data_6NZO
# 
_entry.id   6NZO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.314 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NZO         
WWPDB D_1000239737 
EMDB  EMD-0559     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Set2 bound to nucleosome' 
_pdbx_database_related.db_id          EMD-0559 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NZO 
_pdbx_database_status.recvd_initial_deposition_date   2019-02-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Halic, M.'     1 ? 
'Bilokapic, S.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                3795 
_citation.page_last                 3795 
_citation.title                     'Nucleosome and ubiquitin position Set2 to methylate H3K36.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-11726-4 
_citation.pdbx_database_id_PubMed   31439846 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bilokapic, S.' 1 0000-0003-2199-2929 
primary 'Halic, M.'     2 0000-0002-0061-7372 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NZO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NZO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3'                                      15437.144  2 ?        K36M ? ? 
2 polymer     man 'Histone H4'                                      11394.426  2 ?        ?    ? ? 
3 polymer     man 'Ubiquitin-60S ribosomal protein L40,Histone H2A' 24045.436  2 ?        ?    ? ? 
4 polymer     man 'Histone H2B 1.1'                                 13655.948  2 ?        S29T ? ? 
5 polymer     syn 'DNA (149-MER)'                                   45764.141  1 ?        ?    ? ? 
6 polymer     syn 'DNA (149-MER)'                                   46222.434  1 ?        ?    ? ? 
7 polymer     man 'Histone-lysine N-methyltransferase'              105425.906 1 2.1.1.43 ?    ? ? 
8 non-polymer syn 'ZINC ION'                                        65.409     3 ?        ?    ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVMKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVMKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MDSPDLHHHHHHGTLVPRGSMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGTSSGGSGGSGGSGRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;MDSPDLHHHHHHGTLVPRGSMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGTSSGGSGGSGGSGRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)
;
;CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGC
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)
(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)
(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)
(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)
(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)
(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)
(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)
(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
;
;GCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCG
TACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG
;
J   ? 
7 'polypeptide(L)'        no no 
;MEASDRASGPTAGSKSEERTKQNGPRSKKEDASDSSTSTGSKSASRSSSATTMSPDDAKPADDSALAQENGVAPKPSRKS
SKLPPRNPPQLFNHLPDATEEACRTFQVISDCLYGSRNMGSSDHDALDCDCAEDWRDGKNHACGEDSDCINRATKIECVI
GDCNCGEGCQNQRFQRKQYAKVSVIKTEKKGYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLT
KNEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFNYNVDRYGADPQPCYCGEPNCVGFIG
GKTQTERATKLPLATIEALGIEDGDSWDTTVAKKPRKKKASETDEEYVNSLQPKALDEDGVNKVMATLMQCKEKWIAVKL
LSRLQATQDDHLRHRVVRMHGYQILKSTLNAFKHDNNVVLQVLDILYNLPRITKNKISDSNIEAVVQPLASSSDERVAFE
AKRLLEEWDKLETAYRIPRKKDGRVVSAIANSFEEERRSNREEPTKPADPLANVVIPTGPRSNIPQRNANYYNGVRPRKP
PTNLPEGWFVTVDKKTGKYYFYDVNGKVQWQRPTAPAITTPKPSVKAQQDQKALQDIIDSLTKEPTPRQSAGHTPQRSST
PATEPKKEKWRSLPIEKQMKIYENTLFPHVKYVMDKFHGKLPREDLKKFARDVNKKLVASDYKHNRVQDPTVPLSSKQAK
KVRKYVYDFFDRALQKYLEYQKRKAQYTSKEGMQSSQTEQNTATPTGTLGKDVDEVMSDVEAPNSSPQSTSSAGRKRKRD
DDQDGDHDMRSPADEDAATSSDPPSVKRIKEDDGTGNDVIPSPPPPPPPPAEIPMTEEERSMREQEEALMRENEEAQRLE
DEAKRKQLELQNGLAAAKNAGIELGSASFTVSGEPMDVDNDGPPPQEQAQQQKQAVMSH
;
;MEASDRASGPTAGSKSEERTKQNGPRSKKEDASDSSTSTGSKSASRSSSATTMSPDDAKPADDSALAQENGVAPKPSRKS
SKLPPRNPPQLFNHLPDATEEACRTFQVISDCLYGSRNMGSSDHDALDCDCAEDWRDGKNHACGEDSDCINRATKIECVI
GDCNCGEGCQNQRFQRKQYAKVSVIKTEKKGYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLT
KNEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFNYNVDRYGADPQPCYCGEPNCVGFIG
GKTQTERATKLPLATIEALGIEDGDSWDTTVAKKPRKKKASETDEEYVNSLQPKALDEDGVNKVMATLMQCKEKWIAVKL
LSRLQATQDDHLRHRVVRMHGYQILKSTLNAFKHDNNVVLQVLDILYNLPRITKNKISDSNIEAVVQPLASSSDERVAFE
AKRLLEEWDKLETAYRIPRKKDGRVVSAIANSFEEERRSNREEPTKPADPLANVVIPTGPRSNIPQRNANYYNGVRPRKP
PTNLPEGWFVTVDKKTGKYYFYDVNGKVQWQRPTAPAITTPKPSVKAQQDQKALQDIIDSLTKEPTPRQSAGHTPQRSST
PATEPKKEKWRSLPIEKQMKIYENTLFPHVKYVMDKFHGKLPREDLKKFARDVNKKLVASDYKHNRVQDPTVPLSSKQAK
KVRKYVYDFFDRALQKYLEYQKRKAQYTSKEGMQSSQTEQNTATPTGTLGKDVDEVMSDVEAPNSSPQSTSSAGRKRKRD
DDQDGDHDMRSPADEDAATSSDPPSVKRIKEDDGTGNDVIPSPPPPPPPPAEIPMTEEERSMREQEEALMRENEEAQRLE
DEAKRKQLELQNGLAAAKNAGIELGSASFTVSGEPMDVDNDGPPPQEQAQQQKQAVMSH
;
S   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  MET n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 ALA n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   ASP n 
3 3   SER n 
3 4   PRO n 
3 5   ASP n 
3 6   LEU n 
3 7   HIS n 
3 8   HIS n 
3 9   HIS n 
3 10  HIS n 
3 11  HIS n 
3 12  HIS n 
3 13  GLY n 
3 14  THR n 
3 15  LEU n 
3 16  VAL n 
3 17  PRO n 
3 18  ARG n 
3 19  GLY n 
3 20  SER n 
3 21  MET n 
3 22  GLN n 
3 23  ILE n 
3 24  PHE n 
3 25  VAL n 
3 26  LYS n 
3 27  THR n 
3 28  LEU n 
3 29  THR n 
3 30  GLY n 
3 31  LYS n 
3 32  THR n 
3 33  ILE n 
3 34  THR n 
3 35  LEU n 
3 36  GLU n 
3 37  VAL n 
3 38  GLU n 
3 39  SER n 
3 40  SER n 
3 41  ASP n 
3 42  THR n 
3 43  ILE n 
3 44  ASP n 
3 45  ASN n 
3 46  VAL n 
3 47  LYS n 
3 48  SER n 
3 49  LYS n 
3 50  ILE n 
3 51  GLN n 
3 52  ASP n 
3 53  LYS n 
3 54  GLU n 
3 55  GLY n 
3 56  ILE n 
3 57  PRO n 
3 58  PRO n 
3 59  ASP n 
3 60  GLN n 
3 61  GLN n 
3 62  ARG n 
3 63  LEU n 
3 64  ILE n 
3 65  PHE n 
3 66  ALA n 
3 67  GLY n 
3 68  LYS n 
3 69  GLN n 
3 70  LEU n 
3 71  GLU n 
3 72  ASP n 
3 73  GLY n 
3 74  ARG n 
3 75  THR n 
3 76  LEU n 
3 77  SER n 
3 78  ASP n 
3 79  TYR n 
3 80  ASN n 
3 81  ILE n 
3 82  GLN n 
3 83  LYS n 
3 84  GLU n 
3 85  SER n 
3 86  THR n 
3 87  LEU n 
3 88  HIS n 
3 89  LEU n 
3 90  VAL n 
3 91  LEU n 
3 92  ARG n 
3 93  LEU n 
3 94  ARG n 
3 95  GLY n 
3 96  THR n 
3 97  SER n 
3 98  SER n 
3 99  GLY n 
3 100 GLY n 
3 101 SER n 
3 102 GLY n 
3 103 GLY n 
3 104 SER n 
3 105 GLY n 
3 106 GLY n 
3 107 SER n 
3 108 GLY n 
3 109 ARG n 
3 110 SER n 
3 111 SER n 
3 112 ARG n 
3 113 ALA n 
3 114 GLY n 
3 115 LEU n 
3 116 GLN n 
3 117 PHE n 
3 118 PRO n 
3 119 VAL n 
3 120 GLY n 
3 121 ARG n 
3 122 VAL n 
3 123 HIS n 
3 124 ARG n 
3 125 LEU n 
3 126 LEU n 
3 127 ARG n 
3 128 LYS n 
3 129 GLY n 
3 130 ASN n 
3 131 TYR n 
3 132 ALA n 
3 133 GLU n 
3 134 ARG n 
3 135 VAL n 
3 136 GLY n 
3 137 ALA n 
3 138 GLY n 
3 139 ALA n 
3 140 PRO n 
3 141 VAL n 
3 142 TYR n 
3 143 LEU n 
3 144 ALA n 
3 145 ALA n 
3 146 VAL n 
3 147 LEU n 
3 148 GLU n 
3 149 TYR n 
3 150 LEU n 
3 151 THR n 
3 152 ALA n 
3 153 GLU n 
3 154 ILE n 
3 155 LEU n 
3 156 GLU n 
3 157 LEU n 
3 158 ALA n 
3 159 GLY n 
3 160 ASN n 
3 161 ALA n 
3 162 ALA n 
3 163 ARG n 
3 164 ASP n 
3 165 ASN n 
3 166 LYS n 
3 167 LYS n 
3 168 THR n 
3 169 ARG n 
3 170 ILE n 
3 171 ILE n 
3 172 PRO n 
3 173 ARG n 
3 174 HIS n 
3 175 LEU n 
3 176 GLN n 
3 177 LEU n 
3 178 ALA n 
3 179 VAL n 
3 180 ARG n 
3 181 ASN n 
3 182 ASP n 
3 183 GLU n 
3 184 GLU n 
3 185 LEU n 
3 186 ASN n 
3 187 LYS n 
3 188 LEU n 
3 189 LEU n 
3 190 GLY n 
3 191 ARG n 
3 192 VAL n 
3 193 THR n 
3 194 ILE n 
3 195 ALA n 
3 196 GLN n 
3 197 GLY n 
3 198 GLY n 
3 199 VAL n 
3 200 LEU n 
3 201 PRO n 
3 202 ASN n 
3 203 ILE n 
3 204 GLN n 
3 205 SER n 
3 206 VAL n 
3 207 LEU n 
3 208 LEU n 
3 209 PRO n 
3 210 LYS n 
3 211 LYS n 
3 212 THR n 
3 213 GLU n 
3 214 SER n 
3 215 SER n 
3 216 LYS n 
3 217 SER n 
3 218 ALA n 
3 219 LYS n 
3 220 SER n 
3 221 LYS n 
4 1   MET n 
4 2   ALA n 
4 3   LYS n 
4 4   SER n 
4 5   ALA n 
4 6   PRO n 
4 7   ALA n 
4 8   PRO n 
4 9   LYS n 
4 10  LYS n 
4 11  GLY n 
4 12  SER n 
4 13  LYS n 
4 14  LYS n 
4 15  ALA n 
4 16  VAL n 
4 17  THR n 
4 18  LYS n 
4 19  THR n 
4 20  GLN n 
4 21  LYS n 
4 22  LYS n 
4 23  ASP n 
4 24  GLY n 
4 25  LYS n 
4 26  LYS n 
4 27  ARG n 
4 28  ARG n 
4 29  LYS n 
4 30  THR n 
4 31  ARG n 
4 32  LYS n 
4 33  GLU n 
4 34  SER n 
4 35  TYR n 
4 36  ALA n 
4 37  ILE n 
4 38  TYR n 
4 39  VAL n 
4 40  TYR n 
4 41  LYS n 
4 42  VAL n 
4 43  LEU n 
4 44  LYS n 
4 45  GLN n 
4 46  VAL n 
4 47  HIS n 
4 48  PRO n 
4 49  ASP n 
4 50  THR n 
4 51  GLY n 
4 52  ILE n 
4 53  SER n 
4 54  SER n 
4 55  LYS n 
4 56  ALA n 
4 57  MET n 
4 58  SER n 
4 59  ILE n 
4 60  MET n 
4 61  ASN n 
4 62  SER n 
4 63  PHE n 
4 64  VAL n 
4 65  ASN n 
4 66  ASP n 
4 67  VAL n 
4 68  PHE n 
4 69  GLU n 
4 70  ARG n 
4 71  ILE n 
4 72  ALA n 
4 73  GLY n 
4 74  GLU n 
4 75  ALA n 
4 76  SER n 
4 77  ARG n 
4 78  LEU n 
4 79  ALA n 
4 80  HIS n 
4 81  TYR n 
4 82  ASN n 
4 83  LYS n 
4 84  ARG n 
4 85  SER n 
4 86  THR n 
4 87  ILE n 
4 88  THR n 
4 89  SER n 
4 90  ARG n 
4 91  GLU n 
4 92  ILE n 
4 93  GLN n 
4 94  THR n 
4 95  ALA n 
4 96  VAL n 
4 97  ARG n 
4 98  LEU n 
4 99  LEU n 
4 100 LEU n 
4 101 PRO n 
4 102 GLY n 
4 103 GLU n 
4 104 LEU n 
4 105 ALA n 
4 106 LYS n 
4 107 HIS n 
4 108 ALA n 
4 109 VAL n 
4 110 SER n 
4 111 GLU n 
4 112 GLY n 
4 113 THR n 
4 114 LYS n 
4 115 ALA n 
4 116 VAL n 
4 117 THR n 
4 118 LYS n 
4 119 TYR n 
4 120 THR n 
4 121 SER n 
4 122 ALA n 
4 123 LYS n 
5 1   DC  n 
5 2   DT  n 
5 3   DG  n 
5 4   DG  n 
5 5   DA  n 
5 6   DG  n 
5 7   DA  n 
5 8   DA  n 
5 9   DT  n 
5 10  DC  n 
5 11  DC  n 
5 12  DC  n 
5 13  DG  n 
5 14  DG  n 
5 15  DT  n 
5 16  DG  n 
5 17  DC  n 
5 18  DC  n 
5 19  DG  n 
5 20  DA  n 
5 21  DG  n 
5 22  DG  n 
5 23  DC  n 
5 24  DC  n 
5 25  DG  n 
5 26  DC  n 
5 27  DT  n 
5 28  DC  n 
5 29  DA  n 
5 30  DA  n 
5 31  DT  n 
5 32  DT  n 
5 33  DG  n 
5 34  DG  n 
5 35  DT  n 
5 36  DC  n 
5 37  DG  n 
5 38  DT  n 
5 39  DA  n 
5 40  DG  n 
5 41  DA  n 
5 42  DC  n 
5 43  DA  n 
5 44  DG  n 
5 45  DC  n 
5 46  DT  n 
5 47  DC  n 
5 48  DT  n 
5 49  DA  n 
5 50  DG  n 
5 51  DC  n 
5 52  DA  n 
5 53  DC  n 
5 54  DC  n 
5 55  DG  n 
5 56  DC  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DC  n 
5 63  DG  n 
5 64  DC  n 
5 65  DA  n 
5 66  DC  n 
5 67  DG  n 
5 68  DT  n 
5 69  DA  n 
5 70  DC  n 
5 71  DG  n 
5 72  DC  n 
5 73  DG  n 
5 74  DC  n 
5 75  DT  n 
5 76  DG  n 
5 77  DT  n 
5 78  DC  n 
5 79  DC  n 
5 80  DC  n 
5 81  DC  n 
5 82  DC  n 
5 83  DG  n 
5 84  DC  n 
5 85  DG  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DC  n 
5 93  DC  n 
5 94  DG  n 
5 95  DC  n 
5 96  DC  n 
5 97  DA  n 
5 98  DA  n 
5 99  DG  n 
5 100 DG  n 
5 101 DG  n 
5 102 DG  n 
5 103 DA  n 
5 104 DT  n 
5 105 DT  n 
5 106 DA  n 
5 107 DC  n 
5 108 DT  n 
5 109 DC  n 
5 110 DC  n 
5 111 DC  n 
5 112 DT  n 
5 113 DA  n 
5 114 DG  n 
5 115 DT  n 
5 116 DC  n 
5 117 DT  n 
5 118 DC  n 
5 119 DC  n 
5 120 DA  n 
5 121 DG  n 
5 122 DG  n 
5 123 DC  n 
5 124 DA  n 
5 125 DC  n 
5 126 DG  n 
5 127 DT  n 
5 128 DG  n 
5 129 DT  n 
5 130 DC  n 
5 131 DA  n 
5 132 DG  n 
5 133 DA  n 
5 134 DT  n 
5 135 DA  n 
5 136 DT  n 
5 137 DA  n 
5 138 DT  n 
5 139 DA  n 
5 140 DC  n 
5 141 DA  n 
5 142 DT  n 
5 143 DC  n 
5 144 DC  n 
5 145 DT  n 
5 146 DG  n 
5 147 DT  n 
5 148 DG  n 
5 149 DC  n 
6 1   DG  n 
6 2   DC  n 
6 3   DA  n 
6 4   DC  n 
6 5   DA  n 
6 6   DG  n 
6 7   DG  n 
6 8   DA  n 
6 9   DT  n 
6 10  DG  n 
6 11  DT  n 
6 12  DA  n 
6 13  DT  n 
6 14  DA  n 
6 15  DT  n 
6 16  DA  n 
6 17  DT  n 
6 18  DC  n 
6 19  DT  n 
6 20  DG  n 
6 21  DA  n 
6 22  DC  n 
6 23  DA  n 
6 24  DC  n 
6 25  DG  n 
6 26  DT  n 
6 27  DG  n 
6 28  DC  n 
6 29  DC  n 
6 30  DT  n 
6 31  DG  n 
6 32  DG  n 
6 33  DA  n 
6 34  DG  n 
6 35  DA  n 
6 36  DC  n 
6 37  DT  n 
6 38  DA  n 
6 39  DG  n 
6 40  DG  n 
6 41  DG  n 
6 42  DA  n 
6 43  DG  n 
6 44  DT  n 
6 45  DA  n 
6 46  DA  n 
6 47  DT  n 
6 48  DC  n 
6 49  DC  n 
6 50  DC  n 
6 51  DC  n 
6 52  DT  n 
6 53  DT  n 
6 54  DG  n 
6 55  DG  n 
6 56  DC  n 
6 57  DG  n 
6 58  DG  n 
6 59  DT  n 
6 60  DT  n 
6 61  DA  n 
6 62  DA  n 
6 63  DA  n 
6 64  DA  n 
6 65  DC  n 
6 66  DG  n 
6 67  DC  n 
6 68  DG  n 
6 69  DG  n 
6 70  DG  n 
6 71  DG  n 
6 72  DG  n 
6 73  DA  n 
6 74  DC  n 
6 75  DA  n 
6 76  DG  n 
6 77  DC  n 
6 78  DG  n 
6 79  DC  n 
6 80  DG  n 
6 81  DT  n 
6 82  DA  n 
6 83  DC  n 
6 84  DG  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DG  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DA  n 
6 93  DA  n 
6 94  DG  n 
6 95  DC  n 
6 96  DG  n 
6 97  DG  n 
6 98  DT  n 
6 99  DG  n 
6 100 DC  n 
6 101 DT  n 
6 102 DA  n 
6 103 DG  n 
6 104 DA  n 
6 105 DG  n 
6 106 DC  n 
6 107 DT  n 
6 108 DG  n 
6 109 DT  n 
6 110 DC  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DG  n 
6 115 DA  n 
6 116 DC  n 
6 117 DC  n 
6 118 DA  n 
6 119 DA  n 
6 120 DT  n 
6 121 DT  n 
6 122 DG  n 
6 123 DA  n 
6 124 DG  n 
6 125 DC  n 
6 126 DG  n 
6 127 DG  n 
6 128 DC  n 
6 129 DC  n 
6 130 DT  n 
6 131 DC  n 
6 132 DG  n 
6 133 DG  n 
6 134 DC  n 
6 135 DA  n 
6 136 DC  n 
6 137 DC  n 
6 138 DG  n 
6 139 DG  n 
6 140 DG  n 
6 141 DA  n 
6 142 DT  n 
6 143 DT  n 
6 144 DC  n 
6 145 DT  n 
6 146 DC  n 
6 147 DC  n 
6 148 DA  n 
6 149 DG  n 
7 1   MET n 
7 2   GLU n 
7 3   ALA n 
7 4   SER n 
7 5   ASP n 
7 6   ARG n 
7 7   ALA n 
7 8   SER n 
7 9   GLY n 
7 10  PRO n 
7 11  THR n 
7 12  ALA n 
7 13  GLY n 
7 14  SER n 
7 15  LYS n 
7 16  SER n 
7 17  GLU n 
7 18  GLU n 
7 19  ARG n 
7 20  THR n 
7 21  LYS n 
7 22  GLN n 
7 23  ASN n 
7 24  GLY n 
7 25  PRO n 
7 26  ARG n 
7 27  SER n 
7 28  LYS n 
7 29  LYS n 
7 30  GLU n 
7 31  ASP n 
7 32  ALA n 
7 33  SER n 
7 34  ASP n 
7 35  SER n 
7 36  SER n 
7 37  THR n 
7 38  SER n 
7 39  THR n 
7 40  GLY n 
7 41  SER n 
7 42  LYS n 
7 43  SER n 
7 44  ALA n 
7 45  SER n 
7 46  ARG n 
7 47  SER n 
7 48  SER n 
7 49  SER n 
7 50  ALA n 
7 51  THR n 
7 52  THR n 
7 53  MET n 
7 54  SER n 
7 55  PRO n 
7 56  ASP n 
7 57  ASP n 
7 58  ALA n 
7 59  LYS n 
7 60  PRO n 
7 61  ALA n 
7 62  ASP n 
7 63  ASP n 
7 64  SER n 
7 65  ALA n 
7 66  LEU n 
7 67  ALA n 
7 68  GLN n 
7 69  GLU n 
7 70  ASN n 
7 71  GLY n 
7 72  VAL n 
7 73  ALA n 
7 74  PRO n 
7 75  LYS n 
7 76  PRO n 
7 77  SER n 
7 78  ARG n 
7 79  LYS n 
7 80  SER n 
7 81  SER n 
7 82  LYS n 
7 83  LEU n 
7 84  PRO n 
7 85  PRO n 
7 86  ARG n 
7 87  ASN n 
7 88  PRO n 
7 89  PRO n 
7 90  GLN n 
7 91  LEU n 
7 92  PHE n 
7 93  ASN n 
7 94  HIS n 
7 95  LEU n 
7 96  PRO n 
7 97  ASP n 
7 98  ALA n 
7 99  THR n 
7 100 GLU n 
7 101 GLU n 
7 102 ALA n 
7 103 CYS n 
7 104 ARG n 
7 105 THR n 
7 106 PHE n 
7 107 GLN n 
7 108 VAL n 
7 109 ILE n 
7 110 SER n 
7 111 ASP n 
7 112 CYS n 
7 113 LEU n 
7 114 TYR n 
7 115 GLY n 
7 116 SER n 
7 117 ARG n 
7 118 ASN n 
7 119 MET n 
7 120 GLY n 
7 121 SER n 
7 122 SER n 
7 123 ASP n 
7 124 HIS n 
7 125 ASP n 
7 126 ALA n 
7 127 LEU n 
7 128 ASP n 
7 129 CYS n 
7 130 ASP n 
7 131 CYS n 
7 132 ALA n 
7 133 GLU n 
7 134 ASP n 
7 135 TRP n 
7 136 ARG n 
7 137 ASP n 
7 138 GLY n 
7 139 LYS n 
7 140 ASN n 
7 141 HIS n 
7 142 ALA n 
7 143 CYS n 
7 144 GLY n 
7 145 GLU n 
7 146 ASP n 
7 147 SER n 
7 148 ASP n 
7 149 CYS n 
7 150 ILE n 
7 151 ASN n 
7 152 ARG n 
7 153 ALA n 
7 154 THR n 
7 155 LYS n 
7 156 ILE n 
7 157 GLU n 
7 158 CYS n 
7 159 VAL n 
7 160 ILE n 
7 161 GLY n 
7 162 ASP n 
7 163 CYS n 
7 164 ASN n 
7 165 CYS n 
7 166 GLY n 
7 167 GLU n 
7 168 GLY n 
7 169 CYS n 
7 170 GLN n 
7 171 ASN n 
7 172 GLN n 
7 173 ARG n 
7 174 PHE n 
7 175 GLN n 
7 176 ARG n 
7 177 LYS n 
7 178 GLN n 
7 179 TYR n 
7 180 ALA n 
7 181 LYS n 
7 182 VAL n 
7 183 SER n 
7 184 VAL n 
7 185 ILE n 
7 186 LYS n 
7 187 THR n 
7 188 GLU n 
7 189 LYS n 
7 190 LYS n 
7 191 GLY n 
7 192 TYR n 
7 193 GLY n 
7 194 LEU n 
7 195 ARG n 
7 196 ALA n 
7 197 ASP n 
7 198 THR n 
7 199 ASP n 
7 200 LEU n 
7 201 GLN n 
7 202 PRO n 
7 203 ASN n 
7 204 ASP n 
7 205 PHE n 
7 206 ILE n 
7 207 TYR n 
7 208 GLU n 
7 209 TYR n 
7 210 VAL n 
7 211 GLY n 
7 212 GLU n 
7 213 VAL n 
7 214 ILE n 
7 215 ASN n 
7 216 GLU n 
7 217 PRO n 
7 218 THR n 
7 219 PHE n 
7 220 ARG n 
7 221 SER n 
7 222 ARG n 
7 223 MET n 
7 224 LEU n 
7 225 LYS n 
7 226 TYR n 
7 227 ASP n 
7 228 LYS n 
7 229 GLU n 
7 230 GLY n 
7 231 ILE n 
7 232 LYS n 
7 233 HIS n 
7 234 PHE n 
7 235 TYR n 
7 236 PHE n 
7 237 MET n 
7 238 SER n 
7 239 LEU n 
7 240 THR n 
7 241 LYS n 
7 242 ASN n 
7 243 GLU n 
7 244 PHE n 
7 245 VAL n 
7 246 ASP n 
7 247 ALA n 
7 248 THR n 
7 249 LYS n 
7 250 LYS n 
7 251 GLY n 
7 252 ASN n 
7 253 LEU n 
7 254 GLY n 
7 255 ARG n 
7 256 PHE n 
7 257 CYS n 
7 258 ASN n 
7 259 HIS n 
7 260 SER n 
7 261 CYS n 
7 262 ASN n 
7 263 PRO n 
7 264 ASN n 
7 265 CYS n 
7 266 TYR n 
7 267 VAL n 
7 268 ASP n 
7 269 LYS n 
7 270 TRP n 
7 271 VAL n 
7 272 VAL n 
7 273 GLY n 
7 274 ASP n 
7 275 LYS n 
7 276 LEU n 
7 277 ARG n 
7 278 MET n 
7 279 GLY n 
7 280 ILE n 
7 281 PHE n 
7 282 ALA n 
7 283 ALA n 
7 284 ARG n 
7 285 TYR n 
7 286 ILE n 
7 287 LYS n 
7 288 ALA n 
7 289 GLY n 
7 290 GLU n 
7 291 GLU n 
7 292 LEU n 
7 293 VAL n 
7 294 PHE n 
7 295 ASN n 
7 296 TYR n 
7 297 ASN n 
7 298 VAL n 
7 299 ASP n 
7 300 ARG n 
7 301 TYR n 
7 302 GLY n 
7 303 ALA n 
7 304 ASP n 
7 305 PRO n 
7 306 GLN n 
7 307 PRO n 
7 308 CYS n 
7 309 TYR n 
7 310 CYS n 
7 311 GLY n 
7 312 GLU n 
7 313 PRO n 
7 314 ASN n 
7 315 CYS n 
7 316 VAL n 
7 317 GLY n 
7 318 PHE n 
7 319 ILE n 
7 320 GLY n 
7 321 GLY n 
7 322 LYS n 
7 323 THR n 
7 324 GLN n 
7 325 THR n 
7 326 GLU n 
7 327 ARG n 
7 328 ALA n 
7 329 THR n 
7 330 LYS n 
7 331 LEU n 
7 332 PRO n 
7 333 LEU n 
7 334 ALA n 
7 335 THR n 
7 336 ILE n 
7 337 GLU n 
7 338 ALA n 
7 339 LEU n 
7 340 GLY n 
7 341 ILE n 
7 342 GLU n 
7 343 ASP n 
7 344 GLY n 
7 345 ASP n 
7 346 SER n 
7 347 TRP n 
7 348 ASP n 
7 349 THR n 
7 350 THR n 
7 351 VAL n 
7 352 ALA n 
7 353 LYS n 
7 354 LYS n 
7 355 PRO n 
7 356 ARG n 
7 357 LYS n 
7 358 LYS n 
7 359 LYS n 
7 360 ALA n 
7 361 SER n 
7 362 GLU n 
7 363 THR n 
7 364 ASP n 
7 365 GLU n 
7 366 GLU n 
7 367 TYR n 
7 368 VAL n 
7 369 ASN n 
7 370 SER n 
7 371 LEU n 
7 372 GLN n 
7 373 PRO n 
7 374 LYS n 
7 375 ALA n 
7 376 LEU n 
7 377 ASP n 
7 378 GLU n 
7 379 ASP n 
7 380 GLY n 
7 381 VAL n 
7 382 ASN n 
7 383 LYS n 
7 384 VAL n 
7 385 MET n 
7 386 ALA n 
7 387 THR n 
7 388 LEU n 
7 389 MET n 
7 390 GLN n 
7 391 CYS n 
7 392 LYS n 
7 393 GLU n 
7 394 LYS n 
7 395 TRP n 
7 396 ILE n 
7 397 ALA n 
7 398 VAL n 
7 399 LYS n 
7 400 LEU n 
7 401 LEU n 
7 402 SER n 
7 403 ARG n 
7 404 LEU n 
7 405 GLN n 
7 406 ALA n 
7 407 THR n 
7 408 GLN n 
7 409 ASP n 
7 410 ASP n 
7 411 HIS n 
7 412 LEU n 
7 413 ARG n 
7 414 HIS n 
7 415 ARG n 
7 416 VAL n 
7 417 VAL n 
7 418 ARG n 
7 419 MET n 
7 420 HIS n 
7 421 GLY n 
7 422 TYR n 
7 423 GLN n 
7 424 ILE n 
7 425 LEU n 
7 426 LYS n 
7 427 SER n 
7 428 THR n 
7 429 LEU n 
7 430 ASN n 
7 431 ALA n 
7 432 PHE n 
7 433 LYS n 
7 434 HIS n 
7 435 ASP n 
7 436 ASN n 
7 437 ASN n 
7 438 VAL n 
7 439 VAL n 
7 440 LEU n 
7 441 GLN n 
7 442 VAL n 
7 443 LEU n 
7 444 ASP n 
7 445 ILE n 
7 446 LEU n 
7 447 TYR n 
7 448 ASN n 
7 449 LEU n 
7 450 PRO n 
7 451 ARG n 
7 452 ILE n 
7 453 THR n 
7 454 LYS n 
7 455 ASN n 
7 456 LYS n 
7 457 ILE n 
7 458 SER n 
7 459 ASP n 
7 460 SER n 
7 461 ASN n 
7 462 ILE n 
7 463 GLU n 
7 464 ALA n 
7 465 VAL n 
7 466 VAL n 
7 467 GLN n 
7 468 PRO n 
7 469 LEU n 
7 470 ALA n 
7 471 SER n 
7 472 SER n 
7 473 SER n 
7 474 ASP n 
7 475 GLU n 
7 476 ARG n 
7 477 VAL n 
7 478 ALA n 
7 479 PHE n 
7 480 GLU n 
7 481 ALA n 
7 482 LYS n 
7 483 ARG n 
7 484 LEU n 
7 485 LEU n 
7 486 GLU n 
7 487 GLU n 
7 488 TRP n 
7 489 ASP n 
7 490 LYS n 
7 491 LEU n 
7 492 GLU n 
7 493 THR n 
7 494 ALA n 
7 495 TYR n 
7 496 ARG n 
7 497 ILE n 
7 498 PRO n 
7 499 ARG n 
7 500 LYS n 
7 501 LYS n 
7 502 ASP n 
7 503 GLY n 
7 504 ARG n 
7 505 VAL n 
7 506 VAL n 
7 507 SER n 
7 508 ALA n 
7 509 ILE n 
7 510 ALA n 
7 511 ASN n 
7 512 SER n 
7 513 PHE n 
7 514 GLU n 
7 515 GLU n 
7 516 GLU n 
7 517 ARG n 
7 518 ARG n 
7 519 SER n 
7 520 ASN n 
7 521 ARG n 
7 522 GLU n 
7 523 GLU n 
7 524 PRO n 
7 525 THR n 
7 526 LYS n 
7 527 PRO n 
7 528 ALA n 
7 529 ASP n 
7 530 PRO n 
7 531 LEU n 
7 532 ALA n 
7 533 ASN n 
7 534 VAL n 
7 535 VAL n 
7 536 ILE n 
7 537 PRO n 
7 538 THR n 
7 539 GLY n 
7 540 PRO n 
7 541 ARG n 
7 542 SER n 
7 543 ASN n 
7 544 ILE n 
7 545 PRO n 
7 546 GLN n 
7 547 ARG n 
7 548 ASN n 
7 549 ALA n 
7 550 ASN n 
7 551 TYR n 
7 552 TYR n 
7 553 ASN n 
7 554 GLY n 
7 555 VAL n 
7 556 ARG n 
7 557 PRO n 
7 558 ARG n 
7 559 LYS n 
7 560 PRO n 
7 561 PRO n 
7 562 THR n 
7 563 ASN n 
7 564 LEU n 
7 565 PRO n 
7 566 GLU n 
7 567 GLY n 
7 568 TRP n 
7 569 PHE n 
7 570 VAL n 
7 571 THR n 
7 572 VAL n 
7 573 ASP n 
7 574 LYS n 
7 575 LYS n 
7 576 THR n 
7 577 GLY n 
7 578 LYS n 
7 579 TYR n 
7 580 TYR n 
7 581 PHE n 
7 582 TYR n 
7 583 ASP n 
7 584 VAL n 
7 585 ASN n 
7 586 GLY n 
7 587 LYS n 
7 588 VAL n 
7 589 GLN n 
7 590 TRP n 
7 591 GLN n 
7 592 ARG n 
7 593 PRO n 
7 594 THR n 
7 595 ALA n 
7 596 PRO n 
7 597 ALA n 
7 598 ILE n 
7 599 THR n 
7 600 THR n 
7 601 PRO n 
7 602 LYS n 
7 603 PRO n 
7 604 SER n 
7 605 VAL n 
7 606 LYS n 
7 607 ALA n 
7 608 GLN n 
7 609 GLN n 
7 610 ASP n 
7 611 GLN n 
7 612 LYS n 
7 613 ALA n 
7 614 LEU n 
7 615 GLN n 
7 616 ASP n 
7 617 ILE n 
7 618 ILE n 
7 619 ASP n 
7 620 SER n 
7 621 LEU n 
7 622 THR n 
7 623 LYS n 
7 624 GLU n 
7 625 PRO n 
7 626 THR n 
7 627 PRO n 
7 628 ARG n 
7 629 GLN n 
7 630 SER n 
7 631 ALA n 
7 632 GLY n 
7 633 HIS n 
7 634 THR n 
7 635 PRO n 
7 636 GLN n 
7 637 ARG n 
7 638 SER n 
7 639 SER n 
7 640 THR n 
7 641 PRO n 
7 642 ALA n 
7 643 THR n 
7 644 GLU n 
7 645 PRO n 
7 646 LYS n 
7 647 LYS n 
7 648 GLU n 
7 649 LYS n 
7 650 TRP n 
7 651 ARG n 
7 652 SER n 
7 653 LEU n 
7 654 PRO n 
7 655 ILE n 
7 656 GLU n 
7 657 LYS n 
7 658 GLN n 
7 659 MET n 
7 660 LYS n 
7 661 ILE n 
7 662 TYR n 
7 663 GLU n 
7 664 ASN n 
7 665 THR n 
7 666 LEU n 
7 667 PHE n 
7 668 PRO n 
7 669 HIS n 
7 670 VAL n 
7 671 LYS n 
7 672 TYR n 
7 673 VAL n 
7 674 MET n 
7 675 ASP n 
7 676 LYS n 
7 677 PHE n 
7 678 HIS n 
7 679 GLY n 
7 680 LYS n 
7 681 LEU n 
7 682 PRO n 
7 683 ARG n 
7 684 GLU n 
7 685 ASP n 
7 686 LEU n 
7 687 LYS n 
7 688 LYS n 
7 689 PHE n 
7 690 ALA n 
7 691 ARG n 
7 692 ASP n 
7 693 VAL n 
7 694 ASN n 
7 695 LYS n 
7 696 LYS n 
7 697 LEU n 
7 698 VAL n 
7 699 ALA n 
7 700 SER n 
7 701 ASP n 
7 702 TYR n 
7 703 LYS n 
7 704 HIS n 
7 705 ASN n 
7 706 ARG n 
7 707 VAL n 
7 708 GLN n 
7 709 ASP n 
7 710 PRO n 
7 711 THR n 
7 712 VAL n 
7 713 PRO n 
7 714 LEU n 
7 715 SER n 
7 716 SER n 
7 717 LYS n 
7 718 GLN n 
7 719 ALA n 
7 720 LYS n 
7 721 LYS n 
7 722 VAL n 
7 723 ARG n 
7 724 LYS n 
7 725 TYR n 
7 726 VAL n 
7 727 TYR n 
7 728 ASP n 
7 729 PHE n 
7 730 PHE n 
7 731 ASP n 
7 732 ARG n 
7 733 ALA n 
7 734 LEU n 
7 735 GLN n 
7 736 LYS n 
7 737 TYR n 
7 738 LEU n 
7 739 GLU n 
7 740 TYR n 
7 741 GLN n 
7 742 LYS n 
7 743 ARG n 
7 744 LYS n 
7 745 ALA n 
7 746 GLN n 
7 747 TYR n 
7 748 THR n 
7 749 SER n 
7 750 LYS n 
7 751 GLU n 
7 752 GLY n 
7 753 MET n 
7 754 GLN n 
7 755 SER n 
7 756 SER n 
7 757 GLN n 
7 758 THR n 
7 759 GLU n 
7 760 GLN n 
7 761 ASN n 
7 762 THR n 
7 763 ALA n 
7 764 THR n 
7 765 PRO n 
7 766 THR n 
7 767 GLY n 
7 768 THR n 
7 769 LEU n 
7 770 GLY n 
7 771 LYS n 
7 772 ASP n 
7 773 VAL n 
7 774 ASP n 
7 775 GLU n 
7 776 VAL n 
7 777 MET n 
7 778 SER n 
7 779 ASP n 
7 780 VAL n 
7 781 GLU n 
7 782 ALA n 
7 783 PRO n 
7 784 ASN n 
7 785 SER n 
7 786 SER n 
7 787 PRO n 
7 788 GLN n 
7 789 SER n 
7 790 THR n 
7 791 SER n 
7 792 SER n 
7 793 ALA n 
7 794 GLY n 
7 795 ARG n 
7 796 LYS n 
7 797 ARG n 
7 798 LYS n 
7 799 ARG n 
7 800 ASP n 
7 801 ASP n 
7 802 ASP n 
7 803 GLN n 
7 804 ASP n 
7 805 GLY n 
7 806 ASP n 
7 807 HIS n 
7 808 ASP n 
7 809 MET n 
7 810 ARG n 
7 811 SER n 
7 812 PRO n 
7 813 ALA n 
7 814 ASP n 
7 815 GLU n 
7 816 ASP n 
7 817 ALA n 
7 818 ALA n 
7 819 THR n 
7 820 SER n 
7 821 SER n 
7 822 ASP n 
7 823 PRO n 
7 824 PRO n 
7 825 SER n 
7 826 VAL n 
7 827 LYS n 
7 828 ARG n 
7 829 ILE n 
7 830 LYS n 
7 831 GLU n 
7 832 ASP n 
7 833 ASP n 
7 834 GLY n 
7 835 THR n 
7 836 GLY n 
7 837 ASN n 
7 838 ASP n 
7 839 VAL n 
7 840 ILE n 
7 841 PRO n 
7 842 SER n 
7 843 PRO n 
7 844 PRO n 
7 845 PRO n 
7 846 PRO n 
7 847 PRO n 
7 848 PRO n 
7 849 PRO n 
7 850 PRO n 
7 851 ALA n 
7 852 GLU n 
7 853 ILE n 
7 854 PRO n 
7 855 MET n 
7 856 THR n 
7 857 GLU n 
7 858 GLU n 
7 859 GLU n 
7 860 ARG n 
7 861 SER n 
7 862 MET n 
7 863 ARG n 
7 864 GLU n 
7 865 GLN n 
7 866 GLU n 
7 867 GLU n 
7 868 ALA n 
7 869 LEU n 
7 870 MET n 
7 871 ARG n 
7 872 GLU n 
7 873 ASN n 
7 874 GLU n 
7 875 GLU n 
7 876 ALA n 
7 877 GLN n 
7 878 ARG n 
7 879 LEU n 
7 880 GLU n 
7 881 ASP n 
7 882 GLU n 
7 883 ALA n 
7 884 LYS n 
7 885 ARG n 
7 886 LYS n 
7 887 GLN n 
7 888 LEU n 
7 889 GLU n 
7 890 LEU n 
7 891 GLN n 
7 892 ASN n 
7 893 GLY n 
7 894 LEU n 
7 895 ALA n 
7 896 ALA n 
7 897 ALA n 
7 898 LYS n 
7 899 ASN n 
7 900 ALA n 
7 901 GLY n 
7 902 ILE n 
7 903 GLU n 
7 904 LEU n 
7 905 GLY n 
7 906 SER n 
7 907 ALA n 
7 908 SER n 
7 909 PHE n 
7 910 THR n 
7 911 VAL n 
7 912 SER n 
7 913 GLY n 
7 914 GLU n 
7 915 PRO n 
7 916 MET n 
7 917 ASP n 
7 918 VAL n 
7 919 ASP n 
7 920 ASN n 
7 921 ASP n 
7 922 GLY n 
7 923 PRO n 
7 924 PRO n 
7 925 PRO n 
7 926 GLN n 
7 927 GLU n 
7 928 GLN n 
7 929 ALA n 
7 930 GLN n 
7 931 GLN n 
7 932 GLN n 
7 933 LYS n 
7 934 GLN n 
7 935 ALA n 
7 936 VAL n 
7 937 MET n 
7 938 SER n 
7 939 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   136 'African clawed frog' ? XELAEV_18002543mg                         ? ? ? ? ? ? 
'Xenopus laevis'                                                      8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   103 'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'                                                      8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   108 
;Baker's yeast
;
? 'RPL40B, UBI2, YKR094C'                   ? 'ATCC 204508 / S288c'                ? ? ? ? 
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)'               559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 2 sample 'Biological sequence' 109 221 'African clawed frog' ? 'hist1h2aj, LOC494591, XELAEV_18003602mg' ? ? ? ? ? ? 
'Xenopus laevis'                                                      8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1   123 'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'                                                      8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1   939 ?                     ? CTHT_0025760                              ? 
'DSM 1495 / CBS 144.50 / IMI 039719' ? ? ? ? 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)' 759272 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A0A310TTQ1_XENLA A0A310TTQ1 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1  
2 UNP H4_XENLA         P62799     ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1  
3 UNP RL40B_YEAST      P0CH09     ? 3 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG 1  
4 UNP Q6AZJ8_XENLA     Q6AZJ8     ? 3 
;RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKL
LGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
18 
5 UNP H2B11_XENLA      P02281     ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5  
6 PDB 6NZO             6NZO       ? 5 ? 1  
7 PDB 6NZO             6NZO       ? 6 ? 1  
8 UNP G0S676_CHATD     G0S676     ? 7 
;MEASDRASGPTAGSKSEERTKQNGPRSKKEDASDSSTSTGSKSASRSSSATTMSPDDAKPADDSALAQENGVAPKPSRKS
SKLPPRNPPQLFNHLPDATEEACRTFQVISDCLYGSRNMGSSDHDALDCDCAEDWRDGKNHACGEDSDCINRATKIECVI
GDCNCGEGCQNQRFQRKQYAKVSVIKTEKKGYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLT
KNEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFNYNVDRYGADPQPCYCGEPNCVGFIG
GKTQTERATKLPLATIEALGIEDGDSWDTTVAKKPRKKKASETDEEYVNSLQPKALDEDGVNKVMATLMQCKEKWIAVKL
LSRLQATQDDHLRHRVVRMHGYQILKSTLNAFKHDNNVVLQVLDILYNLPRITKNKISDSNIEAVVQPLASSSDERVAFE
AKRLLEEWDKLETAYRIPRKKDGRVVSAIANSFEEERRSNREEPTKPADPLANVVIPTGPRSNIPQRNANYYNGVRPRKP
PTNLPEGWFVTVDKKTGKYYFYDVNGKVQWQRPTAPAITTPKPSVKAQQDQKALQDIIDSLTKEPTPRQSAGHTPQRSST
PATEPKKEKWRSLPIEKQMKIYENTLFPHVKYVMDKFHGKLPREDLKKFARDVNKKLVASDYKHNRVQDPTVPLSSKQAK
KVRKYVYDFFDRALQKYLEYQKRKAQYTSKEGMQSSQTEQNTATPTGTLGKDVDEVMSDVEAPNSSPQSTSSAGRKRKRD
DDQDGDHDMRSPADEDAATSSDPPSVKRIKEDDGTGNDVIPSPPPPPPPPAEIPMTEEERSMREQEEALMRENEEAQRLE
DEAKRKQLELQNGLAAAKNAGIELGSASFTVSGEPMDVDNDGPPPQEQAQQQKQAVMSH
;
1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6NZO A 1   ? 136 ? A0A310TTQ1 1  ? 136 ? 0   135 
2  2 6NZO B 1   ? 103 ? P62799     1  ? 103 ? 0   102 
3  3 6NZO C 21  ? 95  ? P0CH09     1  ? 75  ? -71 3   
4  4 6NZO C 109 ? 221 ? Q6AZJ8     18 ? 130 ? 17  129 
5  5 6NZO D 2   ? 123 ? P02281     5  ? 126 ? 1   122 
6  1 6NZO E 1   ? 136 ? A0A310TTQ1 1  ? 136 ? 0   135 
7  2 6NZO F 1   ? 103 ? P62799     1  ? 103 ? 0   102 
8  3 6NZO G 21  ? 95  ? P0CH09     1  ? 75  ? -71 3   
9  4 6NZO G 109 ? 221 ? Q6AZJ8     18 ? 130 ? 17  129 
10 5 6NZO H 2   ? 123 ? P02281     5  ? 126 ? 1   122 
11 6 6NZO I 1   ? 149 ? 6NZO       1  ? 149 ? 1   149 
12 7 6NZO J 1   ? 149 ? 6NZO       -1 ? 147 ? -1  147 
13 8 6NZO S 1   ? 939 ? G0S676     1  ? 939 ? 1   939 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6NZO MET A 37  ? UNP A0A310TTQ1 LYS 37 'engineered mutation'   36  1  
3  6NZO MET C 1   ? UNP P0CH09     ?   ?  'initiating methionine' -91 2  
3  6NZO ASP C 2   ? UNP P0CH09     ?   ?  'expression tag'        -90 3  
3  6NZO SER C 3   ? UNP P0CH09     ?   ?  'expression tag'        -89 4  
3  6NZO PRO C 4   ? UNP P0CH09     ?   ?  'expression tag'        -88 5  
3  6NZO ASP C 5   ? UNP P0CH09     ?   ?  'expression tag'        -87 6  
3  6NZO LEU C 6   ? UNP P0CH09     ?   ?  'expression tag'        -86 7  
3  6NZO HIS C 7   ? UNP P0CH09     ?   ?  'expression tag'        -85 8  
3  6NZO HIS C 8   ? UNP P0CH09     ?   ?  'expression tag'        -84 9  
3  6NZO HIS C 9   ? UNP P0CH09     ?   ?  'expression tag'        -83 10 
3  6NZO HIS C 10  ? UNP P0CH09     ?   ?  'expression tag'        -82 11 
3  6NZO HIS C 11  ? UNP P0CH09     ?   ?  'expression tag'        -81 12 
3  6NZO HIS C 12  ? UNP P0CH09     ?   ?  'expression tag'        -80 13 
3  6NZO GLY C 13  ? UNP P0CH09     ?   ?  'expression tag'        -79 14 
3  6NZO THR C 14  ? UNP P0CH09     ?   ?  'expression tag'        -78 15 
3  6NZO LEU C 15  ? UNP P0CH09     ?   ?  'expression tag'        -77 16 
3  6NZO VAL C 16  ? UNP P0CH09     ?   ?  'expression tag'        -76 17 
3  6NZO PRO C 17  ? UNP P0CH09     ?   ?  'expression tag'        -75 18 
3  6NZO ARG C 18  ? UNP P0CH09     ?   ?  'expression tag'        -74 19 
3  6NZO GLY C 19  ? UNP P0CH09     ?   ?  'expression tag'        -73 20 
3  6NZO SER C 20  ? UNP P0CH09     ?   ?  'expression tag'        -72 21 
3  6NZO THR C 96  ? UNP P0CH09     ?   ?  linker                  4   22 
3  6NZO SER C 97  ? UNP P0CH09     ?   ?  linker                  5   23 
3  6NZO SER C 98  ? UNP P0CH09     ?   ?  linker                  6   24 
3  6NZO GLY C 99  ? UNP P0CH09     ?   ?  linker                  7   25 
3  6NZO GLY C 100 ? UNP P0CH09     ?   ?  linker                  8   26 
3  6NZO SER C 101 ? UNP P0CH09     ?   ?  linker                  9   27 
3  6NZO GLY C 102 ? UNP P0CH09     ?   ?  linker                  10  28 
3  6NZO GLY C 103 ? UNP P0CH09     ?   ?  linker                  11  29 
3  6NZO SER C 104 ? UNP P0CH09     ?   ?  linker                  12  30 
3  6NZO GLY C 105 ? UNP P0CH09     ?   ?  linker                  13  31 
3  6NZO GLY C 106 ? UNP P0CH09     ?   ?  linker                  14  32 
3  6NZO SER C 107 ? UNP P0CH09     ?   ?  linker                  15  33 
3  6NZO GLY C 108 ? UNP P0CH09     ?   ?  linker                  16  34 
5  6NZO MET D 1   ? UNP P02281     ?   ?  'initiating methionine' 0   35 
5  6NZO THR D 30  ? UNP P02281     SER 33 'engineered mutation'   29  36 
6  6NZO MET E 37  ? UNP A0A310TTQ1 LYS 37 'engineered mutation'   36  37 
8  6NZO MET G 1   ? UNP P0CH09     ?   ?  'initiating methionine' -91 38 
8  6NZO ASP G 2   ? UNP P0CH09     ?   ?  'expression tag'        -90 39 
8  6NZO SER G 3   ? UNP P0CH09     ?   ?  'expression tag'        -89 40 
8  6NZO PRO G 4   ? UNP P0CH09     ?   ?  'expression tag'        -88 41 
8  6NZO ASP G 5   ? UNP P0CH09     ?   ?  'expression tag'        -87 42 
8  6NZO LEU G 6   ? UNP P0CH09     ?   ?  'expression tag'        -86 43 
8  6NZO HIS G 7   ? UNP P0CH09     ?   ?  'expression tag'        -85 44 
8  6NZO HIS G 8   ? UNP P0CH09     ?   ?  'expression tag'        -84 45 
8  6NZO HIS G 9   ? UNP P0CH09     ?   ?  'expression tag'        -83 46 
8  6NZO HIS G 10  ? UNP P0CH09     ?   ?  'expression tag'        -82 47 
8  6NZO HIS G 11  ? UNP P0CH09     ?   ?  'expression tag'        -81 48 
8  6NZO HIS G 12  ? UNP P0CH09     ?   ?  'expression tag'        -80 49 
8  6NZO GLY G 13  ? UNP P0CH09     ?   ?  'expression tag'        -79 50 
8  6NZO THR G 14  ? UNP P0CH09     ?   ?  'expression tag'        -78 51 
8  6NZO LEU G 15  ? UNP P0CH09     ?   ?  'expression tag'        -77 52 
8  6NZO VAL G 16  ? UNP P0CH09     ?   ?  'expression tag'        -76 53 
8  6NZO PRO G 17  ? UNP P0CH09     ?   ?  'expression tag'        -75 54 
8  6NZO ARG G 18  ? UNP P0CH09     ?   ?  'expression tag'        -74 55 
8  6NZO GLY G 19  ? UNP P0CH09     ?   ?  'expression tag'        -73 56 
8  6NZO SER G 20  ? UNP P0CH09     ?   ?  'expression tag'        -72 57 
8  6NZO THR G 96  ? UNP P0CH09     ?   ?  linker                  4   58 
8  6NZO SER G 97  ? UNP P0CH09     ?   ?  linker                  5   59 
8  6NZO SER G 98  ? UNP P0CH09     ?   ?  linker                  6   60 
8  6NZO GLY G 99  ? UNP P0CH09     ?   ?  linker                  7   61 
8  6NZO GLY G 100 ? UNP P0CH09     ?   ?  linker                  8   62 
8  6NZO SER G 101 ? UNP P0CH09     ?   ?  linker                  9   63 
8  6NZO GLY G 102 ? UNP P0CH09     ?   ?  linker                  10  64 
8  6NZO GLY G 103 ? UNP P0CH09     ?   ?  linker                  11  65 
8  6NZO SER G 104 ? UNP P0CH09     ?   ?  linker                  12  66 
8  6NZO GLY G 105 ? UNP P0CH09     ?   ?  linker                  13  67 
8  6NZO GLY G 106 ? UNP P0CH09     ?   ?  linker                  14  68 
8  6NZO SER G 107 ? UNP P0CH09     ?   ?  linker                  15  69 
8  6NZO GLY G 108 ? UNP P0CH09     ?   ?  linker                  16  70 
10 6NZO MET H 1   ? UNP P02281     ?   ?  'initiating methionine' 0   71 
10 6NZO THR H 30  ? UNP P02281     SER 33 'engineered mutation'   29  72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NZO 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NZO 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.007  ? 14571 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.915  ? 20909 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 24.388 ? 7756  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.056  ? 2351  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007  ? 1659  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6NZO 
_struct.title                        'Set2 bound to nucleosome' 
_struct.pdbx_descriptor              ? 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NZO 
_struct_keywords.text            'Set2, nucleosome, chromatin, KMT, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 45  ? SER A 58  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 64  ? ASP A 78  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 86  ? ALA A 115 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 121 ? GLY A 133 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 ASP B 25  ? ILE B 30  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 31  ? GLY B 43  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P7  AA7 LEU B 50  ? ALA B 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 83  ? GLN B 94  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 ARG C 109 ? ALA C 113 ? ARG C 17  ALA C 21  1 ? 5  
HELX_P HELX_P10 AB1 PRO C 118 ? LYS C 128 ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P11 AB2 ALA C 137 ? ASN C 165 ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE C 171 ? ASP C 182 ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 182 ? LEU C 189 ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 204 ? LEU C 208 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 35  ? HIS D 47  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 53  ? ASN D 82  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 88  ? LEU D 100 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 GLY D 102 ? SER D 121 ? GLY D 101 SER D 120 1 ? 20 
HELX_P HELX_P19 AC1 GLY E 45  ? SER E 58  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 64  ? ASP E 78  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 AC3 GLN E 86  ? ALA E 115 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 121 ? GLY E 133 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P23 AC5 ASN F 26  ? ILE F 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 AC6 THR F 31  ? GLY F 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 50  ? LYS F 78  ? LEU F 49  LYS F 77  1 ? 29 
HELX_P HELX_P26 AC8 THR F 83  ? GLN F 94  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 ARG G 109 ? GLY G 114 ? ARG G 17  GLY G 22  1 ? 6  
HELX_P HELX_P28 AD1 PRO G 118 ? LYS G 128 ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 ALA G 137 ? ASP G 164 ? ALA G 45  ASP G 72  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 171 ? ASN G 181 ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 182 ? LEU G 189 ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 204 ? LEU G 208 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 35  ? HIS H 47  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 53  ? ASN H 82  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 88  ? LEU H 100 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 101 ? SER H 121 ? PRO H 100 SER H 120 1 ? 21 
HELX_P HELX_P37 AE1 ASN K 151 ? LYS K 155 ? ASN S 151 LYS S 155 5 ? 5  
HELX_P HELX_P38 AE2 ASN K 215 ? GLY K 230 ? ASN S 215 GLY S 230 1 ? 16 
HELX_P HELX_P39 AE3 ASN K 252 ? PHE K 256 ? ASN S 252 PHE S 256 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? K CYS 131 SG ? ? ? 1_555 K CYS 149 SG ? ? S CYS 131 S CYS 149  1_555 ? ? ? ? ? ? ?            2.628 ? 
disulf2   disulf ? ? K CYS 143 SG ? ? ? 1_555 K CYS 169 SG ? ? S CYS 143 S CYS 169  1_555 ? ? ? ? ? ? ?            2.848 ? 
disulf3   disulf ? ? K CYS 308 SG ? ? ? 1_555 K CYS 310 SG ? ? S CYS 308 S CYS 310  1_555 ? ? ? ? ? ? ?            2.373 ? 
metalc1   metalc ? ? K CYS 129 SG ? ? ? 1_555 M ZN  .   ZN ? ? S CYS 129 S ZN  1002 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc2   metalc ? ? K CYS 131 SG ? ? ? 1_555 M ZN  .   ZN ? ? S CYS 131 S ZN  1002 1_555 ? ? ? ? ? ? ?            2.495 ? 
metalc3   metalc ? ? K CYS 143 SG ? ? ? 1_555 M ZN  .   ZN ? ? S CYS 143 S ZN  1002 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc4   metalc ? ? K CYS 143 SG ? ? ? 1_555 L ZN  .   ZN ? ? S CYS 143 S ZN  1001 1_555 ? ? ? ? ? ? ?            2.402 ? 
metalc5   metalc ? ? K CYS 149 SG ? ? ? 1_555 M ZN  .   ZN ? ? S CYS 149 S ZN  1002 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc6   metalc ? ? K CYS 158 SG ? ? ? 1_555 L ZN  .   ZN ? ? S CYS 158 S ZN  1001 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc7   metalc ? ? K CYS 163 SG ? ? ? 1_555 L ZN  .   ZN ? ? S CYS 163 S ZN  1001 1_555 ? ? ? ? ? ? ?            2.461 ? 
metalc8   metalc ? ? K CYS 169 SG ? ? ? 1_555 L ZN  .   ZN ? ? S CYS 169 S ZN  1001 1_555 ? ? ? ? ? ? ?            2.379 ? 
metalc9   metalc ? ? K CYS 261 SG ? ? ? 1_555 N ZN  .   ZN ? ? S CYS 261 S ZN  1003 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc10  metalc ? ? K CYS 308 SG ? ? ? 1_555 N ZN  .   ZN ? ? S CYS 308 S ZN  1003 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc11  metalc ? ? K CYS 310 SG ? ? ? 1_555 N ZN  .   ZN ? ? S CYS 310 S ZN  1003 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc12  metalc ? ? K CYS 315 SG ? ? ? 1_555 N ZN  .   ZN ? ? S CYS 315 S ZN  1003 1_555 ? ? ? ? ? ? ?            2.309 ? 
hydrog1   hydrog ? ? I DT  2   N3 ? ? ? 1_555 J DA  148 N1 ? ? I DT  2   J DA  146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? I DT  2   O4 ? ? ? 1_555 J DA  148 N6 ? ? I DT  2   J DA  146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? I DG  3   N1 ? ? ? 1_555 J DC  147 N3 ? ? I DG  3   J DC  145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? I DG  3   N2 ? ? ? 1_555 J DC  147 O2 ? ? I DG  3   J DC  145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? I DG  3   O6 ? ? ? 1_555 J DC  147 N4 ? ? I DG  3   J DC  145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? I DG  4   N1 ? ? ? 1_555 J DC  146 N3 ? ? I DG  4   J DC  144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? I DG  4   N2 ? ? ? 1_555 J DC  146 O2 ? ? I DG  4   J DC  144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? I DG  4   O6 ? ? ? 1_555 J DC  146 N4 ? ? I DG  4   J DC  144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? I DA  5   N1 ? ? ? 1_555 J DT  145 N3 ? ? I DA  5   J DT  143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? I DA  5   N6 ? ? ? 1_555 J DT  145 O4 ? ? I DA  5   J DT  143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? I DG  6   N1 ? ? ? 1_555 J DC  144 N3 ? ? I DG  6   J DC  142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? I DG  6   N2 ? ? ? 1_555 J DC  144 O2 ? ? I DG  6   J DC  142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? I DG  6   O6 ? ? ? 1_555 J DC  144 N4 ? ? I DG  6   J DC  142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? I DA  7   N1 ? ? ? 1_555 J DT  143 N3 ? ? I DA  7   J DT  141  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? I DA  7   N6 ? ? ? 1_555 J DT  143 O4 ? ? I DA  7   J DT  141  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? I DA  8   N1 ? ? ? 1_555 J DT  142 N3 ? ? I DA  8   J DT  140  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? I DA  8   N6 ? ? ? 1_555 J DT  142 O4 ? ? I DA  8   J DT  140  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? I DT  9   N3 ? ? ? 1_555 J DA  141 N1 ? ? I DT  9   J DA  139  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? I DT  9   O4 ? ? ? 1_555 J DA  141 N6 ? ? I DT  9   J DA  139  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? I DC  10  N3 ? ? ? 1_555 J DG  140 N1 ? ? I DC  10  J DG  138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? I DC  10  N4 ? ? ? 1_555 J DG  140 O6 ? ? I DC  10  J DG  138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? I DC  10  O2 ? ? ? 1_555 J DG  140 N2 ? ? I DC  10  J DG  138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? I DC  11  N3 ? ? ? 1_555 J DG  139 N1 ? ? I DC  11  J DG  137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? I DC  11  N4 ? ? ? 1_555 J DG  139 O6 ? ? I DC  11  J DG  137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? I DC  11  O2 ? ? ? 1_555 J DG  139 N2 ? ? I DC  11  J DG  137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? I DC  12  N3 ? ? ? 1_555 J DG  138 N1 ? ? I DC  12  J DG  136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? I DC  12  N4 ? ? ? 1_555 J DG  138 O6 ? ? I DC  12  J DG  136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? I DC  12  O2 ? ? ? 1_555 J DG  138 N2 ? ? I DC  12  J DG  136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? I DG  13  N1 ? ? ? 1_555 J DC  137 N3 ? ? I DG  13  J DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? I DG  13  N2 ? ? ? 1_555 J DC  137 O2 ? ? I DG  13  J DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? I DG  13  O6 ? ? ? 1_555 J DC  137 N4 ? ? I DG  13  J DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? I DG  14  N1 ? ? ? 1_555 J DA  135 N1 ? ? I DG  14  J DA  133  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog33  hydrog ? ? I DG  14  O6 ? ? ? 1_555 J DA  135 N6 ? ? I DG  14  J DA  133  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog34  hydrog ? ? I DG  14  N1 ? ? ? 1_555 J DC  136 N3 ? ? I DG  14  J DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? I DG  14  N2 ? ? ? 1_555 J DC  136 O2 ? ? I DG  14  J DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? I DG  14  O6 ? ? ? 1_555 J DC  136 N4 ? ? I DG  14  J DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? I DT  15  N3 ? ? ? 1_555 J DA  135 N1 ? ? I DT  15  J DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? I DT  15  O4 ? ? ? 1_555 J DA  135 N6 ? ? I DT  15  J DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? I DG  16  N1 ? ? ? 1_555 J DC  134 N3 ? ? I DG  16  J DC  132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? I DG  16  N2 ? ? ? 1_555 J DC  134 O2 ? ? I DG  16  J DC  132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? I DG  16  O6 ? ? ? 1_555 J DC  134 N4 ? ? I DG  16  J DC  132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? I DC  17  N3 ? ? ? 1_555 J DG  133 N1 ? ? I DC  17  J DG  131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? I DC  17  N4 ? ? ? 1_555 J DG  133 O6 ? ? I DC  17  J DG  131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? I DC  17  O2 ? ? ? 1_555 J DG  133 N2 ? ? I DC  17  J DG  131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? I DC  18  N3 ? ? ? 1_555 J DG  132 N1 ? ? I DC  18  J DG  130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? I DC  18  N4 ? ? ? 1_555 J DG  132 O6 ? ? I DC  18  J DG  130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? I DC  18  O2 ? ? ? 1_555 J DG  132 N2 ? ? I DC  18  J DG  130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? I DG  19  N1 ? ? ? 1_555 J DC  131 N3 ? ? I DG  19  J DC  129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? I DG  19  N2 ? ? ? 1_555 J DC  131 O2 ? ? I DG  19  J DC  129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? I DG  19  O6 ? ? ? 1_555 J DC  131 N4 ? ? I DG  19  J DC  129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? I DA  20  N1 ? ? ? 1_555 J DT  130 N3 ? ? I DA  20  J DT  128  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? I DA  20  N6 ? ? ? 1_555 J DT  130 O4 ? ? I DA  20  J DT  128  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? I DG  21  N1 ? ? ? 1_555 J DC  129 N3 ? ? I DG  21  J DC  127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? I DG  21  N2 ? ? ? 1_555 J DC  129 O2 ? ? I DG  21  J DC  127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? I DG  21  O6 ? ? ? 1_555 J DC  129 N4 ? ? I DG  21  J DC  127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? I DG  22  N1 ? ? ? 1_555 J DC  128 N3 ? ? I DG  22  J DC  126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? I DG  22  N2 ? ? ? 1_555 J DC  128 O2 ? ? I DG  22  J DC  126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? I DG  22  O6 ? ? ? 1_555 J DC  128 N4 ? ? I DG  22  J DC  126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? I DC  23  N3 ? ? ? 1_555 J DG  127 N1 ? ? I DC  23  J DG  125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? I DC  23  N4 ? ? ? 1_555 J DG  127 O6 ? ? I DC  23  J DG  125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? I DC  23  O2 ? ? ? 1_555 J DG  127 N2 ? ? I DC  23  J DG  125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? I DC  24  N3 ? ? ? 1_555 J DG  126 N1 ? ? I DC  24  J DG  124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? I DC  24  N4 ? ? ? 1_555 J DG  126 O6 ? ? I DC  24  J DG  124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? I DC  24  O2 ? ? ? 1_555 J DG  126 N2 ? ? I DC  24  J DG  124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? I DG  25  N1 ? ? ? 1_555 J DC  125 N3 ? ? I DG  25  J DC  123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? I DG  25  N2 ? ? ? 1_555 J DC  125 O2 ? ? I DG  25  J DC  123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? I DG  25  O6 ? ? ? 1_555 J DC  125 N4 ? ? I DG  25  J DC  123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? I DC  26  N3 ? ? ? 1_555 J DG  124 N1 ? ? I DC  26  J DG  122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? I DC  26  N4 ? ? ? 1_555 J DG  124 O6 ? ? I DC  26  J DG  122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? I DC  26  O2 ? ? ? 1_555 J DG  124 N2 ? ? I DC  26  J DG  122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? I DT  27  N3 ? ? ? 1_555 J DA  123 N1 ? ? I DT  27  J DA  121  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? I DT  27  O4 ? ? ? 1_555 J DA  123 N6 ? ? I DT  27  J DA  121  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? I DC  28  N3 ? ? ? 1_555 J DG  122 N1 ? ? I DC  28  J DG  120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? I DC  28  N4 ? ? ? 1_555 J DG  122 O6 ? ? I DC  28  J DG  120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? I DC  28  O2 ? ? ? 1_555 J DG  122 N2 ? ? I DC  28  J DG  120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? I DA  29  N1 ? ? ? 1_555 J DT  121 N3 ? ? I DA  29  J DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? I DA  29  N6 ? ? ? 1_555 J DT  121 O4 ? ? I DA  29  J DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? I DA  30  N1 ? ? ? 1_555 J DT  120 N3 ? ? I DA  30  J DT  118  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? I DA  30  N6 ? ? ? 1_555 J DT  120 O4 ? ? I DA  30  J DT  118  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? I DT  31  N3 ? ? ? 1_555 J DA  119 N1 ? ? I DT  31  J DA  117  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? I DT  31  O4 ? ? ? 1_555 J DA  119 N6 ? ? I DT  31  J DA  117  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? I DT  32  N3 ? ? ? 1_555 J DA  118 N1 ? ? I DT  32  J DA  116  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? I DT  32  O4 ? ? ? 1_555 J DA  118 N6 ? ? I DT  32  J DA  116  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? I DG  33  N1 ? ? ? 1_555 J DC  117 N3 ? ? I DG  33  J DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? I DG  33  N2 ? ? ? 1_555 J DC  117 O2 ? ? I DG  33  J DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? I DG  33  O6 ? ? ? 1_555 J DC  117 N4 ? ? I DG  33  J DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? I DG  33  N1 ? ? ? 1_555 J DA  118 N1 ? ? I DG  33  J DA  116  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog88  hydrog ? ? I DG  33  O6 ? ? ? 1_555 J DA  118 N6 ? ? I DG  33  J DA  116  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog89  hydrog ? ? I DG  34  N1 ? ? ? 1_555 J DC  116 N3 ? ? I DG  34  J DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? I DG  34  N2 ? ? ? 1_555 J DC  116 O2 ? ? I DG  34  J DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? I DG  34  O6 ? ? ? 1_555 J DC  116 N4 ? ? I DG  34  J DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? I DT  35  N3 ? ? ? 1_555 J DA  115 N1 ? ? I DT  35  J DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? I DT  35  O4 ? ? ? 1_555 J DA  115 N6 ? ? I DT  35  J DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? I DC  36  N3 ? ? ? 1_555 J DG  114 N1 ? ? I DC  36  J DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? I DC  36  N4 ? ? ? 1_555 J DG  114 O6 ? ? I DC  36  J DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? I DC  36  O2 ? ? ? 1_555 J DG  114 N2 ? ? I DC  36  J DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? I DG  37  N1 ? ? ? 1_555 J DC  113 N3 ? ? I DG  37  J DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? I DG  37  N2 ? ? ? 1_555 J DC  113 O2 ? ? I DG  37  J DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? I DG  37  O6 ? ? ? 1_555 J DC  113 N4 ? ? I DG  37  J DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? I DA  39  N1 ? ? ? 1_555 J DT  111 N3 ? ? I DA  39  J DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? I DA  39  N6 ? ? ? 1_555 J DT  111 O4 ? ? I DA  39  J DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? I DG  40  N1 ? ? ? 1_555 J DC  110 N3 ? ? I DG  40  J DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? I DG  40  N2 ? ? ? 1_555 J DC  110 O2 ? ? I DG  40  J DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? I DG  40  O6 ? ? ? 1_555 J DC  110 N4 ? ? I DG  40  J DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? I DA  41  N1 ? ? ? 1_555 J DT  109 N3 ? ? I DA  41  J DT  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? I DA  41  N6 ? ? ? 1_555 J DT  109 O4 ? ? I DA  41  J DT  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? I DC  42  N3 ? ? ? 1_555 J DG  108 N1 ? ? I DC  42  J DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? I DC  42  N4 ? ? ? 1_555 J DG  108 O6 ? ? I DC  42  J DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? I DC  42  O2 ? ? ? 1_555 J DG  108 N2 ? ? I DC  42  J DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? I DA  43  N1 ? ? ? 1_555 J DT  107 N3 ? ? I DA  43  J DT  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? I DA  43  N6 ? ? ? 1_555 J DT  107 O4 ? ? I DA  43  J DT  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? I DG  44  N1 ? ? ? 1_555 J DC  106 N3 ? ? I DG  44  J DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? I DG  44  N2 ? ? ? 1_555 J DC  106 O2 ? ? I DG  44  J DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? I DG  44  O6 ? ? ? 1_555 J DC  106 N4 ? ? I DG  44  J DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? I DC  45  N3 ? ? ? 1_555 J DG  105 N1 ? ? I DC  45  J DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? I DC  45  N4 ? ? ? 1_555 J DG  105 O6 ? ? I DC  45  J DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? I DC  45  O2 ? ? ? 1_555 J DG  105 N2 ? ? I DC  45  J DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? I DT  46  N3 ? ? ? 1_555 J DA  104 N1 ? ? I DT  46  J DA  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? I DT  46  O4 ? ? ? 1_555 J DA  104 N6 ? ? I DT  46  J DA  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? I DC  47  N3 ? ? ? 1_555 J DG  103 N1 ? ? I DC  47  J DG  101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? I DC  47  N4 ? ? ? 1_555 J DG  103 O6 ? ? I DC  47  J DG  101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? I DC  47  O2 ? ? ? 1_555 J DG  103 N2 ? ? I DC  47  J DG  101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? I DT  48  N3 ? ? ? 1_555 J DA  102 N1 ? ? I DT  48  J DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? I DT  48  O4 ? ? ? 1_555 J DA  102 N6 ? ? I DT  48  J DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? I DA  49  N1 ? ? ? 1_555 J DT  101 N3 ? ? I DA  49  J DT  99   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? I DA  49  N6 ? ? ? 1_555 J DT  101 O4 ? ? I DA  49  J DT  99   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? I DG  50  N1 ? ? ? 1_555 J DC  100 N3 ? ? I DG  50  J DC  98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? I DG  50  N2 ? ? ? 1_555 J DC  100 O2 ? ? I DG  50  J DC  98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? I DG  50  O6 ? ? ? 1_555 J DC  100 N4 ? ? I DG  50  J DC  98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? I DC  51  N3 ? ? ? 1_555 J DG  99  N1 ? ? I DC  51  J DG  97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? I DC  51  N4 ? ? ? 1_555 J DG  99  O6 ? ? I DC  51  J DG  97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? I DC  51  O2 ? ? ? 1_555 J DG  99  N2 ? ? I DC  51  J DG  97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? I DA  52  N1 ? ? ? 1_555 J DT  98  N3 ? ? I DA  52  J DT  96   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? I DA  52  N6 ? ? ? 1_555 J DT  98  O4 ? ? I DA  52  J DT  96   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? I DC  53  N3 ? ? ? 1_555 J DG  97  N1 ? ? I DC  53  J DG  95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? I DC  53  N4 ? ? ? 1_555 J DG  97  O6 ? ? I DC  53  J DG  95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? I DC  53  O2 ? ? ? 1_555 J DG  97  N2 ? ? I DC  53  J DG  95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? I DC  54  N3 ? ? ? 1_555 J DG  96  N1 ? ? I DC  54  J DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? I DC  54  N4 ? ? ? 1_555 J DG  96  O6 ? ? I DC  54  J DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? I DC  54  O2 ? ? ? 1_555 J DG  96  N2 ? ? I DC  54  J DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? I DG  55  N1 ? ? ? 1_555 J DC  95  N3 ? ? I DG  55  J DC  93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? I DG  55  N2 ? ? ? 1_555 J DC  95  O2 ? ? I DG  55  J DC  93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? I DG  55  O6 ? ? ? 1_555 J DC  95  N4 ? ? I DG  55  J DC  93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? I DC  56  N3 ? ? ? 1_555 J DG  94  N1 ? ? I DC  56  J DG  92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? I DC  56  N4 ? ? ? 1_555 J DG  94  O6 ? ? I DC  56  J DG  92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? I DC  56  O2 ? ? ? 1_555 J DG  94  N2 ? ? I DC  56  J DG  92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? I DT  57  N3 ? ? ? 1_555 J DA  93  N1 ? ? I DT  57  J DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? I DT  57  O4 ? ? ? 1_555 J DA  93  N6 ? ? I DT  57  J DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? I DT  58  N3 ? ? ? 1_555 J DA  92  N1 ? ? I DT  58  J DA  90   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog150 hydrog ? ? I DA  59  N1 ? ? ? 1_555 J DT  91  N3 ? ? I DA  59  J DT  89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? I DA  59  N6 ? ? ? 1_555 J DT  91  O4 ? ? I DA  59  J DT  89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? I DA  60  N1 ? ? ? 1_555 J DT  90  N3 ? ? I DA  60  J DT  88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? I DA  60  N6 ? ? ? 1_555 J DT  90  O4 ? ? I DA  60  J DT  88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? I DA  61  N1 ? ? ? 1_555 J DT  89  N3 ? ? I DA  61  J DT  87   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? I DA  61  N6 ? ? ? 1_555 J DT  89  O4 ? ? I DA  61  J DT  87   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? I DC  62  N3 ? ? ? 1_555 J DG  88  N1 ? ? I DC  62  J DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? I DC  62  N4 ? ? ? 1_555 J DG  88  O6 ? ? I DC  62  J DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? I DC  62  O2 ? ? ? 1_555 J DG  88  N2 ? ? I DC  62  J DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? I DG  63  N1 ? ? ? 1_555 J DC  87  N3 ? ? I DG  63  J DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? I DG  63  N2 ? ? ? 1_555 J DC  87  O2 ? ? I DG  63  J DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? I DG  63  O6 ? ? ? 1_555 J DC  87  N4 ? ? I DG  63  J DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? I DC  64  N3 ? ? ? 1_555 J DG  86  N1 ? ? I DC  64  J DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? I DC  64  N4 ? ? ? 1_555 J DG  86  O6 ? ? I DC  64  J DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? I DC  64  O2 ? ? ? 1_555 J DG  86  N2 ? ? I DC  64  J DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? I DA  65  N1 ? ? ? 1_555 J DT  85  N3 ? ? I DA  65  J DT  83   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? I DA  65  N6 ? ? ? 1_555 J DT  85  O4 ? ? I DA  65  J DT  83   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? I DC  66  N3 ? ? ? 1_555 J DG  84  N1 ? ? I DC  66  J DG  82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? I DC  66  N4 ? ? ? 1_555 J DG  84  O6 ? ? I DC  66  J DG  82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? I DC  66  O2 ? ? ? 1_555 J DG  84  N2 ? ? I DC  66  J DG  82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? I DG  67  N1 ? ? ? 1_555 J DC  83  N3 ? ? I DG  67  J DC  81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? I DG  67  N2 ? ? ? 1_555 J DC  83  O2 ? ? I DG  67  J DC  81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? I DG  67  O6 ? ? ? 1_555 J DC  83  N4 ? ? I DG  67  J DC  81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? I DT  68  N3 ? ? ? 1_555 J DA  82  N1 ? ? I DT  68  J DA  80   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? I DT  68  O4 ? ? ? 1_555 J DA  82  N6 ? ? I DT  68  J DA  80   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? I DA  69  N1 ? ? ? 1_555 J DT  81  N3 ? ? I DA  69  J DT  79   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? I DA  69  N6 ? ? ? 1_555 J DT  81  O4 ? ? I DA  69  J DT  79   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? I DC  70  N3 ? ? ? 1_555 J DG  80  N1 ? ? I DC  70  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? I DC  70  N4 ? ? ? 1_555 J DG  80  O6 ? ? I DC  70  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? I DC  70  O2 ? ? ? 1_555 J DG  80  N2 ? ? I DC  70  J DG  78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? I DG  71  N1 ? ? ? 1_555 J DC  79  N3 ? ? I DG  71  J DC  77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? I DG  71  N2 ? ? ? 1_555 J DC  79  O2 ? ? I DG  71  J DC  77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? I DG  71  O6 ? ? ? 1_555 J DC  79  N4 ? ? I DG  71  J DC  77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? I DC  72  N3 ? ? ? 1_555 J DG  78  N1 ? ? I DC  72  J DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? I DC  72  N4 ? ? ? 1_555 J DG  78  O6 ? ? I DC  72  J DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? I DC  72  O2 ? ? ? 1_555 J DG  78  N2 ? ? I DC  72  J DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? I DG  73  N1 ? ? ? 1_555 J DC  77  N3 ? ? I DG  73  J DC  75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? I DG  73  N2 ? ? ? 1_555 J DC  77  O2 ? ? I DG  73  J DC  75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? I DG  73  O6 ? ? ? 1_555 J DC  77  N4 ? ? I DG  73  J DC  75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? I DC  74  N3 ? ? ? 1_555 J DG  76  N1 ? ? I DC  74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? I DC  74  N4 ? ? ? 1_555 J DG  76  O6 ? ? I DC  74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? I DC  74  O2 ? ? ? 1_555 J DG  76  N2 ? ? I DC  74  J DG  74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? I DT  75  N3 ? ? ? 1_555 J DA  75  N1 ? ? I DT  75  J DA  73   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? I DT  75  O4 ? ? ? 1_555 J DA  75  N6 ? ? I DT  75  J DA  73   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? I DG  76  N1 ? ? ? 1_555 J DC  74  N3 ? ? I DG  76  J DC  72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? I DG  76  N2 ? ? ? 1_555 J DC  74  O2 ? ? I DG  76  J DC  72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? I DG  76  O6 ? ? ? 1_555 J DC  74  N4 ? ? I DG  76  J DC  72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? I DT  77  N3 ? ? ? 1_555 J DA  73  N1 ? ? I DT  77  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? I DT  77  O4 ? ? ? 1_555 J DA  73  N6 ? ? I DT  77  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? I DC  78  N3 ? ? ? 1_555 J DG  72  N1 ? ? I DC  78  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? I DC  78  N4 ? ? ? 1_555 J DG  72  O6 ? ? I DC  78  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? I DC  78  O2 ? ? ? 1_555 J DG  72  N2 ? ? I DC  78  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? I DC  79  N3 ? ? ? 1_555 J DG  71  N1 ? ? I DC  79  J DG  69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ? ? I DC  79  N4 ? ? ? 1_555 J DG  71  O6 ? ? I DC  79  J DG  69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ? ? I DC  79  O2 ? ? ? 1_555 J DG  71  N2 ? ? I DC  79  J DG  69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ? ? I DC  80  N3 ? ? ? 1_555 J DG  70  N1 ? ? I DC  80  J DG  68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ? ? I DC  80  N4 ? ? ? 1_555 J DG  70  O6 ? ? I DC  80  J DG  68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ? ? I DC  80  O2 ? ? ? 1_555 J DG  70  N2 ? ? I DC  80  J DG  68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ? ? I DC  81  N3 ? ? ? 1_555 J DG  69  N1 ? ? I DC  81  J DG  67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ? ? I DC  81  N4 ? ? ? 1_555 J DG  69  O6 ? ? I DC  81  J DG  67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ? ? I DC  81  O2 ? ? ? 1_555 J DG  69  N2 ? ? I DC  81  J DG  67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ? ? I DC  82  N3 ? ? ? 1_555 J DG  68  N1 ? ? I DC  82  J DG  66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ? ? I DC  82  N4 ? ? ? 1_555 J DG  68  O6 ? ? I DC  82  J DG  66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ? ? I DC  82  O2 ? ? ? 1_555 J DG  68  N2 ? ? I DC  82  J DG  66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ? ? I DG  83  N1 ? ? ? 1_555 J DC  67  N3 ? ? I DG  83  J DC  65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ? ? I DG  83  N2 ? ? ? 1_555 J DC  67  O2 ? ? I DG  83  J DC  65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ? ? I DG  83  O6 ? ? ? 1_555 J DC  67  N4 ? ? I DG  83  J DC  65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ? ? I DC  84  N3 ? ? ? 1_555 J DG  66  N1 ? ? I DC  84  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ? ? I DC  84  N4 ? ? ? 1_555 J DG  66  O6 ? ? I DC  84  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ? ? I DC  84  O2 ? ? ? 1_555 J DG  66  N2 ? ? I DC  84  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ? ? I DG  85  N1 ? ? ? 1_555 J DC  65  N3 ? ? I DG  85  J DC  63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ? ? I DG  85  N2 ? ? ? 1_555 J DC  65  O2 ? ? I DG  85  J DC  63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ? ? I DG  85  O6 ? ? ? 1_555 J DC  65  N4 ? ? I DG  85  J DC  63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ? ? I DT  86  N3 ? ? ? 1_555 J DA  64  N1 ? ? I DT  86  J DA  62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ? ? I DT  86  O4 ? ? ? 1_555 J DA  64  N6 ? ? I DT  86  J DA  62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ? ? I DT  87  N3 ? ? ? 1_555 J DA  63  N1 ? ? I DT  87  J DA  61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ? ? I DT  87  O4 ? ? ? 1_555 J DA  63  N6 ? ? I DT  87  J DA  61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ? ? I DT  88  N3 ? ? ? 1_555 J DA  62  N1 ? ? I DT  88  J DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ? ? I DT  88  O4 ? ? ? 1_555 J DA  62  N6 ? ? I DT  88  J DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ? ? I DT  89  N3 ? ? ? 1_555 J DA  61  N1 ? ? I DT  89  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ? ? I DT  89  O4 ? ? ? 1_555 J DA  61  N6 ? ? I DT  89  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ? ? I DA  90  N1 ? ? ? 1_555 J DT  60  N3 ? ? I DA  90  J DT  58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ? ? I DA  90  N6 ? ? ? 1_555 J DT  60  O4 ? ? I DA  90  J DT  58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ? ? I DA  91  N1 ? ? ? 1_555 J DT  59  N3 ? ? I DA  91  J DT  57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ? ? I DA  91  N6 ? ? ? 1_555 J DT  59  O4 ? ? I DA  91  J DT  57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ? ? I DC  92  N3 ? ? ? 1_555 J DG  58  N1 ? ? I DC  92  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ? ? I DC  92  N4 ? ? ? 1_555 J DG  58  O6 ? ? I DC  92  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ? ? I DC  92  O2 ? ? ? 1_555 J DG  58  N2 ? ? I DC  92  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ? ? I DC  93  N3 ? ? ? 1_555 J DG  57  N1 ? ? I DC  93  J DG  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ? ? I DC  93  N4 ? ? ? 1_555 J DG  57  O6 ? ? I DC  93  J DG  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ? ? I DC  93  O2 ? ? ? 1_555 J DG  57  N2 ? ? I DC  93  J DG  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ? ? I DG  94  N1 ? ? ? 1_555 J DC  56  N3 ? ? I DG  94  J DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ? ? I DG  94  N2 ? ? ? 1_555 J DC  56  O2 ? ? I DG  94  J DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ? ? I DG  94  O6 ? ? ? 1_555 J DC  56  N4 ? ? I DG  94  J DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ? ? I DC  95  N3 ? ? ? 1_555 J DG  55  N1 ? ? I DC  95  J DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ? ? I DC  95  N4 ? ? ? 1_555 J DG  55  O6 ? ? I DC  95  J DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ? ? I DC  95  O2 ? ? ? 1_555 J DG  55  N2 ? ? I DC  95  J DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ? ? I DC  96  N3 ? ? ? 1_555 J DG  54  N1 ? ? I DC  96  J DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ? ? I DC  96  N4 ? ? ? 1_555 J DG  54  O6 ? ? I DC  96  J DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ? ? I DC  96  O2 ? ? ? 1_555 J DG  54  N2 ? ? I DC  96  J DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ? ? I DA  97  N1 ? ? ? 1_555 J DT  53  N3 ? ? I DA  97  J DT  51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ? ? I DA  97  N6 ? ? ? 1_555 J DT  53  O4 ? ? I DA  97  J DT  51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ? ? I DA  98  N1 ? ? ? 1_555 J DT  52  N3 ? ? I DA  98  J DT  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ? ? I DA  98  N6 ? ? ? 1_555 J DT  52  O4 ? ? I DA  98  J DT  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ? ? I DG  99  N1 ? ? ? 1_555 J DC  51  N3 ? ? I DG  99  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ? ? I DG  99  N2 ? ? ? 1_555 J DC  51  O2 ? ? I DG  99  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ? ? I DG  99  O6 ? ? ? 1_555 J DC  51  N4 ? ? I DG  99  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ? ? I DG  100 N1 ? ? ? 1_555 J DC  50  N3 ? ? I DG  100 J DC  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ? ? I DG  100 N2 ? ? ? 1_555 J DC  50  O2 ? ? I DG  100 J DC  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ? ? I DG  100 O6 ? ? ? 1_555 J DC  50  N4 ? ? I DG  100 J DC  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ? ? I DG  101 N1 ? ? ? 1_555 J DC  49  N3 ? ? I DG  101 J DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ? ? I DG  101 N2 ? ? ? 1_555 J DC  49  O2 ? ? I DG  101 J DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ? ? I DG  101 O6 ? ? ? 1_555 J DC  49  N4 ? ? I DG  101 J DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ? ? I DG  102 N1 ? ? ? 1_555 J DC  48  N3 ? ? I DG  102 J DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ? ? I DG  102 N2 ? ? ? 1_555 J DC  48  O2 ? ? I DG  102 J DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ? ? I DG  102 O6 ? ? ? 1_555 J DC  48  N4 ? ? I DG  102 J DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ? ? I DA  103 N1 ? ? ? 1_555 J DT  47  N3 ? ? I DA  103 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ? ? I DA  103 N6 ? ? ? 1_555 J DT  47  O4 ? ? I DA  103 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ? ? I DT  104 N3 ? ? ? 1_555 J DA  46  N1 ? ? I DT  104 J DA  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ? ? I DT  104 O4 ? ? ? 1_555 J DA  46  N6 ? ? I DT  104 J DA  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ? ? I DT  105 N3 ? ? ? 1_555 J DA  45  N1 ? ? I DT  105 J DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ? ? I DT  105 O4 ? ? ? 1_555 J DA  45  N6 ? ? I DT  105 J DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ? ? I DA  106 N1 ? ? ? 1_555 J DT  44  N3 ? ? I DA  106 J DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ? ? I DA  106 N6 ? ? ? 1_555 J DT  44  O4 ? ? I DA  106 J DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ? ? I DC  107 N3 ? ? ? 1_555 J DG  43  N1 ? ? I DC  107 J DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ? ? I DC  107 N4 ? ? ? 1_555 J DG  43  O6 ? ? I DC  107 J DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ? ? I DC  107 O2 ? ? ? 1_555 J DG  43  N2 ? ? I DC  107 J DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ? ? I DT  108 N3 ? ? ? 1_555 J DA  42  N1 ? ? I DT  108 J DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ? ? I DT  108 O4 ? ? ? 1_555 J DA  42  N6 ? ? I DT  108 J DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ? ? I DC  109 N3 ? ? ? 1_555 J DG  41  N1 ? ? I DC  109 J DG  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ? ? I DC  109 N4 ? ? ? 1_555 J DG  41  O6 ? ? I DC  109 J DG  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ? ? I DC  109 O2 ? ? ? 1_555 J DG  41  N2 ? ? I DC  109 J DG  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ? ? I DC  110 N3 ? ? ? 1_555 J DG  40  N1 ? ? I DC  110 J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ? ? I DC  110 N4 ? ? ? 1_555 J DG  40  O6 ? ? I DC  110 J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ? ? I DC  110 O2 ? ? ? 1_555 J DG  40  N2 ? ? I DC  110 J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ? ? I DC  111 N3 ? ? ? 1_555 J DG  39  N1 ? ? I DC  111 J DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ? ? I DC  111 N4 ? ? ? 1_555 J DG  39  O6 ? ? I DC  111 J DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ? ? I DC  111 O2 ? ? ? 1_555 J DG  39  N2 ? ? I DC  111 J DG  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ? ? I DT  112 N3 ? ? ? 1_555 J DA  38  N1 ? ? I DT  112 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ? ? I DT  112 O4 ? ? ? 1_555 J DA  38  N6 ? ? I DT  112 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ? ? I DA  113 N1 ? ? ? 1_555 J DT  37  N3 ? ? I DA  113 J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ? ? I DA  113 N6 ? ? ? 1_555 J DT  37  O4 ? ? I DA  113 J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ? ? I DG  114 N1 ? ? ? 1_555 J DC  36  N3 ? ? I DG  114 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ? ? I DG  114 N2 ? ? ? 1_555 J DC  36  O2 ? ? I DG  114 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ? ? I DG  114 O6 ? ? ? 1_555 J DC  36  N4 ? ? I DG  114 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ? ? I DT  115 N3 ? ? ? 1_555 J DA  35  N1 ? ? I DT  115 J DA  33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ? ? I DT  115 O4 ? ? ? 1_555 J DA  35  N6 ? ? I DT  115 J DA  33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ? ? I DC  116 N3 ? ? ? 1_555 J DG  34  N1 ? ? I DC  116 J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ? ? I DC  116 N4 ? ? ? 1_555 J DG  34  O6 ? ? I DC  116 J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ? ? I DC  116 O2 ? ? ? 1_555 J DG  34  N2 ? ? I DC  116 J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ? ? I DT  117 N3 ? ? ? 1_555 J DA  33  N1 ? ? I DT  117 J DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ? ? I DT  117 O4 ? ? ? 1_555 J DA  33  N6 ? ? I DT  117 J DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ? ? I DC  118 N3 ? ? ? 1_555 J DG  32  N1 ? ? I DC  118 J DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ? ? I DC  118 N4 ? ? ? 1_555 J DG  32  O6 ? ? I DC  118 J DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ? ? I DC  118 O2 ? ? ? 1_555 J DG  32  N2 ? ? I DC  118 J DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ? ? I DC  119 N3 ? ? ? 1_555 J DG  31  N1 ? ? I DC  119 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ? ? I DC  119 N4 ? ? ? 1_555 J DG  31  O6 ? ? I DC  119 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog307 hydrog ? ? I DC  119 O2 ? ? ? 1_555 J DG  31  N2 ? ? I DC  119 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog308 hydrog ? ? I DA  120 N1 ? ? ? 1_555 J DT  30  N3 ? ? I DA  120 J DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ? ? I DA  120 N6 ? ? ? 1_555 J DT  30  O4 ? ? I DA  120 J DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ? ? I DG  121 N1 ? ? ? 1_555 J DC  29  N3 ? ? I DG  121 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ? ? I DG  121 N2 ? ? ? 1_555 J DC  29  O2 ? ? I DG  121 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ? ? I DG  121 O6 ? ? ? 1_555 J DC  29  N4 ? ? I DG  121 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ? ? I DG  122 N1 ? ? ? 1_555 J DC  28  N3 ? ? I DG  122 J DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ? ? I DG  122 N2 ? ? ? 1_555 J DC  28  O2 ? ? I DG  122 J DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ? ? I DG  122 O6 ? ? ? 1_555 J DC  28  N4 ? ? I DG  122 J DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ? ? I DC  123 N3 ? ? ? 1_555 J DG  27  N1 ? ? I DC  123 J DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ? ? I DC  123 N4 ? ? ? 1_555 J DG  27  O6 ? ? I DC  123 J DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ? ? I DC  123 O2 ? ? ? 1_555 J DG  27  N2 ? ? I DC  123 J DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ? ? I DA  124 N1 ? ? ? 1_555 J DT  26  N3 ? ? I DA  124 J DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ? ? I DA  124 N6 ? ? ? 1_555 J DT  26  O4 ? ? I DA  124 J DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ? ? I DA  124 N1 ? ? ? 1_555 J DG  27  N1 ? ? I DA  124 J DG  25   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog322 hydrog ? ? I DA  124 N6 ? ? ? 1_555 J DG  27  O6 ? ? I DA  124 J DG  25   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? 
hydrog323 hydrog ? ? I DC  125 N3 ? ? ? 1_555 J DG  25  N1 ? ? I DC  125 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ? ? I DC  125 N4 ? ? ? 1_555 J DG  25  O6 ? ? I DC  125 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ? ? I DC  125 O2 ? ? ? 1_555 J DG  25  N2 ? ? I DC  125 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ? ? I DG  126 N1 ? ? ? 1_555 J DC  24  N3 ? ? I DG  126 J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ? ? I DG  126 N2 ? ? ? 1_555 J DC  24  O2 ? ? I DG  126 J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ? ? I DG  126 O6 ? ? ? 1_555 J DC  24  N4 ? ? I DG  126 J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ? ? I DT  127 N3 ? ? ? 1_555 J DA  23  N1 ? ? I DT  127 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ? ? I DT  127 O4 ? ? ? 1_555 J DA  23  N6 ? ? I DT  127 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ? ? I DG  128 N1 ? ? ? 1_555 J DC  22  N3 ? ? I DG  128 J DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ? ? I DG  128 N2 ? ? ? 1_555 J DC  22  O2 ? ? I DG  128 J DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ? ? I DG  128 O6 ? ? ? 1_555 J DC  22  N4 ? ? I DG  128 J DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ? ? I DT  129 N3 ? ? ? 1_555 J DA  21  N1 ? ? I DT  129 J DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog335 hydrog ? ? I DT  129 O4 ? ? ? 1_555 J DA  21  N6 ? ? I DT  129 J DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog336 hydrog ? ? I DC  130 N3 ? ? ? 1_555 J DG  20  N1 ? ? I DC  130 J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog337 hydrog ? ? I DC  130 N4 ? ? ? 1_555 J DG  20  O6 ? ? I DC  130 J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog338 hydrog ? ? I DC  130 O2 ? ? ? 1_555 J DG  20  N2 ? ? I DC  130 J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog339 hydrog ? ? I DA  131 N1 ? ? ? 1_555 J DT  19  N3 ? ? I DA  131 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog340 hydrog ? ? I DA  131 N6 ? ? ? 1_555 J DT  19  O4 ? ? I DA  131 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog341 hydrog ? ? I DG  132 N1 ? ? ? 1_555 J DC  18  N3 ? ? I DG  132 J DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog342 hydrog ? ? I DG  132 N2 ? ? ? 1_555 J DC  18  O2 ? ? I DG  132 J DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog343 hydrog ? ? I DG  132 O6 ? ? ? 1_555 J DC  18  N4 ? ? I DG  132 J DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog344 hydrog ? ? I DA  133 N1 ? ? ? 1_555 J DT  17  N3 ? ? I DA  133 J DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog345 hydrog ? ? I DA  133 N6 ? ? ? 1_555 J DT  17  O4 ? ? I DA  133 J DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog346 hydrog ? ? I DT  134 N3 ? ? ? 1_555 J DA  16  N1 ? ? I DT  134 J DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog347 hydrog ? ? I DT  134 O4 ? ? ? 1_555 J DA  16  N6 ? ? I DT  134 J DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog348 hydrog ? ? I DA  135 N1 ? ? ? 1_555 J DT  15  N3 ? ? I DA  135 J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog349 hydrog ? ? I DA  135 N6 ? ? ? 1_555 J DT  15  O4 ? ? I DA  135 J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog350 hydrog ? ? I DT  136 N3 ? ? ? 1_555 J DA  14  N1 ? ? I DT  136 J DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog351 hydrog ? ? I DT  136 O4 ? ? ? 1_555 J DA  14  N6 ? ? I DT  136 J DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog352 hydrog ? ? I DA  137 N1 ? ? ? 1_555 J DT  13  N3 ? ? I DA  137 J DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog353 hydrog ? ? I DA  137 N6 ? ? ? 1_555 J DT  13  O4 ? ? I DA  137 J DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog354 hydrog ? ? I DT  138 N3 ? ? ? 1_555 J DA  12  N1 ? ? I DT  138 J DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog355 hydrog ? ? I DT  138 O4 ? ? ? 1_555 J DA  12  N6 ? ? I DT  138 J DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog356 hydrog ? ? I DA  139 N1 ? ? ? 1_555 J DT  11  N3 ? ? I DA  139 J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog357 hydrog ? ? I DA  139 N6 ? ? ? 1_555 J DT  11  O4 ? ? I DA  139 J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog358 hydrog ? ? I DC  140 N3 ? ? ? 1_555 J DG  10  N1 ? ? I DC  140 J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog359 hydrog ? ? I DC  140 N4 ? ? ? 1_555 J DG  10  O6 ? ? I DC  140 J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog360 hydrog ? ? I DC  140 O2 ? ? ? 1_555 J DG  10  N2 ? ? I DC  140 J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog361 hydrog ? ? I DA  141 N1 ? ? ? 1_555 J DT  9   N3 ? ? I DA  141 J DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog362 hydrog ? ? I DA  141 N6 ? ? ? 1_555 J DT  9   O4 ? ? I DA  141 J DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog363 hydrog ? ? I DT  142 N3 ? ? ? 1_555 J DA  8   N1 ? ? I DT  142 J DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog364 hydrog ? ? I DT  142 O4 ? ? ? 1_555 J DA  8   N6 ? ? I DT  142 J DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog365 hydrog ? ? I DC  143 N3 ? ? ? 1_555 J DG  7   N1 ? ? I DC  143 J DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog366 hydrog ? ? I DC  143 N4 ? ? ? 1_555 J DG  7   O6 ? ? I DC  143 J DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog367 hydrog ? ? I DC  143 O2 ? ? ? 1_555 J DG  7   N2 ? ? I DC  143 J DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog368 hydrog ? ? I DC  144 N3 ? ? ? 1_555 J DG  6   N1 ? ? I DC  144 J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog369 hydrog ? ? I DC  144 N4 ? ? ? 1_555 J DG  6   O6 ? ? I DC  144 J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog370 hydrog ? ? I DC  144 O2 ? ? ? 1_555 J DG  6   N2 ? ? I DC  144 J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog371 hydrog ? ? I DT  145 N3 ? ? ? 1_555 J DA  5   N1 ? ? I DT  145 J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog372 hydrog ? ? I DT  145 O4 ? ? ? 1_555 J DA  5   N6 ? ? I DT  145 J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog373 hydrog ? ? I DG  146 N1 ? ? ? 1_555 J DC  4   N3 ? ? I DG  146 J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog374 hydrog ? ? I DG  146 N2 ? ? ? 1_555 J DC  4   O2 ? ? I DG  146 J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog375 hydrog ? ? I DG  146 O6 ? ? ? 1_555 J DC  4   N4 ? ? I DG  146 J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84  ? PHE A 85  ? ARG A 83  PHE A 84  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR A 119 ? ILE A 120 ? THR A 118 ILE A 119 
AA2 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
AA3 1 THR B 97  ? TYR B 99  ? THR B 96  TYR B 98  
AA3 2 VAL G 192 ? ILE G 194 ? VAL G 100 ILE G 102 
AA4 1 ARG C 134 ? VAL C 135 ? ARG C 42  VAL C 43  
AA4 2 THR D 86  ? ILE D 87  ? THR D 85  ILE D 86  
AA5 1 ARG C 169 ? ILE C 170 ? ARG C 77  ILE C 78  
AA5 2 GLY D 51  ? ILE D 52  ? GLY D 50  ILE D 51  
AA6 1 VAL C 192 ? ILE C 194 ? VAL C 100 ILE C 102 
AA6 2 THR F 97  ? TYR F 99  ? THR F 96  TYR F 98  
AA7 1 VAL E 36  ? MET E 37  ? VAL E 35  MET E 36  
AA7 2 VAL K 298 ? ASP K 299 ? VAL S 298 ASP S 299 
AA8 1 ARG E 84  ? PHE E 85  ? ARG E 83  PHE E 84  
AA8 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA9 1 THR E 119 ? ILE E 120 ? THR E 118 ILE E 119 
AA9 2 ARG F 46  ? ILE F 47  ? ARG F 45  ILE F 46  
AB1 1 ARG G 134 ? VAL G 135 ? ARG G 42  VAL G 43  
AB1 2 THR H 86  ? ILE H 87  ? THR H 85  ILE H 86  
AB2 1 ARG G 169 ? ILE G 170 ? ARG G 77  ILE G 78  
AB2 2 GLY H 51  ? ILE H 52  ? GLY H 50  ILE H 51  
AB3 1 VAL K 182 ? THR K 187 ? VAL S 182 THR S 187 
AB3 2 GLY K 191 ? ALA K 196 ? GLY S 191 ALA S 196 
AB4 1 PHE K 205 ? GLU K 208 ? PHE S 205 GLU S 208 
AB4 2 LYS K 275 ? ALA K 282 ? LYS S 275 ALA S 282 
AB4 3 CYS K 265 ? VAL K 272 ? CYS S 265 VAL S 272 
AB5 1 GLU K 212 ? ILE K 214 ? GLU S 212 ILE S 214 
AB5 2 PHE K 244 ? ASP K 246 ? PHE S 244 ASP S 246 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84  ? N ARG A 83  O VAL B 82  ? O VAL B 81  
AA2 1 2 N ILE A 120 ? N ILE A 119 O ARG B 46  ? O ARG B 45  
AA3 1 2 N TYR B 99  ? N TYR B 98  O THR G 193 ? O THR G 101 
AA4 1 2 N ARG C 134 ? N ARG C 42  O ILE D 87  ? O ILE D 86  
AA5 1 2 N ILE C 170 ? N ILE C 78  O GLY D 51  ? O GLY D 50  
AA6 1 2 N THR C 193 ? N THR C 101 O TYR F 99  ? O TYR F 98  
AA7 1 2 N VAL E 36  ? N VAL E 35  O ASP K 299 ? O ASP S 299 
AA8 1 2 N ARG E 84  ? N ARG E 83  O VAL F 82  ? O VAL F 81  
AA9 1 2 N ILE E 120 ? N ILE E 119 O ARG F 46  ? O ARG F 45  
AB1 1 2 N ARG G 134 ? N ARG G 42  O ILE H 87  ? O ILE H 86  
AB2 1 2 N ILE G 170 ? N ILE G 78  O GLY H 51  ? O GLY H 50  
AB3 1 2 N THR K 187 ? N THR S 187 O GLY K 191 ? O GLY S 191 
AB4 1 2 N TYR K 207 ? N TYR S 207 O ILE K 280 ? O ILE S 280 
AB4 2 3 O ARG K 277 ? O ARG S 277 N TRP K 270 ? N TRP S 270 
AB5 1 2 N GLU K 212 ? N GLU S 212 O ASP K 246 ? O ASP S 246 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software S ZN 1001 ? 6 'binding site for residue ZN S 1001' 
AC2 Software S ZN 1002 ? 6 'binding site for residue ZN S 1002' 
AC3 Software S ZN 1003 ? 4 'binding site for residue ZN S 1003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 CYS K 143 ? CYS S 143  . ? 1_555 ? 
2  AC1 6 ASN K 151 ? ASN S 151  . ? 1_555 ? 
3  AC1 6 CYS K 158 ? CYS S 158  . ? 1_555 ? 
4  AC1 6 CYS K 163 ? CYS S 163  . ? 1_555 ? 
5  AC1 6 CYS K 169 ? CYS S 169  . ? 1_555 ? 
6  AC1 6 ZN  M .   ? ZN  S 1002 . ? 1_555 ? 
7  AC2 6 CYS K 129 ? CYS S 129  . ? 1_555 ? 
8  AC2 6 CYS K 131 ? CYS S 131  . ? 1_555 ? 
9  AC2 6 CYS K 143 ? CYS S 143  . ? 1_555 ? 
10 AC2 6 CYS K 149 ? CYS S 149  . ? 1_555 ? 
11 AC2 6 ASN K 151 ? ASN S 151  . ? 1_555 ? 
12 AC2 6 ZN  L .   ? ZN  S 1001 . ? 1_555 ? 
13 AC3 4 CYS K 261 ? CYS S 261  . ? 1_555 ? 
14 AC3 4 CYS K 308 ? CYS S 308  . ? 1_555 ? 
15 AC3 4 CYS K 310 ? CYS S 310  . ? 1_555 ? 
16 AC3 4 CYS K 315 ? CYS S 315  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6NZO 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 39  ? 121.496 88.073  83.026  1.00 56.78  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 39  ? 121.971 89.449  82.857  1.00 56.78  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 39  ? 120.896 90.482  83.174  1.00 56.78  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 39  ? 120.431 91.190  82.281  1.00 56.78  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 39  ? 122.361 89.500  81.380  1.00 56.78  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 39  ? 122.760 88.106  81.062  1.00 56.78  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 39  ? 121.868 87.218  81.886  1.00 56.78  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 40  ? 120.510 90.559  84.445  1.00 60.18  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 40  ? 119.505 91.514  84.891  1.00 60.18  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 40  ? 120.130 92.417  85.940  1.00 60.18  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 40  ? 120.400 91.978  87.061  1.00 60.18  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 40  ? 118.275 90.799  85.456  1.00 60.18  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 40  ? 117.375 91.684  86.258  1.00 60.18  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 40  ? 117.378 91.696  87.635  1.00 60.18  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 40  ? 116.443 92.588  85.876  1.00 60.18  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 40  ? 116.486 92.568  88.068  1.00 60.18  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 40  ? 115.905 93.123  87.020  1.00 60.18  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 41  ? 120.361 93.672  85.570  1.00 61.82  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 41  ? 121.058 94.619  86.424  1.00 61.82  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 41  ? 120.141 95.767  86.800  1.00 61.82  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 41  ? 119.336 96.226  85.986  1.00 61.82  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 41  ? 122.301 95.192  85.748  1.00 61.82  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 41  ? 123.512 94.291  85.748  1.00 61.82  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 41  ? 124.672 94.967  85.035  1.00 61.82  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 41  ? 124.981 96.277  85.603  1.00 61.82  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 41  ? 124.802 97.432  84.969  1.00 61.82  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 41  ? 124.305 97.443  83.742  1.00 61.82  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 41  ? 125.109 98.574  85.565  1.00 61.82  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 42  ? 120.272 96.220  88.040  1.00 62.25  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 42  ? 119.564 97.401  88.499  1.00 62.25  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 42  ? 120.243 98.666  87.991  1.00 62.25  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 42  ? 121.444 98.683  87.710  1.00 62.25  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 42  ? 119.495 97.416  90.023  1.00 62.25  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 42  ? 118.476 96.458  90.579  1.00 62.25  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 42  ? 117.128 96.786  90.589  1.00 62.25  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 42  ? 118.857 95.228  91.093  1.00 62.25  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 42  ? 116.187 95.915  91.092  1.00 62.25  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 42  ? 117.924 94.350  91.598  1.00 62.25  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 42  ? 116.591 94.701  91.594  1.00 62.25  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 42  ? 115.653 93.833  92.095  1.00 62.25  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 43  ? 119.456 99.737  87.878  1.00 63.97  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 43  ? 119.985 101.014 87.429  1.00 63.97  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 43  ? 120.852 101.640 88.517  1.00 63.97  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 43  ? 120.626 101.407 89.706  1.00 63.97  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 43  ? 118.858 101.975 87.063  1.00 63.97  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 43  ? 117.882 101.465 86.025  1.00 63.97  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 43  ? 116.669 102.376 85.943  1.00 63.97  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 43  ? 116.976 103.654 85.310  1.00 63.97  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 43  ? 116.909 103.876 84.002  1.00 63.97  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 43  ? 116.546 102.901 83.180  1.00 63.97  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 43  ? 117.206 105.073 83.516  1.00 63.97  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 44  ? 121.873 102.411 88.127  1.00 57.87  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 44  ? 122.750 103.054 89.118  1.00 57.87  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 44  ? 122.054 104.069 90.012  1.00 57.87  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 44  ? 122.034 105.266 89.713  1.00 57.87  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 44  ? 123.816 103.728 88.248  1.00 57.87  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 44  ? 123.871 102.899 87.028  1.00 57.87  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 44  ? 122.467 102.435 86.779  1.00 57.87  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 45  ? 121.477 103.592 91.113  1.00 55.57  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 45  ? 120.798 104.465 92.047  1.00 55.57  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 45  ? 119.608 103.879 92.780  1.00 55.57  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 45  ? 119.287 104.350 93.874  1.00 55.57  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 46  ? 118.920 102.892 92.202  1.00 54.87  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 46  ? 117.806 102.268 92.916  1.00 54.87  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 46  ? 118.298 101.436 94.100  1.00 54.87  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 46  ? 117.614 101.339 95.129  1.00 54.87  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 46  ? 116.948 101.439 91.965  1.00 54.87  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 46  ? 115.938 100.752 92.714  1.00 54.87  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 46  ? 117.775 100.451 91.203  1.00 54.87  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 47  ? 119.474 100.811 93.963  1.00 50.75  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 47  ? 120.065 100.057 95.065  1.00 50.75  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 47  ? 120.422 100.998 96.204  1.00 50.75  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 47  ? 120.293 100.644 97.382  1.00 50.75  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 47  ? 121.289 99.265  94.570  1.00 50.75  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 47  ? 121.866 98.383  95.662  1.00 50.75  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 47  ? 120.911 98.436  93.368  1.00 50.75  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 48  ? 120.862 102.213 95.863  1.00 46.17  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 48  ? 121.123 103.246 96.860  1.00 46.17  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 48  ? 119.873 103.556 97.672  1.00 46.17  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 48  ? 119.929 103.617 98.901  1.00 46.17  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 48  ? 121.658 104.510 96.190  1.00 46.17  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 49  ? 118.740 103.767 96.994  1.00 44.03  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 49  ? 117.486 104.045 97.694  1.00 44.03  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 49  ? 117.024 102.874 98.554  1.00 44.03  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 49  ? 116.499 103.084 99.658  1.00 44.03  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 49  ? 116.391 104.426 96.704  1.00 44.03  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 49  ? 116.224 105.919 96.431  1.00 44.03  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 49  ? 117.391 106.519 95.663  1.00 44.03  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 49  ? 114.923 106.152 95.711  1.00 44.03  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 50  ? 117.164 101.638 98.057  1.00 49.26  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 50  ? 116.791 100.489 98.882  1.00 49.26  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 50  ? 117.687 100.371 100.113 1.00 49.26  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 50  ? 117.206 100.040 101.204 1.00 49.26  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 50  ? 116.801 99.194  98.074  1.00 49.26  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 50  ? 115.783 99.158  96.935  1.00 49.26  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 50  ? 116.023 98.023  95.929  1.00 49.26  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 50  ? 117.425 97.662  95.723  1.00 49.26  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 50  ? 117.989 96.558  96.209  1.00 49.26  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 50  ? 117.271 95.722  96.939  1.00 49.26  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 50  ? 119.264 96.294  95.979  1.00 49.26  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 51  ? 118.981 100.678 99.969  1.00 43.43  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 51  ? 119.864 100.692 101.133 1.00 43.43  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 51  ? 119.510 101.822 102.091 1.00 43.43  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 51  ? 119.646 101.662 103.306 1.00 43.43  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 51  ? 121.331 100.802 100.722 1.00 43.43  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 51  ? 121.892 99.612  99.981  1.00 43.43  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 51  ? 123.374 99.763  99.704  1.00 43.43  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 51  ? 124.064 100.403 100.522 1.00 43.43  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 51  ? 123.849 99.248  98.671  1.00 43.43  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 52  ? 119.108 102.981 101.560 1.00 38.83  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 52  ? 118.674 104.093 102.406 1.00 38.83  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 52  ? 117.478 103.684 103.255 1.00 38.83  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 52  ? 117.477 103.882 104.476 1.00 38.83  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 52  ? 118.379 105.343 101.557 1.00 38.83  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 52  ? 119.689 105.976 101.090 1.00 38.83  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 52  ? 117.535 106.348 102.323 1.00 38.83  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 52  ? 119.516 107.278 100.345 1.00 38.83  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 53  ? 116.450 103.105 102.623 1.00 38.88  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 53  ? 115.286 102.626 103.372 1.00 38.88  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 53  ? 115.662 101.541 104.380 1.00 38.88  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 53  ? 115.151 101.533 105.509 1.00 38.88  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 53  ? 114.211 102.121 102.417 1.00 38.88  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 53  ? 113.635 103.196 101.522 1.00 38.88  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 53  ? 112.450 102.667 100.740 1.00 38.88  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 53  ? 111.900 103.666 99.831  1.00 38.88  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 53  ? 112.245 103.782 98.554  1.00 38.88  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 53  ? 113.142 102.958 98.031  1.00 38.88  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 53  ? 111.689 104.719 97.799  1.00 38.88  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 54  ? 116.587 100.652 104.006 1.00 37.77  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 54  ? 117.018 99.577  104.897 1.00 37.77  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 54  ? 117.741 100.118 106.128 1.00 37.77  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 54  ? 117.366 99.810  107.264 1.00 37.77  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 54  ? 117.903 98.597  104.132 1.00 37.77  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 54  ? 118.677 97.637  105.005 1.00 37.77  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 54  ? 119.590 96.787  104.150 1.00 37.77  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 54  ? 120.464 95.942  104.949 1.00 37.77  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 54  ? 121.319 95.068  104.435 1.00 37.77  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 54  ? 121.411 94.929  103.121 1.00 37.77  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 54  ? 122.083 94.337  105.233 1.00 37.77  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 55  ? 118.796 100.915 105.927 1.00 37.35  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 55  ? 119.575 101.390 107.067 1.00 37.35  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 55  ? 118.857 102.469 107.866 1.00 37.35  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 55  ? 119.164 102.641 109.049 1.00 37.35  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 55  ? 120.947 101.904 106.632 1.00 37.35  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 55  ? 121.852 100.827 106.099 1.00 37.35  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 55  ? 122.357 99.847  106.938 1.00 37.35  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 55  ? 122.242 100.815 104.770 1.00 37.35  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 55  ? 123.192 98.859  106.456 1.00 37.35  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 55  ? 123.073 99.836  104.277 1.00 37.35  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 55  ? 123.548 98.861  105.122 1.00 37.35  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 55  ? 124.382 97.885  104.627 1.00 37.35  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 56  ? 117.917 103.202 107.269 1.00 34.13  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 56  ? 117.100 104.094 108.074 1.00 34.13  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 56  ? 116.021 103.333 108.823 1.00 34.13  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 56  ? 115.491 103.847 109.811 1.00 34.13  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 56  ? 116.480 105.187 107.207 1.00 34.13  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 56  ? 117.461 106.274 106.820 1.00 34.13  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 56  ? 116.799 107.412 106.081 1.00 34.13  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 56  ? 115.599 107.383 105.824 1.00 34.13  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 56  ? 117.579 108.425 105.732 1.00 34.13  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 57  ? 115.694 102.119 108.383 1.00 37.88  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 57  ? 114.702 101.316 109.083 1.00 37.88  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 57  ? 115.314 100.565 110.258 1.00 37.88  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 57  ? 114.669 100.416 111.300 1.00 37.88  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 57  ? 114.058 100.326 108.109 1.00 37.88  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 57  ? 112.970 99.450  108.696 1.00 37.88  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 57  ? 112.314 98.618  107.615 1.00 37.88  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 57  ? 111.120 97.856  108.154 1.00 37.88  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 57  ? 110.404 97.133  107.071 1.00 37.88  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 58  ? 116.558 100.118 110.128 1.00 32.25  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 58  ? 117.192 99.363  111.195 1.00 32.25  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 58  ? 117.922 100.296 112.155 1.00 32.25  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 58  ? 118.152 101.473 111.872 1.00 32.25  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 58  ? 118.161 98.334  110.614 1.00 32.25  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 58  ? 117.482 97.171  110.178 1.00 32.25  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 59  ? 118.286 99.749  113.317 1.00 30.80  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 59  ? 118.947 100.497 114.391 1.00 30.80  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 59  ? 120.077 99.630  114.934 1.00 30.80  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 59  ? 119.867 98.841  115.859 1.00 30.80  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 59  ? 117.991 100.878 115.522 1.00 30.80  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 59  ? 117.521 99.693  116.177 1.00 30.80  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 59  ? 116.815 101.735 115.055 1.00 30.80  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 60  ? 121.269 99.788  114.372 1.00 33.17  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 60  ? 122.435 99.048  114.829 1.00 33.17  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 60  ? 123.662 99.848  114.437 1.00 33.17  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 60  ? 123.601 100.683 113.531 1.00 33.17  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 60  ? 122.498 97.628  114.247 1.00 33.17  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 60  ? 123.213 97.487  112.905 1.00 33.17  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 60  ? 122.368 97.905  111.715 1.00 33.17  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 60  ? 121.191 98.273  111.903 1.00 33.17  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 60  ? 122.885 97.851  110.579 1.00 33.17  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 61  ? 124.750 99.641  115.176 1.00 36.20  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 61  ? 125.990 100.339 114.869 1.00 36.20  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 61  ? 126.531 99.890  113.516 1.00 36.20  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 61  ? 126.573 98.696  113.209 1.00 36.20  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 61  ? 127.039 100.113 115.963 1.00 36.20  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 61  ? 126.885 100.754 117.355 1.00 36.20  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 61  ? 126.708 102.268 117.240 1.00 36.20  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 61  ? 125.821 100.128 118.264 1.00 36.20  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 62  ? 126.945 100.860 112.703 1.00 36.11  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 62  ? 127.344 100.592 111.332 1.00 36.11  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 62  ? 128.845 100.497 111.150 1.00 36.11  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 62  ? 129.298 100.107 110.070 1.00 36.11  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 62  ? 126.801 101.674 110.400 1.00 36.11  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 62  ? 125.323 101.991 110.571 1.00 36.11  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 62  ? 124.949 103.134 109.660 1.00 36.11  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 62  ? 124.496 100.765 110.258 1.00 36.11  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 63  ? 129.615 100.834 112.152 1.00 36.06  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 63  ? 131.060 100.716 112.076 1.00 36.06  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 63  ? 131.432 99.397  112.733 1.00 36.06  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 63  ? 130.781 98.953  113.686 1.00 36.06  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 63  ? 131.729 101.931 112.755 1.00 36.06  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 63  ? 131.201 103.221 112.129 1.00 36.06  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 63  ? 133.239 101.910 112.598 1.00 36.06  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 63  ? 131.764 104.481 112.742 1.00 36.06  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 64  ? 132.456 98.739  112.196 1.00 45.95  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 64  ? 132.899 97.467  112.745 1.00 45.95  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 64  ? 133.536 97.691  114.110 1.00 45.95  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 64  ? 134.434 98.526  114.255 1.00 45.95  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 64  ? 133.880 96.796  111.789 1.00 45.95  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 64  ? 133.227 96.242  110.537 1.00 45.95  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 64  ? 132.413 95.003  110.852 1.00 45.95  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 64  ? 130.981 95.266  110.794 1.00 45.95  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 64  ? 130.062 94.500  111.366 1.00 45.95  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 64  ? 130.429 93.418  112.037 1.00 45.95  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 64  ? 128.778 94.812  111.265 1.00 45.95  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 65  ? 133.026 96.964  115.108 1.00 46.78  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 65  ? 133.354 97.086  116.527 1.00 46.78  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 65  ? 134.849 97.075  116.831 1.00 46.78  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 65  ? 135.363 98.045  117.395 1.00 46.78  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 65  ? 132.660 95.973  117.306 1.00 46.78  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 65  ? 131.157 95.937  117.096 1.00 46.78  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 65  ? 130.454 97.079  117.789 1.00 46.78  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 65  ? 128.958 96.835  117.827 1.00 46.78  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 65  ? 128.471 96.237  116.553 1.00 46.78  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 66  ? 135.533 95.971  116.518 1.00 45.33  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 66  ? 136.965 95.853  116.808 1.00 45.33  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 66  ? 137.846 96.895  116.108 1.00 45.33  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 66  ? 138.762 97.414  116.775 1.00 45.33  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 66  ? 137.427 94.414  116.550 1.00 45.33  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 66  ? 136.961 93.433  117.621 1.00 45.33  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 66  ? 137.369 92.016  117.275 1.00 45.33  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 66  ? 137.548 93.842  118.956 1.00 45.33  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 67  ? 137.715 97.185  114.783 1.00 44.37  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 67  ? 138.487 98.314  114.217 1.00 44.37  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 67  ? 138.242 99.644  114.910 1.00 44.37  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 67  ? 139.186 100.424 115.107 1.00 44.37  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 67  ? 138.022 98.364  112.758 1.00 44.37  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 67  ? 137.623 97.018  112.451 1.00 44.37  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 67  ? 137.018 96.467  113.694 1.00 44.37  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 68  ? 136.993 99.914  115.298 1.00 38.08  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 68  ? 136.692 101.153 116.004 1.00 38.08  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 68  ? 137.329 101.163 117.387 1.00 38.08  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 68  ? 137.774 102.214 117.861 1.00 38.08  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 68  ? 135.184 101.353 116.112 1.00 38.08  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 68  ? 134.806 102.611 116.819 1.00 38.08  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 68  ? 134.895 103.827 116.168 1.00 38.08  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 68  ? 134.385 102.587 118.137 1.00 38.08  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 68  ? 134.560 104.995 116.815 1.00 38.08  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 68  ? 134.060 103.751 118.791 1.00 38.08  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 68  ? 134.142 104.957 118.129 1.00 38.08  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 69  ? 137.353 100.009 118.058 1.00 39.89  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 69  ? 137.997 99.925  119.363 1.00 39.89  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 69  ? 139.498 100.132 119.245 1.00 39.89  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 69  ? 140.106 100.772 120.112 1.00 39.89  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 69  ? 137.690 98.579  120.015 1.00 39.89  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 69  ? 138.300 98.399  121.391 1.00 39.89  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 69  ? 137.882 97.105  122.043 1.00 39.89  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 69  ? 136.699 96.771  122.081 1.00 39.89  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 69  ? 138.853 96.361  122.559 1.00 39.89  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 70  ? 140.097 99.667  118.147 1.00 41.95  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 70  ? 141.519 99.918  117.933 1.00 41.95  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 70  ? 141.771 101.391 117.648 1.00 41.95  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 70  ? 142.779 101.948 118.098 1.00 41.95  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 70  ? 142.052 99.056  116.794 1.00 41.95  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 70  ? 142.049 97.576  117.085 1.00 41.95  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 70  ? 142.853 96.827  116.048 1.00 41.95  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 70  ? 142.258 96.971  114.724 1.00 41.95  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 70  ? 141.454 96.074  114.165 1.00 41.95  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 70  ? 141.140 94.964  114.817 1.00 41.95  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 70  ? 140.961 96.289  112.954 1.00 41.95  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 71  ? 140.859 102.033 116.906 1.00 39.06  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 71  ? 140.940 103.477 116.682 1.00 39.06  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 71  ? 140.865 104.257 117.990 1.00 39.06  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 71  ? 141.654 105.187 118.215 1.00 39.06  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 71  ? 139.816 103.922 115.749 1.00 39.06  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 71  ? 139.697 105.433 115.560 1.00 39.06  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 71  ? 140.936 106.000 114.906 1.00 39.06  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 71  ? 138.471 105.776 114.768 1.00 39.06  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 72  ? 139.922 103.881 118.859 1.00 33.70  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 72  ? 139.742 104.540 120.151 1.00 33.70  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 72  ? 140.987 104.387 121.019 1.00 33.70  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 72  ? 141.484 105.368 121.586 1.00 33.70  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 72  ? 138.481 104.001 120.845 1.00 33.70  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 72  ? 138.478 104.346 122.308 1.00 33.70  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 72  ? 137.262 104.582 120.190 1.00 33.70  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 73  ? 141.504 103.157 121.139 1.00 40.04  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 73  ? 142.706 102.929 121.945 1.00 40.04  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 73  ? 143.920 103.654 121.377 1.00 40.04  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 73  ? 144.744 104.171 122.141 1.00 40.04  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 73  ? 142.995 101.436 122.081 1.00 40.04  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 73  ? 141.916 100.667 122.810 1.00 40.04  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 73  ? 142.247 99.193  122.904 1.00 40.04  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 73  ? 141.142 98.441  123.484 1.00 40.04  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 73  ? 140.940 98.300  124.788 1.00 40.04  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 73  ? 141.774 98.855  125.655 1.00 40.04  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 73  ? 139.904 97.598  125.224 1.00 40.04  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 74  ? 144.052 103.695 120.046 1.00 41.38  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 74  ? 145.155 104.419 119.418 1.00 41.38  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 74  ? 145.089 105.911 119.730 1.00 41.38  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 74  ? 146.111 106.528 120.056 1.00 41.38  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 74  ? 145.151 104.183 117.911 1.00 41.38  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 74  ? 146.108 105.077 117.133 1.00 41.38  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 74  ? 147.541 104.998 117.646 1.00 41.38  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 74  ? 148.055 103.874 117.819 1.00 41.38  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 74  ? 148.150 106.062 117.878 1.00 41.38  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 75  ? 143.901 106.512 119.588 1.00 38.14  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 75  ? 143.719 107.923 119.929 1.00 38.14  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 75  ? 144.003 108.160 121.413 1.00 38.14  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 75  ? 144.624 109.160 121.791 1.00 38.14  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 75  ? 142.300 108.374 119.526 1.00 38.14  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 75  ? 142.187 108.451 118.006 1.00 38.14  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 75  ? 141.943 109.730 120.113 1.00 38.14  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 75  ? 140.833 108.908 117.516 1.00 38.14  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 76  ? 143.621 107.207 122.266 1.00 39.26  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 76  ? 143.831 107.363 123.700 1.00 39.26  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 76  ? 145.289 107.203 124.111 1.00 39.26  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 76  ? 145.657 107.665 125.196 1.00 39.26  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 76  ? 142.971 106.363 124.470 1.00 39.26  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 77  ? 146.098 106.501 123.307 1.00 41.13  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 77  ? 147.515 106.323 123.630 1.00 41.13  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 77  ? 148.268 107.647 123.722 1.00 41.13  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 77  ? 149.174 107.789 124.550 1.00 41.13  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 77  ? 148.192 105.405 122.615 1.00 41.13  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 77  ? 147.903 103.938 122.829 1.00 41.13  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 77  ? 148.630 103.054 121.843 1.00 41.13  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 77  ? 148.521 103.237 120.631 1.00 41.13  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 77  ? 149.381 102.089 122.357 1.00 41.13  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 78  ? 147.917 108.629 122.888 1.00 44.07  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 78  ? 148.695 109.869 122.883 1.00 44.07  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 78  ? 148.414 110.791 124.078 1.00 44.07  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 78  ? 149.013 111.870 124.144 1.00 44.07  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 78  ? 148.515 110.600 121.536 1.00 44.07  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 78  ? 147.065 111.006 121.225 1.00 44.07  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 78  ? 146.343 111.561 122.078 1.00 44.07  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 78  ? 146.654 110.805 120.063 1.00 44.07  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 79  ? 147.552 110.407 125.016 1.00 37.39  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 79  ? 147.266 111.214 126.196 1.00 37.39  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 79  ? 147.752 110.559 127.475 1.00 37.39  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 79  ? 148.328 111.236 128.328 1.00 37.39  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 79  ? 145.765 111.500 126.344 1.00 37.39  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 79  ? 145.140 112.173 125.160 1.00 37.39  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 79  ? 145.520 113.452 124.793 1.00 37.39  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 79  ? 144.115 111.556 124.461 1.00 37.39  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 79  ? 144.926 114.082 123.715 1.00 37.39  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 79  ? 143.511 112.183 123.390 1.00 37.39  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 79  ? 143.918 113.446 123.016 1.00 37.39  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 80  ? 147.529 109.258 127.636 1.00 38.22  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 80  ? 148.010 108.541 128.805 1.00 38.22  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 80  ? 148.263 107.098 128.403 1.00 38.22  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 80  ? 147.454 106.492 127.698 1.00 38.22  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 80  ? 147.014 108.616 129.966 1.00 38.22  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 80  ? 147.585 108.159 131.297 1.00 38.22  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 80  ? 146.622 108.446 132.436 1.00 38.22  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 80  ? 147.241 108.095 133.776 1.00 38.22  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 80  ? 147.647 106.667 133.841 1.00 38.22  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 81  ? 149.383 106.557 128.865 1.00 40.19  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 81  ? 149.810 105.221 128.476 1.00 40.19  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 81  ? 149.093 104.161 129.304 1.00 40.19  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 81  ? 148.872 104.342 130.505 1.00 40.19  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 81  ? 151.326 105.092 128.635 1.00 40.19  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 81  ? 151.959 106.261 128.102 1.00 40.19  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 81  ? 151.854 103.883 127.877 1.00 40.19  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 82  ? 148.713 103.067 128.633 1.00 43.69  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 82  ? 148.054 101.890 129.211 1.00 43.69  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 82  ? 146.720 102.275 129.856 1.00 43.69  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 82  ? 146.505 102.130 131.060 1.00 43.69  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 82  ? 148.987 101.163 130.198 1.00 43.69  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 82  ? 148.559 99.718  130.490 1.00 43.69  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 82  ? 147.364 99.430  130.717 1.00 43.69  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 82  ? 149.455 98.848  130.503 1.00 43.69  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 83  ? 145.837 102.812 129.025 1.00 42.01  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 83  ? 144.481 103.121 129.441 1.00 42.01  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 83  ? 143.590 101.910 129.211 1.00 42.01  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 83  ? 143.751 101.184 128.228 1.00 42.01  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 83  ? 143.939 104.327 128.680 1.00 42.01  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 83  ? 144.348 105.675 129.260 1.00 42.01  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 83  ? 143.968 106.784 128.310 1.00 42.01  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 83  ? 143.688 105.882 130.607 1.00 42.01  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 84  ? 142.653 101.694 130.126 1.00 47.75  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 84  ? 141.648 100.654 129.989 1.00 47.75  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 84  ? 140.309 101.293 129.660 1.00 47.75  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 84  ? 140.077 102.464 129.958 1.00 47.75  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 84  ? 141.545 99.816  131.265 1.00 47.75  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 84  ? 142.559 98.689  131.328 1.00 47.75  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 84  ? 142.899 98.240  132.751 1.00 47.75  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 84  ? 141.913 97.324  133.322 1.00 47.75  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 84  ? 140.897 97.691  134.097 1.00 47.75  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 84  ? 140.728 98.962  134.423 1.00 47.75  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 84  ? 140.057 96.780  134.563 1.00 47.75  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 85  ? 139.463 100.560 128.948 1.00 37.06  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 85  ? 138.155 101.069 128.561 1.00 37.06  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 85  ? 137.070 100.087 128.966 1.00 37.06  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 85  ? 137.173 98.891  128.681 1.00 37.06  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 85  ? 138.083 101.334 127.056 1.00 37.06  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 85  ? 138.699 102.635 126.640 1.00 37.06  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 85  ? 140.073 102.801 126.627 1.00 37.06  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 85  ? 137.898 103.693 126.254 1.00 37.06  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 85  ? 140.633 104.001 126.248 1.00 37.06  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 85  ? 138.452 104.895 125.876 1.00 37.06  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 85  ? 139.821 105.047 125.870 1.00 37.06  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 86  ? 136.036 100.592 129.629 1.00 35.61  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 86  ? 134.819 99.816  129.795 1.00 35.61  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 86  ? 134.139 99.640  128.446 1.00 35.61  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 86  ? 134.243 100.506 127.573 1.00 35.61  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 86  ? 133.861 100.489 130.774 1.00 35.61  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 86  ? 134.209 100.299 132.234 1.00 35.61  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 86  ? 133.154 100.883 133.155 1.00 35.61  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 86  ? 132.278 101.628 132.721 1.00 35.61  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 86  ? 133.231 100.542 134.435 1.00 35.61  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 87  ? 133.504 98.475  128.264 1.00 35.58  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 87  ? 132.759 98.179  127.040 1.00 35.58  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 87  ? 131.674 99.214  126.778 1.00 35.58  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 87  ? 131.432 99.594  125.623 1.00 35.58  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 87  ? 132.145 96.785  127.120 1.00 35.58  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 87  ? 131.368 96.517  125.966 1.00 35.58  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 88  ? 131.000 99.669  127.837 1.00 32.55  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 88  ? 129.946 100.659 127.674 1.00 32.55  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 88  ? 130.501 102.004 127.222 1.00 32.55  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 88  ? 129.817 102.736 126.501 1.00 32.55  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 88  ? 129.165 100.813 128.975 1.00 32.55  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 88  ? 128.189 99.796  129.101 1.00 32.55  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 89  ? 131.735 102.337 127.612 1.00 31.95  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 89  ? 132.342 103.580 127.143 1.00 31.95  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 89  ? 132.635 103.525 125.649 1.00 31.95  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 89  ? 132.409 104.506 124.931 1.00 31.95  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 89  ? 133.617 103.872 127.929 1.00 31.95  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 90  ? 133.097 102.372 125.160 1.00 31.72  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 90  ? 133.368 102.216 123.735 1.00 31.72  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 90  ? 132.065 102.218 122.950 1.00 31.72  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 90  ? 131.988 102.778 121.848 1.00 31.72  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 90  ? 134.191 100.939 123.494 1.00 31.72  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 90  ? 134.527 100.771 122.027 1.00 31.72  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 90  ? 135.464 100.989 124.311 1.00 31.72  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 91  ? 131.008 101.641 123.527 1.00 33.66  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 91  ? 129.704 101.670 122.873 1.00 33.66  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 91  ? 129.148 103.088 122.816 1.00 33.66  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 91  ? 128.556 103.485 121.806 1.00 33.66  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 91  ? 128.731 100.740 123.593 1.00 33.66  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 91  ? 127.446 100.490 122.831 1.00 33.66  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 91  ? 127.656 99.299  121.498 1.00 33.66  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 91  ? 128.619 98.035  122.323 1.00 33.66  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 92  ? 129.305 103.851 123.904 1.00 32.74  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 92  ? 128.876 105.247 123.922 1.00 32.74  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 92  ? 129.646 106.086 122.909 1.00 32.74  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 92  ? 129.063 106.946 122.233 1.00 32.74  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 92  ? 129.042 105.822 125.327 1.00 32.74  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 93  ? 130.946 105.815 122.755 1.00 29.87  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 93  ? 131.741 106.537 121.768 1.00 29.87  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 93  ? 131.296 106.197 120.357 1.00 29.87  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 93  ? 131.200 107.086 119.505 1.00 29.87  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 93  ? 133.225 106.222 121.936 1.00 29.87  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 93  ? 133.962 106.983 123.028 1.00 29.87  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 93  ? 135.349 106.413 123.234 1.00 29.87  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 93  ? 134.040 108.433 122.637 1.00 29.87  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 94  ? 131.008 104.919 120.101 1.00 34.69  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 94  ? 130.569 104.495 118.777 1.00 34.69  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 94  ? 129.203 105.070 118.437 1.00 34.69  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 94  ? 128.965 105.480 117.294 1.00 34.69  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 94  ? 130.552 102.973 118.711 1.00 34.69  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 94  ? 130.394 102.394 117.335 1.00 34.69  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 94  ? 130.555 100.894 117.351 1.00 34.69  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 94  ? 130.751 100.296 118.406 1.00 34.69  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 94  ? 130.470 100.274 116.183 1.00 34.69  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 95  ? 128.299 105.105 119.420 1.00 29.68  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 95  ? 126.991 105.723 119.231 1.00 29.68  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 95  ? 127.107 107.210 118.912 1.00 29.68  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 95  ? 126.456 107.704 117.982 1.00 29.68  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 95  ? 126.127 105.509 120.468 1.00 29.68  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 95  ? 124.712 105.999 120.287 1.00 29.68  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 95  ? 124.131 105.614 118.942 1.00 29.68  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 95  ? 124.004 104.402 118.668 1.00 29.68  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 95  ? 123.797 106.524 118.156 1.00 29.68  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 96  ? 127.925 107.942 119.680 1.00 29.62  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 96  ? 128.083 109.375 119.436 1.00 29.62  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 96  ? 128.759 109.641 118.100 1.00 29.62  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 96  ? 128.389 110.583 117.388 1.00 29.62  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 96  ? 128.888 110.015 120.556 1.00 29.62  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 97  ? 129.711 108.784 117.729 1.00 27.23  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 97  ? 130.425 108.918 116.468 1.00 27.23  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 97  ? 129.487 108.706 115.291 1.00 27.23  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 97  ? 129.477 109.500 114.338 1.00 27.23  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 97  ? 131.566 107.906 116.438 1.00 27.23  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 97  ? 132.328 108.013 115.262 1.00 27.23  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 98  ? 128.659 107.662 115.368 1.00 28.40  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 98  ? 127.718 107.376 114.297 1.00 28.40  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 98  ? 126.656 108.460 114.188 1.00 28.40  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 98  ? 126.337 108.897 113.080 1.00 28.40  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 98  ? 127.070 106.012 114.527 1.00 28.40  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 98  ? 125.782 105.797 113.755 1.00 28.40  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 98  ? 124.921 104.704 114.340 1.00 28.40  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 98  ? 123.775 104.998 114.740 1.00 28.40  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 98  ? 125.385 103.550 114.398 1.00 28.40  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 99  ? 126.119 108.925 115.323 1.00 27.38  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 99  ? 125.106 109.980 115.296 1.00 27.38  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 99  ? 125.650 111.296 114.749 1.00 27.38  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 99  ? 124.965 111.983 113.975 1.00 27.38  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 99  ? 124.534 110.189 116.690 1.00 27.38  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 100 ? 126.887 111.648 115.114 1.00 24.52  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 100 ? 127.483 112.883 114.615 1.00 24.52  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 100 ? 127.731 112.794 113.116 1.00 24.52  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 100 ? 127.452 113.750 112.380 1.00 24.52  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 100 ? 128.766 113.206 115.376 1.00 24.52  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 100 ? 129.575 114.320 114.761 1.00 24.52  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 100 ? 129.199 115.643 114.945 1.00 24.52  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 100 ? 130.736 114.061 114.049 1.00 24.52  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 100 ? 129.929 116.676 114.402 1.00 24.52  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 100 ? 131.475 115.091 113.503 1.00 24.52  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 100 ? 131.066 116.395 113.685 1.00 24.52  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 100 ? 131.793 117.429 113.149 1.00 24.52  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 101 ? 128.269 111.659 112.649 1.00 24.28  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 101 ? 128.482 111.484 111.215 1.00 24.28  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 101 ? 127.172 111.483 110.442 1.00 24.28  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 101 ? 127.114 112.023 109.338 1.00 24.28  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 101 ? 129.244 110.201 110.924 1.00 24.28  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 101 ? 130.716 110.251 111.265 1.00 24.28  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 101 ? 131.328 108.913 110.962 1.00 24.28  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 101 ? 131.378 111.342 110.466 1.00 24.28  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 102 ? 126.135 110.831 110.977 1.00 26.82  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 102 ? 124.821 110.816 110.333 1.00 26.82  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 102 ? 124.269 112.229 110.174 1.00 26.82  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 102 ? 123.791 112.601 109.094 1.00 26.82  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 102 ? 123.855 109.902 111.107 1.00 26.82  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 102 ? 122.427 110.210 110.757 1.00 26.82  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 102 ? 124.123 108.463 110.737 1.00 26.82  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 103 ? 124.328 113.037 111.241 1.00 26.93  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 103 ? 123.850 114.418 111.145 1.00 26.93  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 103 ? 124.678 115.238 110.156 1.00 26.93  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 103 ? 124.123 116.016 109.361 1.00 26.93  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 103 ? 123.865 115.071 112.525 1.00 26.93  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 104 ? 126.005 115.054 110.179 1.00 26.82  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 104 ? 126.888 115.741 109.241 1.00 26.82  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 104 ? 126.592 115.360 107.795 1.00 26.82  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 104 ? 126.548 116.230 106.919 1.00 26.82  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 104 ? 128.339 115.414 109.578 1.00 26.82  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 104 ? 129.417 115.971 108.660 1.00 26.82  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 104 ? 129.308 117.472 108.594 1.00 26.82  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 104 ? 130.784 115.547 109.141 1.00 26.82  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 105 ? 126.361 114.070 107.530 1.00 29.36  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 105 ? 126.057 113.628 106.174 1.00 29.36  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 105 ? 124.676 114.073 105.725 1.00 29.36  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 105 ? 124.483 114.335 104.538 1.00 29.36  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 105 ? 126.189 112.113 106.044 1.00 29.36  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 105 ? 127.594 111.652 105.799 1.00 29.36  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 105 ? 128.266 112.035 104.658 1.00 29.36  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 105 ? 128.228 110.804 106.686 1.00 29.36  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 105 ? 129.558 111.610 104.428 1.00 29.36  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 105 ? 129.517 110.375 106.459 1.00 29.36  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 105 ? 130.179 110.776 105.328 1.00 29.36  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 106 ? 123.707 114.139 106.641 1.00 30.93  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 106 ? 122.390 114.670 106.296 1.00 30.93  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 106 ? 122.474 116.133 105.867 1.00 30.93  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 106 ? 121.889 116.527 104.847 1.00 30.93  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 106 ? 121.438 114.506 107.477 1.00 30.93  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 106 ? 120.132 115.254 107.324 1.00 30.93  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 106 ? 119.368 114.832 106.087 1.00 30.93  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 106 ? 119.207 113.615 105.876 1.00 30.93  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 106 ? 118.927 115.715 105.325 1.00 30.93  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 107 ? 123.242 116.943 106.601 1.00 32.67  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 107 ? 123.369 118.350 106.221 1.00 32.67  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 107 ? 124.211 118.517 104.958 1.00 32.67  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 107 ? 123.925 119.391 104.127 1.00 32.67  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 107 ? 123.935 119.154 107.384 1.00 32.67  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 107 ? 122.916 119.355 108.487 1.00 32.67  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 107 ? 121.835 118.731 108.410 1.00 32.67  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 107 ? 123.194 120.127 109.429 1.00 32.67  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 108 ? 125.262 117.701 104.809 1.00 30.18  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 108 ? 126.043 117.672 103.575 1.00 30.18  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 108 ? 125.172 117.301 102.379 1.00 30.18  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 108 ? 125.314 117.877 101.293 1.00 30.18  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 108 ? 127.205 116.692 103.746 1.00 30.18  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 108 ? 128.088 117.176 104.765 1.00 30.18  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 108 ? 127.978 116.493 102.472 1.00 30.18  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 109 ? 124.234 116.373 102.578 1.00 30.47  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 109 ? 123.301 116.003 101.524 1.00 30.47  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 109 ? 122.379 117.159 101.178 1.00 30.47  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 109 ? 122.061 117.363 100.002 1.00 30.47  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 109 ? 122.489 114.783 101.926 1.00 30.47  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 109 ? 121.886 114.087 100.736 1.00 30.47  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 109 ? 122.450 114.110 99.644  1.00 30.47  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 109 ? 120.730 113.472 100.931 1.00 30.47  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 110 ? 121.898 117.890 102.193 1.00 32.11  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 110 ? 121.067 119.064 101.922 1.00 32.11  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 110 ? 121.836 120.134 101.155 1.00 32.11  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 110 ? 121.267 120.793 100.279 1.00 32.11  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 110 ? 120.508 119.641 103.218 1.00 32.11  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 110 ? 119.536 118.718 103.942 1.00 32.11  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 110 ? 119.066 119.354 105.225 1.00 32.11  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 110 ? 118.356 118.390 103.044 1.00 32.11  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 111 ? 123.140 120.260 101.413 1.00 32.51  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 111 ? 123.965 121.199 100.653 1.00 32.51  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 111 ? 124.125 120.740 99.209  1.00 32.51  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 111 ? 124.072 121.552 98.274  1.00 32.51  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 111 ? 125.342 121.335 101.296 1.00 32.51  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 111 ? 125.400 122.330 102.765 1.00 32.51  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 112 ? 124.363 119.440 99.027  1.00 32.68  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 112 ? 124.472 118.840 97.702  1.00 32.68  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 112 ? 123.210 119.053 96.877  1.00 32.68  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 112 ? 123.284 119.436 95.704  1.00 32.68  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 112 ? 124.765 117.353 97.848  1.00 32.68  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 113 ? 122.046 118.757 97.460  1.00 35.08  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 113 ? 120.769 118.992 96.787  1.00 35.08  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 113 ? 120.578 120.479 96.502  1.00 35.08  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 113 ? 120.051 120.861 95.447  1.00 35.08  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 113 ? 119.620 118.392 97.618  1.00 35.08  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 113 ? 119.763 116.874 97.649  1.00 35.08  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 113 ? 118.253 118.755 97.063  1.00 35.08  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 113 ? 119.200 116.233 98.872  1.00 35.08  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 114 ? 121.021 121.338 97.426  1.00 37.10  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 114 ? 120.960 122.781 97.215  1.00 37.10  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 114 ? 121.795 123.238 96.024  1.00 37.10  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 114 ? 121.403 124.173 95.320  1.00 37.10  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 114 ? 121.417 123.504 98.474  1.00 37.10  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 114 ? 121.470 124.986 98.321  1.00 37.10  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 114 ? 120.345 125.776 98.379  1.00 37.10  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 114 ? 122.513 125.824 98.119  1.00 37.10  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 114 ? 120.691 127.038 98.211  1.00 37.10  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 114 ? 122.000 127.096 98.054  1.00 37.10  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 115 ? 122.922 122.580 95.761  1.00 37.47  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 115 ? 123.782 122.962 94.648  1.00 37.47  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 115 ? 123.407 122.275 93.335  1.00 37.47  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 115 ? 124.259 122.176 92.444  1.00 37.47  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 115 ? 125.244 122.672 94.988  1.00 37.47  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 116 ? 122.151 121.821 93.207  1.00 40.59  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 116 ? 121.615 121.117 92.031  1.00 40.59  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 116 ? 122.442 119.883 91.671  1.00 40.59  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 116 ? 122.745 119.625 90.506  1.00 40.59  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 116 ? 121.478 122.053 90.826  1.00 40.59  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 116 ? 120.580 123.255 91.050  1.00 40.59  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 116 ? 119.610 123.419 89.886  1.00 40.59  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 116 ? 118.785 124.688 90.011  1.00 40.59  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 116 ? 118.482 125.278 88.678  1.00 40.59  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 117 ? 122.799 119.112 92.689  1.00 37.74  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 117 ? 123.501 117.855 92.510  1.00 37.74  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 117 ? 122.850 116.798 93.385  1.00 37.74  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 117 ? 122.010 117.099 94.235  1.00 37.74  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 117 ? 124.991 117.961 92.848  1.00 37.74  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 117 ? 125.797 118.723 91.828  1.00 37.74  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 117 ? 127.280 118.613 92.105  1.00 37.74  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 117 ? 127.719 119.480 93.187  1.00 37.74  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 117 ? 128.007 119.045 94.406  1.00 37.74  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 117 ? 127.901 117.756 94.685  1.00 37.74  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 117 ? 128.407 119.894 95.339  1.00 37.74  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 118 ? 123.233 115.544 93.153  1.00 37.41  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 118 ? 122.772 114.431 93.970  1.00 37.41  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 118 ? 123.915 113.692 94.645  1.00 37.41  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 118 ? 123.663 112.740 95.386  1.00 37.41  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 118 ? 121.915 113.447 93.149  1.00 37.41  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 118 ? 120.641 114.119 92.672  1.00 37.41  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 118 ? 122.701 112.913 91.977  1.00 37.41  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 119 ? 125.160 114.099 94.422  1.00 35.84  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 119 ? 126.314 113.472 95.053  1.00 35.84  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 119 ? 126.933 114.457 96.033  1.00 35.84  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 119 ? 126.716 115.665 95.920  1.00 35.84  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 119 ? 127.349 113.025 94.022  1.00 35.84  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 119 ? 128.428 112.364 94.692  1.00 35.84  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 119 ? 127.901 114.206 93.271  1.00 35.84  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 120 ? 127.718 113.942 96.978  1.00 33.21  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 120 ? 128.384 114.800 97.948  1.00 33.21  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 120 ? 129.869 114.906 97.623  1.00 33.21  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 120 ? 130.479 113.971 97.089  1.00 33.21  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 120 ? 128.144 114.290 99.378  1.00 33.21  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 120 ? 128.770 112.917 99.591  1.00 33.21  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 120 ? 126.663 114.221 99.663  1.00 33.21  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 120 ? 128.773 112.484 101.018 1.00 33.21  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 121 ? 130.443 116.070 97.885  1.00 33.03  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 121 ? 131.839 116.369 97.615  1.00 33.03  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 121 ? 132.479 116.850 98.907  1.00 33.03  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 121 ? 131.765 117.214 99.847  1.00 33.03  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 121 ? 131.953 117.442 96.520  1.00 33.03  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 121 ? 131.213 117.110 95.240  1.00 33.03  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 121 ? 131.422 118.377 93.980  1.00 33.03  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 121 ? 133.192 118.282 93.712  1.00 33.03  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 122 ? 133.822 116.769 99.025  1.00 32.58  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 122 ? 134.508 117.258 100.243 1.00 32.58  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 122 ? 134.188 118.684 100.641 1.00 32.58  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 122 ? 134.060 118.981 101.837 1.00 32.58  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 122 ? 135.987 117.109 99.880  1.00 32.58  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 122 ? 136.012 115.975 98.993  1.00 32.58  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 122 ? 134.753 115.999 98.181  1.00 32.58  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 123 ? 134.069 119.579 99.660  1.00 33.14  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 123 ? 133.729 120.963 99.949  1.00 33.14  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 123 ? 132.323 121.106 100.525 1.00 33.14  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 123 ? 132.076 122.065 101.259 1.00 33.14  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 123 ? 133.913 121.809 98.688  1.00 33.14  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 123 ? 133.052 121.387 97.521  1.00 33.14  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 123 ? 133.497 122.062 96.239  1.00 33.14  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 123 ? 132.578 121.706 95.086  1.00 33.14  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 123 ? 131.253 122.372 95.192  1.00 33.14  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 124 ? 131.431 120.135 100.292 1.00 34.08  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 124 ? 130.132 120.156 100.962 1.00 34.08  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 124 ? 130.273 119.850 102.449 1.00 34.08  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 124 ? 129.610 120.485 103.277 1.00 34.08  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 124 ? 129.165 119.168 100.313 1.00 34.08  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 124 ? 128.664 119.626 98.967  1.00 34.08  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 124 ? 128.482 120.839 98.793  1.00 34.08  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 124 ? 128.431 118.772 98.088  1.00 34.08  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 125 ? 131.111 118.869 102.803 1.00 31.30  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 125 ? 131.373 118.580 104.214 1.00 31.30  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 125 ? 132.054 119.767 104.884 1.00 31.30  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 125 ? 131.710 120.137 106.017 1.00 31.30  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 125 ? 132.196 117.282 104.359 1.00 31.30  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 125 ? 131.382 116.083 103.880 1.00 31.30  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 125 ? 132.672 117.068 105.792 1.00 31.30  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 125 ? 132.050 114.754 104.124 1.00 31.30  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 126 ? 133.002 120.403 104.183 1.00 32.64  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 126 ? 133.678 121.572 104.744 1.00 32.64  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 126 ? 132.705 122.730 104.929 1.00 32.64  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 126 ? 132.773 123.444 105.936 1.00 32.64  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 126 ? 134.865 121.984 103.875 1.00 32.64  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 126 ? 135.949 120.925 103.774 1.00 32.64  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 126 ? 136.910 121.180 102.631 1.00 32.64  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 126 ? 136.724 122.107 101.844 1.00 32.64  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 126 ? 137.950 120.361 102.538 1.00 32.64  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 127 ? 131.777 122.903 103.982 1.00 33.57  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 127 ? 130.736 123.915 104.114 1.00 33.57  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 127 ? 129.839 123.631 105.312 1.00 33.57  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 127 ? 129.537 124.541 106.087 1.00 33.57  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 127 ? 129.904 123.981 102.836 1.00 33.57  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 127 ? 128.620 124.816 102.874 1.00 33.57  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 127 ? 128.903 126.268 103.219 1.00 33.57  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 127 ? 127.891 124.726 101.554 1.00 33.57  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 128 ? 129.378 122.381 105.452 1.00 32.74  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 128 ? 128.510 121.991 106.566 1.00 32.74  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 128 ? 129.172 122.240 107.918 1.00 32.74  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 128 ? 128.554 122.803 108.832 1.00 32.74  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 128 ? 128.109 120.525 106.426 1.00 32.74  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 129 ? 130.432 121.821 108.061 1.00 31.68  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 129 ? 131.154 122.045 109.310 1.00 31.68  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 129 ? 131.416 123.529 109.550 1.00 31.68  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 129 ? 131.478 123.970 110.704 1.00 31.68  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 129 ? 132.452 121.247 109.315 1.00 31.68  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 129 ? 132.207 119.767 109.208 1.00 31.68  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 129 ? 133.466 118.956 109.357 1.00 31.68  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 129 ? 134.114 119.132 110.649 1.00 31.68  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 129 ? 135.369 119.533 110.806 1.00 31.68  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 129 ? 136.118 119.803 109.747 1.00 31.68  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 129 ? 135.877 119.649 112.022 1.00 31.68  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 130 ? 131.614 124.306 108.479 1.00 31.73  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 130 ? 131.792 125.748 108.622 1.00 31.73  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 130 ? 130.515 126.410 109.136 1.00 31.73  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 130 ? 130.570 127.278 110.016 1.00 31.73  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 130 ? 132.218 126.350 107.283 1.00 31.73  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 130 ? 132.144 127.864 107.204 1.00 31.73  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 130 ? 133.157 128.497 108.154 1.00 31.73  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 130 ? 133.150 129.957 108.111 1.00 31.73  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 130 ? 132.373 130.725 108.866 1.00 31.73  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 130 ? 131.536 130.177 109.735 1.00 31.73  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 130 ? 132.437 132.044 108.758 1.00 31.73  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 131 ? 129.362 126.049 108.553 1.00 30.56  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 131 ? 128.068 126.564 109.013 1.00 30.56  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 131 ? 127.820 126.180 110.468 1.00 30.56  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 131 ? 127.318 126.989 111.261 1.00 30.56  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 131 ? 126.922 126.068 108.108 1.00 30.56  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 131 ? 127.126 126.490 106.659 1.00 30.56  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 131 ? 125.582 126.615 108.565 1.00 30.56  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 131 ? 127.116 127.946 106.427 1.00 30.56  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 132 ? 128.174 124.945 110.842 1.00 33.48  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 132 ? 128.000 124.500 112.225 1.00 33.48  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 132 ? 128.876 125.292 113.190 1.00 33.48  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 132 ? 128.463 125.570 114.322 1.00 33.48  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 132 ? 128.250 122.999 112.334 1.00 33.48  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 132 ? 127.064 122.219 111.803 1.00 33.48  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 132 ? 127.198 120.729 111.954 1.00 33.48  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 132 ? 125.924 120.086 111.661 1.00 33.48  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 132 ? 125.678 118.797 111.845 1.00 33.48  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 132 ? 126.625 118.003 112.321 1.00 33.48  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 132 ? 124.486 118.302 111.551 1.00 33.48  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 133 ? 130.082 125.664 112.771 1.00 39.26  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 133 ? 130.895 126.507 113.625 1.00 39.26  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 133 ? 132.262 126.032 114.069 1.00 39.26  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 133 ? 132.783 126.535 115.068 1.00 39.26  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 134 ? 132.860 125.080 113.364 1.00 39.71  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 134 ? 134.205 124.654 113.731 1.00 39.71  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 134 ? 135.235 125.460 112.946 1.00 39.71  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 134 ? 136.122 126.087 113.526 1.00 39.71  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 134 ? 134.407 123.159 113.489 1.00 39.71  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 134 ? 135.848 122.780 113.169 1.00 39.71  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 134 ? 136.732 122.682 114.400 1.00 39.71  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 134 ? 136.203 122.723 115.530 1.00 39.71  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 134 ? 137.964 122.566 114.235 1.00 39.71  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG B 2 24  ? 149.410 103.652 114.975 1.00 51.96  ? 23   ARG B N     1 
ATOM   793   C  CA    . ARG B 2 24  ? 149.769 103.199 113.637 1.00 51.96  ? 23   ARG B CA    1 
ATOM   794   C  C     . ARG B 2 24  ? 148.755 103.681 112.606 1.00 51.96  ? 23   ARG B C     1 
ATOM   795   O  O     . ARG B 2 24  ? 148.085 104.694 112.805 1.00 51.96  ? 23   ARG B O     1 
ATOM   796   C  CB    . ARG B 2 24  ? 149.874 101.674 113.598 1.00 51.96  ? 23   ARG B CB    1 
ATOM   797   C  CG    . ARG B 2 24  ? 151.172 101.161 112.999 1.00 51.96  ? 23   ARG B CG    1 
ATOM   798   C  CD    . ARG B 2 24  ? 151.390 99.695  113.321 1.00 51.96  ? 23   ARG B CD    1 
ATOM   799   N  NE    . ARG B 2 24  ? 150.553 98.825  112.502 1.00 51.96  ? 23   ARG B NE    1 
ATOM   800   C  CZ    . ARG B 2 24  ? 150.547 97.499  112.587 1.00 51.96  ? 23   ARG B CZ    1 
ATOM   801   N  NH1   . ARG B 2 24  ? 151.337 96.885  113.456 1.00 51.96  ? 23   ARG B NH1   1 
ATOM   802   N  NH2   . ARG B 2 24  ? 149.753 96.786  111.801 1.00 51.96  ? 23   ARG B NH2   1 
ATOM   803   N  N     . ASP B 2 25  ? 148.644 102.938 111.502 1.00 48.60  ? 24   ASP B N     1 
ATOM   804   C  CA    . ASP B 2 25  ? 147.704 103.240 110.429 1.00 48.60  ? 24   ASP B CA    1 
ATOM   805   C  C     . ASP B 2 25  ? 146.378 102.516 110.601 1.00 48.60  ? 24   ASP B C     1 
ATOM   806   O  O     . ASP B 2 25  ? 145.719 102.181 109.608 1.00 48.60  ? 24   ASP B O     1 
ATOM   807   C  CB    . ASP B 2 25  ? 148.322 102.906 109.072 1.00 48.60  ? 24   ASP B CB    1 
ATOM   808   C  CG    . ASP B 2 25  ? 147.841 103.833 107.972 1.00 48.60  ? 24   ASP B CG    1 
ATOM   809   O  OD1   . ASP B 2 25  ? 147.559 105.013 108.269 1.00 48.60  ? 24   ASP B OD1   1 
ATOM   810   O  OD2   . ASP B 2 25  ? 147.746 103.380 106.812 1.00 48.60  ? 24   ASP B OD2   1 
ATOM   811   N  N     . ASN B 2 26  ? 145.975 102.257 111.844 1.00 42.16  ? 25   ASN B N     1 
ATOM   812   C  CA    . ASN B 2 26  ? 144.730 101.565 112.147 1.00 42.16  ? 25   ASN B CA    1 
ATOM   813   C  C     . ASN B 2 26  ? 143.484 102.405 111.895 1.00 42.16  ? 25   ASN B C     1 
ATOM   814   O  O     . ASN B 2 26  ? 142.377 101.875 112.031 1.00 42.16  ? 25   ASN B O     1 
ATOM   815   C  CB    . ASN B 2 26  ? 144.744 101.110 113.596 1.00 42.16  ? 25   ASN B CB    1 
ATOM   816   C  CG    . ASN B 2 26  ? 144.924 102.255 114.541 1.00 42.16  ? 25   ASN B CG    1 
ATOM   817   O  OD1   . ASN B 2 26  ? 145.986 102.872 114.592 1.00 42.16  ? 25   ASN B OD1   1 
ATOM   818   N  ND2   . ASN B 2 26  ? 143.877 102.574 115.279 1.00 42.16  ? 25   ASN B ND2   1 
ATOM   819   N  N     . ILE B 2 27  ? 143.625 103.693 111.561 1.00 38.44  ? 26   ILE B N     1 
ATOM   820   C  CA    . ILE B 2 27  ? 142.460 104.526 111.276 1.00 38.44  ? 26   ILE B CA    1 
ATOM   821   C  C     . ILE B 2 27  ? 141.776 104.097 109.978 1.00 38.44  ? 26   ILE B C     1 
ATOM   822   O  O     . ILE B 2 27  ? 140.579 104.347 109.794 1.00 38.44  ? 26   ILE B O     1 
ATOM   823   C  CB    . ILE B 2 27  ? 142.873 106.013 111.263 1.00 38.44  ? 26   ILE B CB    1 
ATOM   824   C  CG1   . ILE B 2 27  ? 141.647 106.925 111.356 1.00 38.44  ? 26   ILE B CG1   1 
ATOM   825   C  CG2   . ILE B 2 27  ? 143.715 106.343 110.040 1.00 38.44  ? 26   ILE B CG2   1 
ATOM   826   C  CD1   . ILE B 2 27  ? 141.976 108.377 111.413 1.00 38.44  ? 26   ILE B CD1   1 
ATOM   827   N  N     . GLN B 2 28  ? 142.484 103.381 109.100 1.00 37.18  ? 27   GLN B N     1 
ATOM   828   C  CA    . GLN B 2 28  ? 141.885 102.783 107.913 1.00 37.18  ? 27   GLN B CA    1 
ATOM   829   C  C     . GLN B 2 28  ? 140.994 101.590 108.238 1.00 37.18  ? 27   GLN B C     1 
ATOM   830   O  O     . GLN B 2 28  ? 140.412 101.014 107.313 1.00 37.18  ? 27   GLN B O     1 
ATOM   831   C  CB    . GLN B 2 28  ? 142.970 102.378 106.915 1.00 37.18  ? 27   GLN B CB    1 
ATOM   832   C  CG    . GLN B 2 28  ? 143.707 103.558 106.290 1.00 37.18  ? 27   GLN B CG    1 
ATOM   833   C  CD    . GLN B 2 28  ? 142.789 104.526 105.554 1.00 37.18  ? 27   GLN B CD    1 
ATOM   834   O  OE1   . GLN B 2 28  ? 142.969 105.740 105.625 1.00 37.18  ? 27   GLN B OE1   1 
ATOM   835   N  NE2   . GLN B 2 28  ? 141.836 103.989 104.800 1.00 37.18  ? 27   GLN B NE2   1 
ATOM   836   N  N     . GLY B 2 29  ? 140.929 101.179 109.510 1.00 41.08  ? 28   GLY B N     1 
ATOM   837   C  CA    . GLY B 2 29  ? 139.996 100.140 109.917 1.00 41.08  ? 28   GLY B CA    1 
ATOM   838   C  C     . GLY B 2 29  ? 138.550 100.525 109.662 1.00 41.08  ? 28   GLY B C     1 
ATOM   839   O  O     . GLY B 2 29  ? 137.709 99.665  109.390 1.00 41.08  ? 28   GLY B O     1 
ATOM   840   N  N     . ILE B 2 30  ? 138.226 101.806 109.817 1.00 36.97  ? 29   ILE B N     1 
ATOM   841   C  CA    . ILE B 2 30  ? 136.933 102.299 109.366 1.00 36.97  ? 29   ILE B CA    1 
ATOM   842   C  C     . ILE B 2 30  ? 136.999 102.288 107.846 1.00 36.97  ? 29   ILE B C     1 
ATOM   843   O  O     . ILE B 2 30  ? 137.656 103.138 107.234 1.00 36.97  ? 29   ILE B O     1 
ATOM   844   C  CB    . ILE B 2 30  ? 136.613 103.696 109.913 1.00 36.97  ? 29   ILE B CB    1 
ATOM   845   C  CG1   . ILE B 2 30  ? 136.359 103.616 111.408 1.00 36.97  ? 29   ILE B CG1   1 
ATOM   846   C  CG2   . ILE B 2 30  ? 135.356 104.243 109.266 1.00 36.97  ? 29   ILE B CG2   1 
ATOM   847   C  CD1   . ILE B 2 30  ? 136.148 104.949 112.032 1.00 36.97  ? 29   ILE B CD1   1 
ATOM   848   N  N     . THR B 2 31  ? 136.369 101.301 107.229 1.00 44.38  ? 30   THR B N     1 
ATOM   849   C  CA    . THR B 2 31  ? 136.571 101.060 105.812 1.00 44.38  ? 30   THR B CA    1 
ATOM   850   C  C     . THR B 2 31  ? 135.583 101.852 104.966 1.00 44.38  ? 30   THR B C     1 
ATOM   851   O  O     . THR B 2 31  ? 134.664 102.498 105.472 1.00 44.38  ? 30   THR B O     1 
ATOM   852   C  CB    . THR B 2 31  ? 136.434 99.576  105.506 1.00 44.38  ? 30   THR B CB    1 
ATOM   853   O  OG1   . THR B 2 31  ? 135.123 99.138  105.877 1.00 44.38  ? 30   THR B OG1   1 
ATOM   854   C  CG2   . THR B 2 31  ? 137.458 98.782  106.282 1.00 44.38  ? 30   THR B CG2   1 
ATOM   855   N  N     . LYS B 2 32  ? 135.818 101.809 103.653 1.00 39.63  ? 31   LYS B N     1 
ATOM   856   C  CA    . LYS B 2 32  ? 134.950 102.449 102.663 1.00 39.63  ? 31   LYS B CA    1 
ATOM   857   C  C     . LYS B 2 32  ? 133.479 102.032 102.738 1.00 39.63  ? 31   LYS B C     1 
ATOM   858   O  O     . LYS B 2 32  ? 132.627 102.934 102.784 1.00 39.63  ? 31   LYS B O     1 
ATOM   859   C  CB    . LYS B 2 32  ? 135.572 102.253 101.268 1.00 39.63  ? 31   LYS B CB    1 
ATOM   860   C  CG    . LYS B 2 32  ? 134.813 102.897 100.127 1.00 39.63  ? 31   LYS B CG    1 
ATOM   861   C  CD    . LYS B 2 32  ? 135.231 102.330 98.767  1.00 39.63  ? 31   LYS B CD    1 
ATOM   862   C  CE    . LYS B 2 32  ? 135.316 100.810 98.756  1.00 39.63  ? 31   LYS B CE    1 
ATOM   863   N  NZ    . LYS B 2 32  ? 133.981 100.169 98.645  1.00 39.63  ? 31   LYS B NZ    1 
ATOM   864   N  N     . PRO B 2 33  ? 133.093 100.741 102.726 1.00 44.66  ? 32   PRO B N     1 
ATOM   865   C  CA    . PRO B 2 33  ? 131.652 100.435 102.799 1.00 44.66  ? 32   PRO B CA    1 
ATOM   866   C  C     . PRO B 2 33  ? 130.995 100.798 104.125 1.00 44.66  ? 32   PRO B C     1 
ATOM   867   O  O     . PRO B 2 33  ? 129.783 101.018 104.141 1.00 44.66  ? 32   PRO B O     1 
ATOM   868   C  CB    . PRO B 2 33  ? 131.588 98.927  102.535 1.00 44.66  ? 32   PRO B CB    1 
ATOM   869   C  CG    . PRO B 2 33  ? 132.878 98.441  102.910 1.00 44.66  ? 32   PRO B CG    1 
ATOM   870   C  CD    . PRO B 2 33  ? 133.856 99.483  102.572 1.00 44.66  ? 32   PRO B CD    1 
ATOM   871   N  N     . ALA B 2 34  ? 131.744 100.898 105.227 1.00 41.50  ? 33   ALA B N     1 
ATOM   872   C  CA    . ALA B 2 34  ? 131.123 101.303 106.487 1.00 41.50  ? 33   ALA B CA    1 
ATOM   873   C  C     . ALA B 2 34  ? 130.771 102.785 106.461 1.00 41.50  ? 33   ALA B C     1 
ATOM   874   O  O     . ALA B 2 34  ? 129.702 103.191 106.943 1.00 41.50  ? 33   ALA B O     1 
ATOM   875   C  CB    . ALA B 2 34  ? 132.051 100.988 107.657 1.00 41.50  ? 33   ALA B CB    1 
ATOM   876   N  N     . ILE B 2 35  ? 131.658 103.601 105.887 1.00 36.45  ? 34   ILE B N     1 
ATOM   877   C  CA    . ILE B 2 35  ? 131.371 105.015 105.675 1.00 36.45  ? 34   ILE B CA    1 
ATOM   878   C  C     . ILE B 2 35  ? 130.210 105.152 104.701 1.00 36.45  ? 34   ILE B C     1 
ATOM   879   O  O     . ILE B 2 35  ? 129.341 106.020 104.857 1.00 36.45  ? 34   ILE B O     1 
ATOM   880   C  CB    . ILE B 2 35  ? 132.637 105.741 105.187 1.00 36.45  ? 34   ILE B CB    1 
ATOM   881   C  CG1   . ILE B 2 35  ? 133.711 105.669 106.266 1.00 36.45  ? 34   ILE B CG1   1 
ATOM   882   C  CG2   . ILE B 2 35  ? 132.352 107.196 104.882 1.00 36.45  ? 34   ILE B CG2   1 
ATOM   883   C  CD1   . ILE B 2 35  ? 135.023 106.292 105.871 1.00 36.45  ? 34   ILE B CD1   1 
ATOM   884   N  N     . ARG B 2 36  ? 130.180 104.286 103.681 1.00 40.59  ? 35   ARG B N     1 
ATOM   885   C  CA    . ARG B 2 36  ? 129.065 104.259 102.741 1.00 40.59  ? 35   ARG B CA    1 
ATOM   886   C  C     . ARG B 2 36  ? 127.756 103.904 103.431 1.00 40.59  ? 35   ARG B C     1 
ATOM   887   O  O     . ARG B 2 36  ? 126.714 104.467 103.096 1.00 40.59  ? 35   ARG B O     1 
ATOM   888   C  CB    . ARG B 2 36  ? 129.342 103.225 101.654 1.00 40.59  ? 35   ARG B CB    1 
ATOM   889   C  CG    . ARG B 2 36  ? 130.296 103.652 100.573 1.00 40.59  ? 35   ARG B CG    1 
ATOM   890   C  CD    . ARG B 2 36  ? 130.365 102.580 99.510  1.00 40.59  ? 35   ARG B CD    1 
ATOM   891   N  NE    . ARG B 2 36  ? 129.255 102.656 98.575  1.00 40.59  ? 35   ARG B NE    1 
ATOM   892   C  CZ    . ARG B 2 36  ? 129.344 103.212 97.376  1.00 40.59  ? 35   ARG B CZ    1 
ATOM   893   N  NH1   . ARG B 2 36  ? 130.493 103.737 96.975  1.00 40.59  ? 35   ARG B NH1   1 
ATOM   894   N  NH2   . ARG B 2 36  ? 128.293 103.242 96.575  1.00 40.59  ? 35   ARG B NH2   1 
ATOM   895   N  N     . ARG B 2 37  ? 127.809 103.029 104.437 1.00 39.99  ? 36   ARG B N     1 
ATOM   896   C  CA    . ARG B 2 37  ? 126.624 102.673 105.213 1.00 39.99  ? 36   ARG B CA    1 
ATOM   897   C  C     . ARG B 2 37  ? 126.120 103.856 106.026 1.00 39.99  ? 36   ARG B C     1 
ATOM   898   O  O     . ARG B 2 37  ? 124.912 104.127 106.059 1.00 39.99  ? 36   ARG B O     1 
ATOM   899   C  CB    . ARG B 2 37  ? 126.936 101.488 106.127 1.00 39.99  ? 36   ARG B CB    1 
ATOM   900   C  CG    . ARG B 2 37  ? 126.872 100.137 105.449 1.00 39.99  ? 36   ARG B CG    1 
ATOM   901   C  CD    . ARG B 2 37  ? 126.819 99.023  106.477 1.00 39.99  ? 36   ARG B CD    1 
ATOM   902   N  NE    . ARG B 2 37  ? 128.049 98.934  107.251 1.00 39.99  ? 36   ARG B NE    1 
ATOM   903   C  CZ    . ARG B 2 37  ? 129.075 98.159  106.920 1.00 39.99  ? 36   ARG B CZ    1 
ATOM   904   N  NH1   . ARG B 2 37  ? 129.014 97.407  105.831 1.00 39.99  ? 36   ARG B NH1   1 
ATOM   905   N  NH2   . ARG B 2 37  ? 130.162 98.132  107.675 1.00 39.99  ? 36   ARG B NH2   1 
ATOM   906   N  N     . LEU B 2 38  ? 127.033 104.519 106.749 1.00 33.64  ? 37   LEU B N     1 
ATOM   907   C  CA    . LEU B 2 38  ? 126.701 105.745 107.477 1.00 33.64  ? 37   LEU B CA    1 
ATOM   908   C  C     . LEU B 2 38  ? 126.084 106.798 106.564 1.00 33.64  ? 37   LEU B C     1 
ATOM   909   O  O     . LEU B 2 38  ? 125.114 107.467 106.939 1.00 33.64  ? 37   LEU B O     1 
ATOM   910   C  CB    . LEU B 2 38  ? 127.948 106.299 108.158 1.00 33.64  ? 37   LEU B CB    1 
ATOM   911   C  CG    . LEU B 2 38  ? 128.529 105.407 109.248 1.00 33.64  ? 37   LEU B CG    1 
ATOM   912   C  CD1   . LEU B 2 38  ? 129.972 105.758 109.514 1.00 33.64  ? 37   LEU B CD1   1 
ATOM   913   C  CD2   . LEU B 2 38  ? 127.718 105.559 110.507 1.00 33.64  ? 37   LEU B CD2   1 
ATOM   914   N  N     . ALA B 2 39  ? 126.637 106.954 105.360 1.00 36.85  ? 38   ALA B N     1 
ATOM   915   C  CA    . ALA B 2 39  ? 126.088 107.901 104.395 1.00 36.85  ? 38   ALA B CA    1 
ATOM   916   C  C     . ALA B 2 39  ? 124.695 107.494 103.925 1.00 36.85  ? 38   ALA B C     1 
ATOM   917   O  O     . ALA B 2 39  ? 123.832 108.359 103.731 1.00 36.85  ? 38   ALA B O     1 
ATOM   918   C  CB    . ALA B 2 39  ? 127.036 108.047 103.211 1.00 36.85  ? 38   ALA B CB    1 
ATOM   919   N  N     . ARG B 2 40  ? 124.481 106.192 103.671 1.00 36.97  ? 39   ARG B N     1 
ATOM   920   C  CA    . ARG B 2 40  ? 123.153 105.697 103.301 1.00 36.97  ? 39   ARG B CA    1 
ATOM   921   C  C     . ARG B 2 40  ? 122.140 105.991 104.392 1.00 36.97  ? 39   ARG B C     1 
ATOM   922   O  O     . ARG B 2 40  ? 120.990 106.343 104.108 1.00 36.97  ? 39   ARG B O     1 
ATOM   923   C  CB    . ARG B 2 40  ? 123.169 104.194 103.030 1.00 36.97  ? 39   ARG B CB    1 
ATOM   924   C  CG    . ARG B 2 40  ? 123.899 103.755 101.791 1.00 36.97  ? 39   ARG B CG    1 
ATOM   925   C  CD    . ARG B 2 40  ? 123.244 104.216 100.523 1.00 36.97  ? 39   ARG B CD    1 
ATOM   926   N  NE    . ARG B 2 40  ? 123.932 103.629 99.384  1.00 36.97  ? 39   ARG B NE    1 
ATOM   927   C  CZ    . ARG B 2 40  ? 124.920 104.223 98.732  1.00 36.97  ? 39   ARG B CZ    1 
ATOM   928   N  NH1   . ARG B 2 40  ? 125.337 105.419 99.112  1.00 36.97  ? 39   ARG B NH1   1 
ATOM   929   N  NH2   . ARG B 2 40  ? 125.493 103.617 97.709  1.00 36.97  ? 39   ARG B NH2   1 
ATOM   930   N  N     . ARG B 2 41  ? 122.547 105.821 105.650 1.00 34.79  ? 40   ARG B N     1 
ATOM   931   C  CA    . ARG B 2 41  ? 121.676 106.170 106.762 1.00 34.79  ? 40   ARG B CA    1 
ATOM   932   C  C     . ARG B 2 41  ? 121.455 107.676 106.833 1.00 34.79  ? 40   ARG B C     1 
ATOM   933   O  O     . ARG B 2 41  ? 120.370 108.130 107.212 1.00 34.79  ? 40   ARG B O     1 
ATOM   934   C  CB    . ARG B 2 41  ? 122.277 105.624 108.061 1.00 34.79  ? 40   ARG B CB    1 
ATOM   935   C  CG    . ARG B 2 41  ? 121.572 106.045 109.324 1.00 34.79  ? 40   ARG B CG    1 
ATOM   936   C  CD    . ARG B 2 41  ? 122.033 105.293 110.547 1.00 34.79  ? 40   ARG B CD    1 
ATOM   937   N  NE    . ARG B 2 41  ? 121.554 103.918 110.541 1.00 34.79  ? 40   ARG B NE    1 
ATOM   938   C  CZ    . ARG B 2 41  ? 121.893 103.013 111.448 1.00 34.79  ? 40   ARG B CZ    1 
ATOM   939   N  NH1   . ARG B 2 41  ? 122.719 103.341 112.429 1.00 34.79  ? 40   ARG B NH1   1 
ATOM   940   N  NH2   . ARG B 2 41  ? 121.406 101.784 111.377 1.00 34.79  ? 40   ARG B NH2   1 
ATOM   941   N  N     . GLY B 2 42  ? 122.425 108.459 106.374 1.00 34.28  ? 41   GLY B N     1 
ATOM   942   C  CA    . GLY B 2 42  ? 122.262 109.897 106.350 1.00 34.28  ? 41   GLY B CA    1 
ATOM   943   C  C     . GLY B 2 42  ? 121.465 110.439 105.185 1.00 34.28  ? 41   GLY B C     1 
ATOM   944   O  O     . GLY B 2 42  ? 121.167 111.636 105.167 1.00 34.28  ? 41   GLY B O     1 
ATOM   945   N  N     . GLY B 2 43  ? 121.123 109.600 104.215 1.00 34.49  ? 42   GLY B N     1 
ATOM   946   C  CA    . GLY B 2 43  ? 120.349 110.021 103.065 1.00 34.49  ? 42   GLY B CA    1 
ATOM   947   C  C     . GLY B 2 43  ? 121.155 110.318 101.822 1.00 34.49  ? 42   GLY B C     1 
ATOM   948   O  O     . GLY B 2 43  ? 120.587 110.807 100.841 1.00 34.49  ? 42   GLY B O     1 
ATOM   949   N  N     . VAL B 2 44  ? 122.448 110.039 101.833 1.00 35.13  ? 43   VAL B N     1 
ATOM   950   C  CA    . VAL B 2 44  ? 123.316 110.283 100.690 1.00 35.13  ? 43   VAL B CA    1 
ATOM   951   C  C     . VAL B 2 44  ? 123.071 109.203 99.646  1.00 35.13  ? 43   VAL B C     1 
ATOM   952   O  O     . VAL B 2 44  ? 122.912 108.025 99.984  1.00 35.13  ? 43   VAL B O     1 
ATOM   953   C  CB    . VAL B 2 44  ? 124.784 110.309 101.152 1.00 35.13  ? 43   VAL B CB    1 
ATOM   954   C  CG1   . VAL B 2 44  ? 125.736 110.532 99.996  1.00 35.13  ? 43   VAL B CG1   1 
ATOM   955   C  CG2   . VAL B 2 44  ? 124.977 111.372 102.209 1.00 35.13  ? 43   VAL B CG2   1 
ATOM   956   N  N     . LYS B 2 45  ? 123.028 109.591 98.373  1.00 38.29  ? 44   LYS B N     1 
ATOM   957   C  CA    . LYS B 2 45  ? 122.760 108.645 97.298  1.00 38.29  ? 44   LYS B CA    1 
ATOM   958   C  C     . LYS B 2 45  ? 123.999 108.314 96.480  1.00 38.29  ? 44   LYS B C     1 
ATOM   959   O  O     . LYS B 2 45  ? 124.187 107.158 96.099  1.00 38.29  ? 44   LYS B O     1 
ATOM   960   C  CB    . LYS B 2 45  ? 121.656 109.194 96.385  1.00 38.29  ? 44   LYS B CB    1 
ATOM   961   C  CG    . LYS B 2 45  ? 121.312 108.324 95.189  1.00 38.29  ? 44   LYS B CG    1 
ATOM   962   C  CD    . LYS B 2 45  ? 120.235 108.965 94.341  1.00 38.29  ? 44   LYS B CD    1 
ATOM   963   C  CE    . LYS B 2 45  ? 119.935 108.142 93.105  1.00 38.29  ? 44   LYS B CE    1 
ATOM   964   N  NZ    . LYS B 2 45  ? 118.827 108.746 92.319  1.00 38.29  ? 44   LYS B NZ    1 
ATOM   965   N  N     . ARG B 2 46  ? 124.879 109.280 96.236  1.00 38.65  ? 45   ARG B N     1 
ATOM   966   C  CA    . ARG B 2 46  ? 126.120 109.038 95.513  1.00 38.65  ? 45   ARG B CA    1 
ATOM   967   C  C     . ARG B 2 46  ? 127.272 109.683 96.267  1.00 38.65  ? 45   ARG B C     1 
ATOM   968   O  O     . ARG B 2 46  ? 127.124 110.769 96.827  1.00 38.65  ? 45   ARG B O     1 
ATOM   969   C  CB    . ARG B 2 46  ? 126.081 109.556 94.077  1.00 38.65  ? 45   ARG B CB    1 
ATOM   970   C  CG    . ARG B 2 46  ? 125.508 108.569 93.079  1.00 38.65  ? 45   ARG B CG    1 
ATOM   971   C  CD    . ARG B 2 46  ? 125.410 109.184 91.700  1.00 38.65  ? 45   ARG B CD    1 
ATOM   972   N  NE    . ARG B 2 46  ? 126.619 108.895 90.935  1.00 38.65  ? 45   ARG B NE    1 
ATOM   973   C  CZ    . ARG B 2 46  ? 127.415 109.818 90.407  1.00 38.65  ? 45   ARG B CZ    1 
ATOM   974   N  NH1   . ARG B 2 46  ? 127.134 111.103 90.556  1.00 38.65  ? 45   ARG B NH1   1 
ATOM   975   N  NH2   . ARG B 2 46  ? 128.494 109.455 89.732  1.00 38.65  ? 45   ARG B NH2   1 
ATOM   976   N  N     . ILE B 2 47  ? 128.420 109.009 96.283  1.00 38.03  ? 46   ILE B N     1 
ATOM   977   C  CA    . ILE B 2 47  ? 129.544 109.381 97.134  1.00 38.03  ? 46   ILE B CA    1 
ATOM   978   C  C     . ILE B 2 47  ? 130.794 109.550 96.282  1.00 38.03  ? 46   ILE B C     1 
ATOM   979   O  O     . ILE B 2 47  ? 131.201 108.617 95.583  1.00 38.03  ? 46   ILE B O     1 
ATOM   980   C  CB    . ILE B 2 47  ? 129.796 108.324 98.221  1.00 38.03  ? 46   ILE B CB    1 
ATOM   981   C  CG1   . ILE B 2 47  ? 128.557 108.110 99.082  1.00 38.03  ? 46   ILE B CG1   1 
ATOM   982   C  CG2   . ILE B 2 47  ? 130.971 108.700 99.071  1.00 38.03  ? 46   ILE B CG2   1 
ATOM   983   C  CD1   . ILE B 2 47  ? 128.743 107.034 100.107 1.00 38.03  ? 46   ILE B CD1   1 
ATOM   984   N  N     . SER B 2 48  ? 131.404 110.730 96.348  1.00 36.76  ? 47   SER B N     1 
ATOM   985   C  CA    . SER B 2 48  ? 132.686 110.968 95.695  1.00 36.76  ? 47   SER B CA    1 
ATOM   986   C  C     . SER B 2 48  ? 133.793 110.199 96.405  1.00 36.76  ? 47   SER B C     1 
ATOM   987   O  O     . SER B 2 48  ? 133.709 109.941 97.605  1.00 36.76  ? 47   SER B O     1 
ATOM   988   C  CB    . SER B 2 48  ? 133.018 112.454 95.681  1.00 36.76  ? 47   SER B CB    1 
ATOM   989   O  OG    . SER B 2 48  ? 134.366 112.658 95.305  1.00 36.76  ? 47   SER B OG    1 
ATOM   990   N  N     . GLY B 2 49  ? 134.805 109.781 95.638  1.00 37.99  ? 48   GLY B N     1 
ATOM   991   C  CA    . GLY B 2 49  ? 135.903 108.997 96.195  1.00 37.99  ? 48   GLY B CA    1 
ATOM   992   C  C     . GLY B 2 49  ? 136.697 109.681 97.296  1.00 37.99  ? 48   GLY B C     1 
ATOM   993   O  O     . GLY B 2 49  ? 137.294 109.010 98.139  1.00 37.99  ? 48   GLY B O     1 
ATOM   994   N  N     . LEU B 2 50  ? 136.743 111.012 97.293  1.00 34.90  ? 49   LEU B N     1 
ATOM   995   C  CA    . LEU B 2 50  ? 137.487 111.750 98.309  1.00 34.90  ? 49   LEU B CA    1 
ATOM   996   C  C     . LEU B 2 50  ? 136.733 111.877 99.633  1.00 34.90  ? 49   LEU B C     1 
ATOM   997   O  O     . LEU B 2 50  ? 137.338 112.271 100.648 1.00 34.90  ? 49   LEU B O     1 
ATOM   998   C  CB    . LEU B 2 50  ? 137.855 113.126 97.765  1.00 34.90  ? 49   LEU B CB    1 
ATOM   999   C  CG    . LEU B 2 50  ? 138.603 113.120 96.433  1.00 34.90  ? 49   LEU B CG    1 
ATOM   1000  C  CD1   . LEU B 2 50  ? 138.688 114.521 95.851  1.00 34.90  ? 49   LEU B CD1   1 
ATOM   1001  C  CD2   . LEU B 2 50  ? 139.990 112.524 96.606  1.00 34.90  ? 49   LEU B CD2   1 
ATOM   1002  N  N     . ILE B 2 51  ? 135.429 111.571 99.629  1.00 31.68  ? 50   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2 51  ? 134.588 111.703 100.819 1.00 31.68  ? 50   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2 51  ? 135.094 110.797 101.932 1.00 31.68  ? 50   ILE B C     1 
ATOM   1005  O  O     . ILE B 2 51  ? 135.051 111.163 103.110 1.00 31.68  ? 50   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2 51  ? 133.120 111.410 100.451 1.00 31.68  ? 50   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2 51  ? 132.519 112.598 99.710  1.00 31.68  ? 50   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2 51  ? 132.247 111.077 101.660 1.00 31.68  ? 50   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2 51  ? 132.320 113.792 100.568 1.00 31.68  ? 50   ILE B CD1   1 
ATOM   1010  N  N     . TYR B 2 52  ? 135.615 109.620 101.570 1.00 34.52  ? 51   TYR B N     1 
ATOM   1011  C  CA    . TYR B 2 52  ? 136.057 108.643 102.563 1.00 34.52  ? 51   TYR B CA    1 
ATOM   1012  C  C     . TYR B 2 52  ? 137.242 109.161 103.374 1.00 34.52  ? 51   TYR B C     1 
ATOM   1013  O  O     . TYR B 2 52  ? 137.236 109.092 104.610 1.00 34.52  ? 51   TYR B O     1 
ATOM   1014  C  CB    . TYR B 2 52  ? 136.396 107.322 101.877 1.00 34.52  ? 51   TYR B CB    1 
ATOM   1015  C  CG    . TYR B 2 52  ? 135.289 106.845 100.970 1.00 34.52  ? 51   TYR B CG    1 
ATOM   1016  C  CD1   . TYR B 2 52  ? 134.079 106.417 101.491 1.00 34.52  ? 51   TYR B CD1   1 
ATOM   1017  C  CD2   . TYR B 2 52  ? 135.460 106.808 99.593  1.00 34.52  ? 51   TYR B CD2   1 
ATOM   1018  C  CE1   . TYR B 2 52  ? 133.062 105.985 100.666 1.00 34.52  ? 51   TYR B CE1   1 
ATOM   1019  C  CE2   . TYR B 2 52  ? 134.450 106.371 98.759  1.00 34.52  ? 51   TYR B CE2   1 
ATOM   1020  C  CZ    . TYR B 2 52  ? 133.255 105.960 99.303  1.00 34.52  ? 51   TYR B CZ    1 
ATOM   1021  O  OH    . TYR B 2 52  ? 132.245 105.524 98.481  1.00 34.52  ? 51   TYR B OH    1 
ATOM   1022  N  N     . GLU B 2 53  ? 138.260 109.705 102.697 1.00 32.36  ? 52   GLU B N     1 
ATOM   1023  C  CA    . GLU B 2 53  ? 139.389 110.288 103.419 1.00 32.36  ? 52   GLU B CA    1 
ATOM   1024  C  C     . GLU B 2 53  ? 138.975 111.538 104.199 1.00 32.36  ? 52   GLU B C     1 
ATOM   1025  O  O     . GLU B 2 53  ? 139.459 111.757 105.322 1.00 32.36  ? 52   GLU B O     1 
ATOM   1026  C  CB    . GLU B 2 53  ? 140.564 110.558 102.466 1.00 32.36  ? 52   GLU B CB    1 
ATOM   1027  C  CG    . GLU B 2 53  ? 140.429 111.713 101.491 1.00 32.36  ? 52   GLU B CG    1 
ATOM   1028  C  CD    . GLU B 2 53  ? 141.716 112.018 100.759 1.00 32.36  ? 52   GLU B CD    1 
ATOM   1029  O  OE1   . GLU B 2 53  ? 142.682 111.245 100.912 1.00 32.36  ? 52   GLU B OE1   1 
ATOM   1030  O  OE2   . GLU B 2 53  ? 141.763 113.033 100.034 1.00 32.36  ? 52   GLU B OE2   1 
ATOM   1031  N  N     . GLU B 2 54  ? 138.066 112.356 103.639 1.00 31.91  ? 53   GLU B N     1 
ATOM   1032  C  CA    . GLU B 2 54  ? 137.599 113.534 104.372 1.00 31.91  ? 53   GLU B CA    1 
ATOM   1033  C  C     . GLU B 2 54  ? 136.837 113.150 105.637 1.00 31.91  ? 53   GLU B C     1 
ATOM   1034  O  O     . GLU B 2 54  ? 137.009 113.774 106.692 1.00 31.91  ? 53   GLU B O     1 
ATOM   1035  C  CB    . GLU B 2 54  ? 136.727 114.411 103.476 1.00 31.91  ? 53   GLU B CB    1 
ATOM   1036  C  CG    . GLU B 2 54  ? 136.394 115.775 104.074 1.00 31.91  ? 53   GLU B CG    1 
ATOM   1037  C  CD    . GLU B 2 54  ? 137.581 116.725 104.164 1.00 31.91  ? 53   GLU B CD    1 
ATOM   1038  O  OE1   . GLU B 2 54  ? 138.617 116.488 103.506 1.00 31.91  ? 53   GLU B OE1   1 
ATOM   1039  O  OE2   . GLU B 2 54  ? 137.477 117.721 104.911 1.00 31.91  ? 53   GLU B OE2   1 
ATOM   1040  N  N     . THR B 2 55  ? 136.023 112.098 105.556 1.00 28.39  ? 54   THR B N     1 
ATOM   1041  C  CA    . THR B 2 55  ? 135.237 111.646 106.695 1.00 28.39  ? 54   THR B CA    1 
ATOM   1042  C  C     . THR B 2 55  ? 136.130 111.031 107.762 1.00 28.39  ? 54   THR B C     1 
ATOM   1043  O  O     . THR B 2 55  ? 135.902 111.248 108.957 1.00 28.39  ? 54   THR B O     1 
ATOM   1044  C  CB    . THR B 2 55  ? 134.168 110.663 106.220 1.00 28.39  ? 54   THR B CB    1 
ATOM   1045  O  OG1   . THR B 2 55  ? 133.341 111.314 105.252 1.00 28.39  ? 54   THR B OG1   1 
ATOM   1046  C  CG2   . THR B 2 55  ? 133.282 110.219 107.360 1.00 28.39  ? 54   THR B CG2   1 
ATOM   1047  N  N     . ARG B 2 56  ? 137.134 110.242 107.351 1.00 29.18  ? 55   ARG B N     1 
ATOM   1048  C  CA    . ARG B 2 56  ? 138.110 109.719 108.308 1.00 29.18  ? 55   ARG B CA    1 
ATOM   1049  C  C     . ARG B 2 56  ? 138.852 110.839 109.035 1.00 29.18  ? 55   ARG B C     1 
ATOM   1050  O  O     . ARG B 2 56  ? 139.068 110.753 110.250 1.00 29.18  ? 55   ARG B O     1 
ATOM   1051  C  CB    . ARG B 2 56  ? 139.092 108.782 107.613 1.00 29.18  ? 55   ARG B CB    1 
ATOM   1052  C  CG    . ARG B 2 56  ? 138.466 107.487 107.139 1.00 29.18  ? 55   ARG B CG    1 
ATOM   1053  C  CD    . ARG B 2 56  ? 139.516 106.531 106.616 1.00 29.18  ? 55   ARG B CD    1 
ATOM   1054  N  NE    . ARG B 2 56  ? 138.922 105.313 106.079 1.00 29.18  ? 55   ARG B NE    1 
ATOM   1055  C  CZ    . ARG B 2 56  ? 138.639 105.120 104.797 1.00 29.18  ? 55   ARG B CZ    1 
ATOM   1056  N  NH1   . ARG B 2 56  ? 138.888 106.074 103.912 1.00 29.18  ? 55   ARG B NH1   1 
ATOM   1057  N  NH2   . ARG B 2 56  ? 138.104 103.974 104.401 1.00 29.18  ? 55   ARG B NH2   1 
ATOM   1058  N  N     . GLY B 2 57  ? 139.217 111.910 108.323 1.00 25.72  ? 56   GLY B N     1 
ATOM   1059  C  CA    . GLY B 2 57  ? 139.871 113.032 108.988 1.00 25.72  ? 56   GLY B CA    1 
ATOM   1060  C  C     . GLY B 2 57  ? 138.965 113.769 109.965 1.00 25.72  ? 56   GLY B C     1 
ATOM   1061  O  O     . GLY B 2 57  ? 139.382 114.107 111.084 1.00 25.72  ? 56   GLY B O     1 
ATOM   1062  N  N     . VAL B 2 58  ? 137.714 114.017 109.556 1.00 25.60  ? 57   VAL B N     1 
ATOM   1063  C  CA    . VAL B 2 58  ? 136.729 114.673 110.418 1.00 25.60  ? 57   VAL B CA    1 
ATOM   1064  C  C     . VAL B 2 58  ? 136.461 113.846 111.671 1.00 25.60  ? 57   VAL B C     1 
ATOM   1065  O  O     . VAL B 2 58  ? 136.410 114.378 112.792 1.00 25.60  ? 57   VAL B O     1 
ATOM   1066  C  CB    . VAL B 2 58  ? 135.439 114.935 109.618 1.00 25.60  ? 57   VAL B CB    1 
ATOM   1067  C  CG1   . VAL B 2 58  ? 134.271 115.261 110.527 1.00 25.60  ? 57   VAL B CG1   1 
ATOM   1068  C  CG2   . VAL B 2 58  ? 135.669 116.067 108.643 1.00 25.60  ? 57   VAL B CG2   1 
ATOM   1069  N  N     . LEU B 2 59  ? 136.299 112.533 111.499 1.00 22.85  ? 58   LEU B N     1 
ATOM   1070  C  CA    . LEU B 2 59  ? 136.065 111.644 112.628 1.00 22.85  ? 58   LEU B CA    1 
ATOM   1071  C  C     . LEU B 2 59  ? 137.263 111.587 113.560 1.00 22.85  ? 58   LEU B C     1 
ATOM   1072  O  O     . LEU B 2 59  ? 137.089 111.465 114.777 1.00 22.85  ? 58   LEU B O     1 
ATOM   1073  C  CB    . LEU B 2 59  ? 135.704 110.250 112.142 1.00 22.85  ? 58   LEU B CB    1 
ATOM   1074  C  CG    . LEU B 2 59  ? 134.878 109.542 113.201 1.00 22.85  ? 58   LEU B CG    1 
ATOM   1075  C  CD1   . LEU B 2 59  ? 133.653 110.377 113.507 1.00 22.85  ? 58   LEU B CD1   1 
ATOM   1076  C  CD2   . LEU B 2 59  ? 134.493 108.177 112.721 1.00 22.85  ? 58   LEU B CD2   1 
ATOM   1077  N  N     . LYS B 2 60  ? 138.480 111.592 113.003 1.00 24.07  ? 59   LYS B N     1 
ATOM   1078  C  CA    . LYS B 2 60  ? 139.684 111.656 113.824 1.00 24.07  ? 59   LYS B CA    1 
ATOM   1079  C  C     . LYS B 2 60  ? 139.682 112.892 114.712 1.00 24.07  ? 59   LYS B C     1 
ATOM   1080  O  O     . LYS B 2 60  ? 139.977 112.799 115.906 1.00 24.07  ? 59   LYS B O     1 
ATOM   1081  C  CB    . LYS B 2 60  ? 140.933 111.649 112.951 1.00 24.07  ? 59   LYS B CB    1 
ATOM   1082  C  CG    . LYS B 2 60  ? 142.206 111.386 113.734 1.00 24.07  ? 59   LYS B CG    1 
ATOM   1083  C  CD    . LYS B 2 60  ? 143.431 111.462 112.842 1.00 24.07  ? 59   LYS B CD    1 
ATOM   1084  C  CE    . LYS B 2 60  ? 143.716 112.894 112.430 1.00 24.07  ? 59   LYS B CE    1 
ATOM   1085  N  NZ    . LYS B 2 60  ? 144.967 113.002 111.635 1.00 24.07  ? 59   LYS B NZ    1 
ATOM   1086  N  N     . VAL B 2 61  ? 139.371 114.060 114.132 1.00 23.95  ? 60   VAL B N     1 
ATOM   1087  C  CA    . VAL B 2 61  ? 139.278 115.305 114.907 1.00 23.95  ? 60   VAL B CA    1 
ATOM   1088  C  C     . VAL B 2 61  ? 138.236 115.200 116.024 1.00 23.95  ? 60   VAL B C     1 
ATOM   1089  O  O     . VAL B 2 61  ? 138.520 115.506 117.196 1.00 23.95  ? 60   VAL B O     1 
ATOM   1090  C  CB    . VAL B 2 61  ? 138.977 116.491 113.973 1.00 23.95  ? 60   VAL B CB    1 
ATOM   1091  C  CG1   . VAL B 2 61  ? 138.648 117.735 114.775 1.00 23.95  ? 60   VAL B CG1   1 
ATOM   1092  C  CG2   . VAL B 2 61  ? 140.162 116.753 113.067 1.00 23.95  ? 60   VAL B CG2   1 
ATOM   1093  N  N     . PHE B 2 62  ? 137.011 114.790 115.661 1.00 22.23  ? 61   PHE B N     1 
ATOM   1094  C  CA    . PHE B 2 62  ? 135.901 114.650 116.611 1.00 22.23  ? 61   PHE B CA    1 
ATOM   1095  C  C     . PHE B 2 62  ? 136.234 113.710 117.769 1.00 22.23  ? 61   PHE B C     1 
ATOM   1096  O  O     . PHE B 2 62  ? 136.080 114.068 118.947 1.00 22.23  ? 61   PHE B O     1 
ATOM   1097  C  CB    . PHE B 2 62  ? 134.663 114.169 115.846 1.00 22.23  ? 61   PHE B CB    1 
ATOM   1098  C  CG    . PHE B 2 62  ? 133.458 113.900 116.706 1.00 22.23  ? 61   PHE B CG    1 
ATOM   1099  C  CD1   . PHE B 2 62  ? 132.579 114.918 117.017 1.00 22.23  ? 61   PHE B CD1   1 
ATOM   1100  C  CD2   . PHE B 2 62  ? 133.156 112.613 117.127 1.00 22.23  ? 61   PHE B CD2   1 
ATOM   1101  C  CE1   . PHE B 2 62  ? 131.458 114.672 117.786 1.00 22.23  ? 61   PHE B CE1   1 
ATOM   1102  C  CE2   . PHE B 2 62  ? 132.041 112.362 117.892 1.00 22.23  ? 61   PHE B CE2   1 
ATOM   1103  C  CZ    . PHE B 2 62  ? 131.190 113.392 118.220 1.00 22.23  ? 61   PHE B CZ    1 
ATOM   1104  N  N     . LEU B 2 63  ? 136.686 112.496 117.442 1.00 25.16  ? 62   LEU B N     1 
ATOM   1105  C  CA    . LEU B 2 63  ? 137.041 111.517 118.460 1.00 25.16  ? 62   LEU B CA    1 
ATOM   1106  C  C     . LEU B 2 63  ? 138.223 111.976 119.296 1.00 25.16  ? 62   LEU B C     1 
ATOM   1107  O  O     . LEU B 2 63  ? 138.284 111.663 120.485 1.00 25.16  ? 62   LEU B O     1 
ATOM   1108  C  CB    . LEU B 2 63  ? 137.323 110.163 117.823 1.00 25.16  ? 62   LEU B CB    1 
ATOM   1109  C  CG    . LEU B 2 63  ? 136.038 109.404 117.520 1.00 25.16  ? 62   LEU B CG    1 
ATOM   1110  C  CD1   . LEU B 2 63  ? 136.334 108.146 116.746 1.00 25.16  ? 62   LEU B CD1   1 
ATOM   1111  C  CD2   . LEU B 2 63  ? 135.306 109.088 118.803 1.00 25.16  ? 62   LEU B CD2   1 
ATOM   1112  N  N     . GLU B 2 64  ? 139.202 112.652 118.680 1.00 27.88  ? 63   GLU B N     1 
ATOM   1113  C  CA    . GLU B 2 64  ? 140.327 113.212 119.423 1.00 27.88  ? 63   GLU B CA    1 
ATOM   1114  C  C     . GLU B 2 64  ? 139.854 114.165 120.513 1.00 27.88  ? 63   GLU B C     1 
ATOM   1115  O  O     . GLU B 2 64  ? 140.284 114.058 121.667 1.00 27.88  ? 63   GLU B O     1 
ATOM   1116  C  CB    . GLU B 2 64  ? 141.287 113.910 118.465 1.00 27.88  ? 63   GLU B CB    1 
ATOM   1117  C  CG    . GLU B 2 64  ? 142.712 113.971 118.969 1.00 27.88  ? 63   GLU B CG    1 
ATOM   1118  C  CD    . GLU B 2 64  ? 143.678 114.477 117.917 1.00 27.88  ? 63   GLU B CD    1 
ATOM   1119  O  OE1   . GLU B 2 64  ? 143.237 114.736 116.778 1.00 27.88  ? 63   GLU B OE1   1 
ATOM   1120  O  OE2   . GLU B 2 64  ? 144.880 114.610 118.226 1.00 27.88  ? 63   GLU B OE2   1 
ATOM   1121  N  N     . ASN B 2 65  ? 138.939 115.082 120.167 1.00 26.97  ? 64   ASN B N     1 
ATOM   1122  C  CA    . ASN B 2 65  ? 138.397 116.016 121.161 1.00 26.97  ? 64   ASN B CA    1 
ATOM   1123  C  C     . ASN B 2 65  ? 137.629 115.296 122.271 1.00 26.97  ? 64   ASN B C     1 
ATOM   1124  O  O     . ASN B 2 65  ? 137.832 115.576 123.465 1.00 26.97  ? 64   ASN B O     1 
ATOM   1125  C  CB    . ASN B 2 65  ? 137.501 117.055 120.490 1.00 26.97  ? 64   ASN B CB    1 
ATOM   1126  C  CG    . ASN B 2 65  ? 138.262 117.959 119.557 1.00 26.97  ? 64   ASN B CG    1 
ATOM   1127  O  OD1   . ASN B 2 65  ? 139.488 118.035 119.616 1.00 26.97  ? 64   ASN B OD1   1 
ATOM   1128  N  ND2   . ASN B 2 65  ? 137.540 118.670 118.701 1.00 26.97  ? 64   ASN B ND2   1 
ATOM   1129  N  N     . VAL B 2 66  ? 136.750 114.359 121.896 1.00 24.31  ? 65   VAL B N     1 
ATOM   1130  C  CA    . VAL B 2 66  ? 135.903 113.693 122.890 1.00 24.31  ? 65   VAL B CA    1 
ATOM   1131  C  C     . VAL B 2 66  ? 136.733 112.799 123.809 1.00 24.31  ? 65   VAL B C     1 
ATOM   1132  O  O     . VAL B 2 66  ? 136.550 112.812 125.032 1.00 24.31  ? 65   VAL B O     1 
ATOM   1133  C  CB    . VAL B 2 66  ? 134.770 112.916 122.200 1.00 24.31  ? 65   VAL B CB    1 
ATOM   1134  C  CG1   . VAL B 2 66  ? 133.926 112.187 123.215 1.00 24.31  ? 65   VAL B CG1   1 
ATOM   1135  C  CG2   . VAL B 2 66  ? 133.893 113.874 121.431 1.00 24.31  ? 65   VAL B CG2   1 
ATOM   1136  N  N     . ILE B 2 67  ? 137.643 112.003 123.240 1.00 25.59  ? 66   ILE B N     1 
ATOM   1137  C  CA    . ILE B 2 67  ? 138.529 111.161 124.041 1.00 25.59  ? 66   ILE B CA    1 
ATOM   1138  C  C     . ILE B 2 67  ? 139.452 112.014 124.912 1.00 25.59  ? 66   ILE B C     1 
ATOM   1139  O  O     . ILE B 2 67  ? 139.767 111.629 126.042 1.00 25.59  ? 66   ILE B O     1 
ATOM   1140  C  CB    . ILE B 2 67  ? 139.288 110.173 123.130 1.00 25.59  ? 66   ILE B CB    1 
ATOM   1141  C  CG1   . ILE B 2 67  ? 138.298 109.163 122.549 1.00 25.59  ? 66   ILE B CG1   1 
ATOM   1142  C  CG2   . ILE B 2 67  ? 140.383 109.410 123.860 1.00 25.59  ? 66   ILE B CG2   1 
ATOM   1143  C  CD1   . ILE B 2 67  ? 138.926 108.115 121.658 1.00 25.59  ? 66   ILE B CD1   1 
ATOM   1144  N  N     . ARG B 2 68  ? 139.878 113.190 124.423 1.00 29.43  ? 67   ARG B N     1 
ATOM   1145  C  CA    . ARG B 2 68  ? 140.674 114.104 125.248 1.00 29.43  ? 67   ARG B CA    1 
ATOM   1146  C  C     . ARG B 2 68  ? 139.909 114.545 126.493 1.00 29.43  ? 67   ARG B C     1 
ATOM   1147  O  O     . ARG B 2 68  ? 140.446 114.518 127.610 1.00 29.43  ? 67   ARG B O     1 
ATOM   1148  C  CB    . ARG B 2 68  ? 141.105 115.326 124.441 1.00 29.43  ? 67   ARG B CB    1 
ATOM   1149  C  CG    . ARG B 2 68  ? 142.080 116.213 125.204 1.00 29.43  ? 67   ARG B CG    1 
ATOM   1150  C  CD    . ARG B 2 68  ? 142.273 117.584 124.566 1.00 29.43  ? 67   ARG B CD    1 
ATOM   1151  N  NE    . ARG B 2 68  ? 142.756 117.524 123.190 1.00 29.43  ? 67   ARG B NE    1 
ATOM   1152  C  CZ    . ARG B 2 68  ? 142.029 117.855 122.128 1.00 29.43  ? 67   ARG B CZ    1 
ATOM   1153  N  NH1   . ARG B 2 68  ? 140.781 118.272 122.280 1.00 29.43  ? 67   ARG B NH1   1 
ATOM   1154  N  NH2   . ARG B 2 68  ? 142.554 117.773 120.914 1.00 29.43  ? 67   ARG B NH2   1 
ATOM   1155  N  N     . ASP B 2 69  ? 138.645 114.946 126.317 1.00 27.98  ? 68   ASP B N     1 
ATOM   1156  C  CA    . ASP B 2 69  ? 137.829 115.338 127.467 1.00 27.98  ? 68   ASP B CA    1 
ATOM   1157  C  C     . ASP B 2 69  ? 137.561 114.158 128.404 1.00 27.98  ? 68   ASP B C     1 
ATOM   1158  O  O     . ASP B 2 69  ? 137.570 114.319 129.635 1.00 27.98  ? 68   ASP B O     1 
ATOM   1159  C  CB    . ASP B 2 69  ? 136.513 115.942 126.984 1.00 27.98  ? 68   ASP B CB    1 
ATOM   1160  C  CG    . ASP B 2 69  ? 136.701 117.281 126.317 1.00 27.98  ? 68   ASP B CG    1 
ATOM   1161  O  OD1   . ASP B 2 69  ? 137.865 117.664 126.082 1.00 27.98  ? 68   ASP B OD1   1 
ATOM   1162  O  OD2   . ASP B 2 69  ? 135.687 117.946 126.019 1.00 27.98  ? 68   ASP B OD2   1 
ATOM   1163  N  N     . ALA B 2 70  ? 137.309 112.972 127.835 1.00 26.84  ? 69   ALA B N     1 
ATOM   1164  C  CA    . ALA B 2 70  ? 137.110 111.756 128.622 1.00 26.84  ? 69   ALA B CA    1 
ATOM   1165  C  C     . ALA B 2 70  ? 138.329 111.429 129.476 1.00 26.84  ? 69   ALA B C     1 
ATOM   1166  O  O     . ALA B 2 70  ? 138.199 111.113 130.662 1.00 26.84  ? 69   ALA B O     1 
ATOM   1167  C  CB    . ALA B 2 70  ? 136.771 110.585 127.705 1.00 26.84  ? 69   ALA B CB    1 
ATOM   1168  N  N     . VAL B 2 71  ? 139.517 111.447 128.867 1.00 26.33  ? 70   VAL B N     1 
ATOM   1169  C  CA    . VAL B 2 71  ? 140.760 111.183 129.584 1.00 26.33  ? 70   VAL B CA    1 
ATOM   1170  C  C     . VAL B 2 71  ? 141.013 112.248 130.646 1.00 26.33  ? 70   VAL B C     1 
ATOM   1171  O  O     . VAL B 2 71  ? 141.535 111.940 131.723 1.00 26.33  ? 70   VAL B O     1 
ATOM   1172  C  CB    . VAL B 2 71  ? 141.917 111.047 128.569 1.00 26.33  ? 70   VAL B CB    1 
ATOM   1173  C  CG1   . VAL B 2 71  ? 143.280 111.018 129.233 1.00 26.33  ? 70   VAL B CG1   1 
ATOM   1174  C  CG2   . VAL B 2 71  ? 141.751 109.761 127.799 1.00 26.33  ? 70   VAL B CG2   1 
ATOM   1175  N  N     . THR B 2 72  ? 140.617 113.500 130.387 1.00 25.59  ? 71   THR B N     1 
ATOM   1176  C  CA    . THR B 2 72  ? 140.748 114.540 131.409 1.00 25.59  ? 71   THR B CA    1 
ATOM   1177  C  C     . THR B 2 72  ? 139.867 114.248 132.625 1.00 25.59  ? 71   THR B C     1 
ATOM   1178  O  O     . THR B 2 72  ? 140.326 114.350 133.775 1.00 25.59  ? 71   THR B O     1 
ATOM   1179  C  CB    . THR B 2 72  ? 140.402 115.900 130.809 1.00 25.59  ? 71   THR B CB    1 
ATOM   1180  O  OG1   . THR B 2 72  ? 141.274 116.166 129.706 1.00 25.59  ? 71   THR B OG1   1 
ATOM   1181  C  CG2   . THR B 2 72  ? 140.588 116.989 131.833 1.00 25.59  ? 71   THR B CG2   1 
ATOM   1182  N  N     . TYR B 2 73  ? 138.624 113.809 132.382 1.00 25.07  ? 72   TYR B N     1 
ATOM   1183  C  CA    . TYR B 2 73  ? 137.741 113.398 133.476 1.00 25.07  ? 72   TYR B CA    1 
ATOM   1184  C  C     . TYR B 2 73  ? 138.286 112.185 134.220 1.00 25.07  ? 72   TYR B C     1 
ATOM   1185  O  O     . TYR B 2 73  ? 138.203 112.121 135.452 1.00 25.07  ? 72   TYR B O     1 
ATOM   1186  C  CB    . TYR B 2 73  ? 136.346 113.067 132.950 1.00 25.07  ? 72   TYR B CB    1 
ATOM   1187  C  CG    . TYR B 2 73  ? 135.437 114.236 132.689 1.00 25.07  ? 72   TYR B CG    1 
ATOM   1188  C  CD1   . TYR B 2 73  ? 135.415 115.319 133.537 1.00 25.07  ? 72   TYR B CD1   1 
ATOM   1189  C  CD2   . TYR B 2 73  ? 134.563 114.230 131.613 1.00 25.07  ? 72   TYR B CD2   1 
ATOM   1190  C  CE1   . TYR B 2 73  ? 134.568 116.383 133.312 1.00 25.07  ? 72   TYR B CE1   1 
ATOM   1191  C  CE2   . TYR B 2 73  ? 133.713 115.286 131.379 1.00 25.07  ? 72   TYR B CE2   1 
ATOM   1192  C  CZ    . TYR B 2 73  ? 133.720 116.361 132.232 1.00 25.07  ? 72   TYR B CZ    1 
ATOM   1193  O  OH    . TYR B 2 73  ? 132.876 117.421 132.009 1.00 25.07  ? 72   TYR B OH    1 
ATOM   1194  N  N     . THR B 2 74  ? 138.820 111.207 133.484 1.00 30.61  ? 73   THR B N     1 
ATOM   1195  C  CA    . THR B 2 74  ? 139.357 109.994 134.096 1.00 30.61  ? 73   THR B CA    1 
ATOM   1196  C  C     . THR B 2 74  ? 140.586 110.285 134.949 1.00 30.61  ? 73   THR B C     1 
ATOM   1197  O  O     . THR B 2 74  ? 140.727 109.739 136.049 1.00 30.61  ? 73   THR B O     1 
ATOM   1198  C  CB    . THR B 2 74  ? 139.678 108.971 133.015 1.00 30.61  ? 73   THR B CB    1 
ATOM   1199  O  OG1   . THR B 2 74  ? 138.516 108.773 132.204 1.00 30.61  ? 73   THR B OG1   1 
ATOM   1200  C  CG2   . THR B 2 74  ? 140.083 107.649 133.628 1.00 30.61  ? 73   THR B CG2   1 
ATOM   1201  N  N     . GLU B 2 75  ? 141.489 111.138 134.459 1.00 30.54  ? 74   GLU B N     1 
ATOM   1202  C  CA    . GLU B 2 75  ? 142.679 111.476 135.231 1.00 30.54  ? 74   GLU B CA    1 
ATOM   1203  C  C     . GLU B 2 75  ? 142.325 112.292 136.460 1.00 30.54  ? 74   GLU B C     1 
ATOM   1204  O  O     . GLU B 2 75  ? 143.014 112.193 137.481 1.00 30.54  ? 74   GLU B O     1 
ATOM   1205  C  CB    . GLU B 2 75  ? 143.689 112.245 134.382 1.00 30.54  ? 74   GLU B CB    1 
ATOM   1206  C  CG    . GLU B 2 75  ? 144.386 111.430 133.312 1.00 30.54  ? 74   GLU B CG    1 
ATOM   1207  C  CD    . GLU B 2 75  ? 145.305 112.278 132.452 1.00 30.54  ? 74   GLU B CD    1 
ATOM   1208  O  OE1   . GLU B 2 75  ? 145.015 113.480 132.275 1.00 30.54  ? 74   GLU B OE1   1 
ATOM   1209  O  OE2   . GLU B 2 75  ? 146.317 111.745 131.955 1.00 30.54  ? 74   GLU B OE2   1 
ATOM   1210  N  N     . HIS B 2 76  ? 141.281 113.121 136.379 1.00 27.93  ? 75   HIS B N     1 
ATOM   1211  C  CA    . HIS B 2 76  ? 140.863 113.833 137.580 1.00 27.93  ? 75   HIS B CA    1 
ATOM   1212  C  C     . HIS B 2 76  ? 140.259 112.906 138.626 1.00 27.93  ? 75   HIS B C     1 
ATOM   1213  O  O     . HIS B 2 76  ? 140.460 113.118 139.826 1.00 27.93  ? 75   HIS B O     1 
ATOM   1214  C  CB    . HIS B 2 76  ? 139.866 114.927 137.246 1.00 27.93  ? 75   HIS B CB    1 
ATOM   1215  C  CG    . HIS B 2 76  ? 139.345 115.625 138.456 1.00 27.93  ? 75   HIS B CG    1 
ATOM   1216  N  ND1   . HIS B 2 76  ? 140.049 116.620 139.093 1.00 27.93  ? 75   HIS B ND1   1 
ATOM   1217  C  CD2   . HIS B 2 76  ? 138.200 115.461 139.160 1.00 27.93  ? 75   HIS B CD2   1 
ATOM   1218  C  CE1   . HIS B 2 76  ? 139.363 117.039 140.139 1.00 27.93  ? 75   HIS B CE1   1 
ATOM   1219  N  NE2   . HIS B 2 76  ? 138.234 116.356 140.199 1.00 27.93  ? 75   HIS B NE2   1 
ATOM   1220  N  N     . ALA B 2 77  ? 139.549 111.865 138.202 1.00 31.97  ? 76   ALA B N     1 
ATOM   1221  C  CA    . ALA B 2 77  ? 138.882 110.965 139.135 1.00 31.97  ? 76   ALA B CA    1 
ATOM   1222  C  C     . ALA B 2 77  ? 139.817 109.954 139.781 1.00 31.97  ? 76   ALA B C     1 
ATOM   1223  O  O     . ALA B 2 77  ? 139.334 109.113 140.547 1.00 31.97  ? 76   ALA B O     1 
ATOM   1224  C  CB    . ALA B 2 77  ? 137.746 110.225 138.429 1.00 31.97  ? 76   ALA B CB    1 
ATOM   1225  N  N     . LYS B 2 78  ? 141.117 110.013 139.461 1.00 36.32  ? 77   LYS B N     1 
ATOM   1226  C  CA    . LYS B 2 78  ? 142.158 109.106 139.961 1.00 36.32  ? 77   LYS B CA    1 
ATOM   1227  C  C     . LYS B 2 78  ? 141.846 107.658 139.600 1.00 36.32  ? 77   LYS B C     1 
ATOM   1228  O  O     . LYS B 2 78  ? 142.078 106.736 140.384 1.00 36.32  ? 77   LYS B O     1 
ATOM   1229  C  CB    . LYS B 2 78  ? 142.365 109.266 141.470 1.00 36.32  ? 77   LYS B CB    1 
ATOM   1230  C  CG    . LYS B 2 78  ? 142.862 110.637 141.872 1.00 36.32  ? 77   LYS B CG    1 
ATOM   1231  C  CD    . LYS B 2 78  ? 142.851 110.805 143.379 1.00 36.32  ? 77   LYS B CD    1 
ATOM   1232  C  CE    . LYS B 2 78  ? 143.263 112.212 143.772 1.00 36.32  ? 77   LYS B CE    1 
ATOM   1233  N  NZ    . LYS B 2 78  ? 143.109 112.449 145.232 1.00 36.32  ? 77   LYS B NZ    1 
ATOM   1234  N  N     . ARG B 2 79  ? 141.313 107.461 138.402 1.00 40.74  ? 78   ARG B N     1 
ATOM   1235  C  CA    . ARG B 2 79  ? 141.019 106.146 137.864 1.00 40.74  ? 78   ARG B CA    1 
ATOM   1236  C  C     . ARG B 2 79  ? 141.890 105.907 136.643 1.00 40.74  ? 78   ARG B C     1 
ATOM   1237  O  O     . ARG B 2 79  ? 142.357 106.847 135.995 1.00 40.74  ? 78   ARG B O     1 
ATOM   1238  C  CB    . ARG B 2 79  ? 139.535 106.005 137.514 1.00 40.74  ? 78   ARG B CB    1 
ATOM   1239  C  CG    . ARG B 2 79  ? 138.680 105.764 138.737 1.00 40.74  ? 78   ARG B CG    1 
ATOM   1240  C  CD    . ARG B 2 79  ? 137.235 105.433 138.408 1.00 40.74  ? 78   ARG B CD    1 
ATOM   1241  N  NE    . ARG B 2 79  ? 136.387 106.612 138.280 1.00 40.74  ? 78   ARG B NE    1 
ATOM   1242  C  CZ    . ARG B 2 79  ? 136.040 107.160 137.124 1.00 40.74  ? 78   ARG B CZ    1 
ATOM   1243  N  NH1   . ARG B 2 79  ? 136.470 106.635 135.989 1.00 40.74  ? 78   ARG B NH1   1 
ATOM   1244  N  NH2   . ARG B 2 79  ? 135.259 108.229 137.107 1.00 40.74  ? 78   ARG B NH2   1 
ATOM   1245  N  N     . LYS B 2 80  ? 142.111 104.636 136.330 1.00 48.08  ? 79   LYS B N     1 
ATOM   1246  C  CA    . LYS B 2 80  ? 142.910 104.278 135.172 1.00 48.08  ? 79   LYS B CA    1 
ATOM   1247  C  C     . LYS B 2 80  ? 142.080 103.759 134.013 1.00 48.08  ? 79   LYS B C     1 
ATOM   1248  O  O     . LYS B 2 80  ? 142.644 103.444 132.962 1.00 48.08  ? 79   LYS B O     1 
ATOM   1249  C  CB    . LYS B 2 80  ? 143.974 103.250 135.562 1.00 48.08  ? 79   LYS B CB    1 
ATOM   1250  C  CG    . LYS B 2 80  ? 144.917 103.767 136.630 1.00 48.08  ? 79   LYS B CG    1 
ATOM   1251  C  CD    . LYS B 2 80  ? 146.048 102.804 136.907 1.00 48.08  ? 79   LYS B CD    1 
ATOM   1252  C  CE    . LYS B 2 80  ? 147.018 103.389 137.916 1.00 48.08  ? 79   LYS B CE    1 
ATOM   1253  N  NZ    . LYS B 2 80  ? 148.149 102.467 138.200 1.00 48.08  ? 79   LYS B NZ    1 
ATOM   1254  N  N     . THR B 2 81  ? 140.764 103.661 134.164 1.00 43.78  ? 80   THR B N     1 
ATOM   1255  C  CA    . THR B 2 81  ? 139.907 103.205 133.081 1.00 43.78  ? 80   THR B CA    1 
ATOM   1256  C  C     . THR B 2 81  ? 138.886 104.284 132.744 1.00 43.78  ? 80   THR B C     1 
ATOM   1257  O  O     . THR B 2 81  ? 138.249 104.856 133.635 1.00 43.78  ? 80   THR B O     1 
ATOM   1258  C  CB    . THR B 2 81  ? 139.238 101.854 133.382 1.00 43.78  ? 80   THR B CB    1 
ATOM   1259  O  OG1   . THR B 2 81  ? 138.450 101.451 132.255 1.00 43.78  ? 80   THR B OG1   1 
ATOM   1260  C  CG2   . THR B 2 81  ? 138.377 101.860 134.629 1.00 43.78  ? 80   THR B CG2   1 
ATOM   1261  N  N     . VAL B 2 82  ? 138.810 104.632 131.465 1.00 33.90  ? 81   VAL B N     1 
ATOM   1262  C  CA    . VAL B 2 82  ? 137.783 105.558 131.015 1.00 33.90  ? 81   VAL B CA    1 
ATOM   1263  C  C     . VAL B 2 82  ? 136.442 104.849 131.102 1.00 33.90  ? 81   VAL B C     1 
ATOM   1264  O  O     . VAL B 2 82  ? 136.189 103.879 130.380 1.00 33.90  ? 81   VAL B O     1 
ATOM   1265  C  CB    . VAL B 2 82  ? 138.067 106.039 129.590 1.00 33.90  ? 81   VAL B CB    1 
ATOM   1266  C  CG1   . VAL B 2 82  ? 137.011 107.022 129.148 1.00 33.90  ? 81   VAL B CG1   1 
ATOM   1267  C  CG2   . VAL B 2 82  ? 139.444 106.665 129.515 1.00 33.90  ? 81   VAL B CG2   1 
ATOM   1268  N  N     . THR B 2 83  ? 135.579 105.324 131.985 1.00 31.52  ? 82   THR B N     1 
ATOM   1269  C  CA    . THR B 2 83  ? 134.275 104.713 132.159 1.00 31.52  ? 82   THR B CA    1 
ATOM   1270  C  C     . THR B 2 83  ? 133.264 105.342 131.211 1.00 31.52  ? 82   THR B C     1 
ATOM   1271  O  O     . THR B 2 83  ? 133.545 106.329 130.530 1.00 31.52  ? 82   THR B O     1 
ATOM   1272  C  CB    . THR B 2 83  ? 133.797 104.849 133.600 1.00 31.52  ? 82   THR B CB    1 
ATOM   1273  O  OG1   . THR B 2 83  ? 132.620 104.054 133.782 1.00 31.52  ? 82   THR B OG1   1 
ATOM   1274  C  CG2   . THR B 2 83  ? 133.464 106.291 133.908 1.00 31.52  ? 82   THR B CG2   1 
ATOM   1275  N  N     . ALA B 2 84  ? 132.085 104.721 131.142 1.00 29.14  ? 83   ALA B N     1 
ATOM   1276  C  CA    . ALA B 2 84  ? 131.015 105.233 130.293 1.00 29.14  ? 83   ALA B CA    1 
ATOM   1277  C  C     . ALA B 2 84  ? 130.532 106.599 130.755 1.00 29.14  ? 83   ALA B C     1 
ATOM   1278  O  O     . ALA B 2 84  ? 130.155 107.435 129.924 1.00 29.14  ? 83   ALA B O     1 
ATOM   1279  C  CB    . ALA B 2 84  ? 129.852 104.247 130.264 1.00 29.14  ? 83   ALA B CB    1 
ATOM   1280  N  N     . MET B 2 85  ? 130.532 106.837 132.069 1.00 29.17  ? 84   MET B N     1 
ATOM   1281  C  CA    . MET B 2 85  ? 130.084 108.122 132.593 1.00 29.17  ? 84   MET B CA    1 
ATOM   1282  C  C     . MET B 2 85  ? 131.013 109.254 132.172 1.00 29.17  ? 84   MET B C     1 
ATOM   1283  O  O     . MET B 2 85  ? 130.547 110.360 131.882 1.00 29.17  ? 84   MET B O     1 
ATOM   1284  C  CB    . MET B 2 85  ? 129.956 108.053 134.112 1.00 29.17  ? 84   MET B CB    1 
ATOM   1285  C  CG    . MET B 2 85  ? 128.738 107.267 134.556 1.00 29.17  ? 84   MET B CG    1 
ATOM   1286  S  SD    . MET B 2 85  ? 127.239 107.866 133.754 1.00 29.17  ? 84   MET B SD    1 
ATOM   1287  C  CE    . MET B 2 85  ? 125.982 107.000 134.685 1.00 29.17  ? 84   MET B CE    1 
ATOM   1288  N  N     . ASP B 2 86  ? 132.329 109.000 132.150 1.00 29.23  ? 85   ASP B N     1 
ATOM   1289  C  CA    . ASP B 2 86  ? 133.285 109.996 131.665 1.00 29.23  ? 85   ASP B CA    1 
ATOM   1290  C  C     . ASP B 2 86  ? 133.013 110.377 130.216 1.00 29.23  ? 85   ASP B C     1 
ATOM   1291  O  O     . ASP B 2 86  ? 133.059 111.560 129.860 1.00 29.23  ? 85   ASP B O     1 
ATOM   1292  C  CB    . ASP B 2 86  ? 134.715 109.483 131.809 1.00 29.23  ? 85   ASP B CB    1 
ATOM   1293  C  CG    . ASP B 2 86  ? 135.154 109.389 133.244 1.00 29.23  ? 85   ASP B CG    1 
ATOM   1294  O  OD1   . ASP B 2 86  ? 134.482 109.990 134.105 1.00 29.23  ? 85   ASP B OD1   1 
ATOM   1295  O  OD2   . ASP B 2 86  ? 136.187 108.742 133.511 1.00 29.23  ? 85   ASP B OD2   1 
ATOM   1296  N  N     . VAL B 2 87  ? 132.665 109.396 129.383 1.00 28.30  ? 86   VAL B N     1 
ATOM   1297  C  CA    . VAL B 2 87  ? 132.382 109.671 127.981 1.00 28.30  ? 86   VAL B CA    1 
ATOM   1298  C  C     . VAL B 2 87  ? 131.077 110.442 127.842 1.00 28.30  ? 86   VAL B C     1 
ATOM   1299  O  O     . VAL B 2 87  ? 130.990 111.389 127.049 1.00 28.30  ? 86   VAL B O     1 
ATOM   1300  C  CB    . VAL B 2 87  ? 132.365 108.354 127.185 1.00 28.30  ? 86   VAL B CB    1 
ATOM   1301  C  CG1   . VAL B 2 87  ? 131.921 108.578 125.755 1.00 28.30  ? 86   VAL B CG1   1 
ATOM   1302  C  CG2   . VAL B 2 87  ? 133.740 107.727 127.203 1.00 28.30  ? 86   VAL B CG2   1 
ATOM   1303  N  N     . VAL B 2 88  ? 130.065 110.091 128.643 1.00 25.16  ? 87   VAL B N     1 
ATOM   1304  C  CA    . VAL B 2 88  ? 128.782 110.792 128.581 1.00 25.16  ? 87   VAL B CA    1 
ATOM   1305  C  C     . VAL B 2 88  ? 128.933 112.243 129.029 1.00 25.16  ? 87   VAL B C     1 
ATOM   1306  O  O     . VAL B 2 88  ? 128.426 113.160 128.378 1.00 25.16  ? 87   VAL B O     1 
ATOM   1307  C  CB    . VAL B 2 88  ? 127.714 110.048 129.399 1.00 25.16  ? 87   VAL B CB    1 
ATOM   1308  C  CG1   . VAL B 2 88  ? 126.430 110.857 129.479 1.00 25.16  ? 87   VAL B CG1   1 
ATOM   1309  C  CG2   . VAL B 2 88  ? 127.411 108.744 128.741 1.00 25.16  ? 87   VAL B CG2   1 
ATOM   1310  N  N     . TYR B 2 89  ? 129.616 112.469 130.155 1.00 29.86  ? 88   TYR B N     1 
ATOM   1311  C  CA    . TYR B 2 89  ? 129.855 113.832 130.632 1.00 29.86  ? 88   TYR B CA    1 
ATOM   1312  C  C     . TYR B 2 89  ? 130.716 114.636 129.656 1.00 29.86  ? 88   TYR B C     1 
ATOM   1313  O  O     . TYR B 2 89  ? 130.513 115.848 129.493 1.00 29.86  ? 88   TYR B O     1 
ATOM   1314  C  CB    . TYR B 2 89  ? 130.472 113.795 132.029 1.00 29.86  ? 88   TYR B CB    1 
ATOM   1315  C  CG    . TYR B 2 89  ? 129.533 113.194 133.052 1.00 29.86  ? 88   TYR B CG    1 
ATOM   1316  C  CD1   . TYR B 2 89  ? 128.160 113.377 132.944 1.00 29.86  ? 88   TYR B CD1   1 
ATOM   1317  C  CD2   . TYR B 2 89  ? 130.013 112.448 134.122 1.00 29.86  ? 88   TYR B CD2   1 
ATOM   1318  C  CE1   . TYR B 2 89  ? 127.293 112.829 133.861 1.00 29.86  ? 88   TYR B CE1   1 
ATOM   1319  C  CE2   . TYR B 2 89  ? 129.150 111.895 135.046 1.00 29.86  ? 88   TYR B CE2   1 
ATOM   1320  C  CZ    . TYR B 2 89  ? 127.792 112.092 134.909 1.00 29.86  ? 88   TYR B CZ    1 
ATOM   1321  O  OH    . TYR B 2 89  ? 126.922 111.550 135.825 1.00 29.86  ? 88   TYR B OH    1 
ATOM   1322  N  N     . ALA B 2 90  ? 131.678 113.978 128.997 1.00 25.19  ? 89   ALA B N     1 
ATOM   1323  C  CA    . ALA B 2 90  ? 132.493 114.645 127.985 1.00 25.19  ? 89   ALA B CA    1 
ATOM   1324  C  C     . ALA B 2 90  ? 131.636 115.097 126.810 1.00 25.19  ? 89   ALA B C     1 
ATOM   1325  O  O     . ALA B 2 90  ? 131.790 116.215 126.308 1.00 25.19  ? 89   ALA B O     1 
ATOM   1326  C  CB    . ALA B 2 90  ? 133.608 113.713 127.522 1.00 25.19  ? 89   ALA B CB    1 
ATOM   1327  N  N     . LEU B 2 91  ? 130.744 114.219 126.345 1.00 22.90  ? 90   LEU B N     1 
ATOM   1328  C  CA    . LEU B 2 91  ? 129.806 114.575 125.284 1.00 22.90  ? 90   LEU B CA    1 
ATOM   1329  C  C     . LEU B 2 91  ? 128.850 115.669 125.739 1.00 22.90  ? 90   LEU B C     1 
ATOM   1330  O  O     . LEU B 2 91  ? 128.404 116.491 124.930 1.00 22.90  ? 90   LEU B O     1 
ATOM   1331  C  CB    . LEU B 2 91  ? 129.027 113.344 124.849 1.00 22.90  ? 90   LEU B CB    1 
ATOM   1332  C  CG    . LEU B 2 91  ? 129.844 112.301 124.103 1.00 22.90  ? 90   LEU B CG    1 
ATOM   1333  C  CD1   . LEU B 2 91  ? 129.042 111.027 124.050 1.00 22.90  ? 90   LEU B CD1   1 
ATOM   1334  C  CD2   . LEU B 2 91  ? 130.209 112.781 122.724 1.00 22.90  ? 90   LEU B CD2   1 
ATOM   1335  N  N     . LYS B 2 92  ? 128.485 115.653 127.024 1.00 23.93  ? 91   LYS B N     1 
ATOM   1336  C  CA    . LYS B 2 92  ? 127.622 116.681 127.595 1.00 23.93  ? 91   LYS B CA    1 
ATOM   1337  C  C     . LYS B 2 92  ? 128.289 118.047 127.543 1.00 23.93  ? 91   LYS B C     1 
ATOM   1338  O  O     . LYS B 2 92  ? 127.619 119.062 127.318 1.00 23.93  ? 91   LYS B O     1 
ATOM   1339  C  CB    . LYS B 2 92  ? 127.262 116.312 129.035 1.00 23.93  ? 91   LYS B CB    1 
ATOM   1340  C  CG    . LYS B 2 92  ? 126.261 117.232 129.714 1.00 23.93  ? 91   LYS B CG    1 
ATOM   1341  C  CD    . LYS B 2 92  ? 124.921 117.221 129.012 1.00 23.93  ? 91   LYS B CD    1 
ATOM   1342  C  CE    . LYS B 2 92  ? 124.020 118.351 129.487 1.00 23.93  ? 91   LYS B CE    1 
ATOM   1343  N  NZ    . LYS B 2 92  ? 123.772 118.290 130.956 1.00 23.93  ? 91   LYS B NZ    1 
ATOM   1344  N  N     . ARG B 2 93  ? 129.605 118.093 127.787 1.00 23.48  ? 92   ARG B N     1 
ATOM   1345  C  CA    . ARG B 2 93  ? 130.349 119.351 127.698 1.00 23.48  ? 92   ARG B CA    1 
ATOM   1346  C  C     . ARG B 2 93  ? 130.305 119.964 126.292 1.00 23.48  ? 92   ARG B C     1 
ATOM   1347  O  O     . ARG B 2 93  ? 130.357 121.192 126.160 1.00 23.48  ? 92   ARG B O     1 
ATOM   1348  C  CB    . ARG B 2 93  ? 131.796 119.139 128.175 1.00 23.48  ? 92   ARG B CB    1 
ATOM   1349  C  CG    . ARG B 2 93  ? 132.626 120.413 128.227 1.00 23.48  ? 92   ARG B CG    1 
ATOM   1350  C  CD    . ARG B 2 93  ? 131.911 121.423 129.108 1.00 23.48  ? 92   ARG B CD    1 
ATOM   1351  N  NE    . ARG B 2 93  ? 132.494 122.758 129.053 1.00 23.48  ? 92   ARG B NE    1 
ATOM   1352  C  CZ    . ARG B 2 93  ? 131.877 123.848 129.498 1.00 23.48  ? 92   ARG B CZ    1 
ATOM   1353  N  NH1   . ARG B 2 93  ? 130.659 123.759 130.011 1.00 23.48  ? 92   ARG B NH1   1 
ATOM   1354  N  NH2   . ARG B 2 93  ? 132.459 125.032 129.407 1.00 23.48  ? 92   ARG B NH2   1 
ATOM   1355  N  N     . GLN B 2 94  ? 130.111 119.160 125.248 1.00 22.94  ? 93   GLN B N     1 
ATOM   1356  C  CA    . GLN B 2 94  ? 130.128 119.664 123.881 1.00 22.94  ? 93   GLN B CA    1 
ATOM   1357  C  C     . GLN B 2 94  ? 128.733 119.820 123.295 1.00 22.94  ? 93   GLN B C     1 
ATOM   1358  O  O     . GLN B 2 94  ? 128.601 120.031 122.085 1.00 22.94  ? 93   GLN B O     1 
ATOM   1359  C  CB    . GLN B 2 94  ? 130.945 118.741 122.983 1.00 22.94  ? 93   GLN B CB    1 
ATOM   1360  C  CG    . GLN B 2 94  ? 132.324 118.431 123.487 1.00 22.94  ? 93   GLN B CG    1 
ATOM   1361  C  CD    . GLN B 2 94  ? 133.090 117.595 122.498 1.00 22.94  ? 93   GLN B CD    1 
ATOM   1362  O  OE1   . GLN B 2 94  ? 132.536 117.143 121.496 1.00 22.94  ? 93   GLN B OE1   1 
ATOM   1363  N  NE2   . GLN B 2 94  ? 134.369 117.377 122.768 1.00 22.94  ? 93   GLN B NE2   1 
ATOM   1364  N  N     . GLY B 2 95  ? 127.695 119.724 124.118 1.00 21.13  ? 94   GLY B N     1 
ATOM   1365  C  CA    . GLY B 2 95  ? 126.334 119.895 123.648 1.00 21.13  ? 94   GLY B CA    1 
ATOM   1366  C  C     . GLY B 2 95  ? 125.843 118.795 122.737 1.00 21.13  ? 94   GLY B C     1 
ATOM   1367  O  O     . GLY B 2 95  ? 124.971 119.034 121.898 1.00 21.13  ? 94   GLY B O     1 
ATOM   1368  N  N     . ARG B 2 96  ? 126.376 117.590 122.888 1.00 23.54  ? 95   ARG B N     1 
ATOM   1369  C  CA    . ARG B 2 96  ? 125.953 116.403 122.155 1.00 23.54  ? 95   ARG B CA    1 
ATOM   1370  C  C     . ARG B 2 96  ? 125.711 115.281 123.140 1.00 23.54  ? 95   ARG B C     1 
ATOM   1371  O  O     . ARG B 2 96  ? 126.313 114.210 123.053 1.00 23.54  ? 95   ARG B O     1 
ATOM   1372  C  CB    . ARG B 2 96  ? 126.966 115.972 121.100 1.00 23.54  ? 95   ARG B CB    1 
ATOM   1373  C  CG    . ARG B 2 96  ? 127.287 117.041 120.083 1.00 23.54  ? 95   ARG B CG    1 
ATOM   1374  C  CD    . ARG B 2 96  ? 128.094 116.503 118.917 1.00 23.54  ? 95   ARG B CD    1 
ATOM   1375  N  NE    . ARG B 2 96  ? 128.292 117.524 117.891 1.00 23.54  ? 95   ARG B NE    1 
ATOM   1376  C  CZ    . ARG B 2 96  ? 127.386 117.876 116.981 1.00 23.54  ? 95   ARG B CZ    1 
ATOM   1377  N  NH1   . ARG B 2 96  ? 126.197 117.288 116.943 1.00 23.54  ? 95   ARG B NH1   1 
ATOM   1378  N  NH2   . ARG B 2 96  ? 127.674 118.820 116.099 1.00 23.54  ? 95   ARG B NH2   1 
ATOM   1379  N  N     . THR B 2 97  ? 124.902 115.593 124.159 1.00 23.13  ? 96   THR B N     1 
ATOM   1380  C  CA    . THR B 2 97  ? 124.551 114.671 125.235 1.00 23.13  ? 96   THR B CA    1 
ATOM   1381  C  C     . THR B 2 97  ? 124.037 113.331 124.718 1.00 23.13  ? 96   THR B C     1 
ATOM   1382  O  O     . THR B 2 97  ? 123.382 113.246 123.675 1.00 23.13  ? 96   THR B O     1 
ATOM   1383  C  CB    . THR B 2 97  ? 123.531 115.324 126.176 1.00 23.13  ? 96   THR B CB    1 
ATOM   1384  O  OG1   . THR B 2 97  ? 123.318 114.484 127.317 1.00 23.13  ? 96   THR B OG1   1 
ATOM   1385  C  CG2   . THR B 2 97  ? 122.212 115.619 125.490 1.00 23.13  ? 96   THR B CG2   1 
ATOM   1386  N  N     . LEU B 2 98  ? 124.400 112.274 125.433 1.00 23.94  ? 97   LEU B N     1 
ATOM   1387  C  CA    . LEU B 2 98  ? 124.064 110.914 125.053 1.00 23.94  ? 97   LEU B CA    1 
ATOM   1388  C  C     . LEU B 2 98  ? 123.299 110.261 126.187 1.00 23.94  ? 97   LEU B C     1 
ATOM   1389  O  O     . LEU B 2 98  ? 123.736 110.303 127.340 1.00 23.94  ? 97   LEU B O     1 
ATOM   1390  C  CB    . LEU B 2 98  ? 125.323 110.118 124.734 1.00 23.94  ? 97   LEU B CB    1 
ATOM   1391  C  CG    . LEU B 2 98  ? 125.063 108.737 124.154 1.00 23.94  ? 97   LEU B CG    1 
ATOM   1392  C  CD1   . LEU B 2 98  ? 124.323 108.856 122.851 1.00 23.94  ? 97   LEU B CD1   1 
ATOM   1393  C  CD2   . LEU B 2 98  ? 126.370 108.028 123.948 1.00 23.94  ? 97   LEU B CD2   1 
ATOM   1394  N  N     . TYR B 2 99  ? 122.168 109.657 125.856 1.00 23.46  ? 98   TYR B N     1 
ATOM   1395  C  CA    . TYR B 2 99  ? 121.323 108.997 126.836 1.00 23.46  ? 98   TYR B CA    1 
ATOM   1396  C  C     . TYR B 2 99  ? 121.547 107.496 126.777 1.00 23.46  ? 98   TYR B C     1 
ATOM   1397  O  O     . TYR B 2 99  ? 121.681 106.922 125.695 1.00 23.46  ? 98   TYR B O     1 
ATOM   1398  C  CB    . TYR B 2 99  ? 119.847 109.306 126.582 1.00 23.46  ? 98   TYR B CB    1 
ATOM   1399  C  CG    . TYR B 2 99  ? 119.399 110.702 126.951 1.00 23.46  ? 98   TYR B CG    1 
ATOM   1400  C  CD1   . TYR B 2 99  ? 120.266 111.609 127.546 1.00 23.46  ? 98   TYR B CD1   1 
ATOM   1401  C  CD2   . TYR B 2 99  ? 118.099 111.110 126.703 1.00 23.46  ? 98   TYR B CD2   1 
ATOM   1402  C  CE1   . TYR B 2 99  ? 119.851 112.878 127.878 1.00 23.46  ? 98   TYR B CE1   1 
ATOM   1403  C  CE2   . TYR B 2 99  ? 117.674 112.371 127.039 1.00 23.46  ? 98   TYR B CE2   1 
ATOM   1404  C  CZ    . TYR B 2 99  ? 118.556 113.253 127.619 1.00 23.46  ? 98   TYR B CZ    1 
ATOM   1405  O  OH    . TYR B 2 99  ? 118.133 114.517 127.947 1.00 23.46  ? 98   TYR B OH    1 
ATOM   1406  N  N     . GLY B 2 100 ? 121.595 106.865 127.936 1.00 27.58  ? 99   GLY B N     1 
ATOM   1407  C  CA    . GLY B 2 100 ? 121.641 105.429 128.018 1.00 27.58  ? 99   GLY B CA    1 
ATOM   1408  C  C     . GLY B 2 100 ? 122.946 104.816 128.463 1.00 27.58  ? 99   GLY B C     1 
ATOM   1409  O  O     . GLY B 2 100 ? 123.206 103.659 128.118 1.00 27.58  ? 99   GLY B O     1 
ATOM   1410  N  N     . PHE B 2 101 ? 123.768 105.538 129.211 1.00 31.24  ? 100  PHE B N     1 
ATOM   1411  C  CA    . PHE B 2 101 ? 125.017 104.982 129.715 1.00 31.24  ? 100  PHE B CA    1 
ATOM   1412  C  C     . PHE B 2 101 ? 125.320 105.555 131.091 1.00 31.24  ? 100  PHE B C     1 
ATOM   1413  O  O     . PHE B 2 101 ? 124.436 106.101 131.751 1.00 31.24  ? 100  PHE B O     1 
ATOM   1414  C  CB    . PHE B 2 101 ? 126.177 105.273 128.760 1.00 31.24  ? 100  PHE B CB    1 
ATOM   1415  C  CG    . PHE B 2 101 ? 126.136 104.482 127.487 1.00 31.24  ? 100  PHE B CG    1 
ATOM   1416  C  CD1   . PHE B 2 101 ? 126.634 103.190 127.441 1.00 31.24  ? 100  PHE B CD1   1 
ATOM   1417  C  CD2   . PHE B 2 101 ? 125.604 105.033 126.332 1.00 31.24  ? 100  PHE B CD2   1 
ATOM   1418  C  CE1   . PHE B 2 101 ? 126.597 102.458 126.267 1.00 31.24  ? 100  PHE B CE1   1 
ATOM   1419  C  CE2   . PHE B 2 101 ? 125.563 104.307 125.155 1.00 31.24  ? 100  PHE B CE2   1 
ATOM   1420  C  CZ    . PHE B 2 101 ? 126.062 103.020 125.123 1.00 31.24  ? 100  PHE B CZ    1 
ATOM   1421  N  N     . GLY C 3 108 ? 148.021 141.869 152.303 1.00 44.57  ? 16   GLY C N     1 
ATOM   1422  C  CA    . GLY C 3 108 ? 146.908 141.411 151.489 1.00 44.57  ? 16   GLY C CA    1 
ATOM   1423  C  C     . GLY C 3 108 ? 147.203 140.018 150.943 1.00 44.57  ? 16   GLY C C     1 
ATOM   1424  O  O     . GLY C 3 108 ? 148.353 139.650 150.694 1.00 44.57  ? 16   GLY C O     1 
ATOM   1425  N  N     . ARG C 3 109 ? 146.140 139.227 150.781 1.00 43.24  ? 17   ARG C N     1 
ATOM   1426  C  CA    . ARG C 3 109 ? 146.297 137.878 150.248 1.00 43.24  ? 17   ARG C CA    1 
ATOM   1427  C  C     . ARG C 3 109 ? 146.701 137.883 148.777 1.00 43.24  ? 17   ARG C C     1 
ATOM   1428  O  O     . ARG C 3 109 ? 147.339 136.932 148.313 1.00 43.24  ? 17   ARG C O     1 
ATOM   1429  C  CB    . ARG C 3 109 ? 145.003 137.089 150.442 1.00 43.24  ? 17   ARG C CB    1 
ATOM   1430  C  CG    . ARG C 3 109 ? 145.210 135.601 150.628 1.00 43.24  ? 17   ARG C CG    1 
ATOM   1431  C  CD    . ARG C 3 109 ? 143.913 134.822 150.477 1.00 43.24  ? 17   ARG C CD    1 
ATOM   1432  N  NE    . ARG C 3 109 ? 143.083 134.871 151.675 1.00 43.24  ? 17   ARG C NE    1 
ATOM   1433  C  CZ    . ARG C 3 109 ? 141.887 134.302 151.775 1.00 43.24  ? 17   ARG C CZ    1 
ATOM   1434  N  NH1   . ARG C 3 109 ? 141.380 133.637 150.746 1.00 43.24  ? 17   ARG C NH1   1 
ATOM   1435  N  NH2   . ARG C 3 109 ? 141.197 134.397 152.903 1.00 43.24  ? 17   ARG C NH2   1 
ATOM   1436  N  N     . SER C 3 110 ? 146.324 138.924 148.027 1.00 42.41  ? 18   SER C N     1 
ATOM   1437  C  CA    . SER C 3 110 ? 146.712 139.036 146.623 1.00 42.41  ? 18   SER C CA    1 
ATOM   1438  C  C     . SER C 3 110 ? 148.216 139.210 146.458 1.00 42.41  ? 18   SER C C     1 
ATOM   1439  O  O     . SER C 3 110 ? 148.817 138.610 145.562 1.00 42.41  ? 18   SER C O     1 
ATOM   1440  C  CB    . SER C 3 110 ? 145.965 140.191 145.959 1.00 42.41  ? 18   SER C CB    1 
ATOM   1441  O  OG    . SER C 3 110 ? 144.579 139.914 145.885 1.00 42.41  ? 18   SER C OG    1 
ATOM   1442  N  N     . SER C 3 111 ? 148.828 140.039 147.303 1.00 43.25  ? 19   SER C N     1 
ATOM   1443  C  CA    . SER C 3 111 ? 150.262 140.298 147.232 1.00 43.25  ? 19   SER C CA    1 
ATOM   1444  C  C     . SER C 3 111 ? 151.085 139.060 147.571 1.00 43.25  ? 19   SER C C     1 
ATOM   1445  O  O     . SER C 3 111 ? 152.211 138.914 147.084 1.00 43.25  ? 19   SER C O     1 
ATOM   1446  C  CB    . SER C 3 111 ? 150.631 141.454 148.159 1.00 43.25  ? 19   SER C CB    1 
ATOM   1447  O  OG    . SER C 3 111 ? 150.280 141.162 149.500 1.00 43.25  ? 19   SER C OG    1 
ATOM   1448  N  N     . ARG C 3 112 ? 150.553 138.183 148.428 1.00 43.44  ? 20   ARG C N     1 
ATOM   1449  C  CA    . ARG C 3 112 ? 151.265 136.964 148.803 1.00 43.44  ? 20   ARG C CA    1 
ATOM   1450  C  C     . ARG C 3 112 ? 151.450 136.015 147.625 1.00 43.44  ? 20   ARG C C     1 
ATOM   1451  O  O     . ARG C 3 112 ? 152.424 135.255 147.592 1.00 43.44  ? 20   ARG C O     1 
ATOM   1452  C  CB    . ARG C 3 112 ? 150.515 136.255 149.930 1.00 43.44  ? 20   ARG C CB    1 
ATOM   1453  C  CG    . ARG C 3 112 ? 150.487 137.028 151.233 1.00 43.44  ? 20   ARG C CG    1 
ATOM   1454  C  CD    . ARG C 3 112 ? 149.691 136.316 152.322 1.00 43.44  ? 20   ARG C CD    1 
ATOM   1455  N  NE    . ARG C 3 112 ? 150.454 135.271 152.999 1.00 43.44  ? 20   ARG C NE    1 
ATOM   1456  C  CZ    . ARG C 3 112 ? 150.402 133.980 152.690 1.00 43.44  ? 20   ARG C CZ    1 
ATOM   1457  N  NH1   . ARG C 3 112 ? 149.612 133.556 151.716 1.00 43.44  ? 20   ARG C NH1   1 
ATOM   1458  N  NH2   . ARG C 3 112 ? 151.135 133.108 153.366 1.00 43.44  ? 20   ARG C NH2   1 
ATOM   1459  N  N     . ALA C 3 113 ? 150.545 136.044 146.652 1.00 42.39  ? 21   ALA C N     1 
ATOM   1460  C  CA    . ALA C 3 113 ? 150.645 135.188 145.479 1.00 42.39  ? 21   ALA C CA    1 
ATOM   1461  C  C     . ALA C 3 113 ? 151.185 135.917 144.261 1.00 42.39  ? 21   ALA C C     1 
ATOM   1462  O  O     . ALA C 3 113 ? 151.353 135.295 143.208 1.00 42.39  ? 21   ALA C O     1 
ATOM   1463  C  CB    . ALA C 3 113 ? 149.280 134.581 145.150 1.00 42.39  ? 21   ALA C CB    1 
ATOM   1464  N  N     . GLY C 3 114 ? 151.476 137.208 144.387 1.00 43.98  ? 22   GLY C N     1 
ATOM   1465  C  CA    . GLY C 3 114 ? 151.960 138.011 143.274 1.00 43.98  ? 22   GLY C CA    1 
ATOM   1466  C  C     . GLY C 3 114 ? 150.954 138.177 142.158 1.00 43.98  ? 22   GLY C C     1 
ATOM   1467  O  O     . GLY C 3 114 ? 151.327 138.171 140.979 1.00 43.98  ? 22   GLY C O     1 
ATOM   1468  N  N     . LEU C 3 115 ? 149.682 138.329 142.505 1.00 42.38  ? 23   LEU C N     1 
ATOM   1469  C  CA    . LEU C 3 115 ? 148.608 138.489 141.542 1.00 42.38  ? 23   LEU C CA    1 
ATOM   1470  C  C     . LEU C 3 115 ? 147.976 139.863 141.694 1.00 42.38  ? 23   LEU C C     1 
ATOM   1471  O  O     . LEU C 3 115 ? 148.043 140.490 142.754 1.00 42.38  ? 23   LEU C O     1 
ATOM   1472  C  CB    . LEU C 3 115 ? 147.540 137.411 141.722 1.00 42.38  ? 23   LEU C CB    1 
ATOM   1473  C  CG    . LEU C 3 115 ? 147.975 135.978 141.445 1.00 42.38  ? 23   LEU C CG    1 
ATOM   1474  C  CD1   . LEU C 3 115 ? 146.785 135.058 141.608 1.00 42.38  ? 23   LEU C CD1   1 
ATOM   1475  C  CD2   . LEU C 3 115 ? 148.576 135.854 140.057 1.00 42.38  ? 23   LEU C CD2   1 
ATOM   1476  N  N     . GLN C 3 116 ? 147.356 140.328 140.618 1.00 45.07  ? 24   GLN C N     1 
ATOM   1477  C  CA    . GLN C 3 116 ? 146.599 141.569 140.690 1.00 45.07  ? 24   GLN C CA    1 
ATOM   1478  C  C     . GLN C 3 116 ? 145.133 141.330 141.020 1.00 45.07  ? 24   GLN C C     1 
ATOM   1479  O  O     . GLN C 3 116 ? 144.537 142.117 141.761 1.00 45.07  ? 24   GLN C O     1 
ATOM   1480  C  CB    . GLN C 3 116 ? 146.731 142.345 139.381 1.00 45.07  ? 24   GLN C CB    1 
ATOM   1481  C  CG    . GLN C 3 116 ? 148.161 142.744 139.060 1.00 45.07  ? 24   GLN C CG    1 
ATOM   1482  C  CD    . GLN C 3 116 ? 148.759 143.670 140.105 1.00 45.07  ? 24   GLN C CD    1 
ATOM   1483  O  OE1   . GLN C 3 116 ? 148.131 144.643 140.521 1.00 45.07  ? 24   GLN C OE1   1 
ATOM   1484  N  NE2   . GLN C 3 116 ? 149.982 143.372 140.530 1.00 45.07  ? 24   GLN C NE2   1 
ATOM   1485  N  N     . PHE C 3 117 ? 144.544 140.267 140.475 1.00 38.06  ? 25   PHE C N     1 
ATOM   1486  C  CA    . PHE C 3 117 ? 143.136 139.971 140.700 1.00 38.06  ? 25   PHE C CA    1 
ATOM   1487  C  C     . PHE C 3 117 ? 142.859 139.577 142.155 1.00 38.06  ? 25   PHE C C     1 
ATOM   1488  O  O     . PHE C 3 117 ? 143.705 138.970 142.816 1.00 38.06  ? 25   PHE C O     1 
ATOM   1489  C  CB    . PHE C 3 117 ? 142.673 138.863 139.755 1.00 38.06  ? 25   PHE C CB    1 
ATOM   1490  C  CG    . PHE C 3 117 ? 142.183 139.366 138.428 1.00 38.06  ? 25   PHE C CG    1 
ATOM   1491  C  CD1   . PHE C 3 117 ? 142.692 140.526 137.873 1.00 38.06  ? 25   PHE C CD1   1 
ATOM   1492  C  CD2   . PHE C 3 117 ? 141.182 138.696 137.753 1.00 38.06  ? 25   PHE C CD2   1 
ATOM   1493  C  CE1   . PHE C 3 117 ? 142.229 140.994 136.662 1.00 38.06  ? 25   PHE C CE1   1 
ATOM   1494  C  CE2   . PHE C 3 117 ? 140.714 139.159 136.538 1.00 38.06  ? 25   PHE C CE2   1 
ATOM   1495  C  CZ    . PHE C 3 117 ? 141.239 140.310 135.994 1.00 38.06  ? 25   PHE C CZ    1 
ATOM   1496  N  N     . PRO C 3 118 ? 141.674 139.937 142.688 1.00 39.78  ? 26   PRO C N     1 
ATOM   1497  C  CA    . PRO C 3 118 ? 141.402 139.716 144.115 1.00 39.78  ? 26   PRO C CA    1 
ATOM   1498  C  C     . PRO C 3 118 ? 141.092 138.272 144.482 1.00 39.78  ? 26   PRO C C     1 
ATOM   1499  O  O     . PRO C 3 118 ? 140.020 137.753 144.154 1.00 39.78  ? 26   PRO C O     1 
ATOM   1500  C  CB    . PRO C 3 118 ? 140.203 140.633 144.381 1.00 39.78  ? 26   PRO C CB    1 
ATOM   1501  C  CG    . PRO C 3 118 ? 139.499 140.711 143.079 1.00 39.78  ? 26   PRO C CG    1 
ATOM   1502  C  CD    . PRO C 3 118 ? 140.569 140.667 142.033 1.00 39.78  ? 26   PRO C CD    1 
ATOM   1503  N  N     . VAL C 3 119 ? 142.051 137.603 145.126 1.00 39.03  ? 27   VAL C N     1 
ATOM   1504  C  CA    . VAL C 3 119 ? 141.834 136.244 145.617 1.00 39.03  ? 27   VAL C CA    1 
ATOM   1505  C  C     . VAL C 3 119 ? 140.690 136.202 146.626 1.00 39.03  ? 27   VAL C C     1 
ATOM   1506  O  O     . VAL C 3 119 ? 139.905 135.247 146.649 1.00 39.03  ? 27   VAL C O     1 
ATOM   1507  C  CB    . VAL C 3 119 ? 143.137 135.671 146.199 1.00 39.03  ? 27   VAL C CB    1 
ATOM   1508  C  CG1   . VAL C 3 119 ? 144.048 135.224 145.087 1.00 39.03  ? 27   VAL C CG1   1 
ATOM   1509  C  CG2   . VAL C 3 119 ? 143.842 136.715 146.999 1.00 39.03  ? 27   VAL C CG2   1 
ATOM   1510  N  N     . GLY C 3 120 ? 140.595 137.220 147.486 1.00 41.39  ? 28   GLY C N     1 
ATOM   1511  C  CA    . GLY C 3 120 ? 139.545 137.252 148.495 1.00 41.39  ? 28   GLY C CA    1 
ATOM   1512  C  C     . GLY C 3 120 ? 138.151 137.353 147.904 1.00 41.39  ? 28   GLY C C     1 
ATOM   1513  O  O     . GLY C 3 120 ? 137.226 136.666 148.347 1.00 41.39  ? 28   GLY C O     1 
ATOM   1514  N  N     . ARG C 3 121 ? 137.978 138.241 146.919 1.00 42.44  ? 29   ARG C N     1 
ATOM   1515  C  CA    . ARG C 3 121 ? 136.682 138.392 146.261 1.00 42.44  ? 29   ARG C CA    1 
ATOM   1516  C  C     . ARG C 3 121 ? 136.289 137.119 145.520 1.00 42.44  ? 29   ARG C C     1 
ATOM   1517  O  O     . ARG C 3 121 ? 135.114 136.733 145.520 1.00 42.44  ? 29   ARG C O     1 
ATOM   1518  C  CB    . ARG C 3 121 ? 136.704 139.597 145.322 1.00 42.44  ? 29   ARG C CB    1 
ATOM   1519  C  CG    . ARG C 3 121 ? 135.421 139.809 144.538 1.00 42.44  ? 29   ARG C CG    1 
ATOM   1520  C  CD    . ARG C 3 121 ? 135.482 141.079 143.715 1.00 42.44  ? 29   ARG C CD    1 
ATOM   1521  N  NE    . ARG C 3 121 ? 135.546 142.267 144.560 1.00 42.44  ? 29   ARG C NE    1 
ATOM   1522  C  CZ    . ARG C 3 121 ? 135.464 143.512 144.108 1.00 42.44  ? 29   ARG C CZ    1 
ATOM   1523  N  NH1   . ARG C 3 121 ? 135.312 143.741 142.813 1.00 42.44  ? 29   ARG C NH1   1 
ATOM   1524  N  NH2   . ARG C 3 121 ? 135.531 144.531 144.951 1.00 42.44  ? 29   ARG C NH2   1 
ATOM   1525  N  N     . VAL C 3 122 ? 137.258 136.472 144.864 1.00 38.42  ? 30   VAL C N     1 
ATOM   1526  C  CA    . VAL C 3 122 ? 137.015 135.185 144.211 1.00 38.42  ? 30   VAL C CA    1 
ATOM   1527  C  C     . VAL C 3 122 ? 136.590 134.134 145.234 1.00 38.42  ? 30   VAL C C     1 
ATOM   1528  O  O     . VAL C 3 122 ? 135.663 133.350 144.988 1.00 38.42  ? 30   VAL C O     1 
ATOM   1529  C  CB    . VAL C 3 122 ? 138.266 134.755 143.421 1.00 38.42  ? 30   VAL C CB    1 
ATOM   1530  C  CG1   . VAL C 3 122 ? 138.192 133.302 143.007 1.00 38.42  ? 30   VAL C CG1   1 
ATOM   1531  C  CG2   . VAL C 3 122 ? 138.411 135.616 142.189 1.00 38.42  ? 30   VAL C CG2   1 
ATOM   1532  N  N     . HIS C 3 123 ? 137.232 134.132 146.409 1.00 37.13  ? 31   HIS C N     1 
ATOM   1533  C  CA    . HIS C 3 123 ? 136.877 133.199 147.478 1.00 37.13  ? 31   HIS C CA    1 
ATOM   1534  C  C     . HIS C 3 123 ? 135.455 133.436 147.969 1.00 37.13  ? 31   HIS C C     1 
ATOM   1535  O  O     . HIS C 3 123 ? 134.703 132.483 148.217 1.00 37.13  ? 31   HIS C O     1 
ATOM   1536  C  CB    . HIS C 3 123 ? 137.864 133.339 148.634 1.00 37.13  ? 31   HIS C CB    1 
ATOM   1537  C  CG    . HIS C 3 123 ? 137.592 132.419 149.782 1.00 37.13  ? 31   HIS C CG    1 
ATOM   1538  N  ND1   . HIS C 3 123 ? 138.121 131.149 149.855 1.00 37.13  ? 31   HIS C ND1   1 
ATOM   1539  C  CD2   . HIS C 3 123 ? 136.861 132.587 150.908 1.00 37.13  ? 31   HIS C CD2   1 
ATOM   1540  C  CE1   . HIS C 3 123 ? 137.723 130.573 150.975 1.00 37.13  ? 31   HIS C CE1   1 
ATOM   1541  N  NE2   . HIS C 3 123 ? 136.958 131.425 151.632 1.00 37.13  ? 31   HIS C NE2   1 
ATOM   1542  N  N     . ARG C 3 124 ? 135.072 134.708 148.101 1.00 41.66  ? 32   ARG C N     1 
ATOM   1543  C  CA    . ARG C 3 124 ? 133.724 135.044 148.543 1.00 41.66  ? 32   ARG C CA    1 
ATOM   1544  C  C     . ARG C 3 124 ? 132.696 134.627 147.502 1.00 41.66  ? 32   ARG C C     1 
ATOM   1545  O  O     . ARG C 3 124 ? 131.639 134.095 147.852 1.00 41.66  ? 32   ARG C O     1 
ATOM   1546  C  CB    . ARG C 3 124 ? 133.611 136.541 148.835 1.00 41.66  ? 32   ARG C CB    1 
ATOM   1547  C  CG    . ARG C 3 124 ? 132.354 136.938 149.611 1.00 41.66  ? 32   ARG C CG    1 
ATOM   1548  C  CD    . ARG C 3 124 ? 131.256 137.519 148.725 1.00 41.66  ? 32   ARG C CD    1 
ATOM   1549  N  NE    . ARG C 3 124 ? 131.778 138.392 147.681 1.00 41.66  ? 32   ARG C NE    1 
ATOM   1550  C  CZ    . ARG C 3 124 ? 131.938 139.702 147.817 1.00 41.66  ? 32   ARG C CZ    1 
ATOM   1551  N  NH1   . ARG C 3 124 ? 131.618 140.295 148.955 1.00 41.66  ? 32   ARG C NH1   1 
ATOM   1552  N  NH2   . ARG C 3 124 ? 132.418 140.421 146.814 1.00 41.66  ? 32   ARG C NH2   1 
ATOM   1553  N  N     . LEU C 3 125 ? 132.961 134.933 146.227 1.00 35.21  ? 33   LEU C N     1 
ATOM   1554  C  CA    . LEU C 3 125 ? 132.068 134.518 145.147 1.00 35.21  ? 33   LEU C CA    1 
ATOM   1555  C  C     . LEU C 3 125 ? 131.930 133.004 145.070 1.00 35.21  ? 33   LEU C C     1 
ATOM   1556  O  O     . LEU C 3 125 ? 130.847 132.492 144.771 1.00 35.21  ? 33   LEU C O     1 
ATOM   1557  C  CB    . LEU C 3 125 ? 132.547 135.075 143.811 1.00 35.21  ? 33   LEU C CB    1 
ATOM   1558  C  CG    . LEU C 3 125 ? 132.359 136.573 143.634 1.00 35.21  ? 33   LEU C CG    1 
ATOM   1559  C  CD1   . LEU C 3 125 ? 132.907 137.001 142.298 1.00 35.21  ? 33   LEU C CD1   1 
ATOM   1560  C  CD2   . LEU C 3 125 ? 130.888 136.911 143.740 1.00 35.21  ? 33   LEU C CD2   1 
ATOM   1561  N  N     . LEU C 3 126 ? 133.010 132.272 145.344 1.00 34.49  ? 34   LEU C N     1 
ATOM   1562  C  CA    . LEU C 3 126 ? 132.933 130.816 145.322 1.00 34.49  ? 34   LEU C CA    1 
ATOM   1563  C  C     . LEU C 3 126 ? 132.093 130.285 146.478 1.00 34.49  ? 34   LEU C C     1 
ATOM   1564  O  O     . LEU C 3 126 ? 131.271 129.381 146.286 1.00 34.49  ? 34   LEU C O     1 
ATOM   1565  C  CB    . LEU C 3 126 ? 134.333 130.210 145.346 1.00 34.49  ? 34   LEU C CB    1 
ATOM   1566  C  CG    . LEU C 3 126 ? 135.019 130.197 143.984 1.00 34.49  ? 34   LEU C CG    1 
ATOM   1567  C  CD1   . LEU C 3 126 ? 136.470 129.758 144.108 1.00 34.49  ? 34   LEU C CD1   1 
ATOM   1568  C  CD2   . LEU C 3 126 ? 134.255 129.299 143.034 1.00 34.49  ? 34   LEU C CD2   1 
ATOM   1569  N  N     . ARG C 3 127 ? 132.306 130.807 147.693 1.00 37.25  ? 35   ARG C N     1 
ATOM   1570  C  CA    . ARG C 3 127 ? 131.522 130.333 148.834 1.00 37.25  ? 35   ARG C CA    1 
ATOM   1571  C  C     . ARG C 3 127 ? 130.052 130.719 148.720 1.00 37.25  ? 35   ARG C C     1 
ATOM   1572  O  O     . ARG C 3 127 ? 129.169 129.876 148.905 1.00 37.25  ? 35   ARG C O     1 
ATOM   1573  C  CB    . ARG C 3 127 ? 132.090 130.863 150.149 1.00 37.25  ? 35   ARG C CB    1 
ATOM   1574  C  CG    . ARG C 3 127 ? 133.386 130.216 150.585 1.00 37.25  ? 35   ARG C CG    1 
ATOM   1575  C  CD    . ARG C 3 127 ? 133.730 130.521 152.042 1.00 37.25  ? 35   ARG C CD    1 
ATOM   1576  N  NE    . ARG C 3 127 ? 133.989 131.933 152.314 1.00 37.25  ? 35   ARG C NE    1 
ATOM   1577  C  CZ    . ARG C 3 127 ? 133.112 132.766 152.870 1.00 37.25  ? 35   ARG C CZ    1 
ATOM   1578  N  NH1   . ARG C 3 127 ? 131.911 132.329 153.223 1.00 37.25  ? 35   ARG C NH1   1 
ATOM   1579  N  NH2   . ARG C 3 127 ? 133.438 134.034 153.076 1.00 37.25  ? 35   ARG C NH2   1 
ATOM   1580  N  N     . LYS C 3 128 ? 129.765 131.981 148.406 1.00 33.03  ? 36   LYS C N     1 
ATOM   1581  C  CA    . LYS C 3 128 ? 128.399 132.478 148.362 1.00 33.03  ? 36   LYS C CA    1 
ATOM   1582  C  C     . LYS C 3 128 ? 127.830 132.495 146.953 1.00 33.03  ? 36   LYS C C     1 
ATOM   1583  O  O     . LYS C 3 128 ? 126.881 133.238 146.684 1.00 33.03  ? 36   LYS C O     1 
ATOM   1584  C  CB    . LYS C 3 128 ? 128.326 133.876 148.975 1.00 33.03  ? 36   LYS C CB    1 
ATOM   1585  N  N     . GLY C 3 129 ? 128.387 131.700 146.048 1.00 33.42  ? 37   GLY C N     1 
ATOM   1586  C  CA    . GLY C 3 129 ? 127.897 131.687 144.689 1.00 33.42  ? 37   GLY C CA    1 
ATOM   1587  C  C     . GLY C 3 129 ? 127.190 130.385 144.395 1.00 33.42  ? 37   GLY C C     1 
ATOM   1588  O  O     . GLY C 3 129 ? 126.746 130.155 143.265 1.00 33.42  ? 37   GLY C O     1 
ATOM   1589  N  N     . ASN C 3 130 ? 127.109 129.533 145.423 1.00 34.27  ? 38   ASN C N     1 
ATOM   1590  C  CA    . ASN C 3 130 ? 126.412 128.244 145.401 1.00 34.27  ? 38   ASN C CA    1 
ATOM   1591  C  C     . ASN C 3 130 ? 126.976 127.304 144.334 1.00 34.27  ? 38   ASN C C     1 
ATOM   1592  O  O     . ASN C 3 130 ? 126.290 126.878 143.405 1.00 34.27  ? 38   ASN C O     1 
ATOM   1593  C  CB    . ASN C 3 130 ? 124.904 128.445 145.246 1.00 34.27  ? 38   ASN C CB    1 
ATOM   1594  C  CG    . ASN C 3 130 ? 124.199 128.478 146.574 1.00 34.27  ? 38   ASN C CG    1 
ATOM   1595  O  OD1   . ASN C 3 130 ? 124.722 127.991 147.576 1.00 34.27  ? 38   ASN C OD1   1 
ATOM   1596  N  ND2   . ASN C 3 130 ? 123.032 129.101 146.607 1.00 34.27  ? 38   ASN C ND2   1 
ATOM   1597  N  N     . TYR C 3 131 ? 128.249 126.983 144.497 1.00 31.78  ? 39   TYR C N     1 
ATOM   1598  C  CA    . TYR C 3 131 ? 128.954 126.081 143.604 1.00 31.78  ? 39   TYR C CA    1 
ATOM   1599  C  C     . TYR C 3 131 ? 129.346 124.784 144.282 1.00 31.78  ? 39   TYR C C     1 
ATOM   1600  O  O     . TYR C 3 131 ? 129.378 123.745 143.622 1.00 31.78  ? 39   TYR C O     1 
ATOM   1601  C  CB    . TYR C 3 131 ? 130.205 126.761 143.033 1.00 31.78  ? 39   TYR C CB    1 
ATOM   1602  C  CG    . TYR C 3 131 ? 129.881 127.987 142.215 1.00 31.78  ? 39   TYR C CG    1 
ATOM   1603  C  CD1   . TYR C 3 131 ? 129.290 127.874 140.965 1.00 31.78  ? 39   TYR C CD1   1 
ATOM   1604  C  CD2   . TYR C 3 131 ? 130.148 129.258 142.701 1.00 31.78  ? 39   TYR C CD2   1 
ATOM   1605  C  CE1   . TYR C 3 131 ? 128.984 128.994 140.217 1.00 31.78  ? 39   TYR C CE1   1 
ATOM   1606  C  CE2   . TYR C 3 131 ? 129.847 130.382 141.960 1.00 31.78  ? 39   TYR C CE2   1 
ATOM   1607  C  CZ    . TYR C 3 131 ? 129.265 130.244 140.723 1.00 31.78  ? 39   TYR C CZ    1 
ATOM   1608  O  OH    . TYR C 3 131 ? 128.964 131.367 139.991 1.00 31.78  ? 39   TYR C OH    1 
ATOM   1609  N  N     . ALA C 3 132 ? 129.633 124.821 145.580 1.00 34.94  ? 40   ALA C N     1 
ATOM   1610  C  CA    . ALA C 3 132 ? 129.930 123.631 146.361 1.00 34.94  ? 40   ALA C CA    1 
ATOM   1611  C  C     . ALA C 3 132 ? 129.730 123.968 147.826 1.00 34.94  ? 40   ALA C C     1 
ATOM   1612  O  O     . ALA C 3 132 ? 129.699 125.140 148.212 1.00 34.94  ? 40   ALA C O     1 
ATOM   1613  C  CB    . ALA C 3 132 ? 131.352 123.119 146.130 1.00 34.94  ? 40   ALA C CB    1 
ATOM   1614  N  N     . GLU C 3 133 ? 129.540 122.916 148.624 1.00 39.25  ? 41   GLU C N     1 
ATOM   1615  C  CA    . GLU C 3 133 ? 129.415 123.074 150.068 1.00 39.25  ? 41   GLU C CA    1 
ATOM   1616  C  C     . GLU C 3 133 ? 130.674 123.679 150.676 1.00 39.25  ? 41   GLU C C     1 
ATOM   1617  O  O     . GLU C 3 133 ? 130.594 124.526 151.572 1.00 39.25  ? 41   GLU C O     1 
ATOM   1618  C  CB    . GLU C 3 133 ? 129.108 121.724 150.712 1.00 39.25  ? 41   GLU C CB    1 
ATOM   1619  C  CG    . GLU C 3 133 ? 127.728 121.180 150.389 1.00 39.25  ? 41   GLU C CG    1 
ATOM   1620  C  CD    . GLU C 3 133 ? 127.467 119.835 151.040 1.00 39.25  ? 41   GLU C CD    1 
ATOM   1621  O  OE1   . GLU C 3 133 ? 127.885 119.644 152.201 1.00 39.25  ? 41   GLU C OE1   1 
ATOM   1622  O  OE2   . GLU C 3 133 ? 126.847 118.968 150.390 1.00 39.25  ? 41   GLU C OE2   1 
ATOM   1623  N  N     . ARG C 3 134 ? 131.847 123.264 150.200 1.00 41.51  ? 42   ARG C N     1 
ATOM   1624  C  CA    . ARG C 3 134 ? 133.112 123.728 150.749 1.00 41.51  ? 42   ARG C CA    1 
ATOM   1625  C  C     . ARG C 3 134 ? 134.014 124.153 149.600 1.00 41.51  ? 42   ARG C C     1 
ATOM   1626  O  O     . ARG C 3 134 ? 133.910 123.642 148.484 1.00 41.51  ? 42   ARG C O     1 
ATOM   1627  C  CB    . ARG C 3 134 ? 133.810 122.639 151.590 1.00 41.51  ? 42   ARG C CB    1 
ATOM   1628  C  CG    . ARG C 3 134 ? 132.879 121.789 152.454 1.00 41.51  ? 42   ARG C CG    1 
ATOM   1629  C  CD    . ARG C 3 134 ? 133.533 120.523 152.961 1.00 41.51  ? 42   ARG C CD    1 
ATOM   1630  N  NE    . ARG C 3 134 ? 134.261 120.717 154.207 1.00 41.51  ? 42   ARG C NE    1 
ATOM   1631  C  CZ    . ARG C 3 134 ? 135.582 120.659 154.309 1.00 41.51  ? 42   ARG C CZ    1 
ATOM   1632  N  NH1   . ARG C 3 134 ? 136.319 120.416 153.237 1.00 41.51  ? 42   ARG C NH1   1 
ATOM   1633  N  NH2   . ARG C 3 134 ? 136.164 120.842 155.484 1.00 41.51  ? 42   ARG C NH2   1 
ATOM   1634  N  N     . VAL C 3 135 ? 134.906 125.099 149.883 1.00 35.95  ? 43   VAL C N     1 
ATOM   1635  C  CA    . VAL C 3 135 ? 135.833 125.646 148.898 1.00 35.95  ? 43   VAL C CA    1 
ATOM   1636  C  C     . VAL C 3 135 ? 137.247 125.536 149.446 1.00 35.95  ? 43   VAL C C     1 
ATOM   1637  O  O     . VAL C 3 135 ? 137.525 126.011 150.553 1.00 35.95  ? 43   VAL C O     1 
ATOM   1638  C  CB    . VAL C 3 135 ? 135.496 127.107 148.551 1.00 35.95  ? 43   VAL C CB    1 
ATOM   1639  C  CG1   . VAL C 3 135 ? 136.571 127.707 147.679 1.00 35.95  ? 43   VAL C CG1   1 
ATOM   1640  C  CG2   . VAL C 3 135 ? 134.160 127.188 147.844 1.00 35.95  ? 43   VAL C CG2   1 
ATOM   1641  N  N     . GLY C 3 136 ? 138.130 124.902 148.677 1.00 32.68  ? 44   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3 136 ? 139.507 124.729 149.098 1.00 32.68  ? 44   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3 136 ? 140.270 126.037 149.183 1.00 32.68  ? 44   GLY C C     1 
ATOM   1644  O  O     . GLY C 3 136 ? 139.873 127.062 148.636 1.00 32.68  ? 44   GLY C O     1 
ATOM   1645  N  N     . ALA C 3 137 ? 141.380 125.993 149.925 1.00 36.87  ? 45   ALA C N     1 
ATOM   1646  C  CA    . ALA C 3 137 ? 142.205 127.183 150.117 1.00 36.87  ? 45   ALA C CA    1 
ATOM   1647  C  C     . ALA C 3 137 ? 142.979 127.561 148.862 1.00 36.87  ? 45   ALA C C     1 
ATOM   1648  O  O     . ALA C 3 137 ? 143.245 128.746 148.638 1.00 36.87  ? 45   ALA C O     1 
ATOM   1649  C  CB    . ALA C 3 137 ? 143.175 126.974 151.277 1.00 36.87  ? 45   ALA C CB    1 
ATOM   1650  N  N     . GLY C 3 138 ? 143.363 126.586 148.046 1.00 35.03  ? 46   GLY C N     1 
ATOM   1651  C  CA    . GLY C 3 138 ? 144.167 126.880 146.876 1.00 35.03  ? 46   GLY C CA    1 
ATOM   1652  C  C     . GLY C 3 138 ? 143.337 127.249 145.666 1.00 35.03  ? 46   GLY C C     1 
ATOM   1653  O  O     . GLY C 3 138 ? 143.859 127.818 144.698 1.00 35.03  ? 46   GLY C O     1 
ATOM   1654  N  N     . ALA C 3 139 ? 142.050 126.892 145.713 1.00 33.05  ? 47   ALA C N     1 
ATOM   1655  C  CA    . ALA C 3 139 ? 141.120 127.196 144.623 1.00 33.05  ? 47   ALA C CA    1 
ATOM   1656  C  C     . ALA C 3 139 ? 141.008 128.684 144.278 1.00 33.05  ? 47   ALA C C     1 
ATOM   1657  O  O     . ALA C 3 139 ? 141.053 128.998 143.076 1.00 33.05  ? 47   ALA C O     1 
ATOM   1658  C  CB    . ALA C 3 139 ? 139.753 126.567 144.917 1.00 33.05  ? 47   ALA C CB    1 
ATOM   1659  N  N     . PRO C 3 140 ? 140.809 129.633 145.222 1.00 33.53  ? 48   PRO C N     1 
ATOM   1660  C  CA    . PRO C 3 140 ? 140.741 131.042 144.792 1.00 33.53  ? 48   PRO C CA    1 
ATOM   1661  C  C     . PRO C 3 140 ? 142.040 131.566 144.212 1.00 33.53  ? 48   PRO C C     1 
ATOM   1662  O  O     . PRO C 3 140 ? 141.999 132.363 143.271 1.00 33.53  ? 48   PRO C O     1 
ATOM   1663  C  CB    . PRO C 3 140 ? 140.369 131.794 146.075 1.00 33.53  ? 48   PRO C CB    1 
ATOM   1664  C  CG    . PRO C 3 140 ? 139.831 130.796 146.958 1.00 33.53  ? 48   PRO C CG    1 
ATOM   1665  C  CD    . PRO C 3 140 ? 140.569 129.559 146.675 1.00 33.53  ? 48   PRO C CD    1 
ATOM   1666  N  N     . VAL C 3 141 ? 143.183 131.156 144.766 1.00 34.02  ? 49   VAL C N     1 
ATOM   1667  C  CA    . VAL C 3 141 ? 144.480 131.572 144.237 1.00 34.02  ? 49   VAL C CA    1 
ATOM   1668  C  C     . VAL C 3 141 ? 144.659 131.079 142.805 1.00 34.02  ? 49   VAL C C     1 
ATOM   1669  O  O     . VAL C 3 141 ? 145.031 131.848 141.907 1.00 34.02  ? 49   VAL C O     1 
ATOM   1670  C  CB    . VAL C 3 141 ? 145.608 131.071 145.153 1.00 34.02  ? 49   VAL C CB    1 
ATOM   1671  C  CG1   . VAL C 3 141 ? 146.967 131.381 144.550 1.00 34.02  ? 49   VAL C CG1   1 
ATOM   1672  C  CG2   . VAL C 3 141 ? 145.469 131.697 146.522 1.00 34.02  ? 49   VAL C CG2   1 
ATOM   1673  N  N     . TYR C 3 142 ? 144.361 129.797 142.571 1.00 29.94  ? 50   TYR C N     1 
ATOM   1674  C  CA    . TYR C 3 142 ? 144.483 129.216 141.236 1.00 29.94  ? 50   TYR C CA    1 
ATOM   1675  C  C     . TYR C 3 142 ? 143.524 129.875 140.250 1.00 29.94  ? 50   TYR C C     1 
ATOM   1676  O  O     . TYR C 3 142 ? 143.906 130.190 139.112 1.00 29.94  ? 50   TYR C O     1 
ATOM   1677  C  CB    . TYR C 3 142 ? 144.223 127.716 141.312 1.00 29.94  ? 50   TYR C CB    1 
ATOM   1678  C  CG    . TYR C 3 142 ? 144.777 126.914 140.166 1.00 29.94  ? 50   TYR C CG    1 
ATOM   1679  C  CD1   . TYR C 3 142 ? 144.076 126.793 138.976 1.00 29.94  ? 50   TYR C CD1   1 
ATOM   1680  C  CD2   . TYR C 3 142 ? 145.991 126.258 140.282 1.00 29.94  ? 50   TYR C CD2   1 
ATOM   1681  C  CE1   . TYR C 3 142 ? 144.572 126.056 137.934 1.00 29.94  ? 50   TYR C CE1   1 
ATOM   1682  C  CE2   . TYR C 3 142 ? 146.496 125.513 139.245 1.00 29.94  ? 50   TYR C CE2   1 
ATOM   1683  C  CZ    . TYR C 3 142 ? 145.783 125.421 138.073 1.00 29.94  ? 50   TYR C CZ    1 
ATOM   1684  O  OH    . TYR C 3 142 ? 146.283 124.684 137.031 1.00 29.94  ? 50   TYR C OH    1 
ATOM   1685  N  N     . LEU C 3 143 ? 142.281 130.106 140.675 1.00 26.05  ? 51   LEU C N     1 
ATOM   1686  C  CA    . LEU C 3 143 ? 141.284 130.705 139.799 1.00 26.05  ? 51   LEU C CA    1 
ATOM   1687  C  C     . LEU C 3 143 ? 141.630 132.151 139.470 1.00 26.05  ? 51   LEU C C     1 
ATOM   1688  O  O     . LEU C 3 143 ? 141.450 132.591 138.330 1.00 26.05  ? 51   LEU C O     1 
ATOM   1689  C  CB    . LEU C 3 143 ? 139.907 130.599 140.435 1.00 26.05  ? 51   LEU C CB    1 
ATOM   1690  C  CG    . LEU C 3 143 ? 138.741 131.101 139.600 1.00 26.05  ? 51   LEU C CG    1 
ATOM   1691  C  CD1   . LEU C 3 143 ? 138.768 130.487 138.229 1.00 26.05  ? 51   LEU C CD1   1 
ATOM   1692  C  CD2   . LEU C 3 143 ? 137.480 130.710 140.309 1.00 26.05  ? 51   LEU C CD2   1 
ATOM   1693  N  N     . ALA C 3 144 ? 142.085 132.916 140.468 1.00 28.39  ? 52   ALA C N     1 
ATOM   1694  C  CA    . ALA C 3 144 ? 142.515 134.289 140.228 1.00 28.39  ? 52   ALA C CA    1 
ATOM   1695  C  C     . ALA C 3 144 ? 143.705 134.342 139.281 1.00 28.39  ? 52   ALA C C     1 
ATOM   1696  O  O     . ALA C 3 144 ? 143.798 135.253 138.450 1.00 28.39  ? 52   ALA C O     1 
ATOM   1697  C  CB    . ALA C 3 144 ? 142.853 134.973 141.547 1.00 28.39  ? 52   ALA C CB    1 
ATOM   1698  N  N     . ALA C 3 145 ? 144.623 133.374 139.389 1.00 29.86  ? 53   ALA C N     1 
ATOM   1699  C  CA    . ALA C 3 145 ? 145.748 133.307 138.457 1.00 29.86  ? 53   ALA C CA    1 
ATOM   1700  C  C     . ALA C 3 145 ? 145.284 133.051 137.030 1.00 29.86  ? 53   ALA C C     1 
ATOM   1701  O  O     . ALA C 3 145 ? 145.774 133.688 136.088 1.00 29.86  ? 53   ALA C O     1 
ATOM   1702  C  CB    . ALA C 3 145 ? 146.721 132.219 138.884 1.00 29.86  ? 53   ALA C CB    1 
ATOM   1703  N  N     . VAL C 3 146 ? 144.334 132.132 136.852 1.00 26.84  ? 54   VAL C N     1 
ATOM   1704  C  CA    . VAL C 3 146 ? 143.830 131.833 135.512 1.00 26.84  ? 54   VAL C CA    1 
ATOM   1705  C  C     . VAL C 3 146 ? 143.075 133.027 134.932 1.00 26.84  ? 54   VAL C C     1 
ATOM   1706  O  O     . VAL C 3 146 ? 143.247 133.373 133.751 1.00 26.84  ? 54   VAL C O     1 
ATOM   1707  C  CB    . VAL C 3 146 ? 142.965 130.563 135.558 1.00 26.84  ? 54   VAL C CB    1 
ATOM   1708  C  CG1   . VAL C 3 146 ? 142.238 130.338 134.245 1.00 26.84  ? 54   VAL C CG1   1 
ATOM   1709  C  CG2   . VAL C 3 146 ? 143.844 129.384 135.881 1.00 26.84  ? 54   VAL C CG2   1 
ATOM   1710  N  N     . LEU C 3 147 ? 142.259 133.695 135.756 1.00 27.33  ? 55   LEU C N     1 
ATOM   1711  C  CA    . LEU C 3 147 ? 141.533 134.879 135.303 1.00 27.33  ? 55   LEU C CA    1 
ATOM   1712  C  C     . LEU C 3 147 ? 142.473 136.016 134.923 1.00 27.33  ? 55   LEU C C     1 
ATOM   1713  O  O     . LEU C 3 147 ? 142.277 136.659 133.883 1.00 27.33  ? 55   LEU C O     1 
ATOM   1714  C  CB    . LEU C 3 147 ? 140.554 135.342 136.378 1.00 27.33  ? 55   LEU C CB    1 
ATOM   1715  C  CG    . LEU C 3 147 ? 139.337 134.455 136.618 1.00 27.33  ? 55   LEU C CG    1 
ATOM   1716  C  CD1   . LEU C 3 147 ? 138.541 134.951 137.806 1.00 27.33  ? 55   LEU C CD1   1 
ATOM   1717  C  CD2   . LEU C 3 147 ? 138.479 134.443 135.382 1.00 27.33  ? 55   LEU C CD2   1 
ATOM   1718  N  N     . GLU C 3 148 ? 143.498 136.280 135.743 1.00 30.98  ? 56   GLU C N     1 
ATOM   1719  C  CA    . GLU C 3 148 ? 144.441 137.347 135.417 1.00 30.98  ? 56   GLU C CA    1 
ATOM   1720  C  C     . GLU C 3 148 ? 145.250 137.014 134.169 1.00 30.98  ? 56   GLU C C     1 
ATOM   1721  O  O     . GLU C 3 148 ? 145.562 137.912 133.381 1.00 30.98  ? 56   GLU C O     1 
ATOM   1722  C  CB    . GLU C 3 148 ? 145.341 137.682 136.615 1.00 30.98  ? 56   GLU C CB    1 
ATOM   1723  C  CG    . GLU C 3 148 ? 146.511 136.758 136.929 1.00 30.98  ? 56   GLU C CG    1 
ATOM   1724  C  CD    . GLU C 3 148 ? 147.803 137.206 136.273 1.00 30.98  ? 56   GLU C CD    1 
ATOM   1725  O  OE1   . GLU C 3 148 ? 147.853 138.356 135.794 1.00 30.98  ? 56   GLU C OE1   1 
ATOM   1726  O  OE2   . GLU C 3 148 ? 148.768 136.413 136.241 1.00 30.98  ? 56   GLU C OE2   1 
ATOM   1727  N  N     . TYR C 3 149 ? 145.605 135.737 133.970 1.00 31.29  ? 57   TYR C N     1 
ATOM   1728  C  CA    . TYR C 3 149 ? 146.345 135.361 132.770 1.00 31.29  ? 57   TYR C CA    1 
ATOM   1729  C  C     . TYR C 3 149 ? 145.509 135.564 131.513 1.00 31.29  ? 57   TYR C C     1 
ATOM   1730  O  O     . TYR C 3 149 ? 146.005 136.095 130.512 1.00 31.29  ? 57   TYR C O     1 
ATOM   1731  C  CB    . TYR C 3 149 ? 146.833 133.917 132.848 1.00 31.29  ? 57   TYR C CB    1 
ATOM   1732  C  CG    . TYR C 3 149 ? 147.314 133.422 131.506 1.00 31.29  ? 57   TYR C CG    1 
ATOM   1733  C  CD1   . TYR C 3 149 ? 148.523 133.867 130.990 1.00 31.29  ? 57   TYR C CD1   1 
ATOM   1734  C  CD2   . TYR C 3 149 ? 146.577 132.505 130.762 1.00 31.29  ? 57   TYR C CD2   1 
ATOM   1735  C  CE1   . TYR C 3 149 ? 148.980 133.434 129.764 1.00 31.29  ? 57   TYR C CE1   1 
ATOM   1736  C  CE2   . TYR C 3 149 ? 147.026 132.067 129.533 1.00 31.29  ? 57   TYR C CE2   1 
ATOM   1737  C  CZ    . TYR C 3 149 ? 148.230 132.533 129.041 1.00 31.29  ? 57   TYR C CZ    1 
ATOM   1738  O  OH    . TYR C 3 149 ? 148.688 132.098 127.819 1.00 31.29  ? 57   TYR C OH    1 
ATOM   1739  N  N     . LEU C 3 150 ? 144.255 135.091 131.526 1.00 29.47  ? 58   LEU C N     1 
ATOM   1740  C  CA    . LEU C 3 150 ? 143.386 135.263 130.360 1.00 29.47  ? 58   LEU C CA    1 
ATOM   1741  C  C     . LEU C 3 150 ? 143.102 136.734 130.079 1.00 29.47  ? 58   LEU C C     1 
ATOM   1742  O  O     . LEU C 3 150 ? 143.099 137.160 128.914 1.00 29.47  ? 58   LEU C O     1 
ATOM   1743  C  CB    . LEU C 3 150 ? 142.085 134.493 130.554 1.00 29.47  ? 58   LEU C CB    1 
ATOM   1744  C  CG    . LEU C 3 150 ? 142.310 132.987 130.490 1.00 29.47  ? 58   LEU C CG    1 
ATOM   1745  C  CD1   . LEU C 3 150 ? 141.057 132.226 130.869 1.00 29.47  ? 58   LEU C CD1   1 
ATOM   1746  C  CD2   . LEU C 3 150 ? 142.778 132.602 129.107 1.00 29.47  ? 58   LEU C CD2   1 
ATOM   1747  N  N     . THR C 3 151 ? 142.891 137.526 131.139 1.00 29.40  ? 59   THR C N     1 
ATOM   1748  C  CA    . THR C 3 151 ? 142.691 138.964 130.994 1.00 29.40  ? 59   THR C CA    1 
ATOM   1749  C  C     . THR C 3 151 ? 143.921 139.640 130.400 1.00 29.40  ? 59   THR C C     1 
ATOM   1750  O  O     . THR C 3 151 ? 143.799 140.484 129.504 1.00 29.40  ? 59   THR C O     1 
ATOM   1751  C  CB    . THR C 3 151 ? 142.346 139.559 132.358 1.00 29.40  ? 59   THR C CB    1 
ATOM   1752  O  OG1   . THR C 3 151 ? 141.074 139.062 132.779 1.00 29.40  ? 59   THR C OG1   1 
ATOM   1753  C  CG2   . THR C 3 151 ? 142.304 141.071 132.323 1.00 29.40  ? 59   THR C CG2   1 
ATOM   1754  N  N     . ALA C 3 152 ? 145.116 139.240 130.849 1.00 30.68  ? 60   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3 152 ? 146.349 139.811 130.321 1.00 30.68  ? 60   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3 152 ? 146.553 139.440 128.860 1.00 30.68  ? 60   ALA C C     1 
ATOM   1757  O  O     . ALA C 3 152 ? 146.984 140.279 128.065 1.00 30.68  ? 60   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3 152 ? 147.543 139.354 131.156 1.00 30.68  ? 60   ALA C CB    1 
ATOM   1759  N  N     . GLU C 3 153 ? 146.262 138.186 128.498 1.00 29.02  ? 61   GLU C N     1 
ATOM   1760  C  CA    . GLU C 3 153 ? 146.398 137.743 127.111 1.00 29.02  ? 61   GLU C CA    1 
ATOM   1761  C  C     . GLU C 3 153 ? 145.470 138.513 126.174 1.00 29.02  ? 61   GLU C C     1 
ATOM   1762  O  O     . GLU C 3 153 ? 145.909 139.001 125.117 1.00 29.02  ? 61   GLU C O     1 
ATOM   1763  C  CB    . GLU C 3 153 ? 146.131 136.241 127.021 1.00 29.02  ? 61   GLU C CB    1 
ATOM   1764  C  CG    . GLU C 3 153 ? 145.656 135.746 125.667 1.00 29.02  ? 61   GLU C CG    1 
ATOM   1765  C  CD    . GLU C 3 153 ? 146.795 135.497 124.700 1.00 29.02  ? 61   GLU C CD    1 
ATOM   1766  O  OE1   . GLU C 3 153 ? 147.968 135.634 125.106 1.00 29.02  ? 61   GLU C OE1   1 
ATOM   1767  O  OE2   . GLU C 3 153 ? 146.518 135.150 123.533 1.00 29.02  ? 61   GLU C OE2   1 
ATOM   1768  N  N     . ILE C 3 154 ? 144.207 138.698 126.572 1.00 27.81  ? 62   ILE C N     1 
ATOM   1769  C  CA    . ILE C 3 154 ? 143.288 139.375 125.660 1.00 27.81  ? 62   ILE C CA    1 
ATOM   1770  C  C     . ILE C 3 154 ? 143.576 140.876 125.624 1.00 27.81  ? 62   ILE C C     1 
ATOM   1771  O  O     . ILE C 3 154 ? 143.493 141.501 124.560 1.00 27.81  ? 62   ILE C O     1 
ATOM   1772  C  CB    . ILE C 3 154 ? 141.815 139.052 125.996 1.00 27.81  ? 62   ILE C CB    1 
ATOM   1773  C  CG1   . ILE C 3 154 ? 140.865 139.694 124.983 1.00 27.81  ? 62   ILE C CG1   1 
ATOM   1774  C  CG2   . ILE C 3 154 ? 141.428 139.488 127.387 1.00 27.81  ? 62   ILE C CG2   1 
ATOM   1775  C  CD1   . ILE C 3 154 ? 139.417 139.348 125.201 1.00 27.81  ? 62   ILE C CD1   1 
ATOM   1776  N  N     . LEU C 3 155 ? 143.961 141.477 126.760 1.00 31.86  ? 63   LEU C N     1 
ATOM   1777  C  CA    . LEU C 3 155 ? 144.321 142.891 126.751 1.00 31.86  ? 63   LEU C CA    1 
ATOM   1778  C  C     . LEU C 3 155 ? 145.609 143.142 125.983 1.00 31.86  ? 63   LEU C C     1 
ATOM   1779  O  O     . LEU C 3 155 ? 145.760 144.205 125.383 1.00 31.86  ? 63   LEU C O     1 
ATOM   1780  C  CB    . LEU C 3 155 ? 144.451 143.429 128.171 1.00 31.86  ? 63   LEU C CB    1 
ATOM   1781  C  CG    . LEU C 3 155 ? 143.146 143.768 128.883 1.00 31.86  ? 63   LEU C CG    1 
ATOM   1782  C  CD1   . LEU C 3 155 ? 143.461 144.468 130.186 1.00 31.86  ? 63   LEU C CD1   1 
ATOM   1783  C  CD2   . LEU C 3 155 ? 142.242 144.618 128.011 1.00 31.86  ? 63   LEU C CD2   1 
ATOM   1784  N  N     . GLU C 3 156 ? 146.525 142.173 125.958 1.00 32.53  ? 64   GLU C N     1 
ATOM   1785  C  CA    . GLU C 3 156 ? 147.744 142.329 125.174 1.00 32.53  ? 64   GLU C CA    1 
ATOM   1786  C  C     . GLU C 3 156 ? 147.438 142.293 123.685 1.00 32.53  ? 64   GLU C C     1 
ATOM   1787  O  O     . GLU C 3 156 ? 147.959 143.114 122.919 1.00 32.53  ? 64   GLU C O     1 
ATOM   1788  C  CB    . GLU C 3 156 ? 148.761 141.252 125.545 1.00 32.53  ? 64   GLU C CB    1 
ATOM   1789  C  CG    . GLU C 3 156 ? 150.075 141.382 124.796 1.00 32.53  ? 64   GLU C CG    1 
ATOM   1790  C  CD    . GLU C 3 156 ? 151.132 140.417 125.288 1.00 32.53  ? 64   GLU C CD    1 
ATOM   1791  O  OE1   . GLU C 3 156 ? 150.864 139.682 126.261 1.00 32.53  ? 64   GLU C OE1   1 
ATOM   1792  O  OE2   . GLU C 3 156 ? 152.234 140.397 124.703 1.00 32.53  ? 64   GLU C OE2   1 
ATOM   1793  N  N     . LEU C 3 157 ? 146.622 141.322 123.253 1.00 33.12  ? 65   LEU C N     1 
ATOM   1794  C  CA    . LEU C 3 157 ? 146.227 141.273 121.844 1.00 33.12  ? 65   LEU C CA    1 
ATOM   1795  C  C     . LEU C 3 157 ? 145.440 142.516 121.429 1.00 33.12  ? 65   LEU C C     1 
ATOM   1796  O  O     . LEU C 3 157 ? 145.659 143.057 120.336 1.00 33.12  ? 65   LEU C O     1 
ATOM   1797  C  CB    . LEU C 3 157 ? 145.421 140.010 121.561 1.00 33.12  ? 65   LEU C CB    1 
ATOM   1798  C  CG    . LEU C 3 157 ? 146.209 138.711 121.657 1.00 33.12  ? 65   LEU C CG    1 
ATOM   1799  C  CD1   . LEU C 3 157 ? 145.277 137.535 121.529 1.00 33.12  ? 65   LEU C CD1   1 
ATOM   1800  C  CD2   . LEU C 3 157 ? 147.263 138.673 120.571 1.00 33.12  ? 65   LEU C CD2   1 
ATOM   1801  N  N     . ALA C 3 158 ? 144.543 142.998 122.297 1.00 35.39  ? 66   ALA C N     1 
ATOM   1802  C  CA    . ALA C 3 158 ? 143.792 144.220 122.013 1.00 35.39  ? 66   ALA C CA    1 
ATOM   1803  C  C     . ALA C 3 158 ? 144.707 145.436 121.934 1.00 35.39  ? 66   ALA C C     1 
ATOM   1804  O  O     . ALA C 3 158 ? 144.521 146.300 121.073 1.00 35.39  ? 66   ALA C O     1 
ATOM   1805  C  CB    . ALA C 3 158 ? 142.712 144.432 123.068 1.00 35.39  ? 66   ALA C CB    1 
ATOM   1806  N  N     . GLY C 3 159 ? 145.639 145.559 122.887 1.00 38.32  ? 67   GLY C N     1 
ATOM   1807  C  CA    . GLY C 3 159 ? 146.613 146.639 122.860 1.00 38.32  ? 67   GLY C CA    1 
ATOM   1808  C  C     . GLY C 3 159 ? 147.449 146.658 121.597 1.00 38.32  ? 67   GLY C C     1 
ATOM   1809  O  O     . GLY C 3 159 ? 147.687 147.720 121.018 1.00 38.32  ? 67   GLY C O     1 
ATOM   1810  N  N     . ASN C 3 160 ? 147.948 145.486 121.183 1.00 38.02  ? 68   ASN C N     1 
ATOM   1811  C  CA    . ASN C 3 160 ? 148.686 145.390 119.924 1.00 38.02  ? 68   ASN C CA    1 
ATOM   1812  C  C     . ASN C 3 160 ? 147.822 145.776 118.728 1.00 38.02  ? 68   ASN C C     1 
ATOM   1813  O  O     . ASN C 3 160 ? 148.301 146.451 117.810 1.00 38.02  ? 68   ASN C O     1 
ATOM   1814  C  CB    . ASN C 3 160 ? 149.259 143.987 119.747 1.00 38.02  ? 68   ASN C CB    1 
ATOM   1815  C  CG    . ASN C 3 160 ? 150.274 143.644 120.813 1.00 38.02  ? 68   ASN C CG    1 
ATOM   1816  O  OD1   . ASN C 3 160 ? 150.763 144.522 121.522 1.00 38.02  ? 68   ASN C OD1   1 
ATOM   1817  N  ND2   . ASN C 3 160 ? 150.605 142.365 120.927 1.00 38.02  ? 68   ASN C ND2   1 
ATOM   1818  N  N     . ALA C 3 161 ? 146.549 145.365 118.724 1.00 38.99  ? 69   ALA C N     1 
ATOM   1819  C  CA    . ALA C 3 161 ? 145.656 145.728 117.625 1.00 38.99  ? 69   ALA C CA    1 
ATOM   1820  C  C     . ALA C 3 161 ? 145.390 147.231 117.590 1.00 38.99  ? 69   ALA C C     1 
ATOM   1821  O  O     . ALA C 3 161 ? 145.335 147.831 116.511 1.00 38.99  ? 69   ALA C O     1 
ATOM   1822  C  CB    . ALA C 3 161 ? 144.345 144.955 117.731 1.00 38.99  ? 69   ALA C CB    1 
ATOM   1823  N  N     . ALA C 3 162 ? 145.194 147.844 118.760 1.00 37.60  ? 70   ALA C N     1 
ATOM   1824  C  CA    . ALA C 3 162 ? 144.978 149.286 118.835 1.00 37.60  ? 70   ALA C CA    1 
ATOM   1825  C  C     . ALA C 3 162 ? 146.216 150.069 118.421 1.00 37.60  ? 70   ALA C C     1 
ATOM   1826  O  O     . ALA C 3 162 ? 146.109 151.081 117.720 1.00 37.60  ? 70   ALA C O     1 
ATOM   1827  C  CB    . ALA C 3 162 ? 144.563 149.680 120.249 1.00 37.60  ? 70   ALA C CB    1 
ATOM   1828  N  N     . ARG C 3 163 ? 147.395 149.638 118.881 1.00 41.49  ? 71   ARG C N     1 
ATOM   1829  C  CA    . ARG C 3 163 ? 148.641 150.310 118.522 1.00 41.49  ? 71   ARG C CA    1 
ATOM   1830  C  C     . ARG C 3 163 ? 148.930 150.185 117.030 1.00 41.49  ? 71   ARG C C     1 
ATOM   1831  O  O     . ARG C 3 163 ? 149.415 151.134 116.404 1.00 41.49  ? 71   ARG C O     1 
ATOM   1832  C  CB    . ARG C 3 163 ? 149.790 149.756 119.364 1.00 41.49  ? 71   ARG C CB    1 
ATOM   1833  C  CG    . ARG C 3 163 ? 151.143 150.369 119.075 1.00 41.49  ? 71   ARG C CG    1 
ATOM   1834  C  CD    . ARG C 3 163 ? 152.251 149.553 119.705 1.00 41.49  ? 71   ARG C CD    1 
ATOM   1835  N  NE    . ARG C 3 163 ? 152.281 148.184 119.204 1.00 41.49  ? 71   ARG C NE    1 
ATOM   1836  C  CZ    . ARG C 3 163 ? 153.121 147.252 119.639 1.00 41.49  ? 71   ARG C CZ    1 
ATOM   1837  N  NH1   . ARG C 3 163 ? 154.000 147.541 120.588 1.00 41.49  ? 71   ARG C NH1   1 
ATOM   1838  N  NH2   . ARG C 3 163 ? 153.082 146.030 119.128 1.00 41.49  ? 71   ARG C NH2   1 
ATOM   1839  N  N     . ASP C 3 164 ? 148.630 149.023 116.440 1.00 41.74  ? 72   ASP C N     1 
ATOM   1840  C  CA    . ASP C 3 164 ? 148.830 148.852 115.005 1.00 41.74  ? 72   ASP C CA    1 
ATOM   1841  C  C     . ASP C 3 164 ? 147.847 149.672 114.178 1.00 41.74  ? 72   ASP C C     1 
ATOM   1842  O  O     . ASP C 3 164 ? 148.100 149.903 112.992 1.00 41.74  ? 72   ASP C O     1 
ATOM   1843  C  CB    . ASP C 3 164 ? 148.748 147.376 114.616 1.00 41.74  ? 72   ASP C CB    1 
ATOM   1844  C  CG    . ASP C 3 164 ? 149.889 146.560 115.192 1.00 41.74  ? 72   ASP C CG    1 
ATOM   1845  O  OD1   . ASP C 3 164 ? 150.849 147.166 115.713 1.00 41.74  ? 72   ASP C OD1   1 
ATOM   1846  O  OD2   . ASP C 3 164 ? 149.829 145.315 115.123 1.00 41.74  ? 72   ASP C OD2   1 
ATOM   1847  N  N     . ASN C 3 165 ? 146.733 150.109 114.766 1.00 38.64  ? 73   ASN C N     1 
ATOM   1848  C  CA    . ASN C 3 165 ? 145.781 150.972 114.083 1.00 38.64  ? 73   ASN C CA    1 
ATOM   1849  C  C     . ASN C 3 165 ? 145.942 152.428 114.499 1.00 38.64  ? 73   ASN C C     1 
ATOM   1850  O  O     . ASN C 3 165 ? 145.024 153.231 114.291 1.00 38.64  ? 73   ASN C O     1 
ATOM   1851  C  CB    . ASN C 3 165 ? 144.352 150.496 114.337 1.00 38.64  ? 73   ASN C CB    1 
ATOM   1852  C  CG    . ASN C 3 165 ? 144.036 149.208 113.611 1.00 38.64  ? 73   ASN C CG    1 
ATOM   1853  O  OD1   . ASN C 3 165 ? 143.810 149.204 112.403 1.00 38.64  ? 73   ASN C OD1   1 
ATOM   1854  N  ND2   . ASN C 3 165 ? 144.028 148.102 114.344 1.00 38.64  ? 73   ASN C ND2   1 
ATOM   1855  N  N     . LYS C 3 166 ? 147.074 152.751 115.137 1.00 38.94  ? 74   LYS C N     1 
ATOM   1856  C  CA    . LYS C 3 166 ? 147.513 154.108 115.472 1.00 38.94  ? 74   LYS C CA    1 
ATOM   1857  C  C     . LYS C 3 166 ? 146.586 154.800 116.464 1.00 38.94  ? 74   LYS C C     1 
ATOM   1858  O  O     . LYS C 3 166 ? 146.408 156.018 116.413 1.00 38.94  ? 74   LYS C O     1 
ATOM   1859  C  CB    . LYS C 3 166 ? 147.709 154.960 114.214 1.00 38.94  ? 74   LYS C CB    1 
ATOM   1860  C  CG    . LYS C 3 166 ? 148.722 154.353 113.258 1.00 38.94  ? 74   LYS C CG    1 
ATOM   1861  C  CD    . LYS C 3 166 ? 148.982 155.240 112.061 1.00 38.94  ? 74   LYS C CD    1 
ATOM   1862  C  CE    . LYS C 3 166 ? 150.030 154.624 111.155 1.00 38.94  ? 74   LYS C CE    1 
ATOM   1863  N  NZ    . LYS C 3 166 ? 150.363 155.517 110.016 1.00 38.94  ? 74   LYS C NZ    1 
ATOM   1864  N  N     . LYS C 3 167 ? 145.993 154.032 117.372 1.00 41.02  ? 75   LYS C N     1 
ATOM   1865  C  CA    . LYS C 3 167 ? 145.175 154.566 118.448 1.00 41.02  ? 75   LYS C CA    1 
ATOM   1866  C  C     . LYS C 3 167 ? 145.793 154.175 119.782 1.00 41.02  ? 75   LYS C C     1 
ATOM   1867  O  O     . LYS C 3 167 ? 146.450 153.138 119.899 1.00 41.02  ? 75   LYS C O     1 
ATOM   1868  C  CB    . LYS C 3 167 ? 143.735 154.055 118.370 1.00 41.02  ? 75   LYS C CB    1 
ATOM   1869  C  CG    . LYS C 3 167 ? 143.044 154.370 117.065 1.00 41.02  ? 75   LYS C CG    1 
ATOM   1870  C  CD    . LYS C 3 167 ? 142.751 155.852 116.962 1.00 41.02  ? 75   LYS C CD    1 
ATOM   1871  C  CE    . LYS C 3 167 ? 142.005 156.173 115.682 1.00 41.02  ? 75   LYS C CE    1 
ATOM   1872  N  NZ    . LYS C 3 167 ? 142.835 155.886 114.478 1.00 41.02  ? 75   LYS C NZ    1 
ATOM   1873  N  N     . THR C 3 168 ? 145.565 155.010 120.792 1.00 43.49  ? 76   THR C N     1 
ATOM   1874  C  CA    . THR C 3 168 ? 146.096 154.769 122.123 1.00 43.49  ? 76   THR C CA    1 
ATOM   1875  C  C     . THR C 3 168 ? 145.044 154.316 123.120 1.00 43.49  ? 76   THR C C     1 
ATOM   1876  O  O     . THR C 3 168 ? 145.405 153.873 124.214 1.00 43.49  ? 76   THR C O     1 
ATOM   1877  C  CB    . THR C 3 168 ? 146.781 156.030 122.663 1.00 43.49  ? 76   THR C CB    1 
ATOM   1878  O  OG1   . THR C 3 168 ? 147.275 155.776 123.982 1.00 43.49  ? 76   THR C OG1   1 
ATOM   1879  C  CG2   . THR C 3 168 ? 145.794 157.183 122.713 1.00 43.49  ? 76   THR C CG2   1 
ATOM   1880  N  N     . ARG C 3 169 ? 143.764 154.408 122.776 1.00 47.12  ? 77   ARG C N     1 
ATOM   1881  C  CA    . ARG C 3 169 ? 142.685 153.961 123.641 1.00 47.12  ? 77   ARG C CA    1 
ATOM   1882  C  C     . ARG C 3 169 ? 142.138 152.658 123.086 1.00 47.12  ? 77   ARG C C     1 
ATOM   1883  O  O     . ARG C 3 169 ? 141.816 152.577 121.897 1.00 47.12  ? 77   ARG C O     1 
ATOM   1884  C  CB    . ARG C 3 169 ? 141.556 154.993 123.703 1.00 47.12  ? 77   ARG C CB    1 
ATOM   1885  C  CG    . ARG C 3 169 ? 141.942 156.371 124.211 1.00 47.12  ? 77   ARG C CG    1 
ATOM   1886  C  CD    . ARG C 3 169 ? 142.389 156.382 125.658 1.00 47.12  ? 77   ARG C CD    1 
ATOM   1887  N  NE    . ARG C 3 169 ? 142.761 157.733 126.070 1.00 47.12  ? 77   ARG C NE    1 
ATOM   1888  C  CZ    . ARG C 3 169 ? 143.441 158.021 127.174 1.00 47.12  ? 77   ARG C CZ    1 
ATOM   1889  N  NH1   . ARG C 3 169 ? 143.837 157.051 127.981 1.00 47.12  ? 77   ARG C NH1   1 
ATOM   1890  N  NH2   . ARG C 3 169 ? 143.733 159.280 127.465 1.00 47.12  ? 77   ARG C NH2   1 
ATOM   1891  N  N     . ILE C 3 170 ? 142.044 151.639 123.939 1.00 37.27  ? 78   ILE C N     1 
ATOM   1892  C  CA    . ILE C 3 170 ? 141.452 150.382 123.509 1.00 37.27  ? 78   ILE C CA    1 
ATOM   1893  C  C     . ILE C 3 170 ? 139.951 150.592 123.373 1.00 37.27  ? 78   ILE C C     1 
ATOM   1894  O  O     . ILE C 3 170 ? 139.301 151.169 124.252 1.00 37.27  ? 78   ILE C O     1 
ATOM   1895  C  CB    . ILE C 3 170 ? 141.799 149.256 124.499 1.00 37.27  ? 78   ILE C CB    1 
ATOM   1896  C  CG1   . ILE C 3 170 ? 143.300 148.976 124.467 1.00 37.27  ? 78   ILE C CG1   1 
ATOM   1897  C  CG2   . ILE C 3 170 ? 141.048 147.980 124.183 1.00 37.27  ? 78   ILE C CG2   1 
ATOM   1898  C  CD1   . ILE C 3 170 ? 143.752 147.970 125.490 1.00 37.27  ? 78   ILE C CD1   1 
ATOM   1899  N  N     . ILE C 3 171 ? 139.394 150.126 122.264 1.00 34.57  ? 79   ILE C N     1 
ATOM   1900  C  CA    . ILE C 3 171 ? 137.976 150.307 121.973 1.00 34.57  ? 79   ILE C CA    1 
ATOM   1901  C  C     . ILE C 3 171 ? 137.431 148.912 121.694 1.00 34.57  ? 79   ILE C C     1 
ATOM   1902  O  O     . ILE C 3 171 ? 138.226 147.984 121.477 1.00 34.57  ? 79   ILE C O     1 
ATOM   1903  C  CB    . ILE C 3 171 ? 137.791 151.280 120.776 1.00 34.57  ? 79   ILE C CB    1 
ATOM   1904  C  CG1   . ILE C 3 171 ? 136.480 152.072 120.777 1.00 34.57  ? 79   ILE C CG1   1 
ATOM   1905  C  CG2   . ILE C 3 171 ? 137.939 150.561 119.459 1.00 34.57  ? 79   ILE C CG2   1 
ATOM   1906  C  CD1   . ILE C 3 171 ? 136.272 152.903 122.016 1.00 34.57  ? 79   ILE C CD1   1 
ATOM   1907  N  N     . PRO C 3 172 ? 136.092 148.691 121.832 1.00 33.90  ? 80   PRO C N     1 
ATOM   1908  C  CA    . PRO C 3 172 ? 135.483 147.401 121.453 1.00 33.90  ? 80   PRO C CA    1 
ATOM   1909  C  C     . PRO C 3 172 ? 135.904 146.768 120.131 1.00 33.90  ? 80   PRO C C     1 
ATOM   1910  O  O     . PRO C 3 172 ? 135.963 145.538 120.038 1.00 33.90  ? 80   PRO C O     1 
ATOM   1911  C  CB    . PRO C 3 172 ? 133.993 147.740 121.455 1.00 33.90  ? 80   PRO C CB    1 
ATOM   1912  C  CG    . PRO C 3 172 ? 133.885 148.654 122.614 1.00 33.90  ? 80   PRO C CG    1 
ATOM   1913  C  CD    . PRO C 3 172 ? 135.162 149.443 122.694 1.00 33.90  ? 80   PRO C CD    1 
ATOM   1914  N  N     . ARG C 3 173 ? 136.125 147.591 119.103 1.00 34.41  ? 81   ARG C N     1 
ATOM   1915  C  CA    . ARG C 3 173 ? 136.612 147.104 117.814 1.00 34.41  ? 81   ARG C CA    1 
ATOM   1916  C  C     . ARG C 3 173 ? 137.940 146.364 117.962 1.00 34.41  ? 81   ARG C C     1 
ATOM   1917  O  O     . ARG C 3 173 ? 138.137 145.293 117.373 1.00 34.41  ? 81   ARG C O     1 
ATOM   1918  C  CB    . ARG C 3 173 ? 136.749 148.282 116.850 1.00 34.41  ? 81   ARG C CB    1 
ATOM   1919  C  CG    . ARG C 3 173 ? 137.310 147.943 115.495 1.00 34.41  ? 81   ARG C CG    1 
ATOM   1920  C  CD    . ARG C 3 173 ? 136.482 146.890 114.814 1.00 34.41  ? 81   ARG C CD    1 
ATOM   1921  N  NE    . ARG C 3 173 ? 136.870 146.729 113.423 1.00 34.41  ? 81   ARG C NE    1 
ATOM   1922  C  CZ    . ARG C 3 173 ? 136.289 145.879 112.591 1.00 34.41  ? 81   ARG C CZ    1 
ATOM   1923  N  NH1   . ARG C 3 173 ? 135.297 145.111 113.017 1.00 34.41  ? 81   ARG C NH1   1 
ATOM   1924  N  NH2   . ARG C 3 173 ? 136.705 145.789 111.338 1.00 34.41  ? 81   ARG C NH2   1 
ATOM   1925  N  N     . HIS C 3 174 ? 138.866 146.928 118.743 1.00 35.30  ? 82   HIS C N     1 
ATOM   1926  C  CA    . HIS C 3 174 ? 140.158 146.281 118.959 1.00 35.30  ? 82   HIS C CA    1 
ATOM   1927  C  C     . HIS C 3 174 ? 140.028 144.991 119.760 1.00 35.30  ? 82   HIS C C     1 
ATOM   1928  O  O     . HIS C 3 174 ? 140.783 144.043 119.520 1.00 35.30  ? 82   HIS C O     1 
ATOM   1929  C  CB    . HIS C 3 174 ? 141.119 147.250 119.632 1.00 35.30  ? 82   HIS C CB    1 
ATOM   1930  C  CG    . HIS C 3 174 ? 141.283 148.533 118.882 1.00 35.30  ? 82   HIS C CG    1 
ATOM   1931  N  ND1   . HIS C 3 174 ? 141.249 149.765 119.494 1.00 35.30  ? 82   HIS C ND1   1 
ATOM   1932  C  CD2   . HIS C 3 174 ? 141.460 148.774 117.562 1.00 35.30  ? 82   HIS C CD2   1 
ATOM   1933  C  CE1   . HIS C 3 174 ? 141.411 150.711 118.587 1.00 35.30  ? 82   HIS C CE1   1 
ATOM   1934  N  NE2   . HIS C 3 174 ? 141.540 150.136 117.406 1.00 35.30  ? 82   HIS C NE2   1 
ATOM   1935  N  N     . LEU C 3 175 ? 139.081 144.931 120.701 1.00 35.30  ? 83   LEU C N     1 
ATOM   1936  C  CA    . LEU C 3 175 ? 138.794 143.682 121.405 1.00 35.30  ? 83   LEU C CA    1 
ATOM   1937  C  C     . LEU C 3 175 ? 138.248 142.628 120.451 1.00 35.30  ? 83   LEU C C     1 
ATOM   1938  O  O     . LEU C 3 175 ? 138.601 141.445 120.548 1.00 35.30  ? 83   LEU C O     1 
ATOM   1939  C  CB    . LEU C 3 175 ? 137.806 143.932 122.542 1.00 35.30  ? 83   LEU C CB    1 
ATOM   1940  C  CG    . LEU C 3 175 ? 138.321 144.676 123.762 1.00 35.30  ? 83   LEU C CG    1 
ATOM   1941  C  CD1   . LEU C 3 175 ? 137.191 144.970 124.709 1.00 35.30  ? 83   LEU C CD1   1 
ATOM   1942  C  CD2   . LEU C 3 175 ? 139.327 143.799 124.454 1.00 35.30  ? 83   LEU C CD2   1 
ATOM   1943  N  N     . GLN C 3 176 ? 137.341 143.041 119.561 1.00 34.51  ? 84   GLN C N     1 
ATOM   1944  C  CA    . GLN C 3 176 ? 136.766 142.149 118.559 1.00 34.51  ? 84   GLN C CA    1 
ATOM   1945  C  C     . GLN C 3 176 ? 137.845 141.574 117.648 1.00 34.51  ? 84   GLN C C     1 
ATOM   1946  O  O     . GLN C 3 176 ? 137.847 140.374 117.350 1.00 34.51  ? 84   GLN C O     1 
ATOM   1947  C  CB    . GLN C 3 176 ? 135.726 142.918 117.748 1.00 34.51  ? 84   GLN C CB    1 
ATOM   1948  C  CG    . GLN C 3 176 ? 135.095 142.154 116.616 1.00 34.51  ? 84   GLN C CG    1 
ATOM   1949  C  CD    . GLN C 3 176 ? 134.072 141.164 117.110 1.00 34.51  ? 84   GLN C CD    1 
ATOM   1950  O  OE1   . GLN C 3 176 ? 133.564 141.291 118.221 1.00 34.51  ? 84   GLN C OE1   1 
ATOM   1951  N  NE2   . GLN C 3 176 ? 133.742 140.185 116.281 1.00 34.51  ? 84   GLN C NE2   1 
ATOM   1952  N  N     . LEU C 3 177 ? 138.771 142.426 117.197 1.00 36.24  ? 85   LEU C N     1 
ATOM   1953  C  CA    . LEU C 3 177 ? 139.897 141.965 116.384 1.00 36.24  ? 85   LEU C CA    1 
ATOM   1954  C  C     . LEU C 3 177 ? 140.813 141.034 117.165 1.00 36.24  ? 85   LEU C C     1 
ATOM   1955  O  O     . LEU C 3 177 ? 141.306 140.039 116.621 1.00 36.24  ? 85   LEU C O     1 
ATOM   1956  C  CB    . LEU C 3 177 ? 140.688 143.150 115.836 1.00 36.24  ? 85   LEU C CB    1 
ATOM   1957  C  CG    . LEU C 3 177 ? 140.332 143.632 114.427 1.00 36.24  ? 85   LEU C CG    1 
ATOM   1958  C  CD1   . LEU C 3 177 ? 138.943 144.205 114.331 1.00 36.24  ? 85   LEU C CD1   1 
ATOM   1959  C  CD2   . LEU C 3 177 ? 141.365 144.653 113.967 1.00 36.24  ? 85   LEU C CD2   1 
ATOM   1960  N  N     . ALA C 3 178 ? 141.097 141.384 118.424 1.00 35.76  ? 86   ALA C N     1 
ATOM   1961  C  CA    . ALA C 3 178 ? 141.911 140.550 119.306 1.00 35.76  ? 86   ALA C CA    1 
ATOM   1962  C  C     . ALA C 3 178 ? 141.325 139.153 119.463 1.00 35.76  ? 86   ALA C C     1 
ATOM   1963  O  O     . ALA C 3 178 ? 142.057 138.157 119.471 1.00 35.76  ? 86   ALA C O     1 
ATOM   1964  C  CB    . ALA C 3 178 ? 142.046 141.226 120.666 1.00 35.76  ? 86   ALA C CB    1 
ATOM   1965  N  N     . VAL C 3 179 ? 140.008 139.066 119.628 1.00 35.89  ? 87   VAL C N     1 
ATOM   1966  C  CA    . VAL C 3 179 ? 139.377 137.766 119.808 1.00 35.89  ? 87   VAL C CA    1 
ATOM   1967  C  C     . VAL C 3 179 ? 139.349 136.999 118.491 1.00 35.89  ? 87   VAL C C     1 
ATOM   1968  O  O     . VAL C 3 179 ? 139.841 135.869 118.405 1.00 35.89  ? 87   VAL C O     1 
ATOM   1969  C  CB    . VAL C 3 179 ? 137.964 137.934 120.392 1.00 35.89  ? 87   VAL C CB    1 
ATOM   1970  C  CG1   . VAL C 3 179 ? 137.195 136.628 120.311 1.00 35.89  ? 87   VAL C CG1   1 
ATOM   1971  C  CG2   . VAL C 3 179 ? 138.048 138.409 121.825 1.00 35.89  ? 87   VAL C CG2   1 
ATOM   1972  N  N     . ARG C 3 180 ? 138.775 137.600 117.446 1.00 36.03  ? 88   ARG C N     1 
ATOM   1973  C  CA    . ARG C 3 180 ? 138.571 136.888 116.190 1.00 36.03  ? 88   ARG C CA    1 
ATOM   1974  C  C     . ARG C 3 180 ? 139.855 136.631 115.403 1.00 36.03  ? 88   ARG C C     1 
ATOM   1975  O  O     . ARG C 3 180 ? 139.829 135.825 114.469 1.00 36.03  ? 88   ARG C O     1 
ATOM   1976  C  CB    . ARG C 3 180 ? 137.572 137.644 115.319 1.00 36.03  ? 88   ARG C CB    1 
ATOM   1977  C  CG    . ARG C 3 180 ? 136.221 137.895 115.954 1.00 36.03  ? 88   ARG C CG    1 
ATOM   1978  C  CD    . ARG C 3 180 ? 135.631 136.652 116.581 1.00 36.03  ? 88   ARG C CD    1 
ATOM   1979  N  NE    . ARG C 3 180 ? 134.174 136.700 116.550 1.00 36.03  ? 88   ARG C NE    1 
ATOM   1980  C  CZ    . ARG C 3 180 ? 133.417 136.961 117.608 1.00 36.03  ? 88   ARG C CZ    1 
ATOM   1981  N  NH1   . ARG C 3 180 ? 133.980 137.193 118.785 1.00 36.03  ? 88   ARG C NH1   1 
ATOM   1982  N  NH2   . ARG C 3 180 ? 132.097 136.990 117.489 1.00 36.03  ? 88   ARG C NH2   1 
ATOM   1983  N  N     . ASN C 3 181 ? 140.969 137.293 115.729 1.00 39.37  ? 89   ASN C N     1 
ATOM   1984  C  CA    . ASN C 3 181 ? 142.214 137.038 115.012 1.00 39.37  ? 89   ASN C CA    1 
ATOM   1985  C  C     . ASN C 3 181 ? 143.095 135.988 115.671 1.00 39.37  ? 89   ASN C C     1 
ATOM   1986  O  O     . ASN C 3 181 ? 143.999 135.461 115.014 1.00 39.37  ? 89   ASN C O     1 
ATOM   1987  C  CB    . ASN C 3 181 ? 143.026 138.327 114.858 1.00 39.37  ? 89   ASN C CB    1 
ATOM   1988  C  CG    . ASN C 3 181 ? 142.597 139.145 113.663 1.00 39.37  ? 89   ASN C CG    1 
ATOM   1989  O  OD1   . ASN C 3 181 ? 142.312 138.602 112.599 1.00 39.37  ? 89   ASN C OD1   1 
ATOM   1990  N  ND2   . ASN C 3 181 ? 142.558 140.461 113.828 1.00 39.37  ? 89   ASN C ND2   1 
ATOM   1991  N  N     . ASP C 3 182 ? 142.870 135.681 116.940 1.00 43.46  ? 90   ASP C N     1 
ATOM   1992  C  CA    . ASP C 3 182 ? 143.615 134.641 117.641 1.00 43.46  ? 90   ASP C CA    1 
ATOM   1993  C  C     . ASP C 3 182 ? 142.748 133.389 117.664 1.00 43.46  ? 90   ASP C C     1 
ATOM   1994  O  O     . ASP C 3 182 ? 141.695 133.376 118.307 1.00 43.46  ? 90   ASP C O     1 
ATOM   1995  C  CB    . ASP C 3 182 ? 144.001 135.084 119.046 1.00 43.46  ? 90   ASP C CB    1 
ATOM   1996  C  CG    . ASP C 3 182 ? 145.000 134.147 119.693 1.00 43.46  ? 90   ASP C CG    1 
ATOM   1997  O  OD1   . ASP C 3 182 ? 146.202 134.251 119.377 1.00 43.46  ? 90   ASP C OD1   1 
ATOM   1998  O  OD2   . ASP C 3 182 ? 144.584 133.304 120.514 1.00 43.46  ? 90   ASP C OD2   1 
ATOM   1999  N  N     . GLU C 3 183 ? 143.162 132.385 116.877 1.00 46.25  ? 91   GLU C N     1 
ATOM   2000  C  CA    . GLU C 3 183 ? 142.493 131.088 116.731 1.00 46.25  ? 91   GLU C CA    1 
ATOM   2001  C  C     . GLU C 3 183 ? 142.004 130.464 118.039 1.00 46.25  ? 91   GLU C C     1 
ATOM   2002  O  O     . GLU C 3 183 ? 140.863 129.996 118.128 1.00 46.25  ? 91   GLU C O     1 
ATOM   2003  C  CB    . GLU C 3 183 ? 143.442 130.116 116.016 1.00 46.25  ? 91   GLU C CB    1 
ATOM   2004  C  CG    . GLU C 3 183 ? 144.290 130.726 114.892 1.00 46.25  ? 91   GLU C CG    1 
ATOM   2005  C  CD    . GLU C 3 183 ? 143.490 131.242 113.695 1.00 46.25  ? 91   GLU C CD    1 
ATOM   2006  O  OE1   . GLU C 3 183 ? 144.062 132.022 112.904 1.00 46.25  ? 91   GLU C OE1   1 
ATOM   2007  O  OE2   . GLU C 3 183 ? 142.322 130.840 113.505 1.00 46.25  ? 91   GLU C OE2   1 
ATOM   2008  N  N     . GLU C 3 184 ? 142.862 130.452 119.063 1.00 43.18  ? 92   GLU C N     1 
ATOM   2009  C  CA    . GLU C 3 184 ? 142.519 129.809 120.329 1.00 43.18  ? 92   GLU C CA    1 
ATOM   2010  C  C     . GLU C 3 184 ? 141.432 130.578 121.069 1.00 43.18  ? 92   GLU C C     1 
ATOM   2011  O  O     . GLU C 3 184 ? 140.454 129.987 121.545 1.00 43.18  ? 92   GLU C O     1 
ATOM   2012  C  CB    . GLU C 3 184 ? 143.769 129.687 121.193 1.00 43.18  ? 92   GLU C CB    1 
ATOM   2013  C  CG    . GLU C 3 184 ? 144.775 128.687 120.667 1.00 43.18  ? 92   GLU C CG    1 
ATOM   2014  C  CD    . GLU C 3 184 ? 146.103 128.771 121.385 1.00 43.18  ? 92   GLU C CD    1 
ATOM   2015  O  OE1   . GLU C 3 184 ? 146.431 129.859 121.904 1.00 43.18  ? 92   GLU C OE1   1 
ATOM   2016  O  OE2   . GLU C 3 184 ? 146.817 127.749 121.431 1.00 43.18  ? 92   GLU C OE2   1 
ATOM   2017  N  N     . LEU C 3 185 ? 141.603 131.897 121.195 1.00 41.78  ? 93   LEU C N     1 
ATOM   2018  C  CA    . LEU C 3 185 ? 140.578 132.731 121.814 1.00 41.78  ? 93   LEU C CA    1 
ATOM   2019  C  C     . LEU C 3 185 ? 139.294 132.731 120.995 1.00 41.78  ? 93   LEU C C     1 
ATOM   2020  O  O     . LEU C 3 185 ? 138.199 132.853 121.554 1.00 41.78  ? 93   LEU C O     1 
ATOM   2021  C  CB    . LEU C 3 185 ? 141.099 134.150 122.017 1.00 41.78  ? 93   LEU C CB    1 
ATOM   2022  C  CG    . LEU C 3 185 ? 141.987 134.302 123.251 1.00 41.78  ? 93   LEU C CG    1 
ATOM   2023  C  CD1   . LEU C 3 185 ? 142.542 135.702 123.336 1.00 41.78  ? 93   LEU C CD1   1 
ATOM   2024  C  CD2   . LEU C 3 185 ? 141.211 133.964 124.506 1.00 41.78  ? 93   LEU C CD2   1 
ATOM   2025  N  N     . ASN C 3 186 ? 139.417 132.657 119.665 1.00 43.00  ? 94   ASN C N     1 
ATOM   2026  C  CA    . ASN C 3 186 ? 138.249 132.506 118.800 1.00 43.00  ? 94   ASN C CA    1 
ATOM   2027  C  C     . ASN C 3 186 ? 137.486 131.234 119.137 1.00 43.00  ? 94   ASN C C     1 
ATOM   2028  O  O     . ASN C 3 186 ? 136.251 131.230 119.172 1.00 43.00  ? 94   ASN C O     1 
ATOM   2029  C  CB    . ASN C 3 186 ? 138.671 132.499 117.332 1.00 43.00  ? 94   ASN C CB    1 
ATOM   2030  C  CG    . ASN C 3 186 ? 137.486 132.453 116.384 1.00 43.00  ? 94   ASN C CG    1 
ATOM   2031  O  OD1   . ASN C 3 186 ? 136.380 132.873 116.727 1.00 43.00  ? 94   ASN C OD1   1 
ATOM   2032  N  ND2   . ASN C 3 186 ? 137.714 131.940 115.181 1.00 43.00  ? 94   ASN C ND2   1 
ATOM   2033  N  N     . LYS C 3 187 ? 138.213 130.131 119.338 1.00 44.61  ? 95   LYS C N     1 
ATOM   2034  C  CA    . LYS C 3 187 ? 137.594 128.865 119.719 1.00 44.61  ? 95   LYS C CA    1 
ATOM   2035  C  C     . LYS C 3 187 ? 136.896 128.977 121.072 1.00 44.61  ? 95   LYS C C     1 
ATOM   2036  O  O     . LYS C 3 187 ? 135.764 128.507 121.238 1.00 44.61  ? 95   LYS C O     1 
ATOM   2037  C  CB    . LYS C 3 187 ? 138.652 127.762 119.745 1.00 44.61  ? 95   LYS C CB    1 
ATOM   2038  C  CG    . LYS C 3 187 ? 138.103 126.362 119.931 1.00 44.61  ? 95   LYS C CG    1 
ATOM   2039  C  CD    . LYS C 3 187 ? 137.247 125.940 118.753 1.00 44.61  ? 95   LYS C CD    1 
ATOM   2040  C  CE    . LYS C 3 187 ? 136.730 124.524 118.938 1.00 44.61  ? 95   LYS C CE    1 
ATOM   2041  N  NZ    . LYS C 3 187 ? 135.903 124.085 117.785 1.00 44.61  ? 95   LYS C NZ    1 
ATOM   2042  N  N     . LEU C 3 188 ? 137.584 129.555 122.063 1.00 39.90  ? 96   LEU C N     1 
ATOM   2043  C  CA    . LEU C 3 188 ? 136.989 129.767 123.384 1.00 39.90  ? 96   LEU C CA    1 
ATOM   2044  C  C     . LEU C 3 188 ? 135.781 130.698 123.335 1.00 39.90  ? 96   LEU C C     1 
ATOM   2045  O  O     . LEU C 3 188 ? 134.794 130.482 124.047 1.00 39.90  ? 96   LEU C O     1 
ATOM   2046  C  CB    . LEU C 3 188 ? 138.042 130.328 124.341 1.00 39.90  ? 96   LEU C CB    1 
ATOM   2047  C  CG    . LEU C 3 188 ? 137.607 130.817 125.728 1.00 39.90  ? 96   LEU C CG    1 
ATOM   2048  C  CD1   . LEU C 3 188 ? 136.964 129.713 126.542 1.00 39.90  ? 96   LEU C CD1   1 
ATOM   2049  C  CD2   . LEU C 3 188 ? 138.784 131.413 126.476 1.00 39.90  ? 96   LEU C CD2   1 
ATOM   2050  N  N     . LEU C 3 189 ? 135.824 131.718 122.486 1.00 36.64  ? 97   LEU C N     1 
ATOM   2051  C  CA    . LEU C 3 189 ? 134.798 132.753 122.454 1.00 36.64  ? 97   LEU C CA    1 
ATOM   2052  C  C     . LEU C 3 189 ? 134.029 132.770 121.138 1.00 36.64  ? 97   LEU C C     1 
ATOM   2053  O  O     . LEU C 3 189 ? 133.707 133.831 120.602 1.00 36.64  ? 97   LEU C O     1 
ATOM   2054  C  CB    . LEU C 3 189 ? 135.432 134.115 122.716 1.00 36.64  ? 97   LEU C CB    1 
ATOM   2055  C  CG    . LEU C 3 189 ? 136.222 134.224 124.014 1.00 36.64  ? 97   LEU C CG    1 
ATOM   2056  C  CD1   . LEU C 3 189 ? 136.882 135.580 124.110 1.00 36.64  ? 97   LEU C CD1   1 
ATOM   2057  C  CD2   . LEU C 3 189 ? 135.308 133.985 125.194 1.00 36.64  ? 97   LEU C CD2   1 
ATOM   2058  N  N     . GLY C 3 190 ? 133.718 131.592 120.598 1.00 36.98  ? 98   GLY C N     1 
ATOM   2059  C  CA    . GLY C 3 190 ? 133.024 131.522 119.323 1.00 36.98  ? 98   GLY C CA    1 
ATOM   2060  C  C     . GLY C 3 190 ? 131.558 131.891 119.367 1.00 36.98  ? 98   GLY C C     1 
ATOM   2061  O  O     . GLY C 3 190 ? 130.993 132.256 118.331 1.00 36.98  ? 98   GLY C O     1 
ATOM   2062  N  N     . ARG C 3 191 ? 130.928 131.812 120.532 1.00 32.80  ? 99   ARG C N     1 
ATOM   2063  C  CA    . ARG C 3 191 ? 129.494 132.035 120.639 1.00 32.80  ? 99   ARG C CA    1 
ATOM   2064  C  C     . ARG C 3 191 ? 129.167 133.262 121.478 1.00 32.80  ? 99   ARG C C     1 
ATOM   2065  O  O     . ARG C 3 191 ? 128.083 133.352 122.057 1.00 32.80  ? 99   ARG C O     1 
ATOM   2066  C  CB    . ARG C 3 191 ? 128.831 130.792 121.225 1.00 32.80  ? 99   ARG C CB    1 
ATOM   2067  C  CG    . ARG C 3 191 ? 128.948 129.575 120.330 1.00 32.80  ? 99   ARG C CG    1 
ATOM   2068  C  CD    . ARG C 3 191 ? 128.001 128.469 120.741 1.00 32.80  ? 99   ARG C CD    1 
ATOM   2069  N  NE    . ARG C 3 191 ? 128.041 127.356 119.799 1.00 32.80  ? 99   ARG C NE    1 
ATOM   2070  C  CZ    . ARG C 3 191 ? 127.197 126.330 119.816 1.00 32.80  ? 99   ARG C CZ    1 
ATOM   2071  N  NH1   . ARG C 3 191 ? 126.241 126.271 120.733 1.00 32.80  ? 99   ARG C NH1   1 
ATOM   2072  N  NH2   . ARG C 3 191 ? 127.311 125.362 118.917 1.00 32.80  ? 99   ARG C NH2   1 
ATOM   2073  N  N     . VAL C 3 192 ? 130.090 134.215 121.558 1.00 32.02  ? 100  VAL C N     1 
ATOM   2074  C  CA    . VAL C 3 192 ? 129.881 135.449 122.302 1.00 32.02  ? 100  VAL C CA    1 
ATOM   2075  C  C     . VAL C 3 192 ? 129.870 136.612 121.317 1.00 32.02  ? 100  VAL C C     1 
ATOM   2076  O  O     . VAL C 3 192 ? 130.496 136.548 120.252 1.00 32.02  ? 100  VAL C O     1 
ATOM   2077  C  CB    . VAL C 3 192 ? 130.944 135.634 123.408 1.00 32.02  ? 100  VAL C CB    1 
ATOM   2078  C  CG1   . VAL C 3 192 ? 132.304 135.917 122.836 1.00 32.02  ? 100  VAL C CG1   1 
ATOM   2079  C  CG2   . VAL C 3 192 ? 130.534 136.690 124.413 1.00 32.02  ? 100  VAL C CG2   1 
ATOM   2080  N  N     . THR C 3 193 ? 129.089 137.635 121.633 1.00 31.77  ? 101  THR C N     1 
ATOM   2081  C  CA    . THR C 3 193 ? 128.999 138.848 120.837 1.00 31.77  ? 101  THR C CA    1 
ATOM   2082  C  C     . THR C 3 193 ? 129.582 139.998 121.645 1.00 31.77  ? 101  THR C C     1 
ATOM   2083  O  O     . THR C 3 193 ? 129.142 140.257 122.768 1.00 31.77  ? 101  THR C O     1 
ATOM   2084  C  CB    . THR C 3 193 ? 127.550 139.145 120.460 1.00 31.77  ? 101  THR C CB    1 
ATOM   2085  O  OG1   . THR C 3 193 ? 127.085 138.168 119.521 1.00 31.77  ? 101  THR C OG1   1 
ATOM   2086  C  CG2   . THR C 3 193 ? 127.435 140.529 119.859 1.00 31.77  ? 101  THR C CG2   1 
ATOM   2087  N  N     . ILE C 3 194 ? 130.583 140.664 121.087 1.00 31.44  ? 102  ILE C N     1 
ATOM   2088  C  CA    . ILE C 3 194 ? 131.223 141.799 121.737 1.00 31.44  ? 102  ILE C CA    1 
ATOM   2089  C  C     . ILE C 3 194 ? 130.501 143.057 121.276 1.00 31.44  ? 102  ILE C C     1 
ATOM   2090  O  O     . ILE C 3 194 ? 130.398 143.303 120.071 1.00 31.44  ? 102  ILE C O     1 
ATOM   2091  C  CB    . ILE C 3 194 ? 132.719 141.856 121.408 1.00 31.44  ? 102  ILE C CB    1 
ATOM   2092  C  CG1   . ILE C 3 194 ? 133.419 140.599 121.928 1.00 31.44  ? 102  ILE C CG1   1 
ATOM   2093  C  CG2   . ILE C 3 194 ? 133.340 143.094 121.993 1.00 31.44  ? 102  ILE C CG2   1 
ATOM   2094  C  CD1   . ILE C 3 194 ? 134.892 140.545 121.620 1.00 31.44  ? 102  ILE C CD1   1 
ATOM   2095  N  N     . ALA C 3 195 ? 129.956 143.815 122.233 1.00 32.21  ? 103  ALA C N     1 
ATOM   2096  C  CA    . ALA C 3 195 ? 129.131 144.981 121.924 1.00 32.21  ? 103  ALA C CA    1 
ATOM   2097  C  C     . ALA C 3 195 ? 129.902 146.050 121.163 1.00 32.21  ? 103  ALA C C     1 
ATOM   2098  O  O     . ALA C 3 195 ? 131.027 146.401 121.527 1.00 32.21  ? 103  ALA C O     1 
ATOM   2099  C  CB    . ALA C 3 195 ? 128.556 145.585 123.203 1.00 32.21  ? 103  ALA C CB    1 
ATOM   2100  N  N     . GLN C 3 196 ? 129.273 146.546 120.089 1.00 37.70  ? 104  GLN C N     1 
ATOM   2101  C  CA    . GLN C 3 196 ? 129.795 147.590 119.198 1.00 37.70  ? 104  GLN C CA    1 
ATOM   2102  C  C     . GLN C 3 196 ? 131.142 147.203 118.596 1.00 37.70  ? 104  GLN C C     1 
ATOM   2103  O  O     . GLN C 3 196 ? 132.004 148.055 118.377 1.00 37.70  ? 104  GLN C O     1 
ATOM   2104  C  CB    . GLN C 3 196 ? 129.901 148.941 119.913 1.00 37.70  ? 104  GLN C CB    1 
ATOM   2105  C  CG    . GLN C 3 196 ? 128.560 149.537 120.299 1.00 37.70  ? 104  GLN C CG    1 
ATOM   2106  C  CD    . GLN C 3 196 ? 127.660 149.792 119.119 1.00 37.70  ? 104  GLN C CD    1 
ATOM   2107  O  OE1   . GLN C 3 196 ? 128.042 150.464 118.163 1.00 37.70  ? 104  GLN C OE1   1 
ATOM   2108  N  NE2   . GLN C 3 196 ? 126.450 149.257 119.180 1.00 37.70  ? 104  GLN C NE2   1 
ATOM   2109  N  N     . GLY C 3 197 ? 131.334 145.915 118.333 1.00 37.18  ? 105  GLY C N     1 
ATOM   2110  C  CA    . GLY C 3 197 ? 132.610 145.427 117.857 1.00 37.18  ? 105  GLY C CA    1 
ATOM   2111  C  C     . GLY C 3 197 ? 132.704 145.178 116.369 1.00 37.18  ? 105  GLY C C     1 
ATOM   2112  O  O     . GLY C 3 197 ? 133.804 145.203 115.813 1.00 37.18  ? 105  GLY C O     1 
ATOM   2113  N  N     . GLY C 3 198 ? 131.570 144.969 115.705 1.00 37.13  ? 106  GLY C N     1 
ATOM   2114  C  CA    . GLY C 3 198 ? 131.642 144.656 114.292 1.00 37.13  ? 106  GLY C CA    1 
ATOM   2115  C  C     . GLY C 3 198 ? 132.207 143.262 114.054 1.00 37.13  ? 106  GLY C C     1 
ATOM   2116  O  O     . GLY C 3 198 ? 132.161 142.381 114.916 1.00 37.13  ? 106  GLY C O     1 
ATOM   2117  N  N     . VAL C 3 199 ? 132.750 143.069 112.848 1.00 36.61  ? 107  VAL C N     1 
ATOM   2118  C  CA    . VAL C 3 199 ? 133.314 141.794 112.416 1.00 36.61  ? 107  VAL C CA    1 
ATOM   2119  C  C     . VAL C 3 199 ? 134.706 142.030 111.847 1.00 36.61  ? 107  VAL C C     1 
ATOM   2120  O  O     . VAL C 3 199 ? 135.124 143.162 111.609 1.00 36.61  ? 107  VAL C O     1 
ATOM   2121  C  CB    . VAL C 3 199 ? 132.440 141.073 111.368 1.00 36.61  ? 107  VAL C CB    1 
ATOM   2122  C  CG1   . VAL C 3 199 ? 131.047 140.816 111.895 1.00 36.61  ? 107  VAL C CG1   1 
ATOM   2123  C  CG2   . VAL C 3 199 ? 132.377 141.891 110.096 1.00 36.61  ? 107  VAL C CG2   1 
ATOM   2124  N  N     . LEU C 3 200 ? 135.426 140.930 111.637 1.00 39.64  ? 108  LEU C N     1 
ATOM   2125  C  CA    . LEU C 3 200 ? 136.727 141.003 110.989 1.00 39.64  ? 108  LEU C CA    1 
ATOM   2126  C  C     . LEU C 3 200 ? 136.560 141.331 109.511 1.00 39.64  ? 108  LEU C C     1 
ATOM   2127  O  O     . LEU C 3 200 ? 135.588 140.892 108.888 1.00 39.64  ? 108  LEU C O     1 
ATOM   2128  C  CB    . LEU C 3 200 ? 137.490 139.689 111.096 1.00 39.64  ? 108  LEU C CB    1 
ATOM   2129  C  CG    . LEU C 3 200 ? 138.519 139.473 112.195 1.00 39.64  ? 108  LEU C CG    1 
ATOM   2130  C  CD1   . LEU C 3 200 ? 139.095 138.077 112.045 1.00 39.64  ? 108  LEU C CD1   1 
ATOM   2131  C  CD2   . LEU C 3 200 ? 139.603 140.520 112.103 1.00 39.64  ? 108  LEU C CD2   1 
ATOM   2132  N  N     . PRO C 3 201 ? 137.448 142.154 108.944 1.00 41.84  ? 109  PRO C N     1 
ATOM   2133  C  CA    . PRO C 3 201 ? 137.443 142.354 107.492 1.00 41.84  ? 109  PRO C CA    1 
ATOM   2134  C  C     . PRO C 3 201 ? 137.720 141.045 106.773 1.00 41.84  ? 109  PRO C C     1 
ATOM   2135  O  O     . PRO C 3 201 ? 138.831 140.510 106.843 1.00 41.84  ? 109  PRO C O     1 
ATOM   2136  C  CB    . PRO C 3 201 ? 138.569 143.370 107.272 1.00 41.84  ? 109  PRO C CB    1 
ATOM   2137  C  CG    . PRO C 3 201 ? 138.685 144.086 108.568 1.00 41.84  ? 109  PRO C CG    1 
ATOM   2138  C  CD    . PRO C 3 201 ? 138.386 143.063 109.622 1.00 41.84  ? 109  PRO C CD    1 
ATOM   2139  N  N     . ASN C 3 202 ? 136.711 140.518 106.088 1.00 43.05  ? 110  ASN C N     1 
ATOM   2140  C  CA    . ASN C 3 202 ? 136.856 139.252 105.379 1.00 43.05  ? 110  ASN C CA    1 
ATOM   2141  C  C     . ASN C 3 202 ? 136.025 139.325 104.110 1.00 43.05  ? 110  ASN C C     1 
ATOM   2142  O  O     . ASN C 3 202 ? 134.796 139.225 104.164 1.00 43.05  ? 110  ASN C O     1 
ATOM   2143  C  CB    . ASN C 3 202 ? 136.413 138.086 106.255 1.00 43.05  ? 110  ASN C CB    1 
ATOM   2144  C  CG    . ASN C 3 202 ? 136.694 136.744 105.621 1.00 43.05  ? 110  ASN C CG    1 
ATOM   2145  O  OD1   . ASN C 3 202 ? 137.505 136.634 104.701 1.00 43.05  ? 110  ASN C OD1   1 
ATOM   2146  N  ND2   . ASN C 3 202 ? 136.016 135.710 106.105 1.00 43.05  ? 110  ASN C ND2   1 
ATOM   2147  N  N     . ILE C 3 203 ? 136.696 139.494 102.978 1.00 42.06  ? 111  ILE C N     1 
ATOM   2148  C  CA    . ILE C 3 203 ? 136.056 139.515 101.672 1.00 42.06  ? 111  ILE C CA    1 
ATOM   2149  C  C     . ILE C 3 203 ? 136.423 138.224 100.960 1.00 42.06  ? 111  ILE C C     1 
ATOM   2150  O  O     . ILE C 3 203 ? 137.610 137.889 100.846 1.00 42.06  ? 111  ILE C O     1 
ATOM   2151  C  CB    . ILE C 3 203 ? 136.486 140.736 100.849 1.00 42.06  ? 111  ILE C CB    1 
ATOM   2152  C  CG1   . ILE C 3 203 ? 136.259 142.016 101.645 1.00 42.06  ? 111  ILE C CG1   1 
ATOM   2153  C  CG2   . ILE C 3 203 ? 135.697 140.795 99.558  1.00 42.06  ? 111  ILE C CG2   1 
ATOM   2154  C  CD1   . ILE C 3 203 ? 136.754 143.254 100.947 1.00 42.06  ? 111  ILE C CD1   1 
ATOM   2155  N  N     . GLN C 3 204 ? 135.405 137.474 100.543 1.00 44.86  ? 112  GLN C N     1 
ATOM   2156  C  CA    . GLN C 3 204 ? 135.610 136.247 99.782  1.00 44.86  ? 112  GLN C CA    1 
ATOM   2157  C  C     . GLN C 3 204 ? 136.335 136.533 98.473  1.00 44.86  ? 112  GLN C C     1 
ATOM   2158  O  O     . GLN C 3 204 ? 136.071 137.548 97.821  1.00 44.86  ? 112  GLN C O     1 
ATOM   2159  C  CB    . GLN C 3 204 ? 134.269 135.570 99.507  1.00 44.86  ? 112  GLN C CB    1 
ATOM   2160  C  CG    . GLN C 3 204 ? 133.609 134.975 100.734 1.00 44.86  ? 112  GLN C CG    1 
ATOM   2161  C  CD    . GLN C 3 204 ? 134.416 133.844 101.333 1.00 44.86  ? 112  GLN C CD    1 
ATOM   2162  O  OE1   . GLN C 3 204 ? 134.642 133.796 102.541 1.00 44.86  ? 112  GLN C OE1   1 
ATOM   2163  N  NE2   . GLN C 3 204 ? 134.854 132.920 100.487 1.00 44.86  ? 112  GLN C NE2   1 
ATOM   2164  N  N     . SER C 3 205 ? 137.310 135.672 98.152  1.00 44.73  ? 113  SER C N     1 
ATOM   2165  C  CA    . SER C 3 205 ? 138.119 135.795 96.938  1.00 44.73  ? 113  SER C CA    1 
ATOM   2166  C  C     . SER C 3 205 ? 137.266 135.863 95.674  1.00 44.73  ? 113  SER C C     1 
ATOM   2167  O  O     . SER C 3 205 ? 137.591 136.597 94.735  1.00 44.73  ? 113  SER C O     1 
ATOM   2168  C  CB    . SER C 3 205 ? 139.103 134.630 96.849  1.00 44.73  ? 113  SER C CB    1 
ATOM   2169  O  OG    . SER C 3 205 ? 138.418 133.397 96.736  1.00 44.73  ? 113  SER C OG    1 
ATOM   2170  N  N     . VAL C 3 206 ? 136.186 135.075 95.628  1.00 41.63  ? 114  VAL C N     1 
ATOM   2171  C  CA    . VAL C 3 206 ? 135.308 134.984 94.464  1.00 41.63  ? 114  VAL C CA    1 
ATOM   2172  C  C     . VAL C 3 206 ? 134.594 136.307 94.172  1.00 41.63  ? 114  VAL C C     1 
ATOM   2173  O  O     . VAL C 3 206 ? 134.253 136.591 93.018  1.00 41.63  ? 114  VAL C O     1 
ATOM   2174  C  CB    . VAL C 3 206 ? 134.325 133.814 94.709  1.00 41.63  ? 114  VAL C CB    1 
ATOM   2175  C  CG1   . VAL C 3 206 ? 133.384 133.575 93.531  1.00 41.63  ? 114  VAL C CG1   1 
ATOM   2176  C  CG2   . VAL C 3 206 ? 135.097 132.551 95.046  1.00 41.63  ? 114  VAL C CG2   1 
ATOM   2177  N  N     . LEU C 3 207 ? 134.431 137.167 95.181  1.00 41.56  ? 115  LEU C N     1 
ATOM   2178  C  CA    . LEU C 3 207 ? 133.746 138.440 94.984  1.00 41.56  ? 115  LEU C CA    1 
ATOM   2179  C  C     . LEU C 3 207 ? 134.576 139.429 94.177  1.00 41.56  ? 115  LEU C C     1 
ATOM   2180  O  O     . LEU C 3 207 ? 134.014 140.351 93.575  1.00 41.56  ? 115  LEU C O     1 
ATOM   2181  C  CB    . LEU C 3 207 ? 133.425 139.068 96.337  1.00 41.56  ? 115  LEU C CB    1 
ATOM   2182  C  CG    . LEU C 3 207 ? 132.566 138.299 97.334  1.00 41.56  ? 115  LEU C CG    1 
ATOM   2183  C  CD1   . LEU C 3 207 ? 132.321 139.167 98.552  1.00 41.56  ? 115  LEU C CD1   1 
ATOM   2184  C  CD2   . LEU C 3 207 ? 131.259 137.888 96.706  1.00 41.56  ? 115  LEU C CD2   1 
ATOM   2185  N  N     . LEU C 3 208 ? 135.890 139.243 94.139  1.00 47.94  ? 116  LEU C N     1 
ATOM   2186  C  CA    . LEU C 3 208 ? 136.788 140.114 93.405  1.00 47.94  ? 116  LEU C CA    1 
ATOM   2187  C  C     . LEU C 3 208 ? 136.627 139.905 91.899  1.00 47.94  ? 116  LEU C C     1 
ATOM   2188  O  O     . LEU C 3 208 ? 136.134 138.863 91.463  1.00 47.94  ? 116  LEU C O     1 
ATOM   2189  C  CB    . LEU C 3 208 ? 138.227 139.835 93.834  1.00 47.94  ? 116  LEU C CB    1 
ATOM   2190  C  CG    . LEU C 3 208 ? 138.495 140.057 95.320  1.00 47.94  ? 116  LEU C CG    1 
ATOM   2191  C  CD1   . LEU C 3 208 ? 139.868 139.539 95.696  1.00 47.94  ? 116  LEU C CD1   1 
ATOM   2192  C  CD2   . LEU C 3 208 ? 138.365 141.525 95.652  1.00 47.94  ? 116  LEU C CD2   1 
ATOM   2193  N  N     . PRO C 3 209 ? 136.980 140.906 91.088  1.00 53.75  ? 117  PRO C N     1 
ATOM   2194  C  CA    . PRO C 3 209 ? 136.892 140.759 89.633  1.00 53.75  ? 117  PRO C CA    1 
ATOM   2195  C  C     . PRO C 3 209 ? 137.822 139.686 89.080  1.00 53.75  ? 117  PRO C C     1 
ATOM   2196  O  O     . PRO C 3 209 ? 138.765 139.230 89.730  1.00 53.75  ? 117  PRO C O     1 
ATOM   2197  C  CB    . PRO C 3 209 ? 137.307 142.144 89.118  1.00 53.75  ? 117  PRO C CB    1 
ATOM   2198  C  CG    . PRO C 3 209 ? 136.894 143.061 90.182  1.00 53.75  ? 117  PRO C CG    1 
ATOM   2199  C  CD    . PRO C 3 209 ? 137.121 142.324 91.470  1.00 53.75  ? 117  PRO C CD    1 
ATOM   2200  N  N     . LYS C 3 210 ? 137.531 139.294 87.846  1.00 57.30  ? 118  LYS C N     1 
ATOM   2201  C  CA    . LYS C 3 210 ? 138.253 138.233 87.164  1.00 57.30  ? 118  LYS C CA    1 
ATOM   2202  C  C     . LYS C 3 210 ? 139.513 138.793 86.504  1.00 57.30  ? 118  LYS C C     1 
ATOM   2203  O  O     . LYS C 3 210 ? 139.898 139.945 86.716  1.00 57.30  ? 118  LYS C O     1 
ATOM   2204  C  CB    . LYS C 3 210 ? 137.338 137.549 86.148  1.00 57.30  ? 118  LYS C CB    1 
ATOM   2205  C  CG    . LYS C 3 210 ? 136.469 136.415 86.700  1.00 57.30  ? 118  LYS C CG    1 
ATOM   2206  C  CD    . LYS C 3 210 ? 135.265 136.923 87.487  1.00 57.30  ? 118  LYS C CD    1 
ATOM   2207  C  CE    . LYS C 3 210 ? 134.327 137.726 86.603  1.00 57.30  ? 118  LYS C CE    1 
ATOM   2208  N  NZ    . LYS C 3 210 ? 133.152 138.244 87.357  1.00 57.30  ? 118  LYS C NZ    1 
ATOM   2209  N  N     . LYS C 3 211 ? 140.168 137.971 85.692  1.00 66.52  ? 119  LYS C N     1 
ATOM   2210  C  CA    . LYS C 3 211 ? 141.354 138.391 84.960  1.00 66.52  ? 119  LYS C CA    1 
ATOM   2211  C  C     . LYS C 3 211 ? 140.971 139.279 83.782  1.00 66.52  ? 119  LYS C C     1 
ATOM   2212  O  O     . LYS C 3 211 ? 140.253 138.851 82.878  1.00 66.52  ? 119  LYS C O     1 
ATOM   2213  C  CB    . LYS C 3 211 ? 142.141 137.173 84.472  1.00 66.52  ? 119  LYS C CB    1 
ATOM   2214  C  CG    . LYS C 3 211 ? 143.266 137.498 83.503  1.00 66.52  ? 119  LYS C CG    1 
ATOM   2215  C  CD    . LYS C 3 211 ? 144.369 138.297 84.176  1.00 66.52  ? 119  LYS C CD    1 
ATOM   2216  C  CE    . LYS C 3 211 ? 145.493 138.604 83.202  1.00 66.52  ? 119  LYS C CE    1 
ATOM   2217  N  NZ    . LYS C 3 211 ? 145.027 139.450 82.070  1.00 66.52  ? 119  LYS C NZ    1 
ATOM   2218  N  N     . ARG D 4 27  ? 124.570 161.954 149.561 1.00 86.92  ? 26   ARG D N     1 
ATOM   2219  C  CA    . ARG D 4 27  ? 124.624 160.538 149.901 1.00 86.92  ? 26   ARG D CA    1 
ATOM   2220  C  C     . ARG D 4 27  ? 124.870 159.690 148.661 1.00 86.92  ? 26   ARG D C     1 
ATOM   2221  O  O     . ARG D 4 27  ? 124.198 159.857 147.644 1.00 86.92  ? 26   ARG D O     1 
ATOM   2222  C  CB    . ARG D 4 27  ? 123.330 160.101 150.590 1.00 86.92  ? 26   ARG D CB    1 
ATOM   2223  C  CG    . ARG D 4 27  ? 123.120 160.719 151.963 1.00 86.92  ? 26   ARG D CG    1 
ATOM   2224  C  CD    . ARG D 4 27  ? 121.858 160.249 152.669 1.00 86.92  ? 26   ARG D CD    1 
ATOM   2225  N  NE    . ARG D 4 27  ? 121.664 160.921 153.951 1.00 86.92  ? 26   ARG D NE    1 
ATOM   2226  C  CZ    . ARG D 4 27  ? 120.588 160.780 154.711 1.00 86.92  ? 26   ARG D CZ    1 
ATOM   2227  N  NH1   . ARG D 4 27  ? 119.599 159.984 154.323 1.00 86.92  ? 26   ARG D NH1   1 
ATOM   2228  N  NH2   . ARG D 4 27  ? 120.496 161.431 155.863 1.00 86.92  ? 26   ARG D NH2   1 
ATOM   2229  N  N     . ARG D 4 28  ? 125.839 158.781 148.753 1.00 90.58  ? 27   ARG D N     1 
ATOM   2230  C  CA    . ARG D 4 28  ? 126.149 157.896 147.641 1.00 90.58  ? 27   ARG D CA    1 
ATOM   2231  C  C     . ARG D 4 28  ? 125.040 156.865 147.456 1.00 90.58  ? 27   ARG D C     1 
ATOM   2232  O  O     . ARG D 4 28  ? 124.269 156.574 148.375 1.00 90.58  ? 27   ARG D O     1 
ATOM   2233  C  CB    . ARG D 4 28  ? 127.495 157.204 147.863 1.00 90.58  ? 27   ARG D CB    1 
ATOM   2234  C  CG    . ARG D 4 28  ? 127.602 156.425 149.162 1.00 90.58  ? 27   ARG D CG    1 
ATOM   2235  C  CD    . ARG D 4 28  ? 129.040 155.997 149.426 1.00 90.58  ? 27   ARG D CD    1 
ATOM   2236  N  NE    . ARG D 4 28  ? 129.907 157.139 149.713 1.00 90.58  ? 27   ARG D NE    1 
ATOM   2237  C  CZ    . ARG D 4 28  ? 131.021 157.423 149.044 1.00 90.58  ? 27   ARG D CZ    1 
ATOM   2238  N  NH1   . ARG D 4 28  ? 131.414 156.649 148.042 1.00 90.58  ? 27   ARG D NH1   1 
ATOM   2239  N  NH2   . ARG D 4 28  ? 131.745 158.483 149.378 1.00 90.58  ? 27   ARG D NH2   1 
ATOM   2240  N  N     . LYS D 4 29  ? 124.960 156.316 146.244 1.00 87.07  ? 28   LYS D N     1 
ATOM   2241  C  CA    . LYS D 4 29  ? 123.795 155.515 145.872 1.00 87.07  ? 28   LYS D CA    1 
ATOM   2242  C  C     . LYS D 4 29  ? 123.894 154.083 146.393 1.00 87.07  ? 28   LYS D C     1 
ATOM   2243  O  O     . LYS D 4 29  ? 123.140 153.690 147.290 1.00 87.07  ? 28   LYS D O     1 
ATOM   2244  C  CB    . LYS D 4 29  ? 123.627 155.545 144.349 1.00 87.07  ? 28   LYS D CB    1 
ATOM   2245  C  CG    . LYS D 4 29  ? 123.781 156.940 143.757 1.00 87.07  ? 28   LYS D CG    1 
ATOM   2246  C  CD    . LYS D 4 29  ? 124.119 156.894 142.278 1.00 87.07  ? 28   LYS D CD    1 
ATOM   2247  C  CE    . LYS D 4 29  ? 125.513 156.347 142.046 1.00 87.07  ? 28   LYS D CE    1 
ATOM   2248  N  NZ    . LYS D 4 29  ? 125.842 156.301 140.597 1.00 87.07  ? 28   LYS D NZ    1 
ATOM   2249  N  N     . THR D 4 30  ? 124.853 153.310 145.882 1.00 77.53  ? 29   THR D N     1 
ATOM   2250  C  CA    . THR D 4 30  ? 124.986 151.902 146.241 1.00 77.53  ? 29   THR D CA    1 
ATOM   2251  C  C     . THR D 4 30  ? 126.369 151.394 145.853 1.00 77.53  ? 29   THR D C     1 
ATOM   2252  O  O     . THR D 4 30  ? 126.906 151.720 144.791 1.00 77.53  ? 29   THR D O     1 
ATOM   2253  C  CB    . THR D 4 30  ? 123.887 151.035 145.597 1.00 77.53  ? 29   THR D CB    1 
ATOM   2254  O  OG1   . THR D 4 30  ? 124.097 149.657 145.932 1.00 77.53  ? 29   THR D OG1   1 
ATOM   2255  C  CG2   . THR D 4 30  ? 123.810 151.215 144.080 1.00 77.53  ? 29   THR D CG2   1 
ATOM   2256  N  N     . ARG D 4 31  ? 126.972 150.640 146.769 1.00 71.08  ? 30   ARG D N     1 
ATOM   2257  C  CA    . ARG D 4 31  ? 128.276 150.033 146.522 1.00 71.08  ? 30   ARG D CA    1 
ATOM   2258  C  C     . ARG D 4 31  ? 128.097 148.820 145.610 1.00 71.08  ? 30   ARG D C     1 
ATOM   2259  O  O     . ARG D 4 31  ? 127.657 147.747 146.020 1.00 71.08  ? 30   ARG D O     1 
ATOM   2260  C  CB    . ARG D 4 31  ? 128.950 149.660 147.836 1.00 71.08  ? 30   ARG D CB    1 
ATOM   2261  C  CG    . ARG D 4 31  ? 130.426 149.349 147.694 1.00 71.08  ? 30   ARG D CG    1 
ATOM   2262  C  CD    . ARG D 4 31  ? 131.066 149.065 149.038 1.00 71.08  ? 30   ARG D CD    1 
ATOM   2263  N  NE    . ARG D 4 31  ? 132.122 148.063 148.935 1.00 71.08  ? 30   ARG D NE    1 
ATOM   2264  C  CZ    . ARG D 4 31  ? 133.308 148.167 149.525 1.00 71.08  ? 30   ARG D CZ    1 
ATOM   2265  N  NH1   . ARG D 4 31  ? 133.594 149.230 150.262 1.00 71.08  ? 30   ARG D NH1   1 
ATOM   2266  N  NH2   . ARG D 4 31  ? 134.210 147.208 149.377 1.00 71.08  ? 30   ARG D NH2   1 
ATOM   2267  N  N     . LYS D 4 32  ? 128.465 149.014 144.346 1.00 62.70  ? 31   LYS D N     1 
ATOM   2268  C  CA    . LYS D 4 32  ? 128.404 147.941 143.361 1.00 62.70  ? 31   LYS D CA    1 
ATOM   2269  C  C     . LYS D 4 32  ? 129.810 147.529 142.950 1.00 62.70  ? 31   LYS D C     1 
ATOM   2270  O  O     . LYS D 4 32  ? 130.616 148.373 142.546 1.00 62.70  ? 31   LYS D O     1 
ATOM   2271  C  CB    . LYS D 4 32  ? 127.589 148.378 142.142 1.00 62.70  ? 31   LYS D CB    1 
ATOM   2272  C  CG    . LYS D 4 32  ? 127.463 147.312 141.072 1.00 62.70  ? 31   LYS D CG    1 
ATOM   2273  C  CD    . LYS D 4 32  ? 126.743 146.089 141.606 1.00 62.70  ? 31   LYS D CD    1 
ATOM   2274  C  CE    . LYS D 4 32  ? 127.118 144.844 140.824 1.00 62.70  ? 31   LYS D CE    1 
ATOM   2275  N  NZ    . LYS D 4 32  ? 128.486 144.370 141.162 1.00 62.70  ? 31   LYS D NZ    1 
ATOM   2276  N  N     . GLU D 4 33  ? 130.118 146.238 143.041 1.00 50.60  ? 32   GLU D N     1 
ATOM   2277  C  CA    . GLU D 4 33  ? 131.479 145.785 142.790 1.00 50.60  ? 32   GLU D CA    1 
ATOM   2278  C  C     . GLU D 4 33  ? 131.670 145.480 141.310 1.00 50.60  ? 32   GLU D C     1 
ATOM   2279  O  O     . GLU D 4 33  ? 130.702 145.212 140.591 1.00 50.60  ? 32   GLU D O     1 
ATOM   2280  C  CB    . GLU D 4 33  ? 131.792 144.551 143.636 1.00 50.60  ? 32   GLU D CB    1 
ATOM   2281  C  CG    . GLU D 4 33  ? 130.993 143.309 143.259 1.00 50.60  ? 32   GLU D CG    1 
ATOM   2282  C  CD    . GLU D 4 33  ? 131.176 142.170 144.243 1.00 50.60  ? 32   GLU D CD    1 
ATOM   2283  O  OE1   . GLU D 4 33  ? 132.337 141.845 144.565 1.00 50.60  ? 32   GLU D OE1   1 
ATOM   2284  O  OE2   . GLU D 4 33  ? 130.159 141.597 144.688 1.00 50.60  ? 32   GLU D OE2   1 
ATOM   2285  N  N     . SER D 4 34  ? 132.921 145.527 140.863 1.00 42.95  ? 33   SER D N     1 
ATOM   2286  C  CA    . SER D 4 34  ? 133.316 145.169 139.512 1.00 42.95  ? 33   SER D CA    1 
ATOM   2287  C  C     . SER D 4 34  ? 134.813 144.898 139.485 1.00 42.95  ? 33   SER D C     1 
ATOM   2288  O  O     . SER D 4 34  ? 135.549 145.238 140.414 1.00 42.95  ? 33   SER D O     1 
ATOM   2289  C  CB    . SER D 4 34  ? 132.967 146.282 138.516 1.00 42.95  ? 33   SER D CB    1 
ATOM   2290  O  OG    . SER D 4 34  ? 133.454 145.979 137.222 1.00 42.95  ? 33   SER D OG    1 
ATOM   2291  N  N     . TYR D 4 35  ? 135.257 144.270 138.403 1.00 36.90  ? 34   TYR D N     1 
ATOM   2292  C  CA    . TYR D 4 35  ? 136.666 143.987 138.166 1.00 36.90  ? 34   TYR D CA    1 
ATOM   2293  C  C     . TYR D 4 35  ? 137.399 145.124 137.473 1.00 36.90  ? 34   TYR D C     1 
ATOM   2294  O  O     . TYR D 4 35  ? 138.475 144.871 136.924 1.00 36.90  ? 34   TYR D O     1 
ATOM   2295  C  CB    . TYR D 4 35  ? 136.817 142.702 137.352 1.00 36.90  ? 34   TYR D CB    1 
ATOM   2296  C  CG    . TYR D 4 35  ? 136.365 141.462 138.080 1.00 36.90  ? 34   TYR D CG    1 
ATOM   2297  C  CD1   . TYR D 4 35  ? 135.051 141.023 138.006 1.00 36.90  ? 34   TYR D CD1   1 
ATOM   2298  C  CD2   . TYR D 4 35  ? 137.257 140.735 138.853 1.00 36.90  ? 34   TYR D CD2   1 
ATOM   2299  C  CE1   . TYR D 4 35  ? 134.640 139.894 138.676 1.00 36.90  ? 34   TYR D CE1   1 
ATOM   2300  C  CE2   . TYR D 4 35  ? 136.859 139.603 139.523 1.00 36.90  ? 34   TYR D CE2   1 
ATOM   2301  C  CZ    . TYR D 4 35  ? 135.550 139.189 139.431 1.00 36.90  ? 34   TYR D CZ    1 
ATOM   2302  O  OH    . TYR D 4 35  ? 135.152 138.060 140.101 1.00 36.90  ? 34   TYR D OH    1 
ATOM   2303  N  N     . ALA D 4 36  ? 136.808 146.324 137.454 1.00 40.58  ? 35   ALA D N     1 
ATOM   2304  C  CA    . ALA D 4 36  ? 137.336 147.480 136.730 1.00 40.58  ? 35   ALA D CA    1 
ATOM   2305  C  C     . ALA D 4 36  ? 138.788 147.800 137.075 1.00 40.58  ? 35   ALA D C     1 
ATOM   2306  O  O     . ALA D 4 36  ? 139.657 147.841 136.192 1.00 40.58  ? 35   ALA D O     1 
ATOM   2307  C  CB    . ALA D 4 36  ? 136.449 148.695 137.003 1.00 40.58  ? 35   ALA D CB    1 
ATOM   2308  N  N     . ILE D 4 37  ? 139.065 148.023 138.362 1.00 44.29  ? 36   ILE D N     1 
ATOM   2309  C  CA    . ILE D 4 37  ? 140.394 148.466 138.772 1.00 44.29  ? 36   ILE D CA    1 
ATOM   2310  C  C     . ILE D 4 37  ? 141.439 147.371 138.573 1.00 44.29  ? 36   ILE D C     1 
ATOM   2311  O  O     . ILE D 4 37  ? 142.600 147.673 138.285 1.00 44.29  ? 36   ILE D O     1 
ATOM   2312  C  CB    . ILE D 4 37  ? 140.358 149.017 140.213 1.00 44.29  ? 36   ILE D CB    1 
ATOM   2313  C  CG1   . ILE D 4 37  ? 140.365 147.913 141.270 1.00 44.29  ? 36   ILE D CG1   1 
ATOM   2314  C  CG2   . ILE D 4 37  ? 139.142 149.897 140.402 1.00 44.29  ? 36   ILE D CG2   1 
ATOM   2315  C  CD1   . ILE D 4 37  ? 140.476 148.436 142.681 1.00 44.29  ? 36   ILE D CD1   1 
ATOM   2316  N  N     . TYR D 4 38  ? 141.052 146.095 138.654 1.00 43.79  ? 37   TYR D N     1 
ATOM   2317  C  CA    . TYR D 4 38  ? 142.027 145.027 138.454 1.00 43.79  ? 37   TYR D CA    1 
ATOM   2318  C  C     . TYR D 4 38  ? 142.398 144.874 136.988 1.00 43.79  ? 37   TYR D C     1 
ATOM   2319  O  O     . TYR D 4 38  ? 143.574 144.667 136.662 1.00 43.79  ? 37   TYR D O     1 
ATOM   2320  C  CB    . TYR D 4 38  ? 141.487 143.725 139.020 1.00 43.79  ? 37   TYR D CB    1 
ATOM   2321  C  CG    . TYR D 4 38  ? 141.033 143.874 140.436 1.00 43.79  ? 37   TYR D CG    1 
ATOM   2322  C  CD1   . TYR D 4 38  ? 141.961 143.997 141.456 1.00 43.79  ? 37   TYR D CD1   1 
ATOM   2323  C  CD2   . TYR D 4 38  ? 139.688 143.929 140.754 1.00 43.79  ? 37   TYR D CD2   1 
ATOM   2324  C  CE1   . TYR D 4 38  ? 141.569 144.137 142.754 1.00 43.79  ? 37   TYR D CE1   1 
ATOM   2325  C  CE2   . TYR D 4 38  ? 139.281 144.081 142.056 1.00 43.79  ? 37   TYR D CE2   1 
ATOM   2326  C  CZ    . TYR D 4 38  ? 140.231 144.179 143.050 1.00 43.79  ? 37   TYR D CZ    1 
ATOM   2327  O  OH    . TYR D 4 38  ? 139.845 144.322 144.354 1.00 43.79  ? 37   TYR D OH    1 
ATOM   2328  N  N     . VAL D 4 39  ? 141.411 144.981 136.093 1.00 39.51  ? 38   VAL D N     1 
ATOM   2329  C  CA    . VAL D 4 39  ? 141.678 144.976 134.659 1.00 39.51  ? 38   VAL D CA    1 
ATOM   2330  C  C     . VAL D 4 39  ? 142.538 146.173 134.288 1.00 39.51  ? 38   VAL D C     1 
ATOM   2331  O  O     . VAL D 4 39  ? 143.458 146.061 133.465 1.00 39.51  ? 38   VAL D O     1 
ATOM   2332  C  CB    . VAL D 4 39  ? 140.345 144.944 133.886 1.00 39.51  ? 38   VAL D CB    1 
ATOM   2333  C  CG1   . VAL D 4 39  ? 140.547 145.162 132.405 1.00 39.51  ? 38   VAL D CG1   1 
ATOM   2334  C  CG2   . VAL D 4 39  ? 139.667 143.612 134.104 1.00 39.51  ? 38   VAL D CG2   1 
ATOM   2335  N  N     . TYR D 4 40  ? 142.321 147.307 134.960 1.00 46.51  ? 39   TYR D N     1 
ATOM   2336  C  CA    . TYR D 4 40  ? 143.129 148.487 134.684 1.00 46.51  ? 39   TYR D CA    1 
ATOM   2337  C  C     . TYR D 4 40  ? 144.562 148.308 135.181 1.00 46.51  ? 39   TYR D C     1 
ATOM   2338  O  O     . TYR D 4 40  ? 145.508 148.743 134.514 1.00 46.51  ? 39   TYR D O     1 
ATOM   2339  C  CB    . TYR D 4 40  ? 142.482 149.719 135.310 1.00 46.51  ? 39   TYR D CB    1 
ATOM   2340  C  CG    . TYR D 4 40  ? 142.860 150.994 134.613 1.00 46.51  ? 39   TYR D CG    1 
ATOM   2341  C  CD1   . TYR D 4 40  ? 143.990 151.705 134.988 1.00 46.51  ? 39   TYR D CD1   1 
ATOM   2342  C  CD2   . TYR D 4 40  ? 142.092 151.481 133.569 1.00 46.51  ? 39   TYR D CD2   1 
ATOM   2343  C  CE1   . TYR D 4 40  ? 144.342 152.872 134.344 1.00 46.51  ? 39   TYR D CE1   1 
ATOM   2344  C  CE2   . TYR D 4 40  ? 142.435 152.645 132.919 1.00 46.51  ? 39   TYR D CE2   1 
ATOM   2345  C  CZ    . TYR D 4 40  ? 143.560 153.337 133.309 1.00 46.51  ? 39   TYR D CZ    1 
ATOM   2346  O  OH    . TYR D 4 40  ? 143.904 154.501 132.662 1.00 46.51  ? 39   TYR D OH    1 
ATOM   2347  N  N     . LYS D 4 41  ? 144.740 147.691 136.355 1.00 42.48  ? 40   LYS D N     1 
ATOM   2348  C  CA    . LYS D 4 41  ? 146.084 147.401 136.856 1.00 42.48  ? 40   LYS D CA    1 
ATOM   2349  C  C     . LYS D 4 41  ? 146.827 146.420 135.956 1.00 42.48  ? 40   LYS D C     1 
ATOM   2350  O  O     . LYS D 4 41  ? 148.037 146.560 135.746 1.00 42.48  ? 40   LYS D O     1 
ATOM   2351  C  CB    . LYS D 4 41  ? 146.023 146.876 138.289 1.00 42.48  ? 40   LYS D CB    1 
ATOM   2352  C  CG    . LYS D 4 41  ? 145.655 147.935 139.312 1.00 42.48  ? 40   LYS D CG    1 
ATOM   2353  C  CD    . LYS D 4 41  ? 145.552 147.355 140.708 1.00 42.48  ? 40   LYS D CD    1 
ATOM   2354  C  CE    . LYS D 4 41  ? 145.198 148.432 141.714 1.00 42.48  ? 40   LYS D CE    1 
ATOM   2355  N  NZ    . LYS D 4 41  ? 144.997 147.867 143.072 1.00 42.48  ? 40   LYS D NZ    1 
ATOM   2356  N  N     . VAL D 4 42  ? 146.121 145.426 135.407 1.00 39.54  ? 41   VAL D N     1 
ATOM   2357  C  CA    . VAL D 4 42  ? 146.761 144.487 134.486 1.00 39.54  ? 41   VAL D CA    1 
ATOM   2358  C  C     . VAL D 4 42  ? 147.160 145.194 133.192 1.00 39.54  ? 41   VAL D C     1 
ATOM   2359  O  O     . VAL D 4 42  ? 148.257 144.965 132.656 1.00 39.54  ? 41   VAL D O     1 
ATOM   2360  C  CB    . VAL D 4 42  ? 145.837 143.280 134.232 1.00 39.54  ? 41   VAL D CB    1 
ATOM   2361  C  CG1   . VAL D 4 42  ? 146.377 142.386 133.136 1.00 39.54  ? 41   VAL D CG1   1 
ATOM   2362  C  CG2   . VAL D 4 42  ? 145.707 142.464 135.495 1.00 39.54  ? 41   VAL D CG2   1 
ATOM   2363  N  N     . LEU D 4 43  ? 146.291 146.082 132.689 1.00 40.95  ? 42   LEU D N     1 
ATOM   2364  C  CA    . LEU D 4 43  ? 146.613 146.866 131.498 1.00 40.95  ? 42   LEU D CA    1 
ATOM   2365  C  C     . LEU D 4 43  ? 147.818 147.769 131.741 1.00 40.95  ? 42   LEU D C     1 
ATOM   2366  O  O     . LEU D 4 43  ? 148.679 147.913 130.867 1.00 40.95  ? 42   LEU D O     1 
ATOM   2367  C  CB    . LEU D 4 43  ? 145.400 147.687 131.075 1.00 40.95  ? 42   LEU D CB    1 
ATOM   2368  C  CG    . LEU D 4 43  ? 145.581 148.646 129.904 1.00 40.95  ? 42   LEU D CG    1 
ATOM   2369  C  CD1   . LEU D 4 43  ? 146.113 147.918 128.682 1.00 40.95  ? 42   LEU D CD1   1 
ATOM   2370  C  CD2   . LEU D 4 43  ? 144.273 149.315 129.591 1.00 40.95  ? 42   LEU D CD2   1 
ATOM   2371  N  N     . LYS D 4 44  ? 147.907 148.368 132.930 1.00 47.52  ? 43   LYS D N     1 
ATOM   2372  C  CA    . LYS D 4 44  ? 149.063 149.198 133.253 1.00 47.52  ? 43   LYS D CA    1 
ATOM   2373  C  C     . LYS D 4 44  ? 150.307 148.361 133.507 1.00 47.52  ? 43   LYS D C     1 
ATOM   2374  O  O     . LYS D 4 44  ? 151.422 148.884 133.416 1.00 47.52  ? 43   LYS D O     1 
ATOM   2375  C  CB    . LYS D 4 44  ? 148.778 150.073 134.474 1.00 47.52  ? 43   LYS D CB    1 
ATOM   2376  C  CG    . LYS D 4 44  ? 147.915 151.285 134.192 1.00 47.52  ? 43   LYS D CG    1 
ATOM   2377  C  CD    . LYS D 4 44  ? 148.523 152.135 133.095 1.00 47.52  ? 43   LYS D CD    1 
ATOM   2378  C  CE    . LYS D 4 44  ? 147.488 153.054 132.476 1.00 47.52  ? 43   LYS D CE    1 
ATOM   2379  N  NZ    . LYS D 4 44  ? 148.067 153.885 131.385 1.00 47.52  ? 43   LYS D NZ    1 
ATOM   2380  N  N     . GLN D 4 45  ? 150.143 147.076 133.818 1.00 44.80  ? 44   GLN D N     1 
ATOM   2381  C  CA    . GLN D 4 45  ? 151.301 146.211 133.980 1.00 44.80  ? 44   GLN D CA    1 
ATOM   2382  C  C     . GLN D 4 45  ? 151.836 145.734 132.639 1.00 44.80  ? 44   GLN D C     1 
ATOM   2383  O  O     . GLN D 4 45  ? 153.047 145.531 132.498 1.00 44.80  ? 44   GLN D O     1 
ATOM   2384  C  CB    . GLN D 4 45  ? 150.945 145.007 134.853 1.00 44.80  ? 44   GLN D CB    1 
ATOM   2385  C  CG    . GLN D 4 45  ? 152.151 144.258 135.403 1.00 44.80  ? 44   GLN D CG    1 
ATOM   2386  C  CD    . GLN D 4 45  ? 151.764 143.022 136.192 1.00 44.80  ? 44   GLN D CD    1 
ATOM   2387  O  OE1   . GLN D 4 45  ? 150.626 142.886 136.638 1.00 44.80  ? 44   GLN D OE1   1 
ATOM   2388  N  NE2   . GLN D 4 45  ? 152.713 142.112 136.366 1.00 44.80  ? 44   GLN D NE2   1 
ATOM   2389  N  N     . VAL D 4 46  ? 150.968 145.561 131.644 1.00 46.81  ? 45   VAL D N     1 
ATOM   2390  C  CA    . VAL D 4 46  ? 151.434 145.024 130.370 1.00 46.81  ? 45   VAL D CA    1 
ATOM   2391  C  C     . VAL D 4 46  ? 151.766 146.121 129.347 1.00 46.81  ? 45   VAL D C     1 
ATOM   2392  O  O     . VAL D 4 46  ? 152.681 145.945 128.535 1.00 46.81  ? 45   VAL D O     1 
ATOM   2393  C  CB    . VAL D 4 46  ? 150.412 143.998 129.827 1.00 46.81  ? 45   VAL D CB    1 
ATOM   2394  C  CG1   . VAL D 4 46  ? 149.124 144.653 129.332 1.00 46.81  ? 45   VAL D CG1   1 
ATOM   2395  C  CG2   . VAL D 4 46  ? 151.031 143.121 128.746 1.00 46.81  ? 45   VAL D CG2   1 
ATOM   2396  N  N     . HIS D 4 47  ? 151.097 147.275 129.408 1.00 48.89  ? 46   HIS D N     1 
ATOM   2397  C  CA    . HIS D 4 47  ? 151.328 148.378 128.469 1.00 48.89  ? 46   HIS D CA    1 
ATOM   2398  C  C     . HIS D 4 47  ? 151.002 149.683 129.178 1.00 48.89  ? 46   HIS D C     1 
ATOM   2399  O  O     . HIS D 4 47  ? 149.859 150.156 129.148 1.00 48.89  ? 46   HIS D O     1 
ATOM   2400  C  CB    . HIS D 4 47  ? 150.489 148.235 127.196 1.00 48.89  ? 46   HIS D CB    1 
ATOM   2401  C  CG    . HIS D 4 47  ? 150.871 147.072 126.337 1.00 48.89  ? 46   HIS D CG    1 
ATOM   2402  N  ND1   . HIS D 4 47  ? 151.994 147.075 125.538 1.00 48.89  ? 46   HIS D ND1   1 
ATOM   2403  C  CD2   . HIS D 4 47  ? 150.289 145.862 126.163 1.00 48.89  ? 46   HIS D CD2   1 
ATOM   2404  C  CE1   . HIS D 4 47  ? 152.083 145.921 124.903 1.00 48.89  ? 46   HIS D CE1   1 
ATOM   2405  N  NE2   . HIS D 4 47  ? 151.061 145.167 125.265 1.00 48.89  ? 46   HIS D NE2   1 
ATOM   2406  N  N     . PRO D 4 48  ? 151.988 150.276 129.865 1.00 50.67  ? 47   PRO D N     1 
ATOM   2407  C  CA    . PRO D 4 48  ? 151.729 151.460 130.714 1.00 50.67  ? 47   PRO D CA    1 
ATOM   2408  C  C     . PRO D 4 48  ? 151.163 152.684 130.005 1.00 50.67  ? 47   PRO D C     1 
ATOM   2409  O  O     . PRO D 4 48  ? 150.479 153.488 130.650 1.00 50.67  ? 47   PRO D O     1 
ATOM   2410  C  CB    . PRO D 4 48  ? 153.111 151.765 131.309 1.00 50.67  ? 47   PRO D CB    1 
ATOM   2411  C  CG    . PRO D 4 48  ? 153.862 150.483 131.218 1.00 50.67  ? 47   PRO D CG    1 
ATOM   2412  C  CD    . PRO D 4 48  ? 153.387 149.827 129.962 1.00 50.67  ? 47   PRO D CD    1 
ATOM   2413  N  N     . ASP D 4 49  ? 151.411 152.858 128.709 1.00 51.04  ? 48   ASP D N     1 
ATOM   2414  C  CA    . ASP D 4 49  ? 150.971 154.055 128.006 1.00 51.04  ? 48   ASP D CA    1 
ATOM   2415  C  C     . ASP D 4 49  ? 149.684 153.819 127.214 1.00 51.04  ? 48   ASP D C     1 
ATOM   2416  O  O     . ASP D 4 49  ? 149.398 154.551 126.261 1.00 51.04  ? 48   ASP D O     1 
ATOM   2417  C  CB    . ASP D 4 49  ? 152.092 154.559 127.093 1.00 51.04  ? 48   ASP D CB    1 
ATOM   2418  C  CG    . ASP D 4 49  ? 151.993 156.049 126.804 1.00 51.04  ? 48   ASP D CG    1 
ATOM   2419  O  OD1   . ASP D 4 49  ? 151.058 156.695 127.323 1.00 51.04  ? 48   ASP D OD1   1 
ATOM   2420  O  OD2   . ASP D 4 49  ? 152.859 156.573 126.072 1.00 51.04  ? 48   ASP D OD2   1 
ATOM   2421  N  N     . THR D 4 50  ? 148.899 152.816 127.592 1.00 46.28  ? 49   THR D N     1 
ATOM   2422  C  CA    . THR D 4 50  ? 147.680 152.470 126.881 1.00 46.28  ? 49   THR D CA    1 
ATOM   2423  C  C     . THR D 4 50  ? 146.493 152.593 127.825 1.00 46.28  ? 49   THR D C     1 
ATOM   2424  O  O     . THR D 4 50  ? 146.551 152.132 128.967 1.00 46.28  ? 49   THR D O     1 
ATOM   2425  C  CB    . THR D 4 50  ? 147.788 151.045 126.314 1.00 46.28  ? 49   THR D CB    1 
ATOM   2426  O  OG1   . THR D 4 50  ? 148.826 151.007 125.327 1.00 46.28  ? 49   THR D OG1   1 
ATOM   2427  C  CG2   . THR D 4 50  ? 146.488 150.586 125.672 1.00 46.28  ? 49   THR D CG2   1 
ATOM   2428  N  N     . GLY D 4 51  ? 145.416 153.218 127.348 1.00 42.63  ? 50   GLY D N     1 
ATOM   2429  C  CA    . GLY D 4 51  ? 144.199 153.358 128.108 1.00 42.63  ? 50   GLY D CA    1 
ATOM   2430  C  C     . GLY D 4 51  ? 143.110 152.436 127.597 1.00 42.63  ? 50   GLY D C     1 
ATOM   2431  O  O     . GLY D 4 51  ? 143.324 151.600 126.718 1.00 42.63  ? 50   GLY D O     1 
ATOM   2432  N  N     . ILE D 4 52  ? 141.918 152.608 128.157 1.00 36.20  ? 51   ILE D N     1 
ATOM   2433  C  CA    . ILE D 4 52  ? 140.799 151.734 127.826 1.00 36.20  ? 51   ILE D CA    1 
ATOM   2434  C  C     . ILE D 4 52  ? 139.496 152.504 127.985 1.00 36.20  ? 51   ILE D C     1 
ATOM   2435  O  O     . ILE D 4 52  ? 139.322 153.284 128.925 1.00 36.20  ? 51   ILE D O     1 
ATOM   2436  C  CB    . ILE D 4 52  ? 140.845 150.440 128.675 1.00 36.20  ? 51   ILE D CB    1 
ATOM   2437  C  CG1   . ILE D 4 52  ? 139.770 149.444 128.239 1.00 36.20  ? 51   ILE D CG1   1 
ATOM   2438  C  CG2   . ILE D 4 52  ? 140.824 150.732 130.167 1.00 36.20  ? 51   ILE D CG2   1 
ATOM   2439  C  CD1   . ILE D 4 52  ? 139.802 148.138 128.995 1.00 36.20  ? 51   ILE D CD1   1 
ATOM   2440  N  N     . SER D 4 53  ? 138.601 152.326 127.020 1.00 35.84  ? 52   SER D N     1 
ATOM   2441  C  CA    . SER D 4 53  ? 137.309 152.985 127.070 1.00 35.84  ? 52   SER D CA    1 
ATOM   2442  C  C     . SER D 4 53  ? 136.428 152.332 128.125 1.00 35.84  ? 52   SER D C     1 
ATOM   2443  O  O     . SER D 4 53  ? 136.627 151.171 128.492 1.00 35.84  ? 52   SER D O     1 
ATOM   2444  C  CB    . SER D 4 53  ? 136.624 152.919 125.710 1.00 35.84  ? 52   SER D CB    1 
ATOM   2445  O  OG    . SER D 4 53  ? 135.335 153.500 125.760 1.00 35.84  ? 52   SER D OG    1 
ATOM   2446  N  N     . SER D 4 54  ? 135.476 153.119 128.644 1.00 38.81  ? 53   SER D N     1 
ATOM   2447  C  CA    . SER D 4 54  ? 134.576 152.648 129.696 1.00 38.81  ? 53   SER D CA    1 
ATOM   2448  C  C     . SER D 4 54  ? 133.737 151.466 129.231 1.00 38.81  ? 53   SER D C     1 
ATOM   2449  O  O     . SER D 4 54  ? 133.533 150.504 129.984 1.00 38.81  ? 53   SER D O     1 
ATOM   2450  C  CB    . SER D 4 54  ? 133.672 153.789 130.158 1.00 38.81  ? 53   SER D CB    1 
ATOM   2451  O  OG    . SER D 4 54  ? 132.876 154.263 129.087 1.00 38.81  ? 53   SER D OG    1 
ATOM   2452  N  N     . LYS D 4 55  ? 133.243 151.524 127.991 1.00 33.32  ? 54   LYS D N     1 
ATOM   2453  C  CA    . LYS D 4 55  ? 132.485 150.409 127.437 1.00 33.32  ? 54   LYS D CA    1 
ATOM   2454  C  C     . LYS D 4 55  ? 133.368 149.182 127.263 1.00 33.32  ? 54   LYS D C     1 
ATOM   2455  O  O     . LYS D 4 55  ? 132.917 148.048 127.457 1.00 33.32  ? 54   LYS D O     1 
ATOM   2456  C  CB    . LYS D 4 55  ? 131.848 150.811 126.114 1.00 33.32  ? 54   LYS D CB    1 
ATOM   2457  C  CG    . LYS D 4 55  ? 130.645 149.978 125.765 1.00 33.32  ? 54   LYS D CG    1 
ATOM   2458  C  CD    . LYS D 4 55  ? 129.763 150.692 124.776 1.00 33.32  ? 54   LYS D CD    1 
ATOM   2459  C  CE    . LYS D 4 55  ? 128.980 149.686 123.977 1.00 33.32  ? 54   LYS D CE    1 
ATOM   2460  N  NZ    . LYS D 4 55  ? 129.908 148.729 123.324 1.00 33.32  ? 54   LYS D NZ    1 
ATOM   2461  N  N     . ALA D 4 56  ? 134.634 149.394 126.902 1.00 32.19  ? 55   ALA D N     1 
ATOM   2462  C  CA    . ALA D 4 56  ? 135.566 148.280 126.787 1.00 32.19  ? 55   ALA D CA    1 
ATOM   2463  C  C     . ALA D 4 56  ? 135.867 147.682 128.154 1.00 32.19  ? 55   ALA D C     1 
ATOM   2464  O  O     . ALA D 4 56  ? 136.056 146.466 128.277 1.00 32.19  ? 55   ALA D O     1 
ATOM   2465  C  CB    . ALA D 4 56  ? 136.849 148.734 126.099 1.00 32.19  ? 55   ALA D CB    1 
ATOM   2466  N  N     . MET D 4 57  ? 135.919 148.523 129.191 1.00 31.49  ? 56   MET D N     1 
ATOM   2467  C  CA    . MET D 4 57  ? 136.090 148.020 130.550 1.00 31.49  ? 56   MET D CA    1 
ATOM   2468  C  C     . MET D 4 57  ? 134.881 147.197 130.977 1.00 31.49  ? 56   MET D C     1 
ATOM   2469  O  O     . MET D 4 57  ? 135.026 146.172 131.655 1.00 31.49  ? 56   MET D O     1 
ATOM   2470  C  CB    . MET D 4 57  ? 136.327 149.184 131.511 1.00 31.49  ? 56   MET D CB    1 
ATOM   2471  C  CG    . MET D 4 57  ? 136.464 148.766 132.951 1.00 31.49  ? 56   MET D CG    1 
ATOM   2472  S  SD    . MET D 4 57  ? 137.872 147.664 133.127 1.00 31.49  ? 56   MET D SD    1 
ATOM   2473  C  CE    . MET D 4 57  ? 139.220 148.818 132.935 1.00 31.49  ? 56   MET D CE    1 
ATOM   2474  N  N     . SER D 4 58  ? 133.681 147.629 130.577 1.00 29.65  ? 57   SER D N     1 
ATOM   2475  C  CA    . SER D 4 58  ? 132.466 146.850 130.814 1.00 29.65  ? 57   SER D CA    1 
ATOM   2476  C  C     . SER D 4 58  ? 132.528 145.487 130.125 1.00 29.65  ? 57   SER D C     1 
ATOM   2477  O  O     . SER D 4 58  ? 132.142 144.466 130.711 1.00 29.65  ? 57   SER D O     1 
ATOM   2478  C  CB    . SER D 4 58  ? 131.243 147.632 130.345 1.00 29.65  ? 57   SER D CB    1 
ATOM   2479  O  OG    . SER D 4 58  ? 130.091 146.810 130.348 1.00 29.65  ? 57   SER D OG    1 
ATOM   2480  N  N     . ILE D 4 59  ? 132.930 145.476 128.847 1.00 28.35  ? 58   ILE D N     1 
ATOM   2481  C  CA    . ILE D 4 59  ? 133.126 144.234 128.092 1.00 28.35  ? 58   ILE D CA    1 
ATOM   2482  C  C     . ILE D 4 59  ? 134.120 143.309 128.786 1.00 28.35  ? 58   ILE D C     1 
ATOM   2483  O  O     . ILE D 4 59  ? 133.885 142.099 128.906 1.00 28.35  ? 58   ILE D O     1 
ATOM   2484  C  CB    . ILE D 4 59  ? 133.571 144.559 126.654 1.00 28.35  ? 58   ILE D CB    1 
ATOM   2485  C  CG1   . ILE D 4 59  ? 132.422 145.195 125.888 1.00 28.35  ? 58   ILE D CG1   1 
ATOM   2486  C  CG2   . ILE D 4 59  ? 134.035 143.319 125.922 1.00 28.35  ? 58   ILE D CG2   1 
ATOM   2487  C  CD1   . ILE D 4 59  ? 132.808 145.707 124.546 1.00 28.35  ? 58   ILE D CD1   1 
ATOM   2488  N  N     . MET D 4 60  ? 135.230 143.867 129.278 1.00 28.70  ? 59   MET D N     1 
ATOM   2489  C  CA    . MET D 4 60  ? 136.222 143.066 129.992 1.00 28.70  ? 59   MET D CA    1 
ATOM   2490  C  C     . MET D 4 60  ? 135.666 142.513 131.298 1.00 28.70  ? 59   MET D C     1 
ATOM   2491  O  O     . MET D 4 60  ? 135.977 141.378 131.679 1.00 28.70  ? 59   MET D O     1 
ATOM   2492  C  CB    . MET D 4 60  ? 137.473 143.894 130.258 1.00 28.70  ? 59   MET D CB    1 
ATOM   2493  C  CG    . MET D 4 60  ? 138.345 144.061 129.040 1.00 28.70  ? 59   MET D CG    1 
ATOM   2494  S  SD    . MET D 4 60  ? 138.838 142.471 128.374 1.00 28.70  ? 59   MET D SD    1 
ATOM   2495  C  CE    . MET D 4 60  ? 139.748 141.830 129.766 1.00 28.70  ? 59   MET D CE    1 
ATOM   2496  N  N     . ASN D 4 61  ? 134.838 143.298 131.988 1.00 27.96  ? 60   ASN D N     1 
ATOM   2497  C  CA    . ASN D 4 61  ? 134.215 142.831 133.223 1.00 27.96  ? 60   ASN D CA    1 
ATOM   2498  C  C     . ASN D 4 61  ? 133.256 141.681 132.958 1.00 27.96  ? 60   ASN D C     1 
ATOM   2499  O  O     . ASN D 4 61  ? 133.241 140.691 133.704 1.00 27.96  ? 60   ASN D O     1 
ATOM   2500  C  CB    . ASN D 4 61  ? 133.471 143.982 133.889 1.00 27.96  ? 60   ASN D CB    1 
ATOM   2501  C  CG    . ASN D 4 61  ? 132.979 143.632 135.265 1.00 27.96  ? 60   ASN D CG    1 
ATOM   2502  O  OD1   . ASN D 4 61  ? 133.763 143.305 136.150 1.00 27.96  ? 60   ASN D OD1   1 
ATOM   2503  N  ND2   . ASN D 4 61  ? 131.667 143.688 135.454 1.00 27.96  ? 60   ASN D ND2   1 
ATOM   2504  N  N     . SER D 4 62  ? 132.464 141.790 131.889 1.00 27.60  ? 61   SER D N     1 
ATOM   2505  C  CA    . SER D 4 62  ? 131.563 140.704 131.515 1.00 27.60  ? 61   SER D CA    1 
ATOM   2506  C  C     . SER D 4 62  ? 132.341 139.465 131.098 1.00 27.60  ? 61   SER D C     1 
ATOM   2507  O  O     . SER D 4 62  ? 131.921 138.341 131.383 1.00 27.60  ? 61   SER D O     1 
ATOM   2508  C  CB    . SER D 4 62  ? 130.623 141.156 130.404 1.00 27.60  ? 61   SER D CB    1 
ATOM   2509  O  OG    . SER D 4 62  ? 129.761 142.178 130.872 1.00 27.60  ? 61   SER D OG    1 
ATOM   2510  N  N     . PHE D 4 63  ? 133.485 139.656 130.436 1.00 26.13  ? 62   PHE D N     1 
ATOM   2511  C  CA    . PHE D 4 63  ? 134.324 138.529 130.034 1.00 26.13  ? 62   PHE D CA    1 
ATOM   2512  C  C     . PHE D 4 63  ? 134.896 137.800 131.244 1.00 26.13  ? 62   PHE D C     1 
ATOM   2513  O  O     . PHE D 4 63  ? 134.928 136.563 131.276 1.00 26.13  ? 62   PHE D O     1 
ATOM   2514  C  CB    . PHE D 4 63  ? 135.450 139.013 129.122 1.00 26.13  ? 62   PHE D CB    1 
ATOM   2515  C  CG    . PHE D 4 63  ? 136.507 137.983 128.871 1.00 26.13  ? 62   PHE D CG    1 
ATOM   2516  C  CD1   . PHE D 4 63  ? 136.269 136.945 127.994 1.00 26.13  ? 62   PHE D CD1   1 
ATOM   2517  C  CD2   . PHE D 4 63  ? 137.742 138.065 129.490 1.00 26.13  ? 62   PHE D CD2   1 
ATOM   2518  C  CE1   . PHE D 4 63  ? 137.233 135.993 127.751 1.00 26.13  ? 62   PHE D CE1   1 
ATOM   2519  C  CE2   . PHE D 4 63  ? 138.709 137.115 129.254 1.00 26.13  ? 62   PHE D CE2   1 
ATOM   2520  C  CZ    . PHE D 4 63  ? 138.455 136.079 128.381 1.00 26.13  ? 62   PHE D CZ    1 
ATOM   2521  N  N     . VAL D 4 64  ? 135.396 138.557 132.226 1.00 25.34  ? 63   VAL D N     1 
ATOM   2522  C  CA    . VAL D 4 64  ? 135.959 137.956 133.435 1.00 25.34  ? 63   VAL D CA    1 
ATOM   2523  C  C     . VAL D 4 64  ? 134.880 137.212 134.214 1.00 25.34  ? 63   VAL D C     1 
ATOM   2524  O  O     . VAL D 4 64  ? 135.094 136.079 134.667 1.00 25.34  ? 63   VAL D O     1 
ATOM   2525  C  CB    . VAL D 4 64  ? 136.653 139.027 134.294 1.00 25.34  ? 63   VAL D CB    1 
ATOM   2526  C  CG1   . VAL D 4 64  ? 137.037 138.476 135.646 1.00 25.34  ? 63   VAL D CG1   1 
ATOM   2527  C  CG2   . VAL D 4 64  ? 137.892 139.508 133.595 1.00 25.34  ? 63   VAL D CG2   1 
ATOM   2528  N  N     . ASN D 4 65  ? 133.698 137.827 134.355 1.00 24.57  ? 64   ASN D N     1 
ATOM   2529  C  CA    . ASN D 4 65  ? 132.579 137.160 135.021 1.00 24.57  ? 64   ASN D CA    1 
ATOM   2530  C  C     . ASN D 4 65  ? 132.142 135.903 134.273 1.00 24.57  ? 64   ASN D C     1 
ATOM   2531  O  O     . ASN D 4 65  ? 131.780 134.900 134.897 1.00 24.57  ? 64   ASN D O     1 
ATOM   2532  C  CB    . ASN D 4 65  ? 131.405 138.122 135.175 1.00 24.57  ? 64   ASN D CB    1 
ATOM   2533  C  CG    . ASN D 4 65  ? 131.532 139.000 136.398 1.00 24.57  ? 64   ASN D CG    1 
ATOM   2534  O  OD1   . ASN D 4 65  ? 131.888 138.531 137.476 1.00 24.57  ? 64   ASN D OD1   1 
ATOM   2535  N  ND2   . ASN D 4 65  ? 131.227 140.281 136.241 1.00 24.57  ? 64   ASN D ND2   1 
ATOM   2536  N  N     . ASP D 4 66  ? 132.188 135.935 132.940 1.00 24.25  ? 65   ASP D N     1 
ATOM   2537  C  CA    . ASP D 4 66  ? 131.828 134.778 132.124 1.00 24.25  ? 65   ASP D CA    1 
ATOM   2538  C  C     . ASP D 4 66  ? 132.794 133.617 132.337 1.00 24.25  ? 65   ASP D C     1 
ATOM   2539  O  O     . ASP D 4 66  ? 132.361 132.480 132.558 1.00 24.25  ? 65   ASP D O     1 
ATOM   2540  C  CB    . ASP D 4 66  ? 131.791 135.182 130.655 1.00 24.25  ? 65   ASP D CB    1 
ATOM   2541  C  CG    . ASP D 4 66  ? 131.193 134.111 129.763 1.00 24.25  ? 65   ASP D CG    1 
ATOM   2542  O  OD1   . ASP D 4 66  ? 130.593 133.146 130.280 1.00 24.25  ? 65   ASP D OD1   1 
ATOM   2543  O  OD2   . ASP D 4 66  ? 131.332 134.233 128.529 1.00 24.25  ? 65   ASP D OD2   1 
ATOM   2544  N  N     . VAL D 4 67  ? 134.097 133.866 132.138 1.00 23.33  ? 66   VAL D N     1 
ATOM   2545  C  CA    . VAL D 4 67  ? 135.129 132.844 132.351 1.00 23.33  ? 66   VAL D CA    1 
ATOM   2546  C  C     . VAL D 4 67  ? 135.056 132.279 133.765 1.00 23.33  ? 66   VAL D C     1 
ATOM   2547  O  O     . VAL D 4 67  ? 135.165 131.059 133.972 1.00 23.33  ? 66   VAL D O     1 
ATOM   2548  C  CB    . VAL D 4 67  ? 136.523 133.421 132.038 1.00 23.33  ? 66   VAL D CB    1 
ATOM   2549  C  CG1   . VAL D 4 67  ? 137.615 132.435 132.386 1.00 23.33  ? 66   VAL D CG1   1 
ATOM   2550  C  CG2   . VAL D 4 67  ? 136.615 133.772 130.576 1.00 23.33  ? 66   VAL D CG2   1 
ATOM   2551  N  N     . PHE D 4 68  ? 134.850 133.160 134.752 1.00 24.16  ? 67   PHE D N     1 
ATOM   2552  C  CA    . PHE D 4 68  ? 134.627 132.750 136.136 1.00 24.16  ? 67   PHE D CA    1 
ATOM   2553  C  C     . PHE D 4 68  ? 133.449 131.796 136.269 1.00 24.16  ? 67   PHE D C     1 
ATOM   2554  O  O     . PHE D 4 68  ? 133.560 130.752 136.921 1.00 24.16  ? 67   PHE D O     1 
ATOM   2555  C  CB    . PHE D 4 68  ? 134.402 133.976 137.008 1.00 24.16  ? 67   PHE D CB    1 
ATOM   2556  C  CG    . PHE D 4 68  ? 133.997 133.641 138.396 1.00 24.16  ? 67   PHE D CG    1 
ATOM   2557  C  CD1   . PHE D 4 68  ? 134.809 132.875 139.205 1.00 24.16  ? 67   PHE D CD1   1 
ATOM   2558  C  CD2   . PHE D 4 68  ? 132.778 134.073 138.884 1.00 24.16  ? 67   PHE D CD2   1 
ATOM   2559  C  CE1   . PHE D 4 68  ? 134.420 132.558 140.483 1.00 24.16  ? 67   PHE D CE1   1 
ATOM   2560  C  CE2   . PHE D 4 68  ? 132.385 133.763 140.160 1.00 24.16  ? 67   PHE D CE2   1 
ATOM   2561  C  CZ    . PHE D 4 68  ? 133.207 133.001 140.961 1.00 24.16  ? 67   PHE D CZ    1 
ATOM   2562  N  N     . GLU D 4 69  ? 132.300 132.168 135.698 1.00 25.11  ? 68   GLU D N     1 
ATOM   2563  C  CA    . GLU D 4 69  ? 131.101 131.344 135.806 1.00 25.11  ? 68   GLU D CA    1 
ATOM   2564  C  C     . GLU D 4 69  ? 131.282 129.990 135.132 1.00 25.11  ? 68   GLU D C     1 
ATOM   2565  O  O     . GLU D 4 69  ? 130.836 128.970 135.666 1.00 25.11  ? 68   GLU D O     1 
ATOM   2566  C  CB    . GLU D 4 69  ? 129.907 132.082 135.206 1.00 25.11  ? 68   GLU D CB    1 
ATOM   2567  C  CG    . GLU D 4 69  ? 128.587 131.733 135.856 1.00 25.11  ? 68   GLU D CG    1 
ATOM   2568  C  CD    . GLU D 4 69  ? 127.944 130.507 135.243 1.00 25.11  ? 68   GLU D CD    1 
ATOM   2569  O  OE1   . GLU D 4 69  ? 127.062 129.908 135.893 1.00 25.11  ? 68   GLU D OE1   1 
ATOM   2570  O  OE2   . GLU D 4 69  ? 128.319 130.143 134.109 1.00 25.11  ? 68   GLU D OE2   1 
ATOM   2571  N  N     . ARG D 4 70  ? 131.944 129.960 133.971 1.00 24.16  ? 69   ARG D N     1 
ATOM   2572  C  CA    . ARG D 4 70  ? 132.201 128.692 133.287 1.00 24.16  ? 69   ARG D CA    1 
ATOM   2573  C  C     . ARG D 4 70  ? 133.105 127.778 134.103 1.00 24.16  ? 69   ARG D C     1 
ATOM   2574  O  O     . ARG D 4 70  ? 132.801 126.590 134.272 1.00 24.16  ? 69   ARG D O     1 
ATOM   2575  C  CB    . ARG D 4 70  ? 132.791 128.927 131.899 1.00 24.16  ? 69   ARG D CB    1 
ATOM   2576  C  CG    . ARG D 4 70  ? 131.840 129.609 130.944 1.00 24.16  ? 69   ARG D CG    1 
ATOM   2577  C  CD    . ARG D 4 70  ? 132.326 129.485 129.517 1.00 24.16  ? 69   ARG D CD    1 
ATOM   2578  N  NE    . ARG D 4 70  ? 131.796 130.545 128.669 1.00 24.16  ? 69   ARG D NE    1 
ATOM   2579  C  CZ    . ARG D 4 70  ? 132.086 130.680 127.380 1.00 24.16  ? 69   ARG D CZ    1 
ATOM   2580  N  NH1   . ARG D 4 70  ? 132.901 129.818 126.791 1.00 24.16  ? 69   ARG D NH1   1 
ATOM   2581  N  NH2   . ARG D 4 70  ? 131.559 131.674 126.680 1.00 24.16  ? 69   ARG D NH2   1 
ATOM   2582  N  N     . ILE D 4 71  ? 134.231 128.308 134.596 1.00 22.57  ? 70   ILE D N     1 
ATOM   2583  C  CA    . ILE D 4 71  ? 135.170 127.486 135.360 1.00 22.57  ? 70   ILE D CA    1 
ATOM   2584  C  C     . ILE D 4 71  ? 134.539 127.007 136.666 1.00 22.57  ? 70   ILE D C     1 
ATOM   2585  O  O     . ILE D 4 71  ? 134.693 125.839 137.049 1.00 22.57  ? 70   ILE D O     1 
ATOM   2586  C  CB    . ILE D 4 71  ? 136.490 128.245 135.586 1.00 22.57  ? 70   ILE D CB    1 
ATOM   2587  C  CG1   . ILE D 4 71  ? 137.210 128.434 134.255 1.00 22.57  ? 70   ILE D CG1   1 
ATOM   2588  C  CG2   . ILE D 4 71  ? 137.408 127.486 136.514 1.00 22.57  ? 70   ILE D CG2   1 
ATOM   2589  C  CD1   . ILE D 4 71  ? 138.471 129.250 134.356 1.00 22.57  ? 70   ILE D CD1   1 
ATOM   2590  N  N     . ALA D 4 72  ? 133.801 127.885 137.356 1.00 25.98  ? 71   ALA D N     1 
ATOM   2591  C  CA    . ALA D 4 72  ? 133.136 127.488 138.595 1.00 25.98  ? 71   ALA D CA    1 
ATOM   2592  C  C     . ALA D 4 72  ? 132.046 126.449 138.343 1.00 25.98  ? 71   ALA D C     1 
ATOM   2593  O  O     . ALA D 4 72  ? 131.891 125.511 139.131 1.00 25.98  ? 71   ALA D O     1 
ATOM   2594  C  CB    . ALA D 4 72  ? 132.557 128.711 139.301 1.00 25.98  ? 71   ALA D CB    1 
ATOM   2595  N  N     . GLY D 4 73  ? 131.284 126.600 137.253 1.00 24.77  ? 72   GLY D N     1 
ATOM   2596  C  CA    . GLY D 4 73  ? 130.275 125.608 136.908 1.00 24.77  ? 72   GLY D CA    1 
ATOM   2597  C  C     . GLY D 4 73  ? 130.868 124.245 136.609 1.00 24.77  ? 72   GLY D C     1 
ATOM   2598  O  O     . GLY D 4 73  ? 130.348 123.217 137.052 1.00 24.77  ? 72   GLY D O     1 
ATOM   2599  N  N     . GLU D 4 74  ? 131.958 124.219 135.833 1.00 25.59  ? 73   GLU D N     1 
ATOM   2600  C  CA    . GLU D 4 74  ? 132.616 122.952 135.517 1.00 25.59  ? 73   GLU D CA    1 
ATOM   2601  C  C     . GLU D 4 74  ? 133.242 122.307 136.747 1.00 25.59  ? 73   GLU D C     1 
ATOM   2602  O  O     . GLU D 4 74  ? 133.189 121.082 136.892 1.00 25.59  ? 73   GLU D O     1 
ATOM   2603  C  CB    . GLU D 4 74  ? 133.649 123.145 134.416 1.00 25.59  ? 73   GLU D CB    1 
ATOM   2604  C  CG    . GLU D 4 74  ? 133.007 123.477 133.086 1.00 25.59  ? 73   GLU D CG    1 
ATOM   2605  C  CD    . GLU D 4 74  ? 131.693 122.743 132.865 1.00 25.59  ? 73   GLU D CD    1 
ATOM   2606  O  OE1   . GLU D 4 74  ? 131.715 121.508 132.687 1.00 25.59  ? 73   GLU D OE1   1 
ATOM   2607  O  OE2   . GLU D 4 74  ? 130.635 123.406 132.866 1.00 25.59  ? 73   GLU D OE2   1 
ATOM   2608  N  N     . ALA D 4 75  ? 133.883 123.099 137.614 1.00 24.12  ? 74   ALA D N     1 
ATOM   2609  C  CA    . ALA D 4 75  ? 134.407 122.554 138.865 1.00 24.12  ? 74   ALA D CA    1 
ATOM   2610  C  C     . ALA D 4 75  ? 133.287 122.020 139.750 1.00 24.12  ? 74   ALA D C     1 
ATOM   2611  O  O     . ALA D 4 75  ? 133.462 121.007 140.436 1.00 24.12  ? 74   ALA D O     1 
ATOM   2612  C  CB    . ALA D 4 75  ? 135.215 123.612 139.605 1.00 24.12  ? 74   ALA D CB    1 
ATOM   2613  N  N     . SER D 4 76  ? 132.131 122.692 139.747 1.00 25.29  ? 75   SER D N     1 
ATOM   2614  C  CA    . SER D 4 76  ? 130.964 122.209 140.480 1.00 25.29  ? 75   SER D CA    1 
ATOM   2615  C  C     . SER D 4 76  ? 130.493 120.862 139.948 1.00 25.29  ? 75   SER D C     1 
ATOM   2616  O  O     . SER D 4 76  ? 130.202 119.944 140.725 1.00 25.29  ? 75   SER D O     1 
ATOM   2617  C  CB    . SER D 4 76  ? 129.837 123.234 140.395 1.00 25.29  ? 75   SER D CB    1 
ATOM   2618  O  OG    . SER D 4 76  ? 129.058 123.025 139.232 1.00 25.29  ? 75   SER D OG    1 
ATOM   2619  N  N     . ARG D 4 77  ? 130.389 120.739 138.620 1.00 28.47  ? 76   ARG D N     1 
ATOM   2620  C  CA    . ARG D 4 77  ? 129.992 119.469 138.014 1.00 28.47  ? 76   ARG D CA    1 
ATOM   2621  C  C     . ARG D 4 77  ? 131.009 118.370 138.291 1.00 28.47  ? 76   ARG D C     1 
ATOM   2622  O  O     . ARG D 4 77  ? 130.629 117.216 138.505 1.00 28.47  ? 76   ARG D O     1 
ATOM   2623  C  CB    . ARG D 4 77  ? 129.781 119.629 136.511 1.00 28.47  ? 76   ARG D CB    1 
ATOM   2624  C  CG    . ARG D 4 77  ? 128.329 119.815 136.104 1.00 28.47  ? 76   ARG D CG    1 
ATOM   2625  C  CD    . ARG D 4 77  ? 127.766 121.150 136.549 1.00 28.47  ? 76   ARG D CD    1 
ATOM   2626  N  NE    . ARG D 4 77  ? 126.467 121.425 135.941 1.00 28.47  ? 76   ARG D NE    1 
ATOM   2627  C  CZ    . ARG D 4 77  ? 126.301 121.968 134.738 1.00 28.47  ? 76   ARG D CZ    1 
ATOM   2628  N  NH1   . ARG D 4 77  ? 127.356 122.302 134.006 1.00 28.47  ? 76   ARG D NH1   1 
ATOM   2629  N  NH2   . ARG D 4 77  ? 125.079 122.181 134.268 1.00 28.47  ? 76   ARG D NH2   1 
ATOM   2630  N  N     . LEU D 4 78  ? 132.300 118.704 138.274 1.00 27.58  ? 77   LEU D N     1 
ATOM   2631  C  CA    . LEU D 4 78  ? 133.339 117.730 138.606 1.00 27.58  ? 77   LEU D CA    1 
ATOM   2632  C  C     . LEU D 4 78  ? 133.217 117.241 140.043 1.00 27.58  ? 77   LEU D C     1 
ATOM   2633  O  O     . LEU D 4 78  ? 133.373 116.044 140.314 1.00 27.58  ? 77   LEU D O     1 
ATOM   2634  C  CB    . LEU D 4 78  ? 134.715 118.331 138.359 1.00 27.58  ? 77   LEU D CB    1 
ATOM   2635  C  CG    . LEU D 4 78  ? 135.203 118.227 136.931 1.00 27.58  ? 77   LEU D CG    1 
ATOM   2636  C  CD1   . LEU D 4 78  ? 136.372 119.136 136.732 1.00 27.58  ? 77   LEU D CD1   1 
ATOM   2637  C  CD2   . LEU D 4 78  ? 135.640 116.807 136.774 1.00 27.58  ? 77   LEU D CD2   1 
ATOM   2638  N  N     . ALA D 4 79  ? 132.989 118.161 140.985 1.00 28.05  ? 78   ALA D N     1 
ATOM   2639  C  CA    . ALA D 4 79  ? 132.792 117.766 142.376 1.00 28.05  ? 78   ALA D CA    1 
ATOM   2640  C  C     . ALA D 4 79  ? 131.535 116.925 142.550 1.00 28.05  ? 78   ALA D C     1 
ATOM   2641  O  O     . ALA D 4 79  ? 131.520 115.974 143.338 1.00 28.05  ? 78   ALA D O     1 
ATOM   2642  C  CB    . ALA D 4 79  ? 132.730 119.004 143.265 1.00 28.05  ? 78   ALA D CB    1 
ATOM   2643  N  N     . HIS D 4 80  ? 130.481 117.242 141.798 1.00 27.09  ? 79   HIS D N     1 
ATOM   2644  C  CA    . HIS D 4 80  ? 129.231 116.500 141.923 1.00 27.09  ? 79   HIS D CA    1 
ATOM   2645  C  C     . HIS D 4 80  ? 129.347 115.089 141.359 1.00 27.09  ? 79   HIS D C     1 
ATOM   2646  O  O     . HIS D 4 80  ? 128.876 114.128 141.978 1.00 27.09  ? 79   HIS D O     1 
ATOM   2647  C  CB    . HIS D 4 80  ? 128.104 117.257 141.231 1.00 27.09  ? 79   HIS D CB    1 
ATOM   2648  C  CG    . HIS D 4 80  ? 126.804 116.524 141.242 1.00 27.09  ? 79   HIS D CG    1 
ATOM   2649  N  ND1   . HIS D 4 80  ? 126.013 116.432 142.365 1.00 27.09  ? 79   HIS D ND1   1 
ATOM   2650  C  CD2   . HIS D 4 80  ? 126.162 115.834 140.271 1.00 27.09  ? 79   HIS D CD2   1 
ATOM   2651  C  CE1   . HIS D 4 80  ? 124.935 115.722 142.084 1.00 27.09  ? 79   HIS D CE1   1 
ATOM   2652  N  NE2   . HIS D 4 80  ? 125.001 115.348 140.819 1.00 27.09  ? 79   HIS D NE2   1 
ATOM   2653  N  N     . TYR D 4 81  ? 129.913 114.957 140.152 1.00 29.31  ? 80   TYR D N     1 
ATOM   2654  C  CA    . TYR D 4 81  ? 130.056 113.656 139.497 1.00 29.31  ? 80   TYR D CA    1 
ATOM   2655  C  C     . TYR D 4 81  ? 130.906 112.680 140.300 1.00 29.31  ? 80   TYR D C     1 
ATOM   2656  O  O     . TYR D 4 81  ? 130.689 111.466 140.221 1.00 29.31  ? 80   TYR D O     1 
ATOM   2657  C  CB    . TYR D 4 81  ? 130.643 113.828 138.096 1.00 29.31  ? 80   TYR D CB    1 
ATOM   2658  C  CG    . TYR D 4 81  ? 129.727 114.557 137.142 1.00 29.31  ? 80   TYR D CG    1 
ATOM   2659  C  CD1   . TYR D 4 81  ? 128.348 114.518 137.307 1.00 29.31  ? 80   TYR D CD1   1 
ATOM   2660  C  CD2   . TYR D 4 81  ? 130.240 115.274 136.069 1.00 29.31  ? 80   TYR D CD2   1 
ATOM   2661  C  CE1   . TYR D 4 81  ? 127.507 115.186 136.442 1.00 29.31  ? 80   TYR D CE1   1 
ATOM   2662  C  CE2   . TYR D 4 81  ? 129.406 115.941 135.195 1.00 29.31  ? 80   TYR D CE2   1 
ATOM   2663  C  CZ    . TYR D 4 81  ? 128.041 115.892 135.385 1.00 29.31  ? 80   TYR D CZ    1 
ATOM   2664  O  OH    . TYR D 4 81  ? 127.208 116.557 134.516 1.00 29.31  ? 80   TYR D OH    1 
ATOM   2665  N  N     . ASN D 4 82  ? 131.869 113.174 141.075 1.00 29.97  ? 81   ASN D N     1 
ATOM   2666  C  CA    . ASN D 4 82  ? 132.738 112.305 141.852 1.00 29.97  ? 81   ASN D CA    1 
ATOM   2667  C  C     . ASN D 4 82  ? 132.336 112.242 143.319 1.00 29.97  ? 81   ASN D C     1 
ATOM   2668  O  O     . ASN D 4 82  ? 133.136 111.790 144.147 1.00 29.97  ? 81   ASN D O     1 
ATOM   2669  C  CB    . ASN D 4 82  ? 134.185 112.769 141.725 1.00 29.97  ? 81   ASN D CB    1 
ATOM   2670  C  CG    . ASN D 4 82  ? 134.696 112.662 140.318 1.00 29.97  ? 81   ASN D CG    1 
ATOM   2671  O  OD1   . ASN D 4 82  ? 133.921 112.661 139.365 1.00 29.97  ? 81   ASN D OD1   1 
ATOM   2672  N  ND2   . ASN D 4 82  ? 136.008 112.576 140.173 1.00 29.97  ? 81   ASN D ND2   1 
ATOM   2673  N  N     . LYS D 4 83  ? 131.096 112.642 143.629 1.00 31.75  ? 82   LYS D N     1 
ATOM   2674  C  CA    . LYS D 4 83  ? 130.483 112.581 144.963 1.00 31.75  ? 82   LYS D CA    1 
ATOM   2675  C  C     . LYS D 4 83  ? 131.351 113.247 146.029 1.00 31.75  ? 82   LYS D C     1 
ATOM   2676  O  O     . LYS D 4 83  ? 131.539 112.727 147.129 1.00 31.75  ? 82   LYS D O     1 
ATOM   2677  C  CB    . LYS D 4 83  ? 130.170 111.133 145.344 1.00 31.75  ? 82   LYS D CB    1 
ATOM   2678  C  CG    . LYS D 4 83  ? 129.331 110.391 144.317 1.00 31.75  ? 82   LYS D CG    1 
ATOM   2679  C  CD    . LYS D 4 83  ? 128.024 111.106 144.033 1.00 31.75  ? 82   LYS D CD    1 
ATOM   2680  C  CE    . LYS D 4 83  ? 126.923 110.640 144.967 1.00 31.75  ? 82   LYS D CE    1 
ATOM   2681  N  NZ    . LYS D 4 83  ? 125.717 111.506 144.866 1.00 31.75  ? 82   LYS D NZ    1 
ATOM   2682  N  N     . ARG D 4 84  ? 131.887 114.413 145.692 1.00 39.05  ? 83   ARG D N     1 
ATOM   2683  C  CA    . ARG D 4 84  ? 132.691 115.193 146.616 1.00 39.05  ? 83   ARG D CA    1 
ATOM   2684  C  C     . ARG D 4 84  ? 132.077 116.571 146.819 1.00 39.05  ? 83   ARG D C     1 
ATOM   2685  O  O     . ARG D 4 84  ? 131.413 117.112 145.933 1.00 39.05  ? 83   ARG D O     1 
ATOM   2686  C  CB    . ARG D 4 84  ? 134.129 115.317 146.116 1.00 39.05  ? 83   ARG D CB    1 
ATOM   2687  C  CG    . ARG D 4 84  ? 134.976 114.120 146.474 1.00 39.05  ? 83   ARG D CG    1 
ATOM   2688  C  CD    . ARG D 4 84  ? 136.375 114.232 145.904 1.00 39.05  ? 83   ARG D CD    1 
ATOM   2689  N  NE    . ARG D 4 84  ? 137.294 113.280 146.522 1.00 39.05  ? 83   ARG D NE    1 
ATOM   2690  C  CZ    . ARG D 4 84  ? 137.368 111.987 146.218 1.00 39.05  ? 83   ARG D CZ    1 
ATOM   2691  N  NH1   . ARG D 4 84  ? 136.582 111.464 145.286 1.00 39.05  ? 83   ARG D NH1   1 
ATOM   2692  N  NH2   . ARG D 4 84  ? 138.240 111.211 146.846 1.00 39.05  ? 83   ARG D NH2   1 
ATOM   2693  N  N     . SER D 4 85  ? 132.273 117.121 148.014 1.00 41.60  ? 84   SER D N     1 
ATOM   2694  C  CA    . SER D 4 85  ? 131.682 118.400 148.378 1.00 41.60  ? 84   SER D CA    1 
ATOM   2695  C  C     . SER D 4 85  ? 132.711 119.516 148.526 1.00 41.60  ? 84   SER D C     1 
ATOM   2696  O  O     . SER D 4 85  ? 132.435 120.516 149.195 1.00 41.60  ? 84   SER D O     1 
ATOM   2697  C  CB    . SER D 4 85  ? 130.880 118.239 149.666 1.00 41.60  ? 84   SER D CB    1 
ATOM   2698  O  OG    . SER D 4 85  ? 131.669 117.615 150.663 1.00 41.60  ? 84   SER D OG    1 
ATOM   2699  N  N     . THR D 4 86  ? 133.887 119.382 147.916 1.00 37.91  ? 85   THR D N     1 
ATOM   2700  C  CA    . THR D 4 86  ? 134.927 120.397 148.039 1.00 37.91  ? 85   THR D CA    1 
ATOM   2701  C  C     . THR D 4 86  ? 135.527 120.733 146.682 1.00 37.91  ? 85   THR D C     1 
ATOM   2702  O  O     . THR D 4 86  ? 135.982 119.841 145.961 1.00 37.91  ? 85   THR D O     1 
ATOM   2703  C  CB    . THR D 4 86  ? 136.034 119.929 148.990 1.00 37.91  ? 85   THR D CB    1 
ATOM   2704  O  OG1   . THR D 4 86  ? 135.457 119.537 150.241 1.00 37.91  ? 85   THR D OG1   1 
ATOM   2705  C  CG2   . THR D 4 86  ? 137.038 121.039 149.236 1.00 37.91  ? 85   THR D CG2   1 
ATOM   2706  N  N     . ILE D 4 87  ? 135.530 122.018 146.345 1.00 27.63  ? 86   ILE D N     1 
ATOM   2707  C  CA    . ILE D 4 87  ? 136.232 122.527 145.173 1.00 27.63  ? 86   ILE D CA    1 
ATOM   2708  C  C     . ILE D 4 87  ? 137.630 122.924 145.629 1.00 27.63  ? 86   ILE D C     1 
ATOM   2709  O  O     . ILE D 4 87  ? 137.798 123.897 146.367 1.00 27.63  ? 86   ILE D O     1 
ATOM   2710  C  CB    . ILE D 4 87  ? 135.494 123.709 144.539 1.00 27.63  ? 86   ILE D CB    1 
ATOM   2711  C  CG1   . ILE D 4 87  ? 134.209 123.227 143.875 1.00 27.63  ? 86   ILE D CG1   1 
ATOM   2712  C  CG2   . ILE D 4 87  ? 136.365 124.385 143.500 1.00 27.63  ? 86   ILE D CG2   1 
ATOM   2713  C  CD1   . ILE D 4 87  ? 133.472 124.291 143.093 1.00 27.63  ? 86   ILE D CD1   1 
ATOM   2714  N  N     . THR D 4 88  ? 138.625 122.144 145.247 1.00 26.79  ? 87   THR D N     1 
ATOM   2715  C  CA    . THR D 4 88  ? 140.009 122.404 145.603 1.00 26.79  ? 87   THR D CA    1 
ATOM   2716  C  C     . THR D 4 88  ? 140.704 122.916 144.338 1.00 26.79  ? 87   THR D C     1 
ATOM   2717  O  O     . THR D 4 88  ? 140.067 123.078 143.295 1.00 26.79  ? 87   THR D O     1 
ATOM   2718  C  CB    . THR D 4 88  ? 140.639 121.129 146.181 1.00 26.79  ? 87   THR D CB    1 
ATOM   2719  O  OG1   . THR D 4 88  ? 139.659 120.461 146.979 1.00 26.79  ? 87   THR D OG1   1 
ATOM   2720  C  CG2   . THR D 4 88  ? 141.790 121.449 147.143 1.00 26.79  ? 87   THR D CG2   1 
ATOM   2721  N  N     . SER D 4 89  ? 142.003 123.225 144.436 1.00 28.02  ? 88   SER D N     1 
ATOM   2722  C  CA    . SER D 4 89  ? 142.773 123.666 143.275 1.00 28.02  ? 88   SER D CA    1 
ATOM   2723  C  C     . SER D 4 89  ? 142.854 122.609 142.179 1.00 28.02  ? 88   SER D C     1 
ATOM   2724  O  O     . SER D 4 89  ? 143.045 122.959 141.010 1.00 28.02  ? 88   SER D O     1 
ATOM   2725  C  CB    . SER D 4 89  ? 144.187 124.046 143.699 1.00 28.02  ? 88   SER D CB    1 
ATOM   2726  O  OG    . SER D 4 89  ? 145.018 122.899 143.717 1.00 28.02  ? 88   SER D OG    1 
ATOM   2727  N  N     . ARG D 4 90  ? 142.687 121.333 142.527 1.00 28.46  ? 89   ARG D N     1 
ATOM   2728  C  CA    . ARG D 4 90  ? 142.742 120.263 141.539 1.00 28.46  ? 89   ARG D CA    1 
ATOM   2729  C  C     . ARG D 4 90  ? 141.530 120.301 140.620 1.00 28.46  ? 89   ARG D C     1 
ATOM   2730  O  O     . ARG D 4 90  ? 141.656 120.107 139.404 1.00 28.46  ? 89   ARG D O     1 
ATOM   2731  C  CB    . ARG D 4 90  ? 142.822 118.917 142.256 1.00 28.46  ? 89   ARG D CB    1 
ATOM   2732  C  CG    . ARG D 4 90  ? 143.372 117.773 141.437 1.00 28.46  ? 89   ARG D CG    1 
ATOM   2733  C  CD    . ARG D 4 90  ? 143.534 116.545 142.319 1.00 28.46  ? 89   ARG D CD    1 
ATOM   2734  N  NE    . ARG D 4 90  ? 144.352 115.504 141.704 1.00 28.46  ? 89   ARG D NE    1 
ATOM   2735  C  CZ    . ARG D 4 90  ? 143.891 114.604 140.841 1.00 28.46  ? 89   ARG D CZ    1 
ATOM   2736  N  NH1   . ARG D 4 90  ? 142.614 114.612 140.486 1.00 28.46  ? 89   ARG D NH1   1 
ATOM   2737  N  NH2   . ARG D 4 90  ? 144.709 113.692 140.335 1.00 28.46  ? 89   ARG D NH2   1 
ATOM   2738  N  N     . GLU D 4 91  ? 140.348 120.531 141.193 1.00 26.57  ? 90   GLU D N     1 
ATOM   2739  C  CA    . GLU D 4 91  ? 139.123 120.619 140.406 1.00 26.57  ? 90   GLU D CA    1 
ATOM   2740  C  C     . GLU D 4 91  ? 139.150 121.823 139.469 1.00 26.57  ? 90   GLU D C     1 
ATOM   2741  O  O     . GLU D 4 91  ? 138.726 121.727 138.308 1.00 26.57  ? 90   GLU D O     1 
ATOM   2742  C  CB    . GLU D 4 91  ? 137.935 120.678 141.359 1.00 26.57  ? 90   GLU D CB    1 
ATOM   2743  C  CG    . GLU D 4 91  ? 137.752 119.368 142.115 1.00 26.57  ? 90   GLU D CG    1 
ATOM   2744  C  CD    . GLU D 4 91  ? 136.316 118.937 142.255 1.00 26.57  ? 90   GLU D CD    1 
ATOM   2745  O  OE1   . GLU D 4 91  ? 135.984 118.265 143.254 1.00 26.57  ? 90   GLU D OE1   1 
ATOM   2746  O  OE2   . GLU D 4 91  ? 135.522 119.268 141.363 1.00 26.57  ? 90   GLU D OE2   1 
ATOM   2747  N  N     . ILE D 4 92  ? 139.653 122.961 139.959 1.00 24.69  ? 91   ILE D N     1 
ATOM   2748  C  CA    . ILE D 4 92  ? 139.839 124.151 139.126 1.00 24.69  ? 91   ILE D CA    1 
ATOM   2749  C  C     . ILE D 4 92  ? 140.825 123.863 138.000 1.00 24.69  ? 91   ILE D C     1 
ATOM   2750  O  O     . ILE D 4 92  ? 140.628 124.292 136.858 1.00 24.69  ? 91   ILE D O     1 
ATOM   2751  C  CB    . ILE D 4 92  ? 140.288 125.344 139.988 1.00 24.69  ? 91   ILE D CB    1 
ATOM   2752  C  CG1   . ILE D 4 92  ? 139.250 125.619 141.069 1.00 24.69  ? 91   ILE D CG1   1 
ATOM   2753  C  CG2   . ILE D 4 92  ? 140.474 126.590 139.145 1.00 24.69  ? 91   ILE D CG2   1 
ATOM   2754  C  CD1   . ILE D 4 92  ? 137.917 126.062 140.518 1.00 24.69  ? 91   ILE D CD1   1 
ATOM   2755  N  N     . GLN D 4 93  ? 141.909 123.145 138.318 1.00 25.10  ? 92   GLN D N     1 
ATOM   2756  C  CA    . GLN D 4 93  ? 142.920 122.788 137.324 1.00 25.10  ? 92   GLN D CA    1 
ATOM   2757  C  C     . GLN D 4 93  ? 142.327 121.932 136.209 1.00 25.10  ? 92   GLN D C     1 
ATOM   2758  O  O     . GLN D 4 93  ? 142.574 122.184 135.022 1.00 25.10  ? 92   GLN D O     1 
ATOM   2759  C  CB    . GLN D 4 93  ? 144.078 122.065 138.008 1.00 25.10  ? 92   GLN D CB    1 
ATOM   2760  C  CG    . GLN D 4 93  ? 145.180 121.621 137.081 1.00 25.10  ? 92   GLN D CG    1 
ATOM   2761  C  CD    . GLN D 4 93  ? 146.351 121.024 137.831 1.00 25.10  ? 92   GLN D CD    1 
ATOM   2762  O  OE1   . GLN D 4 93  ? 146.430 121.118 139.054 1.00 25.10  ? 92   GLN D OE1   1 
ATOM   2763  N  NE2   . GLN D 4 93  ? 147.273 120.413 137.101 1.00 25.10  ? 92   GLN D NE2   1 
ATOM   2764  N  N     . THR D 4 94  ? 141.553 120.907 136.578 1.00 24.87  ? 93   THR D N     1 
ATOM   2765  C  CA    . THR D 4 94  ? 140.881 120.071 135.583 1.00 24.87  ? 93   THR D CA    1 
ATOM   2766  C  C     . THR D 4 94  ? 139.885 120.877 134.749 1.00 24.87  ? 93   THR D C     1 
ATOM   2767  O  O     . THR D 4 94  ? 139.783 120.677 133.529 1.00 24.87  ? 93   THR D O     1 
ATOM   2768  C  CB    . THR D 4 94  ? 140.195 118.891 136.270 1.00 24.87  ? 93   THR D CB    1 
ATOM   2769  O  OG1   . THR D 4 94  ? 141.169 118.141 137.003 1.00 24.87  ? 93   THR D OG1   1 
ATOM   2770  C  CG2   . THR D 4 94  ? 139.558 117.976 135.256 1.00 24.87  ? 93   THR D CG2   1 
ATOM   2771  N  N     . ALA D 4 95  ? 139.145 121.791 135.388 1.00 24.17  ? 94   ALA D N     1 
ATOM   2772  C  CA    . ALA D 4 95  ? 138.234 122.677 134.662 1.00 24.17  ? 94   ALA D CA    1 
ATOM   2773  C  C     . ALA D 4 95  ? 138.978 123.528 133.636 1.00 24.17  ? 94   ALA D C     1 
ATOM   2774  O  O     . ALA D 4 95  ? 138.498 123.731 132.513 1.00 24.17  ? 94   ALA D O     1 
ATOM   2775  C  CB    . ALA D 4 95  ? 137.474 123.563 135.645 1.00 24.17  ? 94   ALA D CB    1 
ATOM   2776  N  N     . VAL D 4 96  ? 140.136 124.063 134.030 1.00 24.78  ? 95   VAL D N     1 
ATOM   2777  C  CA    . VAL D 4 96  ? 140.980 124.849 133.133 1.00 24.78  ? 95   VAL D CA    1 
ATOM   2778  C  C     . VAL D 4 96  ? 141.447 124.009 131.950 1.00 24.78  ? 95   VAL D C     1 
ATOM   2779  O  O     . VAL D 4 96  ? 141.412 124.464 130.799 1.00 24.78  ? 95   VAL D O     1 
ATOM   2780  C  CB    . VAL D 4 96  ? 142.156 125.446 133.928 1.00 24.78  ? 95   VAL D CB    1 
ATOM   2781  C  CG1   . VAL D 4 96  ? 143.301 125.847 133.026 1.00 24.78  ? 95   VAL D CG1   1 
ATOM   2782  C  CG2   . VAL D 4 96  ? 141.671 126.633 134.717 1.00 24.78  ? 95   VAL D CG2   1 
ATOM   2783  N  N     . ARG D 4 97  ? 141.901 122.776 132.214 1.00 23.15  ? 96   ARG D N     1 
ATOM   2784  C  CA    . ARG D 4 97  ? 142.309 121.876 131.133 1.00 23.15  ? 96   ARG D CA    1 
ATOM   2785  C  C     . ARG D 4 97  ? 141.154 121.538 130.198 1.00 23.15  ? 96   ARG D C     1 
ATOM   2786  O  O     . ARG D 4 97  ? 141.373 121.300 129.006 1.00 23.15  ? 96   ARG D O     1 
ATOM   2787  C  CB    . ARG D 4 97  ? 142.944 120.604 131.690 1.00 23.15  ? 96   ARG D CB    1 
ATOM   2788  C  CG    . ARG D 4 97  ? 144.377 120.808 132.151 1.00 23.15  ? 96   ARG D CG    1 
ATOM   2789  C  CD    . ARG D 4 97  ? 144.640 120.192 133.505 1.00 23.15  ? 96   ARG D CD    1 
ATOM   2790  N  NE    . ARG D 4 97  ? 144.350 118.764 133.528 1.00 23.15  ? 96   ARG D NE    1 
ATOM   2791  C  CZ    . ARG D 4 97  ? 144.065 118.083 134.632 1.00 23.15  ? 96   ARG D CZ    1 
ATOM   2792  N  NH1   . ARG D 4 97  ? 144.027 118.700 135.803 1.00 23.15  ? 96   ARG D NH1   1 
ATOM   2793  N  NH2   . ARG D 4 97  ? 143.814 116.784 134.566 1.00 23.15  ? 96   ARG D NH2   1 
ATOM   2794  N  N     . LEU D 4 98  ? 139.927 121.503 130.713 1.00 24.08  ? 97   LEU D N     1 
ATOM   2795  C  CA    . LEU D 4 98  ? 138.790 121.246 129.836 1.00 24.08  ? 97   LEU D CA    1 
ATOM   2796  C  C     . LEU D 4 98  ? 138.417 122.471 129.010 1.00 24.08  ? 97   LEU D C     1 
ATOM   2797  O  O     . LEU D 4 98  ? 138.023 122.335 127.846 1.00 24.08  ? 97   LEU D O     1 
ATOM   2798  C  CB    . LEU D 4 98  ? 137.581 120.781 130.640 1.00 24.08  ? 97   LEU D CB    1 
ATOM   2799  C  CG    . LEU D 4 98  ? 137.667 119.402 131.274 1.00 24.08  ? 97   LEU D CG    1 
ATOM   2800  C  CD1   . LEU D 4 98  ? 136.571 119.244 132.295 1.00 24.08  ? 97   LEU D CD1   1 
ATOM   2801  C  CD2   . LEU D 4 98  ? 137.526 118.365 130.190 1.00 24.08  ? 97   LEU D CD2   1 
ATOM   2802  N  N     . LEU D 4 99  ? 138.532 123.671 129.584 1.00 28.99  ? 98   LEU D N     1 
ATOM   2803  C  CA    . LEU D 4 99  ? 138.013 124.875 128.935 1.00 28.99  ? 98   LEU D CA    1 
ATOM   2804  C  C     . LEU D 4 99  ? 138.969 125.517 127.939 1.00 28.99  ? 98   LEU D C     1 
ATOM   2805  O  O     . LEU D 4 99  ? 138.531 125.947 126.866 1.00 28.99  ? 98   LEU D O     1 
ATOM   2806  C  CB    . LEU D 4 99  ? 137.630 125.922 129.982 1.00 28.99  ? 98   LEU D CB    1 
ATOM   2807  C  CG    . LEU D 4 99  ? 136.149 126.031 130.316 1.00 28.99  ? 98   LEU D CG    1 
ATOM   2808  C  CD1   . LEU D 4 99  ? 135.446 126.586 129.094 1.00 28.99  ? 98   LEU D CD1   1 
ATOM   2809  C  CD2   . LEU D 4 99  ? 135.565 124.691 130.702 1.00 28.99  ? 98   LEU D CD2   1 
ATOM   2810  N  N     . LEU D 4 100 ? 140.244 125.580 128.243 1.00 30.94  ? 99   LEU D N     1 
ATOM   2811  C  CA    . LEU D 4 100 ? 141.051 126.342 127.297 1.00 30.94  ? 99   LEU D CA    1 
ATOM   2812  C  C     . LEU D 4 100 ? 141.629 125.423 126.226 1.00 30.94  ? 99   LEU D C     1 
ATOM   2813  O  O     . LEU D 4 100 ? 142.178 124.368 126.555 1.00 30.94  ? 99   LEU D O     1 
ATOM   2814  C  CB    . LEU D 4 100 ? 142.160 127.081 128.019 1.00 30.94  ? 99   LEU D CB    1 
ATOM   2815  C  CG    . LEU D 4 100 ? 141.685 127.984 129.161 1.00 30.94  ? 99   LEU D CG    1 
ATOM   2816  C  CD1   . LEU D 4 100 ? 142.837 128.803 129.682 1.00 30.94  ? 99   LEU D CD1   1 
ATOM   2817  C  CD2   . LEU D 4 100 ? 140.549 128.900 128.729 1.00 30.94  ? 99   LEU D CD2   1 
ATOM   2818  N  N     . PRO D 4 101 ? 141.504 125.778 124.951 1.00 34.15  ? 100  PRO D N     1 
ATOM   2819  C  CA    . PRO D 4 101 ? 141.987 124.896 123.880 1.00 34.15  ? 100  PRO D CA    1 
ATOM   2820  C  C     . PRO D 4 101 ? 143.486 124.936 123.606 1.00 34.15  ? 100  PRO D C     1 
ATOM   2821  O  O     . PRO D 4 101 ? 143.923 125.680 122.723 1.00 34.15  ? 100  PRO D O     1 
ATOM   2822  C  CB    . PRO D 4 101 ? 141.203 125.382 122.652 1.00 34.15  ? 100  PRO D CB    1 
ATOM   2823  C  CG    . PRO D 4 101 ? 140.103 126.247 123.189 1.00 34.15  ? 100  PRO D CG    1 
ATOM   2824  C  CD    . PRO D 4 101 ? 140.650 126.853 124.428 1.00 34.15  ? 100  PRO D CD    1 
ATOM   2825  N  N     . GLY D 4 102 ? 144.281 124.172 124.335 1.00 37.45  ? 101  GLY D N     1 
ATOM   2826  C  CA    . GLY D 4 102 ? 145.676 123.962 123.943 1.00 37.45  ? 101  GLY D CA    1 
ATOM   2827  C  C     . GLY D 4 102 ? 146.659 124.803 124.750 1.00 37.45  ? 101  GLY D C     1 
ATOM   2828  O  O     . GLY D 4 102 ? 146.772 124.633 125.978 1.00 37.45  ? 101  GLY D O     1 
ATOM   2829  N  N     . GLU D 4 103 ? 147.421 125.651 124.044 1.00 40.28  ? 102  GLU D N     1 
ATOM   2830  C  CA    . GLU D 4 103 ? 148.494 126.423 124.667 1.00 40.28  ? 102  GLU D CA    1 
ATOM   2831  C  C     . GLU D 4 103 ? 147.971 127.380 125.731 1.00 40.28  ? 102  GLU D C     1 
ATOM   2832  O  O     . GLU D 4 103 ? 148.687 127.677 126.697 1.00 40.28  ? 102  GLU D O     1 
ATOM   2833  C  CB    . GLU D 4 103 ? 149.276 127.188 123.600 1.00 40.28  ? 102  GLU D CB    1 
ATOM   2834  C  CG    . GLU D 4 103 ? 150.719 127.468 123.979 1.00 40.28  ? 102  GLU D CG    1 
ATOM   2835  C  CD    . GLU D 4 103 ? 151.558 127.919 122.804 1.00 40.28  ? 102  GLU D CD    1 
ATOM   2836  O  OE1   . GLU D 4 103 ? 151.194 127.598 121.654 1.00 40.28  ? 102  GLU D OE1   1 
ATOM   2837  O  OE2   . GLU D 4 103 ? 152.582 128.596 123.031 1.00 40.28  ? 102  GLU D OE2   1 
ATOM   2838  N  N     . LEU D 4 104 ? 146.734 127.865 125.567 1.00 37.24  ? 103  LEU D N     1 
ATOM   2839  C  CA    . LEU D 4 104 ? 146.090 128.657 126.609 1.00 37.24  ? 103  LEU D CA    1 
ATOM   2840  C  C     . LEU D 4 104 ? 145.957 127.853 127.895 1.00 37.24  ? 103  LEU D C     1 
ATOM   2841  O  O     . LEU D 4 104 ? 146.245 128.360 128.986 1.00 37.24  ? 103  LEU D O     1 
ATOM   2842  C  CB    . LEU D 4 104 ? 144.720 129.133 126.137 1.00 37.24  ? 103  LEU D CB    1 
ATOM   2843  C  CG    . LEU D 4 104 ? 144.668 130.500 125.467 1.00 37.24  ? 103  LEU D CG    1 
ATOM   2844  C  CD1   . LEU D 4 104 ? 143.245 130.811 125.041 1.00 37.24  ? 103  LEU D CD1   1 
ATOM   2845  C  CD2   . LEU D 4 104 ? 145.206 131.568 126.396 1.00 37.24  ? 103  LEU D CD2   1 
ATOM   2846  N  N     . ALA D 4 105 ? 145.581 126.577 127.774 1.00 35.66  ? 104  ALA D N     1 
ATOM   2847  C  CA    . ALA D 4 105 ? 145.460 125.716 128.943 1.00 35.66  ? 104  ALA D CA    1 
ATOM   2848  C  C     . ALA D 4 105 ? 146.819 125.416 129.552 1.00 35.66  ? 104  ALA D C     1 
ATOM   2849  O  O     . ALA D 4 105 ? 146.952 125.395 130.779 1.00 35.66  ? 104  ALA D O     1 
ATOM   2850  C  CB    . ALA D 4 105 ? 144.748 124.418 128.576 1.00 35.66  ? 104  ALA D CB    1 
ATOM   2851  N  N     . LYS D 4 106 ? 147.823 125.143 128.711 1.00 39.34  ? 105  LYS D N     1 
ATOM   2852  C  CA    . LYS D 4 106 ? 149.166 124.854 129.214 1.00 39.34  ? 105  LYS D CA    1 
ATOM   2853  C  C     . LYS D 4 106 ? 149.747 126.035 129.992 1.00 39.34  ? 105  LYS D C     1 
ATOM   2854  O  O     . LYS D 4 106 ? 150.252 125.864 131.113 1.00 39.34  ? 105  LYS D O     1 
ATOM   2855  C  CB    . LYS D 4 106 ? 150.079 124.456 128.058 1.00 39.34  ? 105  LYS D CB    1 
ATOM   2856  C  CG    . LYS D 4 106 ? 149.606 123.202 127.337 1.00 39.34  ? 105  LYS D CG    1 
ATOM   2857  C  CD    . LYS D 4 106 ? 150.543 122.797 126.212 1.00 39.34  ? 105  LYS D CD    1 
ATOM   2858  C  CE    . LYS D 4 106 ? 149.996 121.597 125.450 1.00 39.34  ? 105  LYS D CE    1 
ATOM   2859  N  NZ    . LYS D 4 106 ? 148.569 121.774 125.063 1.00 39.34  ? 105  LYS D NZ    1 
ATOM   2860  N  N     . HIS D 4 107 ? 149.609 127.251 129.459 1.00 39.31  ? 106  HIS D N     1 
ATOM   2861  C  CA    . HIS D 4 107 ? 150.131 128.402 130.185 1.00 39.31  ? 106  HIS D CA    1 
ATOM   2862  C  C     . HIS D 4 107 ? 149.269 128.767 131.385 1.00 39.31  ? 106  HIS D C     1 
ATOM   2863  O  O     . HIS D 4 107 ? 149.801 129.271 132.380 1.00 39.31  ? 106  HIS D O     1 
ATOM   2864  C  CB    . HIS D 4 107 ? 150.281 129.610 129.265 1.00 39.31  ? 106  HIS D CB    1 
ATOM   2865  C  CG    . HIS D 4 107 ? 151.407 129.491 128.290 1.00 39.31  ? 106  HIS D CG    1 
ATOM   2866  N  ND1   . HIS D 4 107 ? 152.694 129.880 128.593 1.00 39.31  ? 106  HIS D ND1   1 
ATOM   2867  C  CD2   . HIS D 4 107 ? 151.440 129.046 127.013 1.00 39.31  ? 106  HIS D CD2   1 
ATOM   2868  C  CE1   . HIS D 4 107 ? 153.474 129.667 127.549 1.00 39.31  ? 106  HIS D CE1   1 
ATOM   2869  N  NE2   . HIS D 4 107 ? 152.737 129.162 126.576 1.00 39.31  ? 106  HIS D NE2   1 
ATOM   2870  N  N     . ALA D 4 108 ? 147.959 128.514 131.325 1.00 37.08  ? 107  ALA D N     1 
ATOM   2871  C  CA    . ALA D 4 108 ? 147.103 128.756 132.480 1.00 37.08  ? 107  ALA D CA    1 
ATOM   2872  C  C     . ALA D 4 108 ? 147.460 127.829 133.635 1.00 37.08  ? 107  ALA D C     1 
ATOM   2873  O  O     . ALA D 4 108 ? 147.498 128.255 134.793 1.00 37.08  ? 107  ALA D O     1 
ATOM   2874  C  CB    . ALA D 4 108 ? 145.641 128.592 132.087 1.00 37.08  ? 107  ALA D CB    1 
ATOM   2875  N  N     . VAL D 4 109 ? 147.697 126.547 133.336 1.00 36.27  ? 108  VAL D N     1 
ATOM   2876  C  CA    . VAL D 4 109 ? 148.117 125.595 134.362 1.00 36.27  ? 108  VAL D CA    1 
ATOM   2877  C  C     . VAL D 4 109 ? 149.483 125.975 134.924 1.00 36.27  ? 108  VAL D C     1 
ATOM   2878  O  O     . VAL D 4 109 ? 149.714 125.873 136.136 1.00 36.27  ? 108  VAL D O     1 
ATOM   2879  C  CB    . VAL D 4 109 ? 148.089 124.161 133.794 1.00 36.27  ? 108  VAL D CB    1 
ATOM   2880  C  CG1   . VAL D 4 109 ? 148.774 123.164 134.719 1.00 36.27  ? 108  VAL D CG1   1 
ATOM   2881  C  CG2   . VAL D 4 109 ? 146.650 123.726 133.582 1.00 36.27  ? 108  VAL D CG2   1 
ATOM   2882  N  N     . SER D 4 110 ? 150.388 126.469 134.066 1.00 39.50  ? 109  SER D N     1 
ATOM   2883  C  CA    . SER D 4 110 ? 151.688 126.954 134.539 1.00 39.50  ? 109  SER D CA    1 
ATOM   2884  C  C     . SER D 4 110 ? 151.538 128.129 135.509 1.00 39.50  ? 109  SER D C     1 
ATOM   2885  O  O     . SER D 4 110 ? 152.156 128.145 136.585 1.00 39.50  ? 109  SER D O     1 
ATOM   2886  C  CB    . SER D 4 110 ? 152.566 127.346 133.353 1.00 39.50  ? 109  SER D CB    1 
ATOM   2887  O  OG    . SER D 4 110 ? 153.767 127.951 133.797 1.00 39.50  ? 109  SER D OG    1 
ATOM   2888  N  N     . GLU D 4 111 ? 150.710 129.117 135.142 1.00 38.68  ? 110  GLU D N     1 
ATOM   2889  C  CA    . GLU D 4 111 ? 150.488 130.285 135.994 1.00 38.68  ? 110  GLU D CA    1 
ATOM   2890  C  C     . GLU D 4 111 ? 149.823 129.902 137.311 1.00 38.68  ? 110  GLU D C     1 
ATOM   2891  O  O     . GLU D 4 111 ? 150.213 130.397 138.376 1.00 38.68  ? 110  GLU D O     1 
ATOM   2892  C  CB    . GLU D 4 111 ? 149.621 131.314 135.265 1.00 38.68  ? 110  GLU D CB    1 
ATOM   2893  C  CG    . GLU D 4 111 ? 150.262 132.027 134.085 1.00 38.68  ? 110  GLU D CG    1 
ATOM   2894  C  CD    . GLU D 4 111 ? 151.382 132.969 134.476 1.00 38.68  ? 110  GLU D CD    1 
ATOM   2895  O  OE1   . GLU D 4 111 ? 151.432 133.402 135.647 1.00 38.68  ? 110  GLU D OE1   1 
ATOM   2896  O  OE2   . GLU D 4 111 ? 152.213 133.285 133.600 1.00 38.68  ? 110  GLU D OE2   1 
ATOM   2897  N  N     . GLY D 4 112 ? 148.801 129.042 137.247 1.00 38.21  ? 111  GLY D N     1 
ATOM   2898  C  CA    . GLY D 4 112 ? 148.134 128.584 138.456 1.00 38.21  ? 111  GLY D CA    1 
ATOM   2899  C  C     . GLY D 4 112 ? 149.046 127.807 139.383 1.00 38.21  ? 111  GLY D C     1 
ATOM   2900  O  O     . GLY D 4 112 ? 148.969 127.953 140.607 1.00 38.21  ? 111  GLY D O     1 
ATOM   2901  N  N     . THR D 4 113 ? 149.920 126.972 138.811 1.00 39.66  ? 112  THR D N     1 
ATOM   2902  C  CA    . THR D 4 113 ? 150.874 126.209 139.606 1.00 39.66  ? 112  THR D CA    1 
ATOM   2903  C  C     . THR D 4 113 ? 151.840 127.145 140.317 1.00 39.66  ? 112  THR D C     1 
ATOM   2904  O  O     . THR D 4 113 ? 152.095 126.986 141.519 1.00 39.66  ? 112  THR D O     1 
ATOM   2905  C  CB    . THR D 4 113 ? 151.621 125.219 138.710 1.00 39.66  ? 112  THR D CB    1 
ATOM   2906  O  OG1   . THR D 4 113 ? 150.705 124.225 138.237 1.00 39.66  ? 112  THR D OG1   1 
ATOM   2907  C  CG2   . THR D 4 113 ? 152.741 124.528 139.467 1.00 39.66  ? 112  THR D CG2   1 
ATOM   2908  N  N     . LYS D 4 114 ? 152.393 128.115 139.574 1.00 39.77  ? 113  LYS D N     1 
ATOM   2909  C  CA    . LYS D 4 114 ? 153.240 129.164 140.146 1.00 39.77  ? 113  LYS D CA    1 
ATOM   2910  C  C     . LYS D 4 114 ? 152.555 129.886 141.304 1.00 39.77  ? 113  LYS D C     1 
ATOM   2911  O  O     . LYS D 4 114 ? 153.142 130.052 142.381 1.00 39.77  ? 113  LYS D O     1 
ATOM   2912  C  CB    . LYS D 4 114 ? 153.633 130.168 139.063 1.00 39.77  ? 113  LYS D CB    1 
ATOM   2913  C  CG    . LYS D 4 114 ? 154.709 129.688 138.108 1.00 39.77  ? 113  LYS D CG    1 
ATOM   2914  C  CD    . LYS D 4 114 ? 154.928 130.687 136.978 1.00 39.77  ? 113  LYS D CD    1 
ATOM   2915  C  CE    . LYS D 4 114 ? 155.124 132.103 137.502 1.00 39.77  ? 113  LYS D CE    1 
ATOM   2916  N  NZ    . LYS D 4 114 ? 155.223 133.091 136.398 1.00 39.77  ? 113  LYS D NZ    1 
ATOM   2917  N  N     . ALA D 4 115 ? 151.334 130.377 141.060 1.00 39.28  ? 114  ALA D N     1 
ATOM   2918  C  CA    . ALA D 4 115 ? 150.551 131.101 142.060 1.00 39.28  ? 114  ALA D CA    1 
ATOM   2919  C  C     . ALA D 4 115 ? 150.326 130.294 143.336 1.00 39.28  ? 114  ALA D C     1 
ATOM   2920  O  O     . ALA D 4 115 ? 150.604 130.777 144.438 1.00 39.28  ? 114  ALA D O     1 
ATOM   2921  C  CB    . ALA D 4 115 ? 149.212 131.516 141.464 1.00 39.28  ? 114  ALA D CB    1 
ATOM   2922  N  N     . VAL D 4 116 ? 149.779 129.079 143.199 1.00 39.03  ? 115  VAL D N     1 
ATOM   2923  C  CA    . VAL D 4 116 ? 149.499 128.219 144.352 1.00 39.03  ? 115  VAL D CA    1 
ATOM   2924  C  C     . VAL D 4 116 ? 150.778 127.867 145.108 1.00 39.03  ? 115  VAL D C     1 
ATOM   2925  O  O     . VAL D 4 116 ? 150.804 127.896 146.347 1.00 39.03  ? 115  VAL D O     1 
ATOM   2926  C  CB    . VAL D 4 116 ? 148.722 126.967 143.899 1.00 39.03  ? 115  VAL D CB    1 
ATOM   2927  C  CG1   . VAL D 4 116 ? 148.663 125.911 144.991 1.00 39.03  ? 115  VAL D CG1   1 
ATOM   2928  C  CG2   . VAL D 4 116 ? 147.313 127.360 143.500 1.00 39.03  ? 115  VAL D CG2   1 
ATOM   2929  N  N     . THR D 4 117 ? 151.856 127.551 144.379 1.00 41.79  ? 116  THR D N     1 
ATOM   2930  C  CA    . THR D 4 117 ? 153.145 127.237 144.993 1.00 41.79  ? 116  THR D CA    1 
ATOM   2931  C  C     . THR D 4 117 ? 153.678 128.405 145.819 1.00 41.79  ? 116  THR D C     1 
ATOM   2932  O  O     . THR D 4 117 ? 153.986 128.246 147.008 1.00 41.79  ? 116  THR D O     1 
ATOM   2933  C  CB    . THR D 4 117 ? 154.146 126.838 143.909 1.00 41.79  ? 116  THR D CB    1 
ATOM   2934  O  OG1   . THR D 4 117 ? 153.766 125.573 143.358 1.00 41.79  ? 116  THR D OG1   1 
ATOM   2935  C  CG2   . THR D 4 117 ? 155.548 126.717 144.487 1.00 41.79  ? 116  THR D CG2   1 
ATOM   2936  N  N     . LYS D 4 118 ? 153.840 129.573 145.183 1.00 43.36  ? 117  LYS D N     1 
ATOM   2937  C  CA    . LYS D 4 118 ? 154.307 130.774 145.875 1.00 43.36  ? 117  LYS D CA    1 
ATOM   2938  C  C     . LYS D 4 118 ? 153.403 131.165 147.043 1.00 43.36  ? 117  LYS D C     1 
ATOM   2939  O  O     . LYS D 4 118 ? 153.883 131.649 148.073 1.00 43.36  ? 117  LYS D O     1 
ATOM   2940  C  CB    . LYS D 4 118 ? 154.423 131.930 144.882 1.00 43.36  ? 117  LYS D CB    1 
ATOM   2941  C  CG    . LYS D 4 118 ? 155.374 133.031 145.323 1.00 43.36  ? 117  LYS D CG    1 
ATOM   2942  C  CD    . LYS D 4 118 ? 156.807 132.527 145.389 1.00 43.36  ? 117  LYS D CD    1 
ATOM   2943  C  CE    . LYS D 4 118 ? 157.766 133.645 145.758 1.00 43.36  ? 117  LYS D CE    1 
ATOM   2944  N  NZ    . LYS D 4 118 ? 159.185 133.226 145.617 1.00 43.36  ? 117  LYS D NZ    1 
ATOM   2945  N  N     . TYR D 4 119 ? 152.089 130.976 146.891 1.00 42.46  ? 118  TYR D N     1 
ATOM   2946  C  CA    . TYR D 4 119 ? 151.143 131.350 147.935 1.00 42.46  ? 118  TYR D CA    1 
ATOM   2947  C  C     . TYR D 4 119 ? 151.262 130.452 149.158 1.00 42.46  ? 118  TYR D C     1 
ATOM   2948  O  O     . TYR D 4 119 ? 151.351 130.944 150.288 1.00 42.46  ? 118  TYR D O     1 
ATOM   2949  C  CB    . TYR D 4 119 ? 149.731 131.296 147.353 1.00 42.46  ? 118  TYR D CB    1 
ATOM   2950  C  CG    . TYR D 4 119 ? 148.598 131.396 148.339 1.00 42.46  ? 118  TYR D CG    1 
ATOM   2951  C  CD1   . TYR D 4 119 ? 148.172 132.627 148.806 1.00 42.46  ? 118  TYR D CD1   1 
ATOM   2952  C  CD2   . TYR D 4 119 ? 147.916 130.260 148.759 1.00 42.46  ? 118  TYR D CD2   1 
ATOM   2953  C  CE1   . TYR D 4 119 ? 147.122 132.725 149.691 1.00 42.46  ? 118  TYR D CE1   1 
ATOM   2954  C  CE2   . TYR D 4 119 ? 146.864 130.348 149.644 1.00 42.46  ? 118  TYR D CE2   1 
ATOM   2955  C  CZ    . TYR D 4 119 ? 146.470 131.584 150.106 1.00 42.46  ? 118  TYR D CZ    1 
ATOM   2956  O  OH    . TYR D 4 119 ? 145.421 131.685 150.991 1.00 42.46  ? 118  TYR D OH    1 
ATOM   2957  N  N     . THR D 4 120 ? 151.264 129.135 148.956 1.00 46.13  ? 119  THR D N     1 
ATOM   2958  C  CA    . THR D 4 120 ? 151.315 128.207 150.077 1.00 46.13  ? 119  THR D CA    1 
ATOM   2959  C  C     . THR D 4 120 ? 152.723 128.096 150.667 1.00 46.13  ? 119  THR D C     1 
ATOM   2960  O  O     . THR D 4 120 ? 152.867 127.775 151.853 1.00 46.13  ? 119  THR D O     1 
ATOM   2961  C  CB    . THR D 4 120 ? 150.751 126.858 149.578 1.00 46.13  ? 119  THR D CB    1 
ATOM   2962  O  OG1   . THR D 4 120 ? 149.372 127.036 149.229 1.00 46.13  ? 119  THR D OG1   1 
ATOM   2963  C  CG2   . THR D 4 120 ? 150.811 125.737 150.616 1.00 46.13  ? 119  THR D CG2   1 
ATOM   2964  N  N     . SER D 4 121 ? 153.754 128.508 149.928 1.00 49.48  ? 120  SER D N     1 
ATOM   2965  C  CA    . SER D 4 121 ? 155.125 128.429 150.416 1.00 49.48  ? 120  SER D CA    1 
ATOM   2966  C  C     . SER D 4 121 ? 155.655 129.772 150.906 1.00 49.48  ? 120  SER D C     1 
ATOM   2967  O  O     . SER D 4 121 ? 156.864 130.018 150.836 1.00 49.48  ? 120  SER D O     1 
ATOM   2968  C  CB    . SER D 4 121 ? 156.038 127.868 149.327 1.00 49.48  ? 120  SER D CB    1 
ATOM   2969  O  OG    . SER D 4 121 ? 157.400 128.102 149.638 1.00 49.48  ? 120  SER D OG    1 
ATOM   2970  N  N     . ALA D 4 122 ? 154.781 130.640 151.405 1.00 50.28  ? 121  ALA D N     1 
ATOM   2971  C  CA    . ALA D 4 122 ? 155.205 131.929 151.938 1.00 50.28  ? 121  ALA D CA    1 
ATOM   2972  C  C     . ALA D 4 122 ? 154.309 132.353 153.094 1.00 50.28  ? 121  ALA D C     1 
ATOM   2973  O  O     . ALA D 4 122 ? 153.203 131.839 153.254 1.00 50.28  ? 121  ALA D O     1 
ATOM   2974  C  CB    . ALA D 4 122 ? 155.200 132.985 150.847 1.00 50.28  ? 121  ALA D CB    1 
ATOM   2975  N  N     . GLY E 1 34  ? 126.648 174.087 74.250  1.00 108.41 ? 33   GLY E N     1 
ATOM   2976  C  CA    . GLY E 1 34  ? 127.541 173.600 75.281  1.00 108.41 ? 33   GLY E CA    1 
ATOM   2977  C  C     . GLY E 1 34  ? 127.229 172.167 75.642  1.00 108.41 ? 33   GLY E C     1 
ATOM   2978  O  O     . GLY E 1 34  ? 127.625 171.224 74.951  1.00 108.41 ? 33   GLY E O     1 
ATOM   2979  N  N     . GLY E 1 35  ? 126.514 172.001 76.747  1.00 118.23 ? 34   GLY E N     1 
ATOM   2980  C  CA    . GLY E 1 35  ? 125.931 170.716 77.064  1.00 118.23 ? 34   GLY E CA    1 
ATOM   2981  C  C     . GLY E 1 35  ? 126.704 170.011 78.158  1.00 118.23 ? 34   GLY E C     1 
ATOM   2982  O  O     . GLY E 1 35  ? 127.928 170.120 78.254  1.00 118.23 ? 34   GLY E O     1 
ATOM   2983  N  N     . VAL E 1 36  ? 125.956 169.273 78.972  1.00 119.07 ? 35   VAL E N     1 
ATOM   2984  C  CA    . VAL E 1 36  ? 126.519 168.416 80.006  1.00 119.07 ? 35   VAL E CA    1 
ATOM   2985  C  C     . VAL E 1 36  ? 126.881 167.082 79.361  1.00 119.07 ? 35   VAL E C     1 
ATOM   2986  O  O     . VAL E 1 36  ? 126.097 166.528 78.580  1.00 119.07 ? 35   VAL E O     1 
ATOM   2987  C  CB    . VAL E 1 36  ? 125.561 168.251 81.208  1.00 119.07 ? 35   VAL E CB    1 
ATOM   2988  C  CG1   . VAL E 1 36  ? 124.159 167.816 80.779  1.00 119.07 ? 35   VAL E CG1   1 
ATOM   2989  C  CG2   . VAL E 1 36  ? 126.125 167.270 82.229  1.00 119.07 ? 35   VAL E CG2   1 
ATOM   2990  N  N     . MET E 1 37  ? 128.097 166.610 79.622  1.00 112.94 ? 36   MET E N     1 
ATOM   2991  C  CA    . MET E 1 37  ? 128.555 165.348 79.060  1.00 112.94 ? 36   MET E CA    1 
ATOM   2992  C  C     . MET E 1 37  ? 128.663 164.308 80.168  1.00 112.94 ? 36   MET E C     1 
ATOM   2993  O  O     . MET E 1 37  ? 129.661 164.267 80.895  1.00 112.94 ? 36   MET E O     1 
ATOM   2994  C  CB    . MET E 1 37  ? 129.895 165.545 78.356  1.00 112.94 ? 36   MET E CB    1 
ATOM   2995  C  CG    . MET E 1 37  ? 130.040 166.921 77.709  1.00 112.94 ? 36   MET E CG    1 
ATOM   2996  S  SD    . MET E 1 37  ? 131.138 167.004 76.277  1.00 112.94 ? 36   MET E SD    1 
ATOM   2997  C  CE    . MET E 1 37  ? 132.746 166.864 77.041  1.00 112.94 ? 36   MET E CE    1 
ATOM   2998  N  N     . LYS E 1 38  ? 127.627 163.482 80.308  1.00 108.07 ? 37   LYS E N     1 
ATOM   2999  C  CA    . LYS E 1 38  ? 127.572 162.445 81.334  1.00 108.07 ? 37   LYS E CA    1 
ATOM   3000  C  C     . LYS E 1 38  ? 128.464 161.279 80.933  1.00 108.07 ? 37   LYS E C     1 
ATOM   3001  O  O     . LYS E 1 38  ? 128.241 160.660 79.882  1.00 108.07 ? 37   LYS E O     1 
ATOM   3002  C  CB    . LYS E 1 38  ? 126.129 161.971 81.539  1.00 108.07 ? 37   LYS E CB    1 
ATOM   3003  C  CG    . LYS E 1 38  ? 125.967 160.754 82.450  1.00 108.07 ? 37   LYS E CG    1 
ATOM   3004  C  CD    . LYS E 1 38  ? 125.601 159.491 81.668  1.00 108.07 ? 37   LYS E CD    1 
ATOM   3005  C  CE    . LYS E 1 38  ? 124.314 159.665 80.893  1.00 108.07 ? 37   LYS E CE    1 
ATOM   3006  N  NZ    . LYS E 1 38  ? 124.006 158.454 80.089  1.00 108.07 ? 37   LYS E NZ    1 
ATOM   3007  N  N     . PRO E 1 39  ? 129.472 160.932 81.727  1.00 99.12  ? 38   PRO E N     1 
ATOM   3008  C  CA    . PRO E 1 39  ? 130.310 159.783 81.388  1.00 99.12  ? 38   PRO E CA    1 
ATOM   3009  C  C     . PRO E 1 39  ? 129.723 158.501 81.949  1.00 99.12  ? 38   PRO E C     1 
ATOM   3010  O  O     . PRO E 1 39  ? 128.643 158.485 82.542  1.00 99.12  ? 38   PRO E O     1 
ATOM   3011  C  CB    . PRO E 1 39  ? 131.655 160.113 82.049  1.00 99.12  ? 38   PRO E CB    1 
ATOM   3012  C  CG    . PRO E 1 39  ? 131.471 161.469 82.676  1.00 99.12  ? 38   PRO E CG    1 
ATOM   3013  C  CD    . PRO E 1 39  ? 130.013 161.648 82.884  1.00 99.12  ? 38   PRO E CD    1 
ATOM   3014  N  N     . HIS E 1 40  ? 130.462 157.412 81.752  1.00 90.66  ? 39   HIS E N     1 
ATOM   3015  C  CA    . HIS E 1 40  ? 130.019 156.111 82.228  1.00 90.66  ? 39   HIS E CA    1 
ATOM   3016  C  C     . HIS E 1 40  ? 130.078 156.044 83.749  1.00 90.66  ? 39   HIS E C     1 
ATOM   3017  O  O     . HIS E 1 40  ? 131.022 156.523 84.381  1.00 90.66  ? 39   HIS E O     1 
ATOM   3018  C  CB    . HIS E 1 40  ? 130.882 155.003 81.626  1.00 90.66  ? 39   HIS E CB    1 
ATOM   3019  C  CG    . HIS E 1 40  ? 130.642 154.776 80.168  1.00 90.66  ? 39   HIS E CG    1 
ATOM   3020  N  ND1   . HIS E 1 40  ? 131.549 155.146 79.198  1.00 90.66  ? 39   HIS E ND1   1 
ATOM   3021  C  CD2   . HIS E 1 40  ? 129.599 154.215 79.513  1.00 90.66  ? 39   HIS E CD2   1 
ATOM   3022  C  CE1   . HIS E 1 40  ? 131.074 154.823 78.009  1.00 90.66  ? 39   HIS E CE1   1 
ATOM   3023  N  NE2   . HIS E 1 40  ? 129.892 154.257 78.172  1.00 90.66  ? 39   HIS E NE2   1 
ATOM   3024  N  N     . ARG E 1 41  ? 129.057 155.425 84.333  1.00 73.91  ? 40   ARG E N     1 
ATOM   3025  C  CA    . ARG E 1 41  ? 128.954 155.255 85.773  1.00 73.91  ? 40   ARG E CA    1 
ATOM   3026  C  C     . ARG E 1 41  ? 129.873 154.128 86.242  1.00 73.91  ? 40   ARG E C     1 
ATOM   3027  O  O     . ARG E 1 41  ? 130.647 153.554 85.473  1.00 73.91  ? 40   ARG E O     1 
ATOM   3028  C  CB    . ARG E 1 41  ? 127.507 154.963 86.157  1.00 73.91  ? 40   ARG E CB    1 
ATOM   3029  C  CG    . ARG E 1 41  ? 127.004 153.630 85.626  1.00 73.91  ? 40   ARG E CG    1 
ATOM   3030  C  CD    . ARG E 1 41  ? 125.562 153.384 86.012  1.00 73.91  ? 40   ARG E CD    1 
ATOM   3031  N  NE    . ARG E 1 41  ? 124.716 154.528 85.693  1.00 73.91  ? 40   ARG E NE    1 
ATOM   3032  C  CZ    . ARG E 1 41  ? 124.084 154.684 84.535  1.00 73.91  ? 40   ARG E CZ    1 
ATOM   3033  N  NH1   . ARG E 1 41  ? 124.203 153.767 83.585  1.00 73.91  ? 40   ARG E NH1   1 
ATOM   3034  N  NH2   . ARG E 1 41  ? 123.332 155.755 84.328  1.00 73.91  ? 40   ARG E NH2   1 
ATOM   3035  N  N     . TYR E 1 42  ? 129.781 153.792 87.525  1.00 67.54  ? 41   TYR E N     1 
ATOM   3036  C  CA    . TYR E 1 42  ? 130.517 152.649 88.036  1.00 67.54  ? 41   TYR E CA    1 
ATOM   3037  C  C     . TYR E 1 42  ? 129.829 151.366 87.603  1.00 67.54  ? 41   TYR E C     1 
ATOM   3038  O  O     . TYR E 1 42  ? 128.601 151.315 87.482  1.00 67.54  ? 41   TYR E O     1 
ATOM   3039  C  CB    . TYR E 1 42  ? 130.617 152.684 89.561  1.00 67.54  ? 41   TYR E CB    1 
ATOM   3040  C  CG    . TYR E 1 42  ? 131.642 153.635 90.117  1.00 67.54  ? 41   TYR E CG    1 
ATOM   3041  C  CD1   . TYR E 1 42  ? 132.987 153.305 90.102  1.00 67.54  ? 41   TYR E CD1   1 
ATOM   3042  C  CD2   . TYR E 1 42  ? 131.270 154.838 90.688  1.00 67.54  ? 41   TYR E CD2   1 
ATOM   3043  C  CE1   . TYR E 1 42  ? 133.938 154.160 90.620  1.00 67.54  ? 41   TYR E CE1   1 
ATOM   3044  C  CE2   . TYR E 1 42  ? 132.210 155.702 91.209  1.00 67.54  ? 41   TYR E CE2   1 
ATOM   3045  C  CZ    . TYR E 1 42  ? 133.543 155.358 91.172  1.00 67.54  ? 41   TYR E CZ    1 
ATOM   3046  O  OH    . TYR E 1 42  ? 134.486 156.215 91.689  1.00 67.54  ? 41   TYR E OH    1 
ATOM   3047  N  N     . ARG E 1 43  ? 130.636 150.346 87.316  1.00 65.39  ? 42   ARG E N     1 
ATOM   3048  C  CA    . ARG E 1 43  ? 130.098 149.045 86.963  1.00 65.39  ? 42   ARG E CA    1 
ATOM   3049  C  C     . ARG E 1 43  ? 129.389 148.444 88.175  1.00 65.39  ? 42   ARG E C     1 
ATOM   3050  O  O     . ARG E 1 43  ? 129.782 148.712 89.315  1.00 65.39  ? 42   ARG E O     1 
ATOM   3051  C  CB    . ARG E 1 43  ? 131.214 148.116 86.487  1.00 65.39  ? 42   ARG E CB    1 
ATOM   3052  C  CG    . ARG E 1 43  ? 131.716 148.390 85.069  1.00 65.39  ? 42   ARG E CG    1 
ATOM   3053  C  CD    . ARG E 1 43  ? 130.631 148.936 84.152  1.00 65.39  ? 42   ARG E CD    1 
ATOM   3054  N  NE    . ARG E 1 43  ? 131.179 149.455 82.907  1.00 65.39  ? 42   ARG E NE    1 
ATOM   3055  C  CZ    . ARG E 1 43  ? 130.439 149.928 81.912  1.00 65.39  ? 42   ARG E CZ    1 
ATOM   3056  N  NH1   . ARG E 1 43  ? 129.119 149.945 82.018  1.00 65.39  ? 42   ARG E NH1   1 
ATOM   3057  N  NH2   . ARG E 1 43  ? 131.020 150.385 80.813  1.00 65.39  ? 42   ARG E NH2   1 
ATOM   3058  N  N     . PRO E 1 44  ? 128.294 147.687 87.955  1.00 61.20  ? 43   PRO E N     1 
ATOM   3059  C  CA    . PRO E 1 44  ? 127.595 147.016 89.063  1.00 61.20  ? 43   PRO E CA    1 
ATOM   3060  C  C     . PRO E 1 44  ? 128.485 146.119 89.910  1.00 61.20  ? 43   PRO E C     1 
ATOM   3061  O  O     . PRO E 1 44  ? 129.143 145.212 89.395  1.00 61.20  ? 43   PRO E O     1 
ATOM   3062  C  CB    . PRO E 1 44  ? 126.510 146.208 88.344  1.00 61.20  ? 43   PRO E CB    1 
ATOM   3063  C  CG    . PRO E 1 44  ? 126.234 146.989 87.117  1.00 61.20  ? 43   PRO E CG    1 
ATOM   3064  C  CD    . PRO E 1 44  ? 127.547 147.576 86.691  1.00 61.20  ? 43   PRO E CD    1 
ATOM   3065  N  N     . GLY E 1 45  ? 128.523 146.385 91.217  1.00 60.08  ? 44   GLY E N     1 
ATOM   3066  C  CA    . GLY E 1 45  ? 129.349 145.656 92.151  1.00 60.08  ? 44   GLY E CA    1 
ATOM   3067  C  C     . GLY E 1 45  ? 130.492 146.472 92.723  1.00 60.08  ? 44   GLY E C     1 
ATOM   3068  O  O     . GLY E 1 45  ? 130.957 146.172 93.831  1.00 60.08  ? 44   GLY E O     1 
ATOM   3069  N  N     . THR E 1 46  ? 130.982 147.465 91.971  1.00 58.61  ? 45   THR E N     1 
ATOM   3070  C  CA    . THR E 1 46  ? 132.094 148.293 92.436  1.00 58.61  ? 45   THR E CA    1 
ATOM   3071  C  C     . THR E 1 46  ? 131.701 149.113 93.662  1.00 58.61  ? 45   THR E C     1 
ATOM   3072  O  O     . THR E 1 46  ? 132.413 149.122 94.677  1.00 58.61  ? 45   THR E O     1 
ATOM   3073  C  CB    . THR E 1 46  ? 132.568 149.206 91.308  1.00 58.61  ? 45   THR E CB    1 
ATOM   3074  O  OG1   . THR E 1 46  ? 133.046 148.409 90.219  1.00 58.61  ? 45   THR E OG1   1 
ATOM   3075  C  CG2   . THR E 1 46  ? 133.690 150.095 91.789  1.00 58.61  ? 45   THR E CG2   1 
ATOM   3076  N  N     . VAL E 1 47  ? 130.548 149.783 93.595  1.00 56.89  ? 46   VAL E N     1 
ATOM   3077  C  CA    . VAL E 1 47  ? 130.067 150.546 94.739  1.00 56.89  ? 46   VAL E CA    1 
ATOM   3078  C  C     . VAL E 1 47  ? 129.669 149.597 95.858  1.00 56.89  ? 46   VAL E C     1 
ATOM   3079  O  O     . VAL E 1 47  ? 129.822 149.919 97.043  1.00 56.89  ? 46   VAL E O     1 
ATOM   3080  C  CB    . VAL E 1 47  ? 128.899 151.454 94.313  1.00 56.89  ? 46   VAL E CB    1 
ATOM   3081  C  CG1   . VAL E 1 47  ? 128.512 152.414 95.430  1.00 56.89  ? 46   VAL E CG1   1 
ATOM   3082  C  CG2   . VAL E 1 47  ? 129.260 152.213 93.055  1.00 56.89  ? 46   VAL E CG2   1 
ATOM   3083  N  N     . ALA E 1 48  ? 129.180 148.407 95.494  1.00 52.93  ? 47   ALA E N     1 
ATOM   3084  C  CA    . ALA E 1 48  ? 128.855 147.377 96.475  1.00 52.93  ? 47   ALA E CA    1 
ATOM   3085  C  C     . ALA E 1 48  ? 130.087 146.954 97.268  1.00 52.93  ? 47   ALA E C     1 
ATOM   3086  O  O     . ALA E 1 48  ? 130.050 146.915 98.500  1.00 52.93  ? 47   ALA E O     1 
ATOM   3087  C  CB    . ALA E 1 48  ? 128.218 146.176 95.778  1.00 52.93  ? 47   ALA E CB    1 
ATOM   3088  N  N     . LEU E 1 49  ? 131.184 146.633 96.574  1.00 49.87  ? 48   LEU E N     1 
ATOM   3089  C  CA    . LEU E 1 49  ? 132.435 146.270 97.243  1.00 49.87  ? 48   LEU E CA    1 
ATOM   3090  C  C     . LEU E 1 49  ? 132.978 147.433 98.071  1.00 49.87  ? 48   LEU E C     1 
ATOM   3091  O  O     . LEU E 1 49  ? 133.593 147.225 99.129  1.00 49.87  ? 48   LEU E O     1 
ATOM   3092  C  CB    . LEU E 1 49  ? 133.453 145.802 96.201  1.00 49.87  ? 48   LEU E CB    1 
ATOM   3093  C  CG    . LEU E 1 49  ? 134.578 144.802 96.526  1.00 49.87  ? 48   LEU E CG    1 
ATOM   3094  C  CD1   . LEU E 1 49  ? 135.208 144.342 95.221  1.00 49.87  ? 48   LEU E CD1   1 
ATOM   3095  C  CD2   . LEU E 1 49  ? 135.664 145.300 97.474  1.00 49.87  ? 48   LEU E CD2   1 
ATOM   3096  N  N     . ARG E 1 50  ? 132.770 148.665 97.595  1.00 54.63  ? 49   ARG E N     1 
ATOM   3097  C  CA    . ARG E 1 50  ? 133.181 149.841 98.359  1.00 54.63  ? 49   ARG E CA    1 
ATOM   3098  C  C     . ARG E 1 50  ? 132.421 149.923 99.681  1.00 54.63  ? 49   ARG E C     1 
ATOM   3099  O  O     . ARG E 1 50  ? 133.009 150.211 100.736 1.00 54.63  ? 49   ARG E O     1 
ATOM   3100  C  CB    . ARG E 1 50  ? 132.946 151.090 97.511  1.00 54.63  ? 49   ARG E CB    1 
ATOM   3101  C  CG    . ARG E 1 50  ? 133.624 152.349 97.988  1.00 54.63  ? 49   ARG E CG    1 
ATOM   3102  C  CD    . ARG E 1 50  ? 133.645 153.369 96.858  1.00 54.63  ? 49   ARG E CD    1 
ATOM   3103  N  NE    . ARG E 1 50  ? 134.409 152.889 95.709  1.00 54.63  ? 49   ARG E NE    1 
ATOM   3104  C  CZ    . ARG E 1 50  ? 135.107 153.674 94.895  1.00 54.63  ? 49   ARG E CZ    1 
ATOM   3105  N  NH1   . ARG E 1 50  ? 135.145 154.980 95.104  1.00 54.63  ? 49   ARG E NH1   1 
ATOM   3106  N  NH2   . ARG E 1 50  ? 135.773 153.153 93.874  1.00 54.63  ? 49   ARG E NH2   1 
ATOM   3107  N  N     . GLU E 1 51  ? 131.121 149.618 99.645  1.00 46.83  ? 50   GLU E N     1 
ATOM   3108  C  CA    . GLU E 1 51  ? 130.330 149.536 100.870 1.00 46.83  ? 50   GLU E CA    1 
ATOM   3109  C  C     . GLU E 1 51  ? 130.791 148.388 101.760 1.00 46.83  ? 50   GLU E C     1 
ATOM   3110  O  O     . GLU E 1 51  ? 130.748 148.508 102.989 1.00 46.83  ? 50   GLU E O     1 
ATOM   3111  C  CB    . GLU E 1 51  ? 128.843 149.404 100.554 1.00 46.83  ? 50   GLU E CB    1 
ATOM   3112  C  CG    . GLU E 1 51  ? 128.263 150.575 99.808  1.00 46.83  ? 50   GLU E CG    1 
ATOM   3113  C  CD    . GLU E 1 51  ? 126.764 150.478 99.678  1.00 46.83  ? 50   GLU E CD    1 
ATOM   3114  O  OE1   . GLU E 1 51  ? 126.140 149.795 100.517 1.00 46.83  ? 50   GLU E OE1   1 
ATOM   3115  O  OE2   . GLU E 1 51  ? 126.208 151.080 98.738  1.00 46.83  ? 50   GLU E OE2   1 
ATOM   3116  N  N     . ILE E 1 52  ? 131.126 147.235 101.155 1.00 44.51  ? 51   ILE E N     1 
ATOM   3117  C  CA    . ILE E 1 52  ? 131.668 146.085 101.894 1.00 44.51  ? 51   ILE E CA    1 
ATOM   3118  C  C     . ILE E 1 52  ? 132.856 146.507 102.746 1.00 44.51  ? 51   ILE E C     1 
ATOM   3119  O  O     . ILE E 1 52  ? 132.898 146.248 103.956 1.00 44.51  ? 51   ILE E O     1 
ATOM   3120  C  CB    . ILE E 1 52  ? 132.077 144.950 100.934 1.00 44.51  ? 51   ILE E CB    1 
ATOM   3121  C  CG1   . ILE E 1 52  ? 130.891 144.335 100.199 1.00 44.51  ? 51   ILE E CG1   1 
ATOM   3122  C  CG2   . ILE E 1 52  ? 132.817 143.859 101.688 1.00 44.51  ? 51   ILE E CG2   1 
ATOM   3123  C  CD1   . ILE E 1 52  ? 129.867 143.741 101.076 1.00 44.51  ? 51   ILE E CD1   1 
ATOM   3124  N  N     . ARG E 1 53  ? 133.835 147.191 102.082 1.00 50.29  ? 52   ARG E N     1 
ATOM   3125  C  CA    . ARG E 1 53  ? 135.017 147.619 102.832 1.00 50.29  ? 52   ARG E CA    1 
ATOM   3126  C  C     . ARG E 1 53  ? 134.673 148.673 103.879 1.00 50.29  ? 52   ARG E C     1 
ATOM   3127  O  O     . ARG E 1 53  ? 135.163 148.601 105.020 1.00 50.29  ? 52   ARG E O     1 
ATOM   3128  C  CB    . ARG E 1 53  ? 136.090 148.151 101.895 1.00 50.29  ? 52   ARG E CB    1 
ATOM   3129  C  CG    . ARG E 1 53  ? 136.633 147.141 100.933 1.00 50.29  ? 52   ARG E CG    1 
ATOM   3130  C  CD    . ARG E 1 53  ? 137.891 147.670 100.279 1.00 50.29  ? 52   ARG E CD    1 
ATOM   3131  N  NE    . ARG E 1 53  ? 138.837 148.185 101.262 1.00 50.29  ? 52   ARG E NE    1 
ATOM   3132  C  CZ    . ARG E 1 53  ? 140.060 148.607 100.966 1.00 50.29  ? 52   ARG E CZ    1 
ATOM   3133  N  NH1   . ARG E 1 53  ? 140.486 148.574 99.713  1.00 50.29  ? 52   ARG E NH1   1 
ATOM   3134  N  NH2   . ARG E 1 53  ? 140.859 149.061 101.920 1.00 50.29  ? 52   ARG E NH2   1 
ATOM   3135  N  N     . ARG E 1 54  ? 133.790 149.652 103.575 1.00 46.88  ? 53   ARG E N     1 
ATOM   3136  C  CA    . ARG E 1 54  ? 133.425 150.715 104.514 1.00 46.88  ? 53   ARG E CA    1 
ATOM   3137  C  C     . ARG E 1 54  ? 132.725 150.162 105.752 1.00 46.88  ? 53   ARG E C     1 
ATOM   3138  O  O     . ARG E 1 54  ? 133.056 150.540 106.881 1.00 46.88  ? 53   ARG E O     1 
ATOM   3139  C  CB    . ARG E 1 54  ? 132.572 151.778 103.822 1.00 46.88  ? 53   ARG E CB    1 
ATOM   3140  C  CG    . ARG E 1 54  ? 132.155 152.904 104.756 1.00 46.88  ? 53   ARG E CG    1 
ATOM   3141  C  CD    . ARG E 1 54  ? 131.227 153.901 104.089 1.00 46.88  ? 53   ARG E CD    1 
ATOM   3142  N  NE    . ARG E 1 54  ? 129.908 153.367 103.781 1.00 46.88  ? 53   ARG E NE    1 
ATOM   3143  C  CZ    . ARG E 1 54  ? 128.961 154.068 103.168 1.00 46.88  ? 53   ARG E CZ    1 
ATOM   3144  N  NH1   . ARG E 1 54  ? 129.198 155.319 102.802 1.00 46.88  ? 53   ARG E NH1   1 
ATOM   3145  N  NH2   . ARG E 1 54  ? 127.780 153.524 102.915 1.00 46.88  ? 53   ARG E NH2   1 
ATOM   3146  N  N     . TYR E 1 55  ? 131.766 149.255 105.569 1.00 42.11  ? 54   TYR E N     1 
ATOM   3147  C  CA    . TYR E 1 55  ? 131.047 148.749 106.728 1.00 42.11  ? 54   TYR E CA    1 
ATOM   3148  C  C     . TYR E 1 55  ? 131.811 147.663 107.469 1.00 42.11  ? 54   TYR E C     1 
ATOM   3149  O  O     . TYR E 1 55  ? 131.588 147.494 108.670 1.00 42.11  ? 54   TYR E O     1 
ATOM   3150  C  CB    . TYR E 1 55  ? 129.664 148.229 106.344 1.00 42.11  ? 54   TYR E CB    1 
ATOM   3151  C  CG    . TYR E 1 55  ? 128.732 149.314 105.886 1.00 42.11  ? 54   TYR E CG    1 
ATOM   3152  C  CD1   . TYR E 1 55  ? 128.348 150.324 106.751 1.00 42.11  ? 54   TYR E CD1   1 
ATOM   3153  C  CD2   . TYR E 1 55  ? 128.192 149.304 104.612 1.00 42.11  ? 54   TYR E CD2   1 
ATOM   3154  C  CE1   . TYR E 1 55  ? 127.487 151.322 106.345 1.00 42.11  ? 54   TYR E CE1   1 
ATOM   3155  C  CE2   . TYR E 1 55  ? 127.329 150.292 104.194 1.00 42.11  ? 54   TYR E CE2   1 
ATOM   3156  C  CZ    . TYR E 1 55  ? 126.977 151.295 105.067 1.00 42.11  ? 54   TYR E CZ    1 
ATOM   3157  O  OH    . TYR E 1 55  ? 126.117 152.283 104.653 1.00 42.11  ? 54   TYR E OH    1 
ATOM   3158  N  N     . GLN E 1 56  ? 132.717 146.932 106.813 1.00 41.84  ? 55   GLN E N     1 
ATOM   3159  C  CA    . GLN E 1 56  ? 133.560 146.031 107.585 1.00 41.84  ? 55   GLN E CA    1 
ATOM   3160  C  C     . GLN E 1 56  ? 134.664 146.761 108.331 1.00 41.84  ? 55   GLN E C     1 
ATOM   3161  O  O     . GLN E 1 56  ? 135.283 146.167 109.218 1.00 41.84  ? 55   GLN E O     1 
ATOM   3162  C  CB    . GLN E 1 56  ? 134.177 144.948 106.697 1.00 41.84  ? 55   GLN E CB    1 
ATOM   3163  C  CG    . GLN E 1 56  ? 133.241 143.799 106.372 1.00 41.84  ? 55   GLN E CG    1 
ATOM   3164  C  CD    . GLN E 1 56  ? 133.936 142.677 105.630 1.00 41.84  ? 55   GLN E CD    1 
ATOM   3165  O  OE1   . GLN E 1 56  ? 135.088 142.806 105.227 1.00 41.84  ? 55   GLN E OE1   1 
ATOM   3166  N  NE2   . GLN E 1 56  ? 133.243 141.561 105.463 1.00 41.84  ? 55   GLN E NE2   1 
ATOM   3167  N  N     . LYS E 1 57  ? 134.930 148.023 108.003 1.00 45.96  ? 56   LYS E N     1 
ATOM   3168  C  CA    . LYS E 1 57  ? 135.959 148.755 108.726 1.00 45.96  ? 56   LYS E CA    1 
ATOM   3169  C  C     . LYS E 1 57  ? 135.394 149.550 109.900 1.00 45.96  ? 56   LYS E C     1 
ATOM   3170  O  O     . LYS E 1 57  ? 136.129 149.831 110.853 1.00 45.96  ? 56   LYS E O     1 
ATOM   3171  C  CB    . LYS E 1 57  ? 136.717 149.677 107.763 1.00 45.96  ? 56   LYS E CB    1 
ATOM   3172  C  CG    . LYS E 1 57  ? 138.050 150.192 108.287 1.00 45.96  ? 56   LYS E CG    1 
ATOM   3173  C  CD    . LYS E 1 57  ? 138.791 150.997 107.234 1.00 45.96  ? 56   LYS E CD    1 
ATOM   3174  C  CE    . LYS E 1 57  ? 140.231 151.246 107.651 1.00 45.96  ? 56   LYS E CE    1 
ATOM   3175  N  NZ    . LYS E 1 57  ? 140.319 152.029 108.914 1.00 45.96  ? 56   LYS E NZ    1 
ATOM   3176  N  N     . SER E 1 58  ? 134.104 149.885 109.877 1.00 44.42  ? 57   SER E N     1 
ATOM   3177  C  CA    . SER E 1 58  ? 133.488 150.699 110.914 1.00 44.42  ? 57   SER E CA    1 
ATOM   3178  C  C     . SER E 1 58  ? 132.692 149.825 111.884 1.00 44.42  ? 57   SER E C     1 
ATOM   3179  O  O     . SER E 1 58  ? 132.616 148.603 111.742 1.00 44.42  ? 57   SER E O     1 
ATOM   3180  C  CB    . SER E 1 58  ? 132.595 151.768 110.289 1.00 44.42  ? 57   SER E CB    1 
ATOM   3181  O  OG    . SER E 1 58  ? 131.276 151.281 110.116 1.00 44.42  ? 57   SER E OG    1 
ATOM   3182  N  N     . THR E 1 59  ? 132.078 150.473 112.893 1.00 42.57  ? 58   THR E N     1 
ATOM   3183  C  CA    . THR E 1 59  ? 131.376 149.763 113.962 1.00 42.57  ? 58   THR E CA    1 
ATOM   3184  C  C     . THR E 1 59  ? 130.008 150.325 114.324 1.00 42.57  ? 58   THR E C     1 
ATOM   3185  O  O     . THR E 1 59  ? 129.384 149.788 115.244 1.00 42.57  ? 58   THR E O     1 
ATOM   3186  C  CB    . THR E 1 59  ? 132.198 149.744 115.274 1.00 42.57  ? 58   THR E CB    1 
ATOM   3187  O  OG1   . THR E 1 59  ? 132.280 151.070 115.812 1.00 42.57  ? 58   THR E OG1   1 
ATOM   3188  C  CG2   . THR E 1 59  ? 133.592 149.168 115.105 1.00 42.57  ? 58   THR E CG2   1 
ATOM   3189  N  N     . GLU E 1 60  ? 129.546 151.401 113.688 1.00 45.14  ? 59   GLU E N     1 
ATOM   3190  C  CA    . GLU E 1 60  ? 128.254 151.989 114.029 1.00 45.14  ? 59   GLU E CA    1 
ATOM   3191  C  C     . GLU E 1 60  ? 127.105 151.033 113.710 1.00 45.14  ? 59   GLU E C     1 
ATOM   3192  O  O     . GLU E 1 60  ? 127.236 150.097 112.916 1.00 45.14  ? 59   GLU E O     1 
ATOM   3193  C  CB    . GLU E 1 60  ? 128.048 153.321 113.305 1.00 45.14  ? 59   GLU E CB    1 
ATOM   3194  C  CG    . GLU E 1 60  ? 127.558 153.209 111.871 1.00 45.14  ? 59   GLU E CG    1 
ATOM   3195  C  CD    . GLU E 1 60  ? 128.690 153.052 110.878 1.00 45.14  ? 59   GLU E CD    1 
ATOM   3196  O  OE1   . GLU E 1 60  ? 128.418 152.705 109.709 1.00 45.14  ? 59   GLU E OE1   1 
ATOM   3197  O  OE2   . GLU E 1 60  ? 129.850 153.301 111.261 1.00 45.14  ? 59   GLU E OE2   1 
ATOM   3198  N  N     . LEU E 1 61  ? 125.976 151.266 114.373 1.00 40.70  ? 60   LEU E N     1 
ATOM   3199  C  CA    . LEU E 1 61  ? 124.789 150.451 114.158 1.00 40.70  ? 60   LEU E CA    1 
ATOM   3200  C  C     . LEU E 1 61  ? 124.194 150.688 112.778 1.00 40.70  ? 60   LEU E C     1 
ATOM   3201  O  O     . LEU E 1 61  ? 124.148 151.818 112.284 1.00 40.70  ? 60   LEU E O     1 
ATOM   3202  C  CB    . LEU E 1 61  ? 123.737 150.755 115.220 1.00 40.70  ? 60   LEU E CB    1 
ATOM   3203  C  CG    . LEU E 1 61  ? 124.048 150.302 116.638 1.00 40.70  ? 60   LEU E CG    1 
ATOM   3204  C  CD1   . LEU E 1 61  ? 122.899 150.655 117.546 1.00 40.70  ? 60   LEU E CD1   1 
ATOM   3205  C  CD2   . LEU E 1 61  ? 124.268 148.804 116.627 1.00 40.70  ? 60   LEU E CD2   1 
ATOM   3206  N  N     . LEU E 1 62  ? 123.726 149.608 112.162 1.00 39.84  ? 61   LEU E N     1 
ATOM   3207  C  CA    . LEU E 1 62  ? 123.231 149.653 110.799 1.00 39.84  ? 61   LEU E CA    1 
ATOM   3208  C  C     . LEU E 1 62  ? 121.715 149.668 110.731 1.00 39.84  ? 61   LEU E C     1 
ATOM   3209  O  O     . LEU E 1 62  ? 121.159 149.922 109.658 1.00 39.84  ? 61   LEU E O     1 
ATOM   3210  C  CB    . LEU E 1 62  ? 123.758 148.452 110.013 1.00 39.84  ? 61   LEU E CB    1 
ATOM   3211  C  CG    . LEU E 1 62  ? 125.256 148.202 110.127 1.00 39.84  ? 61   LEU E CG    1 
ATOM   3212  C  CD1   . LEU E 1 62  ? 125.638 146.970 109.329 1.00 39.84  ? 61   LEU E CD1   1 
ATOM   3213  C  CD2   . LEU E 1 62  ? 126.029 149.418 109.654 1.00 39.84  ? 61   LEU E CD2   1 
ATOM   3214  N  N     . ILE E 1 63  ? 121.041 149.402 111.838 1.00 37.16  ? 62   ILE E N     1 
ATOM   3215  C  CA    . ILE E 1 63  ? 119.589 149.444 111.908 1.00 37.16  ? 62   ILE E CA    1 
ATOM   3216  C  C     . ILE E 1 63  ? 119.196 150.754 112.571 1.00 37.16  ? 62   ILE E C     1 
ATOM   3217  O  O     . ILE E 1 63  ? 119.839 151.184 113.538 1.00 37.16  ? 62   ILE E O     1 
ATOM   3218  C  CB    . ILE E 1 63  ? 119.060 148.226 112.688 1.00 37.16  ? 62   ILE E CB    1 
ATOM   3219  C  CG1   . ILE E 1 63  ? 119.499 146.940 111.995 1.00 37.16  ? 62   ILE E CG1   1 
ATOM   3220  C  CG2   . ILE E 1 63  ? 117.555 148.237 112.766 1.00 37.16  ? 62   ILE E CG2   1 
ATOM   3221  C  CD1   . ILE E 1 63  ? 119.086 145.683 112.719 1.00 37.16  ? 62   ILE E CD1   1 
ATOM   3222  N  N     . ARG E 1 64  ? 118.175 151.412 112.024 1.00 46.06  ? 63   ARG E N     1 
ATOM   3223  C  CA    . ARG E 1 64  ? 117.654 152.642 112.606 1.00 46.06  ? 63   ARG E CA    1 
ATOM   3224  C  C     . ARG E 1 64  ? 117.098 152.371 114.000 1.00 46.06  ? 63   ARG E C     1 
ATOM   3225  O  O     . ARG E 1 64  ? 116.298 151.451 114.187 1.00 46.06  ? 63   ARG E O     1 
ATOM   3226  C  CB    . ARG E 1 64  ? 116.578 153.226 111.697 1.00 46.06  ? 63   ARG E CB    1 
ATOM   3227  C  CG    . ARG E 1 64  ? 117.117 153.789 110.394 1.00 46.06  ? 63   ARG E CG    1 
ATOM   3228  C  CD    . ARG E 1 64  ? 118.031 154.974 110.626 1.00 46.06  ? 63   ARG E CD    1 
ATOM   3229  N  NE    . ARG E 1 64  ? 119.428 154.617 110.405 1.00 46.06  ? 63   ARG E NE    1 
ATOM   3230  C  CZ    . ARG E 1 64  ? 120.435 155.481 110.440 1.00 46.06  ? 63   ARG E CZ    1 
ATOM   3231  N  NH1   . ARG E 1 64  ? 120.201 156.763 110.679 1.00 46.06  ? 63   ARG E NH1   1 
ATOM   3232  N  NH2   . ARG E 1 64  ? 121.677 155.065 110.231 1.00 46.06  ? 63   ARG E NH2   1 
ATOM   3233  N  N     . LYS E 1 65  ? 117.548 153.167 114.977 1.00 42.23  ? 64   LYS E N     1 
ATOM   3234  C  CA    . LYS E 1 65  ? 117.261 152.895 116.385 1.00 42.23  ? 64   LYS E CA    1 
ATOM   3235  C  C     . LYS E 1 65  ? 115.775 152.999 116.712 1.00 42.23  ? 64   LYS E C     1 
ATOM   3236  O  O     . LYS E 1 65  ? 115.206 152.086 117.318 1.00 42.23  ? 64   LYS E O     1 
ATOM   3237  C  CB    . LYS E 1 65  ? 118.065 153.842 117.273 1.00 42.23  ? 64   LYS E CB    1 
ATOM   3238  C  CG    . LYS E 1 65  ? 119.548 153.533 117.313 1.00 42.23  ? 64   LYS E CG    1 
ATOM   3239  C  CD    . LYS E 1 65  ? 120.264 154.401 118.331 1.00 42.23  ? 64   LYS E CD    1 
ATOM   3240  C  CE    . LYS E 1 65  ? 121.771 154.315 118.160 1.00 42.23  ? 64   LYS E CE    1 
ATOM   3241  N  NZ    . LYS E 1 65  ? 122.225 154.961 116.898 1.00 42.23  ? 64   LYS E NZ    1 
ATOM   3242  N  N     . LEU E 1 66  ? 115.142 154.117 116.356 1.00 43.84  ? 65   LEU E N     1 
ATOM   3243  C  CA    . LEU E 1 66  ? 113.738 154.329 116.715 1.00 43.84  ? 65   LEU E CA    1 
ATOM   3244  C  C     . LEU E 1 66  ? 112.760 153.357 116.037 1.00 43.84  ? 65   LEU E C     1 
ATOM   3245  O  O     . LEU E 1 66  ? 111.848 152.876 116.738 1.00 43.84  ? 65   LEU E O     1 
ATOM   3246  C  CB    . LEU E 1 66  ? 113.383 155.811 116.512 1.00 43.84  ? 65   LEU E CB    1 
ATOM   3247  C  CG    . LEU E 1 66  ? 112.150 156.397 117.208 1.00 43.84  ? 65   LEU E CG    1 
ATOM   3248  C  CD1   . LEU E 1 66  ? 112.414 157.857 117.530 1.00 43.84  ? 65   LEU E CD1   1 
ATOM   3249  C  CD2   . LEU E 1 66  ? 110.894 156.280 116.375 1.00 43.84  ? 65   LEU E CD2   1 
ATOM   3250  N  N     . PRO E 1 67  ? 112.808 153.094 114.703 1.00 42.40  ? 66   PRO E N     1 
ATOM   3251  C  CA    . PRO E 1 67  ? 111.944 152.027 114.152 1.00 42.40  ? 66   PRO E CA    1 
ATOM   3252  C  C     . PRO E 1 67  ? 112.149 150.667 114.797 1.00 42.40  ? 66   PRO E C     1 
ATOM   3253  O  O     . PRO E 1 67  ? 111.177 149.926 115.005 1.00 42.40  ? 66   PRO E O     1 
ATOM   3254  C  CB    . PRO E 1 67  ? 112.324 151.994 112.670 1.00 42.40  ? 66   PRO E CB    1 
ATOM   3255  C  CG    . PRO E 1 67  ? 112.768 153.326 112.377 1.00 42.40  ? 66   PRO E CG    1 
ATOM   3256  C  CD    . PRO E 1 67  ? 113.471 153.814 113.597 1.00 42.40  ? 66   PRO E CD    1 
ATOM   3257  N  N     . PHE E 1 68  ? 113.400 150.322 115.110 1.00 35.40  ? 67   PHE E N     1 
ATOM   3258  C  CA    . PHE E 1 68  ? 113.676 149.064 115.791 1.00 35.40  ? 67   PHE E CA    1 
ATOM   3259  C  C     . PHE E 1 68  ? 113.067 149.051 117.187 1.00 35.40  ? 67   PHE E C     1 
ATOM   3260  O  O     . PHE E 1 68  ? 112.587 148.010 117.646 1.00 35.40  ? 67   PHE E O     1 
ATOM   3261  C  CB    . PHE E 1 68  ? 115.181 148.813 115.843 1.00 35.40  ? 67   PHE E CB    1 
ATOM   3262  C  CG    . PHE E 1 68  ? 115.553 147.548 116.539 1.00 35.40  ? 67   PHE E CG    1 
ATOM   3263  C  CD1   . PHE E 1 68  ? 115.546 146.351 115.850 1.00 35.40  ? 67   PHE E CD1   1 
ATOM   3264  C  CD2   . PHE E 1 68  ? 115.954 147.556 117.862 1.00 35.40  ? 67   PHE E CD2   1 
ATOM   3265  C  CE1   . PHE E 1 68  ? 115.891 145.178 116.480 1.00 35.40  ? 67   PHE E CE1   1 
ATOM   3266  C  CE2   . PHE E 1 68  ? 116.287 146.392 118.496 1.00 35.40  ? 67   PHE E CE2   1 
ATOM   3267  C  CZ    . PHE E 1 68  ? 116.270 145.201 117.805 1.00 35.40  ? 67   PHE E CZ    1 
ATOM   3268  N  N     . GLN E 1 69  ? 113.136 150.181 117.896 1.00 36.00  ? 68   GLN E N     1 
ATOM   3269  C  CA    . GLN E 1 69  ? 112.523 150.277 119.217 1.00 36.00  ? 68   GLN E CA    1 
ATOM   3270  C  C     . GLN E 1 69  ? 111.014 150.091 119.136 1.00 36.00  ? 68   GLN E C     1 
ATOM   3271  O  O     . GLN E 1 69  ? 110.416 149.430 119.997 1.00 36.00  ? 68   GLN E O     1 
ATOM   3272  C  CB    . GLN E 1 69  ? 112.870 151.614 119.867 1.00 36.00  ? 68   GLN E CB    1 
ATOM   3273  C  CG    . GLN E 1 69  ? 112.333 151.760 121.276 1.00 36.00  ? 68   GLN E CG    1 
ATOM   3274  C  CD    . GLN E 1 69  ? 112.808 153.021 121.957 1.00 36.00  ? 68   GLN E CD    1 
ATOM   3275  O  OE1   . GLN E 1 69  ? 112.704 154.115 121.407 1.00 36.00  ? 68   GLN E OE1   1 
ATOM   3276  N  NE2   . GLN E 1 69  ? 113.339 152.874 123.164 1.00 36.00  ? 68   GLN E NE2   1 
ATOM   3277  N  N     . ARG E 1 70  ? 110.383 150.661 118.101 1.00 38.70  ? 69   ARG E N     1 
ATOM   3278  C  CA    . ARG E 1 70  ? 108.949 150.446 117.918 1.00 38.70  ? 69   ARG E CA    1 
ATOM   3279  C  C     . ARG E 1 70  ? 108.645 148.981 117.618 1.00 38.70  ? 69   ARG E C     1 
ATOM   3280  O  O     . ARG E 1 70  ? 107.633 148.446 118.091 1.00 38.70  ? 69   ARG E O     1 
ATOM   3281  C  CB    . ARG E 1 70  ? 108.385 151.326 116.804 1.00 38.70  ? 69   ARG E CB    1 
ATOM   3282  C  CG    . ARG E 1 70  ? 108.484 152.824 117.011 1.00 38.70  ? 69   ARG E CG    1 
ATOM   3283  C  CD    . ARG E 1 70  ? 107.471 153.516 116.109 1.00 38.70  ? 69   ARG E CD    1 
ATOM   3284  N  NE    . ARG E 1 70  ? 107.706 153.267 114.690 1.00 38.70  ? 69   ARG E NE    1 
ATOM   3285  C  CZ    . ARG E 1 70  ? 108.186 154.156 113.829 1.00 38.70  ? 69   ARG E CZ    1 
ATOM   3286  N  NH1   . ARG E 1 70  ? 108.477 155.382 114.229 1.00 38.70  ? 69   ARG E NH1   1 
ATOM   3287  N  NH2   . ARG E 1 70  ? 108.357 153.820 112.559 1.00 38.70  ? 69   ARG E NH2   1 
ATOM   3288  N  N     . LEU E 1 71  ? 109.502 148.330 116.822 1.00 35.33  ? 70   LEU E N     1 
ATOM   3289  C  CA    . LEU E 1 71  ? 109.372 146.893 116.572 1.00 35.33  ? 70   LEU E CA    1 
ATOM   3290  C  C     . LEU E 1 71  ? 109.470 146.083 117.861 1.00 35.33  ? 70   LEU E C     1 
ATOM   3291  O  O     . LEU E 1 71  ? 108.700 145.134 118.067 1.00 35.33  ? 70   LEU E O     1 
ATOM   3292  C  CB    . LEU E 1 71  ? 110.454 146.435 115.598 1.00 35.33  ? 70   LEU E CB    1 
ATOM   3293  C  CG    . LEU E 1 71  ? 110.532 144.933 115.318 1.00 35.33  ? 70   LEU E CG    1 
ATOM   3294  C  CD1   . LEU E 1 71  ? 109.201 144.395 114.816 1.00 35.33  ? 70   LEU E CD1   1 
ATOM   3295  C  CD2   . LEU E 1 71  ? 111.657 144.597 114.365 1.00 35.33  ? 70   LEU E CD2   1 
ATOM   3296  N  N     . VAL E 1 72  ? 110.417 146.445 118.732 1.00 31.66  ? 71   VAL E N     1 
ATOM   3297  C  CA    . VAL E 1 72  ? 110.602 145.752 120.007 1.00 31.66  ? 71   VAL E CA    1 
ATOM   3298  C  C     . VAL E 1 72  ? 109.363 145.894 120.879 1.00 31.66  ? 71   VAL E C     1 
ATOM   3299  O  O     . VAL E 1 72  ? 108.881 144.914 121.456 1.00 31.66  ? 71   VAL E O     1 
ATOM   3300  C  CB    . VAL E 1 72  ? 111.873 146.254 120.715 1.00 31.66  ? 71   VAL E CB    1 
ATOM   3301  C  CG1   . VAL E 1 72  ? 111.931 145.772 122.140 1.00 31.66  ? 71   VAL E CG1   1 
ATOM   3302  C  CG2   . VAL E 1 72  ? 113.082 145.725 119.998 1.00 31.66  ? 71   VAL E CG2   1 
ATOM   3303  N  N     . ARG E 1 73  ? 108.835 147.116 120.991 1.00 35.33  ? 72   ARG E N     1 
ATOM   3304  C  CA    . ARG E 1 73  ? 107.639 147.323 121.807 1.00 35.33  ? 72   ARG E CA    1 
ATOM   3305  C  C     . ARG E 1 73  ? 106.422 146.605 121.227 1.00 35.33  ? 72   ARG E C     1 
ATOM   3306  O  O     . ARG E 1 73  ? 105.591 146.089 121.983 1.00 35.33  ? 72   ARG E O     1 
ATOM   3307  C  CB    . ARG E 1 73  ? 107.354 148.810 121.984 1.00 35.33  ? 72   ARG E CB    1 
ATOM   3308  C  CG    . ARG E 1 73  ? 108.486 149.549 122.643 1.00 35.33  ? 72   ARG E CG    1 
ATOM   3309  C  CD    . ARG E 1 73  ? 108.162 151.004 122.855 1.00 35.33  ? 72   ARG E CD    1 
ATOM   3310  N  NE    . ARG E 1 73  ? 109.345 151.715 123.315 1.00 35.33  ? 72   ARG E NE    1 
ATOM   3311  C  CZ    . ARG E 1 73  ? 109.719 151.808 124.584 1.00 35.33  ? 72   ARG E CZ    1 
ATOM   3312  N  NH1   . ARG E 1 73  ? 109.000 151.234 125.536 1.00 35.33  ? 72   ARG E NH1   1 
ATOM   3313  N  NH2   . ARG E 1 73  ? 110.821 152.474 124.897 1.00 35.33  ? 72   ARG E NH2   1 
ATOM   3314  N  N     . GLU E 1 74  ? 106.301 146.549 119.894 1.00 37.87  ? 73   GLU E N     1 
ATOM   3315  C  CA    . GLU E 1 74  ? 105.192 145.811 119.285 1.00 37.87  ? 73   GLU E CA    1 
ATOM   3316  C  C     . GLU E 1 74  ? 105.297 144.310 119.560 1.00 37.87  ? 73   GLU E C     1 
ATOM   3317  O  O     . GLU E 1 74  ? 104.293 143.656 119.872 1.00 37.87  ? 73   GLU E O     1 
ATOM   3318  C  CB    . GLU E 1 74  ? 105.107 146.097 117.784 1.00 37.87  ? 73   GLU E CB    1 
ATOM   3319  C  CG    . GLU E 1 74  ? 104.219 145.111 117.016 1.00 37.87  ? 73   GLU E CG    1 
ATOM   3320  C  CD    . GLU E 1 74  ? 103.962 145.512 115.580 1.00 37.87  ? 73   GLU E CD    1 
ATOM   3321  O  OE1   . GLU E 1 74  ? 103.866 146.726 115.319 1.00 37.87  ? 73   GLU E OE1   1 
ATOM   3322  O  OE2   . GLU E 1 74  ? 103.866 144.617 114.714 1.00 37.87  ? 73   GLU E OE2   1 
ATOM   3323  N  N     . ILE E 1 75  ? 106.501 143.743 119.431 1.00 33.73  ? 74   ILE E N     1 
ATOM   3324  C  CA    . ILE E 1 75  ? 106.695 142.324 119.738 1.00 33.73  ? 74   ILE E CA    1 
ATOM   3325  C  C     . ILE E 1 75  ? 106.464 142.045 121.223 1.00 33.73  ? 74   ILE E C     1 
ATOM   3326  O  O     . ILE E 1 75  ? 105.868 141.023 121.588 1.00 33.73  ? 74   ILE E O     1 
ATOM   3327  C  CB    . ILE E 1 75  ? 108.095 141.885 119.259 1.00 33.73  ? 74   ILE E CB    1 
ATOM   3328  C  CG1   . ILE E 1 75  ? 108.123 141.870 117.731 1.00 33.73  ? 74   ILE E CG1   1 
ATOM   3329  C  CG2   . ILE E 1 75  ? 108.480 140.513 119.791 1.00 33.73  ? 74   ILE E CG2   1 
ATOM   3330  C  CD1   . ILE E 1 75  ? 109.423 141.403 117.138 1.00 33.73  ? 74   ILE E CD1   1 
ATOM   3331  N  N     . ALA E 1 76  ? 106.857 142.976 122.096 1.00 34.47  ? 75   ALA E N     1 
ATOM   3332  C  CA    . ALA E 1 76  ? 106.675 142.785 123.532 1.00 34.47  ? 75   ALA E CA    1 
ATOM   3333  C  C     . ALA E 1 76  ? 105.218 142.929 123.948 1.00 34.47  ? 75   ALA E C     1 
ATOM   3334  O  O     . ALA E 1 76  ? 104.834 142.408 125.001 1.00 34.47  ? 75   ALA E O     1 
ATOM   3335  C  CB    . ALA E 1 76  ? 107.538 143.772 124.312 1.00 34.47  ? 75   ALA E CB    1 
ATOM   3336  N  N     . GLN E 1 77  ? 104.434 143.703 123.181 1.00 36.57  ? 76   GLN E N     1 
ATOM   3337  C  CA    . GLN E 1 77  ? 103.003 143.899 123.430 1.00 36.57  ? 76   GLN E CA    1 
ATOM   3338  C  C     . GLN E 1 77  ? 102.238 142.590 123.598 1.00 36.57  ? 76   GLN E C     1 
ATOM   3339  O  O     . GLN E 1 77  ? 101.317 142.504 124.417 1.00 36.57  ? 76   GLN E O     1 
ATOM   3340  C  CB    . GLN E 1 77  ? 102.387 144.717 122.298 1.00 36.57  ? 76   GLN E CB    1 
ATOM   3341  C  CG    . GLN E 1 77  ? 101.098 145.404 122.673 1.00 36.57  ? 76   GLN E CG    1 
ATOM   3342  C  CD    . GLN E 1 77  ? 101.255 146.292 123.885 1.00 36.57  ? 76   GLN E CD    1 
ATOM   3343  O  OE1   . GLN E 1 77  ? 100.840 145.937 124.988 1.00 36.57  ? 76   GLN E OE1   1 
ATOM   3344  N  NE2   . GLN E 1 77  ? 101.857 147.457 123.688 1.00 36.57  ? 76   GLN E NE2   1 
ATOM   3345  N  N     . ASP E 1 78  ? 102.597 141.559 122.830 1.00 35.14  ? 77   ASP E N     1 
ATOM   3346  C  CA    . ASP E 1 78  ? 101.867 140.295 122.831 1.00 35.14  ? 77   ASP E CA    1 
ATOM   3347  C  C     . ASP E 1 78  ? 102.152 139.418 124.053 1.00 35.14  ? 77   ASP E C     1 
ATOM   3348  O  O     . ASP E 1 78  ? 101.729 138.258 124.062 1.00 35.14  ? 77   ASP E O     1 
ATOM   3349  C  CB    . ASP E 1 78  ? 102.178 139.504 121.557 1.00 35.14  ? 77   ASP E CB    1 
ATOM   3350  C  CG    . ASP E 1 78  ? 101.829 140.269 120.295 1.00 35.14  ? 77   ASP E CG    1 
ATOM   3351  O  OD1   . ASP E 1 78  ? 101.513 141.472 120.396 1.00 35.14  ? 77   ASP E OD1   1 
ATOM   3352  O  OD2   . ASP E 1 78  ? 101.870 139.665 119.202 1.00 35.14  ? 77   ASP E OD2   1 
ATOM   3353  N  N     . PHE E 1 79  ? 102.842 139.922 125.070 1.00 30.60  ? 78   PHE E N     1 
ATOM   3354  C  CA    . PHE E 1 79  ? 103.090 139.156 126.286 1.00 30.60  ? 78   PHE E CA    1 
ATOM   3355  C  C     . PHE E 1 79  ? 102.612 139.866 127.544 1.00 30.60  ? 78   PHE E C     1 
ATOM   3356  O  O     . PHE E 1 79  ? 102.001 139.228 128.403 1.00 30.60  ? 78   PHE E O     1 
ATOM   3357  C  CB    . PHE E 1 79  ? 104.585 138.818 126.433 1.00 30.60  ? 78   PHE E CB    1 
ATOM   3358  C  CG    . PHE E 1 79  ? 105.196 138.205 125.208 1.00 30.60  ? 78   PHE E CG    1 
ATOM   3359  C  CD1   . PHE E 1 79  ? 104.653 137.065 124.643 1.00 30.60  ? 78   PHE E CD1   1 
ATOM   3360  C  CD2   . PHE E 1 79  ? 106.345 138.739 124.652 1.00 30.60  ? 78   PHE E CD2   1 
ATOM   3361  C  CE1   . PHE E 1 79  ? 105.221 136.492 123.522 1.00 30.60  ? 78   PHE E CE1   1 
ATOM   3362  C  CE2   . PHE E 1 79  ? 106.922 138.166 123.535 1.00 30.60  ? 78   PHE E CE2   1 
ATOM   3363  C  CZ    . PHE E 1 79  ? 106.358 137.042 122.971 1.00 30.60  ? 78   PHE E CZ    1 
ATOM   3364  N  N     . LYS E 1 80  ? 102.851 141.172 127.663 1.00 36.31  ? 79   LYS E N     1 
ATOM   3365  C  CA    . LYS E 1 80  ? 102.443 141.958 128.823 1.00 36.31  ? 79   LYS E CA    1 
ATOM   3366  C  C     . LYS E 1 80  ? 102.100 143.366 128.374 1.00 36.31  ? 79   LYS E C     1 
ATOM   3367  O  O     . LYS E 1 80  ? 102.882 143.996 127.657 1.00 36.31  ? 79   LYS E O     1 
ATOM   3368  C  CB    . LYS E 1 80  ? 103.547 142.028 129.886 1.00 36.31  ? 79   LYS E CB    1 
ATOM   3369  C  CG    . LYS E 1 80  ? 103.788 140.769 130.680 1.00 36.31  ? 79   LYS E CG    1 
ATOM   3370  C  CD    . LYS E 1 80  ? 102.597 140.464 131.555 1.00 36.31  ? 79   LYS E CD    1 
ATOM   3371  C  CE    . LYS E 1 80  ? 102.448 141.524 132.634 1.00 36.31  ? 79   LYS E CE    1 
ATOM   3372  N  NZ    . LYS E 1 80  ? 103.661 141.609 133.498 1.00 36.31  ? 79   LYS E NZ    1 
ATOM   3373  N  N     . THR E 1 81  ? 100.944 143.858 128.804 1.00 44.67  ? 80   THR E N     1 
ATOM   3374  C  CA    . THR E 1 81  ? 100.498 145.185 128.415 1.00 44.67  ? 80   THR E CA    1 
ATOM   3375  C  C     . THR E 1 81  ? 101.232 146.238 129.240 1.00 44.67  ? 80   THR E C     1 
ATOM   3376  O  O     . THR E 1 81  ? 101.576 146.008 130.404 1.00 44.67  ? 80   THR E O     1 
ATOM   3377  C  CB    . THR E 1 81  ? 98.984  145.308 128.605 1.00 44.67  ? 80   THR E CB    1 
ATOM   3378  O  OG1   . THR E 1 81  ? 98.360  144.068 128.252 1.00 44.67  ? 80   THR E OG1   1 
ATOM   3379  C  CG2   . THR E 1 81  ? 98.407  146.398 127.713 1.00 44.67  ? 80   THR E CG2   1 
ATOM   3380  N  N     . ASP E 1 82  ? 101.450 147.406 128.617 1.00 48.24  ? 81   ASP E N     1 
ATOM   3381  C  CA    . ASP E 1 82  ? 102.155 148.555 129.204 1.00 48.24  ? 81   ASP E CA    1 
ATOM   3382  C  C     . ASP E 1 82  ? 103.559 148.182 129.673 1.00 48.24  ? 81   ASP E C     1 
ATOM   3383  O  O     . ASP E 1 82  ? 103.991 148.559 130.764 1.00 48.24  ? 81   ASP E O     1 
ATOM   3384  C  CB    . ASP E 1 82  ? 101.358 149.203 130.342 1.00 48.24  ? 81   ASP E CB    1 
ATOM   3385  C  CG    . ASP E 1 82  ? 100.067 149.833 129.864 1.00 48.24  ? 81   ASP E CG    1 
ATOM   3386  O  OD1   . ASP E 1 82  ? 100.090 150.531 128.828 1.00 48.24  ? 81   ASP E OD1   1 
ATOM   3387  O  OD2   . ASP E 1 82  ? 99.030  149.641 130.535 1.00 48.24  ? 81   ASP E OD2   1 
ATOM   3388  N  N     . LEU E 1 83  ? 104.269 147.422 128.849 1.00 40.13  ? 82   LEU E N     1 
ATOM   3389  C  CA    . LEU E 1 83  ? 105.652 147.096 129.154 1.00 40.13  ? 82   LEU E CA    1 
ATOM   3390  C  C     . LEU E 1 83  ? 106.546 148.299 128.916 1.00 40.13  ? 82   LEU E C     1 
ATOM   3391  O  O     . LEU E 1 83  ? 106.375 149.042 127.947 1.00 40.13  ? 82   LEU E O     1 
ATOM   3392  C  CB    . LEU E 1 83  ? 106.127 145.929 128.301 1.00 40.13  ? 82   LEU E CB    1 
ATOM   3393  C  CG    . LEU E 1 83  ? 106.126 144.575 128.989 1.00 40.13  ? 82   LEU E CG    1 
ATOM   3394  C  CD1   . LEU E 1 83  ? 106.468 143.527 127.975 1.00 40.13  ? 82   LEU E CD1   1 
ATOM   3395  C  CD2   . LEU E 1 83  ? 107.137 144.569 130.114 1.00 40.13  ? 82   LEU E CD2   1 
ATOM   3396  N  N     . ARG E 1 84  ? 107.500 148.493 129.814 1.00 44.87  ? 83   ARG E N     1 
ATOM   3397  C  CA    . ARG E 1 84  ? 108.509 149.523 129.668 1.00 44.87  ? 83   ARG E CA    1 
ATOM   3398  C  C     . ARG E 1 84  ? 109.871 148.889 129.429 1.00 44.87  ? 83   ARG E C     1 
ATOM   3399  O  O     . ARG E 1 84  ? 110.119 147.749 129.822 1.00 44.87  ? 83   ARG E O     1 
ATOM   3400  C  CB    . ARG E 1 84  ? 108.528 150.426 130.898 1.00 44.87  ? 83   ARG E CB    1 
ATOM   3401  C  CG    . ARG E 1 84  ? 107.384 151.414 130.877 1.00 44.87  ? 83   ARG E CG    1 
ATOM   3402  C  CD    . ARG E 1 84  ? 107.354 152.339 132.082 1.00 44.87  ? 83   ARG E CD    1 
ATOM   3403  N  NE    . ARG E 1 84  ? 106.504 153.501 131.833 1.00 44.87  ? 83   ARG E NE    1 
ATOM   3404  C  CZ    . ARG E 1 84  ? 105.172 153.495 131.843 1.00 44.87  ? 83   ARG E CZ    1 
ATOM   3405  N  NH1   . ARG E 1 84  ? 104.495 152.385 132.106 1.00 44.87  ? 83   ARG E NH1   1 
ATOM   3406  N  NH2   . ARG E 1 84  ? 104.511 154.616 131.594 1.00 44.87  ? 83   ARG E NH2   1 
ATOM   3407  N  N     . PHE E 1 85  ? 110.737 149.619 128.734 1.00 37.44  ? 84   PHE E N     1 
ATOM   3408  C  CA    . PHE E 1 85  ? 112.077 149.150 128.420 1.00 37.44  ? 84   PHE E CA    1 
ATOM   3409  C  C     . PHE E 1 85  ? 113.102 150.179 128.857 1.00 37.44  ? 84   PHE E C     1 
ATOM   3410  O  O     . PHE E 1 85  ? 112.883 151.381 128.703 1.00 37.44  ? 84   PHE E O     1 
ATOM   3411  C  CB    . PHE E 1 85  ? 112.246 148.889 126.923 1.00 37.44  ? 84   PHE E CB    1 
ATOM   3412  C  CG    . PHE E 1 85  ? 111.687 147.582 126.469 1.00 37.44  ? 84   PHE E CG    1 
ATOM   3413  C  CD1   . PHE E 1 85  ? 110.332 147.433 126.251 1.00 37.44  ? 84   PHE E CD1   1 
ATOM   3414  C  CD2   . PHE E 1 85  ? 112.522 146.500 126.258 1.00 37.44  ? 84   PHE E CD2   1 
ATOM   3415  C  CE1   . PHE E 1 85  ? 109.820 146.226 125.834 1.00 37.44  ? 84   PHE E CE1   1 
ATOM   3416  C  CE2   . PHE E 1 85  ? 112.017 145.293 125.841 1.00 37.44  ? 84   PHE E CE2   1 
ATOM   3417  C  CZ    . PHE E 1 85  ? 110.665 145.154 125.630 1.00 37.44  ? 84   PHE E CZ    1 
ATOM   3418  N  N     . GLN E 1 86  ? 114.229 149.709 129.374 1.00 33.88  ? 85   GLN E N     1 
ATOM   3419  C  CA    . GLN E 1 86  ? 115.382 150.577 129.530 1.00 33.88  ? 85   GLN E CA    1 
ATOM   3420  C  C     . GLN E 1 86  ? 116.047 150.763 128.179 1.00 33.88  ? 85   GLN E C     1 
ATOM   3421  O  O     . GLN E 1 86  ? 115.983 149.877 127.325 1.00 33.88  ? 85   GLN E O     1 
ATOM   3422  C  CB    . GLN E 1 86  ? 116.397 150.010 130.519 1.00 33.88  ? 85   GLN E CB    1 
ATOM   3423  C  CG    . GLN E 1 86  ? 115.979 150.047 131.966 1.00 33.88  ? 85   GLN E CG    1 
ATOM   3424  C  CD    . GLN E 1 86  ? 117.102 149.605 132.881 1.00 33.88  ? 85   GLN E CD    1 
ATOM   3425  O  OE1   . GLN E 1 86  ? 118.082 149.013 132.434 1.00 33.88  ? 85   GLN E OE1   1 
ATOM   3426  N  NE2   . GLN E 1 86  ? 116.968 149.897 134.168 1.00 33.88  ? 85   GLN E NE2   1 
ATOM   3427  N  N     . SER E 1 87  ? 116.598 151.963 127.963 1.00 32.51  ? 86   SER E N     1 
ATOM   3428  C  CA    . SER E 1 87  ? 117.332 152.269 126.737 1.00 32.51  ? 86   SER E CA    1 
ATOM   3429  C  C     . SER E 1 87  ? 118.468 151.280 126.501 1.00 32.51  ? 86   SER E C     1 
ATOM   3430  O  O     . SER E 1 87  ? 118.724 150.872 125.362 1.00 32.51  ? 86   SER E O     1 
ATOM   3431  C  CB    . SER E 1 87  ? 117.870 153.697 126.790 1.00 32.51  ? 86   SER E CB    1 
ATOM   3432  O  OG    . SER E 1 87  ? 118.593 153.999 125.611 1.00 32.51  ? 86   SER E OG    1 
ATOM   3433  N  N     . SER E 1 88  ? 119.183 150.911 127.569 1.00 30.52  ? 87   SER E N     1 
ATOM   3434  C  CA    . SER E 1 88  ? 120.259 149.933 127.448 1.00 30.52  ? 87   SER E CA    1 
ATOM   3435  C  C     . SER E 1 88  ? 119.741 148.556 127.045 1.00 30.52  ? 87   SER E C     1 
ATOM   3436  O  O     . SER E 1 88  ? 120.455 147.801 126.380 1.00 30.52  ? 87   SER E O     1 
ATOM   3437  C  CB    . SER E 1 88  ? 121.032 149.843 128.761 1.00 30.52  ? 87   SER E CB    1 
ATOM   3438  O  OG    . SER E 1 88  ? 121.705 151.058 129.027 1.00 30.52  ? 87   SER E OG    1 
ATOM   3439  N  N     . ALA E 1 89  ? 118.495 148.227 127.396 1.00 31.44  ? 88   ALA E N     1 
ATOM   3440  C  CA    . ALA E 1 89  ? 117.914 146.955 126.974 1.00 31.44  ? 88   ALA E CA    1 
ATOM   3441  C  C     . ALA E 1 89  ? 117.643 146.946 125.476 1.00 31.44  ? 88   ALA E C     1 
ATOM   3442  O  O     . ALA E 1 89  ? 117.948 145.964 124.789 1.00 31.44  ? 88   ALA E O     1 
ATOM   3443  C  CB    . ALA E 1 89  ? 116.638 146.664 127.758 1.00 31.44  ? 88   ALA E CB    1 
ATOM   3444  N  N     . VAL E 1 90  ? 117.027 148.017 124.965 1.00 30.17  ? 89   VAL E N     1 
ATOM   3445  C  CA    . VAL E 1 90  ? 116.800 148.164 123.528 1.00 30.17  ? 89   VAL E CA    1 
ATOM   3446  C  C     . VAL E 1 90  ? 118.127 148.176 122.776 1.00 30.17  ? 89   VAL E C     1 
ATOM   3447  O  O     . VAL E 1 90  ? 118.248 147.598 121.689 1.00 30.17  ? 89   VAL E O     1 
ATOM   3448  C  CB    . VAL E 1 90  ? 115.967 149.432 123.257 1.00 30.17  ? 89   VAL E CB    1 
ATOM   3449  C  CG1   . VAL E 1 90  ? 115.766 149.670 121.770 1.00 30.17  ? 89   VAL E CG1   1 
ATOM   3450  C  CG2   . VAL E 1 90  ? 114.626 149.317 123.939 1.00 30.17  ? 89   VAL E CG2   1 
ATOM   3451  N  N     . MET E 1 91  ? 119.154 148.797 123.363 1.00 29.58  ? 90   MET E N     1 
ATOM   3452  C  CA    . MET E 1 91  ? 120.472 148.819 122.736 1.00 29.58  ? 90   MET E CA    1 
ATOM   3453  C  C     . MET E 1 91  ? 121.103 147.430 122.697 1.00 29.58  ? 90   MET E C     1 
ATOM   3454  O  O     . MET E 1 91  ? 121.709 147.052 121.687 1.00 29.58  ? 90   MET E O     1 
ATOM   3455  C  CB    . MET E 1 91  ? 121.379 149.803 123.473 1.00 29.58  ? 90   MET E CB    1 
ATOM   3456  C  CG    . MET E 1 91  ? 122.516 150.360 122.634 1.00 29.58  ? 90   MET E CG    1 
ATOM   3457  S  SD    . MET E 1 91  ? 122.041 151.148 121.078 1.00 29.58  ? 90   MET E SD    1 
ATOM   3458  C  CE    . MET E 1 91  ? 120.724 152.266 121.565 1.00 29.58  ? 90   MET E CE    1 
ATOM   3459  N  N     . ALA E 1 92  ? 120.989 146.666 123.790 1.00 28.63  ? 91   ALA E N     1 
ATOM   3460  C  CA    . ALA E 1 92  ? 121.484 145.293 123.800 1.00 28.63  ? 91   ALA E CA    1 
ATOM   3461  C  C     . ALA E 1 92  ? 120.725 144.414 122.816 1.00 28.63  ? 91   ALA E C     1 
ATOM   3462  O  O     . ALA E 1 92  ? 121.326 143.545 122.171 1.00 28.63  ? 91   ALA E O     1 
ATOM   3463  C  CB    . ALA E 1 92  ? 121.393 144.710 125.206 1.00 28.63  ? 91   ALA E CB    1 
ATOM   3464  N  N     . LEU E 1 93  ? 119.423 144.660 122.651 1.00 28.85  ? 92   LEU E N     1 
ATOM   3465  C  CA    . LEU E 1 93  ? 118.649 143.903 121.674 1.00 28.85  ? 92   LEU E CA    1 
ATOM   3466  C  C     . LEU E 1 93  ? 119.069 144.251 120.258 1.00 28.85  ? 92   LEU E C     1 
ATOM   3467  O  O     . LEU E 1 93  ? 119.137 143.370 119.399 1.00 28.85  ? 92   LEU E O     1 
ATOM   3468  C  CB    . LEU E 1 93  ? 117.156 144.153 121.846 1.00 28.85  ? 92   LEU E CB    1 
ATOM   3469  C  CG    . LEU E 1 93  ? 116.467 143.328 122.919 1.00 28.85  ? 92   LEU E CG    1 
ATOM   3470  C  CD1   . LEU E 1 93  ? 115.032 143.782 123.092 1.00 28.85  ? 92   LEU E CD1   1 
ATOM   3471  C  CD2   . LEU E 1 93  ? 116.525 141.880 122.517 1.00 28.85  ? 92   LEU E CD2   1 
ATOM   3472  N  N     . GLN E 1 94  ? 119.348 145.529 119.999 1.00 32.33  ? 93   GLN E N     1 
ATOM   3473  C  CA    . GLN E 1 94  ? 119.770 145.944 118.667 1.00 32.33  ? 93   GLN E CA    1 
ATOM   3474  C  C     . GLN E 1 94  ? 121.140 145.384 118.323 1.00 32.33  ? 93   GLN E C     1 
ATOM   3475  O  O     . GLN E 1 94  ? 121.359 144.938 117.190 1.00 32.33  ? 93   GLN E O     1 
ATOM   3476  C  CB    . GLN E 1 94  ? 119.759 147.465 118.575 1.00 32.33  ? 93   GLN E CB    1 
ATOM   3477  C  CG    . GLN E 1 94  ? 119.786 148.001 117.169 1.00 32.33  ? 93   GLN E CG    1 
ATOM   3478  C  CD    . GLN E 1 94  ? 119.543 149.492 117.131 1.00 32.33  ? 93   GLN E CD    1 
ATOM   3479  O  OE1   . GLN E 1 94  ? 119.055 150.073 118.100 1.00 32.33  ? 93   GLN E OE1   1 
ATOM   3480  N  NE2   . GLN E 1 94  ? 119.865 150.121 116.006 1.00 32.33  ? 93   GLN E NE2   1 
ATOM   3481  N  N     . GLU E 1 95  ? 122.063 145.387 119.289 1.00 29.01  ? 94   GLU E N     1 
ATOM   3482  C  CA    . GLU E 1 95  ? 123.367 144.766 119.080 1.00 29.01  ? 94   GLU E CA    1 
ATOM   3483  C  C     . GLU E 1 95  ? 123.244 143.269 118.802 1.00 29.01  ? 94   GLU E C     1 
ATOM   3484  O  O     . GLU E 1 95  ? 123.843 142.764 117.844 1.00 29.01  ? 94   GLU E O     1 
ATOM   3485  C  CB    . GLU E 1 95  ? 124.295 145.023 120.268 1.00 29.01  ? 94   GLU E CB    1 
ATOM   3486  C  CG    . GLU E 1 95  ? 125.504 144.086 120.277 1.00 29.01  ? 94   GLU E CG    1 
ATOM   3487  C  CD    . GLU E 1 95  ? 126.625 144.512 119.329 1.00 29.01  ? 94   GLU E CD    1 
ATOM   3488  O  OE1   . GLU E 1 95  ? 126.468 145.487 118.564 1.00 29.01  ? 94   GLU E OE1   1 
ATOM   3489  O  OE2   . GLU E 1 95  ? 127.649 143.805 119.287 1.00 29.01  ? 94   GLU E OE2   1 
ATOM   3490  N  N     . ALA E 1 96  ? 122.511 142.542 119.657 1.00 25.43  ? 95   ALA E N     1 
ATOM   3491  C  CA    . ALA E 1 96  ? 122.312 141.103 119.472 1.00 25.43  ? 95   ALA E CA    1 
ATOM   3492  C  C     . ALA E 1 96  ? 121.654 140.784 118.135 1.00 25.43  ? 95   ALA E C     1 
ATOM   3493  O  O     . ALA E 1 96  ? 122.078 139.858 117.433 1.00 25.43  ? 95   ALA E O     1 
ATOM   3494  C  CB    . ALA E 1 96  ? 121.478 140.543 120.614 1.00 25.43  ? 95   ALA E CB    1 
ATOM   3495  N  N     . SER E 1 97  ? 120.591 141.519 117.795 1.00 24.80  ? 96   SER E N     1 
ATOM   3496  C  CA    . SER E 1 97  ? 119.885 141.354 116.529 1.00 24.80  ? 96   SER E CA    1 
ATOM   3497  C  C     . SER E 1 97  ? 120.803 141.566 115.335 1.00 24.80  ? 96   SER E C     1 
ATOM   3498  O  O     . SER E 1 97  ? 120.808 140.764 114.392 1.00 24.80  ? 96   SER E O     1 
ATOM   3499  C  CB    . SER E 1 97  ? 118.725 142.337 116.473 1.00 24.80  ? 96   SER E CB    1 
ATOM   3500  O  OG    . SER E 1 97  ? 118.268 142.453 115.146 1.00 24.80  ? 96   SER E OG    1 
ATOM   3501  N  N     . GLU E 1 98  ? 121.579 142.652 115.356 1.00 26.33  ? 97   GLU E N     1 
ATOM   3502  C  CA    . GLU E 1 98  ? 122.454 142.956 114.235 1.00 26.33  ? 97   GLU E CA    1 
ATOM   3503  C  C     . GLU E 1 98  ? 123.579 141.938 114.123 1.00 26.33  ? 97   GLU E C     1 
ATOM   3504  O  O     . GLU E 1 98  ? 123.937 141.537 113.013 1.00 26.33  ? 97   GLU E O     1 
ATOM   3505  C  CB    . GLU E 1 98  ? 122.985 144.387 114.392 1.00 26.33  ? 97   GLU E CB    1 
ATOM   3506  C  CG    . GLU E 1 98  ? 124.135 144.831 113.486 1.00 26.33  ? 97   GLU E CG    1 
ATOM   3507  C  CD    . GLU E 1 98  ? 125.516 144.519 114.048 1.00 26.33  ? 97   GLU E CD    1 
ATOM   3508  O  OE1   . GLU E 1 98  ? 126.509 144.695 113.316 1.00 26.33  ? 97   GLU E OE1   1 
ATOM   3509  O  OE2   . GLU E 1 98  ? 125.602 144.086 115.216 1.00 26.33  ? 97   GLU E OE2   1 
ATOM   3510  N  N     . ALA E 1 99  ? 124.112 141.468 115.255 1.00 25.66  ? 98   ALA E N     1 
ATOM   3511  C  CA    . ALA E 1 99  ? 125.155 140.447 115.215 1.00 25.66  ? 98   ALA E CA    1 
ATOM   3512  C  C     . ALA E 1 99  ? 124.623 139.117 114.701 1.00 25.66  ? 98   ALA E C     1 
ATOM   3513  O  O     . ALA E 1 99  ? 125.302 138.430 113.926 1.00 25.66  ? 98   ALA E O     1 
ATOM   3514  C  CB    . ALA E 1 99  ? 125.769 140.271 116.596 1.00 25.66  ? 98   ALA E CB    1 
ATOM   3515  N  N     . TYR E 1 100 ? 123.397 138.761 115.090 1.00 25.02  ? 99   TYR E N     1 
ATOM   3516  C  CA    . TYR E 1 100 ? 122.791 137.518 114.629 1.00 25.02  ? 99   TYR E CA    1 
ATOM   3517  C  C     . TYR E 1 100 ? 122.522 137.564 113.132 1.00 25.02  ? 99   TYR E C     1 
ATOM   3518  O  O     . TYR E 1 100 ? 122.815 136.601 112.415 1.00 25.02  ? 99   TYR E O     1 
ATOM   3519  C  CB    . TYR E 1 100 ? 121.511 137.244 115.409 1.00 25.02  ? 99   TYR E CB    1 
ATOM   3520  C  CG    . TYR E 1 100 ? 120.653 136.155 114.831 1.00 25.02  ? 99   TYR E CG    1 
ATOM   3521  C  CD1   . TYR E 1 100 ? 121.006 134.824 114.981 1.00 25.02  ? 99   TYR E CD1   1 
ATOM   3522  C  CD2   . TYR E 1 100 ? 119.469 136.450 114.175 1.00 25.02  ? 99   TYR E CD2   1 
ATOM   3523  C  CE1   . TYR E 1 100 ? 120.220 133.816 114.467 1.00 25.02  ? 99   TYR E CE1   1 
ATOM   3524  C  CE2   . TYR E 1 100 ? 118.673 135.451 113.659 1.00 25.02  ? 99   TYR E CE2   1 
ATOM   3525  C  CZ    . TYR E 1 100 ? 119.053 134.134 113.809 1.00 25.02  ? 99   TYR E CZ    1 
ATOM   3526  O  OH    . TYR E 1 100 ? 118.265 133.131 113.298 1.00 25.02  ? 99   TYR E OH    1 
ATOM   3527  N  N     . LEU E 1 101 ? 121.978 138.682 112.642 1.00 23.89  ? 100  LEU E N     1 
ATOM   3528  C  CA    . LEU E 1 101 ? 121.700 138.798 111.213 1.00 23.89  ? 100  LEU E CA    1 
ATOM   3529  C  C     . LEU E 1 101 ? 122.983 138.846 110.391 1.00 23.89  ? 100  LEU E C     1 
ATOM   3530  O  O     . LEU E 1 101 ? 123.037 138.268 109.302 1.00 23.89  ? 100  LEU E O     1 
ATOM   3531  C  CB    . LEU E 1 101 ? 120.826 140.013 110.926 1.00 23.89  ? 100  LEU E CB    1 
ATOM   3532  C  CG    . LEU E 1 101 ? 119.384 139.837 111.387 1.00 23.89  ? 100  LEU E CG    1 
ATOM   3533  C  CD1   . LEU E 1 101 ? 118.548 141.033 110.985 1.00 23.89  ? 100  LEU E CD1   1 
ATOM   3534  C  CD2   . LEU E 1 101 ? 118.799 138.563 110.816 1.00 23.89  ? 100  LEU E CD2   1 
ATOM   3535  N  N     . VAL E 1 102 ? 123.996 139.588 110.857 1.00 26.02  ? 101  VAL E N     1 
ATOM   3536  C  CA    . VAL E 1 102 ? 125.293 139.629 110.177 1.00 26.02  ? 101  VAL E CA    1 
ATOM   3537  C  C     . VAL E 1 102 ? 125.915 138.236 110.082 1.00 26.02  ? 101  VAL E C     1 
ATOM   3538  O  O     . VAL E 1 102 ? 126.401 137.834 109.017 1.00 26.02  ? 101  VAL E O     1 
ATOM   3539  C  CB    . VAL E 1 102 ? 126.228 140.639 110.865 1.00 26.02  ? 101  VAL E CB    1 
ATOM   3540  C  CG1   . VAL E 1 102 ? 127.661 140.410 110.471 1.00 26.02  ? 101  VAL E CG1   1 
ATOM   3541  C  CG2   . VAL E 1 102 ? 125.845 142.040 110.439 1.00 26.02  ? 101  VAL E CG2   1 
ATOM   3542  N  N     . ALA E 1 103 ? 125.889 137.470 111.182 1.00 26.83  ? 102  ALA E N     1 
ATOM   3543  C  CA    . ALA E 1 103 ? 126.440 136.114 111.146 1.00 26.83  ? 102  ALA E CA    1 
ATOM   3544  C  C     . ALA E 1 103 ? 125.632 135.203 110.225 1.00 26.83  ? 102  ALA E C     1 
ATOM   3545  O  O     . ALA E 1 103 ? 126.204 134.365 109.508 1.00 26.83  ? 102  ALA E O     1 
ATOM   3546  C  CB    . ALA E 1 103 ? 126.502 135.531 112.555 1.00 26.83  ? 102  ALA E CB    1 
ATOM   3547  N  N     . LEU E 1 104 ? 124.303 135.361 110.227 1.00 26.78  ? 103  LEU E N     1 
ATOM   3548  C  CA    . LEU E 1 104 ? 123.456 134.587 109.327 1.00 26.78  ? 103  LEU E CA    1 
ATOM   3549  C  C     . LEU E 1 104 ? 123.739 134.920 107.869 1.00 26.78  ? 103  LEU E C     1 
ATOM   3550  O  O     . LEU E 1 104 ? 123.777 134.025 107.022 1.00 26.78  ? 103  LEU E O     1 
ATOM   3551  C  CB    . LEU E 1 104 ? 121.988 134.838 109.644 1.00 26.78  ? 103  LEU E CB    1 
ATOM   3552  C  CG    . LEU E 1 104 ? 121.025 133.964 108.852 1.00 26.78  ? 103  LEU E CG    1 
ATOM   3553  C  CD1   . LEU E 1 104 ? 121.336 132.509 109.120 1.00 26.78  ? 103  LEU E CD1   1 
ATOM   3554  C  CD2   . LEU E 1 104 ? 119.587 134.282 109.185 1.00 26.78  ? 103  LEU E CD2   1 
ATOM   3555  N  N     . PHE E 1 105 ? 123.944 136.202 107.556 1.00 28.47  ? 104  PHE E N     1 
ATOM   3556  C  CA    . PHE E 1 105 ? 124.273 136.582 106.186 1.00 28.47  ? 104  PHE E CA    1 
ATOM   3557  C  C     . PHE E 1 105 ? 125.673 136.139 105.793 1.00 28.47  ? 104  PHE E C     1 
ATOM   3558  O  O     . PHE E 1 105 ? 125.916 135.880 104.615 1.00 28.47  ? 104  PHE E O     1 
ATOM   3559  C  CB    . PHE E 1 105 ? 124.091 138.080 105.977 1.00 28.47  ? 104  PHE E CB    1 
ATOM   3560  C  CG    . PHE E 1 105 ? 122.673 138.469 105.696 1.00 28.47  ? 104  PHE E CG    1 
ATOM   3561  C  CD1   . PHE E 1 105 ? 121.998 137.913 104.627 1.00 28.47  ? 104  PHE E CD1   1 
ATOM   3562  C  CD2   . PHE E 1 105 ? 122.021 139.400 106.478 1.00 28.47  ? 104  PHE E CD2   1 
ATOM   3563  C  CE1   . PHE E 1 105 ? 120.693 138.261 104.357 1.00 28.47  ? 104  PHE E CE1   1 
ATOM   3564  C  CE2   . PHE E 1 105 ? 120.714 139.754 106.209 1.00 28.47  ? 104  PHE E CE2   1 
ATOM   3565  C  CZ    . PHE E 1 105 ? 120.052 139.184 105.147 1.00 28.47  ? 104  PHE E CZ    1 
ATOM   3566  N  N     . GLU E 1 106 ? 126.597 136.045 106.751 1.00 30.39  ? 105  GLU E N     1 
ATOM   3567  C  CA    . GLU E 1 106 ? 127.920 135.487 106.472 1.00 30.39  ? 105  GLU E CA    1 
ATOM   3568  C  C     . GLU E 1 106 ? 127.818 134.020 106.068 1.00 30.39  ? 105  GLU E C     1 
ATOM   3569  O  O     . GLU E 1 106 ? 128.412 133.588 105.066 1.00 30.39  ? 105  GLU E O     1 
ATOM   3570  C  CB    . GLU E 1 106 ? 128.807 135.626 107.709 1.00 30.39  ? 105  GLU E CB    1 
ATOM   3571  C  CG    . GLU E 1 106 ? 130.180 134.994 107.581 1.00 30.39  ? 105  GLU E CG    1 
ATOM   3572  C  CD    . GLU E 1 106 ? 131.114 135.785 106.700 1.00 30.39  ? 105  GLU E CD    1 
ATOM   3573  O  OE1   . GLU E 1 106 ? 130.936 137.013 106.609 1.00 30.39  ? 105  GLU E OE1   1 
ATOM   3574  O  OE2   . GLU E 1 106 ? 132.026 135.181 106.099 1.00 30.39  ? 105  GLU E OE2   1 
ATOM   3575  N  N     . ASP E 1 107 ? 127.033 133.251 106.827 1.00 33.41  ? 106  ASP E N     1 
ATOM   3576  C  CA    . ASP E 1 107 ? 126.813 131.843 106.507 1.00 33.41  ? 106  ASP E CA    1 
ATOM   3577  C  C     . ASP E 1 107 ? 126.059 131.675 105.189 1.00 33.41  ? 106  ASP E C     1 
ATOM   3578  O  O     . ASP E 1 107 ? 126.378 130.780 104.390 1.00 33.41  ? 106  ASP E O     1 
ATOM   3579  C  CB    . ASP E 1 107 ? 126.061 131.187 107.658 1.00 33.41  ? 106  ASP E CB    1 
ATOM   3580  C  CG    . ASP E 1 107 ? 126.880 131.148 108.930 1.00 33.41  ? 106  ASP E CG    1 
ATOM   3581  O  OD1   . ASP E 1 107 ? 127.921 131.837 108.979 1.00 33.41  ? 106  ASP E OD1   1 
ATOM   3582  O  OD2   . ASP E 1 107 ? 126.489 130.439 109.880 1.00 33.41  ? 106  ASP E OD2   1 
ATOM   3583  N  N     . THR E 1 108 ? 125.038 132.510 104.969 1.00 32.66  ? 107  THR E N     1 
ATOM   3584  C  CA    . THR E 1 108 ? 124.301 132.538 103.708 1.00 32.66  ? 107  THR E CA    1 
ATOM   3585  C  C     . THR E 1 108 ? 125.217 132.841 102.528 1.00 32.66  ? 107  THR E C     1 
ATOM   3586  O  O     . THR E 1 108 ? 125.096 132.219 101.471 1.00 32.66  ? 107  THR E O     1 
ATOM   3587  C  CB    . THR E 1 108 ? 123.165 133.556 103.803 1.00 32.66  ? 107  THR E CB    1 
ATOM   3588  O  OG1   . THR E 1 108 ? 122.265 133.160 104.844 1.00 32.66  ? 107  THR E OG1   1 
ATOM   3589  C  CG2   . THR E 1 108 ? 122.395 133.641 102.510 1.00 32.66  ? 107  THR E CG2   1 
ATOM   3590  N  N     . ASN E 1 109 ? 126.111 133.825 102.675 1.00 32.88  ? 108  ASN E N     1 
ATOM   3591  C  CA    . ASN E 1 109 ? 127.066 134.139 101.616 1.00 32.88  ? 108  ASN E CA    1 
ATOM   3592  C  C     . ASN E 1 109 ? 127.993 132.972 101.322 1.00 32.88  ? 108  ASN E C     1 
ATOM   3593  O  O     . ASN E 1 109 ? 128.326 132.724 100.158 1.00 32.88  ? 108  ASN E O     1 
ATOM   3594  C  CB    . ASN E 1 109 ? 127.899 135.360 101.978 1.00 32.88  ? 108  ASN E CB    1 
ATOM   3595  C  CG    . ASN E 1 109 ? 128.609 135.940 100.778 1.00 32.88  ? 108  ASN E CG    1 
ATOM   3596  O  OD1   . ASN E 1 109 ? 128.303 135.599 99.637  1.00 32.88  ? 108  ASN E OD1   1 
ATOM   3597  N  ND2   . ASN E 1 109 ? 129.588 136.795 101.028 1.00 32.88  ? 108  ASN E ND2   1 
ATOM   3598  N  N     . LEU E 1 110 ? 128.423 132.245 102.360 1.00 34.42  ? 109  LEU E N     1 
ATOM   3599  C  CA    . LEU E 1 110 ? 129.290 131.094 102.115 1.00 34.42  ? 109  LEU E CA    1 
ATOM   3600  C  C     . LEU E 1 110 ? 128.563 129.972 101.384 1.00 34.42  ? 109  LEU E C     1 
ATOM   3601  O  O     . LEU E 1 110 ? 129.114 129.391 100.436 1.00 34.42  ? 109  LEU E O     1 
ATOM   3602  C  CB    . LEU E 1 110 ? 129.851 130.578 103.433 1.00 34.42  ? 109  LEU E CB    1 
ATOM   3603  C  CG    . LEU E 1 110 ? 130.883 131.515 104.041 1.00 34.42  ? 109  LEU E CG    1 
ATOM   3604  C  CD1   . LEU E 1 110 ? 131.388 130.958 105.345 1.00 34.42  ? 109  LEU E CD1   1 
ATOM   3605  C  CD2   . LEU E 1 110 ? 132.029 131.712 103.069 1.00 34.42  ? 109  LEU E CD2   1 
ATOM   3606  N  N     . CYS E 1 111 ? 127.307 129.710 101.752 1.00 37.31  ? 110  CYS E N     1 
ATOM   3607  C  CA    . CYS E 1 111 ? 126.545 128.678 101.053 1.00 37.31  ? 110  CYS E CA    1 
ATOM   3608  C  C     . CYS E 1 111 ? 126.169 129.126 99.642  1.00 37.31  ? 110  CYS E C     1 
ATOM   3609  O  O     . CYS E 1 111 ? 126.085 128.300 98.727  1.00 37.31  ? 110  CYS E O     1 
ATOM   3610  C  CB    . CYS E 1 111 ? 125.307 128.285 101.854 1.00 37.31  ? 110  CYS E CB    1 
ATOM   3611  S  SG    . CYS E 1 111 ? 123.841 129.252 101.513 1.00 37.31  ? 110  CYS E SG    1 
ATOM   3612  N  N     . ALA E 1 112 ? 125.876 130.417 99.468  1.00 35.60  ? 111  ALA E N     1 
ATOM   3613  C  CA    . ALA E 1 112 ? 125.587 130.981 98.153  1.00 35.60  ? 111  ALA E CA    1 
ATOM   3614  C  C     . ALA E 1 112 ? 126.776 130.851 97.216  1.00 35.60  ? 111  ALA E C     1 
ATOM   3615  O  O     . ALA E 1 112 ? 126.630 130.398 96.076  1.00 35.60  ? 111  ALA E O     1 
ATOM   3616  C  CB    . ALA E 1 112 ? 125.187 132.446 98.293  1.00 35.60  ? 111  ALA E CB    1 
ATOM   3617  N  N     . ILE E 1 113 ? 127.952 131.315 97.662  1.00 36.61  ? 112  ILE E N     1 
ATOM   3618  C  CA    . ILE E 1 113 ? 129.181 131.217 96.875  1.00 36.61  ? 112  ILE E CA    1 
ATOM   3619  C  C     . ILE E 1 113 ? 129.528 129.760 96.576  1.00 36.61  ? 112  ILE E C     1 
ATOM   3620  O  O     . ILE E 1 113 ? 130.186 129.463 95.571  1.00 36.61  ? 112  ILE E O     1 
ATOM   3621  C  CB    . ILE E 1 113 ? 130.330 131.987 97.565  1.00 36.61  ? 112  ILE E CB    1 
ATOM   3622  C  CG1   . ILE E 1 113 ? 131.174 132.689 96.511  1.00 36.61  ? 112  ILE E CG1   1 
ATOM   3623  C  CG2   . ILE E 1 113 ? 131.243 131.111 98.419  1.00 36.61  ? 112  ILE E CG2   1 
ATOM   3624  C  CD1   . ILE E 1 113 ? 130.413 133.768 95.780  1.00 36.61  ? 112  ILE E CD1   1 
ATOM   3625  N  N     . HIS E 1 114 ? 129.151 128.839 97.477  1.00 36.27  ? 113  HIS E N     1 
ATOM   3626  C  CA    . HIS E 1 114 ? 129.332 127.413 97.220  1.00 36.27  ? 113  HIS E CA    1 
ATOM   3627  C  C     . HIS E 1 114 ? 128.567 126.956 95.981  1.00 36.27  ? 113  HIS E C     1 
ATOM   3628  O  O     . HIS E 1 114 ? 129.100 126.224 95.141  1.00 36.27  ? 113  HIS E O     1 
ATOM   3629  C  CB    . HIS E 1 114 ? 128.894 126.603 98.432  1.00 36.27  ? 113  HIS E CB    1 
ATOM   3630  C  CG    . HIS E 1 114 ? 129.093 125.137 98.260  1.00 36.27  ? 113  HIS E CG    1 
ATOM   3631  N  ND1   . HIS E 1 114 ? 130.332 124.548 98.356  1.00 36.27  ? 113  HIS E ND1   1 
ATOM   3632  C  CD2   . HIS E 1 114 ? 128.220 124.144 97.975  1.00 36.27  ? 113  HIS E CD2   1 
ATOM   3633  C  CE1   . HIS E 1 114 ? 130.214 123.251 98.146  1.00 36.27  ? 113  HIS E CE1   1 
ATOM   3634  N  NE2   . HIS E 1 114 ? 128.943 122.979 97.913  1.00 36.27  ? 113  HIS E NE2   1 
ATOM   3635  N  N     . ALA E 1 115 ? 127.316 127.390 95.848  1.00 38.05  ? 114  ALA E N     1 
ATOM   3636  C  CA    . ALA E 1 115 ? 126.406 126.991 94.778  1.00 38.05  ? 114  ALA E CA    1 
ATOM   3637  C  C     . ALA E 1 115 ? 126.663 127.690 93.439  1.00 38.05  ? 114  ALA E C     1 
ATOM   3638  O  O     . ALA E 1 115 ? 125.723 127.762 92.635  1.00 38.05  ? 114  ALA E O     1 
ATOM   3639  C  CB    . ALA E 1 115 ? 124.959 127.230 95.211  1.00 38.05  ? 114  ALA E CB    1 
ATOM   3640  N  N     . LYS E 1 116 ? 127.863 128.246 93.227  1.00 38.08  ? 115  LYS E N     1 
ATOM   3641  C  CA    . LYS E 1 116 ? 128.315 128.892 91.989  1.00 38.08  ? 115  LYS E CA    1 
ATOM   3642  C  C     . LYS E 1 116 ? 127.507 130.136 91.633  1.00 38.08  ? 115  LYS E C     1 
ATOM   3643  O  O     . LYS E 1 116 ? 127.473 130.543 90.468  1.00 38.08  ? 115  LYS E O     1 
ATOM   3644  C  CB    . LYS E 1 116 ? 128.310 127.916 90.803  1.00 38.08  ? 115  LYS E CB    1 
ATOM   3645  C  CG    . LYS E 1 116 ? 129.228 126.727 90.960  1.00 38.08  ? 115  LYS E CG    1 
ATOM   3646  C  CD    . LYS E 1 116 ? 129.168 125.843 89.730  1.00 38.08  ? 115  LYS E CD    1 
ATOM   3647  C  CE    . LYS E 1 116 ? 130.172 124.711 89.819  1.00 38.08  ? 115  LYS E CE    1 
ATOM   3648  N  NZ    . LYS E 1 116 ? 131.567 125.223 89.893  1.00 38.08  ? 115  LYS E NZ    1 
ATOM   3649  N  N     . ARG E 1 117 ? 126.854 130.755 92.606  1.00 43.24  ? 116  ARG E N     1 
ATOM   3650  C  CA    . ARG E 1 117 ? 126.178 132.026 92.411  1.00 43.24  ? 116  ARG E CA    1 
ATOM   3651  C  C     . ARG E 1 117 ? 126.866 133.086 93.257  1.00 43.24  ? 116  ARG E C     1 
ATOM   3652  O  O     . ARG E 1 117 ? 127.724 132.785 94.089  1.00 43.24  ? 116  ARG E O     1 
ATOM   3653  C  CB    . ARG E 1 117 ? 124.691 131.925 92.765  1.00 43.24  ? 116  ARG E CB    1 
ATOM   3654  C  CG    . ARG E 1 117 ? 123.909 131.036 91.821  1.00 43.24  ? 116  ARG E CG    1 
ATOM   3655  C  CD    . ARG E 1 117 ? 122.423 131.023 92.139  1.00 43.24  ? 116  ARG E CD    1 
ATOM   3656  N  NE    . ARG E 1 117 ? 122.077 130.173 93.271  1.00 43.24  ? 116  ARG E NE    1 
ATOM   3657  C  CZ    . ARG E 1 117 ? 121.846 130.626 94.498  1.00 43.24  ? 116  ARG E CZ    1 
ATOM   3658  N  NH1   . ARG E 1 117 ? 121.919 131.924 94.749  1.00 43.24  ? 116  ARG E NH1   1 
ATOM   3659  N  NH2   . ARG E 1 117 ? 121.530 129.783 95.470  1.00 43.24  ? 116  ARG E NH2   1 
ATOM   3660  N  N     . VAL E 1 118 ? 126.492 134.346 93.035  1.00 46.16  ? 117  VAL E N     1 
ATOM   3661  C  CA    . VAL E 1 118 ? 127.029 135.435 93.843  1.00 46.16  ? 117  VAL E CA    1 
ATOM   3662  C  C     . VAL E 1 118 ? 125.843 136.205 94.417  1.00 46.16  ? 117  VAL E C     1 
ATOM   3663  O  O     . VAL E 1 118 ? 126.007 137.228 95.088  1.00 46.16  ? 117  VAL E O     1 
ATOM   3664  C  CB    . VAL E 1 118 ? 127.948 136.368 93.020  1.00 46.16  ? 117  VAL E CB    1 
ATOM   3665  C  CG1   . VAL E 1 118 ? 128.993 137.026 93.902  1.00 46.16  ? 117  VAL E CG1   1 
ATOM   3666  C  CG2   . VAL E 1 118 ? 128.621 135.660 91.847  1.00 46.16  ? 117  VAL E CG2   1 
ATOM   3667  N  N     . THR E 1 119 ? 124.638 135.698 94.185  1.00 46.43  ? 118  THR E N     1 
ATOM   3668  C  CA    . THR E 1 119 ? 123.411 136.337 94.648  1.00 46.43  ? 118  THR E CA    1 
ATOM   3669  C  C     . THR E 1 119 ? 122.688 135.416 95.623  1.00 46.43  ? 118  THR E C     1 
ATOM   3670  O  O     . THR E 1 119 ? 122.265 134.319 95.243  1.00 46.43  ? 118  THR E O     1 
ATOM   3671  C  CB    . THR E 1 119 ? 122.514 136.688 93.464  1.00 46.43  ? 118  THR E CB    1 
ATOM   3672  O  OG1   . THR E 1 119 ? 123.277 137.416 92.495  1.00 46.43  ? 118  THR E OG1   1 
ATOM   3673  C  CG2   . THR E 1 119 ? 121.346 137.537 93.918  1.00 46.43  ? 118  THR E CG2   1 
ATOM   3674  N  N     . ILE E 1 120 ? 122.560 135.853 96.878  1.00 37.84  ? 119  ILE E N     1 
ATOM   3675  C  CA    . ILE E 1 120 ? 121.829 135.082 97.877  1.00 37.84  ? 119  ILE E CA    1 
ATOM   3676  C  C     . ILE E 1 120 ? 120.341 135.073 97.543  1.00 37.84  ? 119  ILE E C     1 
ATOM   3677  O  O     . ILE E 1 120 ? 119.814 136.006 96.923  1.00 37.84  ? 119  ILE E O     1 
ATOM   3678  C  CB    . ILE E 1 120 ? 122.091 135.619 99.294  1.00 37.84  ? 119  ILE E CB    1 
ATOM   3679  C  CG1   . ILE E 1 120 ? 121.490 137.005 99.491  1.00 37.84  ? 119  ILE E CG1   1 
ATOM   3680  C  CG2   . ILE E 1 120 ? 123.582 135.681 99.557  1.00 37.84  ? 119  ILE E CG2   1 
ATOM   3681  C  CD1   . ILE E 1 120 ? 121.608 137.510 100.903 1.00 37.84  ? 119  ILE E CD1   1 
ATOM   3682  N  N     . MET E 1 121 ? 119.673 133.984 97.894  1.00 40.89  ? 120  MET E N     1 
ATOM   3683  C  CA    . MET E 1 121 ? 118.262 133.746 97.638  1.00 40.89  ? 120  MET E CA    1 
ATOM   3684  C  C     . MET E 1 121 ? 117.621 133.259 98.930  1.00 40.89  ? 120  MET E C     1 
ATOM   3685  O  O     . MET E 1 121 ? 118.338 132.933 99.881  1.00 40.89  ? 120  MET E O     1 
ATOM   3686  C  CB    . MET E 1 121 ? 118.105 132.706 96.514  1.00 40.89  ? 120  MET E CB    1 
ATOM   3687  C  CG    . MET E 1 121 ? 118.603 133.171 95.154  1.00 40.89  ? 120  MET E CG    1 
ATOM   3688  S  SD    . MET E 1 121 ? 118.588 131.857 93.924  1.00 40.89  ? 120  MET E SD    1 
ATOM   3689  C  CE    . MET E 1 121 ? 116.898 131.282 94.079  1.00 40.89  ? 120  MET E CE    1 
ATOM   3690  N  N     . PRO E 1 122 ? 116.273 133.308 99.045  1.00 39.36  ? 121  PRO E N     1 
ATOM   3691  C  CA    . PRO E 1 122 ? 115.608 132.792 100.266 1.00 39.36  ? 121  PRO E CA    1 
ATOM   3692  C  C     . PRO E 1 122 ? 115.962 131.362 100.642 1.00 39.36  ? 121  PRO E C     1 
ATOM   3693  O  O     . PRO E 1 122 ? 116.062 131.043 101.838 1.00 39.36  ? 121  PRO E O     1 
ATOM   3694  C  CB    . PRO E 1 122 ? 114.121 132.924 99.923  1.00 39.36  ? 121  PRO E CB    1 
ATOM   3695  C  CG    . PRO E 1 122 ? 114.065 134.074 99.037  1.00 39.36  ? 121  PRO E CG    1 
ATOM   3696  C  CD    . PRO E 1 122 ? 115.310 134.050 98.206  1.00 39.36  ? 121  PRO E CD    1 
ATOM   3697  N  N     . LYS E 1 123 ? 116.102 130.492 99.635  1.00 43.02  ? 122  LYS E N     1 
ATOM   3698  C  CA    . LYS E 1 123 ? 116.536 129.112 99.839  1.00 43.02  ? 122  LYS E CA    1 
ATOM   3699  C  C     . LYS E 1 123 ? 117.863 129.036 100.583 1.00 43.02  ? 122  LYS E C     1 
ATOM   3700  O  O     . LYS E 1 123 ? 118.071 128.135 101.400 1.00 43.02  ? 122  LYS E O     1 
ATOM   3701  C  CB    . LYS E 1 123 ? 116.649 128.400 98.491  1.00 43.02  ? 122  LYS E CB    1 
ATOM   3702  C  CG    . LYS E 1 123 ? 115.537 128.738 97.516  1.00 43.02  ? 122  LYS E CG    1 
ATOM   3703  C  CD    . LYS E 1 123 ? 114.218 128.147 97.971  1.00 43.02  ? 122  LYS E CD    1 
ATOM   3704  C  CE    . LYS E 1 123 ? 113.090 128.523 97.030  1.00 43.02  ? 122  LYS E CE    1 
ATOM   3705  N  NZ    . LYS E 1 123 ? 111.798 127.923 97.461  1.00 43.02  ? 122  LYS E NZ    1 
ATOM   3706  N  N     . ASP E 1 124 ? 118.771 129.976 100.305 1.00 39.85  ? 123  ASP E N     1 
ATOM   3707  C  CA    . ASP E 1 124 ? 120.078 129.992 100.953 1.00 39.85  ? 123  ASP E CA    1 
ATOM   3708  C  C     . ASP E 1 124 ? 119.961 130.255 102.454 1.00 39.85  ? 123  ASP E C     1 
ATOM   3709  O  O     . ASP E 1 124 ? 120.602 129.576 103.267 1.00 39.85  ? 123  ASP E O     1 
ATOM   3710  C  CB    . ASP E 1 124 ? 120.948 131.050 100.287 1.00 39.85  ? 123  ASP E CB    1 
ATOM   3711  C  CG    . ASP E 1 124 ? 121.166 130.767 98.822  1.00 39.85  ? 123  ASP E CG    1 
ATOM   3712  O  OD1   . ASP E 1 124 ? 120.328 130.057 98.236  1.00 39.85  ? 123  ASP E OD1   1 
ATOM   3713  O  OD2   . ASP E 1 124 ? 122.157 131.252 98.248  1.00 39.85  ? 123  ASP E OD2   1 
ATOM   3714  N  N     . ILE E 1 125 ? 119.140 131.240 102.839 1.00 36.22  ? 124  ILE E N     1 
ATOM   3715  C  CA    . ILE E 1 125 ? 118.917 131.535 104.256 1.00 36.22  ? 124  ILE E CA    1 
ATOM   3716  C  C     . ILE E 1 125 ? 118.208 130.373 104.945 1.00 36.22  ? 124  ILE E C     1 
ATOM   3717  O  O     . ILE E 1 125 ? 118.543 130.012 106.083 1.00 36.22  ? 124  ILE E O     1 
ATOM   3718  C  CB    . ILE E 1 125 ? 118.146 132.862 104.412 1.00 36.22  ? 124  ILE E CB    1 
ATOM   3719  C  CG1   . ILE E 1 125 ? 119.011 134.028 103.945 1.00 36.22  ? 124  ILE E CG1   1 
ATOM   3720  C  CG2   . ILE E 1 125 ? 117.707 133.101 105.850 1.00 36.22  ? 124  ILE E CG2   1 
ATOM   3721  C  CD1   . ILE E 1 125 ? 118.368 135.379 104.128 1.00 36.22  ? 124  ILE E CD1   1 
ATOM   3722  N  N     . GLN E 1 126 ? 117.238 129.751 104.257 1.00 36.07  ? 125  GLN E N     1 
ATOM   3723  C  CA    . GLN E 1 126 ? 116.536 128.610 104.844 1.00 36.07  ? 125  GLN E CA    1 
ATOM   3724  C  C     . GLN E 1 126 ? 117.476 127.427 105.044 1.00 36.07  ? 125  GLN E C     1 
ATOM   3725  O  O     . GLN E 1 126 ? 117.387 126.724 106.058 1.00 36.07  ? 125  GLN E O     1 
ATOM   3726  C  CB    . GLN E 1 126 ? 115.339 128.214 103.985 1.00 36.07  ? 125  GLN E CB    1 
ATOM   3727  C  CG    . GLN E 1 126 ? 114.243 129.259 103.955 1.00 36.07  ? 125  GLN E CG    1 
ATOM   3728  C  CD    . GLN E 1 126 ? 113.376 129.160 102.722 1.00 36.07  ? 125  GLN E CD    1 
ATOM   3729  O  OE1   . GLN E 1 126 ? 113.655 128.381 101.813 1.00 36.07  ? 125  GLN E OE1   1 
ATOM   3730  N  NE2   . GLN E 1 126 ? 112.311 129.949 102.685 1.00 36.07  ? 125  GLN E NE2   1 
ATOM   3731  N  N     . LEU E 1 127 ? 118.402 127.219 104.103 1.00 36.79  ? 126  LEU E N     1 
ATOM   3732  C  CA    . LEU E 1 127 ? 119.417 126.182 104.250 1.00 36.79  ? 126  LEU E CA    1 
ATOM   3733  C  C     . LEU E 1 127 ? 120.340 126.479 105.426 1.00 36.79  ? 126  LEU E C     1 
ATOM   3734  O  O     . LEU E 1 127 ? 120.690 125.570 106.189 1.00 36.79  ? 126  LEU E O     1 
ATOM   3735  C  CB    . LEU E 1 127 ? 120.234 126.066 102.967 1.00 36.79  ? 126  LEU E CB    1 
ATOM   3736  C  CG    . LEU E 1 127 ? 121.382 125.061 103.017 1.00 36.79  ? 126  LEU E CG    1 
ATOM   3737  C  CD1   . LEU E 1 127 ? 120.846 123.670 103.299 1.00 36.79  ? 126  LEU E CD1   1 
ATOM   3738  C  CD2   . LEU E 1 127 ? 122.211 125.092 101.757 1.00 36.79  ? 126  LEU E CD2   1 
ATOM   3739  N  N     . ALA E 1 128 ? 120.763 127.744 105.561 1.00 34.20  ? 127  ALA E N     1 
ATOM   3740  C  CA    . ALA E 1 128 ? 121.615 128.163 106.675 1.00 34.20  ? 127  ALA E CA    1 
ATOM   3741  C  C     . ALA E 1 128 ? 120.951 127.885 108.020 1.00 34.20  ? 127  ALA E C     1 
ATOM   3742  O  O     . ALA E 1 128 ? 121.580 127.341 108.938 1.00 34.20  ? 127  ALA E O     1 
ATOM   3743  C  CB    . ALA E 1 128 ? 121.954 129.644 106.541 1.00 34.20  ? 127  ALA E CB    1 
ATOM   3744  N  N     . ARG E 1 129 ? 119.679 128.266 108.152 1.00 34.11  ? 128  ARG E N     1 
ATOM   3745  C  CA    . ARG E 1 129 ? 118.948 128.029 109.394 1.00 34.11  ? 128  ARG E CA    1 
ATOM   3746  C  C     . ARG E 1 129 ? 118.729 126.543 109.646 1.00 34.11  ? 128  ARG E C     1 
ATOM   3747  O  O     . ARG E 1 129 ? 118.710 126.108 110.803 1.00 34.11  ? 128  ARG E O     1 
ATOM   3748  C  CB    . ARG E 1 129 ? 117.608 128.753 109.364 1.00 34.11  ? 128  ARG E CB    1 
ATOM   3749  C  CG    . ARG E 1 129 ? 117.718 130.241 109.267 1.00 34.11  ? 128  ARG E CG    1 
ATOM   3750  C  CD    . ARG E 1 129 ? 116.352 130.869 109.291 1.00 34.11  ? 128  ARG E CD    1 
ATOM   3751  N  NE    . ARG E 1 129 ? 115.607 130.585 110.512 1.00 34.11  ? 128  ARG E NE    1 
ATOM   3752  C  CZ    . ARG E 1 129 ? 114.399 130.030 110.533 1.00 34.11  ? 128  ARG E CZ    1 
ATOM   3753  N  NH1   . ARG E 1 129 ? 113.797 129.709 109.397 1.00 34.11  ? 128  ARG E NH1   1 
ATOM   3754  N  NH2   . ARG E 1 129 ? 113.787 129.806 111.688 1.00 34.11  ? 128  ARG E NH2   1 
ATOM   3755  N  N     . ARG E 1 130 ? 118.507 125.764 108.583 1.00 33.08  ? 129  ARG E N     1 
ATOM   3756  C  CA    . ARG E 1 130 ? 118.343 124.321 108.730 1.00 33.08  ? 129  ARG E CA    1 
ATOM   3757  C  C     . ARG E 1 130 ? 119.613 123.671 109.272 1.00 33.08  ? 129  ARG E C     1 
ATOM   3758  O  O     . ARG E 1 130 ? 119.558 122.868 110.210 1.00 33.08  ? 129  ARG E O     1 
ATOM   3759  C  CB    . ARG E 1 130 ? 117.946 123.704 107.390 1.00 33.08  ? 129  ARG E CB    1 
ATOM   3760  C  CG    . ARG E 1 130 ? 118.006 122.193 107.351 1.00 33.08  ? 129  ARG E CG    1 
ATOM   3761  C  CD    . ARG E 1 130 ? 116.976 121.600 108.306 1.00 33.08  ? 129  ARG E CD    1 
ATOM   3762  N  NE    . ARG E 1 130 ? 116.926 120.142 108.266 1.00 33.08  ? 129  ARG E NE    1 
ATOM   3763  C  CZ    . ARG E 1 130 ? 117.753 119.341 108.928 1.00 33.08  ? 129  ARG E CZ    1 
ATOM   3764  N  NH1   . ARG E 1 130 ? 118.708 119.848 109.695 1.00 33.08  ? 129  ARG E NH1   1 
ATOM   3765  N  NH2   . ARG E 1 130 ? 117.622 118.026 108.825 1.00 33.08  ? 129  ARG E NH2   1 
ATOM   3766  N  N     . ILE E 1 131 ? 120.764 123.989 108.673 1.00 30.71  ? 130  ILE E N     1 
ATOM   3767  C  CA    . ILE E 1 131 ? 122.032 123.411 109.120 1.00 30.71  ? 130  ILE E CA    1 
ATOM   3768  C  C     . ILE E 1 131 ? 122.414 123.898 110.514 1.00 30.71  ? 130  ILE E C     1 
ATOM   3769  O  O     . ILE E 1 131 ? 122.960 123.131 111.317 1.00 30.71  ? 130  ILE E O     1 
ATOM   3770  C  CB    . ILE E 1 131 ? 123.131 123.720 108.091 1.00 30.71  ? 130  ILE E CB    1 
ATOM   3771  C  CG1   . ILE E 1 131 ? 122.740 123.151 106.743 1.00 30.71  ? 130  ILE E CG1   1 
ATOM   3772  C  CG2   . ILE E 1 131 ? 124.452 123.081 108.483 1.00 30.71  ? 130  ILE E CG2   1 
ATOM   3773  C  CD1   . ILE E 1 131 ? 123.710 123.496 105.686 1.00 30.71  ? 130  ILE E CD1   1 
ATOM   3774  N  N     . ARG E 1 132 ? 122.100 125.154 110.849 1.00 33.13  ? 131  ARG E N     1 
ATOM   3775  C  CA    . ARG E 1 132 ? 122.407 125.660 112.185 1.00 33.13  ? 131  ARG E CA    1 
ATOM   3776  C  C     . ARG E 1 132 ? 121.572 125.000 113.275 1.00 33.13  ? 131  ARG E C     1 
ATOM   3777  O  O     . ARG E 1 132 ? 121.958 125.049 114.447 1.00 33.13  ? 131  ARG E O     1 
ATOM   3778  C  CB    . ARG E 1 132 ? 122.209 127.171 112.243 1.00 33.13  ? 131  ARG E CB    1 
ATOM   3779  C  CG    . ARG E 1 132 ? 123.361 127.986 111.701 1.00 33.13  ? 131  ARG E CG    1 
ATOM   3780  C  CD    . ARG E 1 132 ? 123.131 129.446 112.014 1.00 33.13  ? 131  ARG E CD    1 
ATOM   3781  N  NE    . ARG E 1 132 ? 124.277 130.279 111.680 1.00 33.13  ? 131  ARG E NE    1 
ATOM   3782  C  CZ    . ARG E 1 132 ? 124.423 131.531 112.096 1.00 33.13  ? 131  ARG E CZ    1 
ATOM   3783  N  NH1   . ARG E 1 132 ? 123.496 132.084 112.867 1.00 33.13  ? 131  ARG E NH1   1 
ATOM   3784  N  NH2   . ARG E 1 132 ? 125.495 132.230 111.749 1.00 33.13  ? 131  ARG E NH2   1 
ATOM   3785  N  N     . GLY E 1 133 ? 120.445 124.393 112.920 1.00 37.48  ? 132  GLY E N     1 
ATOM   3786  C  CA    . GLY E 1 133 ? 119.577 123.768 113.893 1.00 37.48  ? 132  GLY E CA    1 
ATOM   3787  C  C     . GLY E 1 133 ? 118.504 124.660 114.466 1.00 37.48  ? 132  GLY E C     1 
ATOM   3788  O  O     . GLY E 1 133 ? 117.905 124.303 115.485 1.00 37.48  ? 132  GLY E O     1 
ATOM   3789  N  N     . GLU E 1 134 ? 118.238 125.808 113.847 1.00 38.34  ? 133  GLU E N     1 
ATOM   3790  C  CA    . GLU E 1 134 ? 117.168 126.679 114.308 1.00 38.34  ? 133  GLU E CA    1 
ATOM   3791  C  C     . GLU E 1 134 ? 115.823 126.347 113.681 1.00 38.34  ? 133  GLU E C     1 
ATOM   3792  O  O     . GLU E 1 134 ? 114.833 127.024 113.977 1.00 38.34  ? 133  GLU E O     1 
ATOM   3793  C  CB    . GLU E 1 134 ? 117.515 128.144 114.026 1.00 38.34  ? 133  GLU E CB    1 
ATOM   3794  C  CG    . GLU E 1 134 ? 118.778 128.622 114.719 1.00 38.34  ? 133  GLU E CG    1 
ATOM   3795  C  CD    . GLU E 1 134 ? 119.119 130.060 114.384 1.00 38.34  ? 133  GLU E CD    1 
ATOM   3796  O  OE1   . GLU E 1 134 ? 118.341 130.702 113.649 1.00 38.34  ? 133  GLU E OE1   1 
ATOM   3797  O  OE2   . GLU E 1 134 ? 120.163 130.550 114.861 1.00 38.34  ? 133  GLU E OE2   1 
ATOM   3798  N  N     . ARG E 1 135 ? 115.763 125.328 112.831 1.00 38.53  ? 134  ARG E N     1 
ATOM   3799  C  CA    . ARG E 1 135 ? 114.521 124.957 112.166 1.00 38.53  ? 134  ARG E CA    1 
ATOM   3800  C  C     . ARG E 1 135 ? 114.210 123.478 112.368 1.00 38.53  ? 134  ARG E C     1 
ATOM   3801  O  O     . ARG E 1 135 ? 114.259 122.689 111.425 1.00 38.53  ? 134  ARG E O     1 
ATOM   3802  C  CB    . ARG E 1 135 ? 114.601 125.277 110.674 1.00 38.53  ? 134  ARG E CB    1 
ATOM   3803  C  CG    . ARG E 1 135 ? 113.305 125.788 110.076 1.00 38.53  ? 134  ARG E CG    1 
ATOM   3804  C  CD    . ARG E 1 135 ? 113.537 126.347 108.683 1.00 38.53  ? 134  ARG E CD    1 
ATOM   3805  N  NE    . ARG E 1 135 ? 114.062 125.336 107.771 1.00 38.53  ? 134  ARG E NE    1 
ATOM   3806  C  CZ    . ARG E 1 135 ? 113.357 124.772 106.797 1.00 38.53  ? 134  ARG E CZ    1 
ATOM   3807  N  NH1   . ARG E 1 135 ? 112.093 125.122 106.604 1.00 38.53  ? 134  ARG E NH1   1 
ATOM   3808  N  NH2   . ARG E 1 135 ? 113.914 123.859 106.014 1.00 38.53  ? 134  ARG E NH2   1 
ATOM   3809  N  N     . ASP F 2 25  ? 101.466 147.531 111.976 1.00 47.55  ? 24   ASP F N     1 
ATOM   3810  C  CA    . ASP F 2 25  ? 102.615 146.892 111.353 1.00 47.55  ? 24   ASP F CA    1 
ATOM   3811  C  C     . ASP F 2 25  ? 103.878 147.722 111.555 1.00 47.55  ? 24   ASP F C     1 
ATOM   3812  O  O     . ASP F 2 25  ? 103.921 148.919 111.260 1.00 47.55  ? 24   ASP F O     1 
ATOM   3813  C  CB    . ASP F 2 25  ? 102.364 146.635 109.861 1.00 47.55  ? 24   ASP F CB    1 
ATOM   3814  C  CG    . ASP F 2 25  ? 101.823 147.851 109.125 1.00 47.55  ? 24   ASP F CG    1 
ATOM   3815  O  OD1   . ASP F 2 25  ? 101.532 148.882 109.765 1.00 47.55  ? 24   ASP F OD1   1 
ATOM   3816  O  OD2   . ASP F 2 25  ? 101.687 147.770 107.887 1.00 47.55  ? 24   ASP F OD2   1 
ATOM   3817  N  N     . ASN F 2 26  ? 104.909 147.074 112.091 1.00 41.39  ? 25   ASN F N     1 
ATOM   3818  C  CA    . ASN F 2 26  ? 106.174 147.757 112.312 1.00 41.39  ? 25   ASN F CA    1 
ATOM   3819  C  C     . ASN F 2 26  ? 107.373 146.930 111.882 1.00 41.39  ? 25   ASN F C     1 
ATOM   3820  O  O     . ASN F 2 26  ? 108.488 147.459 111.875 1.00 41.39  ? 25   ASN F O     1 
ATOM   3821  C  CB    . ASN F 2 26  ? 106.306 148.149 113.791 1.00 41.39  ? 25   ASN F CB    1 
ATOM   3822  C  CG    . ASN F 2 26  ? 107.289 149.277 114.022 1.00 41.39  ? 25   ASN F CG    1 
ATOM   3823  O  OD1   . ASN F 2 26  ? 108.488 149.066 114.192 1.00 41.39  ? 25   ASN F OD1   1 
ATOM   3824  N  ND2   . ASN F 2 26  ? 106.779 150.497 113.983 1.00 41.39  ? 25   ASN F ND2   1 
ATOM   3825  N  N     . ILE F 2 27  ? 107.184 145.664 111.492 1.00 38.15  ? 26   ILE F N     1 
ATOM   3826  C  CA    . ILE F 2 27  ? 108.289 144.845 111.005 1.00 38.15  ? 26   ILE F CA    1 
ATOM   3827  C  C     . ILE F 2 27  ? 108.855 145.398 109.699 1.00 38.15  ? 26   ILE F C     1 
ATOM   3828  O  O     . ILE F 2 27  ? 110.042 145.210 109.410 1.00 38.15  ? 26   ILE F O     1 
ATOM   3829  C  CB    . ILE F 2 27  ? 107.821 143.379 110.879 1.00 38.15  ? 26   ILE F CB    1 
ATOM   3830  C  CG1   . ILE F 2 27  ? 108.997 142.437 110.624 1.00 38.15  ? 26   ILE F CG1   1 
ATOM   3831  C  CG2   . ILE F 2 27  ? 106.756 143.228 109.802 1.00 38.15  ? 26   ILE F CG2   1 
ATOM   3832  C  CD1   . ILE F 2 27  ? 110.041 142.470 111.705 1.00 38.15  ? 26   ILE F CD1   1 
ATOM   3833  N  N     . GLN F 2 28  ? 108.068 146.174 108.953 1.00 37.60  ? 27   GLN F N     1 
ATOM   3834  C  CA    . GLN F 2 28  ? 108.564 146.838 107.760 1.00 37.60  ? 27   GLN F CA    1 
ATOM   3835  C  C     . GLN F 2 28  ? 109.360 148.091 108.093 1.00 37.60  ? 27   GLN F C     1 
ATOM   3836  O  O     . GLN F 2 28  ? 109.931 148.704 107.185 1.00 37.60  ? 27   GLN F O     1 
ATOM   3837  C  CB    . GLN F 2 28  ? 107.404 147.190 106.828 1.00 37.60  ? 27   GLN F CB    1 
ATOM   3838  C  CG    . GLN F 2 28  ? 106.754 145.989 106.162 1.00 37.60  ? 27   GLN F CG    1 
ATOM   3839  C  CD    . GLN F 2 28  ? 107.719 145.198 105.301 1.00 37.60  ? 27   GLN F CD    1 
ATOM   3840  O  OE1   . GLN F 2 28  ? 108.508 145.765 104.547 1.00 37.60  ? 27   GLN F OE1   1 
ATOM   3841  N  NE2   . GLN F 2 28  ? 107.647 143.877 105.397 1.00 37.60  ? 27   GLN F NE2   1 
ATOM   3842  N  N     . GLY F 2 29  ? 109.405 148.486 109.368 1.00 40.46  ? 28   GLY F N     1 
ATOM   3843  C  CA    . GLY F 2 29  ? 110.245 149.591 109.787 1.00 40.46  ? 28   GLY F CA    1 
ATOM   3844  C  C     . GLY F 2 29  ? 111.724 149.286 109.707 1.00 40.46  ? 28   GLY F C     1 
ATOM   3845  O  O     . GLY F 2 29  ? 112.536 150.214 109.642 1.00 40.46  ? 28   GLY F O     1 
ATOM   3846  N  N     . ILE F 2 30  ? 112.094 148.009 109.715 1.00 36.65  ? 29   ILE F N     1 
ATOM   3847  C  CA    . ILE F 2 30  ? 113.472 147.620 109.450 1.00 36.65  ? 29   ILE F CA    1 
ATOM   3848  C  C     . ILE F 2 30  ? 113.576 147.618 107.935 1.00 36.65  ? 29   ILE F C     1 
ATOM   3849  O  O     . ILE F 2 30  ? 113.366 146.588 107.286 1.00 36.65  ? 29   ILE F O     1 
ATOM   3850  C  CB    . ILE F 2 30  ? 113.831 146.257 110.064 1.00 36.65  ? 29   ILE F CB    1 
ATOM   3851  C  CG1   . ILE F 2 30  ? 113.438 146.201 111.539 1.00 36.65  ? 29   ILE F CG1   1 
ATOM   3852  C  CG2   . ILE F 2 30  ? 115.317 145.997 109.938 1.00 36.65  ? 29   ILE F CG2   1 
ATOM   3853  C  CD1   . ILE F 2 30  ? 113.950 147.355 112.386 1.00 36.65  ? 29   ILE F CD1   1 
ATOM   3854  N  N     . THR F 2 31  ? 113.867 148.790 107.375 1.00 46.47  ? 30   THR F N     1 
ATOM   3855  C  CA    . THR F 2 31  ? 113.723 149.062 105.955 1.00 46.47  ? 30   THR F CA    1 
ATOM   3856  C  C     . THR F 2 31  ? 114.709 148.258 105.107 1.00 46.47  ? 30   THR F C     1 
ATOM   3857  O  O     . THR F 2 31  ? 115.712 147.730 105.596 1.00 46.47  ? 30   THR F O     1 
ATOM   3858  C  CB    . THR F 2 31  ? 113.897 150.554 105.697 1.00 46.47  ? 30   THR F CB    1 
ATOM   3859  O  OG1   . THR F 2 31  ? 113.747 150.815 104.301 1.00 46.47  ? 30   THR F OG1   1 
ATOM   3860  C  CG2   . THR F 2 31  ? 115.267 151.009 106.157 1.00 46.47  ? 30   THR F CG2   1 
ATOM   3861  N  N     . LYS F 2 32  ? 114.384 148.169 103.814 1.00 42.03  ? 31   LYS F N     1 
ATOM   3862  C  CA    . LYS F 2 32  ? 115.204 147.438 102.846 1.00 42.03  ? 31   LYS F CA    1 
ATOM   3863  C  C     . LYS F 2 32  ? 116.652 147.930 102.724 1.00 42.03  ? 31   LYS F C     1 
ATOM   3864  O  O     . LYS F 2 32  ? 117.547 147.067 102.650 1.00 42.03  ? 31   LYS F O     1 
ATOM   3865  C  CB    . LYS F 2 32  ? 114.447 147.381 101.508 1.00 42.03  ? 31   LYS F CB    1 
ATOM   3866  C  CG    . LYS F 2 32  ? 115.301 147.251 100.267 1.00 42.03  ? 31   LYS F CG    1 
ATOM   3867  C  CD    . LYS F 2 32  ? 114.428 147.237 99.025  1.00 42.03  ? 31   LYS F CD    1 
ATOM   3868  C  CE    . LYS F 2 32  ? 113.693 148.551 98.848  1.00 42.03  ? 31   LYS F CE    1 
ATOM   3869  N  NZ    . LYS F 2 32  ? 112.851 148.542 97.623  1.00 42.03  ? 31   LYS F NZ    1 
ATOM   3870  N  N     . PRO F 2 33  ? 116.965 149.244 102.624 1.00 46.48  ? 32   PRO F N     1 
ATOM   3871  C  CA    . PRO F 2 33  ? 118.386 149.650 102.703 1.00 46.48  ? 32   PRO F CA    1 
ATOM   3872  C  C     . PRO F 2 33  ? 119.118 149.198 103.960 1.00 46.48  ? 32   PRO F C     1 
ATOM   3873  O  O     . PRO F 2 33  ? 120.301 148.854 103.879 1.00 46.48  ? 32   PRO F O     1 
ATOM   3874  C  CB    . PRO F 2 33  ? 118.317 151.175 102.601 1.00 46.48  ? 32   PRO F CB    1 
ATOM   3875  C  CG    . PRO F 2 33  ? 117.141 151.431 101.814 1.00 46.48  ? 32   PRO F CG    1 
ATOM   3876  C  CD    . PRO F 2 33  ? 116.144 150.394 102.191 1.00 46.48  ? 32   PRO F CD    1 
ATOM   3877  N  N     . ALA F 2 34  ? 118.470 149.265 105.129 1.00 44.40  ? 33   ALA F N     1 
ATOM   3878  C  CA    . ALA F 2 34  ? 119.092 148.789 106.364 1.00 44.40  ? 33   ALA F CA    1 
ATOM   3879  C  C     . ALA F 2 34  ? 119.413 147.301 106.290 1.00 44.40  ? 33   ALA F C     1 
ATOM   3880  O  O     . ALA F 2 34  ? 120.479 146.867 106.744 1.00 44.40  ? 33   ALA F O     1 
ATOM   3881  C  CB    . ALA F 2 34  ? 118.186 149.081 107.557 1.00 44.40  ? 33   ALA F CB    1 
ATOM   3882  N  N     . ILE F 2 35  ? 118.499 146.507 105.723 1.00 38.60  ? 34   ILE F N     1 
ATOM   3883  C  CA    . ILE F 2 35  ? 118.731 145.076 105.543 1.00 38.60  ? 34   ILE F CA    1 
ATOM   3884  C  C     . ILE F 2 35  ? 119.888 144.848 104.580 1.00 38.60  ? 34   ILE F C     1 
ATOM   3885  O  O     . ILE F 2 35  ? 120.723 143.950 104.780 1.00 38.60  ? 34   ILE F O     1 
ATOM   3886  C  CB    . ILE F 2 35  ? 117.433 144.403 105.058 1.00 38.60  ? 34   ILE F CB    1 
ATOM   3887  C  CG1   . ILE F 2 35  ? 116.347 144.531 106.126 1.00 38.60  ? 34   ILE F CG1   1 
ATOM   3888  C  CG2   . ILE F 2 35  ? 117.654 142.944 104.712 1.00 38.60  ? 34   ILE F CG2   1 
ATOM   3889  C  CD1   . ILE F 2 35  ? 115.001 143.985 105.704 1.00 38.60  ? 34   ILE F CD1   1 
ATOM   3890  N  N     . ARG F 2 36  ? 119.968 145.682 103.537 1.00 41.46  ? 35   ARG F N     1 
ATOM   3891  C  CA    . ARG F 2 36  ? 121.097 145.644 102.615 1.00 41.46  ? 35   ARG F CA    1 
ATOM   3892  C  C     . ARG F 2 36  ? 122.410 145.927 103.335 1.00 41.46  ? 35   ARG F C     1 
ATOM   3893  O  O     . ARG F 2 36  ? 123.395 145.221 103.122 1.00 41.46  ? 35   ARG F O     1 
ATOM   3894  C  CB    . ARG F 2 36  ? 120.879 146.632 101.469 1.00 41.46  ? 35   ARG F CB    1 
ATOM   3895  C  CG    . ARG F 2 36  ? 121.927 146.542 100.374 1.00 41.46  ? 35   ARG F CG    1 
ATOM   3896  C  CD    . ARG F 2 36  ? 121.560 147.402 99.183  1.00 41.46  ? 35   ARG F CD    1 
ATOM   3897  N  NE    . ARG F 2 36  ? 120.253 147.043 98.646  1.00 41.46  ? 35   ARG F NE    1 
ATOM   3898  C  CZ    . ARG F 2 36  ? 119.500 147.851 97.909  1.00 41.46  ? 35   ARG F CZ    1 
ATOM   3899  N  NH1   . ARG F 2 36  ? 119.924 149.072 97.617  1.00 41.46  ? 35   ARG F NH1   1 
ATOM   3900  N  NH2   . ARG F 2 36  ? 118.322 147.439 97.463  1.00 41.46  ? 35   ARG F NH2   1 
ATOM   3901  N  N     . ARG F 2 37  ? 122.438 146.970 104.177 1.00 42.07  ? 36   ARG F N     1 
ATOM   3902  C  CA    . ARG F 2 37  ? 123.619 147.298 104.984 1.00 42.07  ? 36   ARG F CA    1 
ATOM   3903  C  C     . ARG F 2 37  ? 124.031 146.146 105.894 1.00 42.07  ? 36   ARG F C     1 
ATOM   3904  O  O     . ARG F 2 37  ? 125.230 145.888 106.081 1.00 42.07  ? 36   ARG F O     1 
ATOM   3905  C  CB    . ARG F 2 37  ? 123.371 148.556 105.812 1.00 42.07  ? 36   ARG F CB    1 
ATOM   3906  C  CG    . ARG F 2 37  ? 123.235 149.820 105.003 1.00 42.07  ? 36   ARG F CG    1 
ATOM   3907  C  CD    . ARG F 2 37  ? 123.341 151.035 105.899 1.00 42.07  ? 36   ARG F CD    1 
ATOM   3908  N  NE    . ARG F 2 37  ? 122.179 151.175 106.765 1.00 42.07  ? 36   ARG F NE    1 
ATOM   3909  C  CZ    . ARG F 2 37  ? 121.097 151.869 106.440 1.00 42.07  ? 36   ARG F CZ    1 
ATOM   3910  N  NH1   . ARG F 2 37  ? 121.035 152.482 105.268 1.00 42.07  ? 36   ARG F NH1   1 
ATOM   3911  N  NH2   . ARG F 2 37  ? 120.079 151.953 107.282 1.00 42.07  ? 36   ARG F NH2   1 
ATOM   3912  N  N     . LEU F 2 38  ? 123.047 145.498 106.527 1.00 37.91  ? 37   LEU F N     1 
ATOM   3913  C  CA    . LEU F 2 38  ? 123.308 144.313 107.344 1.00 37.91  ? 37   LEU F CA    1 
ATOM   3914  C  C     . LEU F 2 38  ? 123.993 143.227 106.530 1.00 37.91  ? 37   LEU F C     1 
ATOM   3915  O  O     . LEU F 2 38  ? 124.954 142.602 106.992 1.00 37.91  ? 37   LEU F O     1 
ATOM   3916  C  CB    . LEU F 2 38  ? 122.009 143.782 107.940 1.00 37.91  ? 37   LEU F CB    1 
ATOM   3917  C  CG    . LEU F 2 38  ? 121.396 144.640 109.034 1.00 37.91  ? 37   LEU F CG    1 
ATOM   3918  C  CD1   . LEU F 2 38  ? 120.013 144.133 109.380 1.00 37.91  ? 37   LEU F CD1   1 
ATOM   3919  C  CD2   . LEU F 2 38  ? 122.300 144.628 110.241 1.00 37.91  ? 37   LEU F CD2   1 
ATOM   3920  N  N     . ALA F 2 39  ? 123.480 142.964 105.327 1.00 37.40  ? 38   ALA F N     1 
ATOM   3921  C  CA    . ALA F 2 39  ? 124.132 142.013 104.432 1.00 37.40  ? 38   ALA F CA    1 
ATOM   3922  C  C     . ALA F 2 39  ? 125.527 142.484 104.027 1.00 37.40  ? 38   ALA F C     1 
ATOM   3923  O  O     . ALA F 2 39  ? 126.429 141.662 103.831 1.00 37.40  ? 38   ALA F O     1 
ATOM   3924  C  CB    . ALA F 2 39  ? 123.269 141.781 103.200 1.00 37.40  ? 38   ALA F CB    1 
ATOM   3925  N  N     . ARG F 2 40  ? 125.702 143.799 103.858 1.00 38.78  ? 39   ARG F N     1 
ATOM   3926  C  CA    . ARG F 2 40  ? 126.999 144.371 103.491 1.00 38.78  ? 39   ARG F CA    1 
ATOM   3927  C  C     . ARG F 2 40  ? 128.048 144.096 104.558 1.00 38.78  ? 39   ARG F C     1 
ATOM   3928  O  O     . ARG F 2 40  ? 129.207 143.810 104.241 1.00 38.78  ? 39   ARG F O     1 
ATOM   3929  C  CB    . ARG F 2 40  ? 126.884 145.874 103.236 1.00 38.78  ? 39   ARG F CB    1 
ATOM   3930  C  CG    . ARG F 2 40  ? 126.171 146.268 101.958 1.00 38.78  ? 39   ARG F CG    1 
ATOM   3931  C  CD    . ARG F 2 40  ? 126.983 145.972 100.728 1.00 38.78  ? 39   ARG F CD    1 
ATOM   3932  N  NE    . ARG F 2 40  ? 126.324 146.467 99.526  1.00 38.78  ? 39   ARG F NE    1 
ATOM   3933  C  CZ    . ARG F 2 40  ? 125.661 145.700 98.670  1.00 38.78  ? 39   ARG F CZ    1 
ATOM   3934  N  NH1   . ARG F 2 40  ? 125.573 144.397 98.881  1.00 38.78  ? 39   ARG F NH1   1 
ATOM   3935  N  NH2   . ARG F 2 40  ? 125.091 146.235 97.600  1.00 38.78  ? 39   ARG F NH2   1 
ATOM   3936  N  N     . ARG F 2 41  ? 127.678 144.228 105.834 1.00 33.21  ? 40   ARG F N     1 
ATOM   3937  C  CA    . ARG F 2 41  ? 128.623 143.860 106.884 1.00 33.21  ? 40   ARG F CA    1 
ATOM   3938  C  C     . ARG F 2 41  ? 128.927 142.365 106.855 1.00 33.21  ? 40   ARG F C     1 
ATOM   3939  O  O     . ARG F 2 41  ? 130.046 141.957 107.184 1.00 33.21  ? 40   ARG F O     1 
ATOM   3940  C  CB    . ARG F 2 41  ? 128.082 144.299 108.252 1.00 33.21  ? 40   ARG F CB    1 
ATOM   3941  C  CG    . ARG F 2 41  ? 128.961 143.931 109.444 1.00 33.21  ? 40   ARG F CG    1 
ATOM   3942  C  CD    . ARG F 2 41  ? 128.592 144.670 110.714 1.00 33.21  ? 40   ARG F CD    1 
ATOM   3943  N  NE    . ARG F 2 41  ? 128.874 146.097 110.615 1.00 33.21  ? 40   ARG F NE    1 
ATOM   3944  C  CZ    . ARG F 2 41  ? 128.487 146.996 111.511 1.00 33.21  ? 40   ARG F CZ    1 
ATOM   3945  N  NH1   . ARG F 2 41  ? 127.798 146.615 112.575 1.00 33.21  ? 40   ARG F NH1   1 
ATOM   3946  N  NH2   . ARG F 2 41  ? 128.790 148.274 111.346 1.00 33.21  ? 40   ARG F NH2   1 
ATOM   3947  N  N     . GLY F 2 42  ? 127.995 141.553 106.363 1.00 34.32  ? 41   GLY F N     1 
ATOM   3948  C  CA    . GLY F 2 42  ? 128.214 140.129 106.228 1.00 34.32  ? 41   GLY F CA    1 
ATOM   3949  C  C     . GLY F 2 42  ? 128.963 139.701 104.986 1.00 34.32  ? 41   GLY F C     1 
ATOM   3950  O  O     . GLY F 2 42  ? 129.260 138.514 104.844 1.00 34.32  ? 41   GLY F O     1 
ATOM   3951  N  N     . GLY F 2 43  ? 129.252 140.616 104.070 1.00 33.91  ? 42   GLY F N     1 
ATOM   3952  C  CA    . GLY F 2 43  ? 130.016 140.266 102.892 1.00 33.91  ? 42   GLY F CA    1 
ATOM   3953  C  C     . GLY F 2 43  ? 129.203 139.899 101.674 1.00 33.91  ? 42   GLY F C     1 
ATOM   3954  O  O     . GLY F 2 43  ? 129.766 139.359 100.719 1.00 33.91  ? 42   GLY F O     1 
ATOM   3955  N  N     . VAL F 2 44  ? 127.910 140.168 101.675 1.00 34.96  ? 43   VAL F N     1 
ATOM   3956  C  CA    . VAL F 2 44  ? 127.043 139.815 100.559 1.00 34.96  ? 43   VAL F CA    1 
ATOM   3957  C  C     . VAL F 2 44  ? 127.198 140.852 99.456  1.00 34.96  ? 43   VAL F C     1 
ATOM   3958  O  O     . VAL F 2 44  ? 127.235 142.058 99.720  1.00 34.96  ? 43   VAL F O     1 
ATOM   3959  C  CB    . VAL F 2 44  ? 125.587 139.716 101.046 1.00 34.96  ? 43   VAL F CB    1 
ATOM   3960  C  CG1   . VAL F 2 44  ? 124.634 139.431 99.906  1.00 34.96  ? 43   VAL F CG1   1 
ATOM   3961  C  CG2   . VAL F 2 44  ? 125.474 138.646 102.102 1.00 34.96  ? 43   VAL F CG2   1 
ATOM   3962  N  N     . LYS F 2 45  ? 127.285 140.391 98.210  1.00 40.55  ? 44   LYS F N     1 
ATOM   3963  C  CA    . LYS F 2 45  ? 127.535 141.279 97.084  1.00 40.55  ? 44   LYS F CA    1 
ATOM   3964  C  C     . LYS F 2 45  ? 126.268 141.630 96.319  1.00 40.55  ? 44   LYS F C     1 
ATOM   3965  O  O     . LYS F 2 45  ? 126.065 142.796 95.972  1.00 40.55  ? 44   LYS F O     1 
ATOM   3966  C  CB    . LYS F 2 45  ? 128.539 140.632 96.126  1.00 40.55  ? 44   LYS F CB    1 
ATOM   3967  C  CG    . LYS F 2 45  ? 128.828 141.439 94.877  1.00 40.55  ? 44   LYS F CG    1 
ATOM   3968  C  CD    . LYS F 2 45  ? 129.757 140.694 93.945  1.00 40.55  ? 44   LYS F CD    1 
ATOM   3969  C  CE    . LYS F 2 45  ? 129.931 141.436 92.635  1.00 40.55  ? 44   LYS F CE    1 
ATOM   3970  N  NZ    . LYS F 2 45  ? 130.749 140.659 91.667  1.00 40.55  ? 44   LYS F NZ    1 
ATOM   3971  N  N     . ARG F 2 46  ? 125.396 140.663 96.068  1.00 46.10  ? 45   ARG F N     1 
ATOM   3972  C  CA    . ARG F 2 46  ? 124.136 140.915 95.386  1.00 46.10  ? 45   ARG F CA    1 
ATOM   3973  C  C     . ARG F 2 46  ? 123.012 140.255 96.163  1.00 46.10  ? 45   ARG F C     1 
ATOM   3974  O  O     . ARG F 2 46  ? 123.172 139.149 96.683  1.00 46.10  ? 45   ARG F O     1 
ATOM   3975  C  CB    . ARG F 2 46  ? 124.140 140.426 93.939  1.00 46.10  ? 45   ARG F CB    1 
ATOM   3976  C  CG    . ARG F 2 46  ? 125.089 141.196 93.042  1.00 46.10  ? 45   ARG F CG    1 
ATOM   3977  C  CD    . ARG F 2 46  ? 125.250 140.574 91.666  1.00 46.10  ? 45   ARG F CD    1 
ATOM   3978  N  NE    . ARG F 2 46  ? 124.240 141.040 90.715  1.00 46.10  ? 45   ARG F NE    1 
ATOM   3979  C  CZ    . ARG F 2 46  ? 123.071 140.450 90.487  1.00 46.10  ? 45   ARG F CZ    1 
ATOM   3980  N  NH1   . ARG F 2 46  ? 122.734 139.343 91.130  1.00 46.10  ? 45   ARG F NH1   1 
ATOM   3981  N  NH2   . ARG F 2 46  ? 122.235 140.969 89.598  1.00 46.10  ? 45   ARG F NH2   1 
ATOM   3982  N  N     . ILE F 2 47  ? 121.874 140.935 96.240  1.00 42.64  ? 46   ILE F N     1 
ATOM   3983  C  CA    . ILE F 2 47  ? 120.766 140.525 97.090  1.00 42.64  ? 46   ILE F CA    1 
ATOM   3984  C  C     . ILE F 2 47  ? 119.519 140.418 96.231  1.00 42.64  ? 46   ILE F C     1 
ATOM   3985  O  O     . ILE F 2 47  ? 119.143 141.384 95.558  1.00 42.64  ? 46   ILE F O     1 
ATOM   3986  C  CB    . ILE F 2 47  ? 120.525 141.523 98.233  1.00 42.64  ? 46   ILE F CB    1 
ATOM   3987  C  CG1   . ILE F 2 47  ? 121.800 141.781 99.028  1.00 42.64  ? 46   ILE F CG1   1 
ATOM   3988  C  CG2   . ILE F 2 47  ? 119.432 141.031 99.143  1.00 42.64  ? 46   ILE F CG2   1 
ATOM   3989  C  CD1   . ILE F 2 47  ? 121.616 142.827 100.084 1.00 42.64  ? 46   ILE F CD1   1 
ATOM   3990  N  N     . SER F 2 48  ? 118.885 139.251 96.248  1.00 41.98  ? 47   SER F N     1 
ATOM   3991  C  CA    . SER F 2 48  ? 117.620 139.072 95.554  1.00 41.98  ? 47   SER F CA    1 
ATOM   3992  C  C     . SER F 2 48  ? 116.519 139.863 96.245  1.00 41.98  ? 47   SER F C     1 
ATOM   3993  O  O     . SER F 2 48  ? 116.565 140.103 97.452  1.00 41.98  ? 47   SER F O     1 
ATOM   3994  C  CB    . SER F 2 48  ? 117.239 137.596 95.505  1.00 41.98  ? 47   SER F CB    1 
ATOM   3995  O  OG    . SER F 2 48  ? 118.354 136.793 95.167  1.00 41.98  ? 47   SER F OG    1 
ATOM   3996  N  N     . GLY F 2 49  ? 115.534 140.296 95.456  1.00 43.85  ? 48   GLY F N     1 
ATOM   3997  C  CA    . GLY F 2 49  ? 114.425 141.070 95.990  1.00 43.85  ? 48   GLY F CA    1 
ATOM   3998  C  C     . GLY F 2 49  ? 113.546 140.312 96.966  1.00 43.85  ? 48   GLY F C     1 
ATOM   3999  O  O     . GLY F 2 49  ? 112.852 140.935 97.775  1.00 43.85  ? 48   GLY F O     1 
ATOM   4000  N  N     . LEU F 2 50  ? 113.536 138.983 96.890  1.00 38.47  ? 49   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2 50  ? 112.753 138.151 97.795  1.00 38.47  ? 49   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2 50  ? 113.414 137.942 99.154  1.00 38.47  ? 49   LEU F C     1 
ATOM   4003  O  O     . LEU F 2 50  ? 112.780 137.351 100.034 1.00 38.47  ? 49   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2 50  ? 112.451 136.793 97.157  1.00 38.47  ? 49   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2 50  ? 111.188 136.657 96.295  1.00 38.47  ? 49   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2 50  ? 109.953 136.982 97.128  1.00 38.47  ? 49   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2 50  ? 111.215 137.482 95.010  1.00 38.47  ? 49   LEU F CD2   1 
ATOM   4008  N  N     . ILE F 2 51  ? 114.672 138.368 99.321  1.00 35.37  ? 50   ILE F N     1 
ATOM   4009  C  CA    . ILE F 2 51  ? 115.408 138.175 100.573 1.00 35.37  ? 50   ILE F CA    1 
ATOM   4010  C  C     . ILE F 2 51  ? 114.742 138.905 101.733 1.00 35.37  ? 50   ILE F C     1 
ATOM   4011  O  O     . ILE F 2 51  ? 114.626 138.354 102.836 1.00 35.37  ? 50   ILE F O     1 
ATOM   4012  C  CB    . ILE F 2 51  ? 116.872 138.619 100.391 1.00 35.37  ? 50   ILE F CB    1 
ATOM   4013  C  CG1   . ILE F 2 51  ? 117.665 137.520 99.709  1.00 35.37  ? 50   ILE F CG1   1 
ATOM   4014  C  CG2   . ILE F 2 51  ? 117.546 139.007 101.708 1.00 35.37  ? 50   ILE F CG2   1 
ATOM   4015  C  CD1   . ILE F 2 51  ? 117.799 136.313 100.566 1.00 35.37  ? 50   ILE F CD1   1 
ATOM   4016  N  N     . TYR F 2 52  ? 114.261 140.132 101.485 1.00 36.08  ? 51   TYR F N     1 
ATOM   4017  C  CA    . TYR F 2 52  ? 113.804 141.041 102.540 1.00 36.08  ? 51   TYR F CA    1 
ATOM   4018  C  C     . TYR F 2 52  ? 112.665 140.466 103.376 1.00 36.08  ? 51   TYR F C     1 
ATOM   4019  O  O     . TYR F 2 52  ? 112.643 140.643 104.601 1.00 36.08  ? 51   TYR F O     1 
ATOM   4020  C  CB    . TYR F 2 52  ? 113.407 142.380 101.930 1.00 36.08  ? 51   TYR F CB    1 
ATOM   4021  C  CG    . TYR F 2 52  ? 114.497 142.958 101.071 1.00 36.08  ? 51   TYR F CG    1 
ATOM   4022  C  CD1   . TYR F 2 52  ? 115.659 143.452 101.642 1.00 36.08  ? 51   TYR F CD1   1 
ATOM   4023  C  CD2   . TYR F 2 52  ? 114.360 143.029 99.694  1.00 36.08  ? 51   TYR F CD2   1 
ATOM   4024  C  CE1   . TYR F 2 52  ? 116.666 143.980 100.866 1.00 36.08  ? 51   TYR F CE1   1 
ATOM   4025  C  CE2   . TYR F 2 52  ? 115.360 143.563 98.906  1.00 36.08  ? 51   TYR F CE2   1 
ATOM   4026  C  CZ    . TYR F 2 52  ? 116.510 144.036 99.500  1.00 36.08  ? 51   TYR F CZ    1 
ATOM   4027  O  OH    . TYR F 2 52  ? 117.513 144.571 98.728  1.00 36.08  ? 51   TYR F OH    1 
ATOM   4028  N  N     . GLU F 2 53  ? 111.742 139.733 102.752 1.00 35.71  ? 52   GLU F N     1 
ATOM   4029  C  CA    . GLU F 2 53  ? 110.648 139.150 103.522 1.00 35.71  ? 52   GLU F CA    1 
ATOM   4030  C  C     . GLU F 2 53  ? 111.146 138.016 104.409 1.00 35.71  ? 52   GLU F C     1 
ATOM   4031  O  O     . GLU F 2 53  ? 110.723 137.898 105.568 1.00 35.71  ? 52   GLU F O     1 
ATOM   4032  C  CB    . GLU F 2 53  ? 109.551 138.650 102.584 1.00 35.71  ? 52   GLU F CB    1 
ATOM   4033  C  CG    . GLU F 2 53  ? 108.284 138.176 103.289 1.00 35.71  ? 52   GLU F CG    1 
ATOM   4034  C  CD    . GLU F 2 53  ? 107.597 139.259 104.104 1.00 35.71  ? 52   GLU F CD    1 
ATOM   4035  O  OE1   . GLU F 2 53  ? 106.949 138.916 105.115 1.00 35.71  ? 52   GLU F OE1   1 
ATOM   4036  O  OE2   . GLU F 2 53  ? 107.656 140.444 103.713 1.00 35.71  ? 52   GLU F OE2   1 
ATOM   4037  N  N     . GLU F 2 54  ? 112.068 137.198 103.892 1.00 32.65  ? 53   GLU F N     1 
ATOM   4038  C  CA    . GLU F 2 54  ? 112.677 136.143 104.697 1.00 32.65  ? 53   GLU F CA    1 
ATOM   4039  C  C     . GLU F 2 54  ? 113.486 136.717 105.853 1.00 32.65  ? 53   GLU F C     1 
ATOM   4040  O  O     . GLU F 2 54  ? 113.456 136.180 106.966 1.00 32.65  ? 53   GLU F O     1 
ATOM   4041  C  CB    . GLU F 2 54  ? 113.561 135.257 103.818 1.00 32.65  ? 53   GLU F CB    1 
ATOM   4042  C  CG    . GLU F 2 54  ? 114.283 134.120 104.547 1.00 32.65  ? 53   GLU F CG    1 
ATOM   4043  C  CD    . GLU F 2 54  ? 113.369 132.998 105.028 1.00 32.65  ? 53   GLU F CD    1 
ATOM   4044  O  OE1   . GLU F 2 54  ? 112.184 132.947 104.634 1.00 32.65  ? 53   GLU F OE1   1 
ATOM   4045  O  OE2   . GLU F 2 54  ? 113.843 132.155 105.818 1.00 32.65  ? 53   GLU F OE2   1 
ATOM   4046  N  N     . THR F 2 55  ? 114.176 137.836 105.620 1.00 30.87  ? 54   THR F N     1 
ATOM   4047  C  CA    . THR F 2 55  ? 114.995 138.444 106.662 1.00 30.87  ? 54   THR F CA    1 
ATOM   4048  C  C     . THR F 2 55  ? 114.128 139.036 107.766 1.00 30.87  ? 54   THR F C     1 
ATOM   4049  O  O     . THR F 2 55  ? 114.434 138.872 108.954 1.00 30.87  ? 54   THR F O     1 
ATOM   4050  C  CB    . THR F 2 55  ? 115.901 139.510 106.050 1.00 30.87  ? 54   THR F CB    1 
ATOM   4051  O  OG1   . THR F 2 55  ? 116.790 138.889 105.118 1.00 30.87  ? 54   THR F OG1   1 
ATOM   4052  C  CG2   . THR F 2 55  ? 116.731 140.200 107.113 1.00 30.87  ? 54   THR F CG2   1 
ATOM   4053  N  N     . ARG F 2 56  ? 113.035 139.709 107.394 1.00 32.12  ? 55   ARG F N     1 
ATOM   4054  C  CA    . ARG F 2 56  ? 112.105 140.219 108.399 1.00 32.12  ? 55   ARG F CA    1 
ATOM   4055  C  C     . ARG F 2 56  ? 111.438 139.088 109.176 1.00 32.12  ? 55   ARG F C     1 
ATOM   4056  O  O     . ARG F 2 56  ? 111.208 139.218 110.384 1.00 32.12  ? 55   ARG F O     1 
ATOM   4057  C  CB    . ARG F 2 56  ? 111.079 141.145 107.755 1.00 32.12  ? 55   ARG F CB    1 
ATOM   4058  C  CG    . ARG F 2 56  ? 111.725 142.389 107.176 1.00 32.12  ? 55   ARG F CG    1 
ATOM   4059  C  CD    . ARG F 2 56  ? 110.708 143.409 106.736 1.00 32.12  ? 55   ARG F CD    1 
ATOM   4060  N  NE    . ARG F 2 56  ? 111.353 144.591 106.179 1.00 32.12  ? 55   ARG F NE    1 
ATOM   4061  C  CZ    . ARG F 2 56  ? 111.576 144.775 104.886 1.00 32.12  ? 55   ARG F CZ    1 
ATOM   4062  N  NH1   . ARG F 2 56  ? 111.196 143.853 104.017 1.00 32.12  ? 55   ARG F NH1   1 
ATOM   4063  N  NH2   . ARG F 2 56  ? 112.172 145.881 104.462 1.00 32.12  ? 55   ARG F NH2   1 
ATOM   4064  N  N     . GLY F 2 57  ? 111.136 137.966 108.511 1.00 28.58  ? 56   GLY F N     1 
ATOM   4065  C  CA    . GLY F 2 57  ? 110.592 136.816 109.225 1.00 28.58  ? 56   GLY F CA    1 
ATOM   4066  C  C     . GLY F 2 57  ? 111.569 136.225 110.231 1.00 28.58  ? 56   GLY F C     1 
ATOM   4067  O  O     . GLY F 2 57  ? 111.187 135.892 111.360 1.00 28.58  ? 56   GLY F O     1 
ATOM   4068  N  N     . VAL F 2 58  ? 112.840 136.092 109.830 1.00 26.27  ? 57   VAL F N     1 
ATOM   4069  C  CA    . VAL F 2 58  ? 113.889 135.588 110.720 1.00 26.27  ? 57   VAL F CA    1 
ATOM   4070  C  C     . VAL F 2 58  ? 114.068 136.518 111.912 1.00 26.27  ? 57   VAL F C     1 
ATOM   4071  O  O     . VAL F 2 58  ? 114.186 136.073 113.065 1.00 26.27  ? 57   VAL F O     1 
ATOM   4072  C  CB    . VAL F 2 58  ? 115.201 135.420 109.936 1.00 26.27  ? 57   VAL F CB    1 
ATOM   4073  C  CG1   . VAL F 2 58  ? 116.385 135.239 110.864 1.00 26.27  ? 57   VAL F CG1   1 
ATOM   4074  C  CG2   . VAL F 2 58  ? 115.087 134.256 109.008 1.00 26.27  ? 57   VAL F CG2   1 
ATOM   4075  N  N     . LEU F 2 59  ? 114.108 137.825 111.638 1.00 24.30  ? 58   LEU F N     1 
ATOM   4076  C  CA    . LEU F 2 59  ? 114.226 138.835 112.683 1.00 24.30  ? 58   LEU F CA    1 
ATOM   4077  C  C     . LEU F 2 59  ? 113.058 138.775 113.658 1.00 24.30  ? 58   LEU F C     1 
ATOM   4078  O  O     . LEU F 2 59  ? 113.252 138.904 114.873 1.00 24.30  ? 58   LEU F O     1 
ATOM   4079  C  CB    . LEU F 2 59  ? 114.312 140.211 112.037 1.00 24.30  ? 58   LEU F CB    1 
ATOM   4080  C  CG    . LEU F 2 59  ? 114.395 141.376 113.000 1.00 24.30  ? 58   LEU F CG    1 
ATOM   4081  C  CD1   . LEU F 2 59  ? 115.668 141.222 113.739 1.00 24.30  ? 58   LEU F CD1   1 
ATOM   4082  C  CD2   . LEU F 2 59  ? 114.380 142.677 112.241 1.00 24.30  ? 58   LEU F CD2   1 
ATOM   4083  N  N     . LYS F 2 60  ? 111.846 138.552 113.141 1.00 24.50  ? 59   LYS F N     1 
ATOM   4084  C  CA    . LYS F 2 60  ? 110.667 138.436 113.991 1.00 24.50  ? 59   LYS F CA    1 
ATOM   4085  C  C     . LYS F 2 60  ? 110.764 137.232 114.916 1.00 24.50  ? 59   LYS F C     1 
ATOM   4086  O  O     . LYS F 2 60  ? 110.464 137.342 116.106 1.00 24.50  ? 59   LYS F O     1 
ATOM   4087  C  CB    . LYS F 2 60  ? 109.402 138.352 113.145 1.00 24.50  ? 59   LYS F CB    1 
ATOM   4088  C  CG    . LYS F 2 60  ? 108.155 138.737 113.912 1.00 24.50  ? 59   LYS F CG    1 
ATOM   4089  C  CD    . LYS F 2 60  ? 106.995 139.035 112.980 1.00 24.50  ? 59   LYS F CD    1 
ATOM   4090  C  CE    . LYS F 2 60  ? 105.788 139.552 113.750 1.00 24.50  ? 59   LYS F CE    1 
ATOM   4091  N  NZ    . LYS F 2 60  ? 105.189 138.503 114.625 1.00 24.50  ? 59   LYS F NZ    1 
ATOM   4092  N  N     . VAL F 2 61  ? 111.139 136.067 114.372 1.00 23.79  ? 60   VAL F N     1 
ATOM   4093  C  CA    . VAL F 2 61  ? 111.304 134.861 115.195 1.00 23.79  ? 60   VAL F CA    1 
ATOM   4094  C  C     . VAL F 2 61  ? 112.362 135.057 116.285 1.00 23.79  ? 60   VAL F C     1 
ATOM   4095  O  O     . VAL F 2 61  ? 112.126 134.735 117.461 1.00 23.79  ? 60   VAL F O     1 
ATOM   4096  C  CB    . VAL F 2 61  ? 111.629 133.644 114.311 1.00 23.79  ? 60   VAL F CB    1 
ATOM   4097  C  CG1   . VAL F 2 61  ? 111.828 132.411 115.163 1.00 23.79  ? 60   VAL F CG1   1 
ATOM   4098  C  CG2   . VAL F 2 61  ? 110.492 133.390 113.350 1.00 23.79  ? 60   VAL F CG2   1 
ATOM   4099  N  N     . PHE F 2 62  ? 113.541 135.573 115.908 1.00 22.58  ? 61   PHE F N     1 
ATOM   4100  C  CA    . PHE F 2 62  ? 114.625 135.782 116.874 1.00 22.58  ? 61   PHE F CA    1 
ATOM   4101  C  C     . PHE F 2 62  ? 114.225 136.756 117.979 1.00 22.58  ? 61   PHE F C     1 
ATOM   4102  O  O     . PHE F 2 62  ? 114.422 136.474 119.173 1.00 22.58  ? 61   PHE F O     1 
ATOM   4103  C  CB    . PHE F 2 62  ? 115.889 136.258 116.160 1.00 22.58  ? 61   PHE F CB    1 
ATOM   4104  C  CG    . PHE F 2 62  ? 117.048 136.525 117.084 1.00 22.58  ? 61   PHE F CG    1 
ATOM   4105  C  CD1   . PHE F 2 62  ? 117.862 135.483 117.494 1.00 22.58  ? 61   PHE F CD1   1 
ATOM   4106  C  CD2   . PHE F 2 62  ? 117.359 137.812 117.498 1.00 22.58  ? 61   PHE F CD2   1 
ATOM   4107  C  CE1   . PHE F 2 62  ? 118.939 135.708 118.333 1.00 22.58  ? 61   PHE F CE1   1 
ATOM   4108  C  CE2   . PHE F 2 62  ? 118.435 138.043 118.336 1.00 22.58  ? 61   PHE F CE2   1 
ATOM   4109  C  CZ    . PHE F 2 62  ? 119.227 136.988 118.750 1.00 22.58  ? 61   PHE F CZ    1 
ATOM   4110  N  N     . LEU F 2 63  ? 113.676 137.916 117.596 1.00 23.57  ? 62   LEU F N     1 
ATOM   4111  C  CA    . LEU F 2 63  ? 113.263 138.903 118.586 1.00 23.57  ? 62   LEU F CA    1 
ATOM   4112  C  C     . LEU F 2 63  ? 112.124 138.381 119.443 1.00 23.57  ? 62   LEU F C     1 
ATOM   4113  O  O     . LEU F 2 63  ? 112.065 138.693 120.633 1.00 23.57  ? 62   LEU F O     1 
ATOM   4114  C  CB    . LEU F 2 63  ? 112.869 140.216 117.919 1.00 23.57  ? 62   LEU F CB    1 
ATOM   4115  C  CG    . LEU F 2 63  ? 114.044 141.110 117.540 1.00 23.57  ? 62   LEU F CG    1 
ATOM   4116  C  CD1   . LEU F 2 63  ? 113.574 142.318 116.748 1.00 23.57  ? 62   LEU F CD1   1 
ATOM   4117  C  CD2   . LEU F 2 63  ? 114.785 141.530 118.787 1.00 23.57  ? 62   LEU F CD2   1 
ATOM   4118  N  N     . GLU F 2 64  ? 111.198 137.618 118.851 1.00 25.52  ? 63   GLU F N     1 
ATOM   4119  C  CA    . GLU F 2 64  ? 110.119 137.004 119.615 1.00 25.52  ? 63   GLU F CA    1 
ATOM   4120  C  C     . GLU F 2 64  ? 110.656 136.094 120.709 1.00 25.52  ? 63   GLU F C     1 
ATOM   4121  O  O     . GLU F 2 64  ? 110.215 136.185 121.858 1.00 25.52  ? 63   GLU F O     1 
ATOM   4122  C  CB    . GLU F 2 64  ? 109.193 136.227 118.686 1.00 25.52  ? 63   GLU F CB    1 
ATOM   4123  C  CG    . GLU F 2 64  ? 107.957 135.688 119.375 1.00 25.52  ? 63   GLU F CG    1 
ATOM   4124  C  CD    . GLU F 2 64  ? 106.745 136.564 119.152 1.00 25.52  ? 63   GLU F CD    1 
ATOM   4125  O  OE1   . GLU F 2 64  ? 106.896 137.632 118.525 1.00 25.52  ? 63   GLU F OE1   1 
ATOM   4126  O  OE2   . GLU F 2 64  ? 105.644 136.189 119.605 1.00 25.52  ? 63   GLU F OE2   1 
ATOM   4127  N  N     . ASN F 2 65  ? 111.644 135.253 120.385 1.00 24.16  ? 64   ASN F N     1 
ATOM   4128  C  CA    . ASN F 2 65  ? 112.190 134.344 121.395 1.00 24.16  ? 64   ASN F CA    1 
ATOM   4129  C  C     . ASN F 2 65  ? 112.937 135.091 122.498 1.00 24.16  ? 64   ASN F C     1 
ATOM   4130  O  O     . ASN F 2 65  ? 112.712 134.829 123.692 1.00 24.16  ? 64   ASN F O     1 
ATOM   4131  C  CB    . ASN F 2 65  ? 113.101 133.308 120.746 1.00 24.16  ? 64   ASN F CB    1 
ATOM   4132  C  CG    . ASN F 2 65  ? 112.336 132.317 119.905 1.00 24.16  ? 64   ASN F CG    1 
ATOM   4133  O  OD1   . ASN F 2 65  ? 111.142 132.106 120.112 1.00 24.16  ? 64   ASN F OD1   1 
ATOM   4134  N  ND2   . ASN F 2 65  ? 113.021 131.691 118.956 1.00 24.16  ? 64   ASN F ND2   1 
ATOM   4135  N  N     . VAL F 2 66  ? 113.782 136.060 122.125 1.00 22.48  ? 65   VAL F N     1 
ATOM   4136  C  CA    . VAL F 2 66  ? 114.575 136.770 123.132 1.00 22.48  ? 65   VAL F CA    1 
ATOM   4137  C  C     . VAL F 2 66  ? 113.684 137.653 124.003 1.00 22.48  ? 65   VAL F C     1 
ATOM   4138  O  O     . VAL F 2 66  ? 113.826 137.673 125.232 1.00 22.48  ? 65   VAL F O     1 
ATOM   4139  C  CB    . VAL F 2 66  ? 115.707 137.573 122.471 1.00 22.48  ? 65   VAL F CB    1 
ATOM   4140  C  CG1   . VAL F 2 66  ? 116.531 138.277 123.519 1.00 22.48  ? 65   VAL F CG1   1 
ATOM   4141  C  CG2   . VAL F 2 66  ? 116.598 136.646 121.684 1.00 22.48  ? 65   VAL F CG2   1 
ATOM   4142  N  N     . ILE F 2 67  ? 112.762 138.395 123.384 1.00 23.43  ? 66   ILE F N     1 
ATOM   4143  C  CA    . ILE F 2 67  ? 111.839 139.246 124.130 1.00 23.43  ? 66   ILE F CA    1 
ATOM   4144  C  C     . ILE F 2 67  ? 110.927 138.414 125.027 1.00 23.43  ? 66   ILE F C     1 
ATOM   4145  O  O     . ILE F 2 67  ? 110.669 138.805 126.167 1.00 23.43  ? 66   ILE F O     1 
ATOM   4146  C  CB    . ILE F 2 67  ? 111.058 140.156 123.162 1.00 23.43  ? 66   ILE F CB    1 
ATOM   4147  C  CG1   . ILE F 2 67  ? 111.984 141.246 122.628 1.00 23.43  ? 66   ILE F CG1   1 
ATOM   4148  C  CG2   . ILE F 2 67  ? 109.844 140.794 123.807 1.00 23.43  ? 66   ILE F CG2   1 
ATOM   4149  C  CD1   . ILE F 2 67  ? 111.334 142.140 121.612 1.00 23.43  ? 66   ILE F CD1   1 
ATOM   4150  N  N     . ARG F 2 68  ? 110.423 137.267 124.537 1.00 25.13  ? 67   ARG F N     1 
ATOM   4151  C  CA    . ARG F 2 68  ? 109.616 136.368 125.367 1.00 25.13  ? 67   ARG F CA    1 
ATOM   4152  C  C     . ARG F 2 68  ? 110.366 135.923 126.619 1.00 25.13  ? 67   ARG F C     1 
ATOM   4153  O  O     . ARG F 2 68  ? 109.812 135.942 127.726 1.00 25.13  ? 67   ARG F O     1 
ATOM   4154  C  CB    . ARG F 2 68  ? 109.159 135.146 124.572 1.00 25.13  ? 67   ARG F CB    1 
ATOM   4155  C  CG    . ARG F 2 68  ? 108.205 134.274 125.378 1.00 25.13  ? 67   ARG F CG    1 
ATOM   4156  C  CD    . ARG F 2 68  ? 108.012 132.872 124.817 1.00 25.13  ? 67   ARG F CD    1 
ATOM   4157  N  NE    . ARG F 2 68  ? 107.499 132.859 123.452 1.00 25.13  ? 67   ARG F NE    1 
ATOM   4158  C  CZ    . ARG F 2 68  ? 108.199 132.456 122.398 1.00 25.13  ? 67   ARG F CZ    1 
ATOM   4159  N  NH1   . ARG F 2 68  ? 109.444 132.026 122.550 1.00 25.13  ? 67   ARG F NH1   1 
ATOM   4160  N  NH2   . ARG F 2 68  ? 107.651 132.475 121.192 1.00 25.13  ? 67   ARG F NH2   1 
ATOM   4161  N  N     . ASP F 2 69  ? 111.633 135.523 126.462 1.00 23.23  ? 68   ASP F N     1 
ATOM   4162  C  CA    . ASP F 2 69  ? 112.409 135.120 127.634 1.00 23.23  ? 68   ASP F CA    1 
ATOM   4163  C  C     . ASP F 2 69  ? 112.678 136.299 128.572 1.00 23.23  ? 68   ASP F C     1 
ATOM   4164  O  O     . ASP F 2 69  ? 112.648 136.137 129.802 1.00 23.23  ? 68   ASP F O     1 
ATOM   4165  C  CB    . ASP F 2 69  ? 113.711 134.465 127.191 1.00 23.23  ? 68   ASP F CB    1 
ATOM   4166  C  CG    . ASP F 2 69  ? 113.484 133.101 126.586 1.00 23.23  ? 68   ASP F CG    1 
ATOM   4167  O  OD1   . ASP F 2 69  ? 112.317 132.779 126.288 1.00 23.23  ? 68   ASP F OD1   1 
ATOM   4168  O  OD2   . ASP F 2 69  ? 114.463 132.352 126.405 1.00 23.23  ? 68   ASP F OD2   1 
ATOM   4169  N  N     . ALA F 2 70  ? 112.927 137.489 128.013 1.00 21.60  ? 69   ALA F N     1 
ATOM   4170  C  CA    . ALA F 2 70  ? 113.112 138.690 128.829 1.00 21.60  ? 69   ALA F CA    1 
ATOM   4171  C  C     . ALA F 2 70  ? 111.860 139.018 129.637 1.00 21.60  ? 69   ALA F C     1 
ATOM   4172  O  O     . ALA F 2 70  ? 111.943 139.358 130.823 1.00 21.60  ? 69   ALA F O     1 
ATOM   4173  C  CB    . ALA F 2 70  ? 113.506 139.870 127.945 1.00 21.60  ? 69   ALA F CB    1 
ATOM   4174  N  N     . VAL F 2 71  ? 110.690 138.923 129.003 1.00 21.70  ? 70   VAL F N     1 
ATOM   4175  C  CA    . VAL F 2 71  ? 109.426 139.181 129.686 1.00 21.70  ? 70   VAL F CA    1 
ATOM   4176  C  C     . VAL F 2 71  ? 109.178 138.136 130.765 1.00 21.70  ? 70   VAL F C     1 
ATOM   4177  O  O     . VAL F 2 71  ? 108.634 138.448 131.832 1.00 21.70  ? 70   VAL F O     1 
ATOM   4178  C  CB    . VAL F 2 71  ? 108.280 139.252 128.658 1.00 21.70  ? 70   VAL F CB    1 
ATOM   4179  C  CG1   . VAL F 2 71  ? 106.935 139.403 129.313 1.00 21.70  ? 70   VAL F CG1   1 
ATOM   4180  C  CG2   . VAL F 2 71  ? 108.472 140.457 127.794 1.00 21.70  ? 70   VAL F CG2   1 
ATOM   4181  N  N     . THR F 2 72  ? 109.590 136.889 130.518 1.00 21.15  ? 71   THR F N     1 
ATOM   4182  C  CA    . THR F 2 72  ? 109.488 135.855 131.547 1.00 21.15  ? 71   THR F CA    1 
ATOM   4183  C  C     . THR F 2 72  ? 110.348 136.192 132.766 1.00 21.15  ? 71   THR F C     1 
ATOM   4184  O  O     . THR F 2 72  ? 109.897 136.047 133.913 1.00 21.15  ? 71   THR F O     1 
ATOM   4185  C  CB    . THR F 2 72  ? 109.878 134.504 130.952 1.00 21.15  ? 71   THR F CB    1 
ATOM   4186  O  OG1   . THR F 2 72  ? 108.982 134.188 129.881 1.00 21.15  ? 71   THR F OG1   1 
ATOM   4187  C  CG2   . THR F 2 72  ? 109.765 133.419 131.980 1.00 21.15  ? 71   THR F CG2   1 
ATOM   4188  N  N     . TYR F 2 73  ? 111.557 136.724 132.535 1.00 21.25  ? 72   TYR F N     1 
ATOM   4189  C  CA    . TYR F 2 73  ? 112.394 137.162 133.656 1.00 21.25  ? 72   TYR F CA    1 
ATOM   4190  C  C     . TYR F 2 73  ? 111.790 138.350 134.398 1.00 21.25  ? 72   TYR F C     1 
ATOM   4191  O  O     . TYR F 2 73  ? 111.908 138.437 135.626 1.00 21.25  ? 72   TYR F O     1 
ATOM   4192  C  CB    . TYR F 2 73  ? 113.794 137.540 133.189 1.00 21.25  ? 72   TYR F CB    1 
ATOM   4193  C  CG    . TYR F 2 73  ? 114.783 136.419 133.059 1.00 21.25  ? 72   TYR F CG    1 
ATOM   4194  C  CD1   . TYR F 2 73  ? 114.578 135.379 132.176 1.00 21.25  ? 72   TYR F CD1   1 
ATOM   4195  C  CD2   . TYR F 2 73  ? 115.953 136.431 133.803 1.00 21.25  ? 72   TYR F CD2   1 
ATOM   4196  C  CE1   . TYR F 2 73  ? 115.502 134.374 132.043 1.00 21.25  ? 72   TYR F CE1   1 
ATOM   4197  C  CE2   . TYR F 2 73  ? 116.880 135.427 133.683 1.00 21.25  ? 72   TYR F CE2   1 
ATOM   4198  C  CZ    . TYR F 2 73  ? 116.648 134.398 132.803 1.00 21.25  ? 72   TYR F CZ    1 
ATOM   4199  O  OH    . TYR F 2 73  ? 117.570 133.387 132.676 1.00 21.25  ? 72   TYR F OH    1 
ATOM   4200  N  N     . THR F 2 74  ? 111.176 139.292 133.674 1.00 24.06  ? 73   THR F N     1 
ATOM   4201  C  CA    . THR F 2 74  ? 110.562 140.445 134.337 1.00 24.06  ? 73   THR F CA    1 
ATOM   4202  C  C     . THR F 2 74  ? 109.360 140.026 135.172 1.00 24.06  ? 73   THR F C     1 
ATOM   4203  O  O     . THR F 2 74  ? 109.169 140.529 136.285 1.00 24.06  ? 73   THR F O     1 
ATOM   4204  C  CB    . THR F 2 74  ? 110.150 141.516 133.337 1.00 24.06  ? 73   THR F CB    1 
ATOM   4205  O  OG1   . THR F 2 74  ? 109.185 140.982 132.427 1.00 24.06  ? 73   THR F OG1   1 
ATOM   4206  C  CG2   . THR F 2 74  ? 111.351 142.024 132.595 1.00 24.06  ? 73   THR F CG2   1 
ATOM   4207  N  N     . GLU F 2 75  ? 108.506 139.155 134.621 1.00 24.94  ? 74   GLU F N     1 
ATOM   4208  C  CA    . GLU F 2 75  ? 107.356 138.652 135.366 1.00 24.94  ? 74   GLU F CA    1 
ATOM   4209  C  C     . GLU F 2 75  ? 107.791 137.889 136.608 1.00 24.94  ? 74   GLU F C     1 
ATOM   4210  O  O     . GLU F 2 75  ? 107.093 137.915 137.627 1.00 24.94  ? 74   GLU F O     1 
ATOM   4211  C  CB    . GLU F 2 75  ? 106.483 137.755 134.490 1.00 24.94  ? 74   GLU F CB    1 
ATOM   4212  C  CG    . GLU F 2 75  ? 105.702 138.457 133.395 1.00 24.94  ? 74   GLU F CG    1 
ATOM   4213  C  CD    . GLU F 2 75  ? 104.886 137.481 132.559 1.00 24.94  ? 74   GLU F CD    1 
ATOM   4214  O  OE1   . GLU F 2 75  ? 105.493 136.649 131.851 1.00 24.94  ? 74   GLU F OE1   1 
ATOM   4215  O  OE2   . GLU F 2 75  ? 103.641 137.530 132.623 1.00 24.94  ? 74   GLU F OE2   1 
ATOM   4216  N  N     . HIS F 2 76  ? 108.907 137.158 136.527 1.00 24.89  ? 75   HIS F N     1 
ATOM   4217  C  CA    . HIS F 2 76  ? 109.426 136.505 137.726 1.00 24.89  ? 75   HIS F CA    1 
ATOM   4218  C  C     . HIS F 2 76  ? 109.890 137.513 138.772 1.00 24.89  ? 75   HIS F C     1 
ATOM   4219  O  O     . HIS F 2 76  ? 109.558 137.392 139.956 1.00 24.89  ? 75   HIS F O     1 
ATOM   4220  C  CB    . HIS F 2 76  ? 110.569 135.559 137.387 1.00 24.89  ? 75   HIS F CB    1 
ATOM   4221  C  CG    . HIS F 2 76  ? 111.198 134.951 138.597 1.00 24.89  ? 75   HIS F CG    1 
ATOM   4222  N  ND1   . HIS F 2 76  ? 110.669 133.850 139.232 1.00 24.89  ? 75   HIS F ND1   1 
ATOM   4223  C  CD2   . HIS F 2 76  ? 112.303 135.296 139.297 1.00 24.89  ? 75   HIS F CD2   1 
ATOM   4224  C  CE1   . HIS F 2 76  ? 111.419 133.545 140.275 1.00 24.89  ? 75   HIS F CE1   1 
ATOM   4225  N  NE2   . HIS F 2 76  ? 112.420 134.404 140.335 1.00 24.89  ? 75   HIS F NE2   1 
ATOM   4226  N  N     . ALA F 2 77  ? 110.662 138.515 138.357 1.00 26.28  ? 76   ALA F N     1 
ATOM   4227  C  CA    . ALA F 2 77  ? 111.226 139.479 139.295 1.00 26.28  ? 76   ALA F CA    1 
ATOM   4228  C  C     . ALA F 2 77  ? 110.231 140.518 139.797 1.00 26.28  ? 76   ALA F C     1 
ATOM   4229  O  O     . ALA F 2 77  ? 110.634 141.380 140.586 1.00 26.28  ? 76   ALA F O     1 
ATOM   4230  C  CB    . ALA F 2 77  ? 112.410 140.198 138.651 1.00 26.28  ? 76   ALA F CB    1 
ATOM   4231  N  N     . LYS F 2 78  ? 108.966 140.447 139.362 1.00 29.74  ? 77   LYS F N     1 
ATOM   4232  C  CA    . LYS F 2 78  ? 107.901 141.400 139.702 1.00 29.74  ? 77   LYS F CA    1 
ATOM   4233  C  C     . LYS F 2 78  ? 108.278 142.835 139.340 1.00 29.74  ? 77   LYS F C     1 
ATOM   4234  O  O     . LYS F 2 78  ? 107.957 143.780 140.062 1.00 29.74  ? 77   LYS F O     1 
ATOM   4235  C  CB    . LYS F 2 78  ? 107.492 141.310 141.176 1.00 29.74  ? 77   LYS F CB    1 
ATOM   4236  C  CG    . LYS F 2 78  ? 106.764 140.039 141.566 1.00 29.74  ? 77   LYS F CG    1 
ATOM   4237  C  CD    . LYS F 2 78  ? 106.297 140.116 143.014 1.00 29.74  ? 77   LYS F CD    1 
ATOM   4238  C  CE    . LYS F 2 78  ? 105.405 138.940 143.380 1.00 29.74  ? 77   LYS F CE    1 
ATOM   4239  N  NZ    . LYS F 2 78  ? 104.866 139.044 144.765 1.00 29.74  ? 77   LYS F NZ    1 
ATOM   4240  N  N     . ARG F 2 79  ? 108.970 143.006 138.221 1.00 34.71  ? 78   ARG F N     1 
ATOM   4241  C  CA    . ARG F 2 79  ? 109.310 144.328 137.726 1.00 34.71  ? 78   ARG F CA    1 
ATOM   4242  C  C     . ARG F 2 79  ? 108.582 144.567 136.412 1.00 34.71  ? 78   ARG F C     1 
ATOM   4243  O  O     . ARG F 2 79  ? 108.287 143.629 135.669 1.00 34.71  ? 78   ARG F O     1 
ATOM   4244  C  CB    . ARG F 2 79  ? 110.822 144.499 137.550 1.00 34.71  ? 78   ARG F CB    1 
ATOM   4245  C  CG    . ARG F 2 79  ? 111.528 144.769 138.870 1.00 34.71  ? 78   ARG F CG    1 
ATOM   4246  C  CD    . ARG F 2 79  ? 113.003 145.147 138.742 1.00 34.71  ? 78   ARG F CD    1 
ATOM   4247  N  NE    . ARG F 2 79  ? 113.893 144.020 138.486 1.00 34.71  ? 78   ARG F NE    1 
ATOM   4248  C  CZ    . ARG F 2 79  ? 114.301 143.645 137.281 1.00 34.71  ? 78   ARG F CZ    1 
ATOM   4249  N  NH1   . ARG F 2 79  ? 113.907 144.314 136.208 1.00 34.71  ? 78   ARG F NH1   1 
ATOM   4250  N  NH2   . ARG F 2 79  ? 115.116 142.609 137.150 1.00 34.71  ? 78   ARG F NH2   1 
ATOM   4251  N  N     . LYS F 2 80  ? 108.297 145.830 136.129 1.00 39.75  ? 79   LYS F N     1 
ATOM   4252  C  CA    . LYS F 2 80  ? 107.587 146.182 134.912 1.00 39.75  ? 79   LYS F CA    1 
ATOM   4253  C  C     . LYS F 2 80  ? 108.505 146.568 133.765 1.00 39.75  ? 79   LYS F C     1 
ATOM   4254  O  O     . LYS F 2 80  ? 108.037 146.662 132.627 1.00 39.75  ? 79   LYS F O     1 
ATOM   4255  C  CB    . LYS F 2 80  ? 106.611 147.324 135.187 1.00 39.75  ? 79   LYS F CB    1 
ATOM   4256  C  CG    . LYS F 2 80  ? 105.722 147.084 136.384 1.00 39.75  ? 79   LYS F CG    1 
ATOM   4257  C  CD    . LYS F 2 80  ? 104.866 145.851 136.187 1.00 39.75  ? 79   LYS F CD    1 
ATOM   4258  C  CE    . LYS F 2 80  ? 104.002 145.585 137.407 1.00 39.75  ? 79   LYS F CE    1 
ATOM   4259  N  NZ    . LYS F 2 80  ? 103.049 146.698 137.663 1.00 39.75  ? 79   LYS F NZ    1 
ATOM   4260  N  N     . THR F 2 81  ? 109.788 146.787 134.019 1.00 40.98  ? 80   THR F N     1 
ATOM   4261  C  CA    . THR F 2 81  ? 110.709 147.246 132.992 1.00 40.98  ? 80   THR F CA    1 
ATOM   4262  C  C     . THR F 2 81  ? 111.644 146.112 132.617 1.00 40.98  ? 80   THR F C     1 
ATOM   4263  O  O     . THR F 2 81  ? 112.214 145.458 133.495 1.00 40.98  ? 80   THR F O     1 
ATOM   4264  C  CB    . THR F 2 81  ? 111.549 148.430 133.466 1.00 40.98  ? 80   THR F CB    1 
ATOM   4265  O  OG1   . THR F 2 81  ? 112.245 148.057 134.657 1.00 40.98  ? 80   THR F OG1   1 
ATOM   4266  C  CG2   . THR F 2 81  ? 110.668 149.620 133.775 1.00 40.98  ? 80   THR F CG2   1 
ATOM   4267  N  N     . VAL F 2 82  ? 111.807 145.886 131.321 1.00 33.42  ? 81   VAL F N     1 
ATOM   4268  C  CA    . VAL F 2 82  ? 112.805 144.938 130.851 1.00 33.42  ? 81   VAL F CA    1 
ATOM   4269  C  C     . VAL F 2 82  ? 114.171 145.578 131.038 1.00 33.42  ? 81   VAL F C     1 
ATOM   4270  O  O     . VAL F 2 82  ? 114.491 146.582 130.396 1.00 33.42  ? 81   VAL F O     1 
ATOM   4271  C  CB    . VAL F 2 82  ? 112.564 144.560 129.387 1.00 33.42  ? 81   VAL F CB    1 
ATOM   4272  C  CG1   . VAL F 2 82  ? 113.552 143.508 128.952 1.00 33.42  ? 81   VAL F CG1   1 
ATOM   4273  C  CG2   . VAL F 2 82  ? 111.144 144.064 129.211 1.00 33.42  ? 81   VAL F CG2   1 
ATOM   4274  N  N     . THR F 2 83  ? 114.973 145.002 131.917 1.00 31.60  ? 82   THR F N     1 
ATOM   4275  C  CA    . THR F 2 83  ? 116.278 145.552 132.232 1.00 31.60  ? 82   THR F CA    1 
ATOM   4276  C  C     . THR F 2 83  ? 117.315 144.942 131.295 1.00 31.60  ? 82   THR F C     1 
ATOM   4277  O  O     . THR F 2 83  ? 117.064 143.925 130.646 1.00 31.60  ? 82   THR F O     1 
ATOM   4278  C  CB    . THR F 2 83  ? 116.608 145.268 133.700 1.00 31.60  ? 82   THR F CB    1 
ATOM   4279  O  OG1   . THR F 2 83  ? 115.401 145.342 134.467 1.00 31.60  ? 82   THR F OG1   1 
ATOM   4280  C  CG2   . THR F 2 83  ? 117.571 146.299 134.275 1.00 31.60  ? 82   THR F CG2   1 
ATOM   4281  N  N     . ALA F 2 84  ? 118.461 145.621 131.185 1.00 30.25  ? 83   ALA F N     1 
ATOM   4282  C  CA    . ALA F 2 84  ? 119.562 145.150 130.349 1.00 30.25  ? 83   ALA F CA    1 
ATOM   4283  C  C     . ALA F 2 84  ? 120.052 143.776 130.781 1.00 30.25  ? 83   ALA F C     1 
ATOM   4284  O  O     . ALA F 2 84  ? 120.347 142.924 129.932 1.00 30.25  ? 83   ALA F O     1 
ATOM   4285  C  CB    . ALA F 2 84  ? 120.709 146.157 130.382 1.00 30.25  ? 83   ALA F CB    1 
ATOM   4286  N  N     . MET F 2 85  ? 120.171 143.559 132.096 1.00 31.05  ? 84   MET F N     1 
ATOM   4287  C  CA    . MET F 2 85  ? 120.632 142.277 132.625 1.00 31.05  ? 84   MET F CA    1 
ATOM   4288  C  C     . MET F 2 85  ? 119.699 141.136 132.235 1.00 31.05  ? 84   MET F C     1 
ATOM   4289  O  O     . MET F 2 85  ? 120.160 140.027 131.942 1.00 31.05  ? 84   MET F O     1 
ATOM   4290  C  CB    . MET F 2 85  ? 120.758 142.359 134.146 1.00 31.05  ? 84   MET F CB    1 
ATOM   4291  C  CG    . MET F 2 85  ? 121.833 143.312 134.630 1.00 31.05  ? 84   MET F CG    1 
ATOM   4292  S  SD    . MET F 2 85  ? 123.436 143.082 133.845 1.00 31.05  ? 84   MET F SD    1 
ATOM   4293  C  CE    . MET F 2 85  ? 123.818 141.389 134.283 1.00 31.05  ? 84   MET F CE    1 
ATOM   4294  N  N     . ASP F 2 86  ? 118.386 141.390 132.250 1.00 29.02  ? 85   ASP F N     1 
ATOM   4295  C  CA    . ASP F 2 86  ? 117.404 140.411 131.791 1.00 29.02  ? 85   ASP F CA    1 
ATOM   4296  C  C     . ASP F 2 86  ? 117.639 140.017 130.336 1.00 29.02  ? 85   ASP F C     1 
ATOM   4297  O  O     . ASP F 2 86  ? 117.565 138.834 129.986 1.00 29.02  ? 85   ASP F O     1 
ATOM   4298  C  CB    . ASP F 2 86  ? 115.993 140.956 131.988 1.00 29.02  ? 85   ASP F CB    1 
ATOM   4299  C  CG    . ASP F 2 86  ? 115.539 140.869 133.430 1.00 29.02  ? 85   ASP F CG    1 
ATOM   4300  O  OD1   . ASP F 2 86  ? 116.412 140.887 134.323 1.00 29.02  ? 85   ASP F OD1   1 
ATOM   4301  O  OD2   . ASP F 2 86  ? 114.315 140.783 133.673 1.00 29.02  ? 85   ASP F OD2   1 
ATOM   4302  N  N     . VAL F 2 87  ? 117.923 141.001 129.477 1.00 27.19  ? 86   VAL F N     1 
ATOM   4303  C  CA    . VAL F 2 87  ? 118.201 140.726 128.069 1.00 27.19  ? 86   VAL F CA    1 
ATOM   4304  C  C     . VAL F 2 87  ? 119.487 139.922 127.915 1.00 27.19  ? 86   VAL F C     1 
ATOM   4305  O  O     . VAL F 2 87  ? 119.542 138.977 127.119 1.00 27.19  ? 86   VAL F O     1 
ATOM   4306  C  CB    . VAL F 2 87  ? 118.248 142.039 127.268 1.00 27.19  ? 86   VAL F CB    1 
ATOM   4307  C  CG1   . VAL F 2 87  ? 118.593 141.780 125.818 1.00 27.19  ? 86   VAL F CG1   1 
ATOM   4308  C  CG2   . VAL F 2 87  ? 116.915 142.743 127.352 1.00 27.19  ? 86   VAL F CG2   1 
ATOM   4309  N  N     . VAL F 2 88  ? 120.534 140.283 128.667 1.00 25.11  ? 87   VAL F N     1 
ATOM   4310  C  CA    . VAL F 2 88  ? 121.803 139.551 128.615 1.00 25.11  ? 87   VAL F CA    1 
ATOM   4311  C  C     . VAL F 2 88  ? 121.616 138.094 129.032 1.00 25.11  ? 87   VAL F C     1 
ATOM   4312  O  O     . VAL F 2 88  ? 122.096 137.175 128.359 1.00 25.11  ? 87   VAL F O     1 
ATOM   4313  C  CB    . VAL F 2 88  ? 122.864 140.252 129.479 1.00 25.11  ? 87   VAL F CB    1 
ATOM   4314  C  CG1   . VAL F 2 88  ? 124.141 139.436 129.526 1.00 25.11  ? 87   VAL F CG1   1 
ATOM   4315  C  CG2   . VAL F 2 88  ? 123.165 141.602 128.911 1.00 25.11  ? 87   VAL F CG2   1 
ATOM   4316  N  N     . TYR F 2 89  ? 120.921 137.864 130.150 1.00 29.81  ? 88   TYR F N     1 
ATOM   4317  C  CA    . TYR F 2 89  ? 120.677 136.497 130.608 1.00 29.81  ? 88   TYR F CA    1 
ATOM   4318  C  C     . TYR F 2 89  ? 119.789 135.713 129.643 1.00 29.81  ? 88   TYR F C     1 
ATOM   4319  O  O     . TYR F 2 89  ? 120.013 134.513 129.433 1.00 29.81  ? 88   TYR F O     1 
ATOM   4320  C  CB    . TYR F 2 89  ? 120.099 136.509 132.021 1.00 29.81  ? 88   TYR F CB    1 
ATOM   4321  C  CG    . TYR F 2 89  ? 121.095 137.031 133.030 1.00 29.81  ? 88   TYR F CG    1 
ATOM   4322  C  CD1   . TYR F 2 89  ? 122.436 136.687 132.935 1.00 29.81  ? 88   TYR F CD1   1 
ATOM   4323  C  CD2   . TYR F 2 89  ? 120.698 137.837 134.089 1.00 29.81  ? 88   TYR F CD2   1 
ATOM   4324  C  CE1   . TYR F 2 89  ? 123.358 137.149 133.844 1.00 29.81  ? 88   TYR F CE1   1 
ATOM   4325  C  CE2   . TYR F 2 89  ? 121.614 138.309 135.004 1.00 29.81  ? 88   TYR F CE2   1 
ATOM   4326  C  CZ    . TYR F 2 89  ? 122.942 137.954 134.878 1.00 29.81  ? 88   TYR F CZ    1 
ATOM   4327  O  OH    . TYR F 2 89  ? 123.866 138.410 135.787 1.00 29.81  ? 88   TYR F OH    1 
ATOM   4328  N  N     . ALA F 2 90  ? 118.764 136.362 129.076 1.00 25.21  ? 89   ALA F N     1 
ATOM   4329  C  CA    . ALA F 2 90  ? 117.911 135.721 128.077 1.00 25.21  ? 89   ALA F CA    1 
ATOM   4330  C  C     . ALA F 2 90  ? 118.717 135.280 126.860 1.00 25.21  ? 89   ALA F C     1 
ATOM   4331  O  O     . ALA F 2 90  ? 118.525 134.174 126.345 1.00 25.21  ? 89   ALA F O     1 
ATOM   4332  C  CB    . ALA F 2 90  ? 116.783 136.665 127.668 1.00 25.21  ? 89   ALA F CB    1 
ATOM   4333  N  N     . LEU F 2 91  ? 119.591 136.160 126.362 1.00 23.82  ? 90   LEU F N     1 
ATOM   4334  C  CA    . LEU F 2 91  ? 120.471 135.809 125.250 1.00 23.82  ? 90   LEU F CA    1 
ATOM   4335  C  C     . LEU F 2 91  ? 121.423 134.681 125.621 1.00 23.82  ? 90   LEU F C     1 
ATOM   4336  O  O     . LEU F 2 91  ? 121.708 133.809 124.791 1.00 23.82  ? 90   LEU F O     1 
ATOM   4337  C  CB    . LEU F 2 91  ? 121.269 137.026 124.803 1.00 23.82  ? 90   LEU F CB    1 
ATOM   4338  C  CG    . LEU F 2 91  ? 120.503 138.125 124.090 1.00 23.82  ? 90   LEU F CG    1 
ATOM   4339  C  CD1   . LEU F 2 91  ? 121.361 139.363 124.076 1.00 23.82  ? 90   LEU F CD1   1 
ATOM   4340  C  CD2   . LEU F 2 91  ? 120.157 137.684 122.690 1.00 23.82  ? 90   LEU F CD2   1 
ATOM   4341  N  N     . LYS F 2 92  ? 121.964 134.717 126.844 1.00 23.28  ? 91   LYS F N     1 
ATOM   4342  C  CA    . LYS F 2 92  ? 122.896 133.688 127.298 1.00 23.28  ? 91   LYS F CA    1 
ATOM   4343  C  C     . LYS F 2 92  ? 122.222 132.323 127.352 1.00 23.28  ? 91   LYS F C     1 
ATOM   4344  O  O     . LYS F 2 92  ? 122.863 131.297 127.095 1.00 23.28  ? 91   LYS F O     1 
ATOM   4345  C  CB    . LYS F 2 92  ? 123.483 134.071 128.657 1.00 23.28  ? 91   LYS F CB    1 
ATOM   4346  C  CG    . LYS F 2 92  ? 124.628 133.179 129.128 1.00 23.28  ? 91   LYS F CG    1 
ATOM   4347  C  CD    . LYS F 2 92  ? 124.211 132.131 130.145 1.00 23.28  ? 91   LYS F CD    1 
ATOM   4348  C  CE    . LYS F 2 92  ? 123.933 132.762 131.487 1.00 23.28  ? 91   LYS F CE    1 
ATOM   4349  N  NZ    . LYS F 2 92  ? 123.370 131.779 132.453 1.00 23.28  ? 91   LYS F NZ    1 
ATOM   4350  N  N     . ARG F 2 93  ? 120.946 132.292 127.752 1.00 23.96  ? 92   ARG F N     1 
ATOM   4351  C  CA    . ARG F 2 93  ? 120.175 131.049 127.753 1.00 23.96  ? 92   ARG F CA    1 
ATOM   4352  C  C     . ARG F 2 93  ? 120.084 130.418 126.365 1.00 23.96  ? 92   ARG F C     1 
ATOM   4353  O  O     . ARG F 2 93  ? 120.024 129.190 126.251 1.00 23.96  ? 92   ARG F O     1 
ATOM   4354  C  CB    . ARG F 2 93  ? 118.781 131.294 128.322 1.00 23.96  ? 92   ARG F CB    1 
ATOM   4355  C  CG    . ARG F 2 93  ? 118.233 130.111 129.080 1.00 23.96  ? 92   ARG F CG    1 
ATOM   4356  C  CD    . ARG F 2 93  ? 116.723 130.178 129.167 1.00 23.96  ? 92   ARG F CD    1 
ATOM   4357  N  NE    . ARG F 2 93  ? 116.089 130.487 127.887 1.00 23.96  ? 92   ARG F NE    1 
ATOM   4358  C  CZ    . ARG F 2 93  ? 115.919 129.624 126.889 1.00 23.96  ? 92   ARG F CZ    1 
ATOM   4359  N  NH1   . ARG F 2 93  ? 116.330 128.368 126.998 1.00 23.96  ? 92   ARG F NH1   1 
ATOM   4360  N  NH2   . ARG F 2 93  ? 115.323 130.023 125.773 1.00 23.96  ? 92   ARG F NH2   1 
ATOM   4361  N  N     . GLN F 2 94  ? 120.076 131.227 125.304 1.00 23.65  ? 93   GLN F N     1 
ATOM   4362  C  CA    . GLN F 2 94  ? 119.976 130.720 123.942 1.00 23.65  ? 93   GLN F CA    1 
ATOM   4363  C  C     . GLN F 2 94  ? 121.340 130.563 123.283 1.00 23.65  ? 93   GLN F C     1 
ATOM   4364  O  O     . GLN F 2 94  ? 121.420 130.449 122.057 1.00 23.65  ? 93   GLN F O     1 
ATOM   4365  C  CB    . GLN F 2 94  ? 119.091 131.625 123.084 1.00 23.65  ? 93   GLN F CB    1 
ATOM   4366  C  CG    . GLN F 2 94  ? 117.720 131.913 123.654 1.00 23.65  ? 93   GLN F CG    1 
ATOM   4367  C  CD    . GLN F 2 94  ? 116.844 132.665 122.673 1.00 23.65  ? 93   GLN F CD    1 
ATOM   4368  O  OE1   . GLN F 2 94  ? 117.286 133.027 121.585 1.00 23.65  ? 93   GLN F OE1   1 
ATOM   4369  N  NE2   . GLN F 2 94  ? 115.596 132.903 123.052 1.00 23.65  ? 93   GLN F NE2   1 
ATOM   4370  N  N     . GLY F 2 95  ? 122.409 130.567 124.071 1.00 23.66  ? 94   GLY F N     1 
ATOM   4371  C  CA    . GLY F 2 95  ? 123.759 130.372 123.568 1.00 23.66  ? 94   GLY F CA    1 
ATOM   4372  C  C     . GLY F 2 95  ? 124.282 131.497 122.702 1.00 23.66  ? 94   GLY F C     1 
ATOM   4373  O  O     . GLY F 2 95  ? 125.070 131.252 121.781 1.00 23.66  ? 94   GLY F O     1 
ATOM   4374  N  N     . ARG F 2 96  ? 123.865 132.731 122.981 1.00 27.83  ? 95   ARG F N     1 
ATOM   4375  C  CA    . ARG F 2 96  ? 124.325 133.920 122.271 1.00 27.83  ? 95   ARG F CA    1 
ATOM   4376  C  C     . ARG F 2 96  ? 124.640 135.004 123.301 1.00 27.83  ? 95   ARG F C     1 
ATOM   4377  O  O     . ARG F 2 96  ? 124.075 136.093 123.271 1.00 27.83  ? 95   ARG F O     1 
ATOM   4378  C  CB    . ARG F 2 96  ? 123.319 134.416 121.232 1.00 27.83  ? 95   ARG F CB    1 
ATOM   4379  C  CG    . ARG F 2 96  ? 123.020 133.422 120.134 1.00 27.83  ? 95   ARG F CG    1 
ATOM   4380  C  CD    . ARG F 2 96  ? 122.248 134.045 118.993 1.00 27.83  ? 95   ARG F CD    1 
ATOM   4381  N  NE    . ARG F 2 96  ? 121.938 133.050 117.972 1.00 27.83  ? 95   ARG F NE    1 
ATOM   4382  C  CZ    . ARG F 2 96  ? 122.778 132.683 117.006 1.00 27.83  ? 95   ARG F CZ    1 
ATOM   4383  N  NH1   . ARG F 2 96  ? 123.984 133.229 116.923 1.00 27.83  ? 95   ARG F NH1   1 
ATOM   4384  N  NH2   . ARG F 2 96  ? 122.410 131.770 116.118 1.00 27.83  ? 95   ARG F NH2   1 
ATOM   4385  N  N     . THR F 2 97  ? 125.485 134.631 124.268 1.00 28.06  ? 96   THR F N     1 
ATOM   4386  C  CA    . THR F 2 97  ? 125.928 135.514 125.344 1.00 28.06  ? 96   THR F CA    1 
ATOM   4387  C  C     . THR F 2 97  ? 126.489 136.826 124.809 1.00 28.06  ? 96   THR F C     1 
ATOM   4388  O  O     . THR F 2 97  ? 127.182 136.858 123.790 1.00 28.06  ? 96   THR F O     1 
ATOM   4389  C  CB    . THR F 2 97  ? 126.967 134.797 126.211 1.00 28.06  ? 96   THR F CB    1 
ATOM   4390  O  OG1   . THR F 2 97  ? 127.603 135.736 127.086 1.00 28.06  ? 96   THR F OG1   1 
ATOM   4391  C  CG2   . THR F 2 97  ? 128.003 134.088 125.355 1.00 28.06  ? 96   THR F CG2   1 
ATOM   4392  N  N     . LEU F 2 98  ? 126.149 137.915 125.490 1.00 26.84  ? 97   LEU F N     1 
ATOM   4393  C  CA    . LEU F 2 98  ? 126.495 139.263 125.066 1.00 26.84  ? 97   LEU F CA    1 
ATOM   4394  C  C     . LEU F 2 98  ? 127.331 139.951 126.132 1.00 26.84  ? 97   LEU F C     1 
ATOM   4395  O  O     . LEU F 2 98  ? 126.935 140.008 127.298 1.00 26.84  ? 97   LEU F O     1 
ATOM   4396  C  CB    . LEU F 2 98  ? 125.230 140.072 124.791 1.00 26.84  ? 97   LEU F CB    1 
ATOM   4397  C  CG    . LEU F 2 98  ? 125.402 141.546 124.456 1.00 26.84  ? 97   LEU F CG    1 
ATOM   4398  C  CD1   . LEU F 2 98  ? 126.188 141.707 123.190 1.00 26.84  ? 97   LEU F CD1   1 
ATOM   4399  C  CD2   . LEU F 2 98  ? 124.044 142.188 124.309 1.00 26.84  ? 97   LEU F CD2   1 
ATOM   4400  N  N     . TYR F 2 99  ? 128.479 140.474 125.723 1.00 26.24  ? 98   TYR F N     1 
ATOM   4401  C  CA    . TYR F 2 99  ? 129.389 141.195 126.599 1.00 26.24  ? 98   TYR F CA    1 
ATOM   4402  C  C     . TYR F 2 99  ? 129.154 142.691 126.486 1.00 26.24  ? 98   TYR F C     1 
ATOM   4403  O  O     . TYR F 2 99  ? 128.881 143.203 125.400 1.00 26.24  ? 98   TYR F O     1 
ATOM   4404  C  CB    . TYR F 2 99  ? 130.844 140.908 126.240 1.00 26.24  ? 98   TYR F CB    1 
ATOM   4405  C  CG    . TYR F 2 99  ? 131.387 139.571 126.655 1.00 26.24  ? 98   TYR F CG    1 
ATOM   4406  C  CD1   . TYR F 2 99  ? 130.658 138.708 127.457 1.00 26.24  ? 98   TYR F CD1   1 
ATOM   4407  C  CD2   . TYR F 2 99  ? 132.642 139.171 126.227 1.00 26.24  ? 98   TYR F CD2   1 
ATOM   4408  C  CE1   . TYR F 2 99  ? 131.178 137.484 127.831 1.00 26.24  ? 98   TYR F CE1   1 
ATOM   4409  C  CE2   . TYR F 2 99  ? 133.162 137.959 126.584 1.00 26.24  ? 98   TYR F CE2   1 
ATOM   4410  C  CZ    . TYR F 2 99  ? 132.431 137.117 127.382 1.00 26.24  ? 98   TYR F CZ    1 
ATOM   4411  O  OH    . TYR F 2 99  ? 132.979 135.906 127.726 1.00 26.24  ? 98   TYR F OH    1 
ATOM   4412  N  N     . GLY F 2 100 ? 129.238 143.386 127.614 1.00 28.51  ? 99   GLY F N     1 
ATOM   4413  C  CA    . GLY F 2 100 ? 129.218 144.833 127.599 1.00 28.51  ? 99   GLY F CA    1 
ATOM   4414  C  C     . GLY F 2 100 ? 127.970 145.450 128.179 1.00 28.51  ? 99   GLY F C     1 
ATOM   4415  O  O     . GLY F 2 100 ? 127.613 146.581 127.841 1.00 28.51  ? 99   GLY F O     1 
ATOM   4416  N  N     . PHE F 2 101 ? 127.306 144.719 129.065 1.00 29.36  ? 100  PHE F N     1 
ATOM   4417  C  CA    . PHE F 2 101 ? 126.130 145.260 129.735 1.00 29.36  ? 100  PHE F CA    1 
ATOM   4418  C  C     . PHE F 2 101 ? 126.038 144.781 131.177 1.00 29.36  ? 100  PHE F C     1 
ATOM   4419  O  O     . PHE F 2 101 ? 125.057 145.112 131.854 1.00 29.36  ? 100  PHE F O     1 
ATOM   4420  C  CB    . PHE F 2 101 ? 124.846 144.887 128.980 1.00 29.36  ? 100  PHE F CB    1 
ATOM   4421  C  CG    . PHE F 2 101 ? 124.688 145.593 127.667 1.00 29.36  ? 100  PHE F CG    1 
ATOM   4422  C  CD1   . PHE F 2 101 ? 124.200 146.886 127.618 1.00 29.36  ? 100  PHE F CD1   1 
ATOM   4423  C  CD2   . PHE F 2 101 ? 125.040 144.967 126.484 1.00 29.36  ? 100  PHE F CD2   1 
ATOM   4424  C  CE1   . PHE F 2 101 ? 124.060 147.542 126.409 1.00 29.36  ? 100  PHE F CE1   1 
ATOM   4425  C  CE2   . PHE F 2 101 ? 124.904 145.618 125.272 1.00 29.36  ? 100  PHE F CE2   1 
ATOM   4426  C  CZ    . PHE F 2 101 ? 124.413 146.906 125.235 1.00 29.36  ? 100  PHE F CZ    1 
ATOM   4427  N  N     . GLY F 2 102 ? 127.020 144.038 131.674 1.00 31.42  ? 101  GLY F N     1 
ATOM   4428  C  CA    . GLY F 2 102 ? 126.985 143.513 133.024 1.00 31.42  ? 101  GLY F CA    1 
ATOM   4429  C  C     . GLY F 2 102 ? 127.180 142.011 133.058 1.00 31.42  ? 101  GLY F C     1 
ATOM   4430  O  O     . GLY F 2 102 ? 127.692 141.422 132.105 1.00 31.42  ? 101  GLY F O     1 
ATOM   4431  N  N     . GLY G 3 108 ? 102.791 108.998 152.881 1.00 49.12  ? 16   GLY G N     1 
ATOM   4432  C  CA    . GLY G 3 108 ? 103.768 109.481 151.915 1.00 49.12  ? 16   GLY G CA    1 
ATOM   4433  C  C     . GLY G 3 108 ? 103.322 110.802 151.294 1.00 49.12  ? 16   GLY G C     1 
ATOM   4434  O  O     . GLY G 3 108 ? 102.155 110.961 150.940 1.00 49.12  ? 16   GLY G O     1 
ATOM   4435  N  N     . ARG G 3 109 ? 104.259 111.754 151.197 1.00 46.13  ? 17   ARG G N     1 
ATOM   4436  C  CA    . ARG G 3 109 ? 103.981 113.033 150.547 1.00 46.13  ? 17   ARG G CA    1 
ATOM   4437  C  C     . ARG G 3 109 ? 103.648 112.882 149.066 1.00 46.13  ? 17   ARG G C     1 
ATOM   4438  O  O     . ARG G 3 109 ? 103.007 113.767 148.488 1.00 46.13  ? 17   ARG G O     1 
ATOM   4439  C  CB    . ARG G 3 109 ? 105.163 113.984 150.708 1.00 46.13  ? 17   ARG G CB    1 
ATOM   4440  C  CG    . ARG G 3 109 ? 105.257 114.683 152.044 1.00 46.13  ? 17   ARG G CG    1 
ATOM   4441  C  CD    . ARG G 3 109 ? 106.351 115.746 152.017 1.00 46.13  ? 17   ARG G CD    1 
ATOM   4442  N  NE    . ARG G 3 109 ? 107.700 115.188 152.012 1.00 46.13  ? 17   ARG G NE    1 
ATOM   4443  C  CZ    . ARG G 3 109 ? 108.805 115.924 151.962 1.00 46.13  ? 17   ARG G CZ    1 
ATOM   4444  N  NH1   . ARG G 3 109 ? 108.720 117.243 151.903 1.00 46.13  ? 17   ARG G NH1   1 
ATOM   4445  N  NH2   . ARG G 3 109 ? 109.994 115.341 151.964 1.00 46.13  ? 17   ARG G NH2   1 
ATOM   4446  N  N     . SER G 3 110 ? 104.111 111.800 148.431 1.00 45.65  ? 18   SER G N     1 
ATOM   4447  C  CA    . SER G 3 110 ? 103.808 111.551 147.024 1.00 45.65  ? 18   SER G CA    1 
ATOM   4448  C  C     . SER G 3 110 ? 102.313 111.355 146.793 1.00 45.65  ? 18   SER G C     1 
ATOM   4449  O  O     . SER G 3 110 ? 101.736 111.934 145.866 1.00 45.65  ? 18   SER G O     1 
ATOM   4450  C  CB    . SER G 3 110 ? 104.591 110.332 146.537 1.00 45.65  ? 18   SER G CB    1 
ATOM   4451  O  OG    . SER G 3 110 ? 104.279 110.023 145.191 1.00 45.65  ? 18   SER G OG    1 
ATOM   4452  N  N     . SER G 3 111 ? 101.672 110.526 147.622 1.00 46.02  ? 19   SER G N     1 
ATOM   4453  C  CA    . SER G 3 111 ? 100.244 110.265 147.463 1.00 46.02  ? 19   SER G CA    1 
ATOM   4454  C  C     . SER G 3 111 ? 99.409  111.489 147.816 1.00 46.02  ? 19   SER G C     1 
ATOM   4455  O  O     . SER G 3 111 ? 98.345  111.709 147.227 1.00 46.02  ? 19   SER G O     1 
ATOM   4456  C  CB    . SER G 3 111 ? 99.829  109.073 148.320 1.00 46.02  ? 19   SER G CB    1 
ATOM   4457  O  OG    . SER G 3 111 ? 99.833  109.415 149.694 1.00 46.02  ? 19   SER G OG    1 
ATOM   4458  N  N     . ARG G 3 112 ? 99.858  112.270 148.805 1.00 43.57  ? 20   ARG G N     1 
ATOM   4459  C  CA    . ARG G 3 112 ? 99.157  113.492 149.192 1.00 43.57  ? 20   ARG G CA    1 
ATOM   4460  C  C     . ARG G 3 112 ? 99.136  114.522 148.071 1.00 43.57  ? 20   ARG G C     1 
ATOM   4461  O  O     . ARG G 3 112 ? 98.167  115.278 147.944 1.00 43.57  ? 20   ARG G O     1 
ATOM   4462  C  CB    . ARG G 3 112 ? 99.798  114.096 150.441 1.00 43.57  ? 20   ARG G CB    1 
ATOM   4463  C  CG    . ARG G 3 112 ? 99.743  113.203 151.667 1.00 43.57  ? 20   ARG G CG    1 
ATOM   4464  C  CD    . ARG G 3 112 ? 100.299 113.916 152.888 1.00 43.57  ? 20   ARG G CD    1 
ATOM   4465  N  NE    . ARG G 3 112 ? 100.068 115.356 152.833 1.00 43.57  ? 20   ARG G NE    1 
ATOM   4466  C  CZ    . ARG G 3 112 ? 100.877 116.262 153.369 1.00 43.57  ? 20   ARG G CZ    1 
ATOM   4467  N  NH1   . ARG G 3 112 ? 101.977 115.881 154.000 1.00 43.57  ? 20   ARG G NH1   1 
ATOM   4468  N  NH2   . ARG G 3 112 ? 100.588 117.551 153.271 1.00 43.57  ? 20   ARG G NH2   1 
ATOM   4469  N  N     . ALA G 3 113 ? 100.177 114.565 147.248 1.00 40.26  ? 21   ALA G N     1 
ATOM   4470  C  CA    . ALA G 3 113 ? 100.258 115.530 146.163 1.00 40.26  ? 21   ALA G CA    1 
ATOM   4471  C  C     . ALA G 3 113 ? 99.705  114.997 144.849 1.00 40.26  ? 21   ALA G C     1 
ATOM   4472  O  O     . ALA G 3 113 ? 99.645  115.746 143.869 1.00 40.26  ? 21   ALA G O     1 
ATOM   4473  C  CB    . ALA G 3 113 ? 101.710 115.975 145.968 1.00 40.26  ? 21   ALA G CB    1 
ATOM   4474  N  N     . GLY G 3 114 ? 99.282  113.737 144.816 1.00 39.56  ? 22   GLY G N     1 
ATOM   4475  C  CA    . GLY G 3 114 ? 98.781  113.095 143.615 1.00 39.56  ? 22   GLY G CA    1 
ATOM   4476  C  C     . GLY G 3 114 ? 99.821  112.973 142.523 1.00 39.56  ? 22   GLY G C     1 
ATOM   4477  O  O     . GLY G 3 114 ? 99.555  113.273 141.357 1.00 39.56  ? 22   GLY G O     1 
ATOM   4478  N  N     . LEU G 3 115 ? 101.016 112.532 142.898 1.00 38.26  ? 23   LEU G N     1 
ATOM   4479  C  CA    . LEU G 3 115 ? 102.114 112.351 141.965 1.00 38.26  ? 23   LEU G CA    1 
ATOM   4480  C  C     . LEU G 3 115 ? 102.694 110.959 142.131 1.00 38.26  ? 23   LEU G C     1 
ATOM   4481  O  O     . LEU G 3 115 ? 102.619 110.361 143.207 1.00 38.26  ? 23   LEU G O     1 
ATOM   4482  C  CB    . LEU G 3 115 ? 103.212 113.386 142.169 1.00 38.26  ? 23   LEU G CB    1 
ATOM   4483  C  CG    . LEU G 3 115 ? 102.882 114.779 141.651 1.00 38.26  ? 23   LEU G CG    1 
ATOM   4484  C  CD1   . LEU G 3 115 ? 104.024 115.716 141.955 1.00 38.26  ? 23   LEU G CD1   1 
ATOM   4485  C  CD2   . LEU G 3 115 ? 102.598 114.737 140.164 1.00 38.26  ? 23   LEU G CD2   1 
ATOM   4486  N  N     . GLN G 3 116 ? 103.278 110.447 141.055 1.00 37.19  ? 24   GLN G N     1 
ATOM   4487  C  CA    . GLN G 3 116 ? 103.960 109.166 141.123 1.00 37.19  ? 24   GLN G CA    1 
ATOM   4488  C  C     . GLN G 3 116 ? 105.452 109.315 141.361 1.00 37.19  ? 24   GLN G C     1 
ATOM   4489  O  O     . GLN G 3 116 ? 106.078 108.401 141.905 1.00 37.19  ? 24   GLN G O     1 
ATOM   4490  C  CB    . GLN G 3 116 ? 103.695 108.369 139.847 1.00 37.19  ? 24   GLN G CB    1 
ATOM   4491  C  CG    . GLN G 3 116 ? 102.217 108.117 139.636 1.00 37.19  ? 24   GLN G CG    1 
ATOM   4492  C  CD    . GLN G 3 116 ? 101.578 107.389 140.802 1.00 37.19  ? 24   GLN G CD    1 
ATOM   4493  O  OE1   . GLN G 3 116 ? 102.146 106.442 141.346 1.00 37.19  ? 24   GLN G OE1   1 
ATOM   4494  N  NE2   . GLN G 3 116 ? 100.407 107.855 141.217 1.00 37.19  ? 24   GLN G NE2   1 
ATOM   4495  N  N     . PHE G 3 117 ? 106.028 110.445 140.982 1.00 34.46  ? 25   PHE G N     1 
ATOM   4496  C  CA    . PHE G 3 117 ? 107.444 110.696 141.182 1.00 34.46  ? 25   PHE G CA    1 
ATOM   4497  C  C     . PHE G 3 117 ? 107.730 111.079 142.633 1.00 34.46  ? 25   PHE G C     1 
ATOM   4498  O  O     . PHE G 3 117 ? 106.906 111.724 143.284 1.00 34.46  ? 25   PHE G O     1 
ATOM   4499  C  CB    . PHE G 3 117 ? 107.908 111.804 140.242 1.00 34.46  ? 25   PHE G CB    1 
ATOM   4500  C  CG    . PHE G 3 117 ? 108.416 111.301 138.936 1.00 34.46  ? 25   PHE G CG    1 
ATOM   4501  C  CD1   . PHE G 3 117 ? 109.717 110.846 138.824 1.00 34.46  ? 25   PHE G CD1   1 
ATOM   4502  C  CD2   . PHE G 3 117 ? 107.598 111.262 137.828 1.00 34.46  ? 25   PHE G CD2   1 
ATOM   4503  C  CE1   . PHE G 3 117 ? 110.195 110.373 137.624 1.00 34.46  ? 25   PHE G CE1   1 
ATOM   4504  C  CE2   . PHE G 3 117 ? 108.069 110.790 136.624 1.00 34.46  ? 25   PHE G CE2   1 
ATOM   4505  C  CZ    . PHE G 3 117 ? 109.370 110.344 136.522 1.00 34.46  ? 25   PHE G CZ    1 
ATOM   4506  N  N     . PRO G 3 118 ? 108.893 110.684 143.172 1.00 35.68  ? 26   PRO G N     1 
ATOM   4507  C  CA    . PRO G 3 118 ? 109.120 110.859 144.610 1.00 35.68  ? 26   PRO G CA    1 
ATOM   4508  C  C     . PRO G 3 118 ? 109.521 112.277 144.961 1.00 35.68  ? 26   PRO G C     1 
ATOM   4509  O  O     . PRO G 3 118 ? 110.655 112.682 144.689 1.00 35.68  ? 26   PRO G O     1 
ATOM   4510  C  CB    . PRO G 3 118 ? 110.250 109.873 144.915 1.00 35.68  ? 26   PRO G CB    1 
ATOM   4511  C  CG    . PRO G 3 118 ? 110.892 109.580 143.608 1.00 35.68  ? 26   PRO G CG    1 
ATOM   4512  C  CD    . PRO G 3 118 ? 110.102 110.176 142.501 1.00 35.68  ? 26   PRO G CD    1 
ATOM   4513  N  N     . VAL G 3 119 ? 108.590 113.041 145.536 1.00 36.28  ? 27   VAL G N     1 
ATOM   4514  C  CA    . VAL G 3 119 ? 108.889 114.397 145.990 1.00 36.28  ? 27   VAL G CA    1 
ATOM   4515  C  C     . VAL G 3 119 ? 109.979 114.413 147.060 1.00 36.28  ? 27   VAL G C     1 
ATOM   4516  O  O     . VAL G 3 119 ? 110.748 115.378 147.150 1.00 36.28  ? 27   VAL G O     1 
ATOM   4517  C  CB    . VAL G 3 119 ? 107.594 115.093 146.447 1.00 36.28  ? 27   VAL G CB    1 
ATOM   4518  C  CG1   . VAL G 3 119 ? 106.642 115.205 145.281 1.00 36.28  ? 27   VAL G CG1   1 
ATOM   4519  C  CG2   . VAL G 3 119 ? 106.920 114.298 147.520 1.00 36.28  ? 27   VAL G CG2   1 
ATOM   4520  N  N     . GLY G 3 120 ? 110.066 113.360 147.878 1.00 38.18  ? 28   GLY G N     1 
ATOM   4521  C  CA    . GLY G 3 120 ? 111.133 113.275 148.865 1.00 38.18  ? 28   GLY G CA    1 
ATOM   4522  C  C     . GLY G 3 120 ? 112.504 113.165 148.228 1.00 38.18  ? 28   GLY G C     1 
ATOM   4523  O  O     . GLY G 3 120 ? 113.449 113.848 148.631 1.00 38.18  ? 28   GLY G O     1 
ATOM   4524  N  N     . ARG G 3 121 ? 112.630 112.272 147.244 1.00 39.44  ? 29   ARG G N     1 
ATOM   4525  C  CA    . ARG G 3 121 ? 113.887 112.082 146.526 1.00 39.44  ? 29   ARG G CA    1 
ATOM   4526  C  C     . ARG G 3 121 ? 114.300 113.348 145.784 1.00 39.44  ? 29   ARG G C     1 
ATOM   4527  O  O     . ARG G 3 121 ? 115.481 113.722 145.780 1.00 39.44  ? 29   ARG G O     1 
ATOM   4528  C  CB    . ARG G 3 121 ? 113.744 110.909 145.559 1.00 39.44  ? 29   ARG G CB    1 
ATOM   4529  C  CG    . ARG G 3 121 ? 114.925 110.673 144.657 1.00 39.44  ? 29   ARG G CG    1 
ATOM   4530  C  CD    . ARG G 3 121 ? 114.792 109.336 143.964 1.00 39.44  ? 29   ARG G CD    1 
ATOM   4531  N  NE    . ARG G 3 121 ? 114.896 108.226 144.902 1.00 39.44  ? 29   ARG G NE    1 
ATOM   4532  C  CZ    . ARG G 3 121 ? 114.833 106.948 144.551 1.00 39.44  ? 29   ARG G CZ    1 
ATOM   4533  N  NH1   . ARG G 3 121 ? 114.662 106.616 143.281 1.00 39.44  ? 29   ARG G NH1   1 
ATOM   4534  N  NH2   . ARG G 3 121 ? 114.942 106.001 145.471 1.00 39.44  ? 29   ARG G NH2   1 
ATOM   4535  N  N     . VAL G 3 122 ? 113.338 113.984 145.106 1.00 33.74  ? 30   VAL G N     1 
ATOM   4536  C  CA    . VAL G 3 122 ? 113.580 115.248 144.411 1.00 33.74  ? 30   VAL G CA    1 
ATOM   4537  C  C     . VAL G 3 122 ? 114.067 116.314 145.388 1.00 33.74  ? 30   VAL G C     1 
ATOM   4538  O  O     . VAL G 3 122 ? 115.032 117.036 145.109 1.00 33.74  ? 30   VAL G O     1 
ATOM   4539  C  CB    . VAL G 3 122 ? 112.309 115.687 143.662 1.00 33.74  ? 30   VAL G CB    1 
ATOM   4540  C  CG1   . VAL G 3 122 ? 112.414 117.114 143.193 1.00 33.74  ? 30   VAL G CG1   1 
ATOM   4541  C  CG2   . VAL G 3 122 ? 112.062 114.779 142.480 1.00 33.74  ? 30   VAL G CG2   1 
ATOM   4542  N  N     . HIS G 3 123 ? 113.409 116.418 146.551 1.00 34.25  ? 31   HIS G N     1 
ATOM   4543  C  CA    . HIS G 3 123 ? 113.823 117.369 147.584 1.00 34.25  ? 31   HIS G CA    1 
ATOM   4544  C  C     . HIS G 3 123 ? 115.233 117.086 148.089 1.00 34.25  ? 31   HIS G C     1 
ATOM   4545  O  O     . HIS G 3 123 ? 116.000 118.022 148.351 1.00 34.25  ? 31   HIS G O     1 
ATOM   4546  C  CB    . HIS G 3 123 ? 112.833 117.352 148.747 1.00 34.25  ? 31   HIS G CB    1 
ATOM   4547  C  CG    . HIS G 3 123 ? 113.123 118.371 149.805 1.00 34.25  ? 31   HIS G CG    1 
ATOM   4548  N  ND1   . HIS G 3 123 ? 112.416 119.548 149.914 1.00 34.25  ? 31   HIS G ND1   1 
ATOM   4549  C  CD2   . HIS G 3 123 ? 114.027 118.383 150.813 1.00 34.25  ? 31   HIS G CD2   1 
ATOM   4550  C  CE1   . HIS G 3 123 ? 112.880 120.245 150.936 1.00 34.25  ? 31   HIS G CE1   1 
ATOM   4551  N  NE2   . HIS G 3 123 ? 113.860 119.561 151.496 1.00 34.25  ? 31   HIS G NE2   1 
ATOM   4552  N  N     . ARG G 3 124 ? 115.583 115.806 148.257 1.00 38.81  ? 32   ARG G N     1 
ATOM   4553  C  CA    . ARG G 3 124 ? 116.922 115.463 148.732 1.00 38.81  ? 32   ARG G CA    1 
ATOM   4554  C  C     . ARG G 3 124 ? 117.972 115.843 147.699 1.00 38.81  ? 32   ARG G C     1 
ATOM   4555  O  O     . ARG G 3 124 ? 119.023 116.398 148.046 1.00 38.81  ? 32   ARG G O     1 
ATOM   4556  C  CB    . ARG G 3 124 ? 117.017 113.976 149.076 1.00 38.81  ? 32   ARG G CB    1 
ATOM   4557  C  CG    . ARG G 3 124 ? 118.440 113.521 149.397 1.00 38.81  ? 32   ARG G CG    1 
ATOM   4558  C  CD    . ARG G 3 124 ? 118.528 112.044 149.726 1.00 38.81  ? 32   ARG G CD    1 
ATOM   4559  N  NE    . ARG G 3 124 ? 118.039 111.195 148.648 1.00 38.81  ? 32   ARG G NE    1 
ATOM   4560  C  CZ    . ARG G 3 124 ? 118.777 110.802 147.617 1.00 38.81  ? 32   ARG G CZ    1 
ATOM   4561  N  NH1   . ARG G 3 124 ? 120.044 111.177 147.523 1.00 38.81  ? 32   ARG G NH1   1 
ATOM   4562  N  NH2   . ARG G 3 124 ? 118.249 110.029 146.682 1.00 38.81  ? 32   ARG G NH2   1 
ATOM   4563  N  N     . LEU G 3 125 ? 117.725 115.499 146.430 1.00 35.18  ? 33   LEU G N     1 
ATOM   4564  C  CA    . LEU G 3 125 ? 118.614 115.917 145.349 1.00 35.18  ? 33   LEU G CA    1 
ATOM   4565  C  C     . LEU G 3 125 ? 118.736 117.434 145.245 1.00 35.18  ? 33   LEU G C     1 
ATOM   4566  O  O     . LEU G 3 125 ? 119.812 117.943 144.917 1.00 35.18  ? 33   LEU G O     1 
ATOM   4567  C  CB    . LEU G 3 125 ? 118.142 115.338 144.018 1.00 35.18  ? 33   LEU G CB    1 
ATOM   4568  C  CG    . LEU G 3 125 ? 118.262 113.827 143.865 1.00 35.18  ? 33   LEU G CG    1 
ATOM   4569  C  CD1   . LEU G 3 125 ? 117.825 113.407 142.475 1.00 35.18  ? 33   LEU G CD1   1 
ATOM   4570  C  CD2   . LEU G 3 125 ? 119.689 113.393 144.136 1.00 35.18  ? 33   LEU G CD2   1 
ATOM   4571  N  N     . LEU G 3 126 ? 117.663 118.172 145.543 1.00 29.99  ? 34   LEU G N     1 
ATOM   4572  C  CA    . LEU G 3 126 ? 117.744 119.630 145.523 1.00 29.99  ? 34   LEU G CA    1 
ATOM   4573  C  C     . LEU G 3 126 ? 118.615 120.153 146.657 1.00 29.99  ? 34   LEU G C     1 
ATOM   4574  O  O     . LEU G 3 126 ? 119.424 121.062 146.449 1.00 29.99  ? 34   LEU G O     1 
ATOM   4575  C  CB    . LEU G 3 126 ? 116.352 120.257 145.593 1.00 29.99  ? 34   LEU G CB    1 
ATOM   4576  C  CG    . LEU G 3 126 ? 115.509 120.229 144.322 1.00 29.99  ? 34   LEU G CG    1 
ATOM   4577  C  CD1   . LEU G 3 126 ? 114.171 120.894 144.561 1.00 29.99  ? 34   LEU G CD1   1 
ATOM   4578  C  CD2   . LEU G 3 126 ? 116.241 120.908 143.194 1.00 29.99  ? 34   LEU G CD2   1 
ATOM   4579  N  N     . ARG G 3 127 ? 118.433 119.622 147.871 1.00 38.02  ? 35   ARG G N     1 
ATOM   4580  C  CA    . ARG G 3 127 ? 119.240 120.078 149.004 1.00 38.02  ? 35   ARG G CA    1 
ATOM   4581  C  C     . ARG G 3 127 ? 120.713 119.726 148.822 1.00 38.02  ? 35   ARG G C     1 
ATOM   4582  O  O     . ARG G 3 127 ? 121.594 120.561 149.051 1.00 38.02  ? 35   ARG G O     1 
ATOM   4583  C  CB    . ARG G 3 127 ? 118.733 119.493 150.323 1.00 38.02  ? 35   ARG G CB    1 
ATOM   4584  C  CG    . ARG G 3 127 ? 117.325 119.874 150.739 1.00 38.02  ? 35   ARG G CG    1 
ATOM   4585  C  CD    . ARG G 3 127 ? 117.196 119.711 152.243 1.00 38.02  ? 35   ARG G CD    1 
ATOM   4586  N  NE    . ARG G 3 127 ? 117.825 118.479 152.708 1.00 38.02  ? 35   ARG G NE    1 
ATOM   4587  C  CZ    . ARG G 3 127 ? 117.166 117.414 153.152 1.00 38.02  ? 35   ARG G CZ    1 
ATOM   4588  N  NH1   . ARG G 3 127 ? 115.843 117.424 153.213 1.00 38.02  ? 35   ARG G NH1   1 
ATOM   4589  N  NH2   . ARG G 3 127 ? 117.835 116.340 153.549 1.00 38.02  ? 35   ARG G NH2   1 
ATOM   4590  N  N     . LYS G 3 128 ? 121.001 118.490 148.420 1.00 34.79  ? 36   LYS G N     1 
ATOM   4591  C  CA    . LYS G 3 128 ? 122.374 118.032 148.265 1.00 34.79  ? 36   LYS G CA    1 
ATOM   4592  C  C     . LYS G 3 128 ? 122.951 118.309 146.885 1.00 34.79  ? 36   LYS G C     1 
ATOM   4593  O  O     . LYS G 3 128 ? 124.066 117.863 146.598 1.00 34.79  ? 36   LYS G O     1 
ATOM   4594  C  CB    . LYS G 3 128 ? 122.469 116.537 148.571 1.00 34.79  ? 36   LYS G CB    1 
ATOM   4595  C  CG    . LYS G 3 128 ? 122.155 116.190 150.012 1.00 34.79  ? 36   LYS G CG    1 
ATOM   4596  C  CD    . LYS G 3 128 ? 123.222 116.739 150.944 1.00 34.79  ? 36   LYS G CD    1 
ATOM   4597  C  CE    . LYS G 3 128 ? 122.939 116.364 152.388 1.00 34.79  ? 36   LYS G CE    1 
ATOM   4598  N  NZ    . LYS G 3 128 ? 123.963 116.920 153.313 1.00 34.79  ? 36   LYS G NZ    1 
ATOM   4599  N  N     . GLY G 3 129 ? 122.233 119.024 146.029 1.00 31.96  ? 37   GLY G N     1 
ATOM   4600  C  CA    . GLY G 3 129 ? 122.678 119.261 144.675 1.00 31.96  ? 37   GLY G CA    1 
ATOM   4601  C  C     . GLY G 3 129 ? 123.351 120.593 144.441 1.00 31.96  ? 37   GLY G C     1 
ATOM   4602  O  O     . GLY G 3 129 ? 123.683 120.894 143.288 1.00 31.96  ? 37   GLY G O     1 
ATOM   4603  N  N     . ASN G 3 130 ? 123.560 121.388 145.497 1.00 32.01  ? 38   ASN G N     1 
ATOM   4604  C  CA    . ASN G 3 130 ? 124.209 122.703 145.456 1.00 32.01  ? 38   ASN G CA    1 
ATOM   4605  C  C     . ASN G 3 130 ? 123.511 123.649 144.476 1.00 32.01  ? 38   ASN G C     1 
ATOM   4606  O  O     . ASN G 3 130 ? 124.122 124.209 143.566 1.00 32.01  ? 38   ASN G O     1 
ATOM   4607  C  CB    . ASN G 3 130 ? 125.703 122.575 145.136 1.00 32.01  ? 38   ASN G CB    1 
ATOM   4608  C  CG    . ASN G 3 130 ? 126.467 121.837 146.212 1.00 32.01  ? 38   ASN G CG    1 
ATOM   4609  O  OD1   . ASN G 3 130 ? 127.314 120.994 145.920 1.00 32.01  ? 38   ASN G OD1   1 
ATOM   4610  N  ND2   . ASN G 3 130 ? 126.175 122.151 147.467 1.00 32.01  ? 38   ASN G ND2   1 
ATOM   4611  N  N     . TYR G 3 131 ? 122.210 123.816 144.680 1.00 26.80  ? 39   TYR G N     1 
ATOM   4612  C  CA    . TYR G 3 131 ? 121.397 124.704 143.859 1.00 26.80  ? 39   TYR G CA    1 
ATOM   4613  C  C     . TYR G 3 131 ? 120.984 125.963 144.596 1.00 26.80  ? 39   TYR G C     1 
ATOM   4614  O  O     . TYR G 3 131 ? 120.984 127.044 144.006 1.00 26.80  ? 39   TYR G O     1 
ATOM   4615  C  CB    . TYR G 3 131 ? 120.164 123.971 143.330 1.00 26.80  ? 39   TYR G CB    1 
ATOM   4616  C  CG    . TYR G 3 131 ? 120.530 122.851 142.388 1.00 26.80  ? 39   TYR G CG    1 
ATOM   4617  C  CD1   . TYR G 3 131 ? 120.993 123.124 141.110 1.00 26.80  ? 39   TYR G CD1   1 
ATOM   4618  C  CD2   . TYR G 3 131 ? 120.418 121.527 142.776 1.00 26.80  ? 39   TYR G CD2   1 
ATOM   4619  C  CE1   . TYR G 3 131 ? 121.341 122.107 140.246 1.00 26.80  ? 39   TYR G CE1   1 
ATOM   4620  C  CE2   . TYR G 3 131 ? 120.753 120.503 141.915 1.00 26.80  ? 39   TYR G CE2   1 
ATOM   4621  C  CZ    . TYR G 3 131 ? 121.213 120.798 140.655 1.00 26.80  ? 39   TYR G CZ    1 
ATOM   4622  O  OH    . TYR G 3 131 ? 121.550 119.772 139.806 1.00 26.80  ? 39   TYR G OH    1 
ATOM   4623  N  N     . ALA G 3 132 ? 120.625 125.847 145.868 1.00 31.03  ? 40   ALA G N     1 
ATOM   4624  C  CA    . ALA G 3 132 ? 120.408 127.015 146.703 1.00 31.03  ? 40   ALA G CA    1 
ATOM   4625  C  C     . ALA G 3 132 ? 120.683 126.624 148.143 1.00 31.03  ? 40   ALA G C     1 
ATOM   4626  O  O     . ALA G 3 132 ? 120.776 125.442 148.481 1.00 31.03  ? 40   ALA G O     1 
ATOM   4627  C  CB    . ALA G 3 132 ? 118.997 127.578 146.562 1.00 31.03  ? 40   ALA G CB    1 
ATOM   4628  N  N     . GLU G 3 133 ? 120.821 127.640 148.996 1.00 35.19  ? 41   GLU G N     1 
ATOM   4629  C  CA    . GLU G 3 133 ? 121.051 127.371 150.409 1.00 35.19  ? 41   GLU G CA    1 
ATOM   4630  C  C     . GLU G 3 133 ? 119.793 126.848 151.076 1.00 35.19  ? 41   GLU G C     1 
ATOM   4631  O  O     . GLU G 3 133 ? 119.875 126.090 152.048 1.00 35.19  ? 41   GLU G O     1 
ATOM   4632  C  CB    . GLU G 3 133 ? 121.553 128.632 151.117 1.00 35.19  ? 41   GLU G CB    1 
ATOM   4633  C  CG    . GLU G 3 133 ? 122.775 129.333 150.487 1.00 35.19  ? 41   GLU G CG    1 
ATOM   4634  C  CD    . GLU G 3 133 ? 124.108 128.584 150.604 1.00 35.19  ? 41   GLU G CD    1 
ATOM   4635  O  OE1   . GLU G 3 133 ? 125.133 129.179 150.212 1.00 35.19  ? 41   GLU G OE1   1 
ATOM   4636  O  OE2   . GLU G 3 133 ? 124.168 127.443 151.111 1.00 35.19  ? 41   GLU G OE2   1 
ATOM   4637  N  N     . ARG G 3 134 ? 118.627 127.234 150.570 1.00 40.02  ? 42   ARG G N     1 
ATOM   4638  C  CA    . ARG G 3 134 ? 117.352 126.827 151.133 1.00 40.02  ? 42   ARG G CA    1 
ATOM   4639  C  C     . ARG G 3 134 ? 116.447 126.424 149.979 1.00 40.02  ? 42   ARG G C     1 
ATOM   4640  O  O     . ARG G 3 134 ? 116.478 127.034 148.909 1.00 40.02  ? 42   ARG G O     1 
ATOM   4641  C  CB    . ARG G 3 134 ? 116.708 127.952 151.967 1.00 40.02  ? 42   ARG G CB    1 
ATOM   4642  C  CG    . ARG G 3 134 ? 117.574 128.460 153.124 1.00 40.02  ? 42   ARG G CG    1 
ATOM   4643  C  CD    . ARG G 3 134 ? 117.130 129.809 153.635 1.00 40.02  ? 42   ARG G CD    1 
ATOM   4644  N  NE    . ARG G 3 134 ? 115.783 129.757 154.183 1.00 40.02  ? 42   ARG G NE    1 
ATOM   4645  C  CZ    . ARG G 3 134 ? 115.518 129.524 155.461 1.00 40.02  ? 42   ARG G CZ    1 
ATOM   4646  N  NH1   . ARG G 3 134 ? 116.511 129.323 156.315 1.00 40.02  ? 42   ARG G NH1   1 
ATOM   4647  N  NH2   . ARG G 3 134 ? 114.264 129.490 155.888 1.00 40.02  ? 42   ARG G NH2   1 
ATOM   4648  N  N     . VAL G 3 135 ? 115.637 125.395 150.203 1.00 35.81  ? 43   VAL G N     1 
ATOM   4649  C  CA    . VAL G 3 135 ? 114.745 124.859 149.182 1.00 35.81  ? 43   VAL G CA    1 
ATOM   4650  C  C     . VAL G 3 135 ? 113.324 124.914 149.712 1.00 35.81  ? 43   VAL G C     1 
ATOM   4651  O  O     . VAL G 3 135 ? 113.022 124.311 150.747 1.00 35.81  ? 43   VAL G O     1 
ATOM   4652  C  CB    . VAL G 3 135 ? 115.118 123.422 148.793 1.00 35.81  ? 43   VAL G CB    1 
ATOM   4653  C  CG1   . VAL G 3 135 ? 114.125 122.890 147.790 1.00 35.81  ? 43   VAL G CG1   1 
ATOM   4654  C  CG2   . VAL G 3 135 ? 116.519 123.370 148.225 1.00 35.81  ? 43   VAL G CG2   1 
ATOM   4655  N  N     . GLY G 3 136 ? 112.467 125.662 149.018 1.00 34.08  ? 44   GLY G N     1 
ATOM   4656  C  CA    . GLY G 3 136 ? 111.076 125.764 149.420 1.00 34.08  ? 44   GLY G CA    1 
ATOM   4657  C  C     . GLY G 3 136 ? 110.351 124.434 149.342 1.00 34.08  ? 44   GLY G C     1 
ATOM   4658  O  O     . GLY G 3 136 ? 110.703 123.559 148.555 1.00 34.08  ? 44   GLY G O     1 
ATOM   4659  N  N     . ALA G 3 137 ? 109.356 124.274 150.221 1.00 35.08  ? 45   ALA G N     1 
ATOM   4660  C  CA    . ALA G 3 137 ? 108.595 123.028 150.302 1.00 35.08  ? 45   ALA G CA    1 
ATOM   4661  C  C     . ALA G 3 137 ? 107.784 122.751 149.041 1.00 35.08  ? 45   ALA G C     1 
ATOM   4662  O  O     . ALA G 3 137 ? 107.558 121.586 148.698 1.00 35.08  ? 45   ALA G O     1 
ATOM   4663  C  CB    . ALA G 3 137 ? 107.674 123.051 151.520 1.00 35.08  ? 45   ALA G CB    1 
ATOM   4664  N  N     . GLY G 3 138 ? 107.324 123.793 148.345 1.00 32.82  ? 46   GLY G N     1 
ATOM   4665  C  CA    . GLY G 3 138 ? 106.519 123.564 147.159 1.00 32.82  ? 46   GLY G CA    1 
ATOM   4666  C  C     . GLY G 3 138 ? 107.327 123.244 145.922 1.00 32.82  ? 46   GLY G C     1 
ATOM   4667  O  O     . GLY G 3 138 ? 106.782 122.675 144.966 1.00 32.82  ? 46   GLY G O     1 
ATOM   4668  N  N     . ALA G 3 139 ? 108.608 123.619 145.922 1.00 31.42  ? 47   ALA G N     1 
ATOM   4669  C  CA    . ALA G 3 139 ? 109.511 123.370 144.798 1.00 31.42  ? 47   ALA G CA    1 
ATOM   4670  C  C     . ALA G 3 139 ? 109.643 121.898 144.399 1.00 31.42  ? 47   ALA G C     1 
ATOM   4671  O  O     . ALA G 3 139 ? 109.527 121.620 143.195 1.00 31.42  ? 47   ALA G O     1 
ATOM   4672  C  CB    . ALA G 3 139 ? 110.873 124.025 145.081 1.00 31.42  ? 47   ALA G CB    1 
ATOM   4673  N  N     . PRO G 3 140 ? 109.938 120.926 145.298 1.00 31.33  ? 48   PRO G N     1 
ATOM   4674  C  CA    . PRO G 3 140 ? 110.039 119.540 144.810 1.00 31.33  ? 48   PRO G CA    1 
ATOM   4675  C  C     . PRO G 3 140 ? 108.724 118.985 144.300 1.00 31.33  ? 48   PRO G C     1 
ATOM   4676  O  O     . PRO G 3 140 ? 108.738 118.179 143.366 1.00 31.33  ? 48   PRO G O     1 
ATOM   4677  C  CB    . PRO G 3 140 ? 110.549 118.762 146.029 1.00 31.33  ? 48   PRO G CB    1 
ATOM   4678  C  CG    . PRO G 3 140 ? 110.124 119.523 147.157 1.00 31.33  ? 48   PRO G CG    1 
ATOM   4679  C  CD    . PRO G 3 140 ? 110.212 120.948 146.750 1.00 31.33  ? 48   PRO G CD    1 
ATOM   4680  N  N     . VAL G 3 141 ? 107.598 119.386 144.897 1.00 30.23  ? 49   VAL G N     1 
ATOM   4681  C  CA    . VAL G 3 141 ? 106.285 118.971 144.403 1.00 30.23  ? 49   VAL G CA    1 
ATOM   4682  C  C     . VAL G 3 141 ? 106.070 119.472 142.982 1.00 30.23  ? 49   VAL G C     1 
ATOM   4683  O  O     . VAL G 3 141 ? 105.661 118.714 142.090 1.00 30.23  ? 49   VAL G O     1 
ATOM   4684  C  CB    . VAL G 3 141 ? 105.178 119.470 145.347 1.00 30.23  ? 49   VAL G CB    1 
ATOM   4685  C  CG1   . VAL G 3 141 ? 103.809 119.184 144.761 1.00 30.23  ? 49   VAL G CG1   1 
ATOM   4686  C  CG2   . VAL G 3 141 ? 105.319 118.820 146.709 1.00 30.23  ? 49   VAL G CG2   1 
ATOM   4687  N  N     . TYR G 3 142 ? 106.391 120.748 142.744 1.00 27.23  ? 50   TYR G N     1 
ATOM   4688  C  CA    . TYR G 3 142 ? 106.216 121.341 141.421 1.00 27.23  ? 50   TYR G CA    1 
ATOM   4689  C  C     . TYR G 3 142 ? 107.138 120.683 140.400 1.00 27.23  ? 50   TYR G C     1 
ATOM   4690  O  O     . TYR G 3 142 ? 106.726 120.382 139.268 1.00 27.23  ? 50   TYR G O     1 
ATOM   4691  C  CB    . TYR G 3 142 ? 106.496 122.838 141.510 1.00 27.23  ? 50   TYR G CB    1 
ATOM   4692  C  CG    . TYR G 3 142 ? 105.867 123.682 140.435 1.00 27.23  ? 50   TYR G CG    1 
ATOM   4693  C  CD1   . TYR G 3 142 ? 106.311 123.637 139.124 1.00 27.23  ? 50   TYR G CD1   1 
ATOM   4694  C  CD2   . TYR G 3 142 ? 104.834 124.547 140.748 1.00 27.23  ? 50   TYR G CD2   1 
ATOM   4695  C  CE1   . TYR G 3 142 ? 105.735 124.413 138.161 1.00 27.23  ? 50   TYR G CE1   1 
ATOM   4696  C  CE2   . TYR G 3 142 ? 104.254 125.329 139.796 1.00 27.23  ? 50   TYR G CE2   1 
ATOM   4697  C  CZ    . TYR G 3 142 ? 104.706 125.256 138.506 1.00 27.23  ? 50   TYR G CZ    1 
ATOM   4698  O  OH    . TYR G 3 142 ? 104.124 126.039 137.555 1.00 27.23  ? 50   TYR G OH    1 
ATOM   4699  N  N     . LEU G 3 143 ? 108.378 120.421 140.804 1.00 27.85  ? 51   LEU G N     1 
ATOM   4700  C  CA    . LEU G 3 143 ? 109.362 119.826 139.911 1.00 27.85  ? 51   LEU G CA    1 
ATOM   4701  C  C     . LEU G 3 143 ? 108.998 118.385 139.573 1.00 27.85  ? 51   LEU G C     1 
ATOM   4702  O  O     . LEU G 3 143 ? 109.139 117.958 138.419 1.00 27.85  ? 51   LEU G O     1 
ATOM   4703  C  CB    . LEU G 3 143 ? 110.736 119.926 140.556 1.00 27.85  ? 51   LEU G CB    1 
ATOM   4704  C  CG    . LEU G 3 143 ? 111.948 119.320 139.885 1.00 27.85  ? 51   LEU G CG    1 
ATOM   4705  C  CD1   . LEU G 3 143 ? 112.028 119.775 138.460 1.00 27.85  ? 51   LEU G CD1   1 
ATOM   4706  C  CD2   . LEU G 3 143 ? 113.131 119.831 140.646 1.00 27.85  ? 51   LEU G CD2   1 
ATOM   4707  N  N     . ALA G 3 144 ? 108.575 117.612 140.578 1.00 27.13  ? 52   ALA G N     1 
ATOM   4708  C  CA    . ALA G 3 144 ? 108.089 116.256 140.351 1.00 27.13  ? 52   ALA G CA    1 
ATOM   4709  C  C     . ALA G 3 144 ? 106.891 116.239 139.411 1.00 27.13  ? 52   ALA G C     1 
ATOM   4710  O  O     . ALA G 3 144 ? 106.771 115.335 138.579 1.00 27.13  ? 52   ALA G O     1 
ATOM   4711  C  CB    . ALA G 3 144 ? 107.740 115.597 141.680 1.00 27.13  ? 52   ALA G CB    1 
ATOM   4712  N  N     . ALA G 3 145 ? 105.984 117.216 139.544 1.00 28.12  ? 53   ALA G N     1 
ATOM   4713  C  CA    . ALA G 3 145 ? 104.845 117.307 138.630 1.00 28.12  ? 53   ALA G CA    1 
ATOM   4714  C  C     . ALA G 3 145 ? 105.289 117.547 137.192 1.00 28.12  ? 53   ALA G C     1 
ATOM   4715  O  O     . ALA G 3 145 ? 104.761 116.926 136.257 1.00 28.12  ? 53   ALA G O     1 
ATOM   4716  C  CB    . ALA G 3 145 ? 103.897 118.415 139.076 1.00 28.12  ? 53   ALA G CB    1 
ATOM   4717  N  N     . VAL G 3 146 ? 106.267 118.435 136.997 1.00 25.64  ? 54   VAL G N     1 
ATOM   4718  C  CA    . VAL G 3 146 ? 106.735 118.725 135.642 1.00 25.64  ? 54   VAL G CA    1 
ATOM   4719  C  C     . VAL G 3 146 ? 107.465 117.519 135.052 1.00 25.64  ? 54   VAL G C     1 
ATOM   4720  O  O     . VAL G 3 146 ? 107.298 117.188 133.863 1.00 25.64  ? 54   VAL G O     1 
ATOM   4721  C  CB    . VAL G 3 146 ? 107.610 119.989 135.663 1.00 25.64  ? 54   VAL G CB    1 
ATOM   4722  C  CG1   . VAL G 3 146 ? 108.255 120.239 134.320 1.00 25.64  ? 54   VAL G CG1   1 
ATOM   4723  C  CG2   . VAL G 3 146 ? 106.759 121.169 136.049 1.00 25.64  ? 54   VAL G CG2   1 
ATOM   4724  N  N     . LEU G 3 147 ? 108.222 116.800 135.888 1.00 26.42  ? 55   LEU G N     1 
ATOM   4725  C  CA    . LEU G 3 147 ? 108.904 115.594 135.427 1.00 26.42  ? 55   LEU G CA    1 
ATOM   4726  C  C     . LEU G 3 147 ? 107.909 114.502 135.063 1.00 26.42  ? 55   LEU G C     1 
ATOM   4727  O  O     . LEU G 3 147 ? 108.099 113.799 134.062 1.00 26.42  ? 55   LEU G O     1 
ATOM   4728  C  CB    . LEU G 3 147 ? 109.880 115.094 136.486 1.00 26.42  ? 55   LEU G CB    1 
ATOM   4729  C  CG    . LEU G 3 147 ? 111.134 115.944 136.652 1.00 26.42  ? 55   LEU G CG    1 
ATOM   4730  C  CD1   . LEU G 3 147 ? 111.999 115.416 137.776 1.00 26.42  ? 55   LEU G CD1   1 
ATOM   4731  C  CD2   . LEU G 3 147 ? 111.903 115.969 135.359 1.00 26.42  ? 55   LEU G CD2   1 
ATOM   4732  N  N     . GLU G 3 148 ? 106.845 114.353 135.861 1.00 30.19  ? 56   GLU G N     1 
ATOM   4733  C  CA    . GLU G 3 148 ? 105.800 113.383 135.550 1.00 30.19  ? 56   GLU G CA    1 
ATOM   4734  C  C     . GLU G 3 148 ? 105.111 113.712 134.237 1.00 30.19  ? 56   GLU G C     1 
ATOM   4735  O  O     . GLU G 3 148 ? 104.826 112.808 133.447 1.00 30.19  ? 56   GLU G O     1 
ATOM   4736  C  CB    . GLU G 3 148 ? 104.769 113.320 136.675 1.00 30.19  ? 56   GLU G CB    1 
ATOM   4737  C  CG    . GLU G 3 148 ? 103.626 112.353 136.394 1.00 30.19  ? 56   GLU G CG    1 
ATOM   4738  C  CD    . GLU G 3 148 ? 102.706 112.159 137.573 1.00 30.19  ? 56   GLU G CD    1 
ATOM   4739  O  OE1   . GLU G 3 148 ? 103.036 111.347 138.461 1.00 30.19  ? 56   GLU G OE1   1 
ATOM   4740  O  OE2   . GLU G 3 148 ? 101.645 112.815 137.605 1.00 30.19  ? 56   GLU G OE2   1 
ATOM   4741  N  N     . TYR G 3 149 ? 104.850 114.997 133.980 1.00 28.08  ? 57   TYR G N     1 
ATOM   4742  C  CA    . TYR G 3 149 ? 104.216 115.369 132.717 1.00 28.08  ? 57   TYR G CA    1 
ATOM   4743  C  C     . TYR G 3 149 ? 105.102 115.052 131.515 1.00 28.08  ? 57   TYR G C     1 
ATOM   4744  O  O     . TYR G 3 149 ? 104.626 114.486 130.520 1.00 28.08  ? 57   TYR G O     1 
ATOM   4745  C  CB    . TYR G 3 149 ? 103.812 116.835 132.695 1.00 28.08  ? 57   TYR G CB    1 
ATOM   4746  C  CG    . TYR G 3 149 ? 102.884 117.074 131.535 1.00 28.08  ? 57   TYR G CG    1 
ATOM   4747  C  CD1   . TYR G 3 149 ? 101.576 116.608 131.574 1.00 28.08  ? 57   TYR G CD1   1 
ATOM   4748  C  CD2   . TYR G 3 149 ? 103.319 117.718 130.386 1.00 28.08  ? 57   TYR G CD2   1 
ATOM   4749  C  CE1   . TYR G 3 149 ? 100.721 116.798 130.515 1.00 28.08  ? 57   TYR G CE1   1 
ATOM   4750  C  CE2   . TYR G 3 149 ? 102.470 117.912 129.318 1.00 28.08  ? 57   TYR G CE2   1 
ATOM   4751  C  CZ    . TYR G 3 149 ? 101.173 117.447 129.389 1.00 28.08  ? 57   TYR G CZ    1 
ATOM   4752  O  OH    . TYR G 3 149 ? 100.319 117.641 128.331 1.00 28.08  ? 57   TYR G OH    1 
ATOM   4753  N  N     . LEU G 3 150 ? 106.381 115.447 131.569 1.00 27.29  ? 58   LEU G N     1 
ATOM   4754  C  CA    . LEU G 3 150 ? 107.278 115.187 130.438 1.00 27.29  ? 58   LEU G CA    1 
ATOM   4755  C  C     . LEU G 3 150 ? 107.490 113.691 130.203 1.00 27.29  ? 58   LEU G C     1 
ATOM   4756  O  O     . LEU G 3 150 ? 107.462 113.222 129.049 1.00 27.29  ? 58   LEU G O     1 
ATOM   4757  C  CB    . LEU G 3 150 ? 108.615 115.878 130.672 1.00 27.29  ? 58   LEU G CB    1 
ATOM   4758  C  CG    . LEU G 3 150 ? 108.526 117.394 130.577 1.00 27.29  ? 58   LEU G CG    1 
ATOM   4759  C  CD1   . LEU G 3 150 ? 109.815 118.031 131.035 1.00 27.29  ? 58   LEU G CD1   1 
ATOM   4760  C  CD2   . LEU G 3 150 ? 108.200 117.800 129.156 1.00 27.29  ? 58   LEU G CD2   1 
ATOM   4761  N  N     . THR G 3 151 ? 107.651 112.926 131.290 1.00 26.23  ? 59   THR G N     1 
ATOM   4762  C  CA    . THR G 3 151 ? 107.781 111.476 131.195 1.00 26.23  ? 59   THR G CA    1 
ATOM   4763  C  C     . THR G 3 151 ? 106.521 110.847 130.616 1.00 26.23  ? 59   THR G C     1 
ATOM   4764  O  O     . THR G 3 151 ? 106.603 109.980 129.740 1.00 26.23  ? 59   THR G O     1 
ATOM   4765  C  CB    . THR G 3 151 ? 108.110 110.901 132.573 1.00 26.23  ? 59   THR G CB    1 
ATOM   4766  O  OG1   . THR G 3 151 ? 109.420 111.329 132.957 1.00 26.23  ? 59   THR G OG1   1 
ATOM   4767  C  CG2   . THR G 3 151 ? 108.082 109.390 132.566 1.00 26.23  ? 59   THR G CG2   1 
ATOM   4768  N  N     . ALA G 3 152 ? 105.347 111.287 131.082 1.00 26.02  ? 60   ALA G N     1 
ATOM   4769  C  CA    . ALA G 3 152 ? 104.084 110.746 130.596 1.00 26.02  ? 60   ALA G CA    1 
ATOM   4770  C  C     . ALA G 3 152 ? 103.882 111.022 129.115 1.00 26.02  ? 60   ALA G C     1 
ATOM   4771  O  O     . ALA G 3 152 ? 103.416 110.144 128.382 1.00 26.02  ? 60   ALA G O     1 
ATOM   4772  C  CB    . ALA G 3 152 ? 102.923 111.319 131.405 1.00 26.02  ? 60   ALA G CB    1 
ATOM   4773  N  N     . GLU G 3 153 ? 104.235 112.226 128.654 1.00 27.02  ? 61   GLU G N     1 
ATOM   4774  C  CA    . GLU G 3 153 ? 104.099 112.544 127.233 1.00 27.02  ? 61   GLU G CA    1 
ATOM   4775  C  C     . GLU G 3 153 ? 105.003 111.677 126.362 1.00 27.02  ? 61   GLU G C     1 
ATOM   4776  O  O     . GLU G 3 153 ? 104.546 111.104 125.357 1.00 27.02  ? 61   GLU G O     1 
ATOM   4777  C  CB    . GLU G 3 153 ? 104.366 114.024 126.983 1.00 27.02  ? 61   GLU G CB    1 
ATOM   4778  C  CG    . GLU G 3 153 ? 103.204 114.895 127.397 1.00 27.02  ? 61   GLU G CG    1 
ATOM   4779  C  CD    . GLU G 3 153 ? 102.021 114.780 126.447 1.00 27.02  ? 61   GLU G CD    1 
ATOM   4780  O  OE1   . GLU G 3 153 ? 102.216 114.376 125.281 1.00 27.02  ? 61   GLU G OE1   1 
ATOM   4781  O  OE2   . GLU G 3 153 ? 100.887 115.080 126.874 1.00 27.02  ? 61   GLU G OE2   1 
ATOM   4782  N  N     . ILE G 3 154 ? 106.287 111.564 126.733 1.00 25.81  ? 62   ILE G N     1 
ATOM   4783  C  CA    . ILE G 3 154 ? 107.213 110.762 125.930 1.00 25.81  ? 62   ILE G CA    1 
ATOM   4784  C  C     . ILE G 3 154 ? 106.823 109.286 125.942 1.00 25.81  ? 62   ILE G C     1 
ATOM   4785  O  O     . ILE G 3 154 ? 106.835 108.627 124.893 1.00 25.81  ? 62   ILE G O     1 
ATOM   4786  C  CB    . ILE G 3 154 ? 108.663 110.989 126.387 1.00 25.81  ? 62   ILE G CB    1 
ATOM   4787  C  CG1   . ILE G 3 154 ? 109.049 112.434 126.099 1.00 25.81  ? 62   ILE G CG1   1 
ATOM   4788  C  CG2   . ILE G 3 154 ? 109.625 110.017 125.724 1.00 25.81  ? 62   ILE G CG2   1 
ATOM   4789  C  CD1   . ILE G 3 154 ? 110.479 112.732 126.332 1.00 25.81  ? 62   ILE G CD1   1 
ATOM   4790  N  N     . LEU G 3 155 ? 106.460 108.751 127.113 1.00 27.23  ? 63   LEU G N     1 
ATOM   4791  C  CA    . LEU G 3 155 ? 106.035 107.357 127.203 1.00 27.23  ? 63   LEU G CA    1 
ATOM   4792  C  C     . LEU G 3 155 ? 104.768 107.097 126.400 1.00 27.23  ? 63   LEU G C     1 
ATOM   4793  O  O     . LEU G 3 155 ? 104.648 106.048 125.763 1.00 27.23  ? 63   LEU G O     1 
ATOM   4794  C  CB    . LEU G 3 155 ? 105.836 106.941 128.653 1.00 27.23  ? 63   LEU G CB    1 
ATOM   4795  C  CG    . LEU G 3 155 ? 107.103 106.773 129.477 1.00 27.23  ? 63   LEU G CG    1 
ATOM   4796  C  CD1   . LEU G 3 155 ? 106.712 106.305 130.854 1.00 27.23  ? 63   LEU G CD1   1 
ATOM   4797  C  CD2   . LEU G 3 155 ? 108.064 105.808 128.823 1.00 27.23  ? 63   LEU G CD2   1 
ATOM   4798  N  N     . GLU G 3 156 ? 103.787 108.009 126.467 1.00 31.42  ? 64   GLU G N     1 
ATOM   4799  C  CA    . GLU G 3 156 ? 102.550 107.836 125.707 1.00 31.42  ? 64   GLU G CA    1 
ATOM   4800  C  C     . GLU G 3 156 ? 102.809 107.807 124.206 1.00 31.42  ? 64   GLU G C     1 
ATOM   4801  O  O     . GLU G 3 156 ? 102.256 106.959 123.489 1.00 31.42  ? 64   GLU G O     1 
ATOM   4802  C  CB    . GLU G 3 156 ? 101.557 108.944 126.048 1.00 31.42  ? 64   GLU G CB    1 
ATOM   4803  C  CG    . GLU G 3 156 ? 100.185 108.758 125.414 1.00 31.42  ? 64   GLU G CG    1 
ATOM   4804  C  CD    . GLU G 3 156 ? 99.979  109.583 124.153 1.00 31.42  ? 64   GLU G CD    1 
ATOM   4805  O  OE1   . GLU G 3 156 ? 100.951 110.191 123.660 1.00 31.42  ? 64   GLU G OE1   1 
ATOM   4806  O  OE2   . GLU G 3 156 ? 98.837  109.618 123.650 1.00 31.42  ? 64   GLU G OE2   1 
ATOM   4807  N  N     . LEU G 3 157 ? 103.682 108.694 123.720 1.00 30.18  ? 65   LEU G N     1 
ATOM   4808  C  CA    . LEU G 3 157 ? 103.963 108.712 122.287 1.00 30.18  ? 65   LEU G CA    1 
ATOM   4809  C  C     . LEU G 3 157 ? 104.772 107.489 121.863 1.00 30.18  ? 65   LEU G C     1 
ATOM   4810  O  O     . LEU G 3 157 ? 104.531 106.925 120.785 1.00 30.18  ? 65   LEU G O     1 
ATOM   4811  C  CB    . LEU G 3 157 ? 104.681 110.007 121.912 1.00 30.18  ? 65   LEU G CB    1 
ATOM   4812  C  CG    . LEU G 3 157 ? 103.823 111.269 121.968 1.00 30.18  ? 65   LEU G CG    1 
ATOM   4813  C  CD1   . LEU G 3 157 ? 104.672 112.502 121.729 1.00 30.18  ? 65   LEU G CD1   1 
ATOM   4814  C  CD2   . LEU G 3 157 ? 102.697 111.184 120.955 1.00 30.18  ? 65   LEU G CD2   1 
ATOM   4815  N  N     . ALA G 3 158 ? 105.715 107.049 122.706 1.00 32.00  ? 66   ALA G N     1 
ATOM   4816  C  CA    . ALA G 3 158 ? 106.487 105.848 122.404 1.00 32.00  ? 66   ALA G CA    1 
ATOM   4817  C  C     . ALA G 3 158 ? 105.604 104.609 122.399 1.00 32.00  ? 66   ALA G C     1 
ATOM   4818  O  O     . ALA G 3 158 ? 105.782 103.725 121.557 1.00 32.00  ? 66   ALA G O     1 
ATOM   4819  C  CB    . ALA G 3 158 ? 107.628 105.690 123.402 1.00 32.00  ? 66   ALA G CB    1 
ATOM   4820  N  N     . GLY G 3 159 ? 104.680 104.518 123.359 1.00 37.05  ? 67   GLY G N     1 
ATOM   4821  C  CA    . GLY G 3 159 ? 103.702 103.440 123.374 1.00 37.05  ? 67   GLY G CA    1 
ATOM   4822  C  C     . GLY G 3 159 ? 102.855 103.388 122.120 1.00 37.05  ? 67   GLY G C     1 
ATOM   4823  O  O     . GLY G 3 159 ? 102.612 102.309 121.566 1.00 37.05  ? 67   GLY G O     1 
ATOM   4824  N  N     . ASN G 3 160 ? 102.310 104.546 121.719 1.00 40.88  ? 68   ASN G N     1 
ATOM   4825  C  CA    . ASN G 3 160 ? 101.553 104.643 120.471 1.00 40.88  ? 68   ASN G CA    1 
ATOM   4826  C  C     . ASN G 3 160 ? 102.368 104.163 119.271 1.00 40.88  ? 68   ASN G C     1 
ATOM   4827  O  O     . ASN G 3 160 ? 101.873 103.388 118.444 1.00 40.88  ? 68   ASN G O     1 
ATOM   4828  C  CB    . ASN G 3 160 ? 101.073 106.076 120.258 1.00 40.88  ? 68   ASN G CB    1 
ATOM   4829  C  CG    . ASN G 3 160 ? 99.710  106.131 119.606 1.00 40.88  ? 68   ASN G CG    1 
ATOM   4830  O  OD1   . ASN G 3 160 ? 99.210  105.124 119.107 1.00 40.88  ? 68   ASN G OD1   1 
ATOM   4831  N  ND2   . ASN G 3 160 ? 99.098  107.308 119.606 1.00 40.88  ? 68   ASN G ND2   1 
ATOM   4832  N  N     . ALA G 3 161 ? 103.620 104.630 119.157 1.00 40.84  ? 69   ALA G N     1 
ATOM   4833  C  CA    . ALA G 3 161 ? 104.496 104.190 118.067 1.00 40.84  ? 69   ALA G CA    1 
ATOM   4834  C  C     . ALA G 3 161 ? 104.776 102.689 118.133 1.00 40.84  ? 69   ALA G C     1 
ATOM   4835  O  O     . ALA G 3 161 ? 104.876 102.018 117.094 1.00 40.84  ? 69   ALA G O     1 
ATOM   4836  C  CB    . ALA G 3 161 ? 105.802 104.980 118.094 1.00 40.84  ? 69   ALA G CB    1 
ATOM   4837  N  N     . ALA G 3 162 ? 104.889 102.144 119.349 1.00 39.62  ? 70   ALA G N     1 
ATOM   4838  C  CA    . ALA G 3 162 ? 105.144 100.719 119.522 1.00 39.62  ? 70   ALA G CA    1 
ATOM   4839  C  C     . ALA G 3 162 ? 103.962 99.891  119.048 1.00 39.62  ? 70   ALA G C     1 
ATOM   4840  O  O     . ALA G 3 162 ? 104.151 98.851  118.408 1.00 39.62  ? 70   ALA G O     1 
ATOM   4841  C  CB    . ALA G 3 162 ? 105.461 100.410 120.982 1.00 39.62  ? 70   ALA G CB    1 
ATOM   4842  N  N     . ARG G 3 163 ? 102.739 100.317 119.383 1.00 44.93  ? 71   ARG G N     1 
ATOM   4843  C  CA    . ARG G 3 163 ? 101.561 99.656  118.822 1.00 44.93  ? 71   ARG G CA    1 
ATOM   4844  C  C     . ARG G 3 163 ? 101.531 99.804  117.305 1.00 44.93  ? 71   ARG G C     1 
ATOM   4845  O  O     . ARG G 3 163 ? 101.138 98.874  116.592 1.00 44.93  ? 71   ARG G O     1 
ATOM   4846  C  CB    . ARG G 3 163 ? 100.270 100.187 119.438 1.00 44.93  ? 71   ARG G CB    1 
ATOM   4847  C  CG    . ARG G 3 163 ? 100.025 99.740  120.868 1.00 44.93  ? 71   ARG G CG    1 
ATOM   4848  C  CD    . ARG G 3 163 ? 98.577  99.949  121.342 1.00 44.93  ? 71   ARG G CD    1 
ATOM   4849  N  NE    . ARG G 3 163 ? 98.124  101.340 121.339 1.00 44.93  ? 71   ARG G NE    1 
ATOM   4850  C  CZ    . ARG G 3 163 ? 97.417  101.908 120.365 1.00 44.93  ? 71   ARG G CZ    1 
ATOM   4851  N  NH1   . ARG G 3 163 ? 97.061  101.203 119.299 1.00 44.93  ? 71   ARG G NH1   1 
ATOM   4852  N  NH2   . ARG G 3 163 ? 97.058  103.181 120.459 1.00 44.93  ? 71   ARG G NH2   1 
ATOM   4853  N  N     . ASP G 3 164 ? 101.951 100.968 116.792 1.00 46.00  ? 72   ASP G N     1 
ATOM   4854  C  CA    . ASP G 3 164 ? 102.056 101.176 115.349 1.00 46.00  ? 72   ASP G CA    1 
ATOM   4855  C  C     . ASP G 3 164 ? 103.186 100.375 114.702 1.00 46.00  ? 72   ASP G C     1 
ATOM   4856  O  O     . ASP G 3 164 ? 103.316 100.407 113.474 1.00 46.00  ? 72   ASP G O     1 
ATOM   4857  C  CB    . ASP G 3 164 ? 102.230 102.661 115.030 1.00 46.00  ? 72   ASP G CB    1 
ATOM   4858  C  CG    . ASP G 3 164 ? 101.030 103.488 115.444 1.00 46.00  ? 72   ASP G CG    1 
ATOM   4859  O  OD1   . ASP G 3 164 ? 100.032 102.898 115.907 1.00 46.00  ? 72   ASP G OD1   1 
ATOM   4860  O  OD2   . ASP G 3 164 ? 101.082 104.727 115.302 1.00 46.00  ? 72   ASP G OD2   1 
ATOM   4861  N  N     . ASN G 3 165 ? 104.008 99.672  115.487 1.00 45.30  ? 73   ASN G N     1 
ATOM   4862  C  CA    . ASN G 3 165 ? 104.998 98.742  114.954 1.00 45.30  ? 73   ASN G CA    1 
ATOM   4863  C  C     . ASN G 3 165 ? 104.734 97.321  115.440 1.00 45.30  ? 73   ASN G C     1 
ATOM   4864  O  O     . ASN G 3 165 ? 105.625 96.468  115.353 1.00 45.30  ? 73   ASN G O     1 
ATOM   4865  C  CB    . ASN G 3 165 ? 106.417 99.163  115.340 1.00 45.30  ? 73   ASN G CB    1 
ATOM   4866  C  CG    . ASN G 3 165 ? 106.921 100.343 114.540 1.00 45.30  ? 73   ASN G CG    1 
ATOM   4867  O  OD1   . ASN G 3 165 ? 106.140 101.142 114.027 1.00 45.30  ? 73   ASN G OD1   1 
ATOM   4868  N  ND2   . ASN G 3 165 ? 108.240 100.458 114.429 1.00 45.30  ? 73   ASN G ND2   1 
ATOM   4869  N  N     . LYS G 3 166 ? 103.514 97.066  115.936 1.00 47.64  ? 74   LYS G N     1 
ATOM   4870  C  CA    . LYS G 3 166 ? 103.039 95.758  116.412 1.00 47.64  ? 74   LYS G CA    1 
ATOM   4871  C  C     . LYS G 3 166 ? 103.929 95.169  117.506 1.00 47.64  ? 74   LYS G C     1 
ATOM   4872  O  O     . LYS G 3 166 ? 104.186 93.965  117.542 1.00 47.64  ? 74   LYS G O     1 
ATOM   4873  C  CB    . LYS G 3 166 ? 102.876 94.768  115.256 1.00 47.64  ? 74   LYS G CB    1 
ATOM   4874  C  CG    . LYS G 3 166 ? 101.545 94.881  114.537 1.00 47.64  ? 74   LYS G CG    1 
ATOM   4875  C  CD    . LYS G 3 166 ? 101.209 93.594  113.806 1.00 47.64  ? 74   LYS G CD    1 
ATOM   4876  C  CE    . LYS G 3 166 ? 100.538 93.876  112.474 1.00 47.64  ? 74   LYS G CE    1 
ATOM   4877  N  NZ    . LYS G 3 166 ? 100.267 92.625  111.714 1.00 47.64  ? 74   LYS G NZ    1 
ATOM   4878  N  N     . LYS G 3 167 ? 104.395 96.023  118.410 1.00 52.81  ? 75   LYS G N     1 
ATOM   4879  C  CA    . LYS G 3 167 ? 105.195 95.612  119.554 1.00 52.81  ? 75   LYS G CA    1 
ATOM   4880  C  C     . LYS G 3 167 ? 104.557 96.168  120.817 1.00 52.81  ? 75   LYS G C     1 
ATOM   4881  O  O     . LYS G 3 167 ? 104.040 97.287  120.819 1.00 52.81  ? 75   LYS G O     1 
ATOM   4882  C  CB    . LYS G 3 167 ? 106.649 96.100  119.457 1.00 52.81  ? 75   LYS G CB    1 
ATOM   4883  C  CG    . LYS G 3 167 ? 107.373 95.748  118.174 1.00 52.81  ? 75   LYS G CG    1 
ATOM   4884  C  CD    . LYS G 3 167 ? 107.702 94.274  118.115 1.00 52.81  ? 75   LYS G CD    1 
ATOM   4885  C  CE    . LYS G 3 167 ? 108.517 93.951  116.875 1.00 52.81  ? 75   LYS G CE    1 
ATOM   4886  N  NZ    . LYS G 3 167 ? 108.912 92.516  116.823 1.00 52.81  ? 75   LYS G NZ    1 
ATOM   4887  N  N     . THR G 3 168 ? 104.601 95.393  121.892 1.00 51.12  ? 76   THR G N     1 
ATOM   4888  C  CA    . THR G 3 168 ? 104.071 95.852  123.164 1.00 51.12  ? 76   THR G CA    1 
ATOM   4889  C  C     . THR G 3 168 ? 105.162 96.327  124.109 1.00 51.12  ? 76   THR G C     1 
ATOM   4890  O  O     . THR G 3 168 ? 104.850 96.914  125.149 1.00 51.12  ? 76   THR G O     1 
ATOM   4891  C  CB    . THR G 3 168 ? 103.254 94.744  123.833 1.00 51.12  ? 76   THR G CB    1 
ATOM   4892  O  OG1   . THR G 3 168 ? 104.057 93.565  123.956 1.00 51.12  ? 76   THR G OG1   1 
ATOM   4893  C  CG2   . THR G 3 168 ? 102.017 94.431  123.009 1.00 51.12  ? 76   THR G CG2   1 
ATOM   4894  N  N     . ARG G 3 169 ? 106.423 96.094  123.769 1.00 51.12  ? 77   ARG G N     1 
ATOM   4895  C  CA    . ARG G 3 169 ? 107.558 96.490  124.588 1.00 51.12  ? 77   ARG G CA    1 
ATOM   4896  C  C     . ARG G 3 169 ? 108.245 97.678  123.930 1.00 51.12  ? 77   ARG G C     1 
ATOM   4897  O  O     . ARG G 3 169 ? 108.624 97.607  122.757 1.00 51.12  ? 77   ARG G O     1 
ATOM   4898  C  CB    . ARG G 3 169 ? 108.531 95.327  124.759 1.00 51.12  ? 77   ARG G CB    1 
ATOM   4899  C  CG    . ARG G 3 169 ? 109.737 95.653  125.599 1.00 51.12  ? 77   ARG G CG    1 
ATOM   4900  C  CD    . ARG G 3 169 ? 110.485 94.393  125.949 1.00 51.12  ? 77   ARG G CD    1 
ATOM   4901  N  NE    . ARG G 3 169 ? 109.637 93.469  126.692 1.00 51.12  ? 77   ARG G NE    1 
ATOM   4902  C  CZ    . ARG G 3 169 ? 109.543 92.172  126.430 1.00 51.12  ? 77   ARG G CZ    1 
ATOM   4903  N  NH1   . ARG G 3 169 ? 110.248 91.641  125.442 1.00 51.12  ? 77   ARG G NH1   1 
ATOM   4904  N  NH2   . ARG G 3 169 ? 108.746 91.404  127.159 1.00 51.12  ? 77   ARG G NH2   1 
ATOM   4905  N  N     . ILE G 3 170 ? 108.393 98.766  124.681 1.00 34.77  ? 78   ILE G N     1 
ATOM   4906  C  CA    . ILE G 3 170 ? 109.027 99.972  124.162 1.00 34.77  ? 78   ILE G CA    1 
ATOM   4907  C  C     . ILE G 3 170 ? 110.534 99.757  124.087 1.00 34.77  ? 78   ILE G C     1 
ATOM   4908  O  O     . ILE G 3 170 ? 111.180 99.417  125.083 1.00 34.77  ? 78   ILE G O     1 
ATOM   4909  C  CB    . ILE G 3 170 ? 108.667 101.187 125.026 1.00 34.77  ? 78   ILE G CB    1 
ATOM   4910  C  CG1   . ILE G 3 170 ? 107.211 101.584 124.781 1.00 34.77  ? 78   ILE G CG1   1 
ATOM   4911  C  CG2   . ILE G 3 170 ? 109.594 102.353 124.752 1.00 34.77  ? 78   ILE G CG2   1 
ATOM   4912  C  CD1   . ILE G 3 170 ? 106.742 102.746 125.606 1.00 34.77  ? 78   ILE G CD1   1 
ATOM   4913  N  N     . ILE G 3 171 ? 111.095 99.958  122.903 1.00 31.11  ? 79   ILE G N     1 
ATOM   4914  C  CA    . ILE G 3 171 ? 112.532 99.850  122.666 1.00 31.11  ? 79   ILE G CA    1 
ATOM   4915  C  C     . ILE G 3 171 ? 113.004 101.240 122.251 1.00 31.11  ? 79   ILE G C     1 
ATOM   4916  O  O     . ILE G 3 171 ? 112.164 102.090 121.915 1.00 31.11  ? 79   ILE G O     1 
ATOM   4917  C  CB    . ILE G 3 171 ? 112.853 98.771  121.605 1.00 31.11  ? 79   ILE G CB    1 
ATOM   4918  C  CG1   . ILE G 3 171 ? 112.270 99.155  120.250 1.00 31.11  ? 79   ILE G CG1   1 
ATOM   4919  C  CG2   . ILE G 3 171 ? 112.332 97.418  122.049 1.00 31.11  ? 79   ILE G CG2   1 
ATOM   4920  C  CD1   . ILE G 3 171 ? 112.558 98.148  119.158 1.00 31.11  ? 79   ILE G CD1   1 
ATOM   4921  N  N     . PRO G 3 172 ? 114.360 101.540 122.342 1.00 27.35  ? 80   PRO G N     1 
ATOM   4922  C  CA    . PRO G 3 172 ? 114.882 102.871 121.964 1.00 27.35  ? 80   PRO G CA    1 
ATOM   4923  C  C     . PRO G 3 172 ? 114.397 103.500 120.664 1.00 27.35  ? 80   PRO G C     1 
ATOM   4924  O  O     . PRO G 3 172 ? 114.265 104.726 120.599 1.00 27.35  ? 80   PRO G O     1 
ATOM   4925  C  CB    . PRO G 3 172 ? 116.392 102.629 121.907 1.00 27.35  ? 80   PRO G CB    1 
ATOM   4926  C  CG    . PRO G 3 172 ? 116.616 101.654 122.967 1.00 27.35  ? 80   PRO G CG    1 
ATOM   4927  C  CD    . PRO G 3 172 ? 115.417 100.758 123.017 1.00 27.35  ? 80   PRO G CD    1 
ATOM   4928  N  N     . ARG G 3 173 ? 114.193 102.683 119.626 1.00 28.11  ? 81   ARG G N     1 
ATOM   4929  C  CA    . ARG G 3 173 ? 113.680 103.179 118.351 1.00 28.11  ? 81   ARG G CA    1 
ATOM   4930  C  C     . ARG G 3 173 ? 112.320 103.854 118.519 1.00 28.11  ? 81   ARG G C     1 
ATOM   4931  O  O     . ARG G 3 173 ? 112.052 104.892 117.899 1.00 28.11  ? 81   ARG G O     1 
ATOM   4932  C  CB    . ARG G 3 173 ? 113.606 102.027 117.344 1.00 28.11  ? 81   ARG G CB    1 
ATOM   4933  C  CG    . ARG G 3 173 ? 112.916 102.340 116.019 1.00 28.11  ? 81   ARG G CG    1 
ATOM   4934  C  CD    . ARG G 3 173 ? 113.559 103.516 115.305 1.00 28.11  ? 81   ARG G CD    1 
ATOM   4935  N  NE    . ARG G 3 173 ? 113.119 103.633 113.922 1.00 28.11  ? 81   ARG G NE    1 
ATOM   4936  C  CZ    . ARG G 3 173 ? 113.610 104.515 113.061 1.00 28.11  ? 81   ARG G CZ    1 
ATOM   4937  N  NH1   . ARG G 3 173 ? 114.557 105.360 113.442 1.00 28.11  ? 81   ARG G NH1   1 
ATOM   4938  N  NH2   . ARG G 3 173 ? 113.151 104.554 111.820 1.00 28.11  ? 81   ARG G NH2   1 
ATOM   4939  N  N     . HIS G 3 174 ? 111.460 103.299 119.376 1.00 31.63  ? 82   HIS G N     1 
ATOM   4940  C  CA    . HIS G 3 174 ? 110.152 103.906 119.600 1.00 31.63  ? 82   HIS G CA    1 
ATOM   4941  C  C     . HIS G 3 174 ? 110.269 105.227 120.351 1.00 31.63  ? 82   HIS G C     1 
ATOM   4942  O  O     . HIS G 3 174 ? 109.532 106.173 120.057 1.00 31.63  ? 82   HIS G O     1 
ATOM   4943  C  CB    . HIS G 3 174 ? 109.223 102.938 120.323 1.00 31.63  ? 82   HIS G CB    1 
ATOM   4944  C  CG    . HIS G 3 174 ? 109.028 101.648 119.600 1.00 31.63  ? 82   HIS G CG    1 
ATOM   4945  N  ND1   . HIS G 3 174 ? 109.120 100.422 120.220 1.00 31.63  ? 82   HIS G ND1   1 
ATOM   4946  C  CD2   . HIS G 3 174 ? 108.744 101.393 118.302 1.00 31.63  ? 82   HIS G CD2   1 
ATOM   4947  C  CE1   . HIS G 3 174 ? 108.899 99.467  119.335 1.00 31.63  ? 82   HIS G CE1   1 
ATOM   4948  N  NE2   . HIS G 3 174 ? 108.672 100.029 118.163 1.00 31.63  ? 82   HIS G NE2   1 
ATOM   4949  N  N     . LEU G 3 175 ? 111.140 105.287 121.367 1.00 28.30  ? 83   LEU G N     1 
ATOM   4950  C  CA    . LEU G 3 175 ? 111.432 106.556 122.036 1.00 28.30  ? 83   LEU G CA    1 
ATOM   4951  C  C     . LEU G 3 175 ? 111.954 107.602 121.059 1.00 28.30  ? 83   LEU G C     1 
ATOM   4952  O  O     . LEU G 3 175 ? 111.604 108.782 121.160 1.00 28.30  ? 83   LEU G O     1 
ATOM   4953  C  CB    . LEU G 3 175 ? 112.439 106.351 123.164 1.00 28.30  ? 83   LEU G CB    1 
ATOM   4954  C  CG    . LEU G 3 175 ? 111.953 105.569 124.377 1.00 28.30  ? 83   LEU G CG    1 
ATOM   4955  C  CD1   . LEU G 3 175 ? 113.116 105.263 125.293 1.00 28.30  ? 83   LEU G CD1   1 
ATOM   4956  C  CD2   . LEU G 3 175 ? 110.904 106.368 125.104 1.00 28.30  ? 83   LEU G CD2   1 
ATOM   4957  N  N     . GLN G 3 176 ? 112.792 107.179 120.108 1.00 26.80  ? 84   GLN G N     1 
ATOM   4958  C  CA    . GLN G 3 176 ? 113.322 108.081 119.087 1.00 26.80  ? 84   GLN G CA    1 
ATOM   4959  C  C     . GLN G 3 176 ? 112.202 108.639 118.215 1.00 26.80  ? 84   GLN G C     1 
ATOM   4960  O  O     . GLN G 3 176 ? 112.130 109.851 117.980 1.00 26.80  ? 84   GLN G O     1 
ATOM   4961  C  CB    . GLN G 3 176 ? 114.362 107.353 118.235 1.00 26.80  ? 84   GLN G CB    1 
ATOM   4962  C  CG    . GLN G 3 176 ? 114.929 108.159 117.071 1.00 26.80  ? 84   GLN G CG    1 
ATOM   4963  C  CD    . GLN G 3 176 ? 116.014 109.156 117.474 1.00 26.80  ? 84   GLN G CD    1 
ATOM   4964  O  OE1   . GLN G 3 176 ? 116.190 109.481 118.646 1.00 26.80  ? 84   GLN G OE1   1 
ATOM   4965  N  NE2   . GLN G 3 176 ? 116.753 109.641 116.484 1.00 26.80  ? 84   GLN G NE2   1 
ATOM   4966  N  N     . LEU G 3 177 ? 111.364 107.747 117.668 1.00 28.77  ? 85   LEU G N     1 
ATOM   4967  C  CA    . LEU G 3 177 ? 110.192 108.158 116.891 1.00 28.77  ? 85   LEU G CA    1 
ATOM   4968  C  C     . LEU G 3 177 ? 109.274 109.083 117.684 1.00 28.77  ? 85   LEU G C     1 
ATOM   4969  O  O     . LEU G 3 177 ? 108.708 110.030 117.130 1.00 28.77  ? 85   LEU G O     1 
ATOM   4970  C  CB    . LEU G 3 177 ? 109.410 106.936 116.414 1.00 28.77  ? 85   LEU G CB    1 
ATOM   4971  C  CG    . LEU G 3 177 ? 110.102 105.998 115.432 1.00 28.77  ? 85   LEU G CG    1 
ATOM   4972  C  CD1   . LEU G 3 177 ? 109.299 104.722 115.263 1.00 28.77  ? 85   LEU G CD1   1 
ATOM   4973  C  CD2   . LEU G 3 177 ? 110.286 106.693 114.102 1.00 28.77  ? 85   LEU G CD2   1 
ATOM   4974  N  N     . ALA G 3 178 ? 109.081 108.786 118.972 1.00 29.28  ? 86   ALA G N     1 
ATOM   4975  C  CA    . ALA G 3 178 ? 108.257 109.617 119.845 1.00 29.28  ? 86   ALA G CA    1 
ATOM   4976  C  C     . ALA G 3 178 ? 108.835 111.017 119.995 1.00 29.28  ? 86   ALA G C     1 
ATOM   4977  O  O     . ALA G 3 178 ? 108.100 112.010 119.971 1.00 29.28  ? 86   ALA G O     1 
ATOM   4978  C  CB    . ALA G 3 178 ? 108.127 108.953 121.211 1.00 29.28  ? 86   ALA G CB    1 
ATOM   4979  N  N     . VAL G 3 179 ? 110.150 111.107 120.201 1.00 28.02  ? 87   VAL G N     1 
ATOM   4980  C  CA    . VAL G 3 179 ? 110.798 112.398 120.402 1.00 28.02  ? 87   VAL G CA    1 
ATOM   4981  C  C     . VAL G 3 179 ? 110.761 113.223 119.122 1.00 28.02  ? 87   VAL G C     1 
ATOM   4982  O  O     . VAL G 3 179 ? 110.367 114.395 119.129 1.00 28.02  ? 87   VAL G O     1 
ATOM   4983  C  CB    . VAL G 3 179 ? 112.240 112.192 120.901 1.00 28.02  ? 87   VAL G CB    1 
ATOM   4984  C  CG1   . VAL G 3 179 ? 113.048 113.457 120.754 1.00 28.02  ? 87   VAL G CG1   1 
ATOM   4985  C  CG2   . VAL G 3 179 ? 112.236 111.770 122.353 1.00 28.02  ? 87   VAL G CG2   1 
ATOM   4986  N  N     . ARG G 3 180 ? 111.131 112.616 117.998 1.00 26.91  ? 88   ARG G N     1 
ATOM   4987  C  CA    . ARG G 3 180 ? 111.286 113.386 116.773 1.00 26.91  ? 88   ARG G CA    1 
ATOM   4988  C  C     . ARG G 3 180 ? 109.974 113.741 116.082 1.00 26.91  ? 88   ARG G C     1 
ATOM   4989  O  O     . ARG G 3 180 ? 109.969 114.651 115.248 1.00 26.91  ? 88   ARG G O     1 
ATOM   4990  C  CB    . ARG G 3 180 ? 112.176 112.636 115.801 1.00 26.91  ? 88   ARG G CB    1 
ATOM   4991  C  CG    . ARG G 3 180 ? 113.553 112.289 116.329 1.00 26.91  ? 88   ARG G CG    1 
ATOM   4992  C  CD    . ARG G 3 180 ? 114.283 113.482 116.908 1.00 26.91  ? 88   ARG G CD    1 
ATOM   4993  N  NE    . ARG G 3 180 ? 115.450 113.051 117.669 1.00 26.91  ? 88   ARG G NE    1 
ATOM   4994  C  CZ    . ARG G 3 180 ? 116.236 113.865 118.361 1.00 26.91  ? 88   ARG G CZ    1 
ATOM   4995  N  NH1   . ARG G 3 180 ? 115.987 115.164 118.390 1.00 26.91  ? 88   ARG G NH1   1 
ATOM   4996  N  NH2   . ARG G 3 180 ? 117.275 113.377 119.021 1.00 26.91  ? 88   ARG G NH2   1 
ATOM   4997  N  N     . ASN G 3 181 ? 108.871 113.063 116.389 1.00 30.47  ? 89   ASN G N     1 
ATOM   4998  C  CA    . ASN G 3 181 ? 107.595 113.399 115.765 1.00 30.47  ? 89   ASN G CA    1 
ATOM   4999  C  C     . ASN G 3 181 ? 106.807 114.434 116.549 1.00 30.47  ? 89   ASN G C     1 
ATOM   5000  O  O     . ASN G 3 181 ? 105.728 114.837 116.106 1.00 30.47  ? 89   ASN G O     1 
ATOM   5001  C  CB    . ASN G 3 181 ? 106.729 112.152 115.573 1.00 30.47  ? 89   ASN G CB    1 
ATOM   5002  C  CG    . ASN G 3 181 ? 107.153 111.326 114.381 1.00 30.47  ? 89   ASN G CG    1 
ATOM   5003  O  OD1   . ASN G 3 181 ? 107.500 111.866 113.332 1.00 30.47  ? 89   ASN G OD1   1 
ATOM   5004  N  ND2   . ASN G 3 181 ? 107.113 110.009 114.529 1.00 30.47  ? 89   ASN G ND2   1 
ATOM   5005  N  N     . ASP G 3 182 ? 107.305 114.861 117.700 1.00 35.02  ? 90   ASP G N     1 
ATOM   5006  C  CA    . ASP G 3 182 ? 106.711 115.946 118.465 1.00 35.02  ? 90   ASP G CA    1 
ATOM   5007  C  C     . ASP G 3 182 ? 107.631 117.145 118.274 1.00 35.02  ? 90   ASP G C     1 
ATOM   5008  O  O     . ASP G 3 182 ? 108.805 117.087 118.656 1.00 35.02  ? 90   ASP G O     1 
ATOM   5009  C  CB    . ASP G 3 182 ? 106.574 115.556 119.941 1.00 35.02  ? 90   ASP G CB    1 
ATOM   5010  C  CG    . ASP G 3 182 ? 105.706 116.521 120.752 1.00 35.02  ? 90   ASP G CG    1 
ATOM   5011  O  OD1   . ASP G 3 182 ? 105.500 117.682 120.348 1.00 35.02  ? 90   ASP G OD1   1 
ATOM   5012  O  OD2   . ASP G 3 182 ? 105.219 116.102 121.823 1.00 35.02  ? 90   ASP G OD2   1 
ATOM   5013  N  N     . GLU G 3 183 ? 107.110 118.190 117.618 1.00 38.40  ? 91   GLU G N     1 
ATOM   5014  C  CA    . GLU G 3 183 ? 107.894 119.389 117.319 1.00 38.40  ? 91   GLU G CA    1 
ATOM   5015  C  C     . GLU G 3 183 ? 108.445 120.054 118.580 1.00 38.40  ? 91   GLU G C     1 
ATOM   5016  O  O     . GLU G 3 183 ? 109.608 120.475 118.608 1.00 38.40  ? 91   GLU G O     1 
ATOM   5017  C  CB    . GLU G 3 183 ? 107.060 120.368 116.486 1.00 38.40  ? 91   GLU G CB    1 
ATOM   5018  C  CG    . GLU G 3 183 ? 105.673 120.677 117.022 1.00 38.40  ? 91   GLU G CG    1 
ATOM   5019  C  CD    . GLU G 3 183 ? 104.916 121.655 116.146 1.00 38.40  ? 91   GLU G CD    1 
ATOM   5020  O  OE1   . GLU G 3 183 ? 105.320 121.848 114.980 1.00 38.40  ? 91   GLU G OE1   1 
ATOM   5021  O  OE2   . GLU G 3 183 ? 103.916 122.230 116.623 1.00 38.40  ? 91   GLU G OE2   1 
ATOM   5022  N  N     . GLU G 3 184 ? 107.638 120.133 119.642 1.00 33.66  ? 92   GLU G N     1 
ATOM   5023  C  CA    . GLU G 3 184 ? 108.083 120.827 120.845 1.00 33.66  ? 92   GLU G CA    1 
ATOM   5024  C  C     . GLU G 3 184 ? 109.092 119.991 121.622 1.00 33.66  ? 92   GLU G C     1 
ATOM   5025  O  O     . GLU G 3 184 ? 110.014 120.541 122.235 1.00 33.66  ? 92   GLU G O     1 
ATOM   5026  C  CB    . GLU G 3 184 ? 106.888 121.191 121.721 1.00 33.66  ? 92   GLU G CB    1 
ATOM   5027  C  CG    . GLU G 3 184 ? 105.949 122.200 121.086 1.00 33.66  ? 92   GLU G CG    1 
ATOM   5028  C  CD    . GLU G 3 184 ? 104.653 121.581 120.613 1.00 33.66  ? 92   GLU G CD    1 
ATOM   5029  O  OE1   . GLU G 3 184 ? 103.604 122.256 120.686 1.00 33.66  ? 92   GLU G OE1   1 
ATOM   5030  O  OE2   . GLU G 3 184 ? 104.683 120.419 120.167 1.00 33.66  ? 92   GLU G OE2   1 
ATOM   5031  N  N     . LEU G 3 185 ? 108.944 118.666 121.592 1.00 31.98  ? 93   LEU G N     1 
ATOM   5032  C  CA    . LEU G 3 185 ? 109.954 117.801 122.190 1.00 31.98  ? 93   LEU G CA    1 
ATOM   5033  C  C     . LEU G 3 185 ? 111.236 117.826 121.375 1.00 31.98  ? 93   LEU G C     1 
ATOM   5034  O  O     . LEU G 3 185 ? 112.334 117.749 121.939 1.00 31.98  ? 93   LEU G O     1 
ATOM   5035  C  CB    . LEU G 3 185 ? 109.426 116.378 122.323 1.00 31.98  ? 93   LEU G CB    1 
ATOM   5036  C  CG    . LEU G 3 185 ? 108.459 116.189 123.482 1.00 31.98  ? 93   LEU G CG    1 
ATOM   5037  C  CD1   . LEU G 3 185 ? 107.856 114.808 123.438 1.00 31.98  ? 93   LEU G CD1   1 
ATOM   5038  C  CD2   . LEU G 3 185 ? 109.201 116.403 124.785 1.00 31.98  ? 93   LEU G CD2   1 
ATOM   5039  N  N     . ASN G 3 186 ? 111.109 117.870 120.043 1.00 32.01  ? 94   ASN G N     1 
ATOM   5040  C  CA    . ASN G 3 186 ? 112.272 118.042 119.177 1.00 32.01  ? 94   ASN G CA    1 
ATOM   5041  C  C     . ASN G 3 186 ? 113.008 119.339 119.486 1.00 32.01  ? 94   ASN G C     1 
ATOM   5042  O  O     . ASN G 3 186 ? 114.241 119.388 119.424 1.00 32.01  ? 94   ASN G O     1 
ATOM   5043  C  CB    . ASN G 3 186 ? 111.854 118.005 117.710 1.00 32.01  ? 94   ASN G CB    1 
ATOM   5044  C  CG    . ASN G 3 186 ? 113.039 118.075 116.772 1.00 32.01  ? 94   ASN G CG    1 
ATOM   5045  O  OD1   . ASN G 3 186 ? 113.966 117.274 116.866 1.00 32.01  ? 94   ASN G OD1   1 
ATOM   5046  N  ND2   . ASN G 3 186 ? 113.015 119.038 115.860 1.00 32.01  ? 94   ASN G ND2   1 
ATOM   5047  N  N     . LYS G 3 187 ? 112.269 120.398 119.827 1.00 35.38  ? 95   LYS G N     1 
ATOM   5048  C  CA    . LYS G 3 187 ? 112.918 121.655 120.178 1.00 35.38  ? 95   LYS G CA    1 
ATOM   5049  C  C     . LYS G 3 187 ? 113.558 121.564 121.555 1.00 35.38  ? 95   LYS G C     1 
ATOM   5050  O  O     . LYS G 3 187 ? 114.633 122.129 121.782 1.00 35.38  ? 95   LYS G O     1 
ATOM   5051  C  CB    . LYS G 3 187 ? 111.914 122.804 120.150 1.00 35.38  ? 95   LYS G CB    1 
ATOM   5052  C  CG    . LYS G 3 187 ? 111.503 123.262 118.770 1.00 35.38  ? 95   LYS G CG    1 
ATOM   5053  C  CD    . LYS G 3 187 ? 110.114 123.866 118.812 1.00 35.38  ? 95   LYS G CD    1 
ATOM   5054  C  CE    . LYS G 3 187 ? 109.777 124.577 117.520 1.00 35.38  ? 95   LYS G CE    1 
ATOM   5055  N  NZ    . LYS G 3 187 ? 108.527 125.369 117.661 1.00 35.38  ? 95   LYS G NZ    1 
ATOM   5056  N  N     . LEU G 3 188 ? 112.898 120.871 122.485 1.00 33.18  ? 96   LEU G N     1 
ATOM   5057  C  CA    . LEU G 3 188 ? 113.478 120.633 123.801 1.00 33.18  ? 96   LEU G CA    1 
ATOM   5058  C  C     . LEU G 3 188 ? 114.673 119.689 123.729 1.00 33.18  ? 96   LEU G C     1 
ATOM   5059  O  O     . LEU G 3 188 ? 115.610 119.813 124.526 1.00 33.18  ? 96   LEU G O     1 
ATOM   5060  C  CB    . LEU G 3 188 ? 112.406 120.076 124.740 1.00 33.18  ? 96   LEU G CB    1 
ATOM   5061  C  CG    . LEU G 3 188 ? 112.767 119.582 126.142 1.00 33.18  ? 96   LEU G CG    1 
ATOM   5062  C  CD1   . LEU G 3 188 ? 113.426 120.671 126.959 1.00 33.18  ? 96   LEU G CD1   1 
ATOM   5063  C  CD2   . LEU G 3 188 ? 111.530 119.054 126.839 1.00 33.18  ? 96   LEU G CD2   1 
ATOM   5064  N  N     . LEU G 3 189 ? 114.682 118.769 122.764 1.00 28.24  ? 97   LEU G N     1 
ATOM   5065  C  CA    . LEU G 3 189 ? 115.765 117.798 122.676 1.00 28.24  ? 97   LEU G CA    1 
ATOM   5066  C  C     . LEU G 3 189 ? 116.530 117.903 121.364 1.00 28.24  ? 97   LEU G C     1 
ATOM   5067  O  O     . LEU G 3 189 ? 116.826 116.883 120.733 1.00 28.24  ? 97   LEU G O     1 
ATOM   5068  C  CB    . LEU G 3 189 ? 115.219 116.381 122.847 1.00 28.24  ? 97   LEU G CB    1 
ATOM   5069  C  CG    . LEU G 3 189 ? 114.401 116.143 124.115 1.00 28.24  ? 97   LEU G CG    1 
ATOM   5070  C  CD1   . LEU G 3 189 ? 113.846 114.736 124.147 1.00 28.24  ? 97   LEU G CD1   1 
ATOM   5071  C  CD2   . LEU G 3 189 ? 115.202 116.433 125.363 1.00 28.24  ? 97   LEU G CD2   1 
ATOM   5072  N  N     . GLY G 3 190 ? 116.861 119.126 120.941 1.00 28.41  ? 98   GLY G N     1 
ATOM   5073  C  CA    . GLY G 3 190 ? 117.558 119.307 119.679 1.00 28.41  ? 98   GLY G CA    1 
ATOM   5074  C  C     . GLY G 3 190 ? 119.033 118.981 119.726 1.00 28.41  ? 98   GLY G C     1 
ATOM   5075  O  O     . GLY G 3 190 ? 119.637 118.735 118.678 1.00 28.41  ? 98   GLY G O     1 
ATOM   5076  N  N     . ARG G 3 191 ? 119.618 118.957 120.919 1.00 26.06  ? 99   ARG G N     1 
ATOM   5077  C  CA    . ARG G 3 191 ? 121.018 118.612 121.114 1.00 26.06  ? 99   ARG G CA    1 
ATOM   5078  C  C     . ARG G 3 191 ? 121.163 117.242 121.750 1.00 26.06  ? 99   ARG G C     1 
ATOM   5079  O  O     . ARG G 3 191 ? 122.251 116.890 122.213 1.00 26.06  ? 99   ARG G O     1 
ATOM   5080  C  CB    . ARG G 3 191 ? 121.715 119.660 121.981 1.00 26.06  ? 99   ARG G CB    1 
ATOM   5081  C  CG    . ARG G 3 191 ? 121.771 121.059 121.390 1.00 26.06  ? 99   ARG G CG    1 
ATOM   5082  C  CD    . ARG G 3 191 ? 122.350 121.074 119.985 1.00 26.06  ? 99   ARG G CD    1 
ATOM   5083  N  NE    . ARG G 3 191 ? 122.248 122.402 119.386 1.00 26.06  ? 99   ARG G NE    1 
ATOM   5084  C  CZ    . ARG G 3 191 ? 122.438 122.660 118.096 1.00 26.06  ? 99   ARG G CZ    1 
ATOM   5085  N  NH1   . ARG G 3 191 ? 122.743 121.678 117.258 1.00 26.06  ? 99   ARG G NH1   1 
ATOM   5086  N  NH2   . ARG G 3 191 ? 122.320 123.900 117.643 1.00 26.06  ? 99   ARG G NH2   1 
ATOM   5087  N  N     . VAL G 3 192 ? 120.088 116.476 121.798 1.00 24.62  ? 100  VAL G N     1 
ATOM   5088  C  CA    . VAL G 3 192 ? 120.066 115.180 122.453 1.00 24.62  ? 100  VAL G CA    1 
ATOM   5089  C  C     . VAL G 3 192 ? 120.167 114.071 121.418 1.00 24.62  ? 100  VAL G C     1 
ATOM   5090  O  O     . VAL G 3 192 ? 119.563 114.135 120.342 1.00 24.62  ? 100  VAL G O     1 
ATOM   5091  C  CB    . VAL G 3 192 ? 118.771 115.082 123.284 1.00 24.62  ? 100  VAL G CB    1 
ATOM   5092  C  CG1   . VAL G 3 192 ? 118.640 113.751 123.961 1.00 24.62  ? 100  VAL G CG1   1 
ATOM   5093  C  CG2   . VAL G 3 192 ? 118.742 116.195 124.303 1.00 24.62  ? 100  VAL G CG2   1 
ATOM   5094  N  N     . THR G 3 193 ? 120.932 113.036 121.752 1.00 24.42  ? 101  THR G N     1 
ATOM   5095  C  CA    . THR G 3 193 ? 121.062 111.841 120.937 1.00 24.42  ? 101  THR G CA    1 
ATOM   5096  C  C     . THR G 3 193 ? 120.588 110.644 121.746 1.00 24.42  ? 101  THR G C     1 
ATOM   5097  O  O     . THR G 3 193 ? 121.078 110.407 122.854 1.00 24.42  ? 101  THR G O     1 
ATOM   5098  C  CB    . THR G 3 193 ? 122.508 111.645 120.490 1.00 24.42  ? 101  THR G CB    1 
ATOM   5099  O  OG1   . THR G 3 193 ? 122.857 112.666 119.549 1.00 24.42  ? 101  THR G OG1   1 
ATOM   5100  C  CG2   . THR G 3 193 ? 122.683 110.292 119.848 1.00 24.42  ? 101  THR G CG2   1 
ATOM   5101  N  N     . ILE G 3 194 ? 119.654 109.884 121.188 1.00 23.23  ? 102  ILE G N     1 
ATOM   5102  C  CA    . ILE G 3 194 ? 119.124 108.689 121.826 1.00 23.23  ? 102  ILE G CA    1 
ATOM   5103  C  C     . ILE G 3 194 ? 119.901 107.495 121.296 1.00 23.23  ? 102  ILE G C     1 
ATOM   5104  O  O     . ILE G 3 194 ? 119.946 107.274 120.080 1.00 23.23  ? 102  ILE G O     1 
ATOM   5105  C  CB    . ILE G 3 194 ? 117.622 108.535 121.557 1.00 23.23  ? 102  ILE G CB    1 
ATOM   5106  C  CG1   . ILE G 3 194 ? 116.849 109.684 122.198 1.00 23.23  ? 102  ILE G CG1   1 
ATOM   5107  C  CG2   . ILE G 3 194 ? 117.126 107.207 122.071 1.00 23.23  ? 102  ILE G CG2   1 
ATOM   5108  C  CD1   . ILE G 3 194 ? 115.374 109.657 121.898 1.00 23.23  ? 102  ILE G CD1   1 
ATOM   5109  N  N     . ALA G 3 195 ? 120.545 106.757 122.202 1.00 24.09  ? 103  ALA G N     1 
ATOM   5110  C  CA    . ALA G 3 195 ? 121.330 105.588 121.823 1.00 24.09  ? 103  ALA G CA    1 
ATOM   5111  C  C     . ALA G 3 195 ? 120.444 104.523 121.196 1.00 24.09  ? 103  ALA G C     1 
ATOM   5112  O  O     . ALA G 3 195 ? 119.327 104.277 121.658 1.00 24.09  ? 103  ALA G O     1 
ATOM   5113  C  CB    . ALA G 3 195 ? 122.056 105.013 123.036 1.00 24.09  ? 103  ALA G CB    1 
ATOM   5114  N  N     . GLN G 3 196 ? 120.944 103.929 120.103 1.00 26.56  ? 104  GLN G N     1 
ATOM   5115  C  CA    . GLN G 3 196 ? 120.270 102.907 119.294 1.00 26.56  ? 104  GLN G CA    1 
ATOM   5116  C  C     . GLN G 3 196 ? 118.969 103.423 118.684 1.00 26.56  ? 104  GLN G C     1 
ATOM   5117  O  O     . GLN G 3 196 ? 118.083 102.633 118.352 1.00 26.56  ? 104  GLN G O     1 
ATOM   5118  C  CB    . GLN G 3 196 ? 120.005 101.609 120.075 1.00 26.56  ? 104  GLN G CB    1 
ATOM   5119  C  CG    . GLN G 3 196 ? 121.135 101.143 120.981 1.00 26.56  ? 104  GLN G CG    1 
ATOM   5120  C  CD    . GLN G 3 196 ? 122.401 100.836 120.224 1.00 26.56  ? 104  GLN G CD    1 
ATOM   5121  O  OE1   . GLN G 3 196 ? 122.474 99.854  119.489 1.00 26.56  ? 104  GLN G OE1   1 
ATOM   5122  N  NE2   . GLN G 3 196 ? 123.412 101.678 120.397 1.00 26.56  ? 104  GLN G NE2   1 
ATOM   5123  N  N     . GLY G 3 197 ? 118.827 104.743 118.544 1.00 28.67  ? 105  GLY G N     1 
ATOM   5124  C  CA    . GLY G 3 197 ? 117.582 105.301 118.052 1.00 28.67  ? 105  GLY G CA    1 
ATOM   5125  C  C     . GLY G 3 197 ? 117.432 105.315 116.549 1.00 28.67  ? 105  GLY G C     1 
ATOM   5126  O  O     . GLY G 3 197 ? 116.326 105.121 116.038 1.00 28.67  ? 105  GLY G O     1 
ATOM   5127  N  N     . GLY G 3 198 ? 118.518 105.533 115.817 1.00 29.67  ? 106  GLY G N     1 
ATOM   5128  C  CA    . GLY G 3 198 ? 118.411 105.592 114.372 1.00 29.67  ? 106  GLY G CA    1 
ATOM   5129  C  C     . GLY G 3 198 ? 117.977 106.968 113.892 1.00 29.67  ? 106  GLY G C     1 
ATOM   5130  O  O     . GLY G 3 198 ? 118.216 107.984 114.544 1.00 29.67  ? 106  GLY G O     1 
ATOM   5131  N  N     . VAL G 3 199 ? 117.342 106.996 112.713 1.00 28.05  ? 107  VAL G N     1 
ATOM   5132  C  CA    . VAL G 3 199 ? 116.946 108.233 112.041 1.00 28.05  ? 107  VAL G CA    1 
ATOM   5133  C  C     . VAL G 3 199 ? 115.529 108.028 111.509 1.00 28.05  ? 107  VAL G C     1 
ATOM   5134  O  O     . VAL G 3 199 ? 115.069 106.896 111.339 1.00 28.05  ? 107  VAL G O     1 
ATOM   5135  C  CB    . VAL G 3 199 ? 117.899 108.645 110.871 1.00 28.05  ? 107  VAL G CB    1 
ATOM   5136  C  CG1   . VAL G 3 199 ? 117.816 110.147 110.543 1.00 28.05  ? 107  VAL G CG1   1 
ATOM   5137  C  CG2   . VAL G 3 199 ? 119.333 108.285 111.122 1.00 28.05  ? 107  VAL G CG2   1 
ATOM   5138  N  N     . LEU G 3 200 ? 114.830 109.135 111.287 1.00 31.59  ? 108  LEU G N     1 
ATOM   5139  C  CA    . LEU G 3 200 ? 113.495 109.120 110.698 1.00 31.59  ? 108  LEU G CA    1 
ATOM   5140  C  C     . LEU G 3 200 ? 113.581 108.668 109.248 1.00 31.59  ? 108  LEU G C     1 
ATOM   5141  O  O     . LEU G 3 200 ? 114.583 108.942 108.584 1.00 31.59  ? 108  LEU G O     1 
ATOM   5142  C  CB    . LEU G 3 200 ? 112.873 110.512 110.699 1.00 31.59  ? 108  LEU G CB    1 
ATOM   5143  C  CG    . LEU G 3 200 ? 112.443 111.272 111.945 1.00 31.59  ? 108  LEU G CG    1 
ATOM   5144  C  CD1   . LEU G 3 200 ? 111.597 110.411 112.878 1.00 31.59  ? 108  LEU G CD1   1 
ATOM   5145  C  CD2   . LEU G 3 200 ? 113.657 111.915 112.612 1.00 31.59  ? 108  LEU G CD2   1 
ATOM   5146  N  N     . PRO G 3 201 ? 112.605 107.926 108.744 1.00 32.94  ? 109  PRO G N     1 
ATOM   5147  C  CA    . PRO G 3 201 ? 112.577 107.639 107.302 1.00 32.94  ? 109  PRO G CA    1 
ATOM   5148  C  C     . PRO G 3 201 ? 112.345 108.884 106.450 1.00 32.94  ? 109  PRO G C     1 
ATOM   5149  O  O     . PRO G 3 201 ? 111.225 109.092 105.973 1.00 32.94  ? 109  PRO G O     1 
ATOM   5150  C  CB    . PRO G 3 201 ? 111.411 106.653 107.167 1.00 32.94  ? 109  PRO G CB    1 
ATOM   5151  C  CG    . PRO G 3 201 ? 111.298 106.013 108.504 1.00 32.94  ? 109  PRO G CG    1 
ATOM   5152  C  CD    . PRO G 3 201 ? 111.667 107.078 109.496 1.00 32.94  ? 109  PRO G CD    1 
ATOM   5153  N  N     . ASN G 3 202 ? 113.366 109.724 106.253 1.00 33.46  ? 110  ASN G N     1 
ATOM   5154  C  CA    . ASN G 3 202 ? 113.231 110.941 105.452 1.00 33.46  ? 110  ASN G CA    1 
ATOM   5155  C  C     . ASN G 3 202 ? 114.087 110.831 104.194 1.00 33.46  ? 110  ASN G C     1 
ATOM   5156  O  O     . ASN G 3 202 ? 115.319 110.894 104.257 1.00 33.46  ? 110  ASN G O     1 
ATOM   5157  C  CB    . ASN G 3 202 ? 113.583 112.205 106.248 1.00 33.46  ? 110  ASN G CB    1 
ATOM   5158  C  CG    . ASN G 3 202 ? 114.837 112.063 107.102 1.00 33.46  ? 110  ASN G CG    1 
ATOM   5159  O  OD1   . ASN G 3 202 ? 115.566 111.080 107.023 1.00 33.46  ? 110  ASN G OD1   1 
ATOM   5160  N  ND2   . ASN G 3 202 ? 115.098 113.076 107.919 1.00 33.46  ? 110  ASN G ND2   1 
ATOM   5161  N  N     . ILE G 3 203 ? 113.439 110.664 103.046 1.00 35.22  ? 111  ILE G N     1 
ATOM   5162  C  CA    . ILE G 3 203 ? 114.127 110.629 101.763 1.00 35.22  ? 111  ILE G CA    1 
ATOM   5163  C  C     . ILE G 3 203 ? 113.762 111.896 100.998 1.00 35.22  ? 111  ILE G C     1 
ATOM   5164  O  O     . ILE G 3 203 ? 112.582 112.248 100.876 1.00 35.22  ? 111  ILE G O     1 
ATOM   5165  C  CB    . ILE G 3 203 ? 113.814 109.338 100.977 1.00 35.22  ? 111  ILE G CB    1 
ATOM   5166  C  CG1   . ILE G 3 203 ? 114.611 109.289 99.672  1.00 35.22  ? 111  ILE G CG1   1 
ATOM   5167  C  CG2   . ILE G 3 203 ? 112.308 109.079 100.799 1.00 35.22  ? 111  ILE G CG2   1 
ATOM   5168  C  CD1   . ILE G 3 203 ? 116.097 109.153 99.879  1.00 35.22  ? 111  ILE G CD1   1 
ATOM   5169  N  N     . GLN G 3 204 ? 114.787 112.631 100.574 1.00 36.14  ? 112  GLN G N     1 
ATOM   5170  C  CA    . GLN G 3 204 ? 114.584 113.887 99.864  1.00 36.14  ? 112  GLN G CA    1 
ATOM   5171  C  C     . GLN G 3 204 ? 113.941 113.655 98.503  1.00 36.14  ? 112  GLN G C     1 
ATOM   5172  O  O     . GLN G 3 204 ? 114.203 112.647 97.842  1.00 36.14  ? 112  GLN G O     1 
ATOM   5173  C  CB    . GLN G 3 204 ? 115.910 114.623 99.718  1.00 36.14  ? 112  GLN G CB    1 
ATOM   5174  C  CG    . GLN G 3 204 ? 116.487 115.059 101.048 1.00 36.14  ? 112  GLN G CG    1 
ATOM   5175  C  CD    . GLN G 3 204 ? 115.650 116.128 101.711 1.00 36.14  ? 112  GLN G CD    1 
ATOM   5176  O  OE1   . GLN G 3 204 ? 115.296 117.128 101.089 1.00 36.14  ? 112  GLN G OE1   1 
ATOM   5177  N  NE2   . GLN G 3 204 ? 115.328 115.925 102.982 1.00 36.14  ? 112  GLN G NE2   1 
ATOM   5178  N  N     . SER G 3 205 ? 113.048 114.580 98.130  1.00 38.60  ? 113  SER G N     1 
ATOM   5179  C  CA    . SER G 3 205 ? 112.263 114.484 96.898  1.00 38.60  ? 113  SER G CA    1 
ATOM   5180  C  C     . SER G 3 205 ? 113.131 114.366 95.648  1.00 38.60  ? 113  SER G C     1 
ATOM   5181  O  O     . SER G 3 205 ? 112.786 113.631 94.715  1.00 38.60  ? 113  SER G O     1 
ATOM   5182  C  CB    . SER G 3 205 ? 111.336 115.693 96.782  1.00 38.60  ? 113  SER G CB    1 
ATOM   5183  O  OG    . SER G 3 205 ? 110.925 115.893 95.441  1.00 38.60  ? 113  SER G OG    1 
ATOM   5184  N  N     . VAL G 3 206 ? 114.245 115.102 95.602  1.00 36.46  ? 114  VAL G N     1 
ATOM   5185  C  CA    . VAL G 3 206 ? 115.115 115.153 94.431  1.00 36.46  ? 114  VAL G CA    1 
ATOM   5186  C  C     . VAL G 3 206 ? 115.778 113.808 94.123  1.00 36.46  ? 114  VAL G C     1 
ATOM   5187  O  O     . VAL G 3 206 ? 116.087 113.523 92.960  1.00 36.46  ? 114  VAL G O     1 
ATOM   5188  C  CB    . VAL G 3 206 ? 116.137 116.296 94.674  1.00 36.46  ? 114  VAL G CB    1 
ATOM   5189  C  CG1   . VAL G 3 206 ? 117.206 116.405 93.589  1.00 36.46  ? 114  VAL G CG1   1 
ATOM   5190  C  CG2   . VAL G 3 206 ? 115.407 117.622 94.823  1.00 36.46  ? 114  VAL G CG2   1 
ATOM   5191  N  N     . LEU G 3 207 ? 115.871 112.912 95.102  1.00 36.47  ? 115  LEU G N     1 
ATOM   5192  C  CA    . LEU G 3 207 ? 116.500 111.618 94.879  1.00 36.47  ? 115  LEU G CA    1 
ATOM   5193  C  C     . LEU G 3 207 ? 115.515 110.553 94.417  1.00 36.47  ? 115  LEU G C     1 
ATOM   5194  O  O     . LEU G 3 207 ? 115.945 109.518 93.895  1.00 36.47  ? 115  LEU G O     1 
ATOM   5195  C  CB    . LEU G 3 207 ? 117.204 111.136 96.151  1.00 36.47  ? 115  LEU G CB    1 
ATOM   5196  C  CG    . LEU G 3 207 ? 118.274 112.053 96.744  1.00 36.47  ? 115  LEU G CG    1 
ATOM   5197  C  CD1   . LEU G 3 207 ? 118.855 111.441 97.999  1.00 36.47  ? 115  LEU G CD1   1 
ATOM   5198  C  CD2   . LEU G 3 207 ? 119.367 112.330 95.743  1.00 36.47  ? 115  LEU G CD2   1 
ATOM   5199  N  N     . LEU G 3 208 ? 114.218 110.777 94.618  1.00 39.90  ? 116  LEU G N     1 
ATOM   5200  C  CA    . LEU G 3 208 ? 113.197 109.828 94.192  1.00 39.90  ? 116  LEU G CA    1 
ATOM   5201  C  C     . LEU G 3 208 ? 113.133 109.726 92.667  1.00 39.90  ? 116  LEU G C     1 
ATOM   5202  O  O     . LEU G 3 208 ? 113.316 110.732 91.974  1.00 39.90  ? 116  LEU G O     1 
ATOM   5203  C  CB    . LEU G 3 208 ? 111.835 110.243 94.737  1.00 39.90  ? 116  LEU G CB    1 
ATOM   5204  C  CG    . LEU G 3 208 ? 111.724 110.238 96.257  1.00 39.90  ? 116  LEU G CG    1 
ATOM   5205  C  CD1   . LEU G 3 208 ? 110.405 110.843 96.696  1.00 39.90  ? 116  LEU G CD1   1 
ATOM   5206  C  CD2   . LEU G 3 208 ? 111.867 108.823 96.777  1.00 39.90  ? 116  LEU G CD2   1 
ATOM   5207  N  N     . PRO G 3 209 ? 112.944 108.515 92.129  1.00 42.09  ? 117  PRO G N     1 
ATOM   5208  C  CA    . PRO G 3 209 ? 112.892 108.315 90.672  1.00 42.09  ? 117  PRO G CA    1 
ATOM   5209  C  C     . PRO G 3 209 ? 111.788 109.113 89.988  1.00 42.09  ? 117  PRO G C     1 
ATOM   5210  O  O     . PRO G 3 209 ? 110.734 109.381 90.567  1.00 42.09  ? 117  PRO G O     1 
ATOM   5211  C  CB    . PRO G 3 209 ? 112.652 106.809 90.536  1.00 42.09  ? 117  PRO G CB    1 
ATOM   5212  C  CG    . PRO G 3 209 ? 113.193 106.227 91.783  1.00 42.09  ? 117  PRO G CG    1 
ATOM   5213  C  CD    . PRO G 3 209 ? 112.903 107.234 92.852  1.00 42.09  ? 117  PRO G CD    1 
ATOM   5214  N  N     . LYS G 3 210 ? 112.047 109.493 88.743  1.00 41.07  ? 118  LYS G N     1 
ATOM   5215  C  CA    . LYS G 3 210 ? 111.096 110.256 87.949  1.00 41.07  ? 118  LYS G CA    1 
ATOM   5216  C  C     . LYS G 3 210 ? 110.897 109.614 86.583  1.00 41.07  ? 118  LYS G C     1 
ATOM   5217  O  O     . LYS G 3 210 ? 111.376 108.508 86.333  1.00 41.07  ? 118  LYS G O     1 
ATOM   5218  C  CB    . LYS G 3 210 ? 111.584 111.692 87.783  1.00 41.07  ? 118  LYS G CB    1 
ATOM   5219  C  CG    . LYS G 3 210 ? 112.888 111.796 87.009  1.00 41.07  ? 118  LYS G CG    1 
ATOM   5220  C  CD    . LYS G 3 210 ? 113.394 113.222 86.966  1.00 41.07  ? 118  LYS G CD    1 
ATOM   5221  C  CE    . LYS G 3 210 ? 113.870 113.659 88.338  1.00 41.07  ? 118  LYS G CE    1 
ATOM   5222  N  NZ    . LYS G 3 210 ? 115.014 112.830 88.806  1.00 41.07  ? 118  LYS G NZ    1 
ATOM   5223  N  N     . ARG H 4 27  ? 122.848 94.170  149.578 1.00 81.48  ? 26   ARG H N     1 
ATOM   5224  C  CA    . ARG H 4 27  ? 123.472 92.862  149.732 1.00 81.48  ? 26   ARG H CA    1 
ATOM   5225  C  C     . ARG H 4 27  ? 124.812 92.815  149.006 1.00 81.48  ? 26   ARG H C     1 
ATOM   5226  O  O     . ARG H 4 27  ? 124.915 92.236  147.922 1.00 81.48  ? 26   ARG H O     1 
ATOM   5227  C  CB    . ARG H 4 27  ? 122.548 91.760  149.210 1.00 81.48  ? 26   ARG H CB    1 
ATOM   5228  C  CG    . ARG H 4 27  ? 121.270 91.590  150.013 1.00 81.48  ? 26   ARG H CG    1 
ATOM   5229  C  CD    . ARG H 4 27  ? 120.385 90.448  149.539 1.00 81.48  ? 26   ARG H CD    1 
ATOM   5230  N  NE    . ARG H 4 27  ? 119.160 90.340  150.326 1.00 81.48  ? 26   ARG H NE    1 
ATOM   5231  C  CZ    . ARG H 4 27  ? 119.076 89.714  151.491 1.00 81.48  ? 26   ARG H CZ    1 
ATOM   5232  N  NH1   . ARG H 4 27  ? 120.150 89.137  152.016 1.00 81.48  ? 26   ARG H NH1   1 
ATOM   5233  N  NH2   . ARG H 4 27  ? 117.919 89.664  152.138 1.00 81.48  ? 26   ARG H NH2   1 
ATOM   5234  N  N     . ARG H 4 28  ? 125.819 93.436  149.635 1.00 82.36  ? 27   ARG H N     1 
ATOM   5235  C  CA    . ARG H 4 28  ? 127.186 93.565  149.115 1.00 82.36  ? 27   ARG H CA    1 
ATOM   5236  C  C     . ARG H 4 28  ? 127.225 94.232  147.742 1.00 82.36  ? 27   ARG H C     1 
ATOM   5237  O  O     . ARG H 4 28  ? 127.928 93.779  146.836 1.00 82.36  ? 27   ARG H O     1 
ATOM   5238  C  CB    . ARG H 4 28  ? 127.916 92.217  149.084 1.00 82.36  ? 27   ARG H CB    1 
ATOM   5239  C  CG    . ARG H 4 28  ? 128.364 91.711  150.455 1.00 82.36  ? 27   ARG H CG    1 
ATOM   5240  C  CD    . ARG H 4 28  ? 129.009 92.808  151.298 1.00 82.36  ? 27   ARG H CD    1 
ATOM   5241  N  NE    . ARG H 4 28  ? 130.206 93.361  150.669 1.00 82.36  ? 27   ARG H NE    1 
ATOM   5242  C  CZ    . ARG H 4 28  ? 130.704 94.563  150.940 1.00 82.36  ? 27   ARG H CZ    1 
ATOM   5243  N  NH1   . ARG H 4 28  ? 130.109 95.341  151.832 1.00 82.36  ? 27   ARG H NH1   1 
ATOM   5244  N  NH2   . ARG H 4 28  ? 131.796 94.986  150.319 1.00 82.36  ? 27   ARG H NH2   1 
ATOM   5245  N  N     . LYS H 4 29  ? 126.467 95.313  147.589 1.00 79.28  ? 28   LYS H N     1 
ATOM   5246  C  CA    . LYS H 4 29  ? 126.484 96.150  146.400 1.00 79.28  ? 28   LYS H CA    1 
ATOM   5247  C  C     . LYS H 4 29  ? 126.033 97.546  146.794 1.00 79.28  ? 28   LYS H C     1 
ATOM   5248  O  O     . LYS H 4 29  ? 125.084 97.699  147.569 1.00 79.28  ? 28   LYS H O     1 
ATOM   5249  C  CB    . LYS H 4 29  ? 125.577 95.593  145.292 1.00 79.28  ? 28   LYS H CB    1 
ATOM   5250  C  CG    . LYS H 4 29  ? 125.610 96.402  143.999 1.00 79.28  ? 28   LYS H CG    1 
ATOM   5251  C  CD    . LYS H 4 29  ? 124.737 95.794  142.920 1.00 79.28  ? 28   LYS H CD    1 
ATOM   5252  C  CE    . LYS H 4 29  ? 124.825 96.588  141.629 1.00 79.28  ? 28   LYS H CE    1 
ATOM   5253  N  NZ    . LYS H 4 29  ? 124.216 97.939  141.772 1.00 79.28  ? 28   LYS H NZ    1 
ATOM   5254  N  N     . THR H 4 30  ? 126.732 98.556  146.277 1.00 75.55  ? 29   THR H N     1 
ATOM   5255  C  CA    . THR H 4 30  ? 126.398 99.942  146.576 1.00 75.55  ? 29   THR H CA    1 
ATOM   5256  C  C     . THR H 4 30  ? 125.036 100.319 145.999 1.00 75.55  ? 29   THR H C     1 
ATOM   5257  O  O     . THR H 4 30  ? 124.675 99.920  144.887 1.00 75.55  ? 29   THR H O     1 
ATOM   5258  C  CB    . THR H 4 30  ? 127.486 100.881 146.044 1.00 75.55  ? 29   THR H CB    1 
ATOM   5259  O  OG1   . THR H 4 30  ? 127.038 102.239 146.135 1.00 75.55  ? 29   THR H OG1   1 
ATOM   5260  C  CG2   . THR H 4 30  ? 127.856 100.553 144.599 1.00 75.55  ? 29   THR H CG2   1 
ATOM   5261  N  N     . ARG H 4 31  ? 124.255 101.042 146.798 1.00 74.52  ? 30   ARG H N     1 
ATOM   5262  C  CA    . ARG H 4 31  ? 122.915 101.461 146.404 1.00 74.52  ? 30   ARG H CA    1 
ATOM   5263  C  C     . ARG H 4 31  ? 123.021 102.504 145.301 1.00 74.52  ? 30   ARG H C     1 
ATOM   5264  O  O     . ARG H 4 31  ? 123.501 103.617 145.532 1.00 74.52  ? 30   ARG H O     1 
ATOM   5265  C  CB    . ARG H 4 31  ? 122.163 102.012 147.611 1.00 74.52  ? 30   ARG H CB    1 
ATOM   5266  C  CG    . ARG H 4 31  ? 121.620 100.943 148.541 1.00 74.52  ? 30   ARG H CG    1 
ATOM   5267  C  CD    . ARG H 4 31  ? 121.030 101.560 149.802 1.00 74.52  ? 30   ARG H CD    1 
ATOM   5268  N  NE    . ARG H 4 31  ? 120.180 100.632 150.547 1.00 74.52  ? 30   ARG H NE    1 
ATOM   5269  C  CZ    . ARG H 4 31  ? 120.628 99.673  151.355 1.00 74.52  ? 30   ARG H CZ    1 
ATOM   5270  N  NH1   . ARG H 4 31  ? 121.931 99.499  151.543 1.00 74.52  ? 30   ARG H NH1   1 
ATOM   5271  N  NH2   . ARG H 4 31  ? 119.768 98.886  151.987 1.00 74.52  ? 30   ARG H NH2   1 
ATOM   5272  N  N     . LYS H 4 32  ? 122.571 102.152 144.105 1.00 60.46  ? 31   LYS H N     1 
ATOM   5273  C  CA    . LYS H 4 32  ? 122.535 103.069 142.971 1.00 60.46  ? 31   LYS H CA    1 
ATOM   5274  C  C     . LYS H 4 32  ? 121.074 103.375 142.671 1.00 60.46  ? 31   LYS H C     1 
ATOM   5275  O  O     . LYS H 4 32  ? 120.354 102.536 142.121 1.00 60.46  ? 31   LYS H O     1 
ATOM   5276  C  CB    . LYS H 4 32  ? 123.243 102.470 141.760 1.00 60.46  ? 31   LYS H CB    1 
ATOM   5277  C  CG    . LYS H 4 32  ? 124.737 102.726 141.732 1.00 60.46  ? 31   LYS H CG    1 
ATOM   5278  C  CD    . LYS H 4 32  ? 125.122 103.631 140.575 1.00 60.46  ? 31   LYS H CD    1 
ATOM   5279  C  CE    . LYS H 4 32  ? 126.630 103.793 140.482 1.00 60.46  ? 31   LYS H CE    1 
ATOM   5280  N  NZ    . LYS H 4 32  ? 127.035 104.577 139.284 1.00 60.46  ? 31   LYS H NZ    1 
ATOM   5281  N  N     . GLU H 4 33  ? 120.638 104.573 143.052 1.00 46.62  ? 32   GLU H N     1 
ATOM   5282  C  CA    . GLU H 4 33  ? 119.249 104.962 142.894 1.00 46.62  ? 32   GLU H CA    1 
ATOM   5283  C  C     . GLU H 4 33  ? 118.910 105.162 141.421 1.00 46.62  ? 32   GLU H C     1 
ATOM   5284  O  O     . GLU H 4 33  ? 119.783 105.263 140.555 1.00 46.62  ? 32   GLU H O     1 
ATOM   5285  C  CB    . GLU H 4 33  ? 118.961 106.243 143.673 1.00 46.62  ? 32   GLU H CB    1 
ATOM   5286  C  CG    . GLU H 4 33  ? 119.812 107.426 143.243 1.00 46.62  ? 32   GLU H CG    1 
ATOM   5287  C  CD    . GLU H 4 33  ? 119.547 108.667 144.070 1.00 46.62  ? 32   GLU H CD    1 
ATOM   5288  O  OE1   . GLU H 4 33  ? 118.682 109.475 143.673 1.00 46.62  ? 32   GLU H OE1   1 
ATOM   5289  O  OE2   . GLU H 4 33  ? 120.197 108.832 145.124 1.00 46.62  ? 32   GLU H OE2   1 
ATOM   5290  N  N     . SER H 4 34  ? 117.614 105.245 141.148 1.00 35.33  ? 33   SER H N     1 
ATOM   5291  C  CA    . SER H 4 34  ? 117.122 105.345 139.785 1.00 35.33  ? 33   SER H CA    1 
ATOM   5292  C  C     . SER H 4 34  ? 115.705 105.890 139.819 1.00 35.33  ? 33   SER H C     1 
ATOM   5293  O  O     . SER H 4 34  ? 115.126 106.121 140.883 1.00 35.33  ? 33   SER H O     1 
ATOM   5294  C  CB    . SER H 4 34  ? 117.160 103.988 139.078 1.00 35.33  ? 33   SER H CB    1 
ATOM   5295  O  OG    . SER H 4 34  ? 116.508 104.055 137.824 1.00 35.33  ? 33   SER H OG    1 
ATOM   5296  N  N     . TYR H 4 35  ? 115.157 106.097 138.632 1.00 31.92  ? 34   TYR H N     1 
ATOM   5297  C  CA    . TYR H 4 35  ? 113.777 106.500 138.441 1.00 31.92  ? 34   TYR H CA    1 
ATOM   5298  C  C     . TYR H 4 35  ? 112.941 105.393 137.826 1.00 31.92  ? 34   TYR H C     1 
ATOM   5299  O  O     . TYR H 4 35  ? 111.838 105.671 137.346 1.00 31.92  ? 34   TYR H O     1 
ATOM   5300  C  CB    . TYR H 4 35  ? 113.721 107.761 137.579 1.00 31.92  ? 34   TYR H CB    1 
ATOM   5301  C  CG    . TYR H 4 35  ? 114.157 108.992 138.329 1.00 31.92  ? 34   TYR H CG    1 
ATOM   5302  C  CD1   . TYR H 4 35  ? 113.279 109.661 139.167 1.00 31.92  ? 34   TYR H CD1   1 
ATOM   5303  C  CD2   . TYR H 4 35  ? 115.459 109.457 138.237 1.00 31.92  ? 34   TYR H CD2   1 
ATOM   5304  C  CE1   . TYR H 4 35  ? 113.673 110.781 139.862 1.00 31.92  ? 34   TYR H CE1   1 
ATOM   5305  C  CE2   . TYR H 4 35  ? 115.865 110.575 138.933 1.00 31.92  ? 34   TYR H CE2   1 
ATOM   5306  C  CZ    . TYR H 4 35  ? 114.967 111.230 139.744 1.00 31.92  ? 34   TYR H CZ    1 
ATOM   5307  O  OH    . TYR H 4 35  ? 115.366 112.345 140.438 1.00 31.92  ? 34   TYR H OH    1 
ATOM   5308  N  N     . ALA H 4 36  ? 113.489 104.173 137.771 1.00 36.24  ? 35   ALA H N     1 
ATOM   5309  C  CA    . ALA H 4 36  ? 112.893 103.023 137.091 1.00 36.24  ? 35   ALA H CA    1 
ATOM   5310  C  C     . ALA H 4 36  ? 111.442 102.755 137.483 1.00 36.24  ? 35   ALA H C     1 
ATOM   5311  O  O     . ALA H 4 36  ? 110.549 102.734 136.625 1.00 36.24  ? 35   ALA H O     1 
ATOM   5312  C  CB    . ALA H 4 36  ? 113.748 101.783 137.355 1.00 36.24  ? 35   ALA H CB    1 
ATOM   5313  N  N     . ILE H 4 37  ? 111.197 102.535 138.777 1.00 39.71  ? 36   ILE H N     1 
ATOM   5314  C  CA    . ILE H 4 37  ? 109.867 102.157 139.250 1.00 39.71  ? 36   ILE H CA    1 
ATOM   5315  C  C     . ILE H 4 37  ? 108.837 103.264 139.031 1.00 39.71  ? 36   ILE H C     1 
ATOM   5316  O  O     . ILE H 4 37  ? 107.664 102.978 138.772 1.00 39.71  ? 36   ILE H O     1 
ATOM   5317  C  CB    . ILE H 4 37  ? 109.947 101.697 140.721 1.00 39.71  ? 36   ILE H CB    1 
ATOM   5318  C  CG1   . ILE H 4 37  ? 110.325 102.842 141.658 1.00 39.71  ? 36   ILE H CG1   1 
ATOM   5319  C  CG2   . ILE H 4 37  ? 110.951 100.574 140.858 1.00 39.71  ? 36   ILE H CG2   1 
ATOM   5320  C  CD1   . ILE H 4 37  ? 110.259 102.469 143.117 1.00 39.71  ? 36   ILE H CD1   1 
ATOM   5321  N  N     . TYR H 4 38  ? 109.257 104.529 139.055 1.00 39.09  ? 37   TYR H N     1 
ATOM   5322  C  CA    . TYR H 4 38  ? 108.306 105.622 138.886 1.00 39.09  ? 37   TYR H CA    1 
ATOM   5323  C  C     . TYR H 4 38  ? 107.918 105.800 137.426 1.00 39.09  ? 37   TYR H C     1 
ATOM   5324  O  O     . TYR H 4 38  ? 106.743 106.041 137.116 1.00 39.09  ? 37   TYR H O     1 
ATOM   5325  C  CB    . TYR H 4 38  ? 108.897 106.903 139.460 1.00 39.09  ? 37   TYR H CB    1 
ATOM   5326  C  CG    . TYR H 4 38  ? 109.501 106.665 140.813 1.00 39.09  ? 37   TYR H CG    1 
ATOM   5327  C  CD1   . TYR H 4 38  ? 108.699 106.555 141.933 1.00 39.09  ? 37   TYR H CD1   1 
ATOM   5328  C  CD2   . TYR H 4 38  ? 110.872 106.533 140.969 1.00 39.09  ? 37   TYR H CD2   1 
ATOM   5329  C  CE1   . TYR H 4 38  ? 109.241 106.326 143.168 1.00 39.09  ? 37   TYR H CE1   1 
ATOM   5330  C  CE2   . TYR H 4 38  ? 111.424 106.299 142.198 1.00 39.09  ? 37   TYR H CE2   1 
ATOM   5331  C  CZ    . TYR H 4 38  ? 110.602 106.190 143.290 1.00 39.09  ? 37   TYR H CZ    1 
ATOM   5332  O  OH    . TYR H 4 38  ? 111.151 105.973 144.519 1.00 39.09  ? 37   TYR H OH    1 
ATOM   5333  N  N     . VAL H 4 39  ? 108.890 105.652 136.521 1.00 36.81  ? 38   VAL H N     1 
ATOM   5334  C  CA    . VAL H 4 39  ? 108.613 105.650 135.088 1.00 36.81  ? 38   VAL H CA    1 
ATOM   5335  C  C     . VAL H 4 39  ? 107.736 104.458 134.741 1.00 36.81  ? 38   VAL H C     1 
ATOM   5336  O  O     . VAL H 4 39  ? 106.828 104.558 133.907 1.00 36.81  ? 38   VAL H O     1 
ATOM   5337  C  CB    . VAL H 4 39  ? 109.943 105.653 134.308 1.00 36.81  ? 38   VAL H CB    1 
ATOM   5338  C  CG1   . VAL H 4 39  ? 109.725 105.454 132.828 1.00 36.81  ? 38   VAL H CG1   1 
ATOM   5339  C  CG2   . VAL H 4 39  ? 110.671 106.958 134.541 1.00 36.81  ? 38   VAL H CG2   1 
ATOM   5340  N  N     . TYR H 4 40  ? 107.922 103.350 135.458 1.00 41.48  ? 39   TYR H N     1 
ATOM   5341  C  CA    . TYR H 4 40  ? 107.104 102.166 135.239 1.00 41.48  ? 39   TYR H CA    1 
ATOM   5342  C  C     . TYR H 4 40  ? 105.670 102.387 135.712 1.00 41.48  ? 39   TYR H C     1 
ATOM   5343  O  O     . TYR H 4 40  ? 104.719 101.964 135.041 1.00 41.48  ? 39   TYR H O     1 
ATOM   5344  C  CB    . TYR H 4 40  ? 107.738 100.989 135.968 1.00 41.48  ? 39   TYR H CB    1 
ATOM   5345  C  CG    . TYR H 4 40  ? 107.296 99.659  135.456 1.00 41.48  ? 39   TYR H CG    1 
ATOM   5346  C  CD1   . TYR H 4 40  ? 107.954 99.055  134.403 1.00 41.48  ? 39   TYR H CD1   1 
ATOM   5347  C  CD2   . TYR H 4 40  ? 106.224 98.999  136.035 1.00 41.48  ? 39   TYR H CD2   1 
ATOM   5348  C  CE1   . TYR H 4 40  ? 107.550 97.842  133.932 1.00 41.48  ? 39   TYR H CE1   1 
ATOM   5349  C  CE2   . TYR H 4 40  ? 105.815 97.778  135.573 1.00 41.48  ? 39   TYR H CE2   1 
ATOM   5350  C  CZ    . TYR H 4 40  ? 106.483 97.202  134.519 1.00 41.48  ? 39   TYR H CZ    1 
ATOM   5351  O  OH    . TYR H 4 40  ? 106.077 95.977  134.047 1.00 41.48  ? 39   TYR H OH    1 
ATOM   5352  N  N     . LYS H 4 41  ? 105.506 103.033 136.872 1.00 38.27  ? 40   LYS H N     1 
ATOM   5353  C  CA    . LYS H 4 41  ? 104.183 103.403 137.374 1.00 38.27  ? 40   LYS H CA    1 
ATOM   5354  C  C     . LYS H 4 41  ? 103.449 104.320 136.401 1.00 38.27  ? 40   LYS H C     1 
ATOM   5355  O  O     . LYS H 4 41  ? 102.258 104.126 136.126 1.00 38.27  ? 40   LYS H O     1 
ATOM   5356  C  CB    . LYS H 4 41  ? 104.311 104.074 138.741 1.00 38.27  ? 40   LYS H CB    1 
ATOM   5357  C  CG    . LYS H 4 41  ? 104.592 103.126 139.894 1.00 38.27  ? 40   LYS H CG    1 
ATOM   5358  C  CD    . LYS H 4 41  ? 104.675 103.887 141.206 1.00 38.27  ? 40   LYS H CD    1 
ATOM   5359  C  CE    . LYS H 4 41  ? 104.913 102.955 142.375 1.00 38.27  ? 40   LYS H CE    1 
ATOM   5360  N  NZ    . LYS H 4 41  ? 105.013 103.710 143.651 1.00 38.27  ? 40   LYS H NZ    1 
ATOM   5361  N  N     . VAL H 4 42  ? 104.146 105.345 135.895 1.00 35.21  ? 41   VAL H N     1 
ATOM   5362  C  CA    . VAL H 4 42  ? 103.551 106.264 134.924 1.00 35.21  ? 41   VAL H CA    1 
ATOM   5363  C  C     . VAL H 4 42  ? 103.170 105.529 133.642 1.00 35.21  ? 41   VAL H C     1 
ATOM   5364  O  O     . VAL H 4 42  ? 102.096 105.769 133.068 1.00 35.21  ? 41   VAL H O     1 
ATOM   5365  C  CB    . VAL H 4 42  ? 104.511 107.438 134.656 1.00 35.21  ? 41   VAL H CB    1 
ATOM   5366  C  CG1   . VAL H 4 42  ? 104.013 108.314 133.519 1.00 35.21  ? 41   VAL H CG1   1 
ATOM   5367  C  CG2   . VAL H 4 42  ? 104.661 108.273 135.909 1.00 35.21  ? 41   VAL H CG2   1 
ATOM   5368  N  N     . LEU H 4 43  ? 104.016 104.589 133.203 1.00 37.04  ? 42   LEU H N     1 
ATOM   5369  C  CA    . LEU H 4 43  ? 103.714 103.809 132.007 1.00 37.04  ? 42   LEU H CA    1 
ATOM   5370  C  C     . LEU H 4 43  ? 102.475 102.948 132.207 1.00 37.04  ? 42   LEU H C     1 
ATOM   5371  O  O     . LEU H 4 43  ? 101.636 102.840 131.306 1.00 37.04  ? 42   LEU H O     1 
ATOM   5372  C  CB    . LEU H 4 43  ? 104.908 102.939 131.627 1.00 37.04  ? 42   LEU H CB    1 
ATOM   5373  C  CG    . LEU H 4 43  ? 104.690 102.087 130.378 1.00 37.04  ? 42   LEU H CG    1 
ATOM   5374  C  CD1   . LEU H 4 43  ? 104.304 102.955 129.188 1.00 37.04  ? 42   LEU H CD1   1 
ATOM   5375  C  CD2   . LEU H 4 43  ? 105.914 101.271 130.064 1.00 37.04  ? 42   LEU H CD2   1 
ATOM   5376  N  N     . LYS H 4 44  ? 102.320 102.365 133.397 1.00 40.03  ? 43   LYS H N     1 
ATOM   5377  C  CA    . LYS H 4 44  ? 101.121 101.577 133.660 1.00 40.03  ? 43   LYS H CA    1 
ATOM   5378  C  C     . LYS H 4 44  ? 99.887  102.450 133.834 1.00 40.03  ? 43   LYS H C     1 
ATOM   5379  O  O     . LYS H 4 44  ? 98.773  101.973 133.597 1.00 40.03  ? 43   LYS H O     1 
ATOM   5380  C  CB    . LYS H 4 44  ? 101.314 100.683 134.885 1.00 40.03  ? 43   LYS H CB    1 
ATOM   5381  C  CG    . LYS H 4 44  ? 102.383 99.627  134.701 1.00 40.03  ? 43   LYS H CG    1 
ATOM   5382  C  CD    . LYS H 4 44  ? 101.873 98.543  133.766 1.00 40.03  ? 43   LYS H CD    1 
ATOM   5383  C  CE    . LYS H 4 44  ? 102.959 97.553  133.399 1.00 40.03  ? 43   LYS H CE    1 
ATOM   5384  N  NZ    . LYS H 4 44  ? 102.413 96.411  132.617 1.00 40.03  ? 43   LYS H NZ    1 
ATOM   5385  N  N     . GLN H 4 45  ? 100.053 103.712 134.235 1.00 39.10  ? 44   GLN H N     1 
ATOM   5386  C  CA    . GLN H 4 45  ? 98.883  104.579 134.339 1.00 39.10  ? 44   GLN H CA    1 
ATOM   5387  C  C     . GLN H 4 45  ? 98.441  105.132 132.990 1.00 39.10  ? 44   GLN H C     1 
ATOM   5388  O  O     . GLN H 4 45  ? 97.252  105.416 132.811 1.00 39.10  ? 44   GLN H O     1 
ATOM   5389  C  CB    . GLN H 4 45  ? 99.136  105.729 135.309 1.00 39.10  ? 44   GLN H CB    1 
ATOM   5390  C  CG    . GLN H 4 45  ? 99.215  105.298 136.750 1.00 39.10  ? 44   GLN H CG    1 
ATOM   5391  C  CD    . GLN H 4 45  ? 99.398  106.465 137.688 1.00 39.10  ? 44   GLN H CD    1 
ATOM   5392  O  OE1   . GLN H 4 45  ? 99.734  107.571 137.267 1.00 39.10  ? 44   GLN H OE1   1 
ATOM   5393  N  NE2   . GLN H 4 45  ? 99.155  106.231 138.969 1.00 39.10  ? 44   GLN H NE2   1 
ATOM   5394  N  N     . VAL H 4 46  ? 99.353  105.295 132.037 1.00 36.56  ? 45   VAL H N     1 
ATOM   5395  C  CA    . VAL H 4 46  ? 99.004  105.872 130.744 1.00 36.56  ? 45   VAL H CA    1 
ATOM   5396  C  C     . VAL H 4 46  ? 98.712  104.793 129.707 1.00 36.56  ? 45   VAL H C     1 
ATOM   5397  O  O     . VAL H 4 46  ? 97.755  104.907 128.941 1.00 36.56  ? 45   VAL H O     1 
ATOM   5398  C  CB    . VAL H 4 46  ? 100.114 106.832 130.261 1.00 36.56  ? 45   VAL H CB    1 
ATOM   5399  C  CG1   . VAL H 4 46  ? 99.723  107.496 128.959 1.00 36.56  ? 45   VAL H CG1   1 
ATOM   5400  C  CG2   . VAL H 4 46  ? 100.360 107.901 131.300 1.00 36.56  ? 45   VAL H CG2   1 
ATOM   5401  N  N     . HIS H 4 47  ? 99.488  103.713 129.703 1.00 38.54  ? 46   HIS H N     1 
ATOM   5402  C  CA    . HIS H 4 47  ? 99.268  102.586 128.796 1.00 38.54  ? 46   HIS H CA    1 
ATOM   5403  C  C     . HIS H 4 47  ? 98.951  101.332 129.591 1.00 38.54  ? 46   HIS H C     1 
ATOM   5404  O  O     . HIS H 4 47  ? 99.754  100.882 130.417 1.00 38.54  ? 46   HIS H O     1 
ATOM   5405  C  CB    . HIS H 4 47  ? 100.479 102.358 127.889 1.00 38.54  ? 46   HIS H CB    1 
ATOM   5406  C  CG    . HIS H 4 47  ? 100.560 103.311 126.744 1.00 38.54  ? 46   HIS H CG    1 
ATOM   5407  N  ND1   . HIS H 4 47  ? 100.308 102.926 125.445 1.00 38.54  ? 46   HIS H ND1   1 
ATOM   5408  C  CD2   . HIS H 4 47  ? 100.839 104.634 126.697 1.00 38.54  ? 46   HIS H CD2   1 
ATOM   5409  C  CE1   . HIS H 4 47  ? 100.440 103.967 124.645 1.00 38.54  ? 46   HIS H CE1   1 
ATOM   5410  N  NE2   . HIS H 4 47  ? 100.760 105.017 125.380 1.00 38.54  ? 46   HIS H NE2   1 
ATOM   5411  N  N     . PRO H 4 48  ? 97.743  100.781 129.417 1.00 40.71  ? 47   PRO H N     1 
ATOM   5412  C  CA    . PRO H 4 48  ? 97.360  99.577  130.174 1.00 40.71  ? 47   PRO H CA    1 
ATOM   5413  C  C     . PRO H 4 48  ? 98.244  98.368  129.909 1.00 40.71  ? 47   PRO H C     1 
ATOM   5414  O  O     . PRO H 4 48  ? 98.910  97.884  130.833 1.00 40.71  ? 47   PRO H O     1 
ATOM   5415  C  CB    . PRO H 4 48  ? 95.918  99.324  129.713 1.00 40.71  ? 47   PRO H CB    1 
ATOM   5416  C  CG    . PRO H 4 48  ? 95.434  100.647 129.228 1.00 40.71  ? 47   PRO H CG    1 
ATOM   5417  C  CD    . PRO H 4 48  ? 96.627  101.304 128.612 1.00 40.71  ? 47   PRO H CD    1 
ATOM   5418  N  N     . ASP H 4 49  ? 98.291  97.881  128.674 1.00 42.22  ? 48   ASP H N     1 
ATOM   5419  C  CA    . ASP H 4 49  ? 99.085  96.700  128.341 1.00 42.22  ? 48   ASP H CA    1 
ATOM   5420  C  C     . ASP H 4 49  ? 100.310 97.085  127.517 1.00 42.22  ? 48   ASP H C     1 
ATOM   5421  O  O     . ASP H 4 49  ? 100.297 97.047  126.288 1.00 42.22  ? 48   ASP H O     1 
ATOM   5422  C  CB    . ASP H 4 49  ? 98.226  95.677  127.607 1.00 42.22  ? 48   ASP H CB    1 
ATOM   5423  C  CG    . ASP H 4 49  ? 98.644  94.254  127.901 1.00 42.22  ? 48   ASP H CG    1 
ATOM   5424  O  OD1   . ASP H 4 49  ? 99.726  94.067  128.495 1.00 42.22  ? 48   ASP H OD1   1 
ATOM   5425  O  OD2   . ASP H 4 49  ? 97.897  93.322  127.536 1.00 42.22  ? 48   ASP H OD2   1 
ATOM   5426  N  N     . THR H 4 50  ? 101.382 97.463  128.211 1.00 40.65  ? 49   THR H N     1 
ATOM   5427  C  CA    . THR H 4 50  ? 102.618 97.877  127.562 1.00 40.65  ? 49   THR H CA    1 
ATOM   5428  C  C     . THR H 4 50  ? 103.758 97.690  128.552 1.00 40.65  ? 49   THR H C     1 
ATOM   5429  O  O     . THR H 4 50  ? 103.635 98.053  129.723 1.00 40.65  ? 49   THR H O     1 
ATOM   5430  C  CB    . THR H 4 50  ? 102.545 99.345  127.088 1.00 40.65  ? 49   THR H CB    1 
ATOM   5431  O  OG1   . THR H 4 50  ? 101.536 99.487  126.079 1.00 40.65  ? 49   THR H OG1   1 
ATOM   5432  C  CG2   . THR H 4 50  ? 103.867 99.831  126.506 1.00 40.65  ? 49   THR H CG2   1 
ATOM   5433  N  N     . GLY H 4 51  ? 104.865 97.122  128.076 1.00 40.90  ? 50   GLY H N     1 
ATOM   5434  C  CA    . GLY H 4 51  ? 106.063 96.974  128.864 1.00 40.90  ? 50   GLY H CA    1 
ATOM   5435  C  C     . GLY H 4 51  ? 107.140 97.913  128.351 1.00 40.90  ? 50   GLY H C     1 
ATOM   5436  O  O     . GLY H 4 51  ? 106.919 98.729  127.461 1.00 40.90  ? 50   GLY H O     1 
ATOM   5437  N  N     . ILE H 4 52  ? 108.322 97.790  128.939 1.00 36.08  ? 51   ILE H N     1 
ATOM   5438  C  CA    . ILE H 4 52  ? 109.427 98.662  128.563 1.00 36.08  ? 51   ILE H CA    1 
ATOM   5439  C  C     . ILE H 4 52  ? 110.743 97.921  128.778 1.00 36.08  ? 51   ILE H C     1 
ATOM   5440  O  O     . ILE H 4 52  ? 110.927 97.232  129.785 1.00 36.08  ? 51   ILE H O     1 
ATOM   5441  C  CB    . ILE H 4 52  ? 109.335 100.004 129.320 1.00 36.08  ? 51   ILE H CB    1 
ATOM   5442  C  CG1   . ILE H 4 52  ? 110.391 100.996 128.830 1.00 36.08  ? 51   ILE H CG1   1 
ATOM   5443  C  CG2   . ILE H 4 52  ? 109.291 99.795  130.824 1.00 36.08  ? 51   ILE H CG2   1 
ATOM   5444  C  CD1   . ILE H 4 52  ? 110.257 102.377 129.421 1.00 36.08  ? 51   ILE H CD1   1 
ATOM   5445  N  N     . SER H 4 53  ? 111.635 98.020  127.798 1.00 33.74  ? 52   SER H N     1 
ATOM   5446  C  CA    . SER H 4 53  ? 112.915 97.331  127.848 1.00 33.74  ? 52   SER H CA    1 
ATOM   5447  C  C     . SER H 4 53  ? 113.875 98.013  128.815 1.00 33.74  ? 52   SER H C     1 
ATOM   5448  O  O     . SER H 4 53  ? 113.658 99.145  129.250 1.00 33.74  ? 52   SER H O     1 
ATOM   5449  C  CB    . SER H 4 53  ? 113.549 97.272  126.462 1.00 33.74  ? 52   SER H CB    1 
ATOM   5450  O  OG    . SER H 4 53  ? 114.180 98.499  126.154 1.00 33.74  ? 52   SER H OG    1 
ATOM   5451  N  N     . SER H 4 54  ? 114.919 97.265  129.193 1.00 33.82  ? 53   SER H N     1 
ATOM   5452  C  CA    . SER H 4 54  ? 115.968 97.780  130.072 1.00 33.82  ? 53   SER H CA    1 
ATOM   5453  C  C     . SER H 4 54  ? 116.657 99.003  129.484 1.00 33.82  ? 53   SER H C     1 
ATOM   5454  O  O     . SER H 4 54  ? 116.897 99.988  130.190 1.00 33.82  ? 53   SER H O     1 
ATOM   5455  C  CB    . SER H 4 54  ? 117.004 96.699  130.351 1.00 33.82  ? 53   SER H CB    1 
ATOM   5456  O  OG    . SER H 4 54  ? 118.005 96.705  129.353 1.00 33.82  ? 53   SER H OG    1 
ATOM   5457  N  N     . LYS H 4 55  ? 117.043 98.930  128.205 1.00 30.88  ? 54   LYS H N     1 
ATOM   5458  C  CA    . LYS H 4 55  ? 117.735 100.049 127.571 1.00 30.88  ? 54   LYS H CA    1 
ATOM   5459  C  C     . LYS H 4 55  ? 116.830 101.269 127.456 1.00 30.88  ? 54   LYS H C     1 
ATOM   5460  O  O     . LYS H 4 55  ? 117.281 102.404 127.653 1.00 30.88  ? 54   LYS H O     1 
ATOM   5461  C  CB    . LYS H 4 55  ? 118.266 99.634  126.200 1.00 30.88  ? 54   LYS H CB    1 
ATOM   5462  C  CG    . LYS H 4 55  ? 119.113 100.695 125.520 1.00 30.88  ? 54   LYS H CG    1 
ATOM   5463  C  CD    . LYS H 4 55  ? 120.291 101.109 126.390 1.00 30.88  ? 54   LYS H CD    1 
ATOM   5464  C  CE    . LYS H 4 55  ? 121.343 100.016 126.493 1.00 30.88  ? 54   LYS H CE    1 
ATOM   5465  N  NZ    . LYS H 4 55  ? 121.827 99.573  125.157 1.00 30.88  ? 54   LYS H NZ    1 
ATOM   5466  N  N     . ALA H 4 56  ? 115.545 101.051 127.167 1.00 30.59  ? 55   ALA H N     1 
ATOM   5467  C  CA    . ALA H 4 56  ? 114.598 102.159 127.111 1.00 30.59  ? 55   ALA H CA    1 
ATOM   5468  C  C     . ALA H 4 56  ? 114.393 102.768 128.491 1.00 30.59  ? 55   ALA H C     1 
ATOM   5469  O  O     . ALA H 4 56  ? 114.248 103.989 128.622 1.00 30.59  ? 55   ALA H O     1 
ATOM   5470  C  CB    . ALA H 4 56  ? 113.270 101.691 126.523 1.00 30.59  ? 55   ALA H CB    1 
ATOM   5471  N  N     . MET H 4 57  ? 114.401 101.933 129.531 1.00 31.25  ? 56   MET H N     1 
ATOM   5472  C  CA    . MET H 4 57  ? 114.297 102.447 130.891 1.00 31.25  ? 56   MET H CA    1 
ATOM   5473  C  C     . MET H 4 57  ? 115.542 103.233 131.278 1.00 31.25  ? 56   MET H C     1 
ATOM   5474  O  O     . MET H 4 57  ? 115.445 104.253 131.969 1.00 31.25  ? 56   MET H O     1 
ATOM   5475  C  CB    . MET H 4 57  ? 114.055 101.296 131.870 1.00 31.25  ? 56   MET H CB    1 
ATOM   5476  C  CG    . MET H 4 57  ? 113.971 101.742 133.307 1.00 31.25  ? 56   MET H CG    1 
ATOM   5477  S  SD    . MET H 4 57  ? 112.668 102.961 133.529 1.00 31.25  ? 56   MET H SD    1 
ATOM   5478  C  CE    . MET H 4 57  ? 111.240 102.050 132.974 1.00 31.25  ? 56   MET H CE    1 
ATOM   5479  N  N     . SER H 4 58  ? 116.713 102.793 130.812 1.00 28.07  ? 57   SER H N     1 
ATOM   5480  C  CA    . SER H 4 58  ? 117.952 103.524 131.059 1.00 28.07  ? 57   SER H CA    1 
ATOM   5481  C  C     . SER H 4 58  ? 117.927 104.889 130.382 1.00 28.07  ? 57   SER H C     1 
ATOM   5482  O  O     . SER H 4 58  ? 118.354 105.893 130.969 1.00 28.07  ? 57   SER H O     1 
ATOM   5483  C  CB    . SER H 4 58  ? 119.150 102.708 130.586 1.00 28.07  ? 57   SER H CB    1 
ATOM   5484  O  OG    . SER H 4 58  ? 120.357 103.371 130.898 1.00 28.07  ? 57   SER H OG    1 
ATOM   5485  N  N     . ILE H 4 59  ? 117.477 104.925 129.124 1.00 24.90  ? 58   ILE H N     1 
ATOM   5486  C  CA    . ILE H 4 59  ? 117.322 106.185 128.395 1.00 24.90  ? 58   ILE H CA    1 
ATOM   5487  C  C     . ILE H 4 59  ? 116.358 107.121 129.120 1.00 24.90  ? 58   ILE H C     1 
ATOM   5488  O  O     . ILE H 4 59  ? 116.650 108.308 129.299 1.00 24.90  ? 58   ILE H O     1 
ATOM   5489  C  CB    . ILE H 4 59  ? 116.872 105.915 126.949 1.00 24.90  ? 58   ILE H CB    1 
ATOM   5490  C  CG1   . ILE H 4 59  ? 118.004 105.257 126.169 1.00 24.90  ? 58   ILE H CG1   1 
ATOM   5491  C  CG2   . ILE H 4 59  ? 116.413 107.182 126.260 1.00 24.90  ? 58   ILE H CG2   1 
ATOM   5492  C  CD1   . ILE H 4 59  ? 117.577 104.727 124.834 1.00 24.90  ? 58   ILE H CD1   1 
ATOM   5493  N  N     . MET H 4 60  ? 115.200 106.601 129.548 1.00 26.39  ? 59   MET H N     1 
ATOM   5494  C  CA    . MET H 4 60  ? 114.237 107.417 130.289 1.00 26.39  ? 59   MET H CA    1 
ATOM   5495  C  C     . MET H 4 60  ? 114.802 107.913 131.616 1.00 26.39  ? 59   MET H C     1 
ATOM   5496  O  O     . MET H 4 60  ? 114.536 109.049 132.021 1.00 26.39  ? 59   MET H O     1 
ATOM   5497  C  CB    . MET H 4 60  ? 112.948 106.637 130.522 1.00 26.39  ? 59   MET H CB    1 
ATOM   5498  C  CG    . MET H 4 60  ? 112.085 106.508 129.286 1.00 26.39  ? 59   MET H CG    1 
ATOM   5499  S  SD    . MET H 4 60  ? 111.606 108.097 128.599 1.00 26.39  ? 59   MET H SD    1 
ATOM   5500  C  CE    . MET H 4 60  ? 110.813 108.841 130.017 1.00 26.39  ? 59   MET H CE    1 
ATOM   5501  N  N     . ASN H 4 61  ? 115.603 107.087 132.292 1.00 25.40  ? 60   ASN H N     1 
ATOM   5502  C  CA    . ASN H 4 61  ? 116.191 107.486 133.566 1.00 25.40  ? 60   ASN H CA    1 
ATOM   5503  C  C     . ASN H 4 61  ? 117.217 108.592 133.383 1.00 25.40  ? 60   ASN H C     1 
ATOM   5504  O  O     . ASN H 4 61  ? 117.233 109.570 134.147 1.00 25.40  ? 60   ASN H O     1 
ATOM   5505  C  CB    . ASN H 4 61  ? 116.844 106.283 134.234 1.00 25.40  ? 60   ASN H CB    1 
ATOM   5506  C  CG    . ASN H 4 61  ? 117.515 106.642 135.530 1.00 25.40  ? 60   ASN H CG    1 
ATOM   5507  O  OD1   . ASN H 4 61  ? 116.865 107.064 136.483 1.00 25.40  ? 60   ASN H OD1   1 
ATOM   5508  N  ND2   . ASN H 4 61  ? 118.831 106.488 135.574 1.00 25.40  ? 60   ASN H ND2   1 
ATOM   5509  N  N     . SER H 4 62  ? 118.060 108.466 132.357 1.00 22.86  ? 61   SER H N     1 
ATOM   5510  C  CA    . SER H 4 62  ? 119.025 109.517 132.065 1.00 22.86  ? 61   SER H CA    1 
ATOM   5511  C  C     . SER H 4 62  ? 118.320 110.782 131.605 1.00 22.86  ? 61   SER H C     1 
ATOM   5512  O  O     . SER H 4 62  ? 118.779 111.889 131.897 1.00 22.86  ? 61   SER H O     1 
ATOM   5513  C  CB    . SER H 4 62  ? 120.034 109.045 131.025 1.00 22.86  ? 61   SER H CB    1 
ATOM   5514  O  OG    . SER H 4 62  ? 121.182 109.874 131.039 1.00 22.86  ? 61   SER H OG    1 
ATOM   5515  N  N     . PHE H 4 63  ? 117.209 110.633 130.875 1.00 22.54  ? 62   PHE H N     1 
ATOM   5516  C  CA    . PHE H 4 63  ? 116.433 111.787 130.433 1.00 22.54  ? 62   PHE H CA    1 
ATOM   5517  C  C     . PHE H 4 63  ? 115.842 112.545 131.613 1.00 22.54  ? 62   PHE H C     1 
ATOM   5518  O  O     . PHE H 4 63  ? 115.843 113.781 131.629 1.00 22.54  ? 62   PHE H O     1 
ATOM   5519  C  CB    . PHE H 4 63  ? 115.316 111.339 129.490 1.00 22.54  ? 62   PHE H CB    1 
ATOM   5520  C  CG    . PHE H 4 63  ? 114.263 112.382 129.266 1.00 22.54  ? 62   PHE H CG    1 
ATOM   5521  C  CD1   . PHE H 4 63  ? 114.506 113.424 128.397 1.00 22.54  ? 62   PHE H CD1   1 
ATOM   5522  C  CD2   . PHE H 4 63  ? 113.029 112.314 129.900 1.00 22.54  ? 62   PHE H CD2   1 
ATOM   5523  C  CE1   . PHE H 4 63  ? 113.556 114.387 128.170 1.00 22.54  ? 62   PHE H CE1   1 
ATOM   5524  C  CE2   . PHE H 4 63  ? 112.079 113.286 129.687 1.00 22.54  ? 62   PHE H CE2   1 
ATOM   5525  C  CZ    . PHE H 4 63  ? 112.349 114.328 128.829 1.00 22.54  ? 62   PHE H CZ    1 
ATOM   5526  N  N     . VAL H 4 64  ? 115.292 111.815 132.587 1.00 21.89  ? 63   VAL H N     1 
ATOM   5527  C  CA    . VAL H 4 64  ? 114.706 112.446 133.766 1.00 21.89  ? 63   VAL H CA    1 
ATOM   5528  C  C     . VAL H 4 64  ? 115.782 113.152 134.580 1.00 21.89  ? 63   VAL H C     1 
ATOM   5529  O  O     . VAL H 4 64  ? 115.588 114.289 135.027 1.00 21.89  ? 63   VAL H O     1 
ATOM   5530  C  CB    . VAL H 4 64  ? 113.922 111.414 134.598 1.00 21.89  ? 63   VAL H CB    1 
ATOM   5531  C  CG1   . VAL H 4 64  ? 113.545 111.970 135.950 1.00 21.89  ? 63   VAL H CG1   1 
ATOM   5532  C  CG2   . VAL H 4 64  ? 112.655 111.035 133.865 1.00 21.89  ? 63   VAL H CG2   1 
ATOM   5533  N  N     . ASN H 4 65  ? 116.942 112.505 134.756 1.00 21.97  ? 64   ASN H N     1 
ATOM   5534  C  CA    . ASN H 4 65  ? 118.049 113.159 135.457 1.00 21.97  ? 64   ASN H CA    1 
ATOM   5535  C  C     . ASN H 4 65  ? 118.549 114.393 134.710 1.00 21.97  ? 64   ASN H C     1 
ATOM   5536  O  O     . ASN H 4 65  ? 118.897 115.402 135.335 1.00 21.97  ? 64   ASN H O     1 
ATOM   5537  C  CB    . ASN H 4 65  ? 119.196 112.180 135.680 1.00 21.97  ? 64   ASN H CB    1 
ATOM   5538  C  CG    . ASN H 4 65  ? 119.070 111.435 136.984 1.00 21.97  ? 64   ASN H CG    1 
ATOM   5539  O  OD1   . ASN H 4 65  ? 118.844 112.038 138.031 1.00 21.97  ? 64   ASN H OD1   1 
ATOM   5540  N  ND2   . ASN H 4 65  ? 119.223 110.119 136.934 1.00 21.97  ? 64   ASN H ND2   1 
ATOM   5541  N  N     . ASP H 4 66  ? 118.578 114.334 133.377 1.00 22.01  ? 65   ASP H N     1 
ATOM   5542  C  CA    . ASP H 4 66  ? 118.976 115.475 132.557 1.00 22.01  ? 65   ASP H CA    1 
ATOM   5543  C  C     . ASP H 4 66  ? 118.023 116.656 132.728 1.00 22.01  ? 65   ASP H C     1 
ATOM   5544  O  O     . ASP H 4 66  ? 118.464 117.786 132.956 1.00 22.01  ? 65   ASP H O     1 
ATOM   5545  C  CB    . ASP H 4 66  ? 119.058 115.058 131.092 1.00 22.01  ? 65   ASP H CB    1 
ATOM   5546  C  CG    . ASP H 4 66  ? 119.748 116.092 130.227 1.00 22.01  ? 65   ASP H CG    1 
ATOM   5547  O  OD1   . ASP H 4 66  ? 120.373 117.023 130.778 1.00 22.01  ? 65   ASP H OD1   1 
ATOM   5548  O  OD2   . ASP H 4 66  ? 119.660 115.976 128.988 1.00 22.01  ? 65   ASP H OD2   1 
ATOM   5549  N  N     . VAL H 4 67  ? 116.720 116.422 132.520 1.00 21.35  ? 66   VAL H N     1 
ATOM   5550  C  CA    . VAL H 4 67  ? 115.711 117.476 132.668 1.00 21.35  ? 66   VAL H CA    1 
ATOM   5551  C  C     . VAL H 4 67  ? 115.704 118.035 134.087 1.00 21.35  ? 66   VAL H C     1 
ATOM   5552  O  O     . VAL H 4 67  ? 115.541 119.247 134.290 1.00 21.35  ? 66   VAL H O     1 
ATOM   5553  C  CB    . VAL H 4 67  ? 114.330 116.947 132.243 1.00 21.35  ? 66   VAL H CB    1 
ATOM   5554  C  CG1   . VAL H 4 67  ? 113.245 117.970 132.478 1.00 21.35  ? 66   VAL H CG1   1 
ATOM   5555  C  CG2   . VAL H 4 67  ? 114.367 116.629 130.791 1.00 21.35  ? 66   VAL H CG2   1 
ATOM   5556  N  N     . PHE H 4 68  ? 115.910 117.169 135.084 1.00 24.64  ? 67   PHE H N     1 
ATOM   5557  C  CA    . PHE H 4 68  ? 116.039 117.620 136.465 1.00 24.64  ? 67   PHE H CA    1 
ATOM   5558  C  C     . PHE H 4 68  ? 117.231 118.550 136.634 1.00 24.64  ? 67   PHE H C     1 
ATOM   5559  O  O     . PHE H 4 68  ? 117.124 119.588 137.295 1.00 24.64  ? 67   PHE H O     1 
ATOM   5560  C  CB    . PHE H 4 68  ? 116.166 116.427 137.404 1.00 24.64  ? 67   PHE H CB    1 
ATOM   5561  C  CG    . PHE H 4 68  ? 116.568 116.807 138.787 1.00 24.64  ? 67   PHE H CG    1 
ATOM   5562  C  CD1   . PHE H 4 68  ? 115.757 117.604 139.566 1.00 24.64  ? 67   PHE H CD1   1 
ATOM   5563  C  CD2   . PHE H 4 68  ? 117.785 116.391 139.297 1.00 24.64  ? 67   PHE H CD2   1 
ATOM   5564  C  CE1   . PHE H 4 68  ? 116.146 117.965 140.838 1.00 24.64  ? 67   PHE H CE1   1 
ATOM   5565  C  CE2   . PHE H 4 68  ? 118.176 116.747 140.568 1.00 24.64  ? 67   PHE H CE2   1 
ATOM   5566  C  CZ    . PHE H 4 68  ? 117.354 117.539 141.336 1.00 24.64  ? 67   PHE H CZ    1 
ATOM   5567  N  N     . GLU H 4 69  ? 118.377 118.183 136.052 1.00 26.00  ? 68   GLU H N     1 
ATOM   5568  C  CA    . GLU H 4 69  ? 119.562 119.028 136.142 1.00 26.00  ? 68   GLU H CA    1 
ATOM   5569  C  C     . GLU H 4 69  ? 119.352 120.366 135.442 1.00 26.00  ? 68   GLU H C     1 
ATOM   5570  O  O     . GLU H 4 69  ? 119.761 121.404 135.968 1.00 26.00  ? 68   GLU H O     1 
ATOM   5571  C  CB    . GLU H 4 69  ? 120.772 118.305 135.561 1.00 26.00  ? 68   GLU H CB    1 
ATOM   5572  C  CG    . GLU H 4 69  ? 122.085 118.714 136.199 1.00 26.00  ? 68   GLU H CG    1 
ATOM   5573  C  CD    . GLU H 4 69  ? 122.737 119.886 135.493 1.00 26.00  ? 68   GLU H CD    1 
ATOM   5574  O  OE1   . GLU H 4 69  ? 123.678 120.475 136.063 1.00 26.00  ? 68   GLU H OE1   1 
ATOM   5575  O  OE2   . GLU H 4 69  ? 122.314 120.219 134.366 1.00 26.00  ? 68   GLU H OE2   1 
ATOM   5576  N  N     . ARG H 4 70  ? 118.731 120.356 134.256 1.00 23.61  ? 69   ARG H N     1 
ATOM   5577  C  CA    . ARG H 4 70  ? 118.414 121.593 133.535 1.00 23.61  ? 69   ARG H CA    1 
ATOM   5578  C  C     . ARG H 4 70  ? 117.520 122.515 134.354 1.00 23.61  ? 69   ARG H C     1 
ATOM   5579  O  O     . ARG H 4 70  ? 117.825 123.701 134.517 1.00 23.61  ? 69   ARG H O     1 
ATOM   5580  C  CB    . ARG H 4 70  ? 117.752 121.298 132.189 1.00 23.61  ? 69   ARG H CB    1 
ATOM   5581  C  CG    . ARG H 4 70  ? 118.598 120.542 131.193 1.00 23.61  ? 69   ARG H CG    1 
ATOM   5582  C  CD    . ARG H 4 70  ? 117.945 120.577 129.822 1.00 23.61  ? 69   ARG H CD    1 
ATOM   5583  N  NE    . ARG H 4 70  ? 118.449 119.527 128.944 1.00 23.61  ? 69   ARG H NE    1 
ATOM   5584  C  CZ    . ARG H 4 70  ? 118.058 119.356 127.686 1.00 23.61  ? 69   ARG H CZ    1 
ATOM   5585  N  NH1   . ARG H 4 70  ? 117.158 120.169 127.154 1.00 23.61  ? 69   ARG H NH1   1 
ATOM   5586  N  NH2   . ARG H 4 70  ? 118.566 118.372 126.960 1.00 23.61  ? 69   ARG H NH2   1 
ATOM   5587  N  N     . ILE H 4 71  ? 116.380 121.996 134.823 1.00 20.75  ? 70   ILE H N     1 
ATOM   5588  C  CA    . ILE H 4 71  ? 115.418 122.812 135.565 1.00 20.75  ? 70   ILE H CA    1 
ATOM   5589  C  C     . ILE H 4 71  ? 116.020 123.318 136.872 1.00 20.75  ? 70   ILE H C     1 
ATOM   5590  O  O     . ILE H 4 71  ? 115.860 124.493 137.225 1.00 20.75  ? 70   ILE H O     1 
ATOM   5591  C  CB    . ILE H 4 71  ? 114.109 122.032 135.791 1.00 20.75  ? 70   ILE H CB    1 
ATOM   5592  C  CG1   . ILE H 4 71  ? 113.410 121.789 134.458 1.00 20.75  ? 70   ILE H CG1   1 
ATOM   5593  C  CG2   . ILE H 4 71  ? 113.161 122.815 136.667 1.00 20.75  ? 70   ILE H CG2   1 
ATOM   5594  C  CD1   . ILE H 4 71  ? 112.137 120.991 134.573 1.00 20.75  ? 70   ILE H CD1   1 
ATOM   5595  N  N     . ALA H 4 72  ? 116.736 122.456 137.600 1.00 23.60  ? 71   ALA H N     1 
ATOM   5596  C  CA    . ALA H 4 72  ? 117.346 122.882 138.855 1.00 23.60  ? 71   ALA H CA    1 
ATOM   5597  C  C     . ALA H 4 72  ? 118.463 123.897 138.626 1.00 23.60  ? 71   ALA H C     1 
ATOM   5598  O  O     . ALA H 4 72  ? 118.605 124.845 139.406 1.00 23.60  ? 71   ALA H O     1 
ATOM   5599  C  CB    . ALA H 4 72  ? 117.861 121.669 139.621 1.00 23.60  ? 71   ALA H CB    1 
ATOM   5600  N  N     . GLY H 4 73  ? 119.253 123.730 137.560 1.00 23.05  ? 72   GLY H N     1 
ATOM   5601  C  CA    . GLY H 4 73  ? 120.276 124.712 137.230 1.00 23.05  ? 72   GLY H CA    1 
ATOM   5602  C  C     . GLY H 4 73  ? 119.687 126.057 136.852 1.00 23.05  ? 72   GLY H C     1 
ATOM   5603  O  O     . GLY H 4 73  ? 120.200 127.109 137.248 1.00 23.05  ? 72   GLY H O     1 
ATOM   5604  N  N     . GLU H 4 74  ? 118.623 126.036 136.041 1.00 23.86  ? 73   GLU H N     1 
ATOM   5605  C  CA    . GLU H 4 74  ? 117.947 127.268 135.648 1.00 23.86  ? 73   GLU H CA    1 
ATOM   5606  C  C     . GLU H 4 74  ? 117.325 127.968 136.847 1.00 23.86  ? 73   GLU H C     1 
ATOM   5607  O  O     . GLU H 4 74  ? 117.397 129.196 136.956 1.00 23.86  ? 73   GLU H O     1 
ATOM   5608  C  CB    . GLU H 4 74  ? 116.880 126.971 134.599 1.00 23.86  ? 73   GLU H CB    1 
ATOM   5609  C  CG    . GLU H 4 74  ? 117.428 126.835 133.199 1.00 23.86  ? 73   GLU H CG    1 
ATOM   5610  C  CD    . GLU H 4 74  ? 118.249 128.033 132.781 1.00 23.86  ? 73   GLU H CD    1 
ATOM   5611  O  OE1   . GLU H 4 74  ? 117.760 129.172 132.930 1.00 23.86  ? 73   GLU H OE1   1 
ATOM   5612  O  OE2   . GLU H 4 74  ? 119.385 127.835 132.301 1.00 23.86  ? 73   GLU H OE2   1 
ATOM   5613  N  N     . ALA H 4 75  ? 116.712 127.206 137.757 1.00 21.54  ? 74   ALA H N     1 
ATOM   5614  C  CA    . ALA H 4 75  ? 116.169 127.798 138.975 1.00 21.54  ? 74   ALA H CA    1 
ATOM   5615  C  C     . ALA H 4 75  ? 117.273 128.357 139.860 1.00 21.54  ? 74   ALA H C     1 
ATOM   5616  O  O     . ALA H 4 75  ? 117.094 129.405 140.488 1.00 21.54  ? 74   ALA H O     1 
ATOM   5617  C  CB    . ALA H 4 75  ? 115.346 126.768 139.740 1.00 21.54  ? 74   ALA H CB    1 
ATOM   5618  N  N     . SER H 4 76  ? 118.426 127.682 139.902 1.00 21.89  ? 75   SER H N     1 
ATOM   5619  C  CA    . SER H 4 76  ? 119.553 128.157 140.698 1.00 21.89  ? 75   SER H CA    1 
ATOM   5620  C  C     . SER H 4 76  ? 120.092 129.480 140.170 1.00 21.89  ? 75   SER H C     1 
ATOM   5621  O  O     . SER H 4 76  ? 120.291 130.431 140.938 1.00 21.89  ? 75   SER H O     1 
ATOM   5622  C  CB    . SER H 4 76  ? 120.659 127.106 140.716 1.00 21.89  ? 75   SER H CB    1 
ATOM   5623  O  OG    . SER H 4 76  ? 121.774 127.564 141.461 1.00 21.89  ? 75   SER H OG    1 
ATOM   5624  N  N     . ARG H 4 77  ? 120.320 129.564 138.855 1.00 23.63  ? 76   ARG H N     1 
ATOM   5625  C  CA    . ARG H 4 77  ? 120.828 130.811 138.292 1.00 23.63  ? 76   ARG H CA    1 
ATOM   5626  C  C     . ARG H 4 77  ? 119.778 131.915 138.363 1.00 23.63  ? 76   ARG H C     1 
ATOM   5627  O  O     . ARG H 4 77  ? 120.126 133.080 138.566 1.00 23.63  ? 76   ARG H O     1 
ATOM   5628  C  CB    . ARG H 4 77  ? 121.345 130.618 136.862 1.00 23.63  ? 76   ARG H CB    1 
ATOM   5629  C  CG    . ARG H 4 77  ? 120.337 130.198 135.816 1.00 23.63  ? 76   ARG H CG    1 
ATOM   5630  C  CD    . ARG H 4 77  ? 120.970 130.137 134.437 1.00 23.63  ? 76   ARG H CD    1 
ATOM   5631  N  NE    . ARG H 4 77  ? 122.289 129.517 134.458 1.00 23.63  ? 76   ARG H NE    1 
ATOM   5632  C  CZ    . ARG H 4 77  ? 122.526 128.259 134.108 1.00 23.63  ? 76   ARG H CZ    1 
ATOM   5633  N  NH1   . ARG H 4 77  ? 121.529 127.487 133.700 1.00 23.63  ? 76   ARG H NH1   1 
ATOM   5634  N  NH2   . ARG H 4 77  ? 123.759 127.775 134.156 1.00 23.63  ? 76   ARG H NH2   1 
ATOM   5635  N  N     . LEU H 4 78  ? 118.497 131.573 138.175 1.00 23.15  ? 77   LEU H N     1 
ATOM   5636  C  CA    . LEU H 4 78  ? 117.421 132.548 138.312 1.00 23.15  ? 77   LEU H CA    1 
ATOM   5637  C  C     . LEU H 4 78  ? 117.345 133.119 139.723 1.00 23.15  ? 77   LEU H C     1 
ATOM   5638  O  O     . LEU H 4 78  ? 117.109 134.319 139.900 1.00 23.15  ? 77   LEU H O     1 
ATOM   5639  C  CB    . LEU H 4 78  ? 116.097 131.906 137.938 1.00 23.15  ? 77   LEU H CB    1 
ATOM   5640  C  CG    . LEU H 4 78  ? 115.047 132.931 137.561 1.00 23.15  ? 77   LEU H CG    1 
ATOM   5641  C  CD1   . LEU H 4 78  ? 115.186 133.268 136.102 1.00 23.15  ? 77   LEU H CD1   1 
ATOM   5642  C  CD2   . LEU H 4 78  ? 113.703 132.365 137.857 1.00 23.15  ? 77   LEU H CD2   1 
ATOM   5643  N  N     . ALA H 4 79  ? 117.498 132.263 140.736 1.00 24.45  ? 78   ALA H N     1 
ATOM   5644  C  CA    . ALA H 4 79  ? 117.527 132.733 142.116 1.00 24.45  ? 78   ALA H CA    1 
ATOM   5645  C  C     . ALA H 4 79  ? 118.749 133.597 142.374 1.00 24.45  ? 78   ALA H C     1 
ATOM   5646  O  O     . ALA H 4 79  ? 118.672 134.578 143.120 1.00 24.45  ? 78   ALA H O     1 
ATOM   5647  C  CB    . ALA H 4 79  ? 117.498 131.551 143.078 1.00 24.45  ? 78   ALA H CB    1 
ATOM   5648  N  N     . HIS H 4 80  ? 119.887 133.234 141.779 1.00 26.10  ? 79   HIS H N     1 
ATOM   5649  C  CA    . HIS H 4 80  ? 121.114 134.008 141.956 1.00 26.10  ? 79   HIS H CA    1 
ATOM   5650  C  C     . HIS H 4 80  ? 121.001 135.406 141.351 1.00 26.10  ? 79   HIS H C     1 
ATOM   5651  O  O     . HIS H 4 80  ? 121.452 136.383 141.961 1.00 26.10  ? 79   HIS H O     1 
ATOM   5652  C  CB    . HIS H 4 80  ? 122.296 133.259 141.352 1.00 26.10  ? 79   HIS H CB    1 
ATOM   5653  C  CG    . HIS H 4 80  ? 123.615 133.894 141.645 1.00 26.10  ? 79   HIS H CG    1 
ATOM   5654  N  ND1   . HIS H 4 80  ? 124.304 133.670 142.817 1.00 26.10  ? 79   HIS H ND1   1 
ATOM   5655  C  CD2   . HIS H 4 80  ? 124.373 134.749 140.920 1.00 26.10  ? 79   HIS H CD2   1 
ATOM   5656  C  CE1   . HIS H 4 80  ? 125.430 134.360 142.801 1.00 26.10  ? 79   HIS H CE1   1 
ATOM   5657  N  NE2   . HIS H 4 80  ? 125.496 135.023 141.661 1.00 26.10  ? 79   HIS H NE2   1 
ATOM   5658  N  N     . TYR H 4 81  ? 120.498 135.493 140.110 1.00 26.39  ? 80   TYR H N     1 
ATOM   5659  C  CA    . TYR H 4 81  ? 120.307 136.762 139.395 1.00 26.39  ? 80   TYR H CA    1 
ATOM   5660  C  C     . TYR H 4 81  ? 119.540 137.790 140.215 1.00 26.39  ? 80   TYR H C     1 
ATOM   5661  O  O     . TYR H 4 81  ? 119.934 138.957 140.299 1.00 26.39  ? 80   TYR H O     1 
ATOM   5662  C  CB    . TYR H 4 81  ? 119.555 136.529 138.082 1.00 26.39  ? 80   TYR H CB    1 
ATOM   5663  C  CG    . TYR H 4 81  ? 120.272 135.717 137.033 1.00 26.39  ? 80   TYR H CG    1 
ATOM   5664  C  CD1   . TYR H 4 81  ? 121.643 135.496 137.097 1.00 26.39  ? 80   TYR H CD1   1 
ATOM   5665  C  CD2   . TYR H 4 81  ? 119.558 135.132 135.997 1.00 26.39  ? 80   TYR H CD2   1 
ATOM   5666  C  CE1   . TYR H 4 81  ? 122.281 134.736 136.142 1.00 26.39  ? 80   TYR H CE1   1 
ATOM   5667  C  CE2   . TYR H 4 81  ? 120.186 134.374 135.040 1.00 26.39  ? 80   TYR H CE2   1 
ATOM   5668  C  CZ    . TYR H 4 81  ? 121.544 134.179 135.117 1.00 26.39  ? 80   TYR H CZ    1 
ATOM   5669  O  OH    . TYR H 4 81  ? 122.167 133.421 134.160 1.00 26.39  ? 80   TYR H OH    1 
ATOM   5670  N  N     . ASN H 4 82  ? 118.446 137.367 140.838 1.00 27.36  ? 81   ASN H N     1 
ATOM   5671  C  CA    . ASN H 4 82  ? 117.567 138.274 141.555 1.00 27.36  ? 81   ASN H CA    1 
ATOM   5672  C  C     . ASN H 4 82  ? 117.935 138.419 143.021 1.00 27.36  ? 81   ASN H C     1 
ATOM   5673  O  O     . ASN H 4 82  ? 117.091 138.870 143.807 1.00 27.36  ? 81   ASN H O     1 
ATOM   5674  C  CB    . ASN H 4 82  ? 116.123 137.802 141.427 1.00 27.36  ? 81   ASN H CB    1 
ATOM   5675  C  CG    . ASN H 4 82  ? 115.651 137.806 140.005 1.00 27.36  ? 81   ASN H CG    1 
ATOM   5676  O  OD1   . ASN H 4 82  ? 116.454 137.888 139.077 1.00 27.36  ? 81   ASN H OD1   1 
ATOM   5677  N  ND2   . ASN H 4 82  ? 114.346 137.709 139.817 1.00 27.36  ? 81   ASN H ND2   1 
ATOM   5678  N  N     . LYS H 4 83  ? 119.177 138.066 143.387 1.00 28.36  ? 82   LYS H N     1 
ATOM   5679  C  CA    . LYS H 4 83  ? 119.723 138.203 144.743 1.00 28.36  ? 82   LYS H CA    1 
ATOM   5680  C  C     . LYS H 4 83  ? 118.850 137.494 145.776 1.00 28.36  ? 82   LYS H C     1 
ATOM   5681  O  O     . LYS H 4 83  ? 118.592 138.005 146.866 1.00 28.36  ? 82   LYS H O     1 
ATOM   5682  C  CB    . LYS H 4 83  ? 119.930 139.675 145.109 1.00 28.36  ? 82   LYS H CB    1 
ATOM   5683  C  CG    . LYS H 4 83  ? 120.549 140.508 143.994 1.00 28.36  ? 82   LYS H CG    1 
ATOM   5684  C  CD    . LYS H 4 83  ? 120.735 141.954 144.413 1.00 28.36  ? 82   LYS H CD    1 
ATOM   5685  C  CE    . LYS H 4 83  ? 119.513 142.783 144.051 1.00 28.36  ? 82   LYS H CE    1 
ATOM   5686  N  NZ    . LYS H 4 83  ? 119.255 142.782 142.585 1.00 28.36  ? 82   LYS H NZ    1 
ATOM   5687  N  N     . ARG H 4 84  ? 118.371 136.313 145.410 1.00 35.53  ? 83   ARG H N     1 
ATOM   5688  C  CA    . ARG H 4 84  ? 117.602 135.455 146.290 1.00 35.53  ? 83   ARG H CA    1 
ATOM   5689  C  C     . ARG H 4 84  ? 118.435 134.229 146.630 1.00 35.53  ? 83   ARG H C     1 
ATOM   5690  O  O     . ARG H 4 84  ? 119.272 133.793 145.836 1.00 35.53  ? 83   ARG H O     1 
ATOM   5691  C  CB    . ARG H 4 84  ? 116.297 135.021 145.625 1.00 35.53  ? 83   ARG H CB    1 
ATOM   5692  C  CG    . ARG H 4 84  ? 115.385 136.164 145.230 1.00 35.53  ? 83   ARG H CG    1 
ATOM   5693  C  CD    . ARG H 4 84  ? 114.871 136.940 146.420 1.00 35.53  ? 83   ARG H CD    1 
ATOM   5694  N  NE    . ARG H 4 84  ? 113.485 137.352 146.216 1.00 35.53  ? 83   ARG H NE    1 
ATOM   5695  C  CZ    . ARG H 4 84  ? 113.120 138.479 145.615 1.00 35.53  ? 83   ARG H CZ    1 
ATOM   5696  N  NH1   . ARG H 4 84  ? 114.038 139.317 145.154 1.00 35.53  ? 83   ARG H NH1   1 
ATOM   5697  N  NH2   . ARG H 4 84  ? 111.834 138.769 145.473 1.00 35.53  ? 83   ARG H NH2   1 
ATOM   5698  N  N     . SER H 4 85  ? 118.224 133.681 147.820 1.00 39.50  ? 84   SER H N     1 
ATOM   5699  C  CA    . SER H 4 85  ? 118.961 132.497 148.238 1.00 39.50  ? 84   SER H CA    1 
ATOM   5700  C  C     . SER H 4 85  ? 118.070 131.272 148.404 1.00 39.50  ? 84   SER H C     1 
ATOM   5701  O  O     . SER H 4 85  ? 118.525 130.260 148.943 1.00 39.50  ? 84   SER H O     1 
ATOM   5702  C  CB    . SER H 4 85  ? 119.712 132.785 149.538 1.00 39.50  ? 84   SER H CB    1 
ATOM   5703  O  OG    . SER H 4 85  ? 120.589 131.723 149.860 1.00 39.50  ? 84   SER H OG    1 
ATOM   5704  N  N     . THR H 4 86  ? 116.823 131.325 147.941 1.00 35.56  ? 85   THR H N     1 
ATOM   5705  C  CA    . THR H 4 86  ? 115.884 130.229 148.134 1.00 35.56  ? 85   THR H CA    1 
ATOM   5706  C  C     . THR H 4 86  ? 115.199 129.873 146.823 1.00 35.56  ? 85   THR H C     1 
ATOM   5707  O  O     . THR H 4 86  ? 114.724 130.760 146.109 1.00 35.56  ? 85   THR H O     1 
ATOM   5708  C  CB    . THR H 4 86  ? 114.837 130.603 149.187 1.00 35.56  ? 85   THR H CB    1 
ATOM   5709  O  OG1   . THR H 4 86  ? 115.498 131.084 150.360 1.00 35.56  ? 85   THR H OG1   1 
ATOM   5710  C  CG2   . THR H 4 86  ? 114.002 129.397 149.569 1.00 35.56  ? 85   THR H CG2   1 
ATOM   5711  N  N     . ILE H 4 87  ? 115.145 128.582 146.512 1.00 26.81  ? 86   ILE H N     1 
ATOM   5712  C  CA    . ILE H 4 87  ? 114.377 128.082 145.377 1.00 26.81  ? 86   ILE H CA    1 
ATOM   5713  C  C     . ILE H 4 87  ? 112.963 127.804 145.871 1.00 26.81  ? 86   ILE H C     1 
ATOM   5714  O  O     . ILE H 4 87  ? 112.736 126.880 146.655 1.00 26.81  ? 86   ILE H O     1 
ATOM   5715  C  CB    . ILE H 4 87  ? 115.006 126.823 144.773 1.00 26.81  ? 86   ILE H CB    1 
ATOM   5716  C  CG1   . ILE H 4 87  ? 116.332 127.156 144.111 1.00 26.81  ? 86   ILE H CG1   1 
ATOM   5717  C  CG2   . ILE H 4 87  ? 114.074 126.205 143.749 1.00 26.81  ? 86   ILE H CG2   1 
ATOM   5718  C  CD1   . ILE H 4 87  ? 116.998 125.969 143.466 1.00 26.81  ? 86   ILE H CD1   1 
ATOM   5719  N  N     . THR H 4 88  ? 112.020 128.630 145.452 1.00 24.88  ? 87   THR H N     1 
ATOM   5720  C  CA    . THR H 4 88  ? 110.622 128.508 145.830 1.00 24.88  ? 87   THR H CA    1 
ATOM   5721  C  C     . THR H 4 88  ? 109.874 127.975 144.604 1.00 24.88  ? 87   THR H C     1 
ATOM   5722  O  O     . THR H 4 88  ? 110.494 127.612 143.602 1.00 24.88  ? 87   THR H O     1 
ATOM   5723  C  CB    . THR H 4 88  ? 110.110 129.867 146.328 1.00 24.88  ? 87   THR H CB    1 
ATOM   5724  O  OG1   . THR H 4 88  ? 111.162 130.510 147.055 1.00 24.88  ? 87   THR H OG1   1 
ATOM   5725  C  CG2   . THR H 4 88  ? 108.962 129.710 147.336 1.00 24.88  ? 87   THR H CG2   1 
ATOM   5726  N  N     . SER H 4 89  ? 108.544 127.861 144.707 1.00 24.51  ? 88   SER H N     1 
ATOM   5727  C  CA    . SER H 4 89  ? 107.723 127.456 143.567 1.00 24.51  ? 88   SER H CA    1 
ATOM   5728  C  C     . SER H 4 89  ? 107.832 128.433 142.401 1.00 24.51  ? 88   SER H C     1 
ATOM   5729  O  O     . SER H 4 89  ? 107.676 128.027 141.243 1.00 24.51  ? 88   SER H O     1 
ATOM   5730  C  CB    . SER H 4 89  ? 106.264 127.317 143.993 1.00 24.51  ? 88   SER H CB    1 
ATOM   5731  O  OG    . SER H 4 89  ? 105.399 127.411 142.875 1.00 24.51  ? 88   SER H OG    1 
ATOM   5732  N  N     . ARG H 4 90  ? 108.064 129.717 142.689 1.00 24.60  ? 89   ARG H N     1 
ATOM   5733  C  CA    . ARG H 4 90  ? 108.161 130.735 141.645 1.00 24.60  ? 89   ARG H CA    1 
ATOM   5734  C  C     . ARG H 4 90  ? 109.333 130.478 140.706 1.00 24.60  ? 89   ARG H C     1 
ATOM   5735  O  O     . ARG H 4 90  ? 109.197 130.607 139.484 1.00 24.60  ? 89   ARG H O     1 
ATOM   5736  C  CB    . ARG H 4 90  ? 108.272 132.123 142.268 1.00 24.60  ? 89   ARG H CB    1 
ATOM   5737  C  CG    . ARG H 4 90  ? 107.641 133.197 141.415 1.00 24.60  ? 89   ARG H CG    1 
ATOM   5738  C  CD    . ARG H 4 90  ? 107.882 134.589 141.970 1.00 24.60  ? 89   ARG H CD    1 
ATOM   5739  N  NE    . ARG H 4 90  ? 107.083 135.576 141.253 1.00 24.60  ? 89   ARG H NE    1 
ATOM   5740  C  CZ    . ARG H 4 90  ? 105.805 135.837 141.504 1.00 24.60  ? 89   ARG H CZ    1 
ATOM   5741  N  NH1   . ARG H 4 90  ? 105.165 135.189 142.468 1.00 24.60  ? 89   ARG H NH1   1 
ATOM   5742  N  NH2   . ARG H 4 90  ? 105.163 136.749 140.788 1.00 24.60  ? 89   ARG H NH2   1 
ATOM   5743  N  N     . GLU H 4 91  ? 110.504 130.155 141.267 1.00 24.36  ? 90   GLU H N     1 
ATOM   5744  C  CA    . GLU H 4 91  ? 111.686 129.898 140.448 1.00 24.36  ? 90   GLU H CA    1 
ATOM   5745  C  C     . GLU H 4 91  ? 111.495 128.680 139.555 1.00 24.36  ? 90   GLU H C     1 
ATOM   5746  O  O     . GLU H 4 91  ? 111.871 128.708 138.378 1.00 24.36  ? 90   GLU H O     1 
ATOM   5747  C  CB    . GLU H 4 91  ? 112.921 129.711 141.329 1.00 24.36  ? 90   GLU H CB    1 
ATOM   5748  C  CG    . GLU H 4 91  ? 113.478 130.983 141.944 1.00 24.36  ? 90   GLU H CG    1 
ATOM   5749  C  CD    . GLU H 4 91  ? 112.694 131.451 143.151 1.00 24.36  ? 90   GLU H CD    1 
ATOM   5750  O  OE1   . GLU H 4 91  ? 112.240 132.614 143.158 1.00 24.36  ? 90   GLU H OE1   1 
ATOM   5751  O  OE2   . GLU H 4 91  ? 112.535 130.652 144.096 1.00 24.36  ? 90   GLU H OE2   1 
ATOM   5752  N  N     . ILE H 4 92  ? 110.945 127.595 140.110 1.00 21.78  ? 91   ILE H N     1 
ATOM   5753  C  CA    . ILE H 4 92  ? 110.640 126.399 139.325 1.00 21.78  ? 91   ILE H CA    1 
ATOM   5754  C  C     . ILE H 4 92  ? 109.642 126.715 138.217 1.00 21.78  ? 91   ILE H C     1 
ATOM   5755  O  O     . ILE H 4 92  ? 109.799 126.255 137.081 1.00 21.78  ? 91   ILE H O     1 
ATOM   5756  C  CB    . ILE H 4 92  ? 110.146 125.270 140.243 1.00 21.78  ? 91   ILE H CB    1 
ATOM   5757  C  CG1   . ILE H 4 92  ? 111.201 124.968 141.301 1.00 21.78  ? 91   ILE H CG1   1 
ATOM   5758  C  CG2   . ILE H 4 92  ? 109.875 124.014 139.450 1.00 21.78  ? 91   ILE H CG2   1 
ATOM   5759  C  CD1   . ILE H 4 92  ? 112.514 124.509 140.723 1.00 21.78  ? 91   ILE H CD1   1 
ATOM   5760  N  N     . GLN H 4 93  ? 108.619 127.519 138.524 1.00 22.09  ? 92   GLN H N     1 
ATOM   5761  C  CA    . GLN H 4 93  ? 107.609 127.884 137.530 1.00 22.09  ? 92   GLN H CA    1 
ATOM   5762  C  C     . GLN H 4 93  ? 108.215 128.683 136.382 1.00 22.09  ? 92   GLN H C     1 
ATOM   5763  O  O     . GLN H 4 93  ? 107.955 128.400 135.203 1.00 22.09  ? 92   GLN H O     1 
ATOM   5764  C  CB    . GLN H 4 93  ? 106.494 128.684 138.199 1.00 22.09  ? 92   GLN H CB    1 
ATOM   5765  C  CG    . GLN H 4 93  ? 105.360 129.075 137.281 1.00 22.09  ? 92   GLN H CG    1 
ATOM   5766  C  CD    . GLN H 4 93  ? 104.216 129.709 138.036 1.00 22.09  ? 92   GLN H CD    1 
ATOM   5767  O  OE1   . GLN H 4 93  ? 104.322 129.977 139.231 1.00 22.09  ? 92   GLN H OE1   1 
ATOM   5768  N  NE2   . GLN H 4 93  ? 103.117 129.962 137.343 1.00 22.09  ? 92   GLN H NE2   1 
ATOM   5769  N  N     . THR H 4 94  ? 109.026 129.688 136.714 1.00 21.35  ? 93   THR H N     1 
ATOM   5770  C  CA    . THR H 4 94  ? 109.671 130.495 135.686 1.00 21.35  ? 93   THR H CA    1 
ATOM   5771  C  C     . THR H 4 94  ? 110.670 129.678 134.873 1.00 21.35  ? 93   THR H C     1 
ATOM   5772  O  O     . THR H 4 94  ? 110.730 129.818 133.648 1.00 21.35  ? 93   THR H O     1 
ATOM   5773  C  CB    . THR H 4 94  ? 110.342 131.705 136.333 1.00 21.35  ? 93   THR H CB    1 
ATOM   5774  O  OG1   . THR H 4 94  ? 109.345 132.509 136.972 1.00 21.35  ? 93   THR H OG1   1 
ATOM   5775  C  CG2   . THR H 4 94  ? 111.056 132.547 135.310 1.00 21.35  ? 93   THR H CG2   1 
ATOM   5776  N  N     . ALA H 4 95  ? 111.415 128.774 135.522 1.00 21.52  ? 94   ALA H N     1 
ATOM   5777  C  CA    . ALA H 4 95  ? 112.358 127.920 134.801 1.00 21.52  ? 94   ALA H CA    1 
ATOM   5778  C  C     . ALA H 4 95  ? 111.644 126.962 133.853 1.00 21.52  ? 94   ALA H C     1 
ATOM   5779  O  O     . ALA H 4 95  ? 112.138 126.684 132.752 1.00 21.52  ? 94   ALA H O     1 
ATOM   5780  C  CB    . ALA H 4 95  ? 113.231 127.147 135.788 1.00 21.52  ? 94   ALA H CB    1 
ATOM   5781  N  N     . VAL H 4 96  ? 110.483 126.447 134.266 1.00 21.01  ? 95   VAL H N     1 
ATOM   5782  C  CA    . VAL H 4 96  ? 109.688 125.579 133.402 1.00 21.01  ? 95   VAL H CA    1 
ATOM   5783  C  C     . VAL H 4 96  ? 109.161 126.351 132.200 1.00 21.01  ? 95   VAL H C     1 
ATOM   5784  O  O     . VAL H 4 96  ? 109.212 125.860 131.064 1.00 21.01  ? 95   VAL H O     1 
ATOM   5785  C  CB    . VAL H 4 96  ? 108.564 124.921 134.221 1.00 21.01  ? 95   VAL H CB    1 
ATOM   5786  C  CG1   . VAL H 4 96  ? 107.469 124.378 133.334 1.00 21.01  ? 95   VAL H CG1   1 
ATOM   5787  C  CG2   . VAL H 4 96  ? 109.151 123.797 135.031 1.00 21.01  ? 95   VAL H CG2   1 
ATOM   5788  N  N     . ARG H 4 97  ? 108.648 127.565 132.424 1.00 20.49  ? 96   ARG H N     1 
ATOM   5789  C  CA    . ARG H 4 97  ? 108.211 128.396 131.301 1.00 20.49  ? 96   ARG H CA    1 
ATOM   5790  C  C     . ARG H 4 97  ? 109.371 128.790 130.385 1.00 20.49  ? 96   ARG H C     1 
ATOM   5791  O  O     . ARG H 4 97  ? 109.168 128.982 129.182 1.00 20.49  ? 96   ARG H O     1 
ATOM   5792  C  CB    . ARG H 4 97  ? 107.460 129.624 131.807 1.00 20.49  ? 96   ARG H CB    1 
ATOM   5793  C  CG    . ARG H 4 97  ? 106.029 129.303 132.194 1.00 20.49  ? 96   ARG H CG    1 
ATOM   5794  C  CD    . ARG H 4 97  ? 105.335 130.475 132.844 1.00 20.49  ? 96   ARG H CD    1 
ATOM   5795  N  NE    . ARG H 4 97  ? 105.345 131.659 131.998 1.00 20.49  ? 96   ARG H NE    1 
ATOM   5796  C  CZ    . ARG H 4 97  ? 105.305 132.901 132.465 1.00 20.49  ? 96   ARG H CZ    1 
ATOM   5797  N  NH1   . ARG H 4 97  ? 105.252 133.114 133.772 1.00 20.49  ? 96   ARG H NH1   1 
ATOM   5798  N  NH2   . ARG H 4 97  ? 105.319 133.930 131.630 1.00 20.49  ? 96   ARG H NH2   1 
ATOM   5799  N  N     . LEU H 4 98  ? 110.583 128.925 130.930 1.00 20.21  ? 97   LEU H N     1 
ATOM   5800  C  CA    . LEU H 4 98  ? 111.738 129.262 130.102 1.00 20.21  ? 97   LEU H CA    1 
ATOM   5801  C  C     . LEU H 4 98  ? 112.217 128.081 129.270 1.00 20.21  ? 97   LEU H C     1 
ATOM   5802  O  O     . LEU H 4 98  ? 112.630 128.264 128.121 1.00 20.21  ? 97   LEU H O     1 
ATOM   5803  C  CB    . LEU H 4 98  ? 112.897 129.751 130.961 1.00 20.21  ? 97   LEU H CB    1 
ATOM   5804  C  CG    . LEU H 4 98  ? 112.850 131.136 131.577 1.00 20.21  ? 97   LEU H CG    1 
ATOM   5805  C  CD1   . LEU H 4 98  ? 113.965 131.222 132.590 1.00 20.21  ? 97   LEU H CD1   1 
ATOM   5806  C  CD2   . LEU H 4 98  ? 113.006 132.186 130.507 1.00 20.21  ? 97   LEU H CD2   1 
ATOM   5807  N  N     . LEU H 4 99  ? 112.184 126.869 129.822 1.00 21.98  ? 98   LEU H N     1 
ATOM   5808  C  CA    . LEU H 4 99  ? 112.807 125.749 129.128 1.00 21.98  ? 98   LEU H CA    1 
ATOM   5809  C  C     . LEU H 4 99  ? 111.851 124.998 128.220 1.00 21.98  ? 98   LEU H C     1 
ATOM   5810  O  O     . LEU H 4 99  ? 112.282 124.461 127.194 1.00 21.98  ? 98   LEU H O     1 
ATOM   5811  C  CB    . LEU H 4 99  ? 113.406 124.757 130.123 1.00 21.98  ? 98   LEU H CB    1 
ATOM   5812  C  CG    . LEU H 4 99  ? 114.649 125.228 130.863 1.00 21.98  ? 98   LEU H CG    1 
ATOM   5813  C  CD1   . LEU H 4 99  ? 114.934 124.297 132.023 1.00 21.98  ? 98   LEU H CD1   1 
ATOM   5814  C  CD2   . LEU H 4 99  ? 115.831 125.303 129.921 1.00 21.98  ? 98   LEU H CD2   1 
ATOM   5815  N  N     . LEU H 4 100 ? 110.584 124.952 128.553 1.00 22.45  ? 99   LEU H N     1 
ATOM   5816  C  CA    . LEU H 4 100 ? 109.723 124.152 127.700 1.00 22.45  ? 99   LEU H CA    1 
ATOM   5817  C  C     . LEU H 4 100 ? 109.056 125.033 126.661 1.00 22.45  ? 99   LEU H C     1 
ATOM   5818  O  O     . LEU H 4 100 ? 108.549 126.108 127.003 1.00 22.45  ? 99   LEU H O     1 
ATOM   5819  C  CB    . LEU H 4 100 ? 108.666 123.436 128.533 1.00 22.45  ? 99   LEU H CB    1 
ATOM   5820  C  CG    . LEU H 4 100 ? 109.204 122.577 129.681 1.00 22.45  ? 99   LEU H CG    1 
ATOM   5821  C  CD1   . LEU H 4 100 ? 108.095 121.766 130.297 1.00 22.45  ? 99   LEU H CD1   1 
ATOM   5822  C  CD2   . LEU H 4 100 ? 110.329 121.663 129.239 1.00 22.45  ? 99   LEU H CD2   1 
ATOM   5823  N  N     . PRO H 4 101 ? 109.089 124.653 125.388 1.00 26.40  ? 100  PRO H N     1 
ATOM   5824  C  CA    . PRO H 4 101 ? 108.425 125.463 124.362 1.00 26.40  ? 100  PRO H CA    1 
ATOM   5825  C  C     . PRO H 4 101 ? 106.915 125.286 124.391 1.00 26.40  ? 100  PRO H C     1 
ATOM   5826  O  O     . PRO H 4 101 ? 106.413 124.185 124.623 1.00 26.40  ? 100  PRO H O     1 
ATOM   5827  C  CB    . PRO H 4 101 ? 109.017 124.931 123.052 1.00 26.40  ? 100  PRO H CB    1 
ATOM   5828  C  CG    . PRO H 4 101 ? 110.248 124.170 123.456 1.00 26.40  ? 100  PRO H CG    1 
ATOM   5829  C  CD    . PRO H 4 101 ? 109.947 123.615 124.801 1.00 26.40  ? 100  PRO H CD    1 
ATOM   5830  N  N     . GLY H 4 102 ? 106.205 126.386 124.119 1.00 27.83  ? 101  GLY H N     1 
ATOM   5831  C  CA    . GLY H 4 102 ? 104.763 126.444 123.909 1.00 27.83  ? 101  GLY H CA    1 
ATOM   5832  C  C     . GLY H 4 102 ? 103.789 125.624 124.739 1.00 27.83  ? 101  GLY H C     1 
ATOM   5833  O  O     . GLY H 4 102 ? 103.644 125.826 125.955 1.00 27.83  ? 101  GLY H O     1 
ATOM   5834  N  N     . GLU H 4 103 ? 103.060 124.748 124.035 1.00 30.97  ? 102  GLU H N     1 
ATOM   5835  C  CA    . GLU H 4 103 ? 101.987 123.956 124.633 1.00 30.97  ? 102  GLU H CA    1 
ATOM   5836  C  C     . GLU H 4 103 ? 102.493 123.075 125.770 1.00 30.97  ? 102  GLU H C     1 
ATOM   5837  O  O     . GLU H 4 103 ? 101.771 122.853 126.753 1.00 30.97  ? 102  GLU H O     1 
ATOM   5838  C  CB    . GLU H 4 103 ? 101.315 123.115 123.548 1.00 30.97  ? 102  GLU H CB    1 
ATOM   5839  C  CG    . GLU H 4 103 ? 100.036 122.414 123.975 1.00 30.97  ? 102  GLU H CG    1 
ATOM   5840  C  CD    . GLU H 4 103 ? 98.843  123.350 124.104 1.00 30.97  ? 102  GLU H CD    1 
ATOM   5841  O  OE1   . GLU H 4 103 ? 98.895  124.479 123.569 1.00 30.97  ? 102  GLU H OE1   1 
ATOM   5842  O  OE2   . GLU H 4 103 ? 97.848  122.950 124.743 1.00 30.97  ? 102  GLU H OE2   1 
ATOM   5843  N  N     . LEU H 4 104 ? 103.703 122.521 125.622 1.00 27.28  ? 103  LEU H N     1 
ATOM   5844  C  CA    . LEU H 4 104 ? 104.358 121.796 126.710 1.00 27.28  ? 103  LEU H CA    1 
ATOM   5845  C  C     . LEU H 4 104 ? 104.461 122.645 127.971 1.00 27.28  ? 103  LEU H C     1 
ATOM   5846  O  O     . LEU H 4 104 ? 104.164 122.173 129.072 1.00 27.28  ? 103  LEU H O     1 
ATOM   5847  C  CB    . LEU H 4 104 ? 105.740 121.314 126.283 1.00 27.28  ? 103  LEU H CB    1 
ATOM   5848  C  CG    . LEU H 4 104 ? 105.732 119.965 125.576 1.00 27.28  ? 103  LEU H CG    1 
ATOM   5849  C  CD1   . LEU H 4 104 ? 107.136 119.614 125.121 1.00 27.28  ? 103  LEU H CD1   1 
ATOM   5850  C  CD2   . LEU H 4 104 ? 105.157 118.891 126.481 1.00 27.28  ? 103  LEU H CD2   1 
ATOM   5851  N  N     . ALA H 4 105 ? 104.906 123.897 127.820 1.00 26.75  ? 104  ALA H N     1 
ATOM   5852  C  CA    . ALA H 4 105 ? 105.013 124.812 128.954 1.00 26.75  ? 104  ALA H CA    1 
ATOM   5853  C  C     . ALA H 4 105 ? 103.653 125.085 129.575 1.00 26.75  ? 104  ALA H C     1 
ATOM   5854  O  O     . ALA H 4 105 ? 103.530 125.146 130.802 1.00 26.75  ? 104  ALA H O     1 
ATOM   5855  C  CB    . ALA H 4 105 ? 105.668 126.121 128.527 1.00 26.75  ? 104  ALA H CB    1 
ATOM   5856  N  N     . LYS H 4 106 ? 102.640 125.330 128.734 1.00 29.65  ? 105  LYS H N     1 
ATOM   5857  C  CA    . LYS H 4 106 ? 101.275 125.566 129.215 1.00 29.65  ? 105  LYS H CA    1 
ATOM   5858  C  C     . LYS H 4 106 ? 100.757 124.404 130.064 1.00 29.65  ? 105  LYS H C     1 
ATOM   5859  O  O     . LYS H 4 106 ? 100.259 124.600 131.183 1.00 29.65  ? 105  LYS H O     1 
ATOM   5860  C  CB    . LYS H 4 106 ? 100.343 125.813 128.031 1.00 29.65  ? 105  LYS H CB    1 
ATOM   5861  C  CG    . LYS H 4 106 ? 98.974  126.344 128.420 1.00 29.65  ? 105  LYS H CG    1 
ATOM   5862  C  CD    . LYS H 4 106 ? 98.064  126.503 127.209 1.00 29.65  ? 105  LYS H CD    1 
ATOM   5863  C  CE    . LYS H 4 106 ? 98.756  127.218 126.058 1.00 29.65  ? 105  LYS H CE    1 
ATOM   5864  N  NZ    . LYS H 4 106 ? 99.186  128.590 126.436 1.00 29.65  ? 105  LYS H NZ    1 
ATOM   5865  N  N     . HIS H 4 107 ? 100.863 123.181 129.547 1.00 30.59  ? 106  HIS H N     1 
ATOM   5866  C  CA    . HIS H 4 107 ? 100.382 122.040 130.318 1.00 30.59  ? 106  HIS H CA    1 
ATOM   5867  C  C     . HIS H 4 107 ? 101.252 121.771 131.542 1.00 30.59  ? 106  HIS H C     1 
ATOM   5868  O  O     . HIS H 4 107 ? 100.736 121.362 132.587 1.00 30.59  ? 106  HIS H O     1 
ATOM   5869  C  CB    . HIS H 4 107 ? 100.274 120.806 129.434 1.00 30.59  ? 106  HIS H CB    1 
ATOM   5870  C  CG    . HIS H 4 107 ? 99.161  120.879 128.437 1.00 30.59  ? 106  HIS H CG    1 
ATOM   5871  N  ND1   . HIS H 4 107 ? 97.873  120.494 128.735 1.00 30.59  ? 106  HIS H ND1   1 
ATOM   5872  C  CD2   . HIS H 4 107 ? 99.142  121.288 127.148 1.00 30.59  ? 106  HIS H CD2   1 
ATOM   5873  C  CE1   . HIS H 4 107 ? 97.107  120.666 127.673 1.00 30.59  ? 106  HIS H CE1   1 
ATOM   5874  N  NE2   . HIS H 4 107 ? 97.853  121.147 126.696 1.00 30.59  ? 106  HIS H NE2   1 
ATOM   5875  N  N     . ALA H 4 108 ? 102.566 121.995 131.443 1.00 28.20  ? 107  ALA H N     1 
ATOM   5876  C  CA    . ALA H 4 108 ? 103.445 121.795 132.591 1.00 28.20  ? 107  ALA H CA    1 
ATOM   5877  C  C     . ALA H 4 108 ? 103.169 122.788 133.716 1.00 28.20  ? 107  ALA H C     1 
ATOM   5878  O  O     . ALA H 4 108 ? 103.209 122.416 134.894 1.00 28.20  ? 107  ALA H O     1 
ATOM   5879  C  CB    . ALA H 4 108 ? 104.902 121.880 132.154 1.00 28.20  ? 107  ALA H CB    1 
ATOM   5880  N  N     . VAL H 4 109 ? 102.892 124.053 133.383 1.00 29.07  ? 108  VAL H N     1 
ATOM   5881  C  CA    . VAL H 4 109 ? 102.571 125.021 134.429 1.00 29.07  ? 108  VAL H CA    1 
ATOM   5882  C  C     . VAL H 4 109 ? 101.204 124.701 135.032 1.00 29.07  ? 108  VAL H C     1 
ATOM   5883  O  O     . VAL H 4 109 ? 100.993 124.883 136.241 1.00 29.07  ? 108  VAL H O     1 
ATOM   5884  C  CB    . VAL H 4 109 ? 102.700 126.479 133.917 1.00 29.07  ? 108  VAL H CB    1 
ATOM   5885  C  CG1   . VAL H 4 109 ? 101.652 126.878 132.911 1.00 29.07  ? 108  VAL H CG1   1 
ATOM   5886  C  CG2   . VAL H 4 109 ? 102.674 127.469 135.056 1.00 29.07  ? 108  VAL H CG2   1 
ATOM   5887  N  N     . SER H 4 110 ? 100.271 124.182 134.213 1.00 32.53  ? 109  SER H N     1 
ATOM   5888  C  CA    . SER H 4 110 ? 98.993  123.695 134.739 1.00 32.53  ? 109  SER H CA    1 
ATOM   5889  C  C     . SER H 4 110 ? 99.196  122.560 135.743 1.00 32.53  ? 109  SER H C     1 
ATOM   5890  O  O     . SER H 4 110 ? 98.599  122.564 136.828 1.00 32.53  ? 109  SER H O     1 
ATOM   5891  C  CB    . SER H 4 110 ? 98.089  123.242 133.594 1.00 32.53  ? 109  SER H CB    1 
ATOM   5892  O  OG    . SER H 4 110 ? 96.857  122.743 134.088 1.00 32.53  ? 109  SER H OG    1 
ATOM   5893  N  N     . GLU H 4 111 ? 100.041 121.581 135.390 1.00 31.88  ? 110  GLU H N     1 
ATOM   5894  C  CA    . GLU H 4 111 ? 100.323 120.451 136.278 1.00 31.88  ? 110  GLU H CA    1 
ATOM   5895  C  C     . GLU H 4 111 ? 101.011 120.895 137.563 1.00 31.88  ? 110  GLU H C     1 
ATOM   5896  O  O     . GLU H 4 111 ? 100.692 120.391 138.647 1.00 31.88  ? 110  GLU H O     1 
ATOM   5897  C  CB    . GLU H 4 111 ? 101.186 119.411 135.561 1.00 31.88  ? 110  GLU H CB    1 
ATOM   5898  C  CG    . GLU H 4 111 ? 100.510 118.680 134.413 1.00 31.88  ? 110  GLU H CG    1 
ATOM   5899  C  CD    . GLU H 4 111 ? 99.442  117.702 134.860 1.00 31.88  ? 110  GLU H CD    1 
ATOM   5900  O  OE1   . GLU H 4 111 ? 99.433  117.318 136.046 1.00 31.88  ? 110  GLU H OE1   1 
ATOM   5901  O  OE2   . GLU H 4 111 ? 98.606  117.313 134.018 1.00 31.88  ? 110  GLU H OE2   1 
ATOM   5902  N  N     . GLY H 4 112 ? 101.986 121.802 137.449 1.00 31.46  ? 111  GLY H N     1 
ATOM   5903  C  CA    . GLY H 4 112 ? 102.661 122.336 138.624 1.00 31.46  ? 111  GLY H CA    1 
ATOM   5904  C  C     . GLY H 4 112 ? 101.716 123.026 139.590 1.00 31.46  ? 111  GLY H C     1 
ATOM   5905  O  O     . GLY H 4 112 ? 101.748 122.764 140.799 1.00 31.46  ? 111  GLY H O     1 
ATOM   5906  N  N     . THR H 4 113 ? 100.893 123.949 139.072 1.00 32.55  ? 112  THR H N     1 
ATOM   5907  C  CA    . THR H 4 113 ? 99.914  124.641 139.908 1.00 32.55  ? 112  THR H CA    1 
ATOM   5908  C  C     . THR H 4 113 ? 98.918  123.674 140.538 1.00 32.55  ? 112  THR H C     1 
ATOM   5909  O  O     . THR H 4 113 ? 98.565  123.834 141.712 1.00 32.55  ? 112  THR H O     1 
ATOM   5910  C  CB    . THR H 4 113 ? 99.179  125.708 139.100 1.00 32.55  ? 112  THR H CB    1 
ATOM   5911  O  OG1   . THR H 4 113 ? 98.623  125.119 137.919 1.00 32.55  ? 112  THR H OG1   1 
ATOM   5912  C  CG2   . THR H 4 113 ? 100.113 126.851 138.732 1.00 32.55  ? 112  THR H CG2   1 
ATOM   5913  N  N     . LYS H 4 114 ? 98.421  122.699 139.759 1.00 33.59  ? 113  LYS H N     1 
ATOM   5914  C  CA    . LYS H 4 114 ? 97.530  121.662 140.286 1.00 33.59  ? 113  LYS H CA    1 
ATOM   5915  C  C     . LYS H 4 114 ? 98.166  120.910 141.454 1.00 33.59  ? 113  LYS H C     1 
ATOM   5916  O  O     . LYS H 4 114 ? 97.530  120.707 142.496 1.00 33.59  ? 113  LYS H O     1 
ATOM   5917  C  CB    . LYS H 4 114 ? 97.131  120.685 139.180 1.00 33.59  ? 113  LYS H CB    1 
ATOM   5918  C  CG    . LYS H 4 114 ? 96.505  119.403 139.706 1.00 33.59  ? 113  LYS H CG    1 
ATOM   5919  C  CD    . LYS H 4 114 ? 96.357  118.343 138.638 1.00 33.59  ? 113  LYS H CD    1 
ATOM   5920  C  CE    . LYS H 4 114 ? 97.509  117.363 138.680 1.00 33.59  ? 113  LYS H CE    1 
ATOM   5921  N  NZ    . LYS H 4 114 ? 97.433  116.467 139.862 1.00 33.59  ? 113  LYS H NZ    1 
ATOM   5922  N  N     . ALA H 4 115 ? 99.411  120.454 141.268 1.00 33.28  ? 114  ALA H N     1 
ATOM   5923  C  CA    . ALA H 4 115 ? 100.118 119.696 142.299 1.00 33.28  ? 114  ALA H CA    1 
ATOM   5924  C  C     . ALA H 4 115 ? 100.318 120.514 143.570 1.00 33.28  ? 114  ALA H C     1 
ATOM   5925  O  O     . ALA H 4 115 ? 100.107 120.008 144.676 1.00 33.28  ? 114  ALA H O     1 
ATOM   5926  C  CB    . ALA H 4 115 ? 101.462 119.211 141.765 1.00 33.28  ? 114  ALA H CB    1 
ATOM   5927  N  N     . VAL H 4 116 ? 100.766 121.768 143.434 1.00 33.25  ? 115  VAL H N     1 
ATOM   5928  C  CA    . VAL H 4 116 ? 100.958 122.626 144.606 1.00 33.25  ? 115  VAL H CA    1 
ATOM   5929  C  C     . VAL H 4 116 ? 99.628  122.911 145.304 1.00 33.25  ? 115  VAL H C     1 
ATOM   5930  O  O     . VAL H 4 116 ? 99.553  122.919 146.541 1.00 33.25  ? 115  VAL H O     1 
ATOM   5931  C  CB    . VAL H 4 116 ? 101.703 123.914 144.209 1.00 33.25  ? 115  VAL H CB    1 
ATOM   5932  C  CG1   . VAL H 4 116 ? 101.843 124.862 145.381 1.00 33.25  ? 115  VAL H CG1   1 
ATOM   5933  C  CG2   . VAL H 4 116 ? 103.081 123.556 143.730 1.00 33.25  ? 115  VAL H CG2   1 
ATOM   5934  N  N     . THR H 4 117 ? 98.558  123.117 144.523 1.00 35.86  ? 116  THR H N     1 
ATOM   5935  C  CA    . THR H 4 117 ? 97.223  123.347 145.079 1.00 35.86  ? 116  THR H CA    1 
ATOM   5936  C  C     . THR H 4 117 ? 96.749  122.149 145.896 1.00 35.86  ? 116  THR H C     1 
ATOM   5937  O  O     . THR H 4 117 ? 96.238  122.304 147.012 1.00 35.86  ? 116  THR H O     1 
ATOM   5938  C  CB    . THR H 4 117 ? 96.242  123.653 143.945 1.00 35.86  ? 116  THR H CB    1 
ATOM   5939  O  OG1   . THR H 4 117 ? 96.615  124.881 143.309 1.00 35.86  ? 116  THR H OG1   1 
ATOM   5940  C  CG2   . THR H 4 117 ? 94.818  123.774 144.462 1.00 35.86  ? 116  THR H CG2   1 
ATOM   5941  N  N     . LYS H 4 118 ? 96.893  120.945 145.339 1.00 37.62  ? 117  LYS H N     1 
ATOM   5942  C  CA    . LYS H 4 118 ? 96.536  119.731 146.064 1.00 37.62  ? 117  LYS H CA    1 
ATOM   5943  C  C     . LYS H 4 118 ? 97.418  119.523 147.293 1.00 37.62  ? 117  LYS H C     1 
ATOM   5944  O  O     . LYS H 4 118 ? 96.929  119.110 148.351 1.00 37.62  ? 117  LYS H O     1 
ATOM   5945  C  CB    . LYS H 4 118 ? 96.641  118.527 145.129 1.00 37.62  ? 117  LYS H CB    1 
ATOM   5946  C  CG    . LYS H 4 118 ? 96.187  117.212 145.727 1.00 37.62  ? 117  LYS H CG    1 
ATOM   5947  C  CD    . LYS H 4 118 ? 96.283  116.094 144.703 1.00 37.62  ? 117  LYS H CD    1 
ATOM   5948  C  CE    . LYS H 4 118 ? 95.521  114.861 145.152 1.00 37.62  ? 117  LYS H CE    1 
ATOM   5949  N  NZ    . LYS H 4 118 ? 95.976  114.382 146.486 1.00 37.62  ? 117  LYS H NZ    1 
ATOM   5950  N  N     . TYR H 4 119 ? 98.720  119.802 147.171 1.00 34.88  ? 118  TYR H N     1 
ATOM   5951  C  CA    . TYR H 4 119 ? 99.661  119.537 148.256 1.00 34.88  ? 118  TYR H CA    1 
ATOM   5952  C  C     . TYR H 4 119 ? 99.489  120.484 149.437 1.00 34.88  ? 118  TYR H C     1 
ATOM   5953  O  O     . TYR H 4 119 ? 99.685  120.068 150.584 1.00 34.88  ? 118  TYR H O     1 
ATOM   5954  C  CB    . TYR H 4 119 ? 101.086 119.599 147.712 1.00 34.88  ? 118  TYR H CB    1 
ATOM   5955  C  CG    . TYR H 4 119 ? 102.181 119.407 148.735 1.00 34.88  ? 118  TYR H CG    1 
ATOM   5956  C  CD1   . TYR H 4 119 ? 102.565 118.132 149.123 1.00 34.88  ? 118  TYR H CD1   1 
ATOM   5957  C  CD2   . TYR H 4 119 ? 102.870 120.489 149.267 1.00 34.88  ? 118  TYR H CD2   1 
ATOM   5958  C  CE1   . TYR H 4 119 ? 103.576 117.938 150.042 1.00 34.88  ? 118  TYR H CE1   1 
ATOM   5959  C  CE2   . TYR H 4 119 ? 103.886 120.305 150.187 1.00 34.88  ? 118  TYR H CE2   1 
ATOM   5960  C  CZ    . TYR H 4 119 ? 104.234 119.025 150.569 1.00 34.88  ? 118  TYR H CZ    1 
ATOM   5961  O  OH    . TYR H 4 119 ? 105.242 118.828 151.483 1.00 34.88  ? 118  TYR H OH    1 
ATOM   5962  N  N     . THR H 4 120 ? 99.158  121.756 149.193 1.00 37.86  ? 119  THR H N     1 
ATOM   5963  C  CA    . THR H 4 120 ? 98.951  122.670 150.315 1.00 37.86  ? 119  THR H CA    1 
ATOM   5964  C  C     . THR H 4 120 ? 97.656  122.375 151.062 1.00 37.86  ? 119  THR H C     1 
ATOM   5965  O  O     . THR H 4 120 ? 97.551  122.677 152.255 1.00 37.86  ? 119  THR H O     1 
ATOM   5966  C  CB    . THR H 4 120 ? 98.964  124.126 149.848 1.00 37.86  ? 119  THR H CB    1 
ATOM   5967  O  OG1   . THR H 4 120 ? 97.972  124.323 148.832 1.00 37.86  ? 119  THR H OG1   1 
ATOM   5968  C  CG2   . THR H 4 120 ? 100.340 124.520 149.330 1.00 37.86  ? 119  THR H CG2   1 
ATOM   5969  N  N     . SER H 4 121 ? 96.668  121.799 150.385 1.00 38.56  ? 120  SER H N     1 
ATOM   5970  C  CA    . SER H 4 121 ? 95.398  121.459 151.016 1.00 38.56  ? 120  SER H CA    1 
ATOM   5971  C  C     . SER H 4 121 ? 95.546  120.254 151.942 1.00 38.56  ? 120  SER H C     1 
ATOM   5972  O  O     . SER H 4 121 ? 95.865  120.399 153.122 1.00 38.56  ? 120  SER H O     1 
ATOM   5973  C  CB    . SER H 4 121 ? 94.330  121.182 149.958 1.00 38.56  ? 120  SER H CB    1 
ATOM   5974  O  OG    . SER H 4 121 ? 94.195  122.282 149.076 1.00 38.56  ? 120  SER H OG    1 
ATOM   5975  P  P     . DT  I 5 2   ? 100.837 101.144 80.303  1.00 108.09 ? 2    DT  I P     1 
ATOM   5976  O  OP1   . DT  I 5 2   ? 99.914  102.030 79.564  1.00 108.09 ? 2    DT  I OP1   1 
ATOM   5977  O  OP2   . DT  I 5 2   ? 100.372 100.390 81.486  1.00 108.09 ? 2    DT  I OP2   1 
ATOM   5978  O  "O5'" . DT  I 5 2   ? 101.511 100.122 79.273  1.00 108.09 ? 2    DT  I "O5'" 1 
ATOM   5979  C  "C5'" . DT  I 5 2   ? 100.710 99.291  78.422  1.00 108.09 ? 2    DT  I "C5'" 1 
ATOM   5980  C  "C4'" . DT  I 5 2   ? 101.149 97.825  78.489  1.00 108.09 ? 2    DT  I "C4'" 1 
ATOM   5981  O  "O4'" . DT  I 5 2   ? 102.564 97.721  78.205  1.00 108.09 ? 2    DT  I "O4'" 1 
ATOM   5982  C  "C3'" . DT  I 5 2   ? 100.945 97.104  79.809  1.00 108.09 ? 2    DT  I "C3'" 1 
ATOM   5983  O  "O3'" . DT  I 5 2   ? 100.661 95.735  79.526  1.00 108.09 ? 2    DT  I "O3'" 1 
ATOM   5984  C  "C2'" . DT  I 5 2   ? 102.302 97.273  80.490  1.00 108.09 ? 2    DT  I "C2'" 1 
ATOM   5985  C  "C1'" . DT  I 5 2   ? 103.246 97.148  79.305  1.00 108.09 ? 2    DT  I "C1'" 1 
ATOM   5986  N  N1    . DT  I 5 2   ? 104.494 97.921  79.432  1.00 108.09 ? 2    DT  I N1    1 
ATOM   5987  C  C2    . DT  I 5 2   ? 105.626 97.444  78.837  1.00 108.09 ? 2    DT  I C2    1 
ATOM   5988  O  O2    . DT  I 5 2   ? 105.673 96.375  78.261  1.00 108.09 ? 2    DT  I O2    1 
ATOM   5989  N  N3    . DT  I 5 2   ? 106.717 98.252  78.956  1.00 108.09 ? 2    DT  I N3    1 
ATOM   5990  C  C4    . DT  I 5 2   ? 106.782 99.471  79.581  1.00 108.09 ? 2    DT  I C4    1 
ATOM   5991  O  O4    . DT  I 5 2   ? 107.818 100.120 79.631  1.00 108.09 ? 2    DT  I O4    1 
ATOM   5992  C  C5    . DT  I 5 2   ? 105.554 99.927  80.165  1.00 108.09 ? 2    DT  I C5    1 
ATOM   5993  C  C7    . DT  I 5 2   ? 105.506 101.243 80.872  1.00 108.09 ? 2    DT  I C7    1 
ATOM   5994  C  C6    . DT  I 5 2   ? 104.476 99.145  80.055  1.00 108.09 ? 2    DT  I C6    1 
ATOM   5995  P  P     . DG  I 5 3   ? 99.689  94.874  80.469  1.00 106.91 ? 3    DG  I P     1 
ATOM   5996  O  OP1   . DG  I 5 3   ? 98.312  95.018  79.950  1.00 106.91 ? 3    DG  I OP1   1 
ATOM   5997  O  OP2   . DG  I 5 3   ? 100.007 95.231  81.870  1.00 106.91 ? 3    DG  I OP2   1 
ATOM   5998  O  "O5'" . DG  I 5 3   ? 100.149 93.363  80.211  1.00 106.91 ? 3    DG  I "O5'" 1 
ATOM   5999  C  "C5'" . DG  I 5 3   ? 101.067 93.076  79.165  1.00 106.91 ? 3    DG  I "C5'" 1 
ATOM   6000  C  "C4'" . DG  I 5 3   ? 102.175 92.134  79.623  1.00 106.91 ? 3    DG  I "C4'" 1 
ATOM   6001  O  "O4'" . DG  I 5 3   ? 103.379 92.900  79.886  1.00 106.91 ? 3    DG  I "O4'" 1 
ATOM   6002  C  "C3'" . DG  I 5 3   ? 101.925 91.350  80.907  1.00 106.91 ? 3    DG  I "C3'" 1 
ATOM   6003  O  "O3'" . DG  I 5 3   ? 102.632 90.130  80.826  1.00 106.91 ? 3    DG  I "O3'" 1 
ATOM   6004  C  "C2'" . DG  I 5 3   ? 102.564 92.250  81.953  1.00 106.91 ? 3    DG  I "C2'" 1 
ATOM   6005  C  "C1'" . DG  I 5 3   ? 103.816 92.637  81.202  1.00 106.91 ? 3    DG  I "C1'" 1 
ATOM   6006  N  N9    . DG  I 5 3   ? 104.468 93.826  81.705  1.00 106.91 ? 3    DG  I N9    1 
ATOM   6007  C  C8    . DG  I 5 3   ? 103.885 94.882  82.337  1.00 106.91 ? 3    DG  I C8    1 
ATOM   6008  N  N7    . DG  I 5 3   ? 104.721 95.838  82.627  1.00 106.91 ? 3    DG  I N7    1 
ATOM   6009  C  C5    . DG  I 5 3   ? 105.937 95.379  82.147  1.00 106.91 ? 3    DG  I C5    1 
ATOM   6010  C  C6    . DG  I 5 3   ? 107.223 95.975  82.179  1.00 106.91 ? 3    DG  I C6    1 
ATOM   6011  O  O6    . DG  I 5 3   ? 107.559 97.069  82.644  1.00 106.91 ? 3    DG  I O6    1 
ATOM   6012  N  N1    . DG  I 5 3   ? 108.172 95.168  81.581  1.00 106.91 ? 3    DG  I N1    1 
ATOM   6013  C  C2    . DG  I 5 3   ? 107.918 93.945  81.022  1.00 106.91 ? 3    DG  I C2    1 
ATOM   6014  N  N2    . DG  I 5 3   ? 108.965 93.305  80.494  1.00 106.91 ? 3    DG  I N2    1 
ATOM   6015  N  N3    . DG  I 5 3   ? 106.726 93.373  80.996  1.00 106.91 ? 3    DG  I N3    1 
ATOM   6016  C  C4    . DG  I 5 3   ? 105.788 94.149  81.563  1.00 106.91 ? 3    DG  I C4    1 
ATOM   6017  P  P     . DG  I 5 4   ? 101.900 88.730  81.079  1.00 105.62 ? 4    DG  I P     1 
ATOM   6018  O  OP1   . DG  I 5 4   ? 101.080 88.466  79.879  1.00 105.62 ? 4    DG  I OP1   1 
ATOM   6019  O  OP2   . DG  I 5 4   ? 101.252 88.803  82.404  1.00 105.62 ? 4    DG  I OP2   1 
ATOM   6020  O  "O5'" . DG  I 5 4   ? 103.100 87.661  81.145  1.00 105.62 ? 4    DG  I "O5'" 1 
ATOM   6021  C  "C5'" . DG  I 5 4   ? 104.098 87.625  80.123  1.00 105.62 ? 4    DG  I "C5'" 1 
ATOM   6022  C  "C4'" . DG  I 5 4   ? 105.525 87.602  80.683  1.00 105.62 ? 4    DG  I "C4'" 1 
ATOM   6023  O  "O4'" . DG  I 5 4   ? 105.949 88.911  81.148  1.00 105.62 ? 4    DG  I "O4'" 1 
ATOM   6024  C  "C3'" . DG  I 5 4   ? 105.790 86.650  81.843  1.00 105.62 ? 4    DG  I "C3'" 1 
ATOM   6025  O  "O3'" . DG  I 5 4   ? 107.059 86.085  81.661  1.00 105.62 ? 4    DG  I "O3'" 1 
ATOM   6026  C  "C2'" . DG  I 5 4   ? 105.789 87.585  83.048  1.00 105.62 ? 4    DG  I "C2'" 1 
ATOM   6027  C  "C1'" . DG  I 5 4   ? 106.486 88.791  82.455  1.00 105.62 ? 4    DG  I "C1'" 1 
ATOM   6028  N  N9    . DG  I 5 4   ? 106.232 90.042  83.151  1.00 105.62 ? 4    DG  I N9    1 
ATOM   6029  C  C8    . DG  I 5 4   ? 105.028 90.495  83.606  1.00 105.62 ? 4    DG  I C8    1 
ATOM   6030  N  N7    . DG  I 5 4   ? 105.085 91.682  84.138  1.00 105.62 ? 4    DG  I N7    1 
ATOM   6031  C  C5    . DG  I 5 4   ? 106.413 92.038  84.022  1.00 105.62 ? 4    DG  I C5    1 
ATOM   6032  C  C6    . DG  I 5 4   ? 107.068 93.216  84.423  1.00 105.62 ? 4    DG  I C6    1 
ATOM   6033  O  O6    . DG  I 5 4   ? 106.586 94.204  84.990  1.00 105.62 ? 4    DG  I O6    1 
ATOM   6034  N  N1    . DG  I 5 4   ? 108.419 93.174  84.129  1.00 105.62 ? 4    DG  I N1    1 
ATOM   6035  C  C2    . DG  I 5 4   ? 109.058 92.119  83.516  1.00 105.62 ? 4    DG  I C2    1 
ATOM   6036  N  N2    . DG  I 5 4   ? 110.375 92.260  83.303  1.00 105.62 ? 4    DG  I N2    1 
ATOM   6037  N  N3    . DG  I 5 4   ? 108.448 91.012  83.122  1.00 105.62 ? 4    DG  I N3    1 
ATOM   6038  C  C4    . DG  I 5 4   ? 107.130 91.046  83.400  1.00 105.62 ? 4    DG  I C4    1 
ATOM   6039  P  P     . DA  I 5 5   ? 107.426 84.643  82.254  1.00 101.35 ? 5    DA  I P     1 
ATOM   6040  O  OP1   . DA  I 5 5   ? 107.543 83.698  81.123  1.00 101.35 ? 5    DA  I OP1   1 
ATOM   6041  O  OP2   . DA  I 5 5   ? 106.498 84.339  83.366  1.00 101.35 ? 5    DA  I OP2   1 
ATOM   6042  O  "O5'" . DA  I 5 5   ? 108.868 84.907  82.878  1.00 101.35 ? 5    DA  I "O5'" 1 
ATOM   6043  C  "C5'" . DA  I 5 5   ? 109.884 85.466  82.061  1.00 101.35 ? 5    DA  I "C5'" 1 
ATOM   6044  C  "C4'" . DA  I 5 5   ? 110.921 86.198  82.893  1.00 101.35 ? 5    DA  I "C4'" 1 
ATOM   6045  O  "O4'" . DA  I 5 5   ? 110.412 87.473  83.362  1.00 101.35 ? 5    DA  I "O4'" 1 
ATOM   6046  C  "C3'" . DA  I 5 5   ? 111.402 85.452  84.128  1.00 101.35 ? 5    DA  I "C3'" 1 
ATOM   6047  O  "O3'" . DA  I 5 5   ? 112.786 85.610  84.238  1.00 101.35 ? 5    DA  I "O3'" 1 
ATOM   6048  C  "C2'" . DA  I 5 5   ? 110.674 86.162  85.269  1.00 101.35 ? 5    DA  I "C2'" 1 
ATOM   6049  C  "C1'" . DA  I 5 5   ? 110.642 87.584  84.752  1.00 101.35 ? 5    DA  I "C1'" 1 
ATOM   6050  N  N9    . DA  I 5 5   ? 109.586 88.417  85.311  1.00 101.35 ? 5    DA  I N9    1 
ATOM   6051  C  C8    . DA  I 5 5   ? 108.263 88.111  85.390  1.00 101.35 ? 5    DA  I C8    1 
ATOM   6052  N  N7    . DA  I 5 5   ? 107.529 89.059  85.912  1.00 101.35 ? 5    DA  I N7    1 
ATOM   6053  C  C5    . DA  I 5 5   ? 108.440 90.046  86.223  1.00 101.35 ? 5    DA  I C5    1 
ATOM   6054  C  C6    . DA  I 5 5   ? 108.292 91.311  86.796  1.00 101.35 ? 5    DA  I C6    1 
ATOM   6055  N  N6    . DA  I 5 5   ? 107.120 91.791  87.209  1.00 101.35 ? 5    DA  I N6    1 
ATOM   6056  N  N1    . DA  I 5 5   ? 109.401 92.054  86.969  1.00 101.35 ? 5    DA  I N1    1 
ATOM   6057  C  C2    . DA  I 5 5   ? 110.578 91.563  86.568  1.00 101.35 ? 5    DA  I C2    1 
ATOM   6058  N  N3    . DA  I 5 5   ? 110.838 90.390  86.002  1.00 101.35 ? 5    DA  I N3    1 
ATOM   6059  C  C4    . DA  I 5 5   ? 109.714 89.675  85.853  1.00 101.35 ? 5    DA  I C4    1 
ATOM   6060  P  P     . DG  I 5 6   ? 113.649 84.530  85.040  1.00 98.34  ? 6    DG  I P     1 
ATOM   6061  O  OP1   . DG  I 5 6   ? 114.684 84.020  84.117  1.00 98.34  ? 6    DG  I OP1   1 
ATOM   6062  O  OP2   . DG  I 5 6   ? 112.710 83.609  85.715  1.00 98.34  ? 6    DG  I OP2   1 
ATOM   6063  O  "O5'" . DG  I 5 6   ? 114.406 85.400  86.128  1.00 98.34  ? 6    DG  I "O5'" 1 
ATOM   6064  C  "C5'" . DG  I 5 6   ? 114.800 86.714  85.817  1.00 98.34  ? 6    DG  I "C5'" 1 
ATOM   6065  C  "C4'" . DG  I 5 6   ? 114.868 87.557  87.068  1.00 98.34  ? 6    DG  I "C4'" 1 
ATOM   6066  O  "O4'" . DG  I 5 6   ? 113.621 88.262  87.278  1.00 98.34  ? 6    DG  I "O4'" 1 
ATOM   6067  C  "C3'" . DG  I 5 6   ? 115.124 86.766  88.346  1.00 98.34  ? 6    DG  I "C3'" 1 
ATOM   6068  O  "O3'" . DG  I 5 6   ? 116.099 87.411  89.100  1.00 98.34  ? 6    DG  I "O3'" 1 
ATOM   6069  C  "C2'" . DG  I 5 6   ? 113.770 86.790  89.042  1.00 98.34  ? 6    DG  I "C2'" 1 
ATOM   6070  C  "C1'" . DG  I 5 6   ? 113.291 88.160  88.635  1.00 98.34  ? 6    DG  I "C1'" 1 
ATOM   6071  N  N9    . DG  I 5 6   ? 111.866 88.377  88.795  1.00 98.34  ? 6    DG  I N9    1 
ATOM   6072  C  C8    . DG  I 5 6   ? 110.854 87.513  88.485  1.00 98.34  ? 6    DG  I C8    1 
ATOM   6073  N  N7    . DG  I 5 6   ? 109.671 87.994  88.737  1.00 98.34  ? 6    DG  I N7    1 
ATOM   6074  C  C5    . DG  I 5 6   ? 109.925 89.253  89.259  1.00 98.34  ? 6    DG  I C5    1 
ATOM   6075  C  C6    . DG  I 5 6   ? 109.034 90.241  89.734  1.00 98.34  ? 6    DG  I C6    1 
ATOM   6076  O  O6    . DG  I 5 6   ? 107.795 90.211  89.762  1.00 98.34  ? 6    DG  I O6    1 
ATOM   6077  N  N1    . DG  I 5 6   ? 109.711 91.372  90.170  1.00 98.34  ? 6    DG  I N1    1 
ATOM   6078  C  C2    . DG  I 5 6   ? 111.075 91.517  90.170  1.00 98.34  ? 6    DG  I C2    1 
ATOM   6079  N  N2    . DG  I 5 6   ? 111.551 92.674  90.640  1.00 98.34  ? 6    DG  I N2    1 
ATOM   6080  N  N3    . DG  I 5 6   ? 111.914 90.595  89.744  1.00 98.34  ? 6    DG  I N3    1 
ATOM   6081  C  C4    . DG  I 5 6   ? 111.271 89.496  89.302  1.00 98.34  ? 6    DG  I C4    1 
ATOM   6082  P  P     . DA  I 5 7   ? 117.153 86.543  89.935  1.00 93.99  ? 7    DA  I P     1 
ATOM   6083  O  OP1   . DA  I 5 7   ? 118.279 86.209  89.039  1.00 93.99  ? 7    DA  I OP1   1 
ATOM   6084  O  OP2   . DA  I 5 7   ? 116.405 85.466  90.612  1.00 93.99  ? 7    DA  I OP2   1 
ATOM   6085  O  "O5'" . DA  I 5 7   ? 117.655 87.559  91.044  1.00 93.99  ? 7    DA  I "O5'" 1 
ATOM   6086  C  "C5'" . DA  I 5 7   ? 117.775 88.915  90.705  1.00 93.99  ? 7    DA  I "C5'" 1 
ATOM   6087  C  "C4'" . DA  I 5 7   ? 117.126 89.773  91.751  1.00 93.99  ? 7    DA  I "C4'" 1 
ATOM   6088  O  "O4'" . DA  I 5 7   ? 115.702 89.746  91.587  1.00 93.99  ? 7    DA  I "O4'" 1 
ATOM   6089  C  "C3'" . DA  I 5 7   ? 117.407 89.337  93.169  1.00 93.99  ? 7    DA  I "C3'" 1 
ATOM   6090  O  "O3'" . DA  I 5 7   ? 118.178 90.344  93.784  1.00 93.99  ? 7    DA  I "O3'" 1 
ATOM   6091  C  "C2'" . DA  I 5 7   ? 116.011 89.167  93.800  1.00 93.99  ? 7    DA  I "C2'" 1 
ATOM   6092  C  "C1'" . DA  I 5 7   ? 115.100 89.903  92.833  1.00 93.99  ? 7    DA  I "C1'" 1 
ATOM   6093  N  N9    . DA  I 5 7   ? 113.765 89.336  92.697  1.00 93.99  ? 7    DA  I N9    1 
ATOM   6094  C  C8    . DA  I 5 7   ? 113.472 88.094  92.242  1.00 93.99  ? 7    DA  I C8    1 
ATOM   6095  N  N7    . DA  I 5 7   ? 112.193 87.834  92.176  1.00 93.99  ? 7    DA  I N7    1 
ATOM   6096  C  C5    . DA  I 5 7   ? 111.600 88.981  92.635  1.00 93.99  ? 7    DA  I C5    1 
ATOM   6097  C  C6    . DA  I 5 7   ? 110.260 89.327  92.818  1.00 93.99  ? 7    DA  I C6    1 
ATOM   6098  N  N6    . DA  I 5 7   ? 109.256 88.500  92.545  1.00 93.99  ? 7    DA  I N6    1 
ATOM   6099  N  N1    . DA  I 5 7   ? 109.987 90.554  93.298  1.00 93.99  ? 7    DA  I N1    1 
ATOM   6100  C  C2    . DA  I 5 7   ? 111.005 91.378  93.571  1.00 93.99  ? 7    DA  I C2    1 
ATOM   6101  N  N3    . DA  I 5 7   ? 112.317 91.158  93.437  1.00 93.99  ? 7    DA  I N3    1 
ATOM   6102  C  C4    . DA  I 5 7   ? 112.548 89.929  92.960  1.00 93.99  ? 7    DA  I C4    1 
ATOM   6103  P  P     . DA  I 5 8   ? 118.686 90.203  95.296  1.00 94.35  ? 8    DA  I P     1 
ATOM   6104  O  OP1   . DA  I 5 8   ? 119.961 90.939  95.383  1.00 94.35  ? 8    DA  I OP1   1 
ATOM   6105  O  OP2   . DA  I 5 8   ? 118.650 88.785  95.711  1.00 94.35  ? 8    DA  I OP2   1 
ATOM   6106  O  "O5'" . DA  I 5 8   ? 117.598 91.030  96.099  1.00 94.35  ? 8    DA  I "O5'" 1 
ATOM   6107  C  "C5'" . DA  I 5 8   ? 117.144 92.246  95.567  1.00 94.35  ? 8    DA  I "C5'" 1 
ATOM   6108  C  "C4'" . DA  I 5 8   ? 116.056 92.816  96.431  1.00 94.35  ? 8    DA  I "C4'" 1 
ATOM   6109  O  "O4'" . DA  I 5 8   ? 114.769 92.290  96.023  1.00 94.35  ? 8    DA  I "O4'" 1 
ATOM   6110  C  "C3'" . DA  I 5 8   ? 116.214 92.517  97.907  1.00 94.35  ? 8    DA  I "C3'" 1 
ATOM   6111  O  "O3'" . DA  I 5 8   ? 116.127 93.719  98.635  1.00 94.35  ? 8    DA  I "O3'" 1 
ATOM   6112  C  "C2'" . DA  I 5 8   ? 115.062 91.560  98.222  1.00 94.35  ? 8    DA  I "C2'" 1 
ATOM   6113  C  "C1'" . DA  I 5 8   ? 114.037 91.870  97.145  1.00 94.35  ? 8    DA  I "C1'" 1 
ATOM   6114  N  N9    . DA  I 5 8   ? 113.231 90.720  96.744  1.00 94.35  ? 8    DA  I N9    1 
ATOM   6115  C  C8    . DA  I 5 8   ? 113.698 89.524  96.304  1.00 94.35  ? 8    DA  I C8    1 
ATOM   6116  N  N7    . DA  I 5 8   ? 112.765 88.669  95.991  1.00 94.35  ? 8    DA  I N7    1 
ATOM   6117  C  C5    . DA  I 5 8   ? 111.593 89.342  96.264  1.00 94.35  ? 8    DA  I C5    1 
ATOM   6118  C  C6    . DA  I 5 8   ? 110.242 88.968  96.150  1.00 94.35  ? 8    DA  I C6    1 
ATOM   6119  N  N6    . DA  I 5 8   ? 109.855 87.774  95.713  1.00 94.35  ? 8    DA  I N6    1 
ATOM   6120  N  N1    . DA  I 5 8   ? 109.305 89.865  96.499  1.00 94.35  ? 8    DA  I N1    1 
ATOM   6121  C  C2    . DA  I 5 8   ? 109.702 91.064  96.937  1.00 94.35  ? 8    DA  I C2    1 
ATOM   6122  N  N3    . DA  I 5 8   ? 110.947 91.532  97.090  1.00 94.35  ? 8    DA  I N3    1 
ATOM   6123  C  C4    . DA  I 5 8   ? 111.854 90.609  96.735  1.00 94.35  ? 8    DA  I C4    1 
ATOM   6124  P  P     . DT  I 5 9   ? 116.365 93.743  100.220 1.00 97.45  ? 9    DT  I P     1 
ATOM   6125  O  OP1   . DT  I 5 9   ? 116.975 95.045  100.554 1.00 97.45  ? 9    DT  I OP1   1 
ATOM   6126  O  OP2   . DT  I 5 9   ? 117.053 92.505  100.641 1.00 97.45  ? 9    DT  I OP2   1 
ATOM   6127  O  "O5'" . DT  I 5 9   ? 114.877 93.768  100.780 1.00 97.45  ? 9    DT  I "O5'" 1 
ATOM   6128  C  "C5'" . DT  I 5 9   ? 113.948 94.640  100.165 1.00 97.45  ? 9    DT  I "C5'" 1 
ATOM   6129  C  "C4'" . DT  I 5 9   ? 112.526 94.309  100.559 1.00 97.45  ? 9    DT  I "C4'" 1 
ATOM   6130  O  "O4'" . DT  I 5 9   ? 112.079 93.094  99.914  1.00 97.45  ? 9    DT  I "O4'" 1 
ATOM   6131  C  "C3'" . DT  I 5 9   ? 112.300 94.126  102.055 1.00 97.45  ? 9    DT  I "C3'" 1 
ATOM   6132  O  "O3'" . DT  I 5 9   ? 111.306 95.055  102.476 1.00 97.45  ? 9    DT  I "O3'" 1 
ATOM   6133  C  "C2'" . DT  I 5 9   ? 111.842 92.666  102.183 1.00 97.45  ? 9    DT  I "C2'" 1 
ATOM   6134  C  "C1'" . DT  I 5 9   ? 111.265 92.387  100.808 1.00 97.45  ? 9    DT  I "C1'" 1 
ATOM   6135  N  N1    . DT  I 5 9   ? 111.276 90.956  100.413 1.00 97.45  ? 9    DT  I N1    1 
ATOM   6136  C  C2    . DT  I 5 9   ? 110.091 90.319  100.159 1.00 97.45  ? 9    DT  I C2    1 
ATOM   6137  O  O2    . DT  I 5 9   ? 109.011 90.857  100.277 1.00 97.45  ? 9    DT  I O2    1 
ATOM   6138  N  N3    . DT  I 5 9   ? 110.216 89.012  99.778  1.00 97.45  ? 9    DT  I N3    1 
ATOM   6139  C  C4    . DT  I 5 9   ? 111.387 88.301  99.617  1.00 97.45  ? 9    DT  I C4    1 
ATOM   6140  O  O4    . DT  I 5 9   ? 111.400 87.127  99.271  1.00 97.45  ? 9    DT  I O4    1 
ATOM   6141  C  C5    . DT  I 5 9   ? 112.594 89.036  99.883  1.00 97.45  ? 9    DT  I C5    1 
ATOM   6142  C  C7    . DT  I 5 9   ? 113.929 88.370  99.742  1.00 97.45  ? 9    DT  I C7    1 
ATOM   6143  C  C6    . DT  I 5 9   ? 112.479 90.312  100.263 1.00 97.45  ? 9    DT  I C6    1 
ATOM   6144  P  P     . DC  I 5 10  ? 110.832 95.146  104.007 1.00 103.88 ? 10   DC  I P     1 
ATOM   6145  O  OP1   . DC  I 5 10  ? 110.498 96.567  104.243 1.00 103.88 ? 10   DC  I OP1   1 
ATOM   6146  O  OP2   . DC  I 5 10  ? 111.849 94.496  104.867 1.00 103.88 ? 10   DC  I OP2   1 
ATOM   6147  O  "O5'" . DC  I 5 10  ? 109.475 94.294  104.039 1.00 103.88 ? 10   DC  I "O5'" 1 
ATOM   6148  C  "C5'" . DC  I 5 10  ? 108.473 94.518  103.048 1.00 103.88 ? 10   DC  I "C5'" 1 
ATOM   6149  C  "C4'" . DC  I 5 10  ? 107.273 93.613  103.269 1.00 103.88 ? 10   DC  I "C4'" 1 
ATOM   6150  O  "O4'" . DC  I 5 10  ? 107.554 92.285  102.757 1.00 103.88 ? 10   DC  I "O4'" 1 
ATOM   6151  C  "C3'" . DC  I 5 10  ? 106.851 93.429  104.720 1.00 103.88 ? 10   DC  I "C3'" 1 
ATOM   6152  O  "O3'" . DC  I 5 10  ? 105.431 93.552  104.808 1.00 103.88 ? 10   DC  I "O3'" 1 
ATOM   6153  C  "C2'" . DC  I 5 10  ? 107.342 92.013  105.051 1.00 103.88 ? 10   DC  I "C2'" 1 
ATOM   6154  C  "C1'" . DC  I 5 10  ? 107.196 91.312  103.713 1.00 103.88 ? 10   DC  I "C1'" 1 
ATOM   6155  N  N1    . DC  I 5 10  ? 108.135 90.173  103.518 1.00 103.88 ? 10   DC  I N1    1 
ATOM   6156  C  C2    . DC  I 5 10  ? 107.662 88.897  103.163 1.00 103.88 ? 10   DC  I C2    1 
ATOM   6157  O  O2    . DC  I 5 10  ? 106.450 88.694  103.072 1.00 103.88 ? 10   DC  I O2    1 
ATOM   6158  N  N3    . DC  I 5 10  ? 108.564 87.900  102.967 1.00 103.88 ? 10   DC  I N3    1 
ATOM   6159  C  C4    . DC  I 5 10  ? 109.868 88.146  103.080 1.00 103.88 ? 10   DC  I C4    1 
ATOM   6160  N  N4    . DC  I 5 10  ? 110.723 87.138  102.876 1.00 103.88 ? 10   DC  I N4    1 
ATOM   6161  C  C5    . DC  I 5 10  ? 110.359 89.436  103.420 1.00 103.88 ? 10   DC  I C5    1 
ATOM   6162  C  C6    . DC  I 5 10  ? 109.468 90.407  103.617 1.00 103.88 ? 10   DC  I C6    1 
ATOM   6163  P  P     . DC  I 5 11  ? 104.677 93.533  106.228 1.00 109.49 ? 11   DC  I P     1 
ATOM   6164  O  OP1   . DC  I 5 11  ? 103.515 94.436  106.096 1.00 109.49 ? 11   DC  I OP1   1 
ATOM   6165  O  OP2   . DC  I 5 11  ? 105.665 93.771  107.303 1.00 109.49 ? 11   DC  I OP2   1 
ATOM   6166  O  "O5'" . DC  I 5 11  ? 104.124 92.037  106.356 1.00 109.49 ? 11   DC  I "O5'" 1 
ATOM   6167  C  "C5'" . DC  I 5 11  ? 103.008 91.617  105.561 1.00 109.49 ? 11   DC  I "C5'" 1 
ATOM   6168  C  "C4'" . DC  I 5 11  ? 102.768 90.125  105.712 1.00 109.49 ? 11   DC  I "C4'" 1 
ATOM   6169  O  "O4'" . DC  I 5 11  ? 103.955 89.381  105.327 1.00 109.49 ? 11   DC  I "O4'" 1 
ATOM   6170  C  "C3'" . DC  I 5 11  ? 102.425 89.650  107.128 1.00 109.49 ? 11   DC  I "C3'" 1 
ATOM   6171  O  "O3'" . DC  I 5 11  ? 101.422 88.666  107.054 1.00 109.49 ? 11   DC  I "O3'" 1 
ATOM   6172  C  "C2'" . DC  I 5 11  ? 103.736 89.031  107.581 1.00 109.49 ? 11   DC  I "C2'" 1 
ATOM   6173  C  "C1'" . DC  I 5 11  ? 104.167 88.382  106.289 1.00 109.49 ? 11   DC  I "C1'" 1 
ATOM   6174  N  N1    . DC  I 5 11  ? 105.577 87.998  106.268 1.00 109.49 ? 11   DC  I N1    1 
ATOM   6175  C  C2    . DC  I 5 11  ? 105.925 86.680  105.996 1.00 109.49 ? 11   DC  I C2    1 
ATOM   6176  O  O2    . DC  I 5 11  ? 105.032 85.856  105.779 1.00 109.49 ? 11   DC  I O2    1 
ATOM   6177  N  N3    . DC  I 5 11  ? 107.229 86.340  105.981 1.00 109.49 ? 11   DC  I N3    1 
ATOM   6178  C  C4    . DC  I 5 11  ? 108.154 87.260  106.225 1.00 109.49 ? 11   DC  I C4    1 
ATOM   6179  N  N4    . DC  I 5 11  ? 109.432 86.883  106.200 1.00 109.49 ? 11   DC  I N4    1 
ATOM   6180  C  C5    . DC  I 5 11  ? 107.813 88.608  106.512 1.00 109.49 ? 11   DC  I C5    1 
ATOM   6181  C  C6    . DC  I 5 11  ? 106.524 88.926  106.522 1.00 109.49 ? 11   DC  I C6    1 
ATOM   6182  P  P     . DC  I 5 12  ? 100.490 88.318  108.314 1.00 109.13 ? 12   DC  I P     1 
ATOM   6183  O  OP1   . DC  I 5 12  ? 99.355  89.259  108.274 1.00 109.13 ? 12   DC  I OP1   1 
ATOM   6184  O  OP2   . DC  I 5 12  ? 101.297 88.186  109.545 1.00 109.13 ? 12   DC  I OP2   1 
ATOM   6185  O  "O5'" . DC  I 5 12  ? 99.966  86.861  107.950 1.00 109.13 ? 12   DC  I "O5'" 1 
ATOM   6186  C  "C5'" . DC  I 5 12  ? 100.780 86.029  107.134 1.00 109.13 ? 12   DC  I "C5'" 1 
ATOM   6187  C  "C4'" . DC  I 5 12  ? 101.229 84.783  107.877 1.00 109.13 ? 12   DC  I "C4'" 1 
ATOM   6188  O  "O4'" . DC  I 5 12  ? 102.673 84.645  107.804 1.00 109.13 ? 12   DC  I "O4'" 1 
ATOM   6189  C  "C3'" . DC  I 5 12  ? 100.878 84.732  109.361 1.00 109.13 ? 12   DC  I "C3'" 1 
ATOM   6190  O  "O3'" . DC  I 5 12  ? 100.402 83.435  109.662 1.00 109.13 ? 12   DC  I "O3'" 1 
ATOM   6191  C  "C2'" . DC  I 5 12  ? 102.213 85.012  110.043 1.00 109.13 ? 12   DC  I "C2'" 1 
ATOM   6192  C  "C1'" . DC  I 5 12  ? 103.166 84.341  109.084 1.00 109.13 ? 12   DC  I "C1'" 1 
ATOM   6193  N  N1    . DC  I 5 12  ? 104.535 84.835  109.174 1.00 109.13 ? 12   DC  I N1    1 
ATOM   6194  C  C2    . DC  I 5 12  ? 105.584 83.947  109.027 1.00 109.13 ? 12   DC  I C2    1 
ATOM   6195  O  O2    . DC  I 5 12  ? 105.338 82.756  108.846 1.00 109.13 ? 12   DC  I O2    1 
ATOM   6196  N  N3    . DC  I 5 12  ? 106.851 84.410  109.105 1.00 109.13 ? 12   DC  I N3    1 
ATOM   6197  C  C4    . DC  I 5 12  ? 107.076 85.703  109.304 1.00 109.13 ? 12   DC  I C4    1 
ATOM   6198  N  N4    . DC  I 5 12  ? 108.342 86.115  109.366 1.00 109.13 ? 12   DC  I N4    1 
ATOM   6199  C  C5    . DC  I 5 12  ? 106.012 86.629  109.451 1.00 109.13 ? 12   DC  I C5    1 
ATOM   6200  C  C6    . DC  I 5 12  ? 104.767 86.152  109.379 1.00 109.13 ? 12   DC  I C6    1 
ATOM   6201  P  P     . DG  I 5 13  ? 99.632  83.135  111.038 1.00 108.21 ? 13   DG  I P     1 
ATOM   6202  O  OP1   . DG  I 5 13  ? 98.353  82.493  110.661 1.00 108.21 ? 13   DG  I OP1   1 
ATOM   6203  O  OP2   . DG  I 5 13  ? 99.594  84.368  111.856 1.00 108.21 ? 13   DG  I OP2   1 
ATOM   6204  O  "O5'" . DG  I 5 13  ? 100.562 82.039  111.750 1.00 108.21 ? 13   DG  I "O5'" 1 
ATOM   6205  C  "C5'" . DG  I 5 13  ? 100.401 80.667  111.408 1.00 108.21 ? 13   DG  I "C5'" 1 
ATOM   6206  C  "C4'" . DG  I 5 13  ? 101.730 79.942  111.386 1.00 108.21 ? 13   DG  I "C4'" 1 
ATOM   6207  O  "O4'" . DG  I 5 13  ? 102.793 80.868  111.060 1.00 108.21 ? 13   DG  I "O4'" 1 
ATOM   6208  C  "C3'" . DG  I 5 13  ? 102.135 79.276  112.705 1.00 108.21 ? 13   DG  I "C3'" 1 
ATOM   6209  O  "O3'" . DG  I 5 13  ? 102.529 77.929  112.458 1.00 108.21 ? 13   DG  I "O3'" 1 
ATOM   6210  C  "C2'" . DG  I 5 13  ? 103.303 80.124  113.184 1.00 108.21 ? 13   DG  I "C2'" 1 
ATOM   6211  C  "C1'" . DG  I 5 13  ? 103.894 80.567  111.867 1.00 108.21 ? 13   DG  I "C1'" 1 
ATOM   6212  N  N9    . DG  I 5 13  ? 104.721 81.741  111.973 1.00 108.21 ? 13   DG  I N9    1 
ATOM   6213  C  C8    . DG  I 5 13  ? 104.302 83.029  112.134 1.00 108.21 ? 13   DG  I C8    1 
ATOM   6214  N  N7    . DG  I 5 13  ? 105.278 83.884  112.200 1.00 108.21 ? 13   DG  I N7    1 
ATOM   6215  C  C5    . DG  I 5 13  ? 106.416 83.105  112.095 1.00 108.21 ? 13   DG  I C5    1 
ATOM   6216  C  C6    . DG  I 5 13  ? 107.772 83.476  112.102 1.00 108.21 ? 13   DG  I C6    1 
ATOM   6217  O  O6    . DG  I 5 13  ? 108.256 84.606  112.211 1.00 108.21 ? 13   DG  I O6    1 
ATOM   6218  N  N1    . DG  I 5 13  ? 108.607 82.374  111.963 1.00 108.21 ? 13   DG  I N1    1 
ATOM   6219  C  C2    . DG  I 5 13  ? 108.179 81.080  111.828 1.00 108.21 ? 13   DG  I C2    1 
ATOM   6220  N  N2    . DG  I 5 13  ? 109.133 80.151  111.706 1.00 108.21 ? 13   DG  I N2    1 
ATOM   6221  N  N3    . DG  I 5 13  ? 106.906 80.720  111.819 1.00 108.21 ? 13   DG  I N3    1 
ATOM   6222  C  C4    . DG  I 5 13  ? 106.086 81.783  111.952 1.00 108.21 ? 13   DG  I C4    1 
ATOM   6223  P  P     . DG  I 5 14  ? 102.394 76.817  113.608 1.00 106.02 ? 14   DG  I P     1 
ATOM   6224  O  OP1   . DG  I 5 14  ? 101.915 75.567  112.986 1.00 106.02 ? 14   DG  I OP1   1 
ATOM   6225  O  OP2   . DG  I 5 14  ? 101.652 77.425  114.730 1.00 106.02 ? 14   DG  I OP2   1 
ATOM   6226  O  "O5'" . DG  I 5 14  ? 103.888 76.579  114.109 1.00 106.02 ? 14   DG  I "O5'" 1 
ATOM   6227  C  "C5'" . DG  I 5 14  ? 104.834 75.942  113.254 1.00 106.02 ? 14   DG  I "C5'" 1 
ATOM   6228  C  "C4'" . DG  I 5 14  ? 106.221 76.024  113.857 1.00 106.02 ? 14   DG  I "C4'" 1 
ATOM   6229  O  "O4'" . DG  I 5 14  ? 106.727 77.367  113.725 1.00 106.02 ? 14   DG  I "O4'" 1 
ATOM   6230  C  "C3'" . DG  I 5 14  ? 106.283 75.684  115.346 1.00 106.02 ? 14   DG  I "C3'" 1 
ATOM   6231  O  "O3'" . DG  I 5 14  ? 107.272 74.702  115.581 1.00 106.02 ? 14   DG  I "O3'" 1 
ATOM   6232  C  "C2'" . DG  I 5 14  ? 106.632 77.017  116.005 1.00 106.02 ? 14   DG  I "C2'" 1 
ATOM   6233  C  "C1'" . DG  I 5 14  ? 107.387 77.724  114.907 1.00 106.02 ? 14   DG  I "C1'" 1 
ATOM   6234  N  N9    . DG  I 5 14  ? 107.330 79.172  115.002 1.00 106.02 ? 14   DG  I N9    1 
ATOM   6235  C  C8    . DG  I 5 14  ? 106.207 79.950  115.060 1.00 106.02 ? 14   DG  I C8    1 
ATOM   6236  N  N7    . DG  I 5 14  ? 106.461 81.222  115.125 1.00 106.02 ? 14   DG  I N7    1 
ATOM   6237  C  C5    . DG  I 5 14  ? 107.838 81.288  115.111 1.00 106.02 ? 14   DG  I C5    1 
ATOM   6238  C  C6    . DG  I 5 14  ? 108.690 82.402  115.159 1.00 106.02 ? 14   DG  I C6    1 
ATOM   6239  O  O6    . DG  I 5 14  ? 108.388 83.597  115.225 1.00 106.02 ? 14   DG  I O6    1 
ATOM   6240  N  N1    . DG  I 5 14  ? 110.023 82.028  115.116 1.00 106.02 ? 14   DG  I N1    1 
ATOM   6241  C  C2    . DG  I 5 14  ? 110.471 80.736  115.035 1.00 106.02 ? 14   DG  I C2    1 
ATOM   6242  N  N2    . DG  I 5 14  ? 111.795 80.567  115.012 1.00 106.02 ? 14   DG  I N2    1 
ATOM   6243  N  N3    . DG  I 5 14  ? 109.682 79.684  114.997 1.00 106.02 ? 14   DG  I N3    1 
ATOM   6244  C  C4    . DG  I 5 14  ? 108.385 80.034  115.032 1.00 106.02 ? 14   DG  I C4    1 
ATOM   6245  P  P     . DT  I 5 15  ? 107.348 73.933  116.991 1.00 102.77 ? 15   DT  I P     1 
ATOM   6246  O  OP1   . DT  I 5 15  ? 107.445 72.492  116.678 1.00 102.77 ? 15   DT  I OP1   1 
ATOM   6247  O  OP2   . DT  I 5 15  ? 106.273 74.401  117.891 1.00 102.77 ? 15   DT  I OP2   1 
ATOM   6248  O  "O5'" . DT  I 5 15  ? 108.747 74.409  117.584 1.00 102.77 ? 15   DT  I "O5'" 1 
ATOM   6249  C  "C5'" . DT  I 5 15  ? 109.909 74.287  116.792 1.00 102.77 ? 15   DT  I "C5'" 1 
ATOM   6250  C  "C4'" . DT  I 5 15  ? 111.031 75.142  117.336 1.00 102.77 ? 15   DT  I "C4'" 1 
ATOM   6251  O  "O4'" . DT  I 5 15  ? 110.759 76.551  117.097 1.00 102.77 ? 15   DT  I "O4'" 1 
ATOM   6252  C  "C3'" . DT  I 5 15  ? 111.286 75.014  118.835 1.00 102.77 ? 15   DT  I "C3'" 1 
ATOM   6253  O  "O3'" . DT  I 5 15  ? 112.686 74.946  119.045 1.00 102.77 ? 15   DT  I "O3'" 1 
ATOM   6254  C  "C2'" . DT  I 5 15  ? 110.707 76.313  119.382 1.00 102.77 ? 15   DT  I "C2'" 1 
ATOM   6255  C  "C1'" . DT  I 5 15  ? 111.080 77.261  118.264 1.00 102.77 ? 15   DT  I "C1'" 1 
ATOM   6256  N  N1    . DT  I 5 15  ? 110.341 78.557  118.266 1.00 102.77 ? 15   DT  I N1    1 
ATOM   6257  C  C2    . DT  I 5 15  ? 111.052 79.724  118.173 1.00 102.77 ? 15   DT  I C2    1 
ATOM   6258  O  O2    . DT  I 5 15  ? 112.260 79.755  118.094 1.00 102.77 ? 15   DT  I O2    1 
ATOM   6259  N  N3    . DT  I 5 15  ? 110.290 80.863  118.179 1.00 102.77 ? 15   DT  I N3    1 
ATOM   6260  C  C4    . DT  I 5 15  ? 108.919 80.948  118.250 1.00 102.77 ? 15   DT  I C4    1 
ATOM   6261  O  O4    . DT  I 5 15  ? 108.322 82.019  118.251 1.00 102.77 ? 15   DT  I O4    1 
ATOM   6262  C  C5    . DT  I 5 15  ? 108.230 79.694  118.348 1.00 102.77 ? 15   DT  I C5    1 
ATOM   6263  C  C7    . DT  I 5 15  ? 106.734 79.677  118.458 1.00 102.77 ? 15   DT  I C7    1 
ATOM   6264  C  C6    . DT  I 5 15  ? 108.965 78.565  118.346 1.00 102.77 ? 15   DT  I C6    1 
ATOM   6265  P  P     . DG  I 5 16  ? 113.310 74.064  120.233 1.00 97.75  ? 16   DG  I P     1 
ATOM   6266  O  OP1   . DG  I 5 16  ? 114.240 73.065  119.656 1.00 97.75  ? 16   DG  I OP1   1 
ATOM   6267  O  OP2   . DG  I 5 16  ? 112.182 73.624  121.084 1.00 97.75  ? 16   DG  I OP2   1 
ATOM   6268  O  "O5'" . DG  I 5 16  ? 114.196 75.120  121.043 1.00 97.75  ? 16   DG  I "O5'" 1 
ATOM   6269  C  "C5'" . DG  I 5 16  ? 115.332 75.710  120.418 1.00 97.75  ? 16   DG  I "C5'" 1 
ATOM   6270  C  "C4'" . DG  I 5 16  ? 115.606 77.096  120.972 1.00 97.75  ? 16   DG  I "C4'" 1 
ATOM   6271  O  "O4'" . DG  I 5 16  ? 114.501 77.990  120.707 1.00 97.75  ? 16   DG  I "O4'" 1 
ATOM   6272  C  "C3'" . DG  I 5 16  ? 115.849 77.165  122.472 1.00 97.75  ? 16   DG  I "C3'" 1 
ATOM   6273  O  "O3'" . DG  I 5 16  ? 116.936 78.010  122.688 1.00 97.75  ? 16   DG  I "O3'" 1 
ATOM   6274  C  "C2'" . DG  I 5 16  ? 114.549 77.780  122.996 1.00 97.75  ? 16   DG  I "C2'" 1 
ATOM   6275  C  "C1'" . DG  I 5 16  ? 114.240 78.738  121.870 1.00 97.75  ? 16   DG  I "C1'" 1 
ATOM   6276  N  N9    . DG  I 5 16  ? 112.856 79.184  121.785 1.00 97.75  ? 16   DG  I N9    1 
ATOM   6277  C  C8    . DG  I 5 16  ? 111.740 78.405  121.848 1.00 97.75  ? 16   DG  I C8    1 
ATOM   6278  N  N7    . DG  I 5 16  ? 110.631 79.064  121.683 1.00 97.75  ? 16   DG  I N7    1 
ATOM   6279  C  C5    . DG  I 5 16  ? 111.039 80.370  121.515 1.00 97.75  ? 16   DG  I C5    1 
ATOM   6280  C  C6    . DG  I 5 16  ? 110.278 81.531  121.313 1.00 97.75  ? 16   DG  I C6    1 
ATOM   6281  O  O6    . DG  I 5 16  ? 109.050 81.637  121.243 1.00 97.75  ? 16   DG  I O6    1 
ATOM   6282  N  N1    . DG  I 5 16  ? 111.081 82.651  121.189 1.00 97.75  ? 16   DG  I N1    1 
ATOM   6283  C  C2    . DG  I 5 16  ? 112.452 82.649  121.255 1.00 97.75  ? 16   DG  I C2    1 
ATOM   6284  N  N2    . DG  I 5 16  ? 113.056 83.835  121.112 1.00 97.75  ? 16   DG  I N2    1 
ATOM   6285  N  N3    . DG  I 5 16  ? 113.179 81.565  121.451 1.00 97.75  ? 16   DG  I N3    1 
ATOM   6286  C  C4    . DG  I 5 16  ? 112.408 80.465  121.570 1.00 97.75  ? 16   DG  I C4    1 
ATOM   6287  P  P     . DC  I 5 17  ? 117.973 77.731  123.876 1.00 95.83  ? 17   DC  I P     1 
ATOM   6288  O  OP1   . DC  I 5 17  ? 119.039 76.859  123.344 1.00 95.83  ? 17   DC  I OP1   1 
ATOM   6289  O  OP2   . DC  I 5 17  ? 117.211 77.321  125.075 1.00 95.83  ? 17   DC  I OP2   1 
ATOM   6290  O  "O5'" . DC  I 5 17  ? 118.593 79.171  124.139 1.00 95.83  ? 17   DC  I "O5'" 1 
ATOM   6291  C  "C5'" . DC  I 5 17  ? 118.274 80.251  123.261 1.00 95.83  ? 17   DC  I "C5'" 1 
ATOM   6292  C  "C4'" . DC  I 5 17  ? 117.921 81.480  124.065 1.00 95.83  ? 17   DC  I "C4'" 1 
ATOM   6293  O  "O4'" . DC  I 5 17  ? 116.502 81.778  123.922 1.00 95.83  ? 17   DC  I "O4'" 1 
ATOM   6294  C  "C3'" . DC  I 5 17  ? 118.169 81.323  125.560 1.00 95.83  ? 17   DC  I "C3'" 1 
ATOM   6295  O  "O3'" . DC  I 5 17  ? 118.730 82.499  126.080 1.00 95.83  ? 17   DC  I "O3'" 1 
ATOM   6296  C  "C2'" . DC  I 5 17  ? 116.768 81.067  126.108 1.00 95.83  ? 17   DC  I "C2'" 1 
ATOM   6297  C  "C1'" . DC  I 5 17  ? 115.939 81.947  125.199 1.00 95.83  ? 17   DC  I "C1'" 1 
ATOM   6298  N  N1    . DC  I 5 17  ? 114.508 81.560  125.133 1.00 95.83  ? 17   DC  I N1    1 
ATOM   6299  C  C2    . DC  I 5 17  ? 113.563 82.484  124.698 1.00 95.83  ? 17   DC  I C2    1 
ATOM   6300  O  O2    . DC  I 5 17  ? 113.924 83.624  124.413 1.00 95.83  ? 17   DC  I O2    1 
ATOM   6301  N  N3    . DC  I 5 17  ? 112.267 82.118  124.635 1.00 95.83  ? 17   DC  I N3    1 
ATOM   6302  C  C4    . DC  I 5 17  ? 111.912 80.880  124.960 1.00 95.83  ? 17   DC  I C4    1 
ATOM   6303  N  N4    . DC  I 5 17  ? 110.620 80.560  124.874 1.00 95.83  ? 17   DC  I N4    1 
ATOM   6304  C  C5    . DC  I 5 17  ? 112.862 79.917  125.390 1.00 95.83  ? 17   DC  I C5    1 
ATOM   6305  C  C6    . DC  I 5 17  ? 114.136 80.297  125.458 1.00 95.83  ? 17   DC  I C6    1 
ATOM   6306  P  P     . DC  I 5 18  ? 120.311 82.577  126.341 1.00 91.13  ? 18   DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5 18  ? 120.994 82.308  125.058 1.00 91.13  ? 18   DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5 18  ? 120.617 81.718  127.502 1.00 91.13  ? 18   DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5 18  ? 120.537 84.095  126.776 1.00 91.13  ? 18   DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5 18  ? 119.981 85.140  125.990 1.00 91.13  ? 18   DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5 18  ? 118.940 85.921  126.771 1.00 91.13  ? 18   DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5 18  ? 117.712 85.153  126.911 1.00 91.13  ? 18   DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5 18  ? 119.346 86.321  128.189 1.00 91.13  ? 18   DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5 18  ? 118.909 87.642  128.435 1.00 91.13  ? 18   DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5 18  ? 118.551 85.337  129.037 1.00 91.13  ? 18   DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5 18  ? 117.270 85.299  128.236 1.00 91.13  ? 18   DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5 18  ? 116.373 84.178  128.576 1.00 91.13  ? 18   DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5 18  ? 115.011 84.292  128.323 1.00 91.13  ? 18   DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5 18  ? 114.580 85.331  127.829 1.00 91.13  ? 18   DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5 18  ? 114.204 83.262  128.633 1.00 91.13  ? 18   DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5 18  ? 114.715 82.157  129.167 1.00 91.13  ? 18   DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5 18  ? 113.881 81.163  129.454 1.00 91.13  ? 18   DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5 18  ? 116.099 82.022  129.438 1.00 91.13  ? 18   DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5 18  ? 116.885 83.046  129.122 1.00 91.13  ? 18   DC  I C6    1 
ATOM   6325  P  P     . DG  I 5 19  ? 119.920 88.887  128.374 1.00 87.38  ? 19   DG  I P     1 
ATOM   6326  O  OP1   . DG  I 5 19  ? 120.589 88.865  127.056 1.00 87.38  ? 19   DG  I OP1   1 
ATOM   6327  O  OP2   . DG  I 5 19  ? 120.724 88.913  129.613 1.00 87.38  ? 19   DG  I OP2   1 
ATOM   6328  O  "O5'" . DG  I 5 19  ? 118.930 90.131  128.417 1.00 87.38  ? 19   DG  I "O5'" 1 
ATOM   6329  C  "C5'" . DG  I 5 19  ? 117.869 90.188  127.478 1.00 87.38  ? 19   DG  I "C5'" 1 
ATOM   6330  C  "C4'" . DG  I 5 19  ? 116.515 90.378  128.150 1.00 87.38  ? 19   DG  I "C4'" 1 
ATOM   6331  O  "O4'" . DG  I 5 19  ? 116.025 89.122  128.668 1.00 87.38  ? 19   DG  I "O4'" 1 
ATOM   6332  C  "C3'" . DG  I 5 19  ? 116.464 91.348  129.327 1.00 87.38  ? 19   DG  I "C3'" 1 
ATOM   6333  O  "O3'" . DG  I 5 19  ? 115.218 92.023  129.278 1.00 87.38  ? 19   DG  I "O3'" 1 
ATOM   6334  C  "C2'" . DG  I 5 19  ? 116.529 90.408  130.532 1.00 87.38  ? 19   DG  I "C2'" 1 
ATOM   6335  C  "C1'" . DG  I 5 19  ? 115.644 89.306  130.013 1.00 87.38  ? 19   DG  I "C1'" 1 
ATOM   6336  N  N9    . DG  I 5 19  ? 115.743 88.033  130.682 1.00 87.38  ? 19   DG  I N9    1 
ATOM   6337  C  C8    . DG  I 5 19  ? 116.857 87.434  131.188 1.00 87.38  ? 19   DG  I C8    1 
ATOM   6338  N  N7    . DG  I 5 19  ? 116.615 86.261  131.699 1.00 87.38  ? 19   DG  I N7    1 
ATOM   6339  C  C5    . DG  I 5 19  ? 115.251 86.093  131.521 1.00 87.38  ? 19   DG  I C5    1 
ATOM   6340  C  C6    . DG  I 5 19  ? 114.408 85.030  131.882 1.00 87.38  ? 19   DG  I C6    1 
ATOM   6341  O  O6    . DG  I 5 19  ? 114.701 83.977  132.448 1.00 87.38  ? 19   DG  I O6    1 
ATOM   6342  N  N1    . DG  I 5 19  ? 113.098 85.272  131.516 1.00 87.38  ? 19   DG  I N1    1 
ATOM   6343  C  C2    . DG  I 5 19  ? 112.660 86.399  130.884 1.00 87.38  ? 19   DG  I C2    1 
ATOM   6344  N  N2    . DG  I 5 19  ? 111.359 86.462  130.604 1.00 87.38  ? 19   DG  I N2    1 
ATOM   6345  N  N3    . DG  I 5 19  ? 113.437 87.396  130.548 1.00 87.38  ? 19   DG  I N3    1 
ATOM   6346  C  C4    . DG  I 5 19  ? 114.713 87.174  130.897 1.00 87.38  ? 19   DG  I C4    1 
ATOM   6347  P  P     . DA  I 5 20  ? 115.099 93.523  129.811 1.00 72.45  ? 20   DA  I P     1 
ATOM   6348  O  OP1   . DA  I 5 20  ? 115.303 94.382  128.635 1.00 72.45  ? 20   DA  I OP1   1 
ATOM   6349  O  OP2   . DA  I 5 20  ? 115.946 93.635  131.012 1.00 72.45  ? 20   DA  I OP2   1 
ATOM   6350  O  "O5'" . DA  I 5 20  ? 113.584 93.686  130.255 1.00 72.45  ? 20   DA  I "O5'" 1 
ATOM   6351  C  "C5'" . DA  I 5 20  ? 112.538 93.471  129.330 1.00 72.45  ? 20   DA  I "C5'" 1 
ATOM   6352  C  "C4'" . DA  I 5 20  ? 111.297 92.891  130.000 1.00 72.45  ? 20   DA  I "C4'" 1 
ATOM   6353  O  "O4'" . DA  I 5 20  ? 111.614 91.672  130.675 1.00 72.45  ? 20   DA  I "O4'" 1 
ATOM   6354  C  "C3'" . DA  I 5 20  ? 110.608 93.743  131.041 1.00 72.45  ? 20   DA  I "C3'" 1 
ATOM   6355  O  "O3'" . DA  I 5 20  ? 109.265 93.385  131.040 1.00 72.45  ? 20   DA  I "O3'" 1 
ATOM   6356  C  "C2'" . DA  I 5 20  ? 111.274 93.282  132.328 1.00 72.45  ? 20   DA  I "C2'" 1 
ATOM   6357  C  "C1'" . DA  I 5 20  ? 111.342 91.799  132.053 1.00 72.45  ? 20   DA  I "C1'" 1 
ATOM   6358  N  N9    . DA  I 5 20  ? 112.413 91.088  132.695 1.00 72.45  ? 20   DA  I N9    1 
ATOM   6359  C  C8    . DA  I 5 20  ? 113.740 91.403  132.683 1.00 72.45  ? 20   DA  I C8    1 
ATOM   6360  N  N7    . DA  I 5 20  ? 114.495 90.512  133.277 1.00 72.45  ? 20   DA  I N7    1 
ATOM   6361  C  C5    . DA  I 5 20  ? 113.597 89.543  133.676 1.00 72.45  ? 20   DA  I C5    1 
ATOM   6362  C  C6    . DA  I 5 20  ? 113.755 88.331  134.352 1.00 72.45  ? 20   DA  I C6    1 
ATOM   6363  N  N6    . DA  I 5 20  ? 114.933 87.878  134.783 1.00 72.45  ? 20   DA  I N6    1 
ATOM   6364  N  N1    . DA  I 5 20  ? 112.644 87.607  134.597 1.00 72.45  ? 20   DA  I N1    1 
ATOM   6365  C  C2    . DA  I 5 20  ? 111.462 88.067  134.175 1.00 72.45  ? 20   DA  I C2    1 
ATOM   6366  N  N3    . DA  I 5 20  ? 111.195 89.184  133.523 1.00 72.45  ? 20   DA  I N3    1 
ATOM   6367  C  C4    . DA  I 5 20  ? 112.314 89.880  133.304 1.00 72.45  ? 20   DA  I C4    1 
ATOM   6368  P  P     . DG  I 5 21  ? 108.145 94.449  131.425 1.00 72.62  ? 21   DG  I P     1 
ATOM   6369  O  OP1   . DG  I 5 21  ? 107.091 94.339  130.401 1.00 72.62  ? 21   DG  I OP1   1 
ATOM   6370  O  OP2   . DG  I 5 21  ? 108.809 95.736  131.702 1.00 72.62  ? 21   DG  I OP2   1 
ATOM   6371  O  "O5'" . DG  I 5 21  ? 107.554 93.886  132.799 1.00 72.62  ? 21   DG  I "O5'" 1 
ATOM   6372  C  "C5'" . DG  I 5 21  ? 107.052 92.574  132.844 1.00 72.62  ? 21   DG  I "C5'" 1 
ATOM   6373  C  "C4'" . DG  I 5 21  ? 107.048 92.006  134.256 1.00 72.62  ? 21   DG  I "C4'" 1 
ATOM   6374  O  "O4'" . DG  I 5 21  ? 108.315 91.376  134.575 1.00 72.62  ? 21   DG  I "O4'" 1 
ATOM   6375  C  "C3'" . DG  I 5 21  ? 106.775 92.988  135.390 1.00 72.62  ? 21   DG  I "C3'" 1 
ATOM   6376  O  "O3'" . DG  I 5 21  ? 105.847 92.393  136.236 1.00 72.62  ? 21   DG  I "O3'" 1 
ATOM   6377  C  "C2'" . DG  I 5 21  ? 108.136 93.105  136.073 1.00 72.62  ? 21   DG  I "C2'" 1 
ATOM   6378  C  "C1'" . DG  I 5 21  ? 108.641 91.698  135.899 1.00 72.62  ? 21   DG  I "C1'" 1 
ATOM   6379  N  N9    . DG  I 5 21  ? 110.074 91.539  136.071 1.00 72.62  ? 21   DG  I N9    1 
ATOM   6380  C  C8    . DG  I 5 21  ? 111.055 92.402  135.677 1.00 72.62  ? 21   DG  I C8    1 
ATOM   6381  N  N7    . DG  I 5 21  ? 112.253 91.982  135.954 1.00 72.62  ? 21   DG  I N7    1 
ATOM   6382  C  C5    . DG  I 5 21  ? 112.047 90.767  136.583 1.00 72.62  ? 21   DG  I C5    1 
ATOM   6383  C  C6    . DG  I 5 21  ? 112.974 89.852  137.117 1.00 72.62  ? 21   DG  I C6    1 
ATOM   6384  O  O6    . DG  I 5 21  ? 114.204 89.930  137.138 1.00 72.62  ? 21   DG  I O6    1 
ATOM   6385  N  N1    . DG  I 5 21  ? 112.347 88.751  137.665 1.00 72.62  ? 21   DG  I N1    1 
ATOM   6386  C  C2    . DG  I 5 21  ? 110.996 88.556  137.689 1.00 72.62  ? 21   DG  I C2    1 
ATOM   6387  N  N2    . DG  I 5 21  ? 110.566 87.436  138.265 1.00 72.62  ? 21   DG  I N2    1 
ATOM   6388  N  N3    . DG  I 5 21  ? 110.116 89.408  137.198 1.00 72.62  ? 21   DG  I N3    1 
ATOM   6389  C  C4    . DG  I 5 21  ? 110.713 90.481  136.654 1.00 72.62  ? 21   DG  I C4    1 
ATOM   6390  P  P     . DG  I 5 22  ? 104.902 93.253  137.200 1.00 80.56  ? 22   DG  I P     1 
ATOM   6391  O  OP1   . DG  I 5 22  ? 103.577 93.344  136.550 1.00 80.56  ? 22   DG  I OP1   1 
ATOM   6392  O  OP2   . DG  I 5 22  ? 105.593 94.490  137.611 1.00 80.56  ? 22   DG  I OP2   1 
ATOM   6393  O  "O5'" . DG  I 5 22  ? 104.794 92.299  138.470 1.00 80.56  ? 22   DG  I "O5'" 1 
ATOM   6394  C  "C5'" . DG  I 5 22  ? 104.794 90.893  138.260 1.00 80.56  ? 22   DG  I "C5'" 1 
ATOM   6395  C  "C4'" . DG  I 5 22  ? 105.532 90.166  139.366 1.00 80.56  ? 22   DG  I "C4'" 1 
ATOM   6396  O  "O4'" . DG  I 5 22  ? 106.965 90.131  139.111 1.00 80.56  ? 22   DG  I "O4'" 1 
ATOM   6397  C  "C3'" . DG  I 5 22  ? 105.356 90.776  140.751 1.00 80.56  ? 22   DG  I "C3'" 1 
ATOM   6398  O  "O3'" . DG  I 5 22  ? 104.903 89.778  141.639 1.00 80.56  ? 22   DG  I "O3'" 1 
ATOM   6399  C  "C2'" . DG  I 5 22  ? 106.766 91.255  141.102 1.00 80.56  ? 22   DG  I "C2'" 1 
ATOM   6400  C  "C1'" . DG  I 5 22  ? 107.625 90.272  140.339 1.00 80.56  ? 22   DG  I "C1'" 1 
ATOM   6401  N  N9    . DG  I 5 22  ? 108.982 90.742  140.089 1.00 80.56  ? 22   DG  I N9    1 
ATOM   6402  C  C8    . DG  I 5 22  ? 109.340 91.894  139.444 1.00 80.56  ? 22   DG  I C8    1 
ATOM   6403  N  N7    . DG  I 5 22  ? 110.629 92.073  139.369 1.00 80.56  ? 22   DG  I N7    1 
ATOM   6404  C  C5    . DG  I 5 22  ? 111.163 90.972  140.015 1.00 80.56  ? 22   DG  I C5    1 
ATOM   6405  C  C6    . DG  I 5 22  ? 112.511 90.630  140.254 1.00 80.56  ? 22   DG  I C6    1 
ATOM   6406  O  O6    . DG  I 5 22  ? 113.522 91.243  139.906 1.00 80.56  ? 22   DG  I O6    1 
ATOM   6407  N  N1    . DG  I 5 22  ? 112.629 89.432  140.944 1.00 80.56  ? 22   DG  I N1    1 
ATOM   6408  C  C2    . DG  I 5 22  ? 111.571 88.667  141.365 1.00 80.56  ? 22   DG  I C2    1 
ATOM   6409  N  N2    . DG  I 5 22  ? 111.879 87.542  142.030 1.00 80.56  ? 22   DG  I N2    1 
ATOM   6410  N  N3    . DG  I 5 22  ? 110.292 88.981  141.154 1.00 80.56  ? 22   DG  I N3    1 
ATOM   6411  C  C4    . DG  I 5 22  ? 110.165 90.143  140.473 1.00 80.56  ? 22   DG  I C4    1 
ATOM   6412  P  P     . DC  I 5 23  ? 104.234 90.169  143.042 1.00 83.22  ? 23   DC  I P     1 
ATOM   6413  O  OP1   . DC  I 5 23  ? 102.918 89.503  143.083 1.00 83.22  ? 23   DC  I OP1   1 
ATOM   6414  O  OP2   . DC  I 5 23  ? 104.310 91.635  143.228 1.00 83.22  ? 23   DC  I OP2   1 
ATOM   6415  O  "O5'" . DC  I 5 23  ? 105.168 89.434  144.097 1.00 83.22  ? 23   DC  I "O5'" 1 
ATOM   6416  C  "C5'" . DC  I 5 23  ? 105.433 88.062  143.922 1.00 83.22  ? 23   DC  I "C5'" 1 
ATOM   6417  C  "C4'" . DC  I 5 23  ? 106.625 87.617  144.741 1.00 83.22  ? 23   DC  I "C4'" 1 
ATOM   6418  O  "O4'" . DC  I 5 23  ? 107.844 88.141  144.158 1.00 83.22  ? 23   DC  I "O4'" 1 
ATOM   6419  C  "C3'" . DC  I 5 23  ? 106.637 88.054  146.204 1.00 83.22  ? 23   DC  I "C3'" 1 
ATOM   6420  O  "O3'" . DC  I 5 23  ? 107.090 86.965  147.007 1.00 83.22  ? 23   DC  I "O3'" 1 
ATOM   6421  C  "C2'" . DC  I 5 23  ? 107.633 89.206  146.205 1.00 83.22  ? 23   DC  I "C2'" 1 
ATOM   6422  C  "C1'" . DC  I 5 23  ? 108.628 88.731  145.169 1.00 83.22  ? 23   DC  I "C1'" 1 
ATOM   6423  N  N1    . DC  I 5 23  ? 109.438 89.810  144.555 1.00 83.22  ? 23   DC  I N1    1 
ATOM   6424  C  C2    . DC  I 5 23  ? 110.826 89.750  144.604 1.00 83.22  ? 23   DC  I C2    1 
ATOM   6425  O  O2    . DC  I 5 23  ? 111.366 88.816  145.190 1.00 83.22  ? 23   DC  I O2    1 
ATOM   6426  N  N3    . DC  I 5 23  ? 111.542 90.735  144.027 1.00 83.22  ? 23   DC  I N3    1 
ATOM   6427  C  C4    . DC  I 5 23  ? 110.923 91.724  143.402 1.00 83.22  ? 23   DC  I C4    1 
ATOM   6428  N  N4    . DC  I 5 23  ? 111.666 92.672  142.843 1.00 83.22  ? 23   DC  I N4    1 
ATOM   6429  C  C5    . DC  I 5 23  ? 109.512 91.799  143.338 1.00 83.22  ? 23   DC  I C5    1 
ATOM   6430  C  C6    . DC  I 5 23  ? 108.817 90.825  143.916 1.00 83.22  ? 23   DC  I C6    1 
ATOM   6431  P  P     . DC  I 5 24  ? 106.792 86.902  148.584 1.00 84.83  ? 24   DC  I P     1 
ATOM   6432  O  OP1   . DC  I 5 24  ? 105.855 85.785  148.805 1.00 84.83  ? 24   DC  I OP1   1 
ATOM   6433  O  OP2   . DC  I 5 24  ? 106.471 88.249  149.098 1.00 84.83  ? 24   DC  I OP2   1 
ATOM   6434  O  "O5'" . DC  I 5 24  ? 108.199 86.502  149.205 1.00 84.83  ? 24   DC  I "O5'" 1 
ATOM   6435  C  "C5'" . DC  I 5 24  ? 109.365 86.629  148.422 1.00 84.83  ? 24   DC  I "C5'" 1 
ATOM   6436  C  "C4'" . DC  I 5 24  ? 110.599 86.549  149.292 1.00 84.83  ? 24   DC  I "C4'" 1 
ATOM   6437  O  "O4'" . DC  I 5 24  ? 111.591 87.465  148.769 1.00 84.83  ? 24   DC  I "O4'" 1 
ATOM   6438  C  "C3'" . DC  I 5 24  ? 110.385 87.007  150.719 1.00 84.83  ? 24   DC  I "C3'" 1 
ATOM   6439  O  "O3'" . DC  I 5 24  ? 111.438 86.548  151.539 1.00 84.83  ? 24   DC  I "O3'" 1 
ATOM   6440  C  "C2'" . DC  I 5 24  ? 110.452 88.506  150.548 1.00 84.83  ? 24   DC  I "C2'" 1 
ATOM   6441  C  "C1'" . DC  I 5 24  ? 111.611 88.632  149.571 1.00 84.83  ? 24   DC  I "C1'" 1 
ATOM   6442  N  N1    . DC  I 5 24  ? 111.489 89.804  148.692 1.00 84.83  ? 24   DC  I N1    1 
ATOM   6443  C  C2    . DC  I 5 24  ? 112.632 90.439  148.242 1.00 84.83  ? 24   DC  I C2    1 
ATOM   6444  O  O2    . DC  I 5 24  ? 113.732 90.013  148.599 1.00 84.83  ? 24   DC  I O2    1 
ATOM   6445  N  N3    . DC  I 5 24  ? 112.505 91.516  147.437 1.00 84.83  ? 24   DC  I N3    1 
ATOM   6446  C  C4    . DC  I 5 24  ? 111.299 91.942  147.082 1.00 84.83  ? 24   DC  I C4    1 
ATOM   6447  N  N4    . DC  I 5 24  ? 111.219 93.005  146.287 1.00 84.83  ? 24   DC  I N4    1 
ATOM   6448  C  C5    . DC  I 5 24  ? 110.121 91.308  147.536 1.00 84.83  ? 24   DC  I C5    1 
ATOM   6449  C  C6    . DC  I 5 24  ? 110.261 90.248  148.327 1.00 84.83  ? 24   DC  I C6    1 
ATOM   6450  P  P     . DG  I 5 25  ? 111.285 86.541  153.139 1.00 84.51  ? 25   DG  I P     1 
ATOM   6451  O  OP1   . DG  I 5 25  ? 111.447 85.136  153.571 1.00 84.51  ? 25   DG  I OP1   1 
ATOM   6452  O  OP2   . DG  I 5 25  ? 110.063 87.273  153.535 1.00 84.51  ? 25   DG  I OP2   1 
ATOM   6453  O  "O5'" . DG  I 5 25  ? 112.546 87.397  153.628 1.00 84.51  ? 25   DG  I "O5'" 1 
ATOM   6454  C  "C5'" . DG  I 5 25  ? 113.861 86.939  153.348 1.00 84.51  ? 25   DG  I "C5'" 1 
ATOM   6455  C  "C4'" . DG  I 5 25  ? 114.866 88.077  153.379 1.00 84.51  ? 25   DG  I "C4'" 1 
ATOM   6456  O  "O4'" . DG  I 5 25  ? 114.545 89.047  152.357 1.00 84.51  ? 25   DG  I "O4'" 1 
ATOM   6457  C  "C3'" . DG  I 5 25  ? 114.956 88.857  154.687 1.00 84.51  ? 25   DG  I "C3'" 1 
ATOM   6458  O  "O3'" . DG  I 5 25  ? 116.330 89.103  154.966 1.00 84.51  ? 25   DG  I "O3'" 1 
ATOM   6459  C  "C2'" . DG  I 5 25  ? 114.187 90.142  154.378 1.00 84.51  ? 25   DG  I "C2'" 1 
ATOM   6460  C  "C1'" . DG  I 5 25  ? 114.532 90.338  152.919 1.00 84.51  ? 25   DG  I "C1'" 1 
ATOM   6461  N  N9    . DG  I 5 25  ? 113.568 91.120  152.168 1.00 84.51  ? 25   DG  I N9    1 
ATOM   6462  C  C8    . DG  I 5 25  ? 112.209 90.974  152.166 1.00 84.51  ? 25   DG  I C8    1 
ATOM   6463  N  N7    . DG  I 5 25  ? 111.601 91.793  151.355 1.00 84.51  ? 25   DG  I N7    1 
ATOM   6464  C  C5    . DG  I 5 25  ? 112.627 92.532  150.793 1.00 84.51  ? 25   DG  I C5    1 
ATOM   6465  C  C6    . DG  I 5 25  ? 112.582 93.575  149.852 1.00 84.51  ? 25   DG  I C6    1 
ATOM   6466  O  O6    . DG  I 5 25  ? 111.591 94.065  149.306 1.00 84.51  ? 25   DG  I O6    1 
ATOM   6467  N  N1    . DG  I 5 25  ? 113.854 94.046  149.547 1.00 84.51  ? 25   DG  I N1    1 
ATOM   6468  C  C2    . DG  I 5 25  ? 115.022 93.566  150.094 1.00 84.51  ? 25   DG  I C2    1 
ATOM   6469  N  N2    . DG  I 5 25  ? 116.160 94.140  149.686 1.00 84.51  ? 25   DG  I N2    1 
ATOM   6470  N  N3    . DG  I 5 25  ? 115.072 92.592  150.979 1.00 84.51  ? 25   DG  I N3    1 
ATOM   6471  C  C4    . DG  I 5 25  ? 113.844 92.125  151.280 1.00 84.51  ? 25   DG  I C4    1 
ATOM   6472  P  P     . DC  I 5 26  ? 116.804 89.653  156.398 1.00 83.93  ? 26   DC  I P     1 
ATOM   6473  O  OP1   . DC  I 5 26  ? 117.975 88.847  156.811 1.00 83.93  ? 26   DC  I OP1   1 
ATOM   6474  O  OP2   . DC  I 5 26  ? 115.610 89.751  157.269 1.00 83.93  ? 26   DC  I OP2   1 
ATOM   6475  O  "O5'" . DC  I 5 26  ? 117.300 91.140  156.094 1.00 83.93  ? 26   DC  I "O5'" 1 
ATOM   6476  C  "C5'" . DC  I 5 26  ? 118.405 91.368  155.213 1.00 83.93  ? 26   DC  I "C5'" 1 
ATOM   6477  C  "C4'" . DC  I 5 26  ? 118.526 92.842  154.860 1.00 83.93  ? 26   DC  I "C4'" 1 
ATOM   6478  O  "O4'" . DC  I 5 26  ? 117.405 93.237  154.025 1.00 83.93  ? 26   DC  I "O4'" 1 
ATOM   6479  C  "C3'" . DC  I 5 26  ? 118.524 93.799  156.047 1.00 83.93  ? 26   DC  I "C3'" 1 
ATOM   6480  O  "O3'" . DC  I 5 26  ? 119.438 94.837  155.812 1.00 83.93  ? 26   DC  I "O3'" 1 
ATOM   6481  C  "C2'" . DC  I 5 26  ? 117.097 94.331  156.042 1.00 83.93  ? 26   DC  I "C2'" 1 
ATOM   6482  C  "C1'" . DC  I 5 26  ? 116.834 94.400  154.555 1.00 83.93  ? 26   DC  I "C1'" 1 
ATOM   6483  N  N1    . DC  I 5 26  ? 115.390 94.427  154.191 1.00 83.93  ? 26   DC  I N1    1 
ATOM   6484  C  C2    . DC  I 5 26  ? 114.984 95.158  153.089 1.00 83.93  ? 26   DC  I C2    1 
ATOM   6485  O  O2    . DC  I 5 26  ? 115.827 95.804  152.473 1.00 83.93  ? 26   DC  I O2    1 
ATOM   6486  N  N3    . DC  I 5 26  ? 113.677 95.179  152.758 1.00 83.93  ? 26   DC  I N3    1 
ATOM   6487  C  C4    . DC  I 5 26  ? 112.804 94.477  153.468 1.00 83.93  ? 26   DC  I C4    1 
ATOM   6488  N  N4    . DC  I 5 26  ? 111.521 94.517  153.098 1.00 83.93  ? 26   DC  I N4    1 
ATOM   6489  C  C5    . DC  I 5 26  ? 113.204 93.691  154.581 1.00 83.93  ? 26   DC  I C5    1 
ATOM   6490  C  C6    . DC  I 5 26  ? 114.497 93.691  154.900 1.00 83.93  ? 26   DC  I C6    1 
ATOM   6491  P  P     . DT  I 5 27  ? 120.731 94.997  156.746 1.00 81.70  ? 27   DT  I P     1 
ATOM   6492  O  OP1   . DT  I 5 27  ? 121.697 93.958  156.337 1.00 81.70  ? 27   DT  I OP1   1 
ATOM   6493  O  OP2   . DT  I 5 27  ? 120.294 95.072  158.154 1.00 81.70  ? 27   DT  I OP2   1 
ATOM   6494  O  "O5'" . DT  I 5 27  ? 121.313 96.423  156.343 1.00 81.70  ? 27   DT  I "O5'" 1 
ATOM   6495  C  "C5'" . DT  I 5 27  ? 121.281 96.855  154.994 1.00 81.70  ? 27   DT  I "C5'" 1 
ATOM   6496  C  "C4'" . DT  I 5 27  ? 120.661 98.236  154.892 1.00 81.70  ? 27   DT  I "C4'" 1 
ATOM   6497  O  "O4'" . DT  I 5 27  ? 119.227 98.151  154.650 1.00 81.70  ? 27   DT  I "O4'" 1 
ATOM   6498  C  "C3'" . DT  I 5 27  ? 120.823 99.106  156.145 1.00 81.70  ? 27   DT  I "C3'" 1 
ATOM   6499  O  "O3'" . DT  I 5 27  ? 121.159 100.418 155.759 1.00 81.70  ? 27   DT  I "O3'" 1 
ATOM   6500  C  "C2'" . DT  I 5 27  ? 119.419 99.063  156.749 1.00 81.70  ? 27   DT  I "C2'" 1 
ATOM   6501  C  "C1'" . DT  I 5 27  ? 118.597 99.092  155.482 1.00 81.70  ? 27   DT  I "C1'" 1 
ATOM   6502  N  N1    . DT  I 5 27  ? 117.175 98.721  155.652 1.00 81.70  ? 27   DT  I N1    1 
ATOM   6503  C  C2    . DT  I 5 27  ? 116.260 99.172  154.738 1.00 81.70  ? 27   DT  I C2    1 
ATOM   6504  O  O2    . DT  I 5 27  ? 116.558 99.876  153.796 1.00 81.70  ? 27   DT  I O2    1 
ATOM   6505  N  N3    . DT  I 5 27  ? 114.974 98.779  154.972 1.00 81.70  ? 27   DT  I N3    1 
ATOM   6506  C  C4    . DT  I 5 27  ? 114.527 97.986  156.000 1.00 81.70  ? 27   DT  I C4    1 
ATOM   6507  O  O4    . DT  I 5 27  ? 113.354 97.680  156.122 1.00 81.70  ? 27   DT  I O4    1 
ATOM   6508  C  C5    . DT  I 5 27  ? 115.537 97.542  156.921 1.00 81.70  ? 27   DT  I C5    1 
ATOM   6509  C  C7    . DT  I 5 27  ? 115.162 96.679  158.084 1.00 81.70  ? 27   DT  I C7    1 
ATOM   6510  C  C6    . DT  I 5 27  ? 116.799 97.924  156.704 1.00 81.70  ? 27   DT  I C6    1 
ATOM   6511  P  P     . DC  I 5 28  ? 122.657 100.976 155.913 1.00 82.54  ? 28   DC  I P     1 
ATOM   6512  O  OP1   . DC  I 5 28  ? 123.586 100.015 155.286 1.00 82.54  ? 28   DC  I OP1   1 
ATOM   6513  O  OP2   . DC  I 5 28  ? 122.856 101.385 157.320 1.00 82.54  ? 28   DC  I OP2   1 
ATOM   6514  O  "O5'" . DC  I 5 28  ? 122.618 102.288 155.013 1.00 82.54  ? 28   DC  I "O5'" 1 
ATOM   6515  C  "C5'" . DC  I 5 28  ? 121.863 102.257 153.799 1.00 82.54  ? 28   DC  I "C5'" 1 
ATOM   6516  C  "C4'" . DC  I 5 28  ? 120.699 103.242 153.818 1.00 82.54  ? 28   DC  I "C4'" 1 
ATOM   6517  O  "O4'" . DC  I 5 28  ? 119.514 102.659 154.441 1.00 82.54  ? 28   DC  I "O4'" 1 
ATOM   6518  C  "C3'" . DC  I 5 28  ? 120.947 104.552 154.553 1.00 82.54  ? 28   DC  I "C3'" 1 
ATOM   6519  O  "O3'" . DC  I 5 28  ? 120.313 105.593 153.819 1.00 82.54  ? 28   DC  I "O3'" 1 
ATOM   6520  C  "C2'" . DC  I 5 28  ? 120.236 104.301 155.876 1.00 82.54  ? 28   DC  I "C2'" 1 
ATOM   6521  C  "C1'" . DC  I 5 28  ? 118.998 103.603 155.352 1.00 82.54  ? 28   DC  I "C1'" 1 
ATOM   6522  N  N1    . DC  I 5 28  ? 118.167 102.906 156.384 1.00 82.54  ? 28   DC  I N1    1 
ATOM   6523  C  C2    . DC  I 5 28  ? 116.811 102.653 156.135 1.00 82.54  ? 28   DC  I C2    1 
ATOM   6524  O  O2    . DC  I 5 28  ? 116.307 103.040 155.081 1.00 82.54  ? 28   DC  I O2    1 
ATOM   6525  N  N3    . DC  I 5 28  ? 116.082 102.018 157.075 1.00 82.54  ? 28   DC  I N3    1 
ATOM   6526  C  C4    . DC  I 5 28  ? 116.654 101.625 158.203 1.00 82.54  ? 28   DC  I C4    1 
ATOM   6527  N  N4    . DC  I 5 28  ? 115.897 100.992 159.097 1.00 82.54  ? 28   DC  I N4    1 
ATOM   6528  C  C5    . DC  I 5 28  ? 118.026 101.864 158.472 1.00 82.54  ? 28   DC  I C5    1 
ATOM   6529  C  C6    . DC  I 5 28  ? 118.738 102.498 157.543 1.00 82.54  ? 28   DC  I C6    1 
ATOM   6530  P  P     . DA  I 5 29  ? 121.160 106.586 152.881 1.00 81.32  ? 29   DA  I P     1 
ATOM   6531  O  OP1   . DA  I 5 29  ? 121.861 105.793 151.848 1.00 81.32  ? 29   DA  I OP1   1 
ATOM   6532  O  OP2   . DA  I 5 29  ? 121.934 107.475 153.771 1.00 81.32  ? 29   DA  I OP2   1 
ATOM   6533  O  "O5'" . DA  I 5 29  ? 120.034 107.468 152.172 1.00 81.32  ? 29   DA  I "O5'" 1 
ATOM   6534  C  "C5'" . DA  I 5 29  ? 119.151 106.858 151.246 1.00 81.32  ? 29   DA  I "C5'" 1 
ATOM   6535  C  "C4'" . DA  I 5 29  ? 117.694 107.111 151.603 1.00 81.32  ? 29   DA  I "C4'" 1 
ATOM   6536  O  "O4'" . DA  I 5 29  ? 117.346 106.431 152.829 1.00 81.32  ? 29   DA  I "O4'" 1 
ATOM   6537  C  "C3'" . DA  I 5 29  ? 117.274 108.557 151.812 1.00 81.32  ? 29   DA  I "C3'" 1 
ATOM   6538  O  "O3'" . DA  I 5 29  ? 115.940 108.692 151.350 1.00 81.32  ? 29   DA  I "O3'" 1 
ATOM   6539  C  "C2'" . DA  I 5 29  ? 117.334 108.694 153.328 1.00 81.32  ? 29   DA  I "C2'" 1 
ATOM   6540  C  "C1'" . DA  I 5 29  ? 116.740 107.357 153.707 1.00 81.32  ? 29   DA  I "C1'" 1 
ATOM   6541  N  N9    . DA  I 5 29  ? 116.995 106.904 155.065 1.00 81.32  ? 29   DA  I N9    1 
ATOM   6542  C  C8    . DA  I 5 29  ? 118.147 107.024 155.779 1.00 81.32  ? 29   DA  I C8    1 
ATOM   6543  N  N7    . DA  I 5 29  ? 118.084 106.474 156.969 1.00 81.32  ? 29   DA  I N7    1 
ATOM   6544  C  C5    . DA  I 5 29  ? 116.815 105.942 157.021 1.00 81.32  ? 29   DA  I C5    1 
ATOM   6545  C  C6    . DA  I 5 29  ? 116.119 105.249 158.020 1.00 81.32  ? 29   DA  I C6    1 
ATOM   6546  N  N6    . DA  I 5 29  ? 116.654 104.922 159.199 1.00 81.32  ? 29   DA  I N6    1 
ATOM   6547  N  N1    . DA  I 5 29  ? 114.850 104.879 157.753 1.00 81.32  ? 29   DA  I N1    1 
ATOM   6548  C  C2    . DA  I 5 29  ? 114.316 105.203 156.574 1.00 81.32  ? 29   DA  I C2    1 
ATOM   6549  N  N3    . DA  I 5 29  ? 114.867 105.864 155.569 1.00 81.32  ? 29   DA  I N3    1 
ATOM   6550  C  C4    . DA  I 5 29  ? 116.128 106.207 155.860 1.00 81.32  ? 29   DA  I C4    1 
ATOM   6551  P  P     . DA  I 5 30  ? 115.459 110.042 150.645 1.00 70.53  ? 30   DA  I P     1 
ATOM   6552  O  OP1   . DA  I 5 30  ? 115.690 109.877 149.197 1.00 70.53  ? 30   DA  I OP1   1 
ATOM   6553  O  OP2   . DA  I 5 30  ? 116.069 111.157 151.392 1.00 70.53  ? 30   DA  I OP2   1 
ATOM   6554  O  "O5'" . DA  I 5 30  ? 113.890 110.123 150.934 1.00 70.53  ? 30   DA  I "O5'" 1 
ATOM   6555  C  "C5'" . DA  I 5 30  ? 113.034 109.011 150.719 1.00 70.53  ? 30   DA  I "C5'" 1 
ATOM   6556  C  "C4'" . DA  I 5 30  ? 111.910 108.988 151.751 1.00 70.53  ? 30   DA  I "C4'" 1 
ATOM   6557  O  "O4'" . DA  I 5 30  ? 112.408 108.499 153.009 1.00 70.53  ? 30   DA  I "O4'" 1 
ATOM   6558  C  "C3'" . DA  I 5 30  ? 111.261 110.336 152.042 1.00 70.53  ? 30   DA  I "C3'" 1 
ATOM   6559  O  "O3'" . DA  I 5 30  ? 109.863 110.180 152.171 1.00 70.53  ? 30   DA  I "O3'" 1 
ATOM   6560  C  "C2'" . DA  I 5 30  ? 111.898 110.729 153.374 1.00 70.53  ? 30   DA  I "C2'" 1 
ATOM   6561  C  "C1'" . DA  I 5 30  ? 112.048 109.378 154.042 1.00 70.53  ? 30   DA  I "C1'" 1 
ATOM   6562  N  N9    . DA  I 5 30  ? 113.136 109.302 155.004 1.00 70.53  ? 30   DA  I N9    1 
ATOM   6563  C  C8    . DA  I 5 30  ? 114.405 109.729 154.815 1.00 70.53  ? 30   DA  I C8    1 
ATOM   6564  N  N7    . DA  I 5 30  ? 115.201 109.499 155.827 1.00 70.53  ? 30   DA  I N7    1 
ATOM   6565  C  C5    . DA  I 5 30  ? 114.401 108.864 156.736 1.00 70.53  ? 30   DA  I C5    1 
ATOM   6566  C  C6    . DA  I 5 30  ? 114.655 108.357 158.010 1.00 70.53  ? 30   DA  I C6    1 
ATOM   6567  N  N6    . DA  I 5 30  ? 115.842 108.437 158.605 1.00 70.53  ? 30   DA  I N6    1 
ATOM   6568  N  N1    . DA  I 5 30  ? 113.640 107.775 158.662 1.00 70.53  ? 30   DA  I N1    1 
ATOM   6569  C  C2    . DA  I 5 30  ? 112.446 107.707 158.068 1.00 70.53  ? 30   DA  I C2    1 
ATOM   6570  N  N3    . DA  I 5 30  ? 112.090 108.144 156.865 1.00 70.53  ? 30   DA  I N3    1 
ATOM   6571  C  C4    . DA  I 5 30  ? 113.125 108.717 156.246 1.00 70.53  ? 30   DA  I C4    1 
ATOM   6572  P  P     . DT  I 5 31  ? 108.889 111.441 151.981 1.00 67.50  ? 31   DT  I P     1 
ATOM   6573  O  OP1   . DT  I 5 31  ? 107.949 111.089 150.897 1.00 67.50  ? 31   DT  I OP1   1 
ATOM   6574  O  OP2   . DT  I 5 31  ? 109.687 112.675 151.891 1.00 67.50  ? 31   DT  I OP2   1 
ATOM   6575  O  "O5'" . DT  I 5 31  ? 108.074 111.492 153.345 1.00 67.50  ? 31   DT  I "O5'" 1 
ATOM   6576  C  "C5'" . DT  I 5 31  ? 107.659 110.291 153.938 1.00 67.50  ? 31   DT  I "C5'" 1 
ATOM   6577  C  "C4'" . DT  I 5 31  ? 107.363 110.463 155.414 1.00 67.50  ? 31   DT  I "C4'" 1 
ATOM   6578  O  "O4'" . DT  I 5 31  ? 108.551 110.206 156.195 1.00 67.50  ? 31   DT  I "O4'" 1 
ATOM   6579  C  "C3'" . DT  I 5 31  ? 106.865 111.841 155.833 1.00 67.50  ? 31   DT  I "C3'" 1 
ATOM   6580  O  "O3'" . DT  I 5 31  ? 105.762 111.670 156.685 1.00 67.50  ? 31   DT  I "O3'" 1 
ATOM   6581  C  "C2'" . DT  I 5 31  ? 108.065 112.421 156.577 1.00 67.50  ? 31   DT  I "C2'" 1 
ATOM   6582  C  "C1'" . DT  I 5 31  ? 108.649 111.173 157.194 1.00 67.50  ? 31   DT  I "C1'" 1 
ATOM   6583  N  N1    . DT  I 5 31  ? 110.066 111.280 157.589 1.00 67.50  ? 31   DT  I N1    1 
ATOM   6584  C  C2    . DT  I 5 31  ? 110.454 110.764 158.797 1.00 67.50  ? 31   DT  I C2    1 
ATOM   6585  O  O2    . DT  I 5 31  ? 109.684 110.216 159.558 1.00 67.50  ? 31   DT  I O2    1 
ATOM   6586  N  N3    . DT  I 5 31  ? 111.784 110.897 159.083 1.00 67.50  ? 31   DT  I N3    1 
ATOM   6587  C  C4    . DT  I 5 31  ? 112.740 111.485 158.289 1.00 67.50  ? 31   DT  I C4    1 
ATOM   6588  O  O4    . DT  I 5 31  ? 113.915 111.560 158.620 1.00 67.50  ? 31   DT  I O4    1 
ATOM   6589  C  C5    . DT  I 5 31  ? 112.264 112.010 157.042 1.00 67.50  ? 31   DT  I C5    1 
ATOM   6590  C  C7    . DT  I 5 31  ? 113.218 112.690 156.121 1.00 67.50  ? 31   DT  I C7    1 
ATOM   6591  C  C6    . DT  I 5 31  ? 110.967 111.870 156.744 1.00 67.50  ? 31   DT  I C6    1 
ATOM   6592  P  P     . DT  I 5 32  ? 104.663 112.824 156.861 1.00 76.83  ? 32   DT  I P     1 
ATOM   6593  O  OP1   . DT  I 5 32  ? 103.405 112.320 156.274 1.00 76.83  ? 32   DT  I OP1   1 
ATOM   6594  O  OP2   . DT  I 5 32  ? 105.241 114.089 156.364 1.00 76.83  ? 32   DT  I OP2   1 
ATOM   6595  O  "O5'" . DT  I 5 32  ? 104.502 112.931 158.449 1.00 76.83  ? 32   DT  I "O5'" 1 
ATOM   6596  C  "C5'" . DT  I 5 32  ? 104.831 111.802 159.265 1.00 76.83  ? 32   DT  I "C5'" 1 
ATOM   6597  C  "C4'" . DT  I 5 32  ? 105.166 112.220 160.686 1.00 76.83  ? 32   DT  I "C4'" 1 
ATOM   6598  O  "O4'" . DT  I 5 32  ? 106.600 112.187 160.906 1.00 76.83  ? 32   DT  I "O4'" 1 
ATOM   6599  C  "C3'" . DT  I 5 32  ? 104.703 113.613 161.074 1.00 76.83  ? 32   DT  I "C3'" 1 
ATOM   6600  O  "O3'" . DT  I 5 32  ? 104.073 113.549 162.329 1.00 76.83  ? 32   DT  I "O3'" 1 
ATOM   6601  C  "C2'" . DT  I 5 32  ? 106.007 114.407 161.126 1.00 76.83  ? 32   DT  I "C2'" 1 
ATOM   6602  C  "C1'" . DT  I 5 32  ? 106.991 113.353 161.583 1.00 76.83  ? 32   DT  I "C1'" 1 
ATOM   6603  N  N1    . DT  I 5 32  ? 108.397 113.637 161.202 1.00 76.83  ? 32   DT  I N1    1 
ATOM   6604  C  C2    . DT  I 5 32  ? 109.407 113.360 162.084 1.00 76.83  ? 32   DT  I C2    1 
ATOM   6605  O  O2    . DT  I 5 32  ? 109.216 112.913 163.192 1.00 76.83  ? 32   DT  I O2    1 
ATOM   6606  N  N3    . DT  I 5 32  ? 110.658 113.632 161.616 1.00 76.83  ? 32   DT  I N3    1 
ATOM   6607  C  C4    . DT  I 5 32  ? 110.988 114.132 160.385 1.00 76.83  ? 32   DT  I C4    1 
ATOM   6608  O  O4    . DT  I 5 32  ? 112.131 114.348 160.047 1.00 76.83  ? 32   DT  I O4    1 
ATOM   6609  C  C5    . DT  I 5 32  ? 109.896 114.394 159.516 1.00 76.83  ? 32   DT  I C5    1 
ATOM   6610  C  C7    . DT  I 5 32  ? 110.156 114.959 158.159 1.00 76.83  ? 32   DT  I C7    1 
ATOM   6611  C  C6    . DT  I 5 32  ? 108.663 114.131 159.953 1.00 76.83  ? 32   DT  I C6    1 
ATOM   6612  P  P     . DG  I 5 33  ? 103.165 114.760 162.859 1.00 83.29  ? 33   DG  I P     1 
ATOM   6613  O  OP1   . DG  I 5 33  ? 101.890 114.156 163.304 1.00 83.29  ? 33   DG  I OP1   1 
ATOM   6614  O  OP2   . DG  I 5 33  ? 103.144 115.828 161.837 1.00 83.29  ? 33   DG  I OP2   1 
ATOM   6615  O  "O5'" . DG  I 5 33  ? 103.964 115.285 164.138 1.00 83.29  ? 33   DG  I "O5'" 1 
ATOM   6616  C  "C5'" . DG  I 5 33  ? 104.628 114.346 164.970 1.00 83.29  ? 33   DG  I "C5'" 1 
ATOM   6617  C  "C4'" . DG  I 5 33  ? 105.555 115.036 165.954 1.00 83.29  ? 33   DG  I "C4'" 1 
ATOM   6618  O  "O4'" . DG  I 5 33  ? 106.900 115.061 165.425 1.00 83.29  ? 33   DG  I "O4'" 1 
ATOM   6619  C  "C3'" . DG  I 5 33  ? 105.210 116.476 166.297 1.00 83.29  ? 33   DG  I "C3'" 1 
ATOM   6620  O  "O3'" . DG  I 5 33  ? 105.414 116.671 167.687 1.00 83.29  ? 33   DG  I "O3'" 1 
ATOM   6621  C  "C2'" . DG  I 5 33  ? 106.195 117.279 165.452 1.00 83.29  ? 33   DG  I "C2'" 1 
ATOM   6622  C  "C1'" . DG  I 5 33  ? 107.405 116.373 165.462 1.00 83.29  ? 33   DG  I "C1'" 1 
ATOM   6623  N  N9    . DG  I 5 33  ? 108.234 116.524 164.285 1.00 83.29  ? 33   DG  I N9    1 
ATOM   6624  C  C8    . DG  I 5 33  ? 107.799 116.632 162.996 1.00 83.29  ? 33   DG  I C8    1 
ATOM   6625  N  N7    . DG  I 5 33  ? 108.758 116.730 162.129 1.00 83.29  ? 33   DG  I N7    1 
ATOM   6626  C  C5    . DG  I 5 33  ? 109.903 116.718 162.899 1.00 83.29  ? 33   DG  I C5    1 
ATOM   6627  C  C6    . DG  I 5 33  ? 111.243 116.786 162.508 1.00 83.29  ? 33   DG  I C6    1 
ATOM   6628  O  O6    . DG  I 5 33  ? 111.696 116.927 161.372 1.00 83.29  ? 33   DG  I O6    1 
ATOM   6629  N  N1    . DG  I 5 33  ? 112.094 116.754 163.600 1.00 83.29  ? 33   DG  I N1    1 
ATOM   6630  C  C2    . DG  I 5 33  ? 111.699 116.634 164.904 1.00 83.29  ? 33   DG  I C2    1 
ATOM   6631  N  N2    . DG  I 5 33  ? 112.672 116.589 165.815 1.00 83.29  ? 33   DG  I N2    1 
ATOM   6632  N  N3    . DG  I 5 33  ? 110.441 116.537 165.285 1.00 83.29  ? 33   DG  I N3    1 
ATOM   6633  C  C4    . DG  I 5 33  ? 109.599 116.589 164.231 1.00 83.29  ? 33   DG  I C4    1 
ATOM   6634  P  P     . DG  I 5 34  ? 104.615 117.806 168.494 1.00 83.20  ? 34   DG  I P     1 
ATOM   6635  O  OP1   . DG  I 5 34  ? 103.699 117.138 169.443 1.00 83.20  ? 34   DG  I OP1   1 
ATOM   6636  O  OP2   . DG  I 5 34  ? 104.058 118.780 167.533 1.00 83.20  ? 34   DG  I OP2   1 
ATOM   6637  O  "O5'" . DG  I 5 34  ? 105.782 118.546 169.287 1.00 83.20  ? 34   DG  I "O5'" 1 
ATOM   6638  C  "C5'" . DG  I 5 34  ? 106.770 119.217 168.553 1.00 83.20  ? 34   DG  I "C5'" 1 
ATOM   6639  C  "C4'" . DG  I 5 34  ? 108.093 119.271 169.288 1.00 83.20  ? 34   DG  I "C4'" 1 
ATOM   6640  O  "O4'" . DG  I 5 34  ? 109.133 118.854 168.378 1.00 83.20  ? 34   DG  I "O4'" 1 
ATOM   6641  C  "C3'" . DG  I 5 34  ? 108.496 120.669 169.693 1.00 83.20  ? 34   DG  I "C3'" 1 
ATOM   6642  O  "O3'" . DG  I 5 34  ? 109.547 120.648 170.644 1.00 83.20  ? 34   DG  I "O3'" 1 
ATOM   6643  C  "C2'" . DG  I 5 34  ? 108.978 121.199 168.363 1.00 83.20  ? 34   DG  I "C2'" 1 
ATOM   6644  C  "C1'" . DG  I 5 34  ? 109.766 120.004 167.858 1.00 83.20  ? 34   DG  I "C1'" 1 
ATOM   6645  N  N9    . DG  I 5 34  ? 109.781 119.895 166.410 1.00 83.20  ? 34   DG  I N9    1 
ATOM   6646  C  C8    . DG  I 5 34  ? 108.704 119.763 165.573 1.00 83.20  ? 34   DG  I C8    1 
ATOM   6647  N  N7    . DG  I 5 34  ? 109.030 119.718 164.316 1.00 83.20  ? 34   DG  I N7    1 
ATOM   6648  C  C5    . DG  I 5 34  ? 110.403 119.862 164.326 1.00 83.20  ? 34   DG  I C5    1 
ATOM   6649  C  C6    . DG  I 5 34  ? 111.312 119.906 163.265 1.00 83.20  ? 34   DG  I C6    1 
ATOM   6650  O  O6    . DG  I 5 34  ? 111.078 119.813 162.058 1.00 83.20  ? 34   DG  I O6    1 
ATOM   6651  N  N1    . DG  I 5 34  ? 112.617 120.062 163.711 1.00 83.20  ? 34   DG  I N1    1 
ATOM   6652  C  C2    . DG  I 5 34  ? 112.990 120.177 165.022 1.00 83.20  ? 34   DG  I C2    1 
ATOM   6653  N  N2    . DG  I 5 34  ? 114.294 120.325 165.265 1.00 83.20  ? 34   DG  I N2    1 
ATOM   6654  N  N3    . DG  I 5 34  ? 112.144 120.146 166.026 1.00 83.20  ? 34   DG  I N3    1 
ATOM   6655  C  C4    . DG  I 5 34  ? 110.874 119.987 165.605 1.00 83.20  ? 34   DG  I C4    1 
ATOM   6656  P  P     . DT  I 5 35  ? 109.769 121.925 171.592 1.00 80.52  ? 35   DT  I P     1 
ATOM   6657  O  OP1   . DT  I 5 35  ? 109.475 121.501 172.975 1.00 80.52  ? 35   DT  I OP1   1 
ATOM   6658  O  OP2   . DT  I 5 35  ? 109.040 123.072 171.022 1.00 80.52  ? 35   DT  I OP2   1 
ATOM   6659  O  "O5'" . DT  I 5 35  ? 111.319 122.268 171.450 1.00 80.52  ? 35   DT  I "O5'" 1 
ATOM   6660  C  "C5'" . DT  I 5 35  ? 112.010 121.944 170.259 1.00 80.52  ? 35   DT  I "C5'" 1 
ATOM   6661  C  "C4'" . DT  I 5 35  ? 113.086 122.968 169.959 1.00 80.52  ? 35   DT  I "C4'" 1 
ATOM   6662  O  "O4'" . DT  I 5 35  ? 113.422 122.907 168.545 1.00 80.52  ? 35   DT  I "O4'" 1 
ATOM   6663  C  "C3'" . DT  I 5 35  ? 112.673 124.412 170.202 1.00 80.52  ? 35   DT  I "C3'" 1 
ATOM   6664  O  "O3'" . DT  I 5 35  ? 113.828 125.209 170.379 1.00 80.52  ? 35   DT  I "O3'" 1 
ATOM   6665  C  "C2'" . DT  I 5 35  ? 111.989 124.732 168.889 1.00 80.52  ? 35   DT  I "C2'" 1 
ATOM   6666  C  "C1'" . DT  I 5 35  ? 112.949 124.076 167.905 1.00 80.52  ? 35   DT  I "C1'" 1 
ATOM   6667  N  N1    . DT  I 5 35  ? 112.316 123.723 166.596 1.00 80.52  ? 35   DT  I N1    1 
ATOM   6668  C  C2    . DT  I 5 35  ? 113.105 123.548 165.494 1.00 80.52  ? 35   DT  I C2    1 
ATOM   6669  O  O2    . DT  I 5 35  ? 114.311 123.634 165.522 1.00 80.52  ? 35   DT  I O2    1 
ATOM   6670  N  N3    . DT  I 5 35  ? 112.432 123.252 164.354 1.00 80.52  ? 35   DT  I N3    1 
ATOM   6671  C  C4    . DT  I 5 35  ? 111.074 123.126 164.205 1.00 80.52  ? 35   DT  I C4    1 
ATOM   6672  O  O4    . DT  I 5 35  ? 110.557 122.858 163.132 1.00 80.52  ? 35   DT  I O4    1 
ATOM   6673  C  C5    . DT  I 5 35  ? 110.300 123.337 165.392 1.00 80.52  ? 35   DT  I C5    1 
ATOM   6674  C  C7    . DT  I 5 35  ? 108.807 123.237 165.342 1.00 80.52  ? 35   DT  I C7    1 
ATOM   6675  C  C6    . DT  I 5 35  ? 110.948 123.629 166.516 1.00 80.52  ? 35   DT  I C6    1 
ATOM   6676  P  P     . DC  I 5 36  ? 113.732 126.762 170.797 1.00 72.45  ? 36   DC  I P     1 
ATOM   6677  O  OP1   . DC  I 5 36  ? 114.556 126.928 172.008 1.00 72.45  ? 36   DC  I OP1   1 
ATOM   6678  O  OP2   . DC  I 5 36  ? 112.325 127.209 170.871 1.00 72.45  ? 36   DC  I OP2   1 
ATOM   6679  O  "O5'" . DC  I 5 36  ? 114.466 127.510 169.582 1.00 72.45  ? 36   DC  I "O5'" 1 
ATOM   6680  C  "C5'" . DC  I 5 36  ? 115.756 127.054 169.162 1.00 72.45  ? 36   DC  I "C5'" 1 
ATOM   6681  C  "C4'" . DC  I 5 36  ? 116.143 127.593 167.793 1.00 72.45  ? 36   DC  I "C4'" 1 
ATOM   6682  O  "O4'" . DC  I 5 36  ? 115.182 127.158 166.802 1.00 72.45  ? 36   DC  I "O4'" 1 
ATOM   6683  C  "C3'" . DC  I 5 36  ? 116.206 129.110 167.672 1.00 72.45  ? 36   DC  I "C3'" 1 
ATOM   6684  O  "O3'" . DC  I 5 36  ? 117.342 129.450 166.902 1.00 72.45  ? 36   DC  I "O3'" 1 
ATOM   6685  C  "C2'" . DC  I 5 36  ? 114.907 129.454 166.953 1.00 72.45  ? 36   DC  I "C2'" 1 
ATOM   6686  C  "C1'" . DC  I 5 36  ? 114.777 128.264 166.032 1.00 72.45  ? 36   DC  I "C1'" 1 
ATOM   6687  N  N1    . DC  I 5 36  ? 113.388 128.006 165.549 1.00 72.45  ? 36   DC  I N1    1 
ATOM   6688  C  C2    . DC  I 5 36  ? 113.192 127.642 164.228 1.00 72.45  ? 36   DC  I C2    1 
ATOM   6689  O  O2    . DC  I 5 36  ? 114.169 127.559 163.491 1.00 72.45  ? 36   DC  I O2    1 
ATOM   6690  N  N3    . DC  I 5 36  ? 111.946 127.388 163.795 1.00 72.45  ? 36   DC  I N3    1 
ATOM   6691  C  C4    . DC  I 5 36  ? 110.922 127.482 164.631 1.00 72.45  ? 36   DC  I C4    1 
ATOM   6692  N  N4    . DC  I 5 36  ? 109.707 127.222 164.156 1.00 72.45  ? 36   DC  I N4    1 
ATOM   6693  C  C5    . DC  I 5 36  ? 111.094 127.849 165.989 1.00 72.45  ? 36   DC  I C5    1 
ATOM   6694  C  C6    . DC  I 5 36  ? 112.336 128.097 166.405 1.00 72.45  ? 36   DC  I C6    1 
ATOM   6695  P  P     . DG  I 5 37  ? 118.419 130.494 167.474 1.00 69.72  ? 37   DG  I P     1 
ATOM   6696  O  OP1   . DG  I 5 37  ? 119.526 129.725 168.078 1.00 69.72  ? 37   DG  I OP1   1 
ATOM   6697  O  OP2   . DG  I 5 37  ? 117.696 131.495 168.284 1.00 69.72  ? 37   DG  I OP2   1 
ATOM   6698  O  "O5'" . DG  I 5 37  ? 118.983 131.225 166.176 1.00 69.72  ? 37   DG  I "O5'" 1 
ATOM   6699  C  "C5'" . DG  I 5 37  ? 119.327 130.466 165.026 1.00 69.72  ? 37   DG  I "C5'" 1 
ATOM   6700  C  "C4'" . DG  I 5 37  ? 118.845 131.158 163.773 1.00 69.72  ? 37   DG  I "C4'" 1 
ATOM   6701  O  "O4'" . DG  I 5 37  ? 117.452 130.849 163.544 1.00 69.72  ? 37   DG  I "O4'" 1 
ATOM   6702  C  "C3'" . DG  I 5 37  ? 118.943 132.680 163.806 1.00 69.72  ? 37   DG  I "C3'" 1 
ATOM   6703  O  "O3'" . DG  I 5 37  ? 119.471 133.137 162.595 1.00 69.72  ? 37   DG  I "O3'" 1 
ATOM   6704  C  "C2'" . DG  I 5 37  ? 117.486 133.098 163.958 1.00 69.72  ? 37   DG  I "C2'" 1 
ATOM   6705  C  "C1'" . DG  I 5 37  ? 116.804 132.020 163.156 1.00 69.72  ? 37   DG  I "C1'" 1 
ATOM   6706  N  N9    . DG  I 5 37  ? 115.406 131.866 163.473 1.00 69.72  ? 37   DG  I N9    1 
ATOM   6707  C  C8    . DG  I 5 37  ? 114.803 132.129 164.668 1.00 69.72  ? 37   DG  I C8    1 
ATOM   6708  N  N7    . DG  I 5 37  ? 113.532 131.891 164.665 1.00 69.72  ? 37   DG  I N7    1 
ATOM   6709  C  C5    . DG  I 5 37  ? 113.277 131.454 163.379 1.00 69.72  ? 37   DG  I C5    1 
ATOM   6710  C  C6    . DG  I 5 37  ? 112.066 131.055 162.783 1.00 69.72  ? 37   DG  I C6    1 
ATOM   6711  O  O6    . DG  I 5 37  ? 110.948 131.005 163.295 1.00 69.72  ? 37   DG  I O6    1 
ATOM   6712  N  N1    . DG  I 5 37  ? 112.237 130.690 161.457 1.00 69.72  ? 37   DG  I N1    1 
ATOM   6713  C  C2    . DG  I 5 37  ? 113.434 130.708 160.792 1.00 69.72  ? 37   DG  I C2    1 
ATOM   6714  N  N2    . DG  I 5 37  ? 113.409 130.312 159.510 1.00 69.72  ? 37   DG  I N2    1 
ATOM   6715  N  N3    . DG  I 5 37  ? 114.582 131.075 161.345 1.00 69.72  ? 37   DG  I N3    1 
ATOM   6716  C  C4    . DG  I 5 37  ? 114.422 131.437 162.635 1.00 69.72  ? 37   DG  I C4    1 
ATOM   6717  P  P     . DT  I 5 38  ? 120.315 134.497 162.536 1.00 65.03  ? 38   DT  I P     1 
ATOM   6718  O  OP1   . DT  I 5 38  ? 121.580 134.247 163.253 1.00 65.03  ? 38   DT  I OP1   1 
ATOM   6719  O  OP2   . DT  I 5 38  ? 119.441 135.607 162.962 1.00 65.03  ? 38   DT  I OP2   1 
ATOM   6720  O  "O5'" . DT  I 5 38  ? 120.606 134.666 160.977 1.00 65.03  ? 38   DT  I "O5'" 1 
ATOM   6721  C  "C5'" . DT  I 5 38  ? 120.581 133.520 160.154 1.00 65.03  ? 38   DT  I "C5'" 1 
ATOM   6722  C  "C4'" . DT  I 5 38  ? 119.507 133.626 159.087 1.00 65.03  ? 38   DT  I "C4'" 1 
ATOM   6723  O  "O4'" . DT  I 5 38  ? 118.192 133.598 159.698 1.00 65.03  ? 38   DT  I "O4'" 1 
ATOM   6724  C  "C3'" . DT  I 5 38  ? 119.530 134.886 158.231 1.00 65.03  ? 38   DT  I "C3'" 1 
ATOM   6725  O  "O3'" . DT  I 5 38  ? 119.314 134.488 156.892 1.00 65.03  ? 38   DT  I "O3'" 1 
ATOM   6726  C  "C2'" . DT  I 5 38  ? 118.360 135.699 158.790 1.00 65.03  ? 38   DT  I "C2'" 1 
ATOM   6727  C  "C1'" . DT  I 5 38  ? 117.392 134.589 159.096 1.00 65.03  ? 38   DT  I "C1'" 1 
ATOM   6728  N  N1    . DT  I 5 38  ? 116.329 134.934 160.063 1.00 65.03  ? 38   DT  I N1    1 
ATOM   6729  C  C2    . DT  I 5 38  ? 115.037 134.576 159.791 1.00 65.03  ? 38   DT  I C2    1 
ATOM   6730  O  O2    . DT  I 5 38  ? 114.697 134.056 158.754 1.00 65.03  ? 38   DT  I O2    1 
ATOM   6731  N  N3    . DT  I 5 38  ? 114.142 134.888 160.761 1.00 65.03  ? 38   DT  I N3    1 
ATOM   6732  C  C4    . DT  I 5 38  ? 114.407 135.480 161.968 1.00 65.03  ? 38   DT  I C4    1 
ATOM   6733  O  O4    . DT  I 5 38  ? 113.532 135.714 162.786 1.00 65.03  ? 38   DT  I O4    1 
ATOM   6734  C  C5    . DT  I 5 38  ? 115.785 135.805 162.206 1.00 65.03  ? 38   DT  I C5    1 
ATOM   6735  C  C7    . DT  I 5 38  ? 116.191 136.463 163.487 1.00 65.03  ? 38   DT  I C7    1 
ATOM   6736  C  C6    . DT  I 5 38  ? 116.672 135.508 161.256 1.00 65.03  ? 38   DT  I C6    1 
ATOM   6737  P  P     . DA  I 5 39  ? 119.768 135.399 155.654 1.00 61.91  ? 39   DA  I P     1 
ATOM   6738  O  OP1   . DA  I 5 39  ? 121.023 134.823 155.133 1.00 61.91  ? 39   DA  I OP1   1 
ATOM   6739  O  OP2   . DA  I 5 39  ? 119.736 136.822 156.042 1.00 61.91  ? 39   DA  I OP2   1 
ATOM   6740  O  "O5'" . DA  I 5 39  ? 118.599 135.168 154.594 1.00 61.91  ? 39   DA  I "O5'" 1 
ATOM   6741  C  "C5'" . DA  I 5 39  ? 118.117 133.846 154.356 1.00 61.91  ? 39   DA  I "C5'" 1 
ATOM   6742  C  "C4'" . DA  I 5 39  ? 116.748 133.824 153.671 1.00 61.91  ? 39   DA  I "C4'" 1 
ATOM   6743  O  "O4'" . DA  I 5 39  ? 115.681 134.103 154.602 1.00 61.91  ? 39   DA  I "O4'" 1 
ATOM   6744  C  "C3'" . DA  I 5 39  ? 116.545 134.772 152.523 1.00 61.91  ? 39   DA  I "C3'" 1 
ATOM   6745  O  "O3'" . DA  I 5 39  ? 115.698 134.159 151.601 1.00 61.91  ? 39   DA  I "O3'" 1 
ATOM   6746  C  "C2'" . DA  I 5 39  ? 115.879 135.972 153.192 1.00 61.91  ? 39   DA  I "C2'" 1 
ATOM   6747  C  "C1'" . DA  I 5 39  ? 115.048 135.325 154.285 1.00 61.91  ? 39   DA  I "C1'" 1 
ATOM   6748  N  N9    . DA  I 5 39  ? 115.003 136.049 155.542 1.00 61.91  ? 39   DA  I N9    1 
ATOM   6749  C  C8    . DA  I 5 39  ? 116.055 136.603 156.203 1.00 61.91  ? 39   DA  I C8    1 
ATOM   6750  N  N7    . DA  I 5 39  ? 115.734 137.127 157.356 1.00 61.91  ? 39   DA  I N7    1 
ATOM   6751  C  C5    . DA  I 5 39  ? 114.385 136.882 157.466 1.00 61.91  ? 39   DA  I C5    1 
ATOM   6752  C  C6    . DA  I 5 39  ? 113.452 137.184 158.465 1.00 61.91  ? 39   DA  I C6    1 
ATOM   6753  N  N6    . DA  I 5 39  ? 113.769 137.834 159.583 1.00 61.91  ? 39   DA  I N6    1 
ATOM   6754  N  N1    . DA  I 5 39  ? 112.175 136.805 158.271 1.00 61.91  ? 39   DA  I N1    1 
ATOM   6755  C  C2    . DA  I 5 39  ? 111.864 136.154 157.153 1.00 61.91  ? 39   DA  I C2    1 
ATOM   6756  N  N3    . DA  I 5 39  ? 112.659 135.812 156.143 1.00 61.91  ? 39   DA  I N3    1 
ATOM   6757  C  C4    . DA  I 5 39  ? 113.918 136.206 156.368 1.00 61.91  ? 39   DA  I C4    1 
ATOM   6758  P  P     . DG  I 5 40  ? 115.440 134.838 150.181 1.00 63.40  ? 40   DG  I P     1 
ATOM   6759  O  OP1   . DG  I 5 40  ? 115.314 133.767 149.181 1.00 63.40  ? 40   DG  I OP1   1 
ATOM   6760  O  OP2   . DG  I 5 40  ? 116.491 135.853 149.991 1.00 63.40  ? 40   DG  I OP2   1 
ATOM   6761  O  "O5'" . DG  I 5 40  ? 114.046 135.581 150.384 1.00 63.40  ? 40   DG  I "O5'" 1 
ATOM   6762  C  "C5'" . DG  I 5 40  ? 112.859 134.822 150.540 1.00 63.40  ? 40   DG  I "C5'" 1 
ATOM   6763  C  "C4'" . DG  I 5 40  ? 111.708 135.677 151.039 1.00 63.40  ? 40   DG  I "C4'" 1 
ATOM   6764  O  "O4'" . DG  I 5 40  ? 112.011 136.196 152.365 1.00 63.40  ? 40   DG  I "O4'" 1 
ATOM   6765  C  "C3'" . DG  I 5 40  ? 111.380 136.901 150.186 1.00 63.40  ? 40   DG  I "C3'" 1 
ATOM   6766  O  "O3'" . DG  I 5 40  ? 109.990 137.089 150.173 1.00 63.40  ? 40   DG  I "O3'" 1 
ATOM   6767  C  "C2'" . DG  I 5 40  ? 112.052 138.016 150.969 1.00 63.40  ? 40   DG  I "C2'" 1 
ATOM   6768  C  "C1'" . DG  I 5 40  ? 111.709 137.564 152.369 1.00 63.40  ? 40   DG  I "C1'" 1 
ATOM   6769  N  N9    . DG  I 5 40  ? 112.455 138.246 153.431 1.00 63.40  ? 40   DG  I N9    1 
ATOM   6770  C  C8    . DG  I 5 40  ? 113.772 138.597 153.414 1.00 63.40  ? 40   DG  I C8    1 
ATOM   6771  N  N7    . DG  I 5 40  ? 114.174 139.183 154.498 1.00 63.40  ? 40   DG  I N7    1 
ATOM   6772  C  C5    . DG  I 5 40  ? 113.037 139.270 155.272 1.00 63.40  ? 40   DG  I C5    1 
ATOM   6773  C  C6    . DG  I 5 40  ? 112.860 139.830 156.545 1.00 63.40  ? 40   DG  I C6    1 
ATOM   6774  O  O6    . DG  I 5 40  ? 113.704 140.374 157.270 1.00 63.40  ? 40   DG  I O6    1 
ATOM   6775  N  N1    . DG  I 5 40  ? 111.553 139.712 156.977 1.00 63.40  ? 40   DG  I N1    1 
ATOM   6776  C  C2    . DG  I 5 40  ? 110.545 139.126 156.262 1.00 63.40  ? 40   DG  I C2    1 
ATOM   6777  N  N2    . DG  I 5 40  ? 109.345 139.111 156.843 1.00 63.40  ? 40   DG  I N2    1 
ATOM   6778  N  N3    . DG  I 5 40  ? 110.700 138.593 155.066 1.00 63.40  ? 40   DG  I N3    1 
ATOM   6779  C  C4    . DG  I 5 40  ? 111.966 138.708 154.630 1.00 63.40  ? 40   DG  I C4    1 
ATOM   6780  P  P     . DA  I 5 41  ? 109.140 136.838 148.838 1.00 68.91  ? 41   DA  I P     1 
ATOM   6781  O  OP1   . DA  I 5 41  ? 109.273 135.411 148.497 1.00 68.91  ? 41   DA  I OP1   1 
ATOM   6782  O  OP2   . DA  I 5 41  ? 109.506 137.871 147.850 1.00 68.91  ? 41   DA  I OP2   1 
ATOM   6783  O  "O5'" . DA  I 5 41  ? 107.647 137.157 149.293 1.00 68.91  ? 41   DA  I "O5'" 1 
ATOM   6784  C  "C5'" . DA  I 5 41  ? 107.142 136.592 150.500 1.00 68.91  ? 41   DA  I "C5'" 1 
ATOM   6785  C  "C4'" . DA  I 5 41  ? 106.285 137.596 151.260 1.00 68.91  ? 41   DA  I "C4'" 1 
ATOM   6786  O  "O4'" . DA  I 5 41  ? 107.070 138.272 152.283 1.00 68.91  ? 41   DA  I "O4'" 1 
ATOM   6787  C  "C3'" . DA  I 5 41  ? 105.670 138.689 150.416 1.00 68.91  ? 41   DA  I "C3'" 1 
ATOM   6788  O  "O3'" . DA  I 5 41  ? 104.375 138.930 150.870 1.00 68.91  ? 41   DA  I "O3'" 1 
ATOM   6789  C  "C2'" . DA  I 5 41  ? 106.589 139.879 150.681 1.00 68.91  ? 41   DA  I "C2'" 1 
ATOM   6790  C  "C1'" . DA  I 5 41  ? 106.955 139.673 152.140 1.00 68.91  ? 41   DA  I "C1'" 1 
ATOM   6791  N  N9    . DA  I 5 41  ? 108.260 140.215 152.500 1.00 68.91  ? 41   DA  I N9    1 
ATOM   6792  C  C8    . DA  I 5 41  ? 109.400 140.052 151.798 1.00 68.91  ? 41   DA  I C8    1 
ATOM   6793  N  N7    . DA  I 5 41  ? 110.451 140.604 152.346 1.00 68.91  ? 41   DA  I N7    1 
ATOM   6794  C  C5    . DA  I 5 41  ? 109.976 141.156 153.497 1.00 68.91  ? 41   DA  I C5    1 
ATOM   6795  C  C6    . DA  I 5 41  ? 110.607 141.888 154.507 1.00 68.91  ? 41   DA  I C6    1 
ATOM   6796  N  N6    . DA  I 5 41  ? 111.911 142.165 154.501 1.00 68.91  ? 41   DA  I N6    1 
ATOM   6797  N  N1    . DA  I 5 41  ? 109.854 142.317 155.532 1.00 68.91  ? 41   DA  I N1    1 
ATOM   6798  C  C2    . DA  I 5 41  ? 108.544 142.032 155.529 1.00 68.91  ? 41   DA  I C2    1 
ATOM   6799  N  N3    . DA  I 5 41  ? 107.835 141.349 154.622 1.00 68.91  ? 41   DA  I N3    1 
ATOM   6800  C  C4    . DA  I 5 41  ? 108.620 140.933 153.624 1.00 68.91  ? 41   DA  I C4    1 
ATOM   6801  P  P     . DC  I 5 42  ? 103.345 139.741 149.957 1.00 73.01  ? 42   DC  I P     1 
ATOM   6802  O  OP1   . DC  I 5 42  ? 102.062 139.013 150.011 1.00 73.01  ? 42   DC  I OP1   1 
ATOM   6803  O  OP2   . DC  I 5 42  ? 103.983 140.027 148.656 1.00 73.01  ? 42   DC  I OP2   1 
ATOM   6804  O  "O5'" . DC  I 5 42  ? 103.198 141.118 150.734 1.00 73.01  ? 42   DC  I "O5'" 1 
ATOM   6805  C  "C5'" . DC  I 5 42  ? 103.124 141.120 152.147 1.00 73.01  ? 42   DC  I "C5'" 1 
ATOM   6806  C  "C4'" . DC  I 5 42  ? 103.336 142.516 152.681 1.00 73.01  ? 42   DC  I "C4'" 1 
ATOM   6807  O  "O4'" . DC  I 5 42  ? 104.732 142.720 153.004 1.00 73.01  ? 42   DC  I "O4'" 1 
ATOM   6808  C  "C3'" . DC  I 5 42  ? 102.953 143.626 151.705 1.00 73.01  ? 42   DC  I "C3'" 1 
ATOM   6809  O  "O3'" . DC  I 5 42  ? 102.211 144.604 152.388 1.00 73.01  ? 42   DC  I "O3'" 1 
ATOM   6810  C  "C2'" . DC  I 5 42  ? 104.311 144.158 151.247 1.00 73.01  ? 42   DC  I "C2'" 1 
ATOM   6811  C  "C1'" . DC  I 5 42  ? 105.125 143.972 152.509 1.00 73.01  ? 42   DC  I "C1'" 1 
ATOM   6812  N  N1    . DC  I 5 42  ? 106.586 143.944 152.295 1.00 73.01  ? 42   DC  I N1    1 
ATOM   6813  C  C2    . DC  I 5 42  ? 107.413 144.638 153.161 1.00 73.01  ? 42   DC  I C2    1 
ATOM   6814  O  O2    . DC  I 5 42  ? 106.900 145.269 154.082 1.00 73.01  ? 42   DC  I O2    1 
ATOM   6815  N  N3    . DC  I 5 42  ? 108.748 144.595 152.970 1.00 73.01  ? 42   DC  I N3    1 
ATOM   6816  C  C4    . DC  I 5 42  ? 109.246 143.904 151.959 1.00 73.01  ? 42   DC  I C4    1 
ATOM   6817  N  N4    . DC  I 5 42  ? 110.566 143.881 151.807 1.00 73.01  ? 42   DC  I N4    1 
ATOM   6818  C  C5    . DC  I 5 42  ? 108.415 143.188 151.067 1.00 73.01  ? 42   DC  I C5    1 
ATOM   6819  C  C6    . DC  I 5 42  ? 107.103 143.243 151.270 1.00 73.01  ? 42   DC  I C6    1 
ATOM   6820  P  P     . DA  I 5 43  ? 101.177 145.537 151.595 1.00 75.38  ? 43   DA  I P     1 
ATOM   6821  O  OP1   . DA  I 5 43  ? 99.831  144.993 151.860 1.00 75.38  ? 43   DA  I OP1   1 
ATOM   6822  O  OP2   . DA  I 5 43  ? 101.642 145.688 150.202 1.00 75.38  ? 43   DA  I OP2   1 
ATOM   6823  O  "O5'" . DA  I 5 43  ? 101.310 146.947 152.325 1.00 75.38  ? 43   DA  I "O5'" 1 
ATOM   6824  C  "C5'" . DA  I 5 43  ? 101.562 146.989 153.717 1.00 75.38  ? 43   DA  I "C5'" 1 
ATOM   6825  C  "C4'" . DA  I 5 43  ? 102.260 148.275 154.111 1.00 75.38  ? 43   DA  I "C4'" 1 
ATOM   6826  O  "O4'" . DA  I 5 43  ? 103.694 148.096 154.059 1.00 75.38  ? 43   DA  I "O4'" 1 
ATOM   6827  C  "C3'" . DA  I 5 43  ? 101.946 149.484 153.250 1.00 75.38  ? 43   DA  I "C3'" 1 
ATOM   6828  O  "O3'" . DA  I 5 43  ? 101.773 150.592 154.095 1.00 75.38  ? 43   DA  I "O3'" 1 
ATOM   6829  C  "C2'" . DA  I 5 43  ? 103.186 149.616 152.362 1.00 75.38  ? 43   DA  I "C2'" 1 
ATOM   6830  C  "C1'" . DA  I 5 43  ? 104.285 149.104 153.272 1.00 75.38  ? 43   DA  I "C1'" 1 
ATOM   6831  N  N9    . DA  I 5 43  ? 105.360 148.453 152.554 1.00 75.38  ? 43   DA  I N9    1 
ATOM   6832  C  C8    . DA  I 5 43  ? 105.219 147.490 151.611 1.00 75.38  ? 43   DA  I C8    1 
ATOM   6833  N  N7    . DA  I 5 43  ? 106.345 147.037 151.144 1.00 75.38  ? 43   DA  I N7    1 
ATOM   6834  C  C5    . DA  I 5 43  ? 107.295 147.755 151.829 1.00 75.38  ? 43   DA  I C5    1 
ATOM   6835  C  C6    . DA  I 5 43  ? 108.689 147.735 151.786 1.00 75.38  ? 43   DA  I C6    1 
ATOM   6836  N  N6    . DA  I 5 43  ? 109.376 146.937 150.973 1.00 75.38  ? 43   DA  I N6    1 
ATOM   6837  N  N1    . DA  I 5 43  ? 109.357 148.576 152.596 1.00 75.38  ? 43   DA  I N1    1 
ATOM   6838  C  C2    . DA  I 5 43  ? 108.661 149.388 153.398 1.00 75.38  ? 43   DA  I C2    1 
ATOM   6839  N  N3    . DA  I 5 43  ? 107.337 149.482 153.537 1.00 75.38  ? 43   DA  I N3    1 
ATOM   6840  C  C4    . DA  I 5 43  ? 106.709 148.632 152.711 1.00 75.38  ? 43   DA  I C4    1 
ATOM   6841  P  P     . DG  I 5 44  ? 101.321 152.016 153.517 1.00 77.44  ? 44   DG  I P     1 
ATOM   6842  O  OP1   . DG  I 5 44  ? 100.478 152.660 154.547 1.00 77.44  ? 44   DG  I OP1   1 
ATOM   6843  O  OP2   . DG  I 5 44  ? 100.794 151.821 152.151 1.00 77.44  ? 44   DG  I OP2   1 
ATOM   6844  O  "O5'" . DG  I 5 44  ? 102.703 152.808 153.422 1.00 77.44  ? 44   DG  I "O5'" 1 
ATOM   6845  C  "C5'" . DG  I 5 44  ? 103.566 152.836 154.558 1.00 77.44  ? 44   DG  I "C5'" 1 
ATOM   6846  C  "C4'" . DG  I 5 44  ? 104.853 153.573 154.249 1.00 77.44  ? 44   DG  I "C4'" 1 
ATOM   6847  O  "O4'" . DG  I 5 44  ? 105.815 152.685 153.625 1.00 77.44  ? 44   DG  I "O4'" 1 
ATOM   6848  C  "C3'" . DG  I 5 44  ? 104.697 154.764 153.319 1.00 77.44  ? 44   DG  I "C3'" 1 
ATOM   6849  O  "O3'" . DG  I 5 44  ? 105.417 155.846 153.871 1.00 77.44  ? 44   DG  I "O3'" 1 
ATOM   6850  C  "C2'" . DG  I 5 44  ? 105.312 154.255 152.010 1.00 77.44  ? 44   DG  I "C2'" 1 
ATOM   6851  C  "C1'" . DG  I 5 44  ? 106.403 153.343 152.535 1.00 77.44  ? 44   DG  I "C1'" 1 
ATOM   6852  N  N9    . DG  I 5 44  ? 106.842 152.314 151.593 1.00 77.44  ? 44   DG  I N9    1 
ATOM   6853  C  C8    . DG  I 5 44  ? 106.041 151.479 150.858 1.00 77.44  ? 44   DG  I C8    1 
ATOM   6854  N  N7    . DG  I 5 44  ? 106.705 150.637 150.121 1.00 77.44  ? 44   DG  I N7    1 
ATOM   6855  C  C5    . DG  I 5 44  ? 108.035 150.929 150.384 1.00 77.44  ? 44   DG  I C5    1 
ATOM   6856  C  C6    . DG  I 5 44  ? 109.213 150.355 149.854 1.00 77.44  ? 44   DG  I C6    1 
ATOM   6857  O  O6    . DG  I 5 44  ? 109.311 149.430 149.045 1.00 77.44  ? 44   DG  I O6    1 
ATOM   6858  N  N1    . DG  I 5 44  ? 110.358 150.938 150.378 1.00 77.44  ? 44   DG  I N1    1 
ATOM   6859  C  C2    . DG  I 5 44  ? 110.369 151.963 151.284 1.00 77.44  ? 44   DG  I C2    1 
ATOM   6860  N  N2    . DG  I 5 44  ? 111.574 152.401 151.668 1.00 77.44  ? 44   DG  I N2    1 
ATOM   6861  N  N3    . DG  I 5 44  ? 109.271 152.524 151.780 1.00 77.44  ? 44   DG  I N3    1 
ATOM   6862  C  C4    . DG  I 5 44  ? 108.141 151.961 151.282 1.00 77.44  ? 44   DG  I C4    1 
ATOM   6863  P  P     . DC  I 5 45  ? 105.122 157.360 153.431 1.00 76.64  ? 45   DC  I P     1 
ATOM   6864  O  OP1   . DC  I 5 45  ? 104.820 158.129 154.655 1.00 76.64  ? 45   DC  I OP1   1 
ATOM   6865  O  OP2   . DC  I 5 45  ? 104.161 157.349 152.308 1.00 76.64  ? 45   DC  I OP2   1 
ATOM   6866  O  "O5'" . DC  I 5 45  ? 106.535 157.848 152.889 1.00 76.64  ? 45   DC  I "O5'" 1 
ATOM   6867  C  "C5'" . DC  I 5 45  ? 107.714 157.570 153.647 1.00 76.64  ? 45   DC  I "C5'" 1 
ATOM   6868  C  "C4'" . DC  I 5 45  ? 108.941 157.682 152.768 1.00 76.64  ? 45   DC  I "C4'" 1 
ATOM   6869  O  "O4'" . DC  I 5 45  ? 109.141 156.441 152.045 1.00 76.64  ? 45   DC  I "O4'" 1 
ATOM   6870  C  "C3'" . DC  I 5 45  ? 108.866 158.783 151.715 1.00 76.64  ? 45   DC  I "C3'" 1 
ATOM   6871  O  "O3'" . DC  I 5 45  ? 110.076 159.504 151.690 1.00 76.64  ? 45   DC  I "O3'" 1 
ATOM   6872  C  "C2'" . DC  I 5 45  ? 108.652 158.009 150.425 1.00 76.64  ? 45   DC  I "C2'" 1 
ATOM   6873  C  "C1'" . DC  I 5 45  ? 109.415 156.738 150.703 1.00 76.64  ? 45   DC  I "C1'" 1 
ATOM   6874  N  N1    . DC  I 5 45  ? 108.978 155.599 149.872 1.00 76.64  ? 45   DC  I N1    1 
ATOM   6875  C  C2    . DC  I 5 45  ? 109.924 154.738 149.335 1.00 76.64  ? 45   DC  I C2    1 
ATOM   6876  O  O2    . DC  I 5 45  ? 111.116 154.950 149.551 1.00 76.64  ? 45   DC  I O2    1 
ATOM   6877  N  N3    . DC  I 5 45  ? 109.514 153.700 148.582 1.00 76.64  ? 45   DC  I N3    1 
ATOM   6878  C  C4    . DC  I 5 45  ? 108.222 153.515 148.364 1.00 76.64  ? 45   DC  I C4    1 
ATOM   6879  N  N4    . DC  I 5 45  ? 107.862 152.474 147.620 1.00 76.64  ? 45   DC  I N4    1 
ATOM   6880  C  C5    . DC  I 5 45  ? 107.241 154.374 148.915 1.00 76.64  ? 45   DC  I C5    1 
ATOM   6881  C  C6    . DC  I 5 45  ? 107.662 155.400 149.648 1.00 76.64  ? 45   DC  I C6    1 
ATOM   6882  P  P     . DT  I 5 46  ? 110.119 161.026 151.178 1.00 72.43  ? 46   DT  I P     1 
ATOM   6883  O  OP1   . DT  I 5 46  ? 110.231 161.892 152.370 1.00 72.43  ? 46   DT  I OP1   1 
ATOM   6884  O  OP2   . DT  I 5 46  ? 109.027 161.260 150.209 1.00 72.43  ? 46   DT  I OP2   1 
ATOM   6885  O  "O5'" . DT  I 5 46  ? 111.487 161.078 150.369 1.00 72.43  ? 46   DT  I "O5'" 1 
ATOM   6886  C  "C5'" . DT  I 5 46  ? 112.562 160.240 150.765 1.00 72.43  ? 46   DT  I "C5'" 1 
ATOM   6887  C  "C4'" . DT  I 5 46  ? 113.314 159.715 149.556 1.00 72.43  ? 46   DT  I "C4'" 1 
ATOM   6888  O  "O4'" . DT  I 5 46  ? 112.605 158.602 148.958 1.00 72.43  ? 46   DT  I "O4'" 1 
ATOM   6889  C  "C3'" . DT  I 5 46  ? 113.524 160.727 148.442 1.00 72.43  ? 46   DT  I "C3'" 1 
ATOM   6890  O  "O3'" . DT  I 5 46  ? 114.836 160.606 147.955 1.00 72.43  ? 46   DT  I "O3'" 1 
ATOM   6891  C  "C2'" . DT  I 5 46  ? 112.505 160.280 147.384 1.00 72.43  ? 46   DT  I "C2'" 1 
ATOM   6892  C  "C1'" . DT  I 5 46  ? 112.575 158.785 147.569 1.00 72.43  ? 46   DT  I "C1'" 1 
ATOM   6893  N  N1    . DT  I 5 46  ? 111.437 158.028 147.035 1.00 72.43  ? 46   DT  I N1    1 
ATOM   6894  C  C2    . DT  I 5 46  ? 111.690 156.848 146.417 1.00 72.43  ? 46   DT  I C2    1 
ATOM   6895  O  O2    . DT  I 5 46  ? 112.808 156.420 146.253 1.00 72.43  ? 46   DT  I O2    1 
ATOM   6896  N  N3    . DT  I 5 46  ? 110.594 156.183 145.977 1.00 72.43  ? 46   DT  I N3    1 
ATOM   6897  C  C4    . DT  I 5 46  ? 109.282 156.569 146.113 1.00 72.43  ? 46   DT  I C4    1 
ATOM   6898  O  O4    . DT  I 5 46  ? 108.354 155.902 145.686 1.00 72.43  ? 46   DT  I O4    1 
ATOM   6899  C  C5    . DT  I 5 46  ? 109.076 157.811 146.782 1.00 72.43  ? 46   DT  I C5    1 
ATOM   6900  C  C7    . DT  I 5 46  ? 107.681 158.323 146.965 1.00 72.43  ? 46   DT  I C7    1 
ATOM   6901  C  C6    . DT  I 5 46  ? 110.154 158.481 147.216 1.00 72.43  ? 46   DT  I C6    1 
ATOM   6902  P  P     . DC  I 5 47  ? 115.710 161.912 147.653 1.00 69.63  ? 47   DC  I P     1 
ATOM   6903  O  OP1   . DC  I 5 47  ? 116.792 161.935 148.658 1.00 69.63  ? 47   DC  I OP1   1 
ATOM   6904  O  OP2   . DC  I 5 47  ? 114.804 163.070 147.512 1.00 69.63  ? 47   DC  I OP2   1 
ATOM   6905  O  "O5'" . DC  I 5 47  ? 116.372 161.601 146.237 1.00 69.63  ? 47   DC  I "O5'" 1 
ATOM   6906  C  "C5'" . DC  I 5 47  ? 116.749 160.284 145.911 1.00 69.63  ? 47   DC  I "C5'" 1 
ATOM   6907  C  "C4'" . DC  I 5 47  ? 116.373 159.936 144.480 1.00 69.63  ? 47   DC  I "C4'" 1 
ATOM   6908  O  "O4'" . DC  I 5 47  ? 114.977 159.558 144.382 1.00 69.63  ? 47   DC  I "O4'" 1 
ATOM   6909  C  "C3'" . DC  I 5 47  ? 116.573 161.057 143.455 1.00 69.63  ? 47   DC  I "C3'" 1 
ATOM   6910  O  "O3'" . DC  I 5 47  ? 117.160 160.502 142.307 1.00 69.63  ? 47   DC  I "O3'" 1 
ATOM   6911  C  "C2'" . DC  I 5 47  ? 115.139 161.496 143.167 1.00 69.63  ? 47   DC  I "C2'" 1 
ATOM   6912  C  "C1'" . DC  I 5 47  ? 114.460 160.152 143.224 1.00 69.63  ? 47   DC  I "C1'" 1 
ATOM   6913  N  N1    . DC  I 5 47  ? 112.978 160.175 143.297 1.00 69.63  ? 47   DC  I N1    1 
ATOM   6914  C  C2    . DC  I 5 47  ? 112.280 159.094 142.783 1.00 69.63  ? 47   DC  I C2    1 
ATOM   6915  O  O2    . DC  I 5 47  ? 112.922 158.158 142.305 1.00 69.63  ? 47   DC  I O2    1 
ATOM   6916  N  N3    . DC  I 5 47  ? 110.931 159.088 142.836 1.00 69.63  ? 47   DC  I N3    1 
ATOM   6917  C  C4    . DC  I 5 47  ? 110.286 160.119 143.364 1.00 69.63  ? 47   DC  I C4    1 
ATOM   6918  N  N4    . DC  I 5 47  ? 108.951 160.066 143.392 1.00 69.63  ? 47   DC  I N4    1 
ATOM   6919  C  C5    . DC  I 5 47  ? 110.980 161.247 143.889 1.00 69.63  ? 47   DC  I C5    1 
ATOM   6920  C  C6    . DC  I 5 47  ? 112.318 161.234 143.831 1.00 69.63  ? 47   DC  I C6    1 
ATOM   6921  P  P     . DT  I 5 48  ? 118.482 161.143 141.659 1.00 67.57  ? 48   DT  I P     1 
ATOM   6922  O  OP1   . DT  I 5 48  ? 119.598 160.942 142.608 1.00 67.57  ? 48   DT  I OP1   1 
ATOM   6923  O  OP2   . DT  I 5 48  ? 118.166 162.495 141.156 1.00 67.57  ? 48   DT  I OP2   1 
ATOM   6924  O  "O5'" . DT  I 5 48  ? 118.753 160.188 140.422 1.00 67.57  ? 48   DT  I "O5'" 1 
ATOM   6925  C  "C5'" . DT  I 5 48  ? 118.693 158.803 140.634 1.00 67.57  ? 48   DT  I "C5'" 1 
ATOM   6926  C  "C4'" . DT  I 5 48  ? 117.864 158.104 139.580 1.00 67.57  ? 48   DT  I "C4'" 1 
ATOM   6927  O  "O4'" . DT  I 5 48  ? 116.443 158.358 139.757 1.00 67.57  ? 48   DT  I "O4'" 1 
ATOM   6928  C  "C3'" . DT  I 5 48  ? 118.170 158.484 138.145 1.00 67.57  ? 48   DT  I "C3'" 1 
ATOM   6929  O  "O3'" . DT  I 5 48  ? 118.162 157.300 137.411 1.00 67.57  ? 48   DT  I "O3'" 1 
ATOM   6930  C  "C2'" . DT  I 5 48  ? 116.989 159.385 137.777 1.00 67.57  ? 48   DT  I "C2'" 1 
ATOM   6931  C  "C1'" . DT  I 5 48  ? 115.887 158.655 138.495 1.00 67.57  ? 48   DT  I "C1'" 1 
ATOM   6932  N  N1    . DT  I 5 48  ? 114.604 159.391 138.707 1.00 67.57  ? 48   DT  I N1    1 
ATOM   6933  C  C2    . DT  I 5 48  ? 113.422 158.738 138.461 1.00 67.57  ? 48   DT  I C2    1 
ATOM   6934  O  O2    . DT  I 5 48  ? 113.367 157.615 138.014 1.00 67.57  ? 48   DT  I O2    1 
ATOM   6935  N  N3    . DT  I 5 48  ? 112.299 159.457 138.724 1.00 67.57  ? 48   DT  I N3    1 
ATOM   6936  C  C4    . DT  I 5 48  ? 112.235 160.727 139.232 1.00 67.57  ? 48   DT  I C4    1 
ATOM   6937  O  O4    . DT  I 5 48  ? 111.172 161.287 139.443 1.00 67.57  ? 48   DT  I O4    1 
ATOM   6938  C  C5    . DT  I 5 48  ? 113.500 161.351 139.492 1.00 67.57  ? 48   DT  I C5    1 
ATOM   6939  C  C7    . DT  I 5 48  ? 113.541 162.740 140.040 1.00 67.57  ? 48   DT  I C7    1 
ATOM   6940  C  C6    . DT  I 5 48  ? 114.616 160.655 139.234 1.00 67.57  ? 48   DT  I C6    1 
ATOM   6941  P  P     . DA  I 5 49  ? 119.134 157.082 136.160 1.00 63.65  ? 49   DA  I P     1 
ATOM   6942  O  OP1   . DA  I 5 49  ? 120.229 156.175 136.571 1.00 63.65  ? 49   DA  I OP1   1 
ATOM   6943  O  OP2   . DA  I 5 49  ? 119.442 158.412 135.597 1.00 63.65  ? 49   DA  I OP2   1 
ATOM   6944  O  "O5'" . DA  I 5 49  ? 118.169 156.342 135.142 1.00 63.65  ? 49   DA  I "O5'" 1 
ATOM   6945  C  "C5'" . DA  I 5 49  ? 117.040 155.690 135.667 1.00 63.65  ? 49   DA  I "C5'" 1 
ATOM   6946  C  "C4'" . DA  I 5 49  ? 115.827 155.870 134.789 1.00 63.65  ? 49   DA  I "C4'" 1 
ATOM   6947  O  "O4'" . DA  I 5 49  ? 114.977 156.901 135.355 1.00 63.65  ? 49   DA  I "O4'" 1 
ATOM   6948  C  "C3'" . DA  I 5 49  ? 116.102 156.321 133.354 1.00 63.65  ? 49   DA  I "C3'" 1 
ATOM   6949  O  "O3'" . DA  I 5 49  ? 115.141 155.731 132.486 1.00 63.65  ? 49   DA  I "O3'" 1 
ATOM   6950  C  "C2'" . DA  I 5 49  ? 115.870 157.821 133.446 1.00 63.65  ? 49   DA  I "C2'" 1 
ATOM   6951  C  "C1'" . DA  I 5 49  ? 114.659 157.795 134.329 1.00 63.65  ? 49   DA  I "C1'" 1 
ATOM   6952  N  N9    . DA  I 5 49  ? 114.263 159.070 134.872 1.00 63.65  ? 49   DA  I N9    1 
ATOM   6953  C  C8    . DA  I 5 49  ? 115.052 160.145 135.097 1.00 63.65  ? 49   DA  I C8    1 
ATOM   6954  N  N7    . DA  I 5 49  ? 114.410 161.172 135.589 1.00 63.65  ? 49   DA  I N7    1 
ATOM   6955  C  C5    . DA  I 5 49  ? 113.101 160.746 135.634 1.00 63.65  ? 49   DA  I C5    1 
ATOM   6956  C  C6    . DA  I 5 49  ? 111.916 161.374 136.035 1.00 63.65  ? 49   DA  I C6    1 
ATOM   6957  N  N6    . DA  I 5 49  ? 111.869 162.623 136.499 1.00 63.65  ? 49   DA  I N6    1 
ATOM   6958  N  N1    . DA  I 5 49  ? 110.778 160.666 135.958 1.00 63.65  ? 49   DA  I N1    1 
ATOM   6959  C  C2    . DA  I 5 49  ? 110.831 159.416 135.505 1.00 63.65  ? 49   DA  I C2    1 
ATOM   6960  N  N3    . DA  I 5 49  ? 111.884 158.730 135.086 1.00 63.65  ? 49   DA  I N3    1 
ATOM   6961  C  C4    . DA  I 5 49  ? 112.995 159.458 135.182 1.00 63.65  ? 49   DA  I C4    1 
ATOM   6962  P  P     . DG  I 5 50  ? 115.502 154.410 131.656 1.00 57.36  ? 50   DG  I P     1 
ATOM   6963  O  OP1   . DG  I 5 50  ? 115.985 153.381 132.594 1.00 57.36  ? 50   DG  I OP1   1 
ATOM   6964  O  OP2   . DG  I 5 50  ? 116.323 154.837 130.511 1.00 57.36  ? 50   DG  I OP2   1 
ATOM   6965  O  "O5'" . DG  I 5 50  ? 114.111 153.927 131.064 1.00 57.36  ? 50   DG  I "O5'" 1 
ATOM   6966  C  "C5'" . DG  I 5 50  ? 113.036 153.625 131.918 1.00 57.36  ? 50   DG  I "C5'" 1 
ATOM   6967  C  "C4'" . DG  I 5 50  ? 111.737 154.208 131.389 1.00 57.36  ? 50   DG  I "C4'" 1 
ATOM   6968  O  "O4'" . DG  I 5 50  ? 111.534 155.518 131.952 1.00 57.36  ? 50   DG  I "O4'" 1 
ATOM   6969  C  "C3'" . DG  I 5 50  ? 111.643 154.394 129.879 1.00 57.36  ? 50   DG  I "C3'" 1 
ATOM   6970  O  "O3'" . DG  I 5 50  ? 110.327 154.163 129.473 1.00 57.36  ? 50   DG  I "O3'" 1 
ATOM   6971  C  "C2'" . DG  I 5 50  ? 111.991 155.859 129.720 1.00 57.36  ? 50   DG  I "C2'" 1 
ATOM   6972  C  "C1'" . DG  I 5 50  ? 111.266 156.422 130.913 1.00 57.36  ? 50   DG  I "C1'" 1 
ATOM   6973  N  N9    . DG  I 5 50  ? 111.749 157.725 131.337 1.00 57.36  ? 50   DG  I N9    1 
ATOM   6974  C  C8    . DG  I 5 50  ? 113.042 158.157 131.346 1.00 57.36  ? 50   DG  I C8    1 
ATOM   6975  N  N7    . DG  I 5 50  ? 113.180 159.364 131.803 1.00 57.36  ? 50   DG  I N7    1 
ATOM   6976  C  C5    . DG  I 5 50  ? 111.892 159.762 132.085 1.00 57.36  ? 50   DG  I C5    1 
ATOM   6977  C  C6    . DG  I 5 50  ? 111.418 160.978 132.592 1.00 57.36  ? 50   DG  I C6    1 
ATOM   6978  O  O6    . DG  I 5 50  ? 112.067 161.981 132.905 1.00 57.36  ? 50   DG  I O6    1 
ATOM   6979  N  N1    . DG  I 5 50  ? 110.043 160.966 132.730 1.00 57.36  ? 50   DG  I N1    1 
ATOM   6980  C  C2    . DG  I 5 50  ? 109.231 159.908 132.414 1.00 57.36  ? 50   DG  I C2    1 
ATOM   6981  N  N2    . DG  I 5 50  ? 107.925 160.077 132.612 1.00 57.36  ? 50   DG  I N2    1 
ATOM   6982  N  N3    . DG  I 5 50  ? 109.666 158.766 131.938 1.00 57.36  ? 50   DG  I N3    1 
ATOM   6983  C  C4    . DG  I 5 50  ? 111.001 158.763 131.805 1.00 57.36  ? 50   DG  I C4    1 
ATOM   6984  P  P     . DC  I 5 51  ? 110.010 153.673 127.985 1.00 62.78  ? 51   DC  I P     1 
ATOM   6985  O  OP1   . DC  I 5 51  ? 109.850 152.209 128.017 1.00 62.78  ? 51   DC  I OP1   1 
ATOM   6986  O  OP2   . DC  I 5 51  ? 110.991 154.271 127.068 1.00 62.78  ? 51   DC  I OP2   1 
ATOM   6987  O  "O5'" . DC  I 5 51  ? 108.600 154.332 127.673 1.00 62.78  ? 51   DC  I "O5'" 1 
ATOM   6988  C  "C5'" . DC  I 5 51  ? 107.686 154.522 128.720 1.00 62.78  ? 51   DC  I "C5'" 1 
ATOM   6989  C  "C4'" . DC  I 5 51  ? 106.930 155.823 128.551 1.00 62.78  ? 51   DC  I "C4'" 1 
ATOM   6990  O  "O4'" . DC  I 5 51  ? 107.707 156.918 129.086 1.00 62.78  ? 51   DC  I "O4'" 1 
ATOM   6991  C  "C3'" . DC  I 5 51  ? 106.587 156.210 127.115 1.00 62.78  ? 51   DC  I "C3'" 1 
ATOM   6992  O  "O3'" . DC  I 5 51  ? 105.237 156.640 127.070 1.00 62.78  ? 51   DC  I "O3'" 1 
ATOM   6993  C  "C2'" . DC  I 5 51  ? 107.550 157.354 126.827 1.00 62.78  ? 51   DC  I "C2'" 1 
ATOM   6994  C  "C1'" . DC  I 5 51  ? 107.633 157.992 128.195 1.00 62.78  ? 51   DC  I "C1'" 1 
ATOM   6995  N  N1    . DC  I 5 51  ? 108.816 158.859 128.412 1.00 62.78  ? 51   DC  I N1    1 
ATOM   6996  C  C2    . DC  I 5 51  ? 108.637 160.137 128.915 1.00 62.78  ? 51   DC  I C2    1 
ATOM   6997  O  O2    . DC  I 5 51  ? 107.485 160.548 129.078 1.00 62.78  ? 51   DC  I O2    1 
ATOM   6998  N  N3    . DC  I 5 51  ? 109.719 160.923 129.103 1.00 62.78  ? 51   DC  I N3    1 
ATOM   6999  C  C4    . DC  I 5 51  ? 110.931 160.440 128.881 1.00 62.78  ? 51   DC  I C4    1 
ATOM   7000  N  N4    . DC  I 5 51  ? 111.971 161.234 129.110 1.00 62.78  ? 51   DC  I N4    1 
ATOM   7001  C  C5    . DC  I 5 51  ? 111.134 159.123 128.411 1.00 62.78  ? 51   DC  I C5    1 
ATOM   7002  C  C6    . DC  I 5 51  ? 110.056 158.374 128.194 1.00 62.78  ? 51   DC  I C6    1 
ATOM   7003  P  P     . DA  I 5 52  ? 104.361 156.451 125.738 1.00 74.95  ? 52   DA  I P     1 
ATOM   7004  O  OP1   . DA  I 5 52  ? 103.271 155.502 126.044 1.00 74.95  ? 52   DA  I OP1   1 
ATOM   7005  O  OP2   . DA  I 5 52  ? 105.288 156.189 124.619 1.00 74.95  ? 52   DA  I OP2   1 
ATOM   7006  O  "O5'" . DA  I 5 52  ? 103.705 157.885 125.504 1.00 74.95  ? 52   DA  I "O5'" 1 
ATOM   7007  C  "C5'" . DA  I 5 52  ? 103.341 158.687 126.615 1.00 74.95  ? 52   DA  I "C5'" 1 
ATOM   7008  C  "C4'" . DA  I 5 52  ? 103.537 160.152 126.291 1.00 74.95  ? 52   DA  I "C4'" 1 
ATOM   7009  O  "O4'" . DA  I 5 52  ? 104.836 160.578 126.735 1.00 74.95  ? 52   DA  I "O4'" 1 
ATOM   7010  C  "C3'" . DA  I 5 52  ? 103.459 160.496 124.806 1.00 74.95  ? 52   DA  I "C3'" 1 
ATOM   7011  O  "O3'" . DA  I 5 52  ? 102.326 161.310 124.570 1.00 74.95  ? 52   DA  I "O3'" 1 
ATOM   7012  C  "C2'" . DA  I 5 52  ? 104.775 161.233 124.513 1.00 74.95  ? 52   DA  I "C2'" 1 
ATOM   7013  C  "C1'" . DA  I 5 52  ? 105.267 161.606 125.899 1.00 74.95  ? 52   DA  I "C1'" 1 
ATOM   7014  N  N9    . DA  I 5 52  ? 106.710 161.681 126.017 1.00 74.95  ? 52   DA  I N9    1 
ATOM   7015  C  C8    . DA  I 5 52  ? 107.600 160.673 125.829 1.00 74.95  ? 52   DA  I C8    1 
ATOM   7016  N  N7    . DA  I 5 52  ? 108.847 161.026 126.006 1.00 74.95  ? 52   DA  I N7    1 
ATOM   7017  C  C5    . DA  I 5 52  ? 108.761 162.355 126.346 1.00 74.95  ? 52   DA  I C5    1 
ATOM   7018  C  C6    . DA  I 5 52  ? 109.732 163.309 126.663 1.00 74.95  ? 52   DA  I C6    1 
ATOM   7019  N  N6    . DA  I 5 52  ? 111.033 163.040 126.688 1.00 74.95  ? 52   DA  I N6    1 
ATOM   7020  N  N1    . DA  I 5 52  ? 109.315 164.563 126.930 1.00 74.95  ? 52   DA  I N1    1 
ATOM   7021  C  C2    . DA  I 5 52  ? 108.008 164.830 126.881 1.00 74.95  ? 52   DA  I C2    1 
ATOM   7022  N  N3    . DA  I 5 52  ? 107.000 164.008 126.610 1.00 74.95  ? 52   DA  I N3    1 
ATOM   7023  C  C4    . DA  I 5 52  ? 107.449 162.775 126.359 1.00 74.95  ? 52   DA  I C4    1 
ATOM   7024  P  P     . DC  I 5 53  ? 101.919 161.726 123.075 1.00 77.10  ? 53   DC  I P     1 
ATOM   7025  O  OP1   . DC  I 5 53  ? 100.449 161.849 123.061 1.00 77.10  ? 53   DC  I OP1   1 
ATOM   7026  O  OP2   . DC  I 5 53  ? 102.605 160.855 122.100 1.00 77.10  ? 53   DC  I OP2   1 
ATOM   7027  O  "O5'" . DC  I 5 53  ? 102.503 163.192 122.928 1.00 77.10  ? 53   DC  I "O5'" 1 
ATOM   7028  C  "C5'" . DC  I 5 53  ? 102.337 164.100 123.983 1.00 77.10  ? 53   DC  I "C5'" 1 
ATOM   7029  C  "C4'" . DC  I 5 53  ? 103.083 165.384 123.704 1.00 77.10  ? 53   DC  I "C4'" 1 
ATOM   7030  O  "O4'" . DC  I 5 53  ? 104.456 165.254 124.125 1.00 77.10  ? 53   DC  I "O4'" 1 
ATOM   7031  C  "C3'" . DC  I 5 53  ? 103.124 165.799 122.239 1.00 77.10  ? 53   DC  I "C3'" 1 
ATOM   7032  O  "O3'" . DC  I 5 53  ? 102.728 167.127 122.141 1.00 77.10  ? 53   DC  I "O3'" 1 
ATOM   7033  C  "C2'" . DC  I 5 53  ? 104.589 165.612 121.846 1.00 77.10  ? 53   DC  I "C2'" 1 
ATOM   7034  C  "C1'" . DC  I 5 53  ? 105.288 165.842 123.168 1.00 77.10  ? 53   DC  I "C1'" 1 
ATOM   7035  N  N1    . DC  I 5 53  ? 106.600 165.194 123.266 1.00 77.10  ? 53   DC  I N1    1 
ATOM   7036  C  C2    . DC  I 5 53  ? 107.719 165.956 123.585 1.00 77.10  ? 53   DC  I C2    1 
ATOM   7037  O  O2    . DC  I 5 53  ? 107.584 167.167 123.763 1.00 77.10  ? 53   DC  I O2    1 
ATOM   7038  N  N3    . DC  I 5 53  ? 108.919 165.350 123.671 1.00 77.10  ? 53   DC  I N3    1 
ATOM   7039  C  C4    . DC  I 5 53  ? 109.016 164.043 123.466 1.00 77.10  ? 53   DC  I C4    1 
ATOM   7040  N  N4    . DC  I 5 53  ? 110.225 163.484 123.564 1.00 77.10  ? 53   DC  I N4    1 
ATOM   7041  C  C5    . DC  I 5 53  ? 107.883 163.250 123.131 1.00 77.10  ? 53   DC  I C5    1 
ATOM   7042  C  C6    . DC  I 5 53  ? 106.705 163.861 123.056 1.00 77.10  ? 53   DC  I C6    1 
ATOM   7043  P  P     . DC  I 5 54  ? 102.187 167.702 120.751 1.00 78.81  ? 54   DC  I P     1 
ATOM   7044  O  OP1   . DC  I 5 54  ? 100.876 168.340 120.986 1.00 78.81  ? 54   DC  I OP1   1 
ATOM   7045  O  OP2   . DC  I 5 54  ? 102.289 166.628 119.743 1.00 78.81  ? 54   DC  I OP2   1 
ATOM   7046  O  "O5'" . DC  I 5 54  ? 103.257 168.822 120.399 1.00 78.81  ? 54   DC  I "O5'" 1 
ATOM   7047  C  "C5'" . DC  I 5 54  ? 103.960 169.482 121.445 1.00 78.81  ? 54   DC  I "C5'" 1 
ATOM   7048  C  "C4'" . DC  I 5 54  ? 105.164 170.197 120.884 1.00 78.81  ? 54   DC  I "C4'" 1 
ATOM   7049  O  "O4'" . DC  I 5 54  ? 106.373 169.490 121.249 1.00 78.81  ? 54   DC  I "O4'" 1 
ATOM   7050  C  "C3'" . DC  I 5 54  ? 105.172 170.294 119.367 1.00 78.81  ? 54   DC  I "C3'" 1 
ATOM   7051  O  "O3'" . DC  I 5 54  ? 105.511 171.589 118.985 1.00 78.81  ? 54   DC  I "O3'" 1 
ATOM   7052  C  "C2'" . DC  I 5 54  ? 106.242 169.286 118.960 1.00 78.81  ? 54   DC  I "C2'" 1 
ATOM   7053  C  "C1'" . DC  I 5 54  ? 107.202 169.394 120.122 1.00 78.81  ? 54   DC  I "C1'" 1 
ATOM   7054  N  N1    . DC  I 5 54  ? 108.054 168.203 120.286 1.00 78.81  ? 54   DC  I N1    1 
ATOM   7055  C  C2    . DC  I 5 54  ? 109.417 168.346 120.538 1.00 78.81  ? 54   DC  I C2    1 
ATOM   7056  O  O2    . DC  I 5 54  ? 109.894 169.474 120.628 1.00 78.81  ? 54   DC  I O2    1 
ATOM   7057  N  N3    . DC  I 5 54  ? 110.172 167.242 120.694 1.00 78.81  ? 54   DC  I N3    1 
ATOM   7058  C  C4    . DC  I 5 54  ? 109.617 166.044 120.595 1.00 78.81  ? 54   DC  I C4    1 
ATOM   7059  N  N4    . DC  I 5 54  ? 110.399 164.978 120.748 1.00 78.81  ? 54   DC  I N4    1 
ATOM   7060  C  C5    . DC  I 5 54  ? 108.236 165.878 120.323 1.00 78.81  ? 54   DC  I C5    1 
ATOM   7061  C  C6    . DC  I 5 54  ? 107.499 166.974 120.187 1.00 78.81  ? 54   DC  I C6    1 
ATOM   7062  P  P     . DG  I 5 55  ? 104.979 172.181 117.594 1.00 81.33  ? 55   DG  I P     1 
ATOM   7063  O  OP1   . DG  I 5 55  ? 103.921 173.155 117.932 1.00 81.33  ? 55   DG  I OP1   1 
ATOM   7064  O  OP2   . DG  I 5 55  ? 104.641 171.056 116.691 1.00 81.33  ? 55   DG  I OP2   1 
ATOM   7065  O  "O5'" . DG  I 5 55  ? 106.263 172.943 117.010 1.00 81.33  ? 55   DG  I "O5'" 1 
ATOM   7066  C  "C5'" . DG  I 5 55  ? 107.065 173.741 117.882 1.00 81.33  ? 55   DG  I "C5'" 1 
ATOM   7067  C  "C4'" . DG  I 5 55  ? 108.518 173.769 117.438 1.00 81.33  ? 55   DG  I "C4'" 1 
ATOM   7068  O  "O4'" . DG  I 5 55  ? 109.223 172.579 117.879 1.00 81.33  ? 55   DG  I "O4'" 1 
ATOM   7069  C  "C3'" . DG  I 5 55  ? 108.746 173.866 115.937 1.00 81.33  ? 55   DG  I "C3'" 1 
ATOM   7070  O  "O3'" . DG  I 5 55  ? 109.781 174.795 115.707 1.00 81.33  ? 55   DG  I "O3'" 1 
ATOM   7071  C  "C2'" . DG  I 5 55  ? 109.175 172.444 115.567 1.00 81.33  ? 55   DG  I "C2'" 1 
ATOM   7072  C  "C1'" . DG  I 5 55  ? 109.964 172.052 116.801 1.00 81.33  ? 55   DG  I "C1'" 1 
ATOM   7073  N  N9    . DG  I 5 55  ? 110.073 170.616 117.007 1.00 81.33  ? 55   DG  I N9    1 
ATOM   7074  C  C8    . DG  I 5 55  ? 109.044 169.720 116.976 1.00 81.33  ? 55   DG  I C8    1 
ATOM   7075  N  N7    . DG  I 5 55  ? 109.407 168.499 117.218 1.00 81.33  ? 55   DG  I N7    1 
ATOM   7076  C  C5    . DG  I 5 55  ? 110.774 168.583 117.407 1.00 81.33  ? 55   DG  I C5    1 
ATOM   7077  C  C6    . DG  I 5 55  ? 111.703 167.566 117.677 1.00 81.33  ? 55   DG  I C6    1 
ATOM   7078  O  O6    . DG  I 5 55  ? 111.481 166.362 117.824 1.00 81.33  ? 55   DG  I O6    1 
ATOM   7079  N  N1    . DG  I 5 55  ? 112.991 168.056 117.785 1.00 81.33  ? 55   DG  I N1    1 
ATOM   7080  C  C2    . DG  I 5 55  ? 113.341 169.368 117.646 1.00 81.33  ? 55   DG  I C2    1 
ATOM   7081  N  N2    . DG  I 5 55  ? 114.638 169.643 117.795 1.00 81.33  ? 55   DG  I N2    1 
ATOM   7082  N  N3    . DG  I 5 55  ? 112.477 170.346 117.386 1.00 81.33  ? 55   DG  I N3    1 
ATOM   7083  C  C4    . DG  I 5 55  ? 111.212 169.876 117.273 1.00 81.33  ? 55   DG  I C4    1 
ATOM   7084  P  P     . DC  I 5 56  ? 109.985 175.465 114.267 1.00 82.94  ? 56   DC  I P     1 
ATOM   7085  O  OP1   . DC  I 5 56  ? 110.048 176.926 114.476 1.00 82.94  ? 56   DC  I OP1   1 
ATOM   7086  O  OP2   . DC  I 5 56  ? 108.994 174.892 113.332 1.00 82.94  ? 56   DC  I OP2   1 
ATOM   7087  O  "O5'" . DC  I 5 56  ? 111.435 174.962 113.841 1.00 82.94  ? 56   DC  I "O5'" 1 
ATOM   7088  C  "C5'" . DC  I 5 56  ? 112.494 174.978 114.791 1.00 82.94  ? 56   DC  I "C5'" 1 
ATOM   7089  C  "C4'" . DC  I 5 56  ? 113.668 174.159 114.300 1.00 82.94  ? 56   DC  I "C4'" 1 
ATOM   7090  O  "O4'" . DC  I 5 56  ? 113.540 172.779 114.734 1.00 82.94  ? 56   DC  I "O4'" 1 
ATOM   7091  C  "C3'" . DC  I 5 56  ? 113.820 174.122 112.789 1.00 82.94  ? 56   DC  I "C3'" 1 
ATOM   7092  O  "O3'" . DC  I 5 56  ? 115.174 174.238 112.452 1.00 82.94  ? 56   DC  I "O3'" 1 
ATOM   7093  C  "C2'" . DC  I 5 56  ? 113.282 172.744 112.430 1.00 82.94  ? 56   DC  I "C2'" 1 
ATOM   7094  C  "C1'" . DC  I 5 56  ? 113.723 171.935 113.626 1.00 82.94  ? 56   DC  I "C1'" 1 
ATOM   7095  N  N1    . DC  I 5 56  ? 112.943 170.673 113.835 1.00 82.94  ? 56   DC  I N1    1 
ATOM   7096  C  C2    . DC  I 5 56  ? 113.597 169.521 114.272 1.00 82.94  ? 56   DC  I C2    1 
ATOM   7097  O  O2    . DC  I 5 56  ? 114.817 169.556 114.443 1.00 82.94  ? 56   DC  I O2    1 
ATOM   7098  N  N3    . DC  I 5 56  ? 112.880 168.393 114.466 1.00 82.94  ? 56   DC  I N3    1 
ATOM   7099  C  C4    . DC  I 5 56  ? 111.567 168.395 114.253 1.00 82.94  ? 56   DC  I C4    1 
ATOM   7100  N  N4    . DC  I 5 56  ? 110.898 167.261 114.468 1.00 82.94  ? 56   DC  I N4    1 
ATOM   7101  C  C5    . DC  I 5 56  ? 110.877 169.564 113.833 1.00 82.94  ? 56   DC  I C5    1 
ATOM   7102  C  C6    . DC  I 5 56  ? 111.598 170.669 113.637 1.00 82.94  ? 56   DC  I C6    1 
ATOM   7103  P  P     . DT  I 5 57  ? 115.611 174.842 111.030 1.00 84.44  ? 57   DT  I P     1 
ATOM   7104  O  OP1   . DT  I 5 57  ? 115.933 176.269 111.246 1.00 84.44  ? 57   DT  I OP1   1 
ATOM   7105  O  OP2   . DT  I 5 57  ? 114.634 174.440 109.992 1.00 84.44  ? 57   DT  I OP2   1 
ATOM   7106  O  "O5'" . DT  I 5 57  ? 116.964 174.072 110.716 1.00 84.44  ? 57   DT  I "O5'" 1 
ATOM   7107  C  "C5'" . DT  I 5 57  ? 117.682 173.477 111.776 1.00 84.44  ? 57   DT  I "C5'" 1 
ATOM   7108  C  "C4'" . DT  I 5 57  ? 118.182 172.104 111.378 1.00 84.44  ? 57   DT  I "C4'" 1 
ATOM   7109  O  "O4'" . DT  I 5 57  ? 117.185 171.091 111.672 1.00 84.44  ? 57   DT  I "O4'" 1 
ATOM   7110  C  "C3'" . DT  I 5 57  ? 118.525 171.937 109.900 1.00 84.44  ? 57   DT  I "C3'" 1 
ATOM   7111  O  "O3'" . DT  I 5 57  ? 119.739 171.244 109.817 1.00 84.44  ? 57   DT  I "O3'" 1 
ATOM   7112  C  "C2'" . DT  I 5 57  ? 117.353 171.102 109.365 1.00 84.44  ? 57   DT  I "C2'" 1 
ATOM   7113  C  "C1'" . DT  I 5 57  ? 117.089 170.228 110.567 1.00 84.44  ? 57   DT  I "C1'" 1 
ATOM   7114  N  N1    . DT  I 5 57  ? 115.767 169.554 110.606 1.00 84.44  ? 57   DT  I N1    1 
ATOM   7115  C  C2    . DT  I 5 57  ? 115.708 168.281 111.094 1.00 84.44  ? 57   DT  I C2    1 
ATOM   7116  O  O2    . DT  I 5 57  ? 116.693 167.659 111.435 1.00 84.44  ? 57   DT  I O2    1 
ATOM   7117  N  N3    . DT  I 5 57  ? 114.468 167.736 111.131 1.00 84.44  ? 57   DT  I N3    1 
ATOM   7118  C  C4    . DT  I 5 57  ? 113.292 168.343 110.768 1.00 84.44  ? 57   DT  I C4    1 
ATOM   7119  O  O4    . DT  I 5 57  ? 112.215 167.775 110.841 1.00 84.44  ? 57   DT  I O4    1 
ATOM   7120  C  C5    . DT  I 5 57  ? 113.412 169.685 110.290 1.00 84.44  ? 57   DT  I C5    1 
ATOM   7121  C  C7    . DT  I 5 57  ? 112.187 170.427 109.860 1.00 84.44  ? 57   DT  I C7    1 
ATOM   7122  C  C6    . DT  I 5 57  ? 114.632 170.231 110.240 1.00 84.44  ? 57   DT  I C6    1 
ATOM   7123  P  P     . DT  I 5 58  ? 120.722 171.437 108.569 1.00 80.64  ? 58   DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5 58  ? 122.007 171.965 109.069 1.00 80.64  ? 58   DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5 58  ? 119.989 172.163 107.514 1.00 80.64  ? 58   DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5 58  ? 120.938 169.944 108.070 1.00 80.64  ? 58   DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5 58  ? 120.954 168.885 109.026 1.00 80.64  ? 58   DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5 58  ? 120.486 167.599 108.390 1.00 80.64  ? 58   DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5 58  ? 119.040 167.562 108.378 1.00 80.64  ? 58   DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5 58  ? 120.920 167.438 106.938 1.00 80.64  ? 58   DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5 58  ? 121.467 166.150 106.735 1.00 80.64  ? 58   DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5 58  ? 119.618 167.634 106.168 1.00 80.64  ? 58   DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5 58  ? 118.639 167.038 107.148 1.00 80.64  ? 58   DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5 58  ? 117.246 167.440 106.919 1.00 80.64  ? 58   DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5 58  ? 116.248 166.635 107.367 1.00 80.64  ? 58   DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5 58  ? 116.450 165.574 107.912 1.00 80.64  ? 58   DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5 58  ? 114.993 167.096 107.128 1.00 80.64  ? 58   DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5 58  ? 114.646 168.274 106.512 1.00 80.64  ? 58   DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5 58  ? 113.482 168.609 106.342 1.00 80.64  ? 58   DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5 58  ? 115.743 169.084 106.080 1.00 80.64  ? 58   DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5 58  ? 115.485 170.391 105.396 1.00 80.64  ? 58   DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5 58  ? 116.979 168.638 106.310 1.00 80.64  ? 58   DT  I C6    1 
ATOM   7143  P  P     . DA  I 5 59  ? 123.061 165.966 106.673 1.00 75.01  ? 59   DA  I P     1 
ATOM   7144  O  OP1   . DA  I 5 59  ? 123.650 166.728 107.794 1.00 75.01  ? 59   DA  I OP1   1 
ATOM   7145  O  OP2   . DA  I 5 59  ? 123.481 166.243 105.286 1.00 75.01  ? 59   DA  I OP2   1 
ATOM   7146  O  "O5'" . DA  I 5 59  ? 123.294 164.414 106.959 1.00 75.01  ? 59   DA  I "O5'" 1 
ATOM   7147  C  "C5'" . DA  I 5 59  ? 122.695 163.805 108.079 1.00 75.01  ? 59   DA  I "C5'" 1 
ATOM   7148  C  "C4'" . DA  I 5 59  ? 121.911 162.561 107.691 1.00 75.01  ? 59   DA  I "C4'" 1 
ATOM   7149  O  "O4'" . DA  I 5 59  ? 120.558 162.909 107.303 1.00 75.01  ? 59   DA  I "O4'" 1 
ATOM   7150  C  "C3'" . DA  I 5 59  ? 122.476 161.735 106.546 1.00 75.01  ? 59   DA  I "C3'" 1 
ATOM   7151  O  "O3'" . DA  I 5 59  ? 122.268 160.382 106.854 1.00 75.01  ? 59   DA  I "O3'" 1 
ATOM   7152  C  "C2'" . DA  I 5 59  ? 121.609 162.175 105.369 1.00 75.01  ? 59   DA  I "C2'" 1 
ATOM   7153  C  "C1'" . DA  I 5 59  ? 120.265 162.351 106.043 1.00 75.01  ? 59   DA  I "C1'" 1 
ATOM   7154  N  N9    . DA  I 5 59  ? 119.398 163.290 105.372 1.00 75.01  ? 59   DA  I N9    1 
ATOM   7155  C  C8    . DA  I 5 59  ? 119.779 164.397 104.697 1.00 75.01  ? 59   DA  I C8    1 
ATOM   7156  N  N7    . DA  I 5 59  ? 118.785 165.088 104.217 1.00 75.01  ? 59   DA  I N7    1 
ATOM   7157  C  C5    . DA  I 5 59  ? 117.677 164.393 104.623 1.00 75.01  ? 59   DA  I C5    1 
ATOM   7158  C  C6    . DA  I 5 59  ? 116.318 164.616 104.433 1.00 75.01  ? 59   DA  I C6    1 
ATOM   7159  N  N6    . DA  I 5 59  ? 115.845 165.654 103.759 1.00 75.01  ? 59   DA  I N6    1 
ATOM   7160  N  N1    . DA  I 5 59  ? 115.460 163.736 104.959 1.00 75.01  ? 59   DA  I N1    1 
ATOM   7161  C  C2    . DA  I 5 59  ? 115.941 162.699 105.638 1.00 75.01  ? 59   DA  I C2    1 
ATOM   7162  N  N3    . DA  I 5 59  ? 117.210 162.382 105.877 1.00 75.01  ? 59   DA  I N3    1 
ATOM   7163  C  C4    . DA  I 5 59  ? 118.032 163.281 105.338 1.00 75.01  ? 59   DA  I C4    1 
ATOM   7164  P  P     . DA  I 5 60  ? 123.069 159.205 106.116 1.00 72.39  ? 60   DA  I P     1 
ATOM   7165  O  OP1   . DA  I 5 60  ? 124.026 158.660 107.100 1.00 72.39  ? 60   DA  I OP1   1 
ATOM   7166  O  OP2   . DA  I 5 60  ? 123.575 159.669 104.809 1.00 72.39  ? 60   DA  I OP2   1 
ATOM   7167  O  "O5'" . DA  I 5 60  ? 121.920 158.124 105.878 1.00 72.39  ? 60   DA  I "O5'" 1 
ATOM   7168  C  "C5'" . DA  I 5 60  ? 120.980 157.894 106.915 1.00 72.39  ? 60   DA  I "C5'" 1 
ATOM   7169  C  "C4'" . DA  I 5 60  ? 119.590 157.623 106.371 1.00 72.39  ? 60   DA  I "C4'" 1 
ATOM   7170  O  "O4'" . DA  I 5 60  ? 119.058 158.810 105.740 1.00 72.39  ? 60   DA  I "O4'" 1 
ATOM   7171  C  "C3'" . DA  I 5 60  ? 119.484 156.516 105.332 1.00 72.39  ? 60   DA  I "C3'" 1 
ATOM   7172  O  "O3'" . DA  I 5 60  ? 118.313 155.748 105.613 1.00 72.39  ? 60   DA  I "O3'" 1 
ATOM   7173  C  "C2'" . DA  I 5 60  ? 119.358 157.303 104.030 1.00 72.39  ? 60   DA  I "C2'" 1 
ATOM   7174  C  "C1'" . DA  I 5 60  ? 118.501 158.453 104.501 1.00 72.39  ? 60   DA  I "C1'" 1 
ATOM   7175  N  N9    . DA  I 5 60  ? 118.528 159.638 103.661 1.00 72.39  ? 60   DA  I N9    1 
ATOM   7176  C  C8    . DA  I 5 60  ? 119.627 160.304 103.234 1.00 72.39  ? 60   DA  I C8    1 
ATOM   7177  N  N7    . DA  I 5 60  ? 119.357 161.370 102.530 1.00 72.39  ? 60   DA  I N7    1 
ATOM   7178  C  C5    . DA  I 5 60  ? 117.984 161.399 102.488 1.00 72.39  ? 60   DA  I C5    1 
ATOM   7179  C  C6    . DA  I 5 60  ? 117.080 162.281 101.884 1.00 72.39  ? 60   DA  I C6    1 
ATOM   7180  N  N6    . DA  I 5 60  ? 117.463 163.344 101.178 1.00 72.39  ? 60   DA  I N6    1 
ATOM   7181  N  N1    . DA  I 5 60  ? 115.766 162.029 102.026 1.00 72.39  ? 60   DA  I N1    1 
ATOM   7182  C  C2    . DA  I 5 60  ? 115.391 160.962 102.730 1.00 72.39  ? 60   DA  I C2    1 
ATOM   7183  N  N3    . DA  I 5 60  ? 116.154 160.065 103.348 1.00 72.39  ? 60   DA  I N3    1 
ATOM   7184  C  C4    . DA  I 5 60  ? 117.452 160.346 103.185 1.00 72.39  ? 60   DA  I C4    1 
ATOM   7185  P  P     . DA  I 5 61  ? 118.201 154.221 105.140 1.00 66.32  ? 61   DA  I P     1 
ATOM   7186  O  OP1   . DA  I 5 61  ? 118.252 153.403 106.363 1.00 66.32  ? 61   DA  I OP1   1 
ATOM   7187  O  OP2   . DA  I 5 61  ? 119.172 153.996 104.055 1.00 66.32  ? 61   DA  I OP2   1 
ATOM   7188  O  "O5'" . DA  I 5 61  ? 116.732 154.096 104.543 1.00 66.32  ? 61   DA  I "O5'" 1 
ATOM   7189  C  "C5'" . DA  I 5 61  ? 115.637 154.594 105.272 1.00 66.32  ? 61   DA  I "C5'" 1 
ATOM   7190  C  "C4'" . DA  I 5 61  ? 114.494 154.973 104.350 1.00 66.32  ? 61   DA  I "C4'" 1 
ATOM   7191  O  "O4'" . DA  I 5 61  ? 114.794 156.209 103.679 1.00 66.32  ? 61   DA  I "O4'" 1 
ATOM   7192  C  "C3'" . DA  I 5 61  ? 114.152 153.980 103.258 1.00 66.32  ? 61   DA  I "C3'" 1 
ATOM   7193  O  "O3'" . DA  I 5 61  ? 112.755 153.925 103.137 1.00 66.32  ? 61   DA  I "O3'" 1 
ATOM   7194  C  "C2'" . DA  I 5 61  ? 114.798 154.600 102.027 1.00 66.32  ? 61   DA  I "C2'" 1 
ATOM   7195  C  "C1'" . DA  I 5 61  ? 114.576 156.064 102.301 1.00 66.32  ? 61   DA  I "C1'" 1 
ATOM   7196  N  N9    . DA  I 5 61  ? 115.521 156.954 101.651 1.00 66.32  ? 61   DA  I N9    1 
ATOM   7197  C  C8    . DA  I 5 61  ? 116.870 156.911 101.751 1.00 66.32  ? 61   DA  I C8    1 
ATOM   7198  N  N7    . DA  I 5 61  ? 117.481 157.871 101.108 1.00 66.32  ? 61   DA  I N7    1 
ATOM   7199  C  C5    . DA  I 5 61  ? 116.455 158.582 100.534 1.00 66.32  ? 61   DA  I C5    1 
ATOM   7200  C  C6    . DA  I 5 61  ? 116.435 159.717 99.718  1.00 66.32  ? 61   DA  I C6    1 
ATOM   7201  N  N6    . DA  I 5 61  ? 117.537 160.346 99.321  1.00 66.32  ? 61   DA  I N6    1 
ATOM   7202  N  N1    . DA  I 5 61  ? 115.235 160.183 99.317  1.00 66.32  ? 61   DA  I N1    1 
ATOM   7203  C  C2    . DA  I 5 61  ? 114.142 159.542 99.717  1.00 66.32  ? 61   DA  I C2    1 
ATOM   7204  N  N3    . DA  I 5 61  ? 114.036 158.474 100.491 1.00 66.32  ? 61   DA  I N3    1 
ATOM   7205  C  C4    . DA  I 5 61  ? 115.239 158.043 100.873 1.00 66.32  ? 61   DA  I C4    1 
ATOM   7206  P  P     . DC  I 5 62  ? 112.041 152.726 102.351 1.00 69.60  ? 62   DC  I P     1 
ATOM   7207  O  OP1   . DC  I 5 62  ? 111.021 152.154 103.253 1.00 69.60  ? 62   DC  I OP1   1 
ATOM   7208  O  OP2   . DC  I 5 62  ? 113.067 151.858 101.740 1.00 69.60  ? 62   DC  I OP2   1 
ATOM   7209  O  "O5'" . DC  I 5 62  ? 111.284 153.467 101.166 1.00 69.60  ? 62   DC  I "O5'" 1 
ATOM   7210  C  "C5'" . DC  I 5 62  ? 110.848 154.805 101.328 1.00 69.60  ? 62   DC  I "C5'" 1 
ATOM   7211  C  "C4'" . DC  I 5 62  ? 110.533 155.418 99.980  1.00 69.60  ? 62   DC  I "C4'" 1 
ATOM   7212  O  "O4'" . DC  I 5 62  ? 111.651 156.204 99.523  1.00 69.60  ? 62   DC  I "O4'" 1 
ATOM   7213  C  "C3'" . DC  I 5 62  ? 110.237 154.410 98.880  1.00 69.60  ? 62   DC  I "C3'" 1 
ATOM   7214  O  "O3'" . DC  I 5 62  ? 109.077 154.821 98.180  1.00 69.60  ? 62   DC  I "O3'" 1 
ATOM   7215  C  "C2'" . DC  I 5 62  ? 111.502 154.454 98.014  1.00 69.60  ? 62   DC  I "C2'" 1 
ATOM   7216  C  "C1'" . DC  I 5 62  ? 111.927 155.898 98.182  1.00 69.60  ? 62   DC  I "C1'" 1 
ATOM   7217  N  N1    . DC  I 5 62  ? 113.369 156.148 98.003  1.00 69.60  ? 62   DC  I N1    1 
ATOM   7218  C  C2    . DC  I 5 62  ? 113.785 157.219 97.229  1.00 69.60  ? 62   DC  I C2    1 
ATOM   7219  O  O2    . DC  I 5 62  ? 112.937 157.898 96.652  1.00 69.60  ? 62   DC  I O2    1 
ATOM   7220  N  N3    . DC  I 5 62  ? 115.108 157.473 97.116  1.00 69.60  ? 62   DC  I N3    1 
ATOM   7221  C  C4    . DC  I 5 62  ? 115.985 156.715 97.759  1.00 69.60  ? 62   DC  I C4    1 
ATOM   7222  N  N4    . DC  I 5 62  ? 117.279 157.000 97.618  1.00 69.60  ? 62   DC  I N4    1 
ATOM   7223  C  C5    . DC  I 5 62  ? 115.577 155.628 98.569  1.00 69.60  ? 62   DC  I C5    1 
ATOM   7224  C  C6    . DC  I 5 62  ? 114.269 155.394 98.669  1.00 69.60  ? 62   DC  I C6    1 
ATOM   7225  P  P     . DG  I 5 63  ? 108.137 153.733 97.470  1.00 74.50  ? 63   DG  I P     1 
ATOM   7226  O  OP1   . DG  I 5 63  ? 106.819 153.814 98.129  1.00 74.50  ? 63   DG  I OP1   1 
ATOM   7227  O  OP2   . DG  I 5 63  ? 108.872 152.452 97.428  1.00 74.50  ? 63   DG  I OP2   1 
ATOM   7228  O  "O5'" . DG  I 5 63  ? 107.976 154.274 95.981  1.00 74.50  ? 63   DG  I "O5'" 1 
ATOM   7229  C  "C5'" . DG  I 5 63  ? 107.922 155.670 95.746  1.00 74.50  ? 63   DG  I "C5'" 1 
ATOM   7230  C  "C4'" . DG  I 5 63  ? 108.389 155.997 94.342  1.00 74.50  ? 63   DG  I "C4'" 1 
ATOM   7231  O  "O4'" . DG  I 5 63  ? 109.801 156.338 94.356  1.00 74.50  ? 63   DG  I "O4'" 1 
ATOM   7232  C  "C3'" . DG  I 5 63  ? 108.236 154.870 93.327  1.00 74.50  ? 63   DG  I "C3'" 1 
ATOM   7233  O  "O3'" . DG  I 5 63  ? 107.722 155.410 92.134  1.00 74.50  ? 63   DG  I "O3'" 1 
ATOM   7234  C  "C2'" . DG  I 5 63  ? 109.671 154.366 93.157  1.00 74.50  ? 63   DG  I "C2'" 1 
ATOM   7235  C  "C1'" . DG  I 5 63  ? 110.455 155.652 93.318  1.00 74.50  ? 63   DG  I "C1'" 1 
ATOM   7236  N  N9    . DG  I 5 63  ? 111.833 155.440 93.735  1.00 74.50  ? 63   DG  I N9    1 
ATOM   7237  C  C8    . DG  I 5 63  ? 112.269 154.536 94.653  1.00 74.50  ? 63   DG  I C8    1 
ATOM   7238  N  N7    . DG  I 5 63  ? 113.548 154.572 94.850  1.00 74.50  ? 63   DG  I N7    1 
ATOM   7239  C  C5    . DG  I 5 63  ? 113.993 155.562 94.001  1.00 74.50  ? 63   DG  I C5    1 
ATOM   7240  C  C6    . DG  I 5 63  ? 115.294 156.022 93.768  1.00 74.50  ? 63   DG  I C6    1 
ATOM   7241  O  O6    . DG  I 5 63  ? 116.335 155.645 94.300  1.00 74.50  ? 63   DG  I O6    1 
ATOM   7242  N  N1    . DG  I 5 63  ? 115.324 157.026 92.820  1.00 74.50  ? 63   DG  I N1    1 
ATOM   7243  C  C2    . DG  I 5 63  ? 114.229 157.514 92.167  1.00 74.50  ? 63   DG  I C2    1 
ATOM   7244  N  N2    . DG  I 5 63  ? 114.448 158.494 91.284  1.00 74.50  ? 63   DG  I N2    1 
ATOM   7245  N  N3    . DG  I 5 63  ? 112.994 157.084 92.375  1.00 74.50  ? 63   DG  I N3    1 
ATOM   7246  C  C4    . DG  I 5 63  ? 112.954 156.106 93.300  1.00 74.50  ? 63   DG  I C4    1 
ATOM   7247  P  P     . DC  I 5 64  ? 107.078 154.476 90.999  1.00 79.30  ? 64   DC  I P     1 
ATOM   7248  O  OP1   . DC  I 5 64  ? 105.679 154.916 90.802  1.00 79.30  ? 64   DC  I OP1   1 
ATOM   7249  O  OP2   . DC  I 5 64  ? 107.353 153.055 91.307  1.00 79.30  ? 64   DC  I OP2   1 
ATOM   7250  O  "O5'" . DC  I 5 64  ? 107.908 154.905 89.710  1.00 79.30  ? 64   DC  I "O5'" 1 
ATOM   7251  C  "C5'" . DC  I 5 64  ? 108.264 156.264 89.562  1.00 79.30  ? 64   DC  I "C5'" 1 
ATOM   7252  C  "C4'" . DC  I 5 64  ? 109.552 156.403 88.794  1.00 79.30  ? 64   DC  I "C4'" 1 
ATOM   7253  O  "O4'" . DC  I 5 64  ? 110.681 156.129 89.645  1.00 79.30  ? 64   DC  I "O4'" 1 
ATOM   7254  C  "C3'" . DC  I 5 64  ? 109.697 155.484 87.588  1.00 79.30  ? 64   DC  I "C3'" 1 
ATOM   7255  O  "O3'" . DC  I 5 64  ? 109.928 156.285 86.453  1.00 79.30  ? 64   DC  I "O3'" 1 
ATOM   7256  C  "C2'" . DC  I 5 64  ? 110.913 154.620 87.932  1.00 79.30  ? 64   DC  I "C2'" 1 
ATOM   7257  C  "C1'" . DC  I 5 64  ? 111.676 155.536 88.861  1.00 79.30  ? 64   DC  I "C1'" 1 
ATOM   7258  N  N1    . DC  I 5 64  ? 112.593 154.838 89.760  1.00 79.30  ? 64   DC  I N1    1 
ATOM   7259  C  C2    . DC  I 5 64  ? 113.949 155.175 89.789  1.00 79.30  ? 64   DC  I C2    1 
ATOM   7260  O  O2    . DC  I 5 64  ? 114.379 156.017 89.000  1.00 79.30  ? 64   DC  I O2    1 
ATOM   7261  N  N3    . DC  I 5 64  ? 114.764 154.513 90.640  1.00 79.30  ? 64   DC  I N3    1 
ATOM   7262  C  C4    . DC  I 5 64  ? 114.266 153.590 91.451  1.00 79.30  ? 64   DC  I C4    1 
ATOM   7263  N  N4    . DC  I 5 64  ? 115.093 152.979 92.294  1.00 79.30  ? 64   DC  I N4    1 
ATOM   7264  C  C5    . DC  I 5 64  ? 112.886 153.266 91.458  1.00 79.30  ? 64   DC  I C5    1 
ATOM   7265  C  C6    . DC  I 5 64  ? 112.097 153.908 90.604  1.00 79.30  ? 64   DC  I C6    1 
ATOM   7266  P  P     . DA  I 5 65  ? 109.711 155.713 84.973  1.00 75.71  ? 65   DA  I P     1 
ATOM   7267  O  OP1   . DA  I 5 65  ? 108.870 156.679 84.239  1.00 75.71  ? 65   DA  I OP1   1 
ATOM   7268  O  OP2   . DA  I 5 65  ? 109.297 154.300 85.070  1.00 75.71  ? 65   DA  I OP2   1 
ATOM   7269  O  "O5'" . DA  I 5 65  ? 111.179 155.778 84.359  1.00 75.71  ? 65   DA  I "O5'" 1 
ATOM   7270  C  "C5'" . DA  I 5 65  ? 111.928 156.984 84.459  1.00 75.71  ? 65   DA  I "C5'" 1 
ATOM   7271  C  "C4'" . DA  I 5 65  ? 113.387 156.758 84.099  1.00 75.71  ? 65   DA  I "C4'" 1 
ATOM   7272  O  "O4'" . DA  I 5 65  ? 114.146 156.295 85.249  1.00 75.71  ? 65   DA  I "O4'" 1 
ATOM   7273  C  "C3'" . DA  I 5 65  ? 113.611 155.739 82.990  1.00 75.71  ? 65   DA  I "C3'" 1 
ATOM   7274  O  "O3'" . DA  I 5 65  ? 114.589 156.222 82.098  1.00 75.71  ? 65   DA  I "O3'" 1 
ATOM   7275  C  "C2'" . DA  I 5 65  ? 114.106 154.510 83.756  1.00 75.71  ? 65   DA  I "C2'" 1 
ATOM   7276  C  "C1'" . DA  I 5 65  ? 114.882 155.149 84.891  1.00 75.71  ? 65   DA  I "C1'" 1 
ATOM   7277  N  N9    . DA  I 5 65  ? 115.008 154.309 86.072  1.00 75.71  ? 65   DA  I N9    1 
ATOM   7278  C  C8    . DA  I 5 65  ? 114.008 153.646 86.701  1.00 75.71  ? 65   DA  I C8    1 
ATOM   7279  N  N7    . DA  I 5 65  ? 114.398 152.956 87.735  1.00 75.71  ? 65   DA  I N7    1 
ATOM   7280  C  C5    . DA  I 5 65  ? 115.754 153.181 87.793  1.00 75.71  ? 65   DA  I C5    1 
ATOM   7281  C  C6    . DA  I 5 65  ? 116.747 152.726 88.669  1.00 75.71  ? 65   DA  I C6    1 
ATOM   7282  N  N6    . DA  I 5 65  ? 116.492 151.931 89.698  1.00 75.71  ? 65   DA  I N6    1 
ATOM   7283  N  N1    . DA  I 5 65  ? 118.011 153.118 88.449  1.00 75.71  ? 65   DA  I N1    1 
ATOM   7284  C  C2    . DA  I 5 65  ? 118.264 153.914 87.409  1.00 75.71  ? 65   DA  I C2    1 
ATOM   7285  N  N3    . DA  I 5 65  ? 117.408 154.410 86.514  1.00 75.71  ? 65   DA  I N3    1 
ATOM   7286  C  C4    . DA  I 5 65  ? 116.157 153.999 86.767  1.00 75.71  ? 65   DA  I C4    1 
ATOM   7287  P  P     . DC  I 5 66  ? 114.740 155.597 80.627  1.00 76.83  ? 66   DC  I P     1 
ATOM   7288  O  OP1   . DC  I 5 66  ? 114.734 156.707 79.656  1.00 76.83  ? 66   DC  I OP1   1 
ATOM   7289  O  OP2   . DC  I 5 66  ? 113.786 154.480 80.467  1.00 76.83  ? 66   DC  I OP2   1 
ATOM   7290  O  "O5'" . DC  I 5 66  ? 116.201 154.986 80.667  1.00 76.83  ? 66   DC  I "O5'" 1 
ATOM   7291  C  "C5'" . DC  I 5 66  ? 117.228 155.696 81.332  1.00 76.83  ? 66   DC  I "C5'" 1 
ATOM   7292  C  "C4'" . DC  I 5 66  ? 118.415 154.798 81.576  1.00 76.83  ? 66   DC  I "C4'" 1 
ATOM   7293  O  "O4'" . DC  I 5 66  ? 118.275 154.118 82.848  1.00 76.83  ? 66   DC  I "O4'" 1 
ATOM   7294  C  "C3'" . DC  I 5 66  ? 118.602 153.715 80.528  1.00 76.83  ? 66   DC  I "C3'" 1 
ATOM   7295  O  "O3'" . DC  I 5 66  ? 119.966 153.642 80.182  1.00 76.83  ? 66   DC  I "O3'" 1 
ATOM   7296  C  "C2'" . DC  I 5 66  ? 118.123 152.449 81.249  1.00 76.83  ? 66   DC  I "C2'" 1 
ATOM   7297  C  "C1'" . DC  I 5 66  ? 118.546 152.751 82.670  1.00 76.83  ? 66   DC  I "C1'" 1 
ATOM   7298  N  N1    . DC  I 5 66  ? 117.813 151.994 83.722  1.00 76.83  ? 66   DC  I N1    1 
ATOM   7299  C  C2    . DC  I 5 66  ? 118.514 151.484 84.813  1.00 76.83  ? 66   DC  I C2    1 
ATOM   7300  O  O2    . DC  I 5 66  ? 119.736 151.634 84.855  1.00 76.83  ? 66   DC  I O2    1 
ATOM   7301  N  N3    . DC  I 5 66  ? 117.840 150.820 85.775  1.00 76.83  ? 66   DC  I N3    1 
ATOM   7302  C  C4    . DC  I 5 66  ? 116.524 150.681 85.683  1.00 76.83  ? 66   DC  I C4    1 
ATOM   7303  N  N4    . DC  I 5 66  ? 115.897 150.024 86.656  1.00 76.83  ? 66   DC  I N4    1 
ATOM   7304  C  C5    . DC  I 5 66  ? 115.788 151.212 84.591  1.00 76.83  ? 66   DC  I C5    1 
ATOM   7305  C  C6    . DC  I 5 66  ? 116.468 151.857 83.643  1.00 76.83  ? 66   DC  I C6    1 
ATOM   7306  P  P     . DG  I 5 67  ? 120.402 153.112 78.734  1.00 76.04  ? 67   DG  I P     1 
ATOM   7307  O  OP1   . DG  I 5 67  ? 121.023 154.249 78.021  1.00 76.04  ? 67   DG  I OP1   1 
ATOM   7308  O  OP2   . DG  I 5 67  ? 119.250 152.406 78.136  1.00 76.04  ? 67   DG  I OP2   1 
ATOM   7309  O  "O5'" . DG  I 5 67  ? 121.537 152.045 79.052  1.00 76.04  ? 67   DG  I "O5'" 1 
ATOM   7310  C  "C5'" . DG  I 5 67  ? 122.427 152.269 80.122  1.00 76.04  ? 67   DG  I "C5'" 1 
ATOM   7311  C  "C4'" . DG  I 5 67  ? 122.813 150.968 80.788  1.00 76.04  ? 67   DG  I "C4'" 1 
ATOM   7312  O  "O4'" . DG  I 5 67  ? 121.771 150.567 81.703  1.00 76.04  ? 67   DG  I "O4'" 1 
ATOM   7313  C  "C3'" . DG  I 5 67  ? 123.015 149.782 79.843  1.00 76.04  ? 67   DG  I "C3'" 1 
ATOM   7314  O  "O3'" . DG  I 5 67  ? 124.128 149.019 80.274  1.00 76.04  ? 67   DG  I "O3'" 1 
ATOM   7315  C  "C2'" . DG  I 5 67  ? 121.725 149.002 80.036  1.00 76.04  ? 67   DG  I "C2'" 1 
ATOM   7316  C  "C1'" . DG  I 5 67  ? 121.521 149.203 81.513  1.00 76.04  ? 67   DG  I "C1'" 1 
ATOM   7317  N  N9    . DG  I 5 67  ? 120.171 148.913 81.980  1.00 76.04  ? 67   DG  I N9    1 
ATOM   7318  C  C8    . DG  I 5 67  ? 118.990 149.119 81.313  1.00 76.04  ? 67   DG  I C8    1 
ATOM   7319  N  N7    . DG  I 5 67  ? 117.939 148.786 82.007  1.00 76.04  ? 67   DG  I N7    1 
ATOM   7320  C  C5    . DG  I 5 67  ? 118.460 148.333 83.205  1.00 76.04  ? 67   DG  I C5    1 
ATOM   7321  C  C6    . DG  I 5 67  ? 117.809 147.841 84.347  1.00 76.04  ? 67   DG  I C6    1 
ATOM   7322  O  O6    . DG  I 5 67  ? 116.597 147.696 84.537  1.00 76.04  ? 67   DG  I O6    1 
ATOM   7323  N  N1    . DG  I 5 67  ? 118.714 147.494 85.342  1.00 76.04  ? 67   DG  I N1    1 
ATOM   7324  C  C2    . DG  I 5 67  ? 120.076 147.610 85.238  1.00 76.04  ? 67   DG  I C2    1 
ATOM   7325  N  N2    . DG  I 5 67  ? 120.792 147.225 86.295  1.00 76.04  ? 67   DG  I N2    1 
ATOM   7326  N  N3    . DG  I 5 67  ? 120.696 148.066 84.173  1.00 76.04  ? 67   DG  I N3    1 
ATOM   7327  C  C4    . DG  I 5 67  ? 119.830 148.407 83.201  1.00 76.04  ? 67   DG  I C4    1 
ATOM   7328  P  P     . DT  I 5 68  ? 125.425 148.843 79.343  1.00 75.58  ? 68   DT  I P     1 
ATOM   7329  O  OP1   . DT  I 5 68  ? 126.115 150.137 79.200  1.00 75.58  ? 68   DT  I OP1   1 
ATOM   7330  O  OP2   . DT  I 5 68  ? 125.007 148.101 78.141  1.00 75.58  ? 68   DT  I OP2   1 
ATOM   7331  O  "O5'" . DT  I 5 68  ? 126.345 147.858 80.188  1.00 75.58  ? 68   DT  I "O5'" 1 
ATOM   7332  C  "C5'" . DT  I 5 68  ? 126.471 148.037 81.593  1.00 75.58  ? 68   DT  I "C5'" 1 
ATOM   7333  C  "C4'" . DT  I 5 68  ? 126.214 146.736 82.339  1.00 75.58  ? 68   DT  I "C4'" 1 
ATOM   7334  O  "O4'" . DT  I 5 68  ? 124.786 146.526 82.507  1.00 75.58  ? 68   DT  I "O4'" 1 
ATOM   7335  C  "C3'" . DT  I 5 68  ? 126.736 145.471 81.668  1.00 75.58  ? 68   DT  I "C3'" 1 
ATOM   7336  O  "O3'" . DT  I 5 68  ? 127.246 144.593 82.672  1.00 75.58  ? 68   DT  I "O3'" 1 
ATOM   7337  C  "C2'" . DT  I 5 68  ? 125.471 144.905 81.023  1.00 75.58  ? 68   DT  I "C2'" 1 
ATOM   7338  C  "C1'" . DT  I 5 68  ? 124.470 145.211 82.110  1.00 75.58  ? 68   DT  I "C1'" 1 
ATOM   7339  N  N1    . DT  I 5 68  ? 123.020 145.174 81.693  1.00 75.58  ? 68   DT  I N1    1 
ATOM   7340  C  C2    . DT  I 5 68  ? 122.071 144.883 82.636  1.00 75.58  ? 68   DT  I C2    1 
ATOM   7341  O  O2    . DT  I 5 68  ? 122.342 144.617 83.785  1.00 75.58  ? 68   DT  I O2    1 
ATOM   7342  N  N3    . DT  I 5 68  ? 120.787 144.896 82.186  1.00 75.58  ? 68   DT  I N3    1 
ATOM   7343  C  C4    . DT  I 5 68  ? 120.354 145.173 80.919  1.00 75.58  ? 68   DT  I C4    1 
ATOM   7344  O  O4    . DT  I 5 68  ? 119.174 145.158 80.615  1.00 75.58  ? 68   DT  I O4    1 
ATOM   7345  C  C5    . DT  I 5 68  ? 121.383 145.482 79.973  1.00 75.58  ? 68   DT  I C5    1 
ATOM   7346  C  C7    . DT  I 5 68  ? 121.015 145.792 78.553  1.00 75.58  ? 68   DT  I C7    1 
ATOM   7347  C  C6    . DT  I 5 68  ? 122.660 145.478 80.400  1.00 75.58  ? 68   DT  I C6    1 
ATOM   7348  P  P     . DA  I 5 69  ? 128.822 144.522 82.995  1.00 71.92  ? 69   DA  I P     1 
ATOM   7349  O  OP1   . DA  I 5 69  ? 129.279 145.858 83.410  1.00 71.92  ? 69   DA  I OP1   1 
ATOM   7350  O  OP2   . DA  I 5 69  ? 129.510 143.876 81.864  1.00 71.92  ? 69   DA  I OP2   1 
ATOM   7351  O  "O5'" . DA  I 5 69  ? 128.907 143.521 84.240  1.00 71.92  ? 69   DA  I "O5'" 1 
ATOM   7352  C  "C5'" . DA  I 5 69  ? 127.919 143.586 85.267  1.00 71.92  ? 69   DA  I "C5'" 1 
ATOM   7353  C  "C4'" . DA  I 5 69  ? 127.199 142.260 85.459  1.00 71.92  ? 69   DA  I "C4'" 1 
ATOM   7354  O  "O4'" . DA  I 5 69  ? 125.941 142.261 84.738  1.00 71.92  ? 69   DA  I "O4'" 1 
ATOM   7355  C  "C3'" . DA  I 5 69  ? 127.948 141.020 84.984  1.00 71.92  ? 69   DA  I "C3'" 1 
ATOM   7356  O  "O3'" . DA  I 5 69  ? 127.656 139.943 85.837  1.00 71.92  ? 69   DA  I "O3'" 1 
ATOM   7357  C  "C2'" . DA  I 5 69  ? 127.296 140.780 83.633  1.00 71.92  ? 69   DA  I "C2'" 1 
ATOM   7358  C  "C1'" . DA  I 5 69  ? 125.859 141.074 83.999  1.00 71.92  ? 69   DA  I "C1'" 1 
ATOM   7359  N  N9    . DA  I 5 69  ? 125.010 141.326 82.860  1.00 71.92  ? 69   DA  I N9    1 
ATOM   7360  C  C8    . DA  I 5 69  ? 125.419 141.548 81.592  1.00 71.92  ? 69   DA  I C8    1 
ATOM   7361  N  N7    . DA  I 5 69  ? 124.447 141.756 80.754  1.00 71.92  ? 69   DA  I N7    1 
ATOM   7362  C  C5    . DA  I 5 69  ? 123.316 141.624 81.523  1.00 71.92  ? 69   DA  I C5    1 
ATOM   7363  C  C6    . DA  I 5 69  ? 121.958 141.714 81.211  1.00 71.92  ? 69   DA  I C6    1 
ATOM   7364  N  N6    . DA  I 5 69  ? 121.517 141.978 79.987  1.00 71.92  ? 69   DA  I N6    1 
ATOM   7365  N  N1    . DA  I 5 69  ? 121.070 141.527 82.198  1.00 71.92  ? 69   DA  I N1    1 
ATOM   7366  C  C2    . DA  I 5 69  ? 121.524 141.258 83.423  1.00 71.92  ? 69   DA  I C2    1 
ATOM   7367  N  N3    . DA  I 5 69  ? 122.788 141.153 83.837  1.00 71.92  ? 69   DA  I N3    1 
ATOM   7368  C  C4    . DA  I 5 69  ? 123.640 141.349 82.824  1.00 71.92  ? 69   DA  I C4    1 
ATOM   7369  P  P     . DC  I 5 70  ? 128.517 139.626 87.152  1.00 68.84  ? 70   DC  I P     1 
ATOM   7370  O  OP1   . DC  I 5 70  ? 128.872 140.869 87.857  1.00 68.84  ? 70   DC  I OP1   1 
ATOM   7371  O  OP2   . DC  I 5 70  ? 129.575 138.660 86.797  1.00 68.84  ? 70   DC  I OP2   1 
ATOM   7372  O  "O5'" . DC  I 5 70  ? 127.457 138.852 88.041  1.00 68.84  ? 70   DC  I "O5'" 1 
ATOM   7373  C  "C5'" . DC  I 5 70  ? 126.190 139.438 88.260  1.00 68.84  ? 70   DC  I "C5'" 1 
ATOM   7374  C  "C4'" . DC  I 5 70  ? 125.071 138.442 88.013  1.00 68.84  ? 70   DC  I "C4'" 1 
ATOM   7375  O  "O4'" . DC  I 5 70  ? 124.571 138.565 86.654  1.00 68.84  ? 70   DC  I "O4'" 1 
ATOM   7376  C  "C3'" . DC  I 5 70  ? 125.441 136.974 88.177  1.00 68.84  ? 70   DC  I "C3'" 1 
ATOM   7377  O  "O3'" . DC  I 5 70  ? 124.370 136.316 88.759  1.00 68.84  ? 70   DC  I "O3'" 1 
ATOM   7378  C  "C2'" . DC  I 5 70  ? 125.617 136.520 86.741  1.00 68.84  ? 70   DC  I "C2'" 1 
ATOM   7379  C  "C1'" . DC  I 5 70  ? 124.489 137.280 86.094  1.00 68.84  ? 70   DC  I "C1'" 1 
ATOM   7380  N  N1    . DC  I 5 70  ? 124.605 137.394 84.646  1.00 68.84  ? 70   DC  I N1    1 
ATOM   7381  C  C2    . DC  I 5 70  ? 123.453 137.434 83.871  1.00 68.84  ? 70   DC  I C2    1 
ATOM   7382  O  O2    . DC  I 5 70  ? 122.359 137.356 84.422  1.00 68.84  ? 70   DC  I O2    1 
ATOM   7383  N  N3    . DC  I 5 70  ? 123.570 137.550 82.538  1.00 68.84  ? 70   DC  I N3    1 
ATOM   7384  C  C4    . DC  I 5 70  ? 124.773 137.628 81.983  1.00 68.84  ? 70   DC  I C4    1 
ATOM   7385  N  N4    . DC  I 5 70  ? 124.840 137.743 80.657  1.00 68.84  ? 70   DC  I N4    1 
ATOM   7386  C  C5    . DC  I 5 70  ? 125.963 137.587 82.758  1.00 68.84  ? 70   DC  I C5    1 
ATOM   7387  C  C6    . DC  I 5 70  ? 125.832 137.471 84.075  1.00 68.84  ? 70   DC  I C6    1 
ATOM   7388  P  P     . DG  I 5 71  ? 124.600 135.092 89.758  1.00 70.53  ? 71   DG  I P     1 
ATOM   7389  O  OP1   . DG  I 5 71  ? 124.779 135.633 91.120  1.00 70.53  ? 71   DG  I OP1   1 
ATOM   7390  O  OP2   . DG  I 5 71  ? 125.629 134.218 89.169  1.00 70.53  ? 71   DG  I OP2   1 
ATOM   7391  O  "O5'" . DG  I 5 71  ? 123.217 134.319 89.660  1.00 70.53  ? 71   DG  I "O5'" 1 
ATOM   7392  C  "C5'" . DG  I 5 71  ? 122.014 135.040 89.840  1.00 70.53  ? 71   DG  I "C5'" 1 
ATOM   7393  C  "C4'" . DG  I 5 71  ? 120.922 134.503 88.945  1.00 70.53  ? 71   DG  I "C4'" 1 
ATOM   7394  O  "O4'" . DG  I 5 71  ? 121.254 134.796 87.578  1.00 70.53  ? 71   DG  I "O4'" 1 
ATOM   7395  C  "C3'" . DG  I 5 71  ? 120.687 133.006 89.012  1.00 70.53  ? 71   DG  I "C3'" 1 
ATOM   7396  O  "O3'" . DG  I 5 71  ? 119.286 132.756 88.971  1.00 70.53  ? 71   DG  I "O3'" 1 
ATOM   7397  C  "C2'" . DG  I 5 71  ? 121.401 132.483 87.773  1.00 70.53  ? 71   DG  I "C2'" 1 
ATOM   7398  C  "C1'" . DG  I 5 71  ? 121.190 133.625 86.806  1.00 70.53  ? 71   DG  I "C1'" 1 
ATOM   7399  N  N9    . DG  I 5 71  ? 122.217 133.749 85.782  1.00 70.53  ? 71   DG  I N9    1 
ATOM   7400  C  C8    . DG  I 5 71  ? 123.572 133.806 85.972  1.00 70.53  ? 71   DG  I C8    1 
ATOM   7401  N  N7    . DG  I 5 71  ? 124.245 133.966 84.868  1.00 70.53  ? 71   DG  I N7    1 
ATOM   7402  C  C5    . DG  I 5 71  ? 123.272 134.020 83.892  1.00 70.53  ? 71   DG  I C5    1 
ATOM   7403  C  C6    . DG  I 5 71  ? 123.398 134.176 82.506  1.00 70.53  ? 71   DG  I C6    1 
ATOM   7404  O  O6    . DG  I 5 71  ? 124.433 134.303 81.839  1.00 70.53  ? 71   DG  I O6    1 
ATOM   7405  N  N1    . DG  I 5 71  ? 122.159 134.177 81.881  1.00 70.53  ? 71   DG  I N1    1 
ATOM   7406  C  C2    . DG  I 5 71  ? 120.954 134.029 82.524  1.00 70.53  ? 71   DG  I C2    1 
ATOM   7407  N  N2    . DG  I 5 71  ? 119.858 134.064 81.761  1.00 70.53  ? 71   DG  I N2    1 
ATOM   7408  N  N3    . DG  I 5 71  ? 120.826 133.898 83.823  1.00 70.53  ? 71   DG  I N3    1 
ATOM   7409  C  C4    . DG  I 5 71  ? 122.020 133.895 84.440  1.00 70.53  ? 71   DG  I C4    1 
ATOM   7410  P  P     . DC  I 5 72  ? 118.696 131.355 89.483  1.00 77.96  ? 72   DC  I P     1 
ATOM   7411  O  OP1   . DC  I 5 72  ? 117.514 131.667 90.309  1.00 77.96  ? 72   DC  I OP1   1 
ATOM   7412  O  OP2   . DC  I 5 72  ? 119.813 130.549 90.016  1.00 77.96  ? 72   DC  I OP2   1 
ATOM   7413  O  "O5'" . DC  I 5 72  ? 118.156 130.632 88.173  1.00 77.96  ? 72   DC  I "O5'" 1 
ATOM   7414  C  "C5'" . DC  I 5 72  ? 117.535 131.378 87.147  1.00 77.96  ? 72   DC  I "C5'" 1 
ATOM   7415  C  "C4'" . DC  I 5 72  ? 117.579 130.605 85.847  1.00 77.96  ? 72   DC  I "C4'" 1 
ATOM   7416  O  "O4'" . DC  I 5 72  ? 118.770 130.935 85.108  1.00 77.96  ? 72   DC  I "O4'" 1 
ATOM   7417  C  "C3'" . DC  I 5 72  ? 117.586 129.087 86.000  1.00 77.96  ? 72   DC  I "C3'" 1 
ATOM   7418  O  "O3'" . DC  I 5 72  ? 116.567 128.548 85.177  1.00 77.96  ? 72   DC  I "O3'" 1 
ATOM   7419  C  "C2'" . DC  I 5 72  ? 118.991 128.693 85.521  1.00 77.96  ? 72   DC  I "C2'" 1 
ATOM   7420  C  "C1'" . DC  I 5 72  ? 119.250 129.773 84.499  1.00 77.96  ? 72   DC  I "C1'" 1 
ATOM   7421  N  N1    . DC  I 5 72  ? 120.665 130.002 84.197  1.00 77.96  ? 72   DC  I N1    1 
ATOM   7422  C  C2    . DC  I 5 72  ? 121.050 130.206 82.880  1.00 77.96  ? 72   DC  I C2    1 
ATOM   7423  O  O2    . DC  I 5 72  ? 120.191 130.138 81.996  1.00 77.96  ? 72   DC  I O2    1 
ATOM   7424  N  N3    . DC  I 5 72  ? 122.352 130.452 82.606  1.00 77.96  ? 72   DC  I N3    1 
ATOM   7425  C  C4    . DC  I 5 72  ? 123.239 130.515 83.596  1.00 77.96  ? 72   DC  I C4    1 
ATOM   7426  N  N4    . DC  I 5 72  ? 124.513 130.763 83.283  1.00 77.96  ? 72   DC  I N4    1 
ATOM   7427  C  C5    . DC  I 5 72  ? 122.858 130.322 84.952  1.00 77.96  ? 72   DC  I C5    1 
ATOM   7428  C  C6    . DC  I 5 72  ? 121.571 130.070 85.201  1.00 77.96  ? 72   DC  I C6    1 
ATOM   7429  P  P     . DG  I 5 73  ? 115.880 127.137 85.514  1.00 82.92  ? 73   DG  I P     1 
ATOM   7430  O  OP1   . DG  I 5 73  ? 114.550 127.418 86.102  1.00 82.92  ? 73   DG  I OP1   1 
ATOM   7431  O  OP2   . DG  I 5 73  ? 116.843 126.315 86.278  1.00 82.92  ? 73   DG  I OP2   1 
ATOM   7432  O  "O5'" . DG  I 5 73  ? 115.673 126.489 84.063  1.00 82.92  ? 73   DG  I "O5'" 1 
ATOM   7433  C  "C5'" . DG  I 5 73  ? 115.274 127.320 82.977  1.00 82.92  ? 73   DG  I "C5'" 1 
ATOM   7434  C  "C4'" . DG  I 5 73  ? 115.956 126.920 81.686  1.00 82.92  ? 73   DG  I "C4'" 1 
ATOM   7435  O  "O4'" . DG  I 5 73  ? 117.288 127.481 81.612  1.00 82.92  ? 73   DG  I "O4'" 1 
ATOM   7436  C  "C3'" . DG  I 5 73  ? 116.103 125.420 81.476  1.00 82.92  ? 73   DG  I "C3'" 1 
ATOM   7437  O  "O3'" . DG  I 5 73  ? 115.521 125.076 80.250  1.00 82.92  ? 73   DG  I "O3'" 1 
ATOM   7438  C  "C2'" . DG  I 5 73  ? 117.615 125.198 81.465  1.00 82.92  ? 73   DG  I "C2'" 1 
ATOM   7439  C  "C1'" . DG  I 5 73  ? 118.139 126.544 81.009  1.00 82.92  ? 73   DG  I "C1'" 1 
ATOM   7440  N  N9    . DG  I 5 73  ? 119.508 126.802 81.452  1.00 82.92  ? 73   DG  I N9    1 
ATOM   7441  C  C8    . DG  I 5 73  ? 119.956 126.789 82.744  1.00 82.92  ? 73   DG  I C8    1 
ATOM   7442  N  N7    . DG  I 5 73  ? 121.224 127.035 82.864  1.00 82.92  ? 73   DG  I N7    1 
ATOM   7443  C  C5    . DG  I 5 73  ? 121.659 127.200 81.567  1.00 82.92  ? 73   DG  I C5    1 
ATOM   7444  C  C6    . DG  I 5 73  ? 122.947 127.481 81.087  1.00 82.92  ? 73   DG  I C6    1 
ATOM   7445  O  O6    . DG  I 5 73  ? 123.982 127.643 81.740  1.00 82.92  ? 73   DG  I O6    1 
ATOM   7446  N  N1    . DG  I 5 73  ? 122.972 127.570 79.705  1.00 82.92  ? 73   DG  I N1    1 
ATOM   7447  C  C2    . DG  I 5 73  ? 121.881 127.410 78.889  1.00 82.92  ? 73   DG  I C2    1 
ATOM   7448  N  N2    . DG  I 5 73  ? 122.103 127.530 77.576  1.00 82.92  ? 73   DG  I N2    1 
ATOM   7449  N  N3    . DG  I 5 73  ? 120.657 127.141 79.329  1.00 82.92  ? 73   DG  I N3    1 
ATOM   7450  C  C4    . DG  I 5 73  ? 120.619 127.065 80.677  1.00 82.92  ? 73   DG  I C4    1 
ATOM   7451  P  P     . DC  I 5 74  ? 115.320 123.542 79.824  1.00 87.62  ? 74   DC  I P     1 
ATOM   7452  O  OP1   . DC  I 5 74  ? 113.991 123.431 79.182  1.00 87.62  ? 74   DC  I OP1   1 
ATOM   7453  O  OP2   . DC  I 5 74  ? 115.622 122.682 80.986  1.00 87.62  ? 74   DC  I OP2   1 
ATOM   7454  O  "O5'" . DC  I 5 74  ? 116.457 123.336 78.724  1.00 87.62  ? 74   DC  I "O5'" 1 
ATOM   7455  C  "C5'" . DC  I 5 74  ? 116.523 124.239 77.632  1.00 87.62  ? 74   DC  I "C5'" 1 
ATOM   7456  C  "C4'" . DC  I 5 74  ? 117.778 124.017 76.832  1.00 87.62  ? 74   DC  I "C4'" 1 
ATOM   7457  O  "O4'" . DC  I 5 74  ? 118.910 124.518 77.576  1.00 87.62  ? 74   DC  I "O4'" 1 
ATOM   7458  C  "C3'" . DC  I 5 74  ? 118.071 122.558 76.519  1.00 87.62  ? 74   DC  I "C3'" 1 
ATOM   7459  O  "O3'" . DC  I 5 74  ? 118.099 122.360 75.109  1.00 87.62  ? 74   DC  I "O3'" 1 
ATOM   7460  C  "C2'" . DC  I 5 74  ? 119.434 122.297 77.164  1.00 87.62  ? 74   DC  I "C2'" 1 
ATOM   7461  C  "C1'" . DC  I 5 74  ? 120.012 123.691 77.342  1.00 87.62  ? 74   DC  I "C1'" 1 
ATOM   7462  N  N1    . DC  I 5 74  ? 120.933 123.823 78.517  1.00 87.62  ? 74   DC  I N1    1 
ATOM   7463  C  C2    . DC  I 5 74  ? 122.285 124.126 78.323  1.00 87.62  ? 74   DC  I C2    1 
ATOM   7464  O  O2    . DC  I 5 74  ? 122.715 124.250 77.175  1.00 87.62  ? 74   DC  I O2    1 
ATOM   7465  N  N3    . DC  I 5 74  ? 123.089 124.257 79.407  1.00 87.62  ? 74   DC  I N3    1 
ATOM   7466  C  C4    . DC  I 5 74  ? 122.586 124.115 80.627  1.00 87.62  ? 74   DC  I C4    1 
ATOM   7467  N  N4    . DC  I 5 74  ? 123.406 124.257 81.663  1.00 87.62  ? 74   DC  I N4    1 
ATOM   7468  C  C5    . DC  I 5 74  ? 121.219 123.810 80.843  1.00 87.62  ? 74   DC  I C5    1 
ATOM   7469  C  C6    . DC  I 5 74  ? 120.431 123.703 79.772  1.00 87.62  ? 74   DC  I C6    1 
ATOM   7470  P  P     . DT  I 5 75  ? 118.203 120.878 74.501  1.00 87.64  ? 75   DT  I P     1 
ATOM   7471  O  OP1   . DT  I 5 75  ? 117.550 120.896 73.178  1.00 87.64  ? 75   DT  I OP1   1 
ATOM   7472  O  OP2   . DT  I 5 75  ? 117.772 119.907 75.525  1.00 87.64  ? 75   DT  I OP2   1 
ATOM   7473  O  "O5'" . DT  I 5 75  ? 119.760 120.673 74.258  1.00 87.64  ? 75   DT  I "O5'" 1 
ATOM   7474  C  "C5'" . DT  I 5 75  ? 120.503 121.670 73.594  1.00 87.64  ? 75   DT  I "C5'" 1 
ATOM   7475  C  "C4'" . DT  I 5 75  ? 121.973 121.309 73.579  1.00 87.64  ? 75   DT  I "C4'" 1 
ATOM   7476  O  "O4'" . DT  I 5 75  ? 122.581 121.710 74.828  1.00 87.64  ? 75   DT  I "O4'" 1 
ATOM   7477  C  "C3'" . DT  I 5 75  ? 122.264 119.811 73.424  1.00 87.64  ? 75   DT  I "C3'" 1 
ATOM   7478  O  "O3'" . DT  I 5 75  ? 123.225 119.604 72.387  1.00 87.64  ? 75   DT  I "O3'" 1 
ATOM   7479  C  "C2'" . DT  I 5 75  ? 122.790 119.409 74.800  1.00 87.64  ? 75   DT  I "C2'" 1 
ATOM   7480  C  "C1'" . DT  I 5 75  ? 123.441 120.694 75.265  1.00 87.64  ? 75   DT  I "C1'" 1 
ATOM   7481  N  N1    . DT  I 5 75  ? 123.548 120.800 76.727  1.00 87.64  ? 75   DT  I N1    1 
ATOM   7482  C  C2    . DT  I 5 75  ? 124.739 121.177 77.289  1.00 87.64  ? 75   DT  I C2    1 
ATOM   7483  O  O2    . DT  I 5 75  ? 125.735 121.424 76.640  1.00 87.64  ? 75   DT  I O2    1 
ATOM   7484  N  N3    . DT  I 5 75  ? 124.724 121.260 78.648  1.00 87.64  ? 75   DT  I N3    1 
ATOM   7485  C  C4    . DT  I 5 75  ? 123.662 121.012 79.481  1.00 87.64  ? 75   DT  I C4    1 
ATOM   7486  O  O4    . DT  I 5 75  ? 123.745 121.110 80.693  1.00 87.64  ? 75   DT  I O4    1 
ATOM   7487  C  C5    . DT  I 5 75  ? 122.446 120.617 78.828  1.00 87.64  ? 75   DT  I C5    1 
ATOM   7488  C  C7    . DT  I 5 75  ? 121.229 120.296 79.640  1.00 87.64  ? 75   DT  I C7    1 
ATOM   7489  C  C6    . DT  I 5 75  ? 122.450 120.527 77.497  1.00 87.64  ? 75   DT  I C6    1 
ATOM   7490  P  P     . DG  I 5 76  ? 123.506 118.136 71.789  1.00 83.31  ? 76   DG  I P     1 
ATOM   7491  O  OP1   . DG  I 5 76  ? 123.399 118.243 70.322  1.00 83.31  ? 76   DG  I OP1   1 
ATOM   7492  O  OP2   . DG  I 5 76  ? 122.679 117.136 72.492  1.00 83.31  ? 76   DG  I OP2   1 
ATOM   7493  O  "O5'" . DG  I 5 76  ? 125.030 117.866 72.183  1.00 83.31  ? 76   DG  I "O5'" 1 
ATOM   7494  C  "C5'" . DG  I 5 76  ? 126.044 118.754 71.711  1.00 83.31  ? 76   DG  I "C5'" 1 
ATOM   7495  C  "C4'" . DG  I 5 76  ? 127.335 118.580 72.487  1.00 83.31  ? 76   DG  I "C4'" 1 
ATOM   7496  O  "O4'" . DG  I 5 76  ? 127.135 119.004 73.857  1.00 83.31  ? 76   DG  I "O4'" 1 
ATOM   7497  C  "C3'" . DG  I 5 76  ? 127.884 117.156 72.562  1.00 83.31  ? 76   DG  I "C3'" 1 
ATOM   7498  O  "O3'" . DG  I 5 76  ? 129.291 117.185 72.392  1.00 83.31  ? 76   DG  I "O3'" 1 
ATOM   7499  C  "C2'" . DG  I 5 76  ? 127.516 116.723 73.969  1.00 83.31  ? 76   DG  I "C2'" 1 
ATOM   7500  C  "C1'" . DG  I 5 76  ? 127.648 118.024 74.725  1.00 83.31  ? 76   DG  I "C1'" 1 
ATOM   7501  N  N9    . DG  I 5 76  ? 126.859 118.068 75.942  1.00 83.31  ? 76   DG  I N9    1 
ATOM   7502  C  C8    . DG  I 5 76  ? 125.529 117.792 76.055  1.00 83.31  ? 76   DG  I C8    1 
ATOM   7503  N  N7    . DG  I 5 76  ? 125.070 117.921 77.259  1.00 83.31  ? 76   DG  I N7    1 
ATOM   7504  C  C5    . DG  I 5 76  ? 126.177 118.271 78.000  1.00 83.31  ? 76   DG  I C5    1 
ATOM   7505  C  C6    . DG  I 5 76  ? 126.289 118.529 79.369  1.00 83.31  ? 76   DG  I C6    1 
ATOM   7506  O  O6    . DG  I 5 76  ? 125.401 118.492 80.222  1.00 83.31  ? 76   DG  I O6    1 
ATOM   7507  N  N1    . DG  I 5 76  ? 127.586 118.853 79.724  1.00 83.31  ? 76   DG  I N1    1 
ATOM   7508  C  C2    . DG  I 5 76  ? 128.646 118.922 78.857  1.00 83.31  ? 76   DG  I C2    1 
ATOM   7509  N  N2    . DG  I 5 76  ? 129.827 119.256 79.384  1.00 83.31  ? 76   DG  I N2    1 
ATOM   7510  N  N3    . DG  I 5 76  ? 128.553 118.681 77.562  1.00 83.31  ? 76   DG  I N3    1 
ATOM   7511  C  C4    . DG  I 5 76  ? 127.290 118.363 77.206  1.00 83.31  ? 76   DG  I C4    1 
ATOM   7512  P  P     . DT  I 5 77  ? 130.087 115.901 71.847  1.00 84.32  ? 77   DT  I P     1 
ATOM   7513  O  OP1   . DT  I 5 77  ? 130.716 116.242 70.553  1.00 84.32  ? 77   DT  I OP1   1 
ATOM   7514  O  OP2   . DT  I 5 77  ? 129.203 114.723 71.971  1.00 84.32  ? 77   DT  I OP2   1 
ATOM   7515  O  "O5'" . DT  I 5 77  ? 131.249 115.710 72.913  1.00 84.32  ? 77   DT  I "O5'" 1 
ATOM   7516  C  "C5'" . DT  I 5 77  ? 131.796 116.836 73.583  1.00 84.32  ? 77   DT  I "C5'" 1 
ATOM   7517  C  "C4'" . DT  I 5 77  ? 132.354 116.430 74.935  1.00 84.32  ? 77   DT  I "C4'" 1 
ATOM   7518  O  "O4'" . DT  I 5 77  ? 131.344 116.539 75.975  1.00 84.32  ? 77   DT  I "O4'" 1 
ATOM   7519  C  "C3'" . DT  I 5 77  ? 132.875 115.002 75.022  1.00 84.32  ? 77   DT  I "C3'" 1 
ATOM   7520  O  "O3'" . DT  I 5 77  ? 133.995 114.996 75.836  1.00 84.32  ? 77   DT  I "O3'" 1 
ATOM   7521  C  "C2'" . DT  I 5 77  ? 131.726 114.281 75.708  1.00 84.32  ? 77   DT  I "C2'" 1 
ATOM   7522  C  "C1'" . DT  I 5 77  ? 131.341 115.335 76.715  1.00 84.32  ? 77   DT  I "C1'" 1 
ATOM   7523  N  N1    . DT  I 5 77  ? 129.999 115.172 77.340  1.00 84.32  ? 77   DT  I N1    1 
ATOM   7524  C  C2    . DT  I 5 77  ? 129.838 115.539 78.647  1.00 84.32  ? 77   DT  I C2    1 
ATOM   7525  O  O2    . DT  I 5 77  ? 130.748 115.936 79.343  1.00 84.32  ? 77   DT  I O2    1 
ATOM   7526  N  N3    . DT  I 5 77  ? 128.579 115.392 79.127  1.00 84.32  ? 77   DT  I N3    1 
ATOM   7527  C  C4    . DT  I 5 77  ? 127.478 114.951 78.442  1.00 84.32  ? 77   DT  I C4    1 
ATOM   7528  O  O4    . DT  I 5 77  ? 126.382 114.868 78.957  1.00 84.32  ? 77   DT  I O4    1 
ATOM   7529  C  C5    . DT  I 5 77  ? 127.698 114.606 77.075  1.00 84.32  ? 77   DT  I C5    1 
ATOM   7530  C  C7    . DT  I 5 77  ? 126.557 114.103 76.249  1.00 84.32  ? 77   DT  I C7    1 
ATOM   7531  C  C6    . DT  I 5 77  ? 128.934 114.738 76.584  1.00 84.32  ? 77   DT  I C6    1 
ATOM   7532  P  P     . DC  I 5 78  ? 135.326 114.233 75.391  1.00 81.22  ? 78   DC  I P     1 
ATOM   7533  O  OP1   . DC  I 5 78  ? 136.218 115.176 74.684  1.00 81.22  ? 78   DC  I OP1   1 
ATOM   7534  O  OP2   . DC  I 5 78  ? 134.914 112.974 74.742  1.00 81.22  ? 78   DC  I OP2   1 
ATOM   7535  O  "O5'" . DC  I 5 78  ? 135.976 113.856 76.786  1.00 81.22  ? 78   DC  I "O5'" 1 
ATOM   7536  C  "C5'" . DC  I 5 78  ? 135.710 114.658 77.934  1.00 81.22  ? 78   DC  I "C5'" 1 
ATOM   7537  C  "C4'" . DC  I 5 78  ? 135.356 113.777 79.115  1.00 81.22  ? 78   DC  I "C4'" 1 
ATOM   7538  O  "O4'" . DC  I 5 78  ? 133.916 113.678 79.300  1.00 81.22  ? 78   DC  I "O4'" 1 
ATOM   7539  C  "C3'" . DC  I 5 78  ? 135.863 112.344 78.998  1.00 81.22  ? 78   DC  I "C3'" 1 
ATOM   7540  O  "O3'" . DC  I 5 78  ? 136.364 111.929 80.243  1.00 81.22  ? 78   DC  I "O3'" 1 
ATOM   7541  C  "C2'" . DC  I 5 78  ? 134.586 111.594 78.633  1.00 81.22  ? 78   DC  I "C2'" 1 
ATOM   7542  C  "C1'" . DC  I 5 78  ? 133.598 112.323 79.515  1.00 81.22  ? 78   DC  I "C1'" 1 
ATOM   7543  N  N1    . DC  I 5 78  ? 132.154 112.112 79.179  1.00 81.22  ? 78   DC  I N1    1 
ATOM   7544  C  C2    . DC  I 5 78  ? 131.171 112.410 80.129  1.00 81.22  ? 78   DC  I C2    1 
ATOM   7545  O  O2    . DC  I 5 78  ? 131.516 112.812 81.244  1.00 81.22  ? 78   DC  I O2    1 
ATOM   7546  N  N3    . DC  I 5 78  ? 129.866 112.241 79.804  1.00 81.22  ? 78   DC  I N3    1 
ATOM   7547  C  C4    . DC  I 5 78  ? 129.535 111.803 78.598  1.00 81.22  ? 78   DC  I C4    1 
ATOM   7548  N  N4    . DC  I 5 78  ? 128.241 111.649 78.320  1.00 81.22  ? 78   DC  I N4    1 
ATOM   7549  C  C5    . DC  I 5 78  ? 130.518 111.494 77.621  1.00 81.22  ? 78   DC  I C5    1 
ATOM   7550  C  C6    . DC  I 5 78  ? 131.802 111.655 77.955  1.00 81.22  ? 78   DC  I C6    1 
ATOM   7551  P  P     . DC  I 5 79  ? 137.929 112.065 80.585  1.00 78.80  ? 79   DC  I P     1 
ATOM   7552  O  OP1   . DC  I 5 79  ? 138.469 113.304 79.992  1.00 78.80  ? 79   DC  I OP1   1 
ATOM   7553  O  OP2   . DC  I 5 79  ? 138.568 110.774 80.261  1.00 78.80  ? 79   DC  I OP2   1 
ATOM   7554  O  "O5'" . DC  I 5 79  ? 137.924 112.204 82.168  1.00 78.80  ? 79   DC  I "O5'" 1 
ATOM   7555  C  "C5'" . DC  I 5 79  ? 136.838 112.884 82.802  1.00 78.80  ? 79   DC  I "C5'" 1 
ATOM   7556  C  "C4'" . DC  I 5 79  ? 136.137 111.978 83.798  1.00 78.80  ? 79   DC  I "C4'" 1 
ATOM   7557  O  "O4'" . DC  I 5 79  ? 134.825 111.568 83.297  1.00 78.80  ? 79   DC  I "O4'" 1 
ATOM   7558  C  "C3'" . DC  I 5 79  ? 136.885 110.688 84.118  1.00 78.80  ? 79   DC  I "C3'" 1 
ATOM   7559  O  "O3'" . DC  I 5 79  ? 136.671 110.356 85.463  1.00 78.80  ? 79   DC  I "O3'" 1 
ATOM   7560  C  "C2'" . DC  I 5 79  ? 136.182 109.693 83.200  1.00 78.80  ? 79   DC  I "C2'" 1 
ATOM   7561  C  "C1'" . DC  I 5 79  ? 134.744 110.161 83.355  1.00 78.80  ? 79   DC  I "C1'" 1 
ATOM   7562  N  N1    . DC  I 5 79  ? 133.813 109.680 82.299  1.00 78.80  ? 79   DC  I N1    1 
ATOM   7563  C  C2    . DC  I 5 79  ? 132.428 109.791 82.475  1.00 78.80  ? 79   DC  I C2    1 
ATOM   7564  O  O2    . DC  I 5 79  ? 131.979 110.255 83.520  1.00 78.80  ? 79   DC  I O2    1 
ATOM   7565  N  N3    . DC  I 5 79  ? 131.609 109.347 81.498  1.00 78.80  ? 79   DC  I N3    1 
ATOM   7566  C  C4    . DC  I 5 79  ? 132.116 108.835 80.384  1.00 78.80  ? 79   DC  I C4    1 
ATOM   7567  N  N4    . DC  I 5 79  ? 131.268 108.414 79.442  1.00 78.80  ? 79   DC  I N4    1 
ATOM   7568  C  C5    . DC  I 5 79  ? 133.514 108.709 80.192  1.00 78.80  ? 79   DC  I C5    1 
ATOM   7569  C  C6    . DC  I 5 79  ? 134.317 109.152 81.159  1.00 78.80  ? 79   DC  I C6    1 
ATOM   7570  P  P     . DC  I 5 80  ? 137.744 110.754 86.583  1.00 70.37  ? 80   DC  I P     1 
ATOM   7571  O  OP1   . DC  I 5 80  ? 138.219 112.127 86.319  1.00 70.37  ? 80   DC  I OP1   1 
ATOM   7572  O  OP2   . DC  I 5 80  ? 138.710 109.642 86.692  1.00 70.37  ? 80   DC  I OP2   1 
ATOM   7573  O  "O5'" . DC  I 5 80  ? 136.881 110.756 87.920  1.00 70.37  ? 80   DC  I "O5'" 1 
ATOM   7574  C  "C5'" . DC  I 5 80  ? 135.584 111.349 87.924  1.00 70.37  ? 80   DC  I "C5'" 1 
ATOM   7575  C  "C4'" . DC  I 5 80  ? 134.530 110.386 88.462  1.00 70.37  ? 80   DC  I "C4'" 1 
ATOM   7576  O  "O4'" . DC  I 5 80  ? 133.889 109.661 87.373  1.00 70.37  ? 80   DC  I "O4'" 1 
ATOM   7577  C  "C3'" . DC  I 5 80  ? 135.035 109.316 89.417  1.00 70.37  ? 80   DC  I "C3'" 1 
ATOM   7578  O  "O3'" . DC  I 5 80  ? 134.038 109.068 90.355  1.00 70.37  ? 80   DC  I "O3'" 1 
ATOM   7579  C  "C2'" . DC  I 5 80  ? 135.193 108.120 88.490  1.00 70.37  ? 80   DC  I "C2'" 1 
ATOM   7580  C  "C1'" . DC  I 5 80  ? 133.945 108.276 87.647  1.00 70.37  ? 80   DC  I "C1'" 1 
ATOM   7581  N  N1    . DC  I 5 80  ? 134.004 107.575 86.354  1.00 70.37  ? 80   DC  I N1    1 
ATOM   7582  C  C2    . DC  I 5 80  ? 132.826 107.272 85.680  1.00 70.37  ? 80   DC  I C2    1 
ATOM   7583  O  O2    . DC  I 5 80  ? 131.745 107.537 86.194  1.00 70.37  ? 80   DC  I O2    1 
ATOM   7584  N  N3    . DC  I 5 80  ? 132.901 106.654 84.485  1.00 70.37  ? 80   DC  I N3    1 
ATOM   7585  C  C4    . DC  I 5 80  ? 134.082 106.360 83.960  1.00 70.37  ? 80   DC  I C4    1 
ATOM   7586  N  N4    . DC  I 5 80  ? 134.105 105.752 82.775  1.00 70.37  ? 80   DC  I N4    1 
ATOM   7587  C  C5    . DC  I 5 80  ? 135.294 106.660 84.630  1.00 70.37  ? 80   DC  I C5    1 
ATOM   7588  C  C6    . DC  I 5 80  ? 135.210 107.278 85.804  1.00 70.37  ? 80   DC  I C6    1 
ATOM   7589  P  P     . DC  I 5 81  ? 134.316 109.231 91.920  1.00 60.38  ? 81   DC  I P     1 
ATOM   7590  O  OP1   . DC  I 5 81  ? 134.184 110.663 92.243  1.00 60.38  ? 81   DC  I OP1   1 
ATOM   7591  O  OP2   . DC  I 5 81  ? 135.550 108.493 92.246  1.00 60.38  ? 81   DC  I OP2   1 
ATOM   7592  O  "O5'" . DC  I 5 81  ? 133.088 108.464 92.559  1.00 60.38  ? 81   DC  I "O5'" 1 
ATOM   7593  C  "C5'" . DC  I 5 81  ? 131.806 108.931 92.272  1.00 60.38  ? 81   DC  I "C5'" 1 
ATOM   7594  C  "C4'" . DC  I 5 81  ? 130.911 107.798 91.844  1.00 60.38  ? 81   DC  I "C4'" 1 
ATOM   7595  O  "O4'" . DC  I 5 81  ? 131.414 107.214 90.620  1.00 60.38  ? 81   DC  I "O4'" 1 
ATOM   7596  C  "C3'" . DC  I 5 81  ? 130.786 106.654 92.835  1.00 60.38  ? 81   DC  I "C3'" 1 
ATOM   7597  O  "O3'" . DC  I 5 81  ? 129.422 106.274 92.908  1.00 60.38  ? 81   DC  I "O3'" 1 
ATOM   7598  C  "C2'" . DC  I 5 81  ? 131.643 105.570 92.199  1.00 60.38  ? 81   DC  I "C2'" 1 
ATOM   7599  C  "C1'" . DC  I 5 81  ? 131.359 105.820 90.735  1.00 60.38  ? 81   DC  I "C1'" 1 
ATOM   7600  N  N1    . DC  I 5 81  ? 132.359 105.222 89.789  1.00 60.38  ? 81   DC  I N1    1 
ATOM   7601  C  C2    . DC  I 5 81  ? 131.920 104.624 88.604  1.00 60.38  ? 81   DC  I C2    1 
ATOM   7602  O  O2    . DC  I 5 81  ? 130.718 104.575 88.366  1.00 60.38  ? 81   DC  I O2    1 
ATOM   7603  N  N3    . DC  I 5 81  ? 132.831 104.102 87.754  1.00 60.38  ? 81   DC  I N3    1 
ATOM   7604  C  C4    . DC  I 5 81  ? 134.129 104.167 88.045  1.00 60.38  ? 81   DC  I C4    1 
ATOM   7605  N  N4    . DC  I 5 81  ? 134.997 103.640 87.170  1.00 60.38  ? 81   DC  I N4    1 
ATOM   7606  C  C5    . DC  I 5 81  ? 134.596 104.764 89.248  1.00 60.38  ? 81   DC  I C5    1 
ATOM   7607  C  C6    . DC  I 5 81  ? 133.685 105.282 90.079  1.00 60.38  ? 81   DC  I C6    1 
ATOM   7608  P  P     . DC  I 5 82  ? 128.830 105.569 94.218  1.00 59.04  ? 82   DC  I P     1 
ATOM   7609  O  OP1   . DC  I 5 82  ? 128.293 106.631 95.081  1.00 59.04  ? 82   DC  I OP1   1 
ATOM   7610  O  OP2   . DC  I 5 82  ? 129.835 104.641 94.758  1.00 59.04  ? 82   DC  I OP2   1 
ATOM   7611  O  "O5'" . DC  I 5 82  ? 127.583 104.748 93.671  1.00 59.04  ? 82   DC  I "O5'" 1 
ATOM   7612  C  "C5'" . DC  I 5 82  ? 127.007 105.096 92.429  1.00 59.04  ? 82   DC  I "C5'" 1 
ATOM   7613  C  "C4'" . DC  I 5 82  ? 126.557 103.868 91.651  1.00 59.04  ? 82   DC  I "C4'" 1 
ATOM   7614  O  "O4'" . DC  I 5 82  ? 127.582 103.450 90.716  1.00 59.04  ? 82   DC  I "O4'" 1 
ATOM   7615  C  "C3'" . DC  I 5 82  ? 126.239 102.647 92.482  1.00 59.04  ? 82   DC  I "C3'" 1 
ATOM   7616  O  "O3'" . DC  I 5 82  ? 125.147 102.011 91.923  1.00 59.04  ? 82   DC  I "O3'" 1 
ATOM   7617  C  "C2'" . DC  I 5 82  ? 127.498 101.805 92.323  1.00 59.04  ? 82   DC  I "C2'" 1 
ATOM   7618  C  "C1'" . DC  I 5 82  ? 127.836 102.075 90.879  1.00 59.04  ? 82   DC  I "C1'" 1 
ATOM   7619  N  N1    . DC  I 5 82  ? 129.252 101.875 90.558  1.00 59.04  ? 82   DC  I N1    1 
ATOM   7620  C  C2    . DC  I 5 82  ? 129.618 101.223 89.390  1.00 59.04  ? 82   DC  I C2    1 
ATOM   7621  O  O2    . DC  I 5 82  ? 128.746 100.778 88.652  1.00 59.04  ? 82   DC  I O2    1 
ATOM   7622  N  N3    . DC  I 5 82  ? 130.927 101.091 89.100  1.00 59.04  ? 82   DC  I N3    1 
ATOM   7623  C  C4    . DC  I 5 82  ? 131.835 101.581 89.917  1.00 59.04  ? 82   DC  I C4    1 
ATOM   7624  N  N4    . DC  I 5 82  ? 133.119 101.429 89.598  1.00 59.04  ? 82   DC  I N4    1 
ATOM   7625  C  C5    . DC  I 5 82  ? 131.479 102.244 91.106  1.00 59.04  ? 82   DC  I C5    1 
ATOM   7626  C  C6    . DC  I 5 82  ? 130.189 102.378 91.379  1.00 59.04  ? 82   DC  I C6    1 
ATOM   7627  P  P     . DG  I 5 83  ? 124.124 101.228 92.860  1.00 62.39  ? 83   DG  I P     1 
ATOM   7628  O  OP1   . DG  I 5 83  ? 122.830 101.935 92.801  1.00 62.39  ? 83   DG  I OP1   1 
ATOM   7629  O  OP2   . DG  I 5 83  ? 124.800 101.035 94.155  1.00 62.39  ? 83   DG  I OP2   1 
ATOM   7630  O  "O5'" . DG  I 5 83  ? 123.998 99.806  92.157  1.00 62.39  ? 83   DG  I "O5'" 1 
ATOM   7631  C  "C5'" . DG  I 5 83  ? 123.643 99.728  90.795  1.00 62.39  ? 83   DG  I "C5'" 1 
ATOM   7632  C  "C4'" . DG  I 5 83  ? 124.110 98.428  90.190  1.00 62.39  ? 83   DG  I "C4'" 1 
ATOM   7633  O  "O4'" . DG  I 5 83  ? 125.524 98.490  89.916  1.00 62.39  ? 83   DG  I "O4'" 1 
ATOM   7634  C  "C3'" . DG  I 5 83  ? 123.891 97.201  91.060  1.00 62.39  ? 83   DG  I "C3'" 1 
ATOM   7635  O  "O3'" . DG  I 5 83  ? 123.358 96.174  90.277  1.00 62.39  ? 83   DG  I "O3'" 1 
ATOM   7636  C  "C2'" . DG  I 5 83  ? 125.298 96.851  91.535  1.00 62.39  ? 83   DG  I "C2'" 1 
ATOM   7637  C  "C1'" . DG  I 5 83  ? 126.144 97.321  90.371  1.00 62.39  ? 83   DG  I "C1'" 1 
ATOM   7638  N  N9    . DG  I 5 83  ? 127.489 97.679  90.763  1.00 62.39  ? 83   DG  I N9    1 
ATOM   7639  C  C8    . DG  I 5 83  ? 127.838 98.412  91.855  1.00 62.39  ? 83   DG  I C8    1 
ATOM   7640  N  N7    . DG  I 5 83  ? 129.113 98.608  91.968  1.00 62.39  ? 83   DG  I N7    1 
ATOM   7641  C  C5    . DG  I 5 83  ? 129.648 97.957  90.879  1.00 62.39  ? 83   DG  I C5    1 
ATOM   7642  C  C6    . DG  I 5 83  ? 130.987 97.823  90.490  1.00 62.39  ? 83   DG  I C6    1 
ATOM   7643  O  O6    . DG  I 5 83  ? 131.988 98.273  91.051  1.00 62.39  ? 83   DG  I O6    1 
ATOM   7644  N  N1    . DG  I 5 83  ? 131.113 97.083  89.331  1.00 62.39  ? 83   DG  I N1    1 
ATOM   7645  C  C2    . DG  I 5 83  ? 130.067 96.540  88.630  1.00 62.39  ? 83   DG  I C2    1 
ATOM   7646  N  N2    . DG  I 5 83  ? 130.389 95.858  87.526  1.00 62.39  ? 83   DG  I N2    1 
ATOM   7647  N  N3    . DG  I 5 83  ? 128.794 96.658  88.987  1.00 62.39  ? 83   DG  I N3    1 
ATOM   7648  C  C4    . DG  I 5 83  ? 128.663 97.377  90.122  1.00 62.39  ? 83   DG  I C4    1 
ATOM   7649  P  P     . DC  I 5 84  ? 122.842 94.815  90.950  1.00 66.59  ? 84   DC  I P     1 
ATOM   7650  O  OP1   . DC  I 5 84  ? 121.755 94.304  90.096  1.00 66.59  ? 84   DC  I OP1   1 
ATOM   7651  O  OP2   . DC  I 5 84  ? 122.609 95.026  92.390  1.00 66.59  ? 84   DC  I OP2   1 
ATOM   7652  O  "O5'" . DC  I 5 84  ? 124.088 93.849  90.763  1.00 66.59  ? 84   DC  I "O5'" 1 
ATOM   7653  C  "C5'" . DC  I 5 84  ? 124.673 93.735  89.496  1.00 66.59  ? 84   DC  I "C5'" 1 
ATOM   7654  C  "C4'" . DC  I 5 84  ? 125.903 92.863  89.543  1.00 66.59  ? 84   DC  I "C4'" 1 
ATOM   7655  O  "O4'" . DC  I 5 84  ? 127.088 93.639  89.868  1.00 66.59  ? 84   DC  I "O4'" 1 
ATOM   7656  C  "C3'" . DC  I 5 84  ? 125.855 91.732  90.559  1.00 66.59  ? 84   DC  I "C3'" 1 
ATOM   7657  O  "O3'" . DC  I 5 84  ? 126.353 90.605  89.949  1.00 66.59  ? 84   DC  I "O3'" 1 
ATOM   7658  C  "C2'" . DC  I 5 84  ? 126.799 92.215  91.650  1.00 66.59  ? 84   DC  I "C2'" 1 
ATOM   7659  C  "C1'" . DC  I 5 84  ? 127.835 92.912  90.807  1.00 66.59  ? 84   DC  I "C1'" 1 
ATOM   7660  N  N1    . DC  I 5 84  ? 128.712 93.824  91.568  1.00 66.59  ? 84   DC  I N1    1 
ATOM   7661  C  C2    . DC  I 5 84  ? 130.083 93.846  91.306  1.00 66.59  ? 84   DC  I C2    1 
ATOM   7662  O  O2    . DC  I 5 84  ? 130.549 93.098  90.447  1.00 66.59  ? 84   DC  I O2    1 
ATOM   7663  N  N3    . DC  I 5 84  ? 130.873 94.681  92.016  1.00 66.59  ? 84   DC  I N3    1 
ATOM   7664  C  C4    . DC  I 5 84  ? 130.340 95.471  92.936  1.00 66.59  ? 84   DC  I C4    1 
ATOM   7665  N  N4    . DC  I 5 84  ? 131.154 96.285  93.608  1.00 66.59  ? 84   DC  I N4    1 
ATOM   7666  C  C5    . DC  I 5 84  ? 128.944 95.469  93.210  1.00 66.59  ? 84   DC  I C5    1 
ATOM   7667  C  C6    . DC  I 5 84  ? 128.176 94.635  92.511  1.00 66.59  ? 84   DC  I C6    1 
ATOM   7668  P  P     . DG  I 5 85  ? 125.827 89.153  90.351  1.00 70.65  ? 85   DG  I P     1 
ATOM   7669  O  OP1   . DG  I 5 85  ? 124.738 88.779  89.426  1.00 70.65  ? 85   DG  I OP1   1 
ATOM   7670  O  OP2   . DG  I 5 85  ? 125.607 89.124  91.811  1.00 70.65  ? 85   DG  I OP2   1 
ATOM   7671  O  "O5'" . DG  I 5 85  ? 127.090 88.262  90.033  1.00 70.65  ? 85   DG  I "O5'" 1 
ATOM   7672  C  "C5'" . DG  I 5 85  ? 127.821 88.528  88.856  1.00 70.65  ? 85   DG  I "C5'" 1 
ATOM   7673  C  "C4'" . DG  I 5 85  ? 129.285 88.264  89.087  1.00 70.65  ? 85   DG  I "C4'" 1 
ATOM   7674  O  "O4'" . DG  I 5 85  ? 129.895 89.381  89.770  1.00 70.65  ? 85   DG  I "O4'" 1 
ATOM   7675  C  "C3'" . DG  I 5 85  ? 129.565 87.035  89.934  1.00 70.65  ? 85   DG  I "C3'" 1 
ATOM   7676  O  "O3'" . DG  I 5 85  ? 130.551 86.278  89.311  1.00 70.65  ? 85   DG  I "O3'" 1 
ATOM   7677  C  "C2'" . DG  I 5 85  ? 130.046 87.616  91.268  1.00 70.65  ? 85   DG  I "C2'" 1 
ATOM   7678  C  "C1'" . DG  I 5 85  ? 130.702 88.901  90.819  1.00 70.65  ? 85   DG  I "C1'" 1 
ATOM   7679  N  N9    . DG  I 5 85  ? 130.750 89.947  91.837  1.00 70.65  ? 85   DG  I N9    1 
ATOM   7680  C  C8    . DG  I 5 85  ? 129.690 90.475  92.520  1.00 70.65  ? 85   DG  I C8    1 
ATOM   7681  N  N7    . DG  I 5 85  ? 130.023 91.411  93.356  1.00 70.65  ? 85   DG  I N7    1 
ATOM   7682  C  C5    . DG  I 5 85  ? 131.393 91.508  93.223  1.00 70.65  ? 85   DG  I C5    1 
ATOM   7683  C  C6    . DG  I 5 85  ? 132.305 92.349  93.879  1.00 70.65  ? 85   DG  I C6    1 
ATOM   7684  O  O6    . DG  I 5 85  ? 132.074 93.203  94.739  1.00 70.65  ? 85   DG  I O6    1 
ATOM   7685  N  N1    . DG  I 5 85  ? 133.603 92.125  93.457  1.00 70.65  ? 85   DG  I N1    1 
ATOM   7686  C  C2    . DG  I 5 85  ? 133.972 91.208  92.509  1.00 70.65  ? 85   DG  I C2    1 
ATOM   7687  N  N2    . DG  I 5 85  ? 135.277 91.133  92.230  1.00 70.65  ? 85   DG  I N2    1 
ATOM   7688  N  N3    . DG  I 5 85  ? 133.127 90.406  91.890  1.00 70.65  ? 85   DG  I N3    1 
ATOM   7689  C  C4    . DG  I 5 85  ? 131.859 90.613  92.293  1.00 70.65  ? 85   DG  I C4    1 
ATOM   7690  P  P     . DT  I 5 86  ? 130.791 84.760  89.749  1.00 72.32  ? 86   DT  I P     1 
ATOM   7691  O  OP1   . DT  I 5 86  ? 130.862 83.978  88.496  1.00 72.32  ? 86   DT  I OP1   1 
ATOM   7692  O  OP2   . DT  I 5 86  ? 129.787 84.394  90.770  1.00 72.32  ? 86   DT  I OP2   1 
ATOM   7693  O  "O5'" . DT  I 5 86  ? 132.239 84.817  90.413  1.00 72.32  ? 86   DT  I "O5'" 1 
ATOM   7694  C  "C5'" . DT  I 5 86  ? 133.259 85.546  89.761  1.00 72.32  ? 86   DT  I "C5'" 1 
ATOM   7695  C  "C4'" . DT  I 5 86  ? 134.471 85.711  90.649  1.00 72.32  ? 86   DT  I "C4'" 1 
ATOM   7696  O  "O4'" . DT  I 5 86  ? 134.354 86.901  91.475  1.00 72.32  ? 86   DT  I "O4'" 1 
ATOM   7697  C  "C3'" . DT  I 5 86  ? 134.746 84.558  91.599  1.00 72.32  ? 86   DT  I "C3'" 1 
ATOM   7698  O  "O3'" . DT  I 5 86  ? 136.112 84.313  91.588  1.00 72.32  ? 86   DT  I "O3'" 1 
ATOM   7699  C  "C2'" . DT  I 5 86  ? 134.289 85.114  92.949  1.00 72.32  ? 86   DT  I "C2'" 1 
ATOM   7700  C  "C1'" . DT  I 5 86  ? 134.673 86.570  92.806  1.00 72.32  ? 86   DT  I "C1'" 1 
ATOM   7701  N  N1    . DT  I 5 86  ? 133.960 87.520  93.720  1.00 72.32  ? 86   DT  I N1    1 
ATOM   7702  C  C2    . DT  I 5 86  ? 134.676 88.519  94.327  1.00 72.32  ? 86   DT  I C2    1 
ATOM   7703  O  O2    . DT  I 5 86  ? 135.872 88.655  94.189  1.00 72.32  ? 86   DT  I O2    1 
ATOM   7704  N  N3    . DT  I 5 86  ? 133.937 89.355  95.113  1.00 72.32  ? 86   DT  I N3    1 
ATOM   7705  C  C4    . DT  I 5 86  ? 132.585 89.299  95.343  1.00 72.32  ? 86   DT  I C4    1 
ATOM   7706  O  O4    . DT  I 5 86  ? 132.008 90.096  96.069  1.00 72.32  ? 86   DT  I O4    1 
ATOM   7707  C  C5    . DT  I 5 86  ? 131.888 88.240  94.674  1.00 72.32  ? 86   DT  I C5    1 
ATOM   7708  C  C7    . DT  I 5 86  ? 130.411 88.082  94.869  1.00 72.32  ? 86   DT  I C7    1 
ATOM   7709  C  C6    . DT  I 5 86  ? 132.598 87.416  93.889  1.00 72.32  ? 86   DT  I C6    1 
ATOM   7710  P  P     . DT  I 5 87  ? 136.725 82.997  92.260  1.00 74.24  ? 87   DT  I P     1 
ATOM   7711  O  OP1   . DT  I 5 87  ? 137.555 82.348  91.226  1.00 74.24  ? 87   DT  I OP1   1 
ATOM   7712  O  OP2   . DT  I 5 87  ? 135.662 82.204  92.915  1.00 74.24  ? 87   DT  I OP2   1 
ATOM   7713  O  "O5'" . DT  I 5 87  ? 137.697 83.611  93.367  1.00 74.24  ? 87   DT  I "O5'" 1 
ATOM   7714  C  "C5'" . DT  I 5 87  ? 138.664 84.582  92.975  1.00 74.24  ? 87   DT  I "C5'" 1 
ATOM   7715  C  "C4'" . DT  I 5 87  ? 139.160 85.398  94.157  1.00 74.24  ? 87   DT  I "C4'" 1 
ATOM   7716  O  "O4'" . DT  I 5 87  ? 138.115 86.253  94.678  1.00 74.24  ? 87   DT  I "O4'" 1 
ATOM   7717  C  "C3'" . DT  I 5 87  ? 139.678 84.579  95.335  1.00 74.24  ? 87   DT  I "C3'" 1 
ATOM   7718  O  "O3'" . DT  I 5 87  ? 140.909 85.119  95.757  1.00 74.24  ? 87   DT  I "O3'" 1 
ATOM   7719  C  "C2'" . DT  I 5 87  ? 138.585 84.765  96.387  1.00 74.24  ? 87   DT  I "C2'" 1 
ATOM   7720  C  "C1'" . DT  I 5 87  ? 138.129 86.169  96.078  1.00 74.24  ? 87   DT  I "C1'" 1 
ATOM   7721  N  N1    . DT  I 5 87  ? 136.775 86.524  96.576  1.00 74.24  ? 87   DT  I N1    1 
ATOM   7722  C  C2    . DT  I 5 87  ? 136.614 87.712  97.230  1.00 74.24  ? 87   DT  I C2    1 
ATOM   7723  O  O2    . DT  I 5 87  ? 137.537 88.466  97.470  1.00 74.24  ? 87   DT  I O2    1 
ATOM   7724  N  N3    . DT  I 5 87  ? 135.336 87.978  97.629  1.00 74.24  ? 87   DT  I N3    1 
ATOM   7725  C  C4    . DT  I 5 87  ? 134.221 87.195  97.418  1.00 74.24  ? 87   DT  I C4    1 
ATOM   7726  O  O4    . DT  I 5 87  ? 133.114 87.516  97.808  1.00 74.24  ? 87   DT  I O4    1 
ATOM   7727  C  C5    . DT  I 5 87  ? 134.447 85.979  96.705  1.00 74.24  ? 87   DT  I C5    1 
ATOM   7728  C  C7    . DT  I 5 87  ? 133.300 85.057  96.440  1.00 74.24  ? 87   DT  I C7    1 
ATOM   7729  C  C6    . DT  I 5 87  ? 135.700 85.700  96.311  1.00 74.24  ? 87   DT  I C6    1 
ATOM   7730  P  P     . DT  I 5 88  ? 141.886 84.278  96.710  1.00 75.05  ? 88   DT  I P     1 
ATOM   7731  O  OP1   . DT  I 5 88  ? 143.245 84.347  96.124  1.00 75.05  ? 88   DT  I OP1   1 
ATOM   7732  O  OP2   . DT  I 5 88  ? 141.255 82.970  96.983  1.00 75.05  ? 88   DT  I OP2   1 
ATOM   7733  O  "O5'" . DT  I 5 88  ? 141.909 85.127  98.055  1.00 75.05  ? 88   DT  I "O5'" 1 
ATOM   7734  C  "C5'" . DT  I 5 88  ? 142.365 86.463  98.021  1.00 75.05  ? 88   DT  I "C5'" 1 
ATOM   7735  C  "C4'" . DT  I 5 88  ? 141.949 87.224  99.263  1.00 75.05  ? 88   DT  I "C4'" 1 
ATOM   7736  O  "O4'" . DT  I 5 88  ? 140.502 87.312  99.334  1.00 75.05  ? 88   DT  I "O4'" 1 
ATOM   7737  C  "C3'" . DT  I 5 88  ? 142.396 86.604  100.581 1.00 75.05  ? 88   DT  I "C3'" 1 
ATOM   7738  O  "O3'" . DT  I 5 88  ? 142.823 87.635  101.424 1.00 75.05  ? 88   DT  I "O3'" 1 
ATOM   7739  C  "C2'" . DT  I 5 88  ? 141.101 85.966  101.092 1.00 75.05  ? 88   DT  I "C2'" 1 
ATOM   7740  C  "C1'" . DT  I 5 88  ? 140.100 87.002  100.644 1.00 75.05  ? 88   DT  I "C1'" 1 
ATOM   7741  N  N1    . DT  I 5 88  ? 138.676 86.545  100.582 1.00 75.05  ? 88   DT  I N1    1 
ATOM   7742  C  C2    . DT  I 5 88  ? 137.695 87.394  101.013 1.00 75.05  ? 88   DT  I C2    1 
ATOM   7743  O  O2    . DT  I 5 88  ? 137.927 88.485  101.486 1.00 75.05  ? 88   DT  I O2    1 
ATOM   7744  N  N3    . DT  I 5 88  ? 136.427 86.923  100.881 1.00 75.05  ? 88   DT  I N3    1 
ATOM   7745  C  C4    . DT  I 5 88  ? 136.047 85.718  100.368 1.00 75.05  ? 88   DT  I C4    1 
ATOM   7746  O  O4    . DT  I 5 88  ? 134.880 85.384  100.294 1.00 75.05  ? 88   DT  I O4    1 
ATOM   7747  C  C5    . DT  I 5 88  ? 137.113 84.874  99.924  1.00 75.05  ? 88   DT  I C5    1 
ATOM   7748  C  C7    . DT  I 5 88  ? 136.803 83.530  99.351  1.00 75.05  ? 88   DT  I C7    1 
ATOM   7749  C  C6    . DT  I 5 88  ? 138.368 85.323  100.042 1.00 75.05  ? 88   DT  I C6    1 
ATOM   7750  P  P     . DT  I 5 89  ? 144.228 87.550  102.194 1.00 78.11  ? 89   DT  I P     1 
ATOM   7751  O  OP1   . DT  I 5 89  ? 145.280 88.043  101.286 1.00 78.11  ? 89   DT  I OP1   1 
ATOM   7752  O  OP2   . DT  I 5 89  ? 144.355 86.209  102.795 1.00 78.11  ? 89   DT  I OP2   1 
ATOM   7753  O  "O5'" . DT  I 5 89  ? 144.028 88.599  103.373 1.00 78.11  ? 89   DT  I "O5'" 1 
ATOM   7754  C  "C5'" . DT  I 5 89  ? 143.185 89.722  103.151 1.00 78.11  ? 89   DT  I "C5'" 1 
ATOM   7755  C  "C4'" . DT  I 5 89  ? 142.225 89.921  104.304 1.00 78.11  ? 89   DT  I "C4'" 1 
ATOM   7756  O  "O4'" . DT  I 5 89  ? 141.004 89.180  104.064 1.00 78.11  ? 89   DT  I "O4'" 1 
ATOM   7757  C  "C3'" . DT  I 5 89  ? 142.724 89.455  105.669 1.00 78.11  ? 89   DT  I "C3'" 1 
ATOM   7758  O  "O3'" . DT  I 5 89  ? 142.353 90.404  106.608 1.00 78.11  ? 89   DT  I "O3'" 1 
ATOM   7759  C  "C2'" . DT  I 5 89  ? 141.942 88.165  105.886 1.00 78.11  ? 89   DT  I "C2'" 1 
ATOM   7760  C  "C1'" . DT  I 5 89  ? 140.624 88.563  105.267 1.00 78.11  ? 89   DT  I "C1'" 1 
ATOM   7761  N  N1    . DT  I 5 89  ? 139.763 87.432  104.932 1.00 78.11  ? 89   DT  I N1    1 
ATOM   7762  C  C2    . DT  I 5 89  ? 138.412 87.608  104.962 1.00 78.11  ? 89   DT  I C2    1 
ATOM   7763  O  O2    . DT  I 5 89  ? 137.891 88.663  105.245 1.00 78.11  ? 89   DT  I O2    1 
ATOM   7764  N  N3    . DT  I 5 89  ? 137.687 86.514  104.621 1.00 78.11  ? 89   DT  I N3    1 
ATOM   7765  C  C4    . DT  I 5 89  ? 138.177 85.277  104.271 1.00 78.11  ? 89   DT  I C4    1 
ATOM   7766  O  O4    . DT  I 5 89  ? 137.444 84.346  103.981 1.00 78.11  ? 89   DT  I O4    1 
ATOM   7767  C  C5    . DT  I 5 89  ? 139.609 85.152  104.273 1.00 78.11  ? 89   DT  I C5    1 
ATOM   7768  C  C7    . DT  I 5 89  ? 140.253 83.843  103.918 1.00 78.11  ? 89   DT  I C7    1 
ATOM   7769  C  C6    . DT  I 5 89  ? 140.327 86.225  104.604 1.00 78.11  ? 89   DT  I C6    1 
ATOM   7770  P  P     . DA  I 5 90  ? 143.409 91.061  107.613 1.00 76.30  ? 90   DA  I P     1 
ATOM   7771  O  OP1   . DA  I 5 90  ? 144.174 92.090  106.880 1.00 76.30  ? 90   DA  I OP1   1 
ATOM   7772  O  OP2   . DA  I 5 90  ? 144.106 89.977  108.331 1.00 76.30  ? 90   DA  I OP2   1 
ATOM   7773  O  "O5'" . DA  I 5 90  ? 142.442 91.792  108.635 1.00 76.30  ? 90   DA  I "O5'" 1 
ATOM   7774  C  "C5'" . DA  I 5 90  ? 141.166 92.219  108.166 1.00 76.30  ? 90   DA  I "C5'" 1 
ATOM   7775  C  "C4'" . DA  I 5 90  ? 140.039 91.647  109.003 1.00 76.30  ? 90   DA  I "C4'" 1 
ATOM   7776  O  "O4'" . DA  I 5 90  ? 139.656 90.331  108.517 1.00 76.30  ? 90   DA  I "O4'" 1 
ATOM   7777  C  "C3'" . DA  I 5 90  ? 140.364 91.459  110.482 1.00 76.30  ? 90   DA  I "C3'" 1 
ATOM   7778  O  "O3'" . DA  I 5 90  ? 139.250 91.841  111.224 1.00 76.30  ? 90   DA  I "O3'" 1 
ATOM   7779  C  "C2'" . DA  I 5 90  ? 140.582 89.951  110.579 1.00 76.30  ? 90   DA  I "C2'" 1 
ATOM   7780  C  "C1'" . DA  I 5 90  ? 139.507 89.493  109.631 1.00 76.30  ? 90   DA  I "C1'" 1 
ATOM   7781  N  N9    . DA  I 5 90  ? 139.622 88.110  109.210 1.00 76.30  ? 90   DA  I N9    1 
ATOM   7782  C  C8    . DA  I 5 90  ? 140.763 87.385  109.062 1.00 76.30  ? 90   DA  I C8    1 
ATOM   7783  N  N7    . DA  I 5 90  ? 140.556 86.158  108.655 1.00 76.30  ? 90   DA  I N7    1 
ATOM   7784  C  C5    . DA  I 5 90  ? 139.182 86.074  108.551 1.00 76.30  ? 90   DA  I C5    1 
ATOM   7785  C  C6    . DA  I 5 90  ? 138.320 85.031  108.175 1.00 76.30  ? 90   DA  I C6    1 
ATOM   7786  N  N6    . DA  I 5 90  ? 138.744 83.820  107.821 1.00 76.30  ? 90   DA  I N6    1 
ATOM   7787  N  N1    . DA  I 5 90  ? 136.998 85.279  108.182 1.00 76.30  ? 90   DA  I N1    1 
ATOM   7788  C  C2    . DA  I 5 90  ? 136.576 86.491  108.542 1.00 76.30  ? 90   DA  I C2    1 
ATOM   7789  N  N3    . DA  I 5 90  ? 137.290 87.545  108.916 1.00 76.30  ? 90   DA  I N3    1 
ATOM   7790  C  C4    . DA  I 5 90  ? 138.595 87.266  108.898 1.00 76.30  ? 90   DA  I C4    1 
ATOM   7791  P  P     . DA  I 5 91  ? 139.379 92.996  112.320 1.00 70.26  ? 91   DA  I P     1 
ATOM   7792  O  OP1   . DA  I 5 91  ? 139.950 94.176  111.641 1.00 70.26  ? 91   DA  I OP1   1 
ATOM   7793  O  OP2   . DA  I 5 91  ? 140.093 92.428  113.480 1.00 70.26  ? 91   DA  I OP2   1 
ATOM   7794  O  "O5'" . DA  I 5 91  ? 137.860 93.282  112.713 1.00 70.26  ? 91   DA  I "O5'" 1 
ATOM   7795  C  "C5'" . DA  I 5 91  ? 136.893 93.444  111.695 1.00 70.26  ? 91   DA  I "C5'" 1 
ATOM   7796  C  "C4'" . DA  I 5 91  ? 135.621 92.668  111.990 1.00 70.26  ? 91   DA  I "C4'" 1 
ATOM   7797  O  "O4'" . DA  I 5 91  ? 135.793 91.299  111.595 1.00 70.26  ? 91   DA  I "O4'" 1 
ATOM   7798  C  "C3'" . DA  I 5 91  ? 135.138 92.617  113.433 1.00 70.26  ? 91   DA  I "C3'" 1 
ATOM   7799  O  "O3'" . DA  I 5 91  ? 133.701 92.594  113.418 1.00 70.26  ? 91   DA  I "O3'" 1 
ATOM   7800  C  "C2'" . DA  I 5 91  ? 135.704 91.296  113.917 1.00 70.26  ? 91   DA  I "C2'" 1 
ATOM   7801  C  "C1'" . DA  I 5 91  ? 135.498 90.451  112.680 1.00 70.26  ? 91   DA  I "C1'" 1 
ATOM   7802  N  N9    . DA  I 5 91  ? 136.380 89.312  112.559 1.00 70.26  ? 91   DA  I N9    1 
ATOM   7803  C  C8    . DA  I 5 91  ? 137.733 89.321  112.640 1.00 70.26  ? 91   DA  I C8    1 
ATOM   7804  N  N7    . DA  I 5 91  ? 138.278 88.154  112.435 1.00 70.26  ? 91   DA  I N7    1 
ATOM   7805  C  C5    . DA  I 5 91  ? 137.209 87.333  112.175 1.00 70.26  ? 91   DA  I C5    1 
ATOM   7806  C  C6    . DA  I 5 91  ? 137.126 85.973  111.887 1.00 70.26  ? 91   DA  I C6    1 
ATOM   7807  N  N6    . DA  I 5 91  ? 138.196 85.182  111.798 1.00 70.26  ? 91   DA  I N6    1 
ATOM   7808  N  N1    . DA  I 5 91  ? 135.903 85.449  111.687 1.00 70.26  ? 91   DA  I N1    1 
ATOM   7809  C  C2    . DA  I 5 91  ? 134.837 86.249  111.779 1.00 70.26  ? 91   DA  I C2    1 
ATOM   7810  N  N3    . DA  I 5 91  ? 134.797 87.546  112.049 1.00 70.26  ? 91   DA  I N3    1 
ATOM   7811  C  C4    . DA  I 5 91  ? 136.029 88.029  112.237 1.00 70.26  ? 91   DA  I C4    1 
ATOM   7812  P  P     . DC  I 5 92  ? 132.840 92.967  114.721 1.00 71.46  ? 92   DC  I P     1 
ATOM   7813  O  OP1   . DC  I 5 92  ? 131.959 94.079  114.325 1.00 71.46  ? 92   DC  I OP1   1 
ATOM   7814  O  OP2   . DC  I 5 92  ? 133.765 93.117  115.860 1.00 71.46  ? 92   DC  I OP2   1 
ATOM   7815  O  "O5'" . DC  I 5 92  ? 131.897 91.696  114.976 1.00 71.46  ? 92   DC  I "O5'" 1 
ATOM   7816  C  "C5'" . DC  I 5 92  ? 131.799 90.671  113.997 1.00 71.46  ? 92   DC  I "C5'" 1 
ATOM   7817  C  "C4'" . DC  I 5 92  ? 131.434 89.329  114.620 1.00 71.46  ? 92   DC  I "C4'" 1 
ATOM   7818  O  "O4'" . DC  I 5 92  ? 132.513 88.379  114.429 1.00 71.46  ? 92   DC  I "O4'" 1 
ATOM   7819  C  "C3'" . DC  I 5 92  ? 131.164 89.342  116.113 1.00 71.46  ? 92   DC  I "C3'" 1 
ATOM   7820  O  "O3'" . DC  I 5 92  ? 130.160 88.362  116.399 1.00 71.46  ? 92   DC  I "O3'" 1 
ATOM   7821  C  "C2'" . DC  I 5 92  ? 132.519 88.913  116.654 1.00 71.46  ? 92   DC  I "C2'" 1 
ATOM   7822  C  "C1'" . DC  I 5 92  ? 132.832 87.811  115.670 1.00 71.46  ? 92   DC  I "C1'" 1 
ATOM   7823  N  N1    . DC  I 5 92  ? 134.258 87.396  115.609 1.00 71.46  ? 92   DC  I N1    1 
ATOM   7824  C  C2    . DC  I 5 92  ? 134.579 86.060  115.390 1.00 71.46  ? 92   DC  I C2    1 
ATOM   7825  O  O2    . DC  I 5 92  ? 133.669 85.233  115.309 1.00 71.46  ? 92   DC  I O2    1 
ATOM   7826  N  N3    . DC  I 5 92  ? 135.880 85.703  115.296 1.00 71.46  ? 92   DC  I N3    1 
ATOM   7827  C  C4    . DC  I 5 92  ? 136.829 86.626  115.394 1.00 71.46  ? 92   DC  I C4    1 
ATOM   7828  N  N4    . DC  I 5 92  ? 138.097 86.234  115.290 1.00 71.46  ? 92   DC  I N4    1 
ATOM   7829  C  C5    . DC  I 5 92  ? 136.520 87.993  115.599 1.00 71.46  ? 92   DC  I C5    1 
ATOM   7830  C  C6    . DC  I 5 92  ? 135.233 88.327  115.695 1.00 71.46  ? 92   DC  I C6    1 
ATOM   7831  P  P     . DC  I 5 93  ? 128.927 88.685  117.382 1.00 80.13  ? 93   DC  I P     1 
ATOM   7832  O  OP1   . DC  I 5 93  ? 127.816 89.133  116.516 1.00 80.13  ? 93   DC  I OP1   1 
ATOM   7833  O  OP2   . DC  I 5 93  ? 129.394 89.552  118.484 1.00 80.13  ? 93   DC  I OP2   1 
ATOM   7834  O  "O5'" . DC  I 5 93  ? 128.512 87.257  117.983 1.00 80.13  ? 93   DC  I "O5'" 1 
ATOM   7835  C  "C5'" . DC  I 5 93  ? 128.644 86.078  117.196 1.00 80.13  ? 93   DC  I "C5'" 1 
ATOM   7836  C  "C4'" . DC  I 5 93  ? 129.197 84.921  118.013 1.00 80.13  ? 93   DC  I "C4'" 1 
ATOM   7837  O  "O4'" . DC  I 5 93  ? 130.620 84.752  117.770 1.00 80.13  ? 93   DC  I "O4'" 1 
ATOM   7838  C  "C3'" . DC  I 5 93  ? 129.048 85.048  119.528 1.00 80.13  ? 93   DC  I "C3'" 1 
ATOM   7839  O  "O3'" . DC  I 5 93  ? 128.625 83.821  120.049 1.00 80.13  ? 93   DC  I "O3'" 1 
ATOM   7840  C  "C2'" . DC  I 5 93  ? 130.465 85.363  119.981 1.00 80.13  ? 93   DC  I "C2'" 1 
ATOM   7841  C  "C1'" . DC  I 5 93  ? 131.257 84.529  119.004 1.00 80.13  ? 93   DC  I "C1'" 1 
ATOM   7842  N  N1    . DC  I 5 93  ? 132.655 84.949  118.892 1.00 80.13  ? 93   DC  I N1    1 
ATOM   7843  C  C2    . DC  I 5 93  ? 133.660 84.000  118.762 1.00 80.13  ? 93   DC  I C2    1 
ATOM   7844  O  O2    . DC  I 5 93  ? 133.360 82.808  118.747 1.00 80.13  ? 93   DC  I O2    1 
ATOM   7845  N  N3    . DC  I 5 93  ? 134.942 84.420  118.659 1.00 80.13  ? 93   DC  I N3    1 
ATOM   7846  C  C4    . DC  I 5 93  ? 135.220 85.719  118.683 1.00 80.13  ? 93   DC  I C4    1 
ATOM   7847  N  N4    . DC  I 5 93  ? 136.494 86.100  118.575 1.00 80.13  ? 93   DC  I N4    1 
ATOM   7848  C  C5    . DC  I 5 93  ? 134.206 86.689  118.824 1.00 80.13  ? 93   DC  I C5    1 
ATOM   7849  C  C6    . DC  I 5 93  ? 132.952 86.263  118.926 1.00 80.13  ? 93   DC  I C6    1 
ATOM   7850  P  P     . DG  I 5 94  ? 127.819 83.743  121.433 1.00 86.40  ? 94   DG  I P     1 
ATOM   7851  O  OP1   . DG  I 5 94  ? 126.392 83.523  121.119 1.00 86.40  ? 94   DG  I OP1   1 
ATOM   7852  O  OP2   . DG  I 5 94  ? 128.228 84.867  122.300 1.00 86.40  ? 94   DG  I OP2   1 
ATOM   7853  O  "O5'" . DG  I 5 94  ? 128.407 82.424  122.092 1.00 86.40  ? 94   DG  I "O5'" 1 
ATOM   7854  C  "C5'" . DG  I 5 94  ? 128.814 81.365  121.254 1.00 86.40  ? 94   DG  I "C5'" 1 
ATOM   7855  C  "C4'" . DG  I 5 94  ? 130.008 80.661  121.845 1.00 86.40  ? 94   DG  I "C4'" 1 
ATOM   7856  O  "O4'" . DG  I 5 94  ? 131.236 81.294  121.403 1.00 86.40  ? 94   DG  I "O4'" 1 
ATOM   7857  C  "C3'" . DG  I 5 94  ? 130.033 80.667  123.365 1.00 86.40  ? 94   DG  I "C3'" 1 
ATOM   7858  O  "O3'" . DG  I 5 94  ? 130.135 79.332  123.819 1.00 86.40  ? 94   DG  I "O3'" 1 
ATOM   7859  C  "C2'" . DG  I 5 94  ? 131.270 81.518  123.712 1.00 86.40  ? 94   DG  I "C2'" 1 
ATOM   7860  C  "C1'" . DG  I 5 94  ? 132.137 81.347  122.475 1.00 86.40  ? 94   DG  I "C1'" 1 
ATOM   7861  N  N9    . DG  I 5 94  ? 133.064 82.456  122.227 1.00 86.40  ? 94   DG  I N9    1 
ATOM   7862  C  C8    . DG  I 5 94  ? 132.740 83.779  122.115 1.00 86.40  ? 94   DG  I C8    1 
ATOM   7863  N  N7    . DG  I 5 94  ? 133.761 84.551  121.895 1.00 86.40  ? 94   DG  I N7    1 
ATOM   7864  C  C5    . DG  I 5 94  ? 134.842 83.693  121.898 1.00 86.40  ? 94   DG  I C5    1 
ATOM   7865  C  C6    . DG  I 5 94  ? 136.214 83.967  121.728 1.00 86.40  ? 94   DG  I C6    1 
ATOM   7866  O  O6    . DG  I 5 94  ? 136.759 85.059  121.531 1.00 86.40  ? 94   DG  I O6    1 
ATOM   7867  N  N1    . DG  I 5 94  ? 136.980 82.819  121.802 1.00 86.40  ? 94   DG  I N1    1 
ATOM   7868  C  C2    . DG  I 5 94  ? 136.484 81.564  122.015 1.00 86.40  ? 94   DG  I C2    1 
ATOM   7869  N  N2    . DG  I 5 94  ? 137.383 80.577  122.057 1.00 86.40  ? 94   DG  I N2    1 
ATOM   7870  N  N3    . DG  I 5 94  ? 135.197 81.289  122.178 1.00 86.40  ? 94   DG  I N3    1 
ATOM   7871  C  C4    . DG  I 5 94  ? 134.436 82.398  122.105 1.00 86.40  ? 94   DG  I C4    1 
ATOM   7872  P  P     . DC  I 5 95  ? 130.040 78.983  125.381 1.00 90.90  ? 95   DC  I P     1 
ATOM   7873  O  OP1   . DC  I 5 95  ? 129.432 77.639  125.488 1.00 90.90  ? 95   DC  I OP1   1 
ATOM   7874  O  OP2   . DC  I 5 95  ? 129.426 80.131  126.080 1.00 90.90  ? 95   DC  I OP2   1 
ATOM   7875  O  "O5'" . DC  I 5 95  ? 131.564 78.871  125.818 1.00 90.90  ? 95   DC  I "O5'" 1 
ATOM   7876  C  "C5'" . DC  I 5 95  ? 132.459 78.143  125.005 1.00 90.90  ? 95   DC  I "C5'" 1 
ATOM   7877  C  "C4'" . DC  I 5 95  ? 133.831 78.157  125.614 1.00 90.90  ? 95   DC  I "C4'" 1 
ATOM   7878  O  "O4'" . DC  I 5 95  ? 134.572 79.266  125.057 1.00 90.90  ? 95   DC  I "O4'" 1 
ATOM   7879  C  "C3'" . DC  I 5 95  ? 133.840 78.341  127.132 1.00 90.90  ? 95   DC  I "C3'" 1 
ATOM   7880  O  "O3'" . DC  I 5 95  ? 134.589 77.290  127.736 1.00 90.90  ? 95   DC  I "O3'" 1 
ATOM   7881  C  "C2'" . DC  I 5 95  ? 134.475 79.714  127.338 1.00 90.90  ? 95   DC  I "C2'" 1 
ATOM   7882  C  "C1'" . DC  I 5 95  ? 135.292 79.893  126.076 1.00 90.90  ? 95   DC  I "C1'" 1 
ATOM   7883  N  N1    . DC  I 5 95  ? 135.459 81.314  125.723 1.00 90.90  ? 95   DC  I N1    1 
ATOM   7884  C  C2    . DC  I 5 95  ? 136.729 81.812  125.475 1.00 90.90  ? 95   DC  I C2    1 
ATOM   7885  O  O2    . DC  I 5 95  ? 137.696 81.052  125.552 1.00 90.90  ? 95   DC  I O2    1 
ATOM   7886  N  N3    . DC  I 5 95  ? 136.870 83.117  125.168 1.00 90.90  ? 95   DC  I N3    1 
ATOM   7887  C  C4    . DC  I 5 95  ? 135.803 83.906  125.102 1.00 90.90  ? 95   DC  I C4    1 
ATOM   7888  N  N4    . DC  I 5 95  ? 135.997 85.186  124.790 1.00 90.90  ? 95   DC  I N4    1 
ATOM   7889  C  C5    . DC  I 5 95  ? 134.493 83.418  125.350 1.00 90.90  ? 95   DC  I C5    1 
ATOM   7890  C  C6    . DC  I 5 95  ? 134.368 82.126  125.654 1.00 90.90  ? 95   DC  I C6    1 
ATOM   7891  P  P     . DC  I 5 96  ? 134.837 77.223  129.326 1.00 90.47  ? 96   DC  I P     1 
ATOM   7892  O  OP1   . DC  I 5 96  ? 134.959 75.788  129.664 1.00 90.47  ? 96   DC  I OP1   1 
ATOM   7893  O  OP2   . DC  I 5 96  ? 133.837 78.042  130.044 1.00 90.47  ? 96   DC  I OP2   1 
ATOM   7894  O  "O5'" . DC  I 5 96  ? 136.269 77.905  129.495 1.00 90.47  ? 96   DC  I "O5'" 1 
ATOM   7895  C  "C5'" . DC  I 5 96  ? 137.293 77.569  128.574 1.00 90.47  ? 96   DC  I "C5'" 1 
ATOM   7896  C  "C4'" . DC  I 5 96  ? 138.596 78.247  128.923 1.00 90.47  ? 96   DC  I "C4'" 1 
ATOM   7897  O  "O4'" . DC  I 5 96  ? 138.616 79.590  128.378 1.00 90.47  ? 96   DC  I "O4'" 1 
ATOM   7898  C  "C3'" . DC  I 5 96  ? 138.880 78.384  130.416 1.00 90.47  ? 96   DC  I "C3'" 1 
ATOM   7899  O  "O3'" . DC  I 5 96  ? 140.251 78.026  130.655 1.00 90.47  ? 96   DC  I "O3'" 1 
ATOM   7900  C  "C2'" . DC  I 5 96  ? 138.615 79.868  130.680 1.00 90.47  ? 96   DC  I "C2'" 1 
ATOM   7901  C  "C1'" . DC  I 5 96  ? 139.076 80.468  129.369 1.00 90.47  ? 96   DC  I "C1'" 1 
ATOM   7902  N  N1    . DC  I 5 96  ? 138.531 81.797  129.084 1.00 90.47  ? 96   DC  I N1    1 
ATOM   7903  C  C2    . DC  I 5 96  ? 139.398 82.831  128.769 1.00 90.47  ? 96   DC  I C2    1 
ATOM   7904  O  O2    . DC  I 5 96  ? 140.611 82.627  128.805 1.00 90.47  ? 96   DC  I O2    1 
ATOM   7905  N  N3    . DC  I 5 96  ? 138.889 84.051  128.489 1.00 90.47  ? 96   DC  I N3    1 
ATOM   7906  C  C4    . DC  I 5 96  ? 137.572 84.233  128.472 1.00 90.47  ? 96   DC  I C4    1 
ATOM   7907  N  N4    . DC  I 5 96  ? 137.115 85.450  128.174 1.00 90.47  ? 96   DC  I N4    1 
ATOM   7908  C  C5    . DC  I 5 96  ? 136.667 83.176  128.755 1.00 90.47  ? 96   DC  I C5    1 
ATOM   7909  C  C6    . DC  I 5 96  ? 137.187 81.981  129.042 1.00 90.47  ? 96   DC  I C6    1 
ATOM   7910  P  P     . DA  I 5 97  ? 140.761 77.587  132.114 1.00 84.81  ? 97   DA  I P     1 
ATOM   7911  O  OP1   . DA  I 5 97  ? 141.407 76.268  131.963 1.00 84.81  ? 97   DA  I OP1   1 
ATOM   7912  O  OP2   . DA  I 5 97  ? 139.677 77.772  133.101 1.00 84.81  ? 97   DA  I OP2   1 
ATOM   7913  O  "O5'" . DA  I 5 97  ? 141.899 78.645  132.449 1.00 84.81  ? 97   DA  I "O5'" 1 
ATOM   7914  C  "C5'" . DA  I 5 97  ? 142.887 78.970  131.485 1.00 84.81  ? 97   DA  I "C5'" 1 
ATOM   7915  C  "C4'" . DA  I 5 97  ? 143.595 80.250  131.884 1.00 84.81  ? 97   DA  I "C4'" 1 
ATOM   7916  O  "O4'" . DA  I 5 97  ? 142.883 81.393  131.360 1.00 84.81  ? 97   DA  I "O4'" 1 
ATOM   7917  C  "C3'" . DA  I 5 97  ? 143.698 80.468  133.386 1.00 84.81  ? 97   DA  I "C3'" 1 
ATOM   7918  O  "O3'" . DA  I 5 97  ? 144.994 80.880  133.722 1.00 84.81  ? 97   DA  I "O3'" 1 
ATOM   7919  C  "C2'" . DA  I 5 97  ? 142.664 81.562  133.664 1.00 84.81  ? 97   DA  I "C2'" 1 
ATOM   7920  C  "C1'" . DA  I 5 97  ? 142.730 82.351  132.377 1.00 84.81  ? 97   DA  I "C1'" 1 
ATOM   7921  N  N9    . DA  I 5 97  ? 141.524 83.107  132.078 1.00 84.81  ? 97   DA  I N9    1 
ATOM   7922  C  C8    . DA  I 5 97  ? 140.234 82.676  132.172 1.00 84.81  ? 97   DA  I C8    1 
ATOM   7923  N  N7    . DA  I 5 97  ? 139.353 83.577  131.819 1.00 84.81  ? 97   DA  I N7    1 
ATOM   7924  C  C5    . DA  I 5 97  ? 140.123 84.673  131.479 1.00 84.81  ? 97   DA  I C5    1 
ATOM   7925  C  C6    . DA  I 5 97  ? 139.795 85.955  131.016 1.00 84.81  ? 97   DA  I C6    1 
ATOM   7926  N  N6    . DA  I 5 97  ? 138.540 86.362  130.819 1.00 84.81  ? 97   DA  I N6    1 
ATOM   7927  N  N1    . DA  I 5 97  ? 140.809 86.814  130.776 1.00 84.81  ? 97   DA  I N1    1 
ATOM   7928  C  C2    . DA  I 5 97  ? 142.061 86.401  130.975 1.00 84.81  ? 97   DA  I C2    1 
ATOM   7929  N  N3    . DA  I 5 97  ? 142.489 85.223  131.403 1.00 84.81  ? 97   DA  I N3    1 
ATOM   7930  C  C4    . DA  I 5 97  ? 141.461 84.398  131.636 1.00 84.81  ? 97   DA  I C4    1 
ATOM   7931  P  P     . DA  I 5 98  ? 145.709 80.246  135.007 1.00 82.62  ? 98   DA  I P     1 
ATOM   7932  O  OP1   . DA  I 5 98  ? 146.844 79.429  134.529 1.00 82.62  ? 98   DA  I OP1   1 
ATOM   7933  O  OP2   . DA  I 5 98  ? 144.656 79.655  135.858 1.00 82.62  ? 98   DA  I OP2   1 
ATOM   7934  O  "O5'" . DA  I 5 98  ? 146.266 81.517  135.781 1.00 82.62  ? 98   DA  I "O5'" 1 
ATOM   7935  C  "C5'" . DA  I 5 98  ? 145.535 82.716  135.740 1.00 82.62  ? 98   DA  I "C5'" 1 
ATOM   7936  C  "C4'" . DA  I 5 98  ? 146.407 83.838  135.233 1.00 82.62  ? 98   DA  I "C4'" 1 
ATOM   7937  O  "O4'" . DA  I 5 98  ? 145.648 84.709  134.361 1.00 82.62  ? 98   DA  I "O4'" 1 
ATOM   7938  C  "C3'" . DA  I 5 98  ? 146.891 84.753  136.308 1.00 82.62  ? 98   DA  I "C3'" 1 
ATOM   7939  O  "O3'" . DA  I 5 98  ? 147.944 85.506  135.820 1.00 82.62  ? 98   DA  I "O3'" 1 
ATOM   7940  C  "C2'" . DA  I 5 98  ? 145.661 85.610  136.526 1.00 82.62  ? 98   DA  I "C2'" 1 
ATOM   7941  C  "C1'" . DA  I 5 98  ? 145.186 85.823  135.101 1.00 82.62  ? 98   DA  I "C1'" 1 
ATOM   7942  N  N9    . DA  I 5 98  ? 143.744 85.865  134.945 1.00 82.62  ? 98   DA  I N9    1 
ATOM   7943  C  C8    . DA  I 5 98  ? 142.862 84.884  135.273 1.00 82.62  ? 98   DA  I C8    1 
ATOM   7944  N  N7    . DA  I 5 98  ? 141.619 85.174  134.993 1.00 82.62  ? 98   DA  I N7    1 
ATOM   7945  C  C5    . DA  I 5 98  ? 141.689 86.437  134.451 1.00 82.62  ? 98   DA  I C5    1 
ATOM   7946  C  C6    . DA  I 5 98  ? 140.706 87.304  133.965 1.00 82.62  ? 98   DA  I C6    1 
ATOM   7947  N  N6    . DA  I 5 98  ? 139.414 86.998  133.953 1.00 82.62  ? 98   DA  I N6    1 
ATOM   7948  N  N1    . DA  I 5 98  ? 141.102 88.497  133.490 1.00 82.62  ? 98   DA  I N1    1 
ATOM   7949  C  C2    . DA  I 5 98  ? 142.404 88.797  133.506 1.00 82.62  ? 98   DA  I C2    1 
ATOM   7950  N  N3    . DA  I 5 98  ? 143.423 88.061  133.949 1.00 82.62  ? 98   DA  I N3    1 
ATOM   7951  C  C4    . DA  I 5 98  ? 142.991 86.882  134.411 1.00 82.62  ? 98   DA  I C4    1 
ATOM   7952  P  P     . DG  I 5 99  ? 148.976 86.170  136.842 1.00 81.91  ? 99   DG  I P     1 
ATOM   7953  O  OP1   . DG  I 5 99  ? 150.233 86.450  136.115 1.00 81.91  ? 99   DG  I OP1   1 
ATOM   7954  O  OP2   . DG  I 5 99  ? 149.003 85.347  138.072 1.00 81.91  ? 99   DG  I OP2   1 
ATOM   7955  O  "O5'" . DG  I 5 99  ? 148.255 87.548  137.170 1.00 81.91  ? 99   DG  I "O5'" 1 
ATOM   7956  C  "C5'" . DG  I 5 99  ? 148.148 88.519  136.154 1.00 81.91  ? 99   DG  I "C5'" 1 
ATOM   7957  C  "C4'" . DG  I 5 99  ? 147.135 89.578  136.521 1.00 81.91  ? 99   DG  I "C4'" 1 
ATOM   7958  O  "O4'" . DG  I 5 99  ? 145.770 89.092  136.362 1.00 81.91  ? 99   DG  I "O4'" 1 
ATOM   7959  C  "C3'" . DG  I 5 99  ? 147.249 90.072  137.961 1.00 81.91  ? 99   DG  I "C3'" 1 
ATOM   7960  O  "O3'" . DG  I 5 99  ? 147.206 91.474  137.956 1.00 81.91  ? 99   DG  I "O3'" 1 
ATOM   7961  C  "C2'" . DG  I 5 99  ? 145.991 89.478  138.610 1.00 81.91  ? 99   DG  I "C2'" 1 
ATOM   7962  C  "C1'" . DG  I 5 99  ? 145.033 89.589  137.443 1.00 81.91  ? 99   DG  I "C1'" 1 
ATOM   7963  N  N9    . DG  I 5 99  ? 143.790 88.840  137.582 1.00 81.91  ? 99   DG  I N9    1 
ATOM   7964  C  C8    . DG  I 5 99  ? 143.608 87.671  138.261 1.00 81.91  ? 99   DG  I C8    1 
ATOM   7965  N  N7    . DG  I 5 99  ? 142.389 87.230  138.224 1.00 81.91  ? 99   DG  I N7    1 
ATOM   7966  C  C5    . DG  I 5 99  ? 141.702 88.198  137.520 1.00 81.91  ? 99   DG  I C5    1 
ATOM   7967  C  C6    . DG  I 5 99  ? 140.341 88.271  137.191 1.00 81.91  ? 99   DG  I C6    1 
ATOM   7968  O  O6    . DG  I 5 99  ? 139.453 87.467  137.463 1.00 81.91  ? 99   DG  I O6    1 
ATOM   7969  N  N1    . DG  I 5 99  ? 140.045 89.407  136.471 1.00 81.91  ? 99   DG  I N1    1 
ATOM   7970  C  C2    . DG  I 5 99  ? 140.946 90.367  136.120 1.00 81.91  ? 99   DG  I C2    1 
ATOM   7971  N  N2    . DG  I 5 99  ? 140.464 91.397  135.420 1.00 81.91  ? 99   DG  I N2    1 
ATOM   7972  N  N3    . DG  I 5 99  ? 142.237 90.317  136.422 1.00 81.91  ? 99   DG  I N3    1 
ATOM   7973  C  C4    . DG  I 5 99  ? 142.542 89.203  137.124 1.00 81.91  ? 99   DG  I C4    1 
ATOM   7974  P  P     . DG  I 5 100 ? 148.560 92.319  138.111 1.00 82.22  ? 100  DG  I P     1 
ATOM   7975  O  OP1   . DG  I 5 100 ? 149.589 91.669  137.276 1.00 82.22  ? 100  DG  I OP1   1 
ATOM   7976  O  OP2   . DG  I 5 100 ? 148.816 92.525  139.550 1.00 82.22  ? 100  DG  I OP2   1 
ATOM   7977  O  "O5'" . DG  I 5 100 ? 148.185 93.728  137.469 1.00 82.22  ? 100  DG  I "O5'" 1 
ATOM   7978  C  "C5'" . DG  I 5 100 ? 147.505 93.776  136.218 1.00 82.22  ? 100  DG  I "C5'" 1 
ATOM   7979  C  "C4'" . DG  I 5 100 ? 146.364 94.791  136.227 1.00 82.22  ? 100  DG  I "C4'" 1 
ATOM   7980  O  "O4'" . DG  I 5 100 ? 145.112 94.146  136.561 1.00 82.22  ? 100  DG  I "O4'" 1 
ATOM   7981  C  "C3'" . DG  I 5 100 ? 146.502 95.962  137.185 1.00 82.22  ? 100  DG  I "C3'" 1 
ATOM   7982  O  "O3'" . DG  I 5 100 ? 145.915 97.112  136.570 1.00 82.22  ? 100  DG  I "O3'" 1 
ATOM   7983  C  "C2'" . DG  I 5 100 ? 145.696 95.478  138.390 1.00 82.22  ? 100  DG  I "C2'" 1 
ATOM   7984  C  "C1'" . DG  I 5 100 ? 144.548 94.747  137.711 1.00 82.22  ? 100  DG  I "C1'" 1 
ATOM   7985  N  N9    . DG  I 5 100 ? 143.974 93.650  138.479 1.00 82.22  ? 100  DG  I N9    1 
ATOM   7986  C  C8    . DG  I 5 100 ? 144.658 92.724  139.218 1.00 82.22  ? 100  DG  I C8    1 
ATOM   7987  N  N7    . DG  I 5 100 ? 143.894 91.822  139.754 1.00 82.22  ? 100  DG  I N7    1 
ATOM   7988  C  C5    . DG  I 5 100 ? 142.625 92.167  139.340 1.00 82.22  ? 100  DG  I C5    1 
ATOM   7989  C  C6    . DG  I 5 100 ? 141.398 91.555  139.615 1.00 82.22  ? 100  DG  I C6    1 
ATOM   7990  O  O6    . DG  I 5 100 ? 141.181 90.550  140.297 1.00 82.22  ? 100  DG  I O6    1 
ATOM   7991  N  N1    . DG  I 5 100 ? 140.350 92.218  139.014 1.00 82.22  ? 100  DG  I N1    1 
ATOM   7992  C  C2    . DG  I 5 100 ? 140.464 93.332  138.238 1.00 82.22  ? 100  DG  I C2    1 
ATOM   7993  N  N2    . DG  I 5 100 ? 139.322 93.825  137.751 1.00 82.22  ? 100  DG  I N2    1 
ATOM   7994  N  N3    . DG  I 5 100 ? 141.613 93.925  137.968 1.00 82.22  ? 100  DG  I N3    1 
ATOM   7995  C  C4    . DG  I 5 100 ? 142.651 93.286  138.551 1.00 82.22  ? 100  DG  I C4    1 
ATOM   7996  P  P     . DG  I 5 101 ? 146.285 98.599  137.045 1.00 79.47  ? 101  DG  I P     1 
ATOM   7997  O  OP1   . DG  I 5 101 ? 146.838 99.301  135.872 1.00 79.47  ? 101  DG  I OP1   1 
ATOM   7998  O  OP2   . DG  I 5 101 ? 147.046 98.498  138.302 1.00 79.47  ? 101  DG  I OP2   1 
ATOM   7999  O  "O5'" . DG  I 5 101 ? 144.874 99.257  137.389 1.00 79.47  ? 101  DG  I "O5'" 1 
ATOM   8000  C  "C5'" . DG  I 5 101 ? 143.703 98.799  136.733 1.00 79.47  ? 101  DG  I "C5'" 1 
ATOM   8001  C  "C4'" . DG  I 5 101 ? 142.483 98.875  137.638 1.00 79.47  ? 101  DG  I "C4'" 1 
ATOM   8002  O  "O4'" . DG  I 5 101 ? 142.419 97.664  138.424 1.00 79.47  ? 101  DG  I "O4'" 1 
ATOM   8003  C  "C3'" . DG  I 5 101 ? 142.458 100.007 138.662 1.00 79.47  ? 101  DG  I "C3'" 1 
ATOM   8004  O  "O3'" . DG  I 5 101 ? 141.132 100.436 138.832 1.00 79.47  ? 101  DG  I "O3'" 1 
ATOM   8005  C  "C2'" . DG  I 5 101 ? 142.951 99.321  139.921 1.00 79.47  ? 101  DG  I "C2'" 1 
ATOM   8006  C  "C1'" . DG  I 5 101 ? 142.225 98.013  139.769 1.00 79.47  ? 101  DG  I "C1'" 1 
ATOM   8007  N  N9    . DG  I 5 101 ? 142.759 96.945  140.592 1.00 79.47  ? 101  DG  I N9    1 
ATOM   8008  C  C8    . DG  I 5 101 ? 144.045 96.794  141.040 1.00 79.47  ? 101  DG  I C8    1 
ATOM   8009  N  N7    . DG  I 5 101 ? 144.230 95.698  141.719 1.00 79.47  ? 101  DG  I N7    1 
ATOM   8010  C  C5    . DG  I 5 101 ? 142.985 95.100  141.725 1.00 79.47  ? 101  DG  I C5    1 
ATOM   8011  C  C6    . DG  I 5 101 ? 142.562 93.901  142.310 1.00 79.47  ? 101  DG  I C6    1 
ATOM   8012  O  O6    . DG  I 5 101 ? 143.224 93.089  142.969 1.00 79.47  ? 101  DG  I O6    1 
ATOM   8013  N  N1    . DG  I 5 101 ? 141.215 93.670  142.070 1.00 79.47  ? 101  DG  I N1    1 
ATOM   8014  C  C2    . DG  I 5 101 ? 140.386 94.500  141.356 1.00 79.47  ? 101  DG  I C2    1 
ATOM   8015  N  N2    . DG  I 5 101 ? 139.116 94.115  141.231 1.00 79.47  ? 101  DG  I N2    1 
ATOM   8016  N  N3    . DG  I 5 101 ? 140.773 95.621  140.806 1.00 79.47  ? 101  DG  I N3    1 
ATOM   8017  C  C4    . DG  I 5 101 ? 142.076 95.857  141.030 1.00 79.47  ? 101  DG  I C4    1 
ATOM   8018  P  P     . DG  I 5 102 ? 140.747 101.956 138.533 1.00 77.47  ? 102  DG  I P     1 
ATOM   8019  O  OP1   . DG  I 5 102 ? 141.039 102.204 137.109 1.00 77.47  ? 102  DG  I OP1   1 
ATOM   8020  O  OP2   . DG  I 5 102 ? 141.440 102.753 139.567 1.00 77.47  ? 102  DG  I OP2   1 
ATOM   8021  O  "O5'" . DG  I 5 102 ? 139.162 102.039 138.791 1.00 77.47  ? 102  DG  I "O5'" 1 
ATOM   8022  C  "C5'" . DG  I 5 102 ? 138.250 101.189 138.089 1.00 77.47  ? 102  DG  I "C5'" 1 
ATOM   8023  C  "C4'" . DG  I 5 102 ? 137.128 100.671 138.995 1.00 77.47  ? 102  DG  I "C4'" 1 
ATOM   8024  O  "O4'" . DG  I 5 102 ? 137.604 99.594  139.827 1.00 77.47  ? 102  DG  I "O4'" 1 
ATOM   8025  C  "C3'" . DG  I 5 102 ? 136.482 101.662 139.948 1.00 77.47  ? 102  DG  I "C3'" 1 
ATOM   8026  O  "O3'" . DG  I 5 102 ? 135.116 101.331 140.062 1.00 77.47  ? 102  DG  I "O3'" 1 
ATOM   8027  C  "C2'" . DG  I 5 102 ? 137.223 101.399 141.255 1.00 77.47  ? 102  DG  I "C2'" 1 
ATOM   8028  C  "C1'" . DG  I 5 102 ? 137.394 99.896  141.194 1.00 77.47  ? 102  DG  I "C1'" 1 
ATOM   8029  N  N9    . DG  I 5 102 ? 138.584 99.409  141.853 1.00 77.47  ? 102  DG  I N9    1 
ATOM   8030  C  C8    . DG  I 5 102 ? 139.843 99.919  141.719 1.00 77.47  ? 102  DG  I C8    1 
ATOM   8031  N  N7    . DG  I 5 102 ? 140.739 99.258  142.378 1.00 77.47  ? 102  DG  I N7    1 
ATOM   8032  C  C5    . DG  I 5 102 ? 140.050 98.207  142.929 1.00 77.47  ? 102  DG  I C5    1 
ATOM   8033  C  C6    . DG  I 5 102 ? 140.522 97.156  143.717 1.00 77.47  ? 102  DG  I C6    1 
ATOM   8034  O  O6    . DG  I 5 102 ? 141.683 96.952  144.102 1.00 77.47  ? 102  DG  I O6    1 
ATOM   8035  N  N1    . DG  I 5 102 ? 139.496 96.319  144.109 1.00 77.47  ? 102  DG  I N1    1 
ATOM   8036  C  C2    . DG  I 5 102 ? 138.178 96.466  143.746 1.00 77.47  ? 102  DG  I C2    1 
ATOM   8037  N  N2    . DG  I 5 102 ? 137.332 95.545  144.214 1.00 77.47  ? 102  DG  I N2    1 
ATOM   8038  N  N3    . DG  I 5 102 ? 137.726 97.447  142.989 1.00 77.47  ? 102  DG  I N3    1 
ATOM   8039  C  C4    . DG  I 5 102 ? 138.718 98.274  142.612 1.00 77.47  ? 102  DG  I C4    1 
ATOM   8040  P  P     . DA  I 5 103 ? 134.063 102.387 140.645 1.00 78.98  ? 103  DA  I P     1 
ATOM   8041  O  OP1   . DA  I 5 103 ? 132.951 102.451 139.671 1.00 78.98  ? 103  DA  I OP1   1 
ATOM   8042  O  OP2   . DA  I 5 103 ? 134.804 103.620 140.990 1.00 78.98  ? 103  DA  I OP2   1 
ATOM   8043  O  "O5'" . DA  I 5 103 ? 133.556 101.706 142.009 1.00 78.98  ? 103  DA  I "O5'" 1 
ATOM   8044  C  "C5'" . DA  I 5 103 ? 133.340 100.297 142.067 1.00 78.98  ? 103  DA  I "C5'" 1 
ATOM   8045  C  "C4'" . DA  I 5 103 ? 133.251 99.811  143.502 1.00 78.98  ? 103  DA  I "C4'" 1 
ATOM   8046  O  "O4'" . DA  I 5 103 ? 134.522 99.232  143.901 1.00 78.98  ? 103  DA  I "O4'" 1 
ATOM   8047  C  "C3'" . DA  I 5 103 ? 132.929 100.885 144.536 1.00 78.98  ? 103  DA  I "C3'" 1 
ATOM   8048  O  "O3'" . DA  I 5 103 ? 131.969 100.394 145.453 1.00 78.98  ? 103  DA  I "O3'" 1 
ATOM   8049  C  "C2'" . DA  I 5 103 ? 134.275 101.116 145.201 1.00 78.98  ? 103  DA  I "C2'" 1 
ATOM   8050  C  "C1'" . DA  I 5 103 ? 134.879 99.734  145.161 1.00 78.98  ? 103  DA  I "C1'" 1 
ATOM   8051  N  N9    . DA  I 5 103 ? 136.335 99.761  145.244 1.00 78.98  ? 103  DA  I N9    1 
ATOM   8052  C  C8    . DA  I 5 103 ? 137.158 100.648 144.630 1.00 78.98  ? 103  DA  I C8    1 
ATOM   8053  N  N7    . DA  I 5 103 ? 138.421 100.467 144.887 1.00 78.98  ? 103  DA  I N7    1 
ATOM   8054  C  C5    . DA  I 5 103 ? 138.433 99.388  145.731 1.00 78.98  ? 103  DA  I C5    1 
ATOM   8055  C  C6    . DA  I 5 103 ? 139.475 98.710  146.363 1.00 78.98  ? 103  DA  I C6    1 
ATOM   8056  N  N6    . DA  I 5 103 ? 140.753 99.043  146.207 1.00 78.98  ? 103  DA  I N6    1 
ATOM   8057  N  N1    . DA  I 5 103 ? 139.162 97.665  147.143 1.00 78.98  ? 103  DA  I N1    1 
ATOM   8058  C  C2    . DA  I 5 103 ? 137.877 97.340  147.291 1.00 78.98  ? 103  DA  I C2    1 
ATOM   8059  N  N3    . DA  I 5 103 ? 136.804 97.915  146.752 1.00 78.98  ? 103  DA  I N3    1 
ATOM   8060  C  C4    . DA  I 5 103 ? 137.157 98.941  145.975 1.00 78.98  ? 103  DA  I C4    1 
ATOM   8061  P  P     . DT  I 5 104 ? 131.219 101.369 146.493 1.00 84.18  ? 104  DT  I P     1 
ATOM   8062  O  OP1   . DT  I 5 104 ? 129.779 101.277 146.217 1.00 84.18  ? 104  DT  I OP1   1 
ATOM   8063  O  OP2   . DT  I 5 104 ? 131.839 102.708 146.538 1.00 84.18  ? 104  DT  I OP2   1 
ATOM   8064  O  "O5'" . DT  I 5 104 ? 131.462 100.646 147.885 1.00 84.18  ? 104  DT  I "O5'" 1 
ATOM   8065  C  "C5'" . DT  I 5 104 ? 131.488 99.235  147.924 1.00 84.18  ? 104  DT  I "C5'" 1 
ATOM   8066  C  "C4'" . DT  I 5 104 ? 132.279 98.758  149.115 1.00 84.18  ? 104  DT  I "C4'" 1 
ATOM   8067  O  "O4'" . DT  I 5 104 ? 133.689 98.792  148.783 1.00 84.18  ? 104  DT  I "O4'" 1 
ATOM   8068  C  "C3'" . DT  I 5 104 ? 132.117 99.605  150.383 1.00 84.18  ? 104  DT  I "C3'" 1 
ATOM   8069  O  "O3'" . DT  I 5 104 ? 131.725 98.781  151.480 1.00 84.18  ? 104  DT  I "O3'" 1 
ATOM   8070  C  "C2'" . DT  I 5 104 ? 133.500 100.198 150.600 1.00 84.18  ? 104  DT  I "C2'" 1 
ATOM   8071  C  "C1'" . DT  I 5 104 ? 134.394 99.191  149.919 1.00 84.18  ? 104  DT  I "C1'" 1 
ATOM   8072  N  N1    . DT  I 5 104 ? 135.671 99.773  149.504 1.00 84.18  ? 104  DT  I N1    1 
ATOM   8073  C  C2    . DT  I 5 104 ? 136.831 99.223  149.959 1.00 84.18  ? 104  DT  I C2    1 
ATOM   8074  O  O2    . DT  I 5 104 ? 136.866 98.268  150.705 1.00 84.18  ? 104  DT  I O2    1 
ATOM   8075  N  N3    . DT  I 5 104 ? 137.959 99.844  149.524 1.00 84.18  ? 104  DT  I N3    1 
ATOM   8076  C  C4    . DT  I 5 104 ? 138.036 100.932 148.690 1.00 84.18  ? 104  DT  I C4    1 
ATOM   8077  O  O4    . DT  I 5 104 ? 139.095 101.423 148.346 1.00 84.18  ? 104  DT  I O4    1 
ATOM   8078  C  C5    . DT  I 5 104 ? 136.787 101.453 148.243 1.00 84.18  ? 104  DT  I C5    1 
ATOM   8079  C  C7    . DT  I 5 104 ? 136.763 102.651 147.350 1.00 84.18  ? 104  DT  I C7    1 
ATOM   8080  C  C6    . DT  I 5 104 ? 135.673 100.847 148.652 1.00 84.18  ? 104  DT  I C6    1 
ATOM   8081  P  P     . DT  I 5 105 ? 131.482 99.406  152.945 1.00 89.83  ? 105  DT  I P     1 
ATOM   8082  O  OP1   . DT  I 5 105 ? 130.431 98.598  153.591 1.00 89.83  ? 105  DT  I OP1   1 
ATOM   8083  O  OP2   . DT  I 5 105 ? 131.340 100.876 152.882 1.00 89.83  ? 105  DT  I OP2   1 
ATOM   8084  O  "O5'" . DT  I 5 105 ? 132.837 99.111  153.716 1.00 89.83  ? 105  DT  I "O5'" 1 
ATOM   8085  C  "C5'" . DT  I 5 105 ? 133.299 97.784  153.868 1.00 89.83  ? 105  DT  I "C5'" 1 
ATOM   8086  C  "C4'" . DT  I 5 105 ? 134.531 97.754  154.748 1.00 89.83  ? 105  DT  I "C4'" 1 
ATOM   8087  O  "O4'" . DT  I 5 105 ? 135.652 98.343  154.045 1.00 89.83  ? 105  DT  I "O4'" 1 
ATOM   8088  C  "C3'" . DT  I 5 105 ? 134.392 98.527  156.052 1.00 89.83  ? 105  DT  I "C3'" 1 
ATOM   8089  O  "O3'" . DT  I 5 105 ? 134.945 97.782  157.121 1.00 89.83  ? 105  DT  I "O3'" 1 
ATOM   8090  C  "C2'" . DT  I 5 105 ? 135.180 99.811  155.789 1.00 89.83  ? 105  DT  I "C2'" 1 
ATOM   8091  C  "C1'" . DT  I 5 105 ? 136.266 99.310  154.865 1.00 89.83  ? 105  DT  I "C1'" 1 
ATOM   8092  N  N1    . DT  I 5 105 ? 136.877 100.348 153.981 1.00 89.83  ? 105  DT  I N1    1 
ATOM   8093  C  C2    . DT  I 5 105 ? 138.239 100.457 153.946 1.00 89.83  ? 105  DT  I C2    1 
ATOM   8094  O  O2    . DT  I 5 105 ? 138.977 99.786  154.637 1.00 89.83  ? 105  DT  I O2    1 
ATOM   8095  N  N3    . DT  I 5 105 ? 138.715 101.397 153.089 1.00 89.83  ? 105  DT  I N3    1 
ATOM   8096  C  C4    . DT  I 5 105 ? 137.990 102.203 152.252 1.00 89.83  ? 105  DT  I C4    1 
ATOM   8097  O  O4    . DT  I 5 105 ? 138.517 103.028 151.520 1.00 89.83  ? 105  DT  I O4    1 
ATOM   8098  C  C5    . DT  I 5 105 ? 136.571 102.046 152.323 1.00 89.83  ? 105  DT  I C5    1 
ATOM   8099  C  C7    . DT  I 5 105 ? 135.695 102.909 151.475 1.00 89.83  ? 105  DT  I C7    1 
ATOM   8100  C  C6    . DT  I 5 105 ? 136.078 101.123 153.165 1.00 89.83  ? 105  DT  I C6    1 
ATOM   8101  P  P     . DA  I 5 106 ? 134.558 98.155  158.634 1.00 90.82  ? 106  DA  I P     1 
ATOM   8102  O  OP1   . DA  I 5 106 ? 134.262 96.888  159.334 1.00 90.82  ? 106  DA  I OP1   1 
ATOM   8103  O  OP2   . DA  I 5 106 ? 133.592 99.270  158.639 1.00 90.82  ? 106  DA  I OP2   1 
ATOM   8104  O  "O5'" . DA  I 5 106 ? 135.888 98.758  159.236 1.00 90.82  ? 106  DA  I "O5'" 1 
ATOM   8105  C  "C5'" . DA  I 5 106 ? 137.118 98.123  159.008 1.00 90.82  ? 106  DA  I "C5'" 1 
ATOM   8106  C  "C4'" . DA  I 5 106 ? 138.243 98.963  159.569 1.00 90.82  ? 106  DA  I "C4'" 1 
ATOM   8107  O  "O4'" . DA  I 5 106 ? 138.795 99.806  158.527 1.00 90.82  ? 106  DA  I "O4'" 1 
ATOM   8108  C  "C3'" . DA  I 5 106 ? 137.811 99.883  160.701 1.00 90.82  ? 106  DA  I "C3'" 1 
ATOM   8109  O  "O3'" . DA  I 5 106 ? 138.751 99.837  161.739 1.00 90.82  ? 106  DA  I "O3'" 1 
ATOM   8110  C  "C2'" . DA  I 5 106 ? 137.756 101.267 160.033 1.00 90.82  ? 106  DA  I "C2'" 1 
ATOM   8111  C  "C1'" . DA  I 5 106 ? 138.802 101.152 158.935 1.00 90.82  ? 106  DA  I "C1'" 1 
ATOM   8112  N  N9    . DA  I 5 106 ? 138.482 101.951 157.759 1.00 90.82  ? 106  DA  I N9    1 
ATOM   8113  C  C8    . DA  I 5 106 ? 137.254 102.123 157.204 1.00 90.82  ? 106  DA  I C8    1 
ATOM   8114  N  N7    . DA  I 5 106 ? 137.252 102.872 156.133 1.00 90.82  ? 106  DA  I N7    1 
ATOM   8115  C  C5    . DA  I 5 106 ? 138.570 103.225 155.982 1.00 90.82  ? 106  DA  I C5    1 
ATOM   8116  C  C6    . DA  I 5 106 ? 139.227 104.021 155.039 1.00 90.82  ? 106  DA  I C6    1 
ATOM   8117  N  N6    . DA  I 5 106 ? 138.603 104.636 154.036 1.00 90.82  ? 106  DA  I N6    1 
ATOM   8118  N  N1    . DA  I 5 106 ? 140.555 104.175 155.169 1.00 90.82  ? 106  DA  I N1    1 
ATOM   8119  C  C2    . DA  I 5 106 ? 141.182 103.576 156.186 1.00 90.82  ? 106  DA  I C2    1 
ATOM   8120  N  N3    . DA  I 5 106 ? 140.670 102.799 157.133 1.00 90.82  ? 106  DA  I N3    1 
ATOM   8121  C  C4    . DA  I 5 106 ? 139.347 102.666 156.974 1.00 90.82  ? 106  DA  I C4    1 
ATOM   8122  P  P     . DC  I 5 107 ? 138.401 100.454 163.178 1.00 87.65  ? 107  DC  I P     1 
ATOM   8123  O  OP1   . DC  I 5 107 ? 138.869 99.503  164.210 1.00 87.65  ? 107  DC  I OP1   1 
ATOM   8124  O  OP2   . DC  I 5 107 ? 136.990 100.894 163.201 1.00 87.65  ? 107  DC  I OP2   1 
ATOM   8125  O  "O5'" . DC  I 5 107 ? 139.317 101.745 163.182 1.00 87.65  ? 107  DC  I "O5'" 1 
ATOM   8126  C  "C5'" . DC  I 5 107 ? 140.578 101.655 162.581 1.00 87.65  ? 107  DC  I "C5'" 1 
ATOM   8127  C  "C4'" . DC  I 5 107 ? 141.166 103.018 162.338 1.00 87.65  ? 107  DC  I "C4'" 1 
ATOM   8128  O  "O4'" . DC  I 5 107 ? 140.805 103.504 161.011 1.00 87.65  ? 107  DC  I "O4'" 1 
ATOM   8129  C  "C3'" . DC  I 5 107 ? 140.729 104.104 163.313 1.00 87.65  ? 107  DC  I "C3'" 1 
ATOM   8130  O  "O3'" . DC  I 5 107 ? 141.856 104.864 163.609 1.00 87.65  ? 107  DC  I "O3'" 1 
ATOM   8131  C  "C2'" . DC  I 5 107 ? 139.726 104.907 162.495 1.00 87.65  ? 107  DC  I "C2'" 1 
ATOM   8132  C  "C1'" . DC  I 5 107 ? 140.375 104.833 161.138 1.00 87.65  ? 107  DC  I "C1'" 1 
ATOM   8133  N  N1    . DC  I 5 107 ? 139.507 105.221 160.000 1.00 87.65  ? 107  DC  I N1    1 
ATOM   8134  C  C2    . DC  I 5 107 ? 140.081 105.835 158.890 1.00 87.65  ? 107  DC  I C2    1 
ATOM   8135  O  O2    . DC  I 5 107 ? 141.297 106.039 158.888 1.00 87.65  ? 107  DC  I O2    1 
ATOM   8136  N  N3    . DC  I 5 107 ? 139.291 106.204 157.860 1.00 87.65  ? 107  DC  I N3    1 
ATOM   8137  C  C4    . DC  I 5 107 ? 137.983 105.969 157.915 1.00 87.65  ? 107  DC  I C4    1 
ATOM   8138  N  N4    . DC  I 5 107 ? 137.234 106.342 156.875 1.00 87.65  ? 107  DC  I N4    1 
ATOM   8139  C  C5    . DC  I 5 107 ? 137.383 105.341 159.039 1.00 87.65  ? 107  DC  I C5    1 
ATOM   8140  C  C6    . DC  I 5 107 ? 138.178 104.986 160.049 1.00 87.65  ? 107  DC  I C6    1 
ATOM   8141  P  P     . DT  I 5 108 ? 142.006 105.675 164.982 1.00 83.67  ? 108  DT  I P     1 
ATOM   8142  O  OP1   . DT  I 5 108 ? 142.586 104.764 165.993 1.00 83.67  ? 108  DT  I OP1   1 
ATOM   8143  O  OP2   . DT  I 5 108 ? 140.724 106.346 165.279 1.00 83.67  ? 108  DT  I OP2   1 
ATOM   8144  O  "O5'" . DT  I 5 108 ? 143.066 106.804 164.572 1.00 83.67  ? 108  DT  I "O5'" 1 
ATOM   8145  C  "C5'" . DT  I 5 108 ? 144.059 106.499 163.565 1.00 83.67  ? 108  DT  I "C5'" 1 
ATOM   8146  C  "C4'" . DT  I 5 108 ? 144.313 107.678 162.636 1.00 83.67  ? 108  DT  I "C4'" 1 
ATOM   8147  O  "O4'" . DT  I 5 108 ? 143.239 107.820 161.674 1.00 83.67  ? 108  DT  I "O4'" 1 
ATOM   8148  C  "C3'" . DT  I 5 108 ? 144.444 109.022 163.331 1.00 83.67  ? 108  DT  I "C3'" 1 
ATOM   8149  O  "O3'" . DT  I 5 108 ? 145.499 109.751 162.735 1.00 83.67  ? 108  DT  I "O3'" 1 
ATOM   8150  C  "C2'" . DT  I 5 108 ? 143.092 109.673 163.059 1.00 83.67  ? 108  DT  I "C2'" 1 
ATOM   8151  C  "C1'" . DT  I 5 108 ? 142.816 109.159 161.667 1.00 83.67  ? 108  DT  I "C1'" 1 
ATOM   8152  N  N1    . DT  I 5 108 ? 141.394 109.185 161.266 1.00 83.67  ? 108  DT  I N1    1 
ATOM   8153  C  C2    . DT  I 5 108 ? 141.076 109.582 160.001 1.00 83.67  ? 108  DT  I C2    1 
ATOM   8154  O  O2    . DT  I 5 108 ? 141.898 109.992 159.212 1.00 83.67  ? 108  DT  I O2    1 
ATOM   8155  N  N3    . DT  I 5 108 ? 139.747 109.546 159.706 1.00 83.67  ? 108  DT  I N3    1 
ATOM   8156  C  C4    . DT  I 5 108 ? 138.725 109.115 160.520 1.00 83.67  ? 108  DT  I C4    1 
ATOM   8157  O  O4    . DT  I 5 108 ? 137.559 109.107 160.157 1.00 83.67  ? 108  DT  I O4    1 
ATOM   8158  C  C5    . DT  I 5 108 ? 139.126 108.671 161.825 1.00 83.67  ? 108  DT  I C5    1 
ATOM   8159  C  C7    . DT  I 5 108 ? 138.097 108.184 162.800 1.00 83.67  ? 108  DT  I C7    1 
ATOM   8160  C  C6    . DT  I 5 108 ? 140.432 108.713 162.130 1.00 83.67  ? 108  DT  I C6    1 
ATOM   8161  P  P     . DC  I 5 109 ? 146.396 110.735 163.627 1.00 78.29  ? 109  DC  I P     1 
ATOM   8162  O  OP1   . DC  I 5 109 ? 147.655 110.030 163.941 1.00 78.29  ? 109  DC  I OP1   1 
ATOM   8163  O  OP2   . DC  I 5 109 ? 145.552 111.260 164.719 1.00 78.29  ? 109  DC  I OP2   1 
ATOM   8164  O  "O5'" . DC  I 5 109 ? 146.748 111.931 162.641 1.00 78.29  ? 109  DC  I "O5'" 1 
ATOM   8165  C  "C5'" . DC  I 5 109 ? 146.487 111.820 161.255 1.00 78.29  ? 109  DC  I "C5'" 1 
ATOM   8166  C  "C4'" . DC  I 5 109 ? 145.810 113.076 160.743 1.00 78.29  ? 109  DC  I "C4'" 1 
ATOM   8167  O  "O4'" . DC  I 5 109 ? 144.396 112.836 160.501 1.00 78.29  ? 109  DC  I "O4'" 1 
ATOM   8168  C  "C3'" . DC  I 5 109 ? 145.873 114.280 161.691 1.00 78.29  ? 109  DC  I "C3'" 1 
ATOM   8169  O  "O3'" . DC  I 5 109 ? 146.138 115.471 160.948 1.00 78.29  ? 109  DC  I "O3'" 1 
ATOM   8170  C  "C2'" . DC  I 5 109 ? 144.471 114.296 162.289 1.00 78.29  ? 109  DC  I "C2'" 1 
ATOM   8171  C  "C1'" . DC  I 5 109 ? 143.676 113.902 161.066 1.00 78.29  ? 109  DC  I "C1'" 1 
ATOM   8172  N  N1    . DC  I 5 109 ? 142.287 113.482 161.323 1.00 78.29  ? 109  DC  I N1    1 
ATOM   8173  C  C2    . DC  I 5 109 ? 141.367 113.530 160.285 1.00 78.29  ? 109  DC  I C2    1 
ATOM   8174  O  O2    . DC  I 5 109 ? 141.735 113.942 159.183 1.00 78.29  ? 109  DC  I O2    1 
ATOM   8175  N  N3    . DC  I 5 109 ? 140.096 113.152 160.519 1.00 78.29  ? 109  DC  I N3    1 
ATOM   8176  C  C4    . DC  I 5 109 ? 139.745 112.722 161.721 1.00 78.29  ? 109  DC  I C4    1 
ATOM   8177  N  N4    . DC  I 5 109 ? 138.483 112.354 161.903 1.00 78.29  ? 109  DC  I N4    1 
ATOM   8178  C  C5    . DC  I 5 109 ? 140.671 112.655 162.795 1.00 78.29  ? 109  DC  I C5    1 
ATOM   8179  C  C6    . DC  I 5 109 ? 141.923 113.041 162.553 1.00 78.29  ? 109  DC  I C6    1 
ATOM   8180  P  P     . DC  I 5 110 ? 147.623 116.079 160.904 1.00 78.75  ? 110  DC  I P     1 
ATOM   8181  O  OP1   . DC  I 5 110 ? 148.562 114.991 160.563 1.00 78.75  ? 110  DC  I OP1   1 
ATOM   8182  O  OP2   . DC  I 5 110 ? 147.772 116.845 162.158 1.00 78.75  ? 110  DC  I OP2   1 
ATOM   8183  O  "O5'" . DC  I 5 110 ? 147.602 117.124 159.696 1.00 78.75  ? 110  DC  I "O5'" 1 
ATOM   8184  C  "C5'" . DC  I 5 110 ? 147.214 116.696 158.399 1.00 78.75  ? 110  DC  I "C5'" 1 
ATOM   8185  C  "C4'" . DC  I 5 110 ? 146.024 117.490 157.878 1.00 78.75  ? 110  DC  I "C4'" 1 
ATOM   8186  O  "O4'" . DC  I 5 110 ? 144.800 117.096 158.558 1.00 78.75  ? 110  DC  I "O4'" 1 
ATOM   8187  C  "C3'" . DC  I 5 110 ? 146.102 119.006 158.025 1.00 78.75  ? 110  DC  I "C3'" 1 
ATOM   8188  O  "O3'" . DC  I 5 110 ? 145.473 119.594 156.886 1.00 78.75  ? 110  DC  I "O3'" 1 
ATOM   8189  C  "C2'" . DC  I 5 110 ? 145.257 119.227 159.267 1.00 78.75  ? 110  DC  I "C2'" 1 
ATOM   8190  C  "C1'" . DC  I 5 110 ? 144.131 118.265 158.960 1.00 78.75  ? 110  DC  I "C1'" 1 
ATOM   8191  N  N1    . DC  I 5 110 ? 143.264 117.932 160.105 1.00 78.75  ? 110  DC  I N1    1 
ATOM   8192  C  C2    . DC  I 5 110 ? 141.917 117.627 159.895 1.00 78.75  ? 110  DC  I C2    1 
ATOM   8193  O  O2    . DC  I 5 110 ? 141.446 117.706 158.763 1.00 78.75  ? 110  DC  I O2    1 
ATOM   8194  N  N3    . DC  I 5 110 ? 141.152 117.305 160.952 1.00 78.75  ? 110  DC  I N3    1 
ATOM   8195  C  C4    . DC  I 5 110 ? 141.690 117.228 162.157 1.00 78.75  ? 110  DC  I C4    1 
ATOM   8196  N  N4    . DC  I 5 110 ? 140.890 116.902 163.172 1.00 78.75  ? 110  DC  I N4    1 
ATOM   8197  C  C5    . DC  I 5 110 ? 143.057 117.519 162.390 1.00 78.75  ? 110  DC  I C5    1 
ATOM   8198  C  C6    . DC  I 5 110 ? 143.804 117.841 161.341 1.00 78.75  ? 110  DC  I C6    1 
ATOM   8199  P  P     . DC  I 5 111 ? 146.178 120.733 156.000 1.00 75.44  ? 111  DC  I P     1 
ATOM   8200  O  OP1   . DC  I 5 111 ? 147.324 120.130 155.292 1.00 75.44  ? 111  DC  I OP1   1 
ATOM   8201  O  OP2   . DC  I 5 111 ? 146.392 121.918 156.852 1.00 75.44  ? 111  DC  I OP2   1 
ATOM   8202  O  "O5'" . DC  I 5 111 ? 145.039 121.123 154.941 1.00 75.44  ? 111  DC  I "O5'" 1 
ATOM   8203  C  "C5'" . DC  I 5 111 ? 144.057 120.148 154.537 1.00 75.44  ? 111  DC  I "C5'" 1 
ATOM   8204  C  "C4'" . DC  I 5 111 ? 142.635 120.675 154.704 1.00 75.44  ? 111  DC  I "C4'" 1 
ATOM   8205  O  "O4'" . DC  I 5 111 ? 142.136 120.394 156.040 1.00 75.44  ? 111  DC  I "O4'" 1 
ATOM   8206  C  "C3'" . DC  I 5 111 ? 142.459 122.171 154.518 1.00 75.44  ? 111  DC  I "C3'" 1 
ATOM   8207  O  "O3'" . DC  I 5 111 ? 141.242 122.415 153.871 1.00 75.44  ? 111  DC  I "O3'" 1 
ATOM   8208  C  "C2'" . DC  I 5 111 ? 142.400 122.668 155.952 1.00 75.44  ? 111  DC  I "C2'" 1 
ATOM   8209  C  "C1'" . DC  I 5 111 ? 141.572 121.576 156.571 1.00 75.44  ? 111  DC  I "C1'" 1 
ATOM   8210  N  N1    . DC  I 5 111 ? 141.639 121.488 158.063 1.00 75.44  ? 111  DC  I N1    1 
ATOM   8211  C  C2    . DC  I 5 111 ? 140.509 121.075 158.780 1.00 75.44  ? 111  DC  I C2    1 
ATOM   8212  O  O2    . DC  I 5 111 ? 139.460 120.848 158.171 1.00 75.44  ? 111  DC  I O2    1 
ATOM   8213  N  N3    . DC  I 5 111 ? 140.593 120.953 160.124 1.00 75.44  ? 111  DC  I N3    1 
ATOM   8214  C  C4    . DC  I 5 111 ? 141.742 121.211 160.744 1.00 75.44  ? 111  DC  I C4    1 
ATOM   8215  N  N4    . DC  I 5 111 ? 141.779 121.074 162.073 1.00 75.44  ? 111  DC  I N4    1 
ATOM   8216  C  C5    . DC  I 5 111 ? 142.898 121.631 160.034 1.00 75.44  ? 111  DC  I C5    1 
ATOM   8217  C  C6    . DC  I 5 111 ? 142.809 121.737 158.705 1.00 75.44  ? 111  DC  I C6    1 
ATOM   8218  P  P     . DT  I 5 112 ? 141.127 123.613 152.821 1.00 63.63  ? 112  DT  I P     1 
ATOM   8219  O  OP1   . DT  I 5 112 ? 141.183 123.021 151.474 1.00 63.63  ? 112  DT  I OP1   1 
ATOM   8220  O  OP2   . DT  I 5 112 ? 142.113 124.628 153.238 1.00 63.63  ? 112  DT  I OP2   1 
ATOM   8221  O  "O5'" . DT  I 5 112 ? 139.661 124.201 153.060 1.00 63.63  ? 112  DT  I "O5'" 1 
ATOM   8222  C  "C5'" . DT  I 5 112 ? 138.540 123.343 153.050 1.00 63.63  ? 112  DT  I "C5'" 1 
ATOM   8223  C  "C4'" . DT  I 5 112 ? 137.521 123.775 154.088 1.00 63.63  ? 112  DT  I "C4'" 1 
ATOM   8224  O  "O4'" . DT  I 5 112 ? 138.047 123.534 155.413 1.00 63.63  ? 112  DT  I "O4'" 1 
ATOM   8225  C  "C3'" . DT  I 5 112 ? 137.119 125.252 154.059 1.00 63.63  ? 112  DT  I "C3'" 1 
ATOM   8226  O  "O3'" . DT  I 5 112 ? 135.700 125.355 154.142 1.00 63.63  ? 112  DT  I "O3'" 1 
ATOM   8227  C  "C2'" . DT  I 5 112 ? 137.798 125.804 155.302 1.00 63.63  ? 112  DT  I "C2'" 1 
ATOM   8228  C  "C1'" . DT  I 5 112 ? 137.693 124.615 156.218 1.00 63.63  ? 112  DT  I "C1'" 1 
ATOM   8229  N  N1    . DT  I 5 112 ? 138.596 124.659 157.386 1.00 63.63  ? 112  DT  I N1    1 
ATOM   8230  C  C2    . DT  I 5 112 ? 138.096 124.318 158.598 1.00 63.63  ? 112  DT  I C2    1 
ATOM   8231  O  O2    . DT  I 5 112 ? 136.947 123.993 158.765 1.00 63.63  ? 112  DT  I O2    1 
ATOM   8232  N  N3    . DT  I 5 112 ? 138.984 124.369 159.619 1.00 63.63  ? 112  DT  I N3    1 
ATOM   8233  C  C4    . DT  I 5 112 ? 140.305 124.726 159.550 1.00 63.63  ? 112  DT  I C4    1 
ATOM   8234  O  O4    . DT  I 5 112 ? 141.030 124.750 160.531 1.00 63.63  ? 112  DT  I O4    1 
ATOM   8235  C  C5    . DT  I 5 112 ? 140.778 125.079 158.257 1.00 63.63  ? 112  DT  I C5    1 
ATOM   8236  C  C7    . DT  I 5 112 ? 142.204 125.503 158.091 1.00 63.63  ? 112  DT  I C7    1 
ATOM   8237  C  C6    . DT  I 5 112 ? 139.912 125.028 157.235 1.00 63.63  ? 112  DT  I C6    1 
ATOM   8238  P  P     . DA  I 5 113 ? 134.933 126.671 153.633 1.00 67.68  ? 113  DA  I P     1 
ATOM   8239  O  OP1   . DA  I 5 113 ? 134.497 126.390 152.260 1.00 67.68  ? 113  DA  I OP1   1 
ATOM   8240  O  OP2   . DA  I 5 113 ? 135.769 127.853 153.891 1.00 67.68  ? 113  DA  I OP2   1 
ATOM   8241  O  "O5'" . DA  I 5 113 ? 133.611 126.759 154.538 1.00 67.68  ? 113  DA  I "O5'" 1 
ATOM   8242  C  "C5'" . DA  I 5 113 ? 132.937 125.562 154.950 1.00 67.68  ? 113  DA  I "C5'" 1 
ATOM   8243  C  "C4'" . DA  I 5 113 ? 132.095 125.748 156.220 1.00 67.68  ? 113  DA  I "C4'" 1 
ATOM   8244  O  "O4'" . DA  I 5 113 ? 132.914 125.540 157.388 1.00 67.68  ? 113  DA  I "O4'" 1 
ATOM   8245  C  "C3'" . DA  I 5 113 ? 131.419 127.092 156.413 1.00 67.68  ? 113  DA  I "C3'" 1 
ATOM   8246  O  "O3'" . DA  I 5 113 ? 130.167 126.901 157.068 1.00 67.68  ? 113  DA  I "O3'" 1 
ATOM   8247  C  "C2'" . DA  I 5 113 ? 132.404 127.833 157.299 1.00 67.68  ? 113  DA  I "C2'" 1 
ATOM   8248  C  "C1'" . DA  I 5 113 ? 132.986 126.717 158.156 1.00 67.68  ? 113  DA  I "C1'" 1 
ATOM   8249  N  N9    . DA  I 5 113 ? 134.392 126.904 158.434 1.00 67.68  ? 113  DA  I N9    1 
ATOM   8250  C  C8    . DA  I 5 113 ? 135.361 127.125 157.514 1.00 67.68  ? 113  DA  I C8    1 
ATOM   8251  N  N7    . DA  I 5 113 ? 136.556 127.234 158.020 1.00 67.68  ? 113  DA  I N7    1 
ATOM   8252  C  C5    . DA  I 5 113 ? 136.364 127.064 159.361 1.00 67.68  ? 113  DA  I C5    1 
ATOM   8253  C  C6    . DA  I 5 113 ? 137.256 127.059 160.428 1.00 67.68  ? 113  DA  I C6    1 
ATOM   8254  N  N6    . DA  I 5 113 ? 138.557 127.267 160.279 1.00 67.68  ? 113  DA  I N6    1 
ATOM   8255  N  N1    . DA  I 5 113 ? 136.756 126.872 161.662 1.00 67.68  ? 113  DA  I N1    1 
ATOM   8256  C  C2    . DA  I 5 113 ? 135.437 126.679 161.800 1.00 67.68  ? 113  DA  I C2    1 
ATOM   8257  N  N3    . DA  I 5 113 ? 134.493 126.658 160.855 1.00 67.68  ? 113  DA  I N3    1 
ATOM   8258  C  C4    . DA  I 5 113 ? 135.034 126.847 159.646 1.00 67.68  ? 113  DA  I C4    1 
ATOM   8259  P  P     . DG  I 5 114 ? 129.140 128.125 157.254 1.00 77.74  ? 114  DG  I P     1 
ATOM   8260  O  OP1   . DG  I 5 114 ? 127.779 127.550 157.252 1.00 77.74  ? 114  DG  I OP1   1 
ATOM   8261  O  OP2   . DG  I 5 114 ? 129.502 129.171 156.279 1.00 77.74  ? 114  DG  I OP2   1 
ATOM   8262  O  "O5'" . DG  I 5 114 ? 129.445 128.683 158.725 1.00 77.74  ? 114  DG  I "O5'" 1 
ATOM   8263  C  "C5'" . DG  I 5 114 ? 129.280 127.830 159.841 1.00 77.74  ? 114  DG  I "C5'" 1 
ATOM   8264  C  "C4'" . DG  I 5 114 ? 129.671 128.513 161.138 1.00 77.74  ? 114  DG  I "C4'" 1 
ATOM   8265  O  "O4'" . DG  I 5 114 ? 131.111 128.407 161.336 1.00 77.74  ? 114  DG  I "O4'" 1 
ATOM   8266  C  "C3'" . DG  I 5 114 ? 129.334 129.995 161.243 1.00 77.74  ? 114  DG  I "C3'" 1 
ATOM   8267  O  "O3'" . DG  I 5 114 ? 128.790 130.254 162.531 1.00 77.74  ? 114  DG  I "O3'" 1 
ATOM   8268  C  "C2'" . DG  I 5 114 ? 130.687 130.666 161.067 1.00 77.74  ? 114  DG  I "C2'" 1 
ATOM   8269  C  "C1'" . DG  I 5 114 ? 131.624 129.661 161.705 1.00 77.74  ? 114  DG  I "C1'" 1 
ATOM   8270  N  N9    . DG  I 5 114 ? 132.993 129.766 161.212 1.00 77.74  ? 114  DG  I N9    1 
ATOM   8271  C  C8    . DG  I 5 114 ? 133.368 129.829 159.908 1.00 77.74  ? 114  DG  I C8    1 
ATOM   8272  N  N7    . DG  I 5 114 ? 134.644 129.946 159.733 1.00 77.74  ? 114  DG  I N7    1 
ATOM   8273  C  C5    . DG  I 5 114 ? 135.160 129.960 161.008 1.00 77.74  ? 114  DG  I C5    1 
ATOM   8274  C  C6    . DG  I 5 114 ? 136.493 130.073 161.428 1.00 77.74  ? 114  DG  I C6    1 
ATOM   8275  O  O6    . DG  I 5 114 ? 137.506 130.160 160.727 1.00 77.74  ? 114  DG  I O6    1 
ATOM   8276  N  N1    . DG  I 5 114 ? 136.601 130.048 162.803 1.00 77.74  ? 114  DG  I N1    1 
ATOM   8277  C  C2    . DG  I 5 114 ? 135.544 129.944 163.670 1.00 77.74  ? 114  DG  I C2    1 
ATOM   8278  N  N2    . DG  I 5 114 ? 135.849 129.942 164.976 1.00 77.74  ? 114  DG  I N2    1 
ATOM   8279  N  N3    . DG  I 5 114 ? 134.274 129.846 163.284 1.00 77.74  ? 114  DG  I N3    1 
ATOM   8280  C  C4    . DG  I 5 114 ? 134.160 129.863 161.941 1.00 77.74  ? 114  DG  I C4    1 
ATOM   8281  P  P     . DT  I 5 115 ? 128.088 131.658 162.893 1.00 85.43  ? 115  DT  I P     1 
ATOM   8282  O  OP1   . DT  I 5 115 ? 126.774 131.385 163.512 1.00 85.43  ? 115  DT  I OP1   1 
ATOM   8283  O  OP2   . DT  I 5 115 ? 128.148 132.579 161.740 1.00 85.43  ? 115  DT  I OP2   1 
ATOM   8284  O  "O5'" . DT  I 5 115 ? 129.050 132.240 164.022 1.00 85.43  ? 115  DT  I "O5'" 1 
ATOM   8285  C  "C5'" . DT  I 5 115 ? 129.935 131.355 164.711 1.00 85.43  ? 115  DT  I "C5'" 1 
ATOM   8286  C  "C4'" . DT  I 5 115 ? 130.841 132.110 165.666 1.00 85.43  ? 115  DT  I "C4'" 1 
ATOM   8287  O  "O4'" . DT  I 5 115 ? 132.211 132.035 165.200 1.00 85.43  ? 115  DT  I "O4'" 1 
ATOM   8288  C  "C3'" . DT  I 5 115 ? 130.535 133.593 165.818 1.00 85.43  ? 115  DT  I "C3'" 1 
ATOM   8289  O  "O3'" . DT  I 5 115 ? 130.809 133.994 167.155 1.00 85.43  ? 115  DT  I "O3'" 1 
ATOM   8290  C  "C2'" . DT  I 5 115 ? 131.497 134.229 164.830 1.00 85.43  ? 115  DT  I "C2'" 1 
ATOM   8291  C  "C1'" . DT  I 5 115 ? 132.707 133.334 164.986 1.00 85.43  ? 115  DT  I "C1'" 1 
ATOM   8292  N  N1    . DT  I 5 115 ? 133.565 133.308 163.801 1.00 85.43  ? 115  DT  I N1    1 
ATOM   8293  C  C2    . DT  I 5 115 ? 134.920 133.278 163.965 1.00 85.43  ? 115  DT  I C2    1 
ATOM   8294  O  O2    . DT  I 5 115 ? 135.463 133.303 165.049 1.00 85.43  ? 115  DT  I O2    1 
ATOM   8295  N  N3    . DT  I 5 115 ? 135.628 133.249 162.815 1.00 85.43  ? 115  DT  I N3    1 
ATOM   8296  C  C4    . DT  I 5 115 ? 135.132 133.221 161.538 1.00 85.43  ? 115  DT  I C4    1 
ATOM   8297  O  O4    . DT  I 5 115 ? 135.856 133.197 160.561 1.00 85.43  ? 115  DT  I O4    1 
ATOM   8298  C  C5    . DT  I 5 115 ? 133.706 133.245 161.428 1.00 85.43  ? 115  DT  I C5    1 
ATOM   8299  C  C7    . DT  I 5 115 ? 133.063 133.242 160.079 1.00 85.43  ? 115  DT  I C7    1 
ATOM   8300  C  C6    . DT  I 5 115 ? 132.993 133.276 162.554 1.00 85.43  ? 115  DT  I C6    1 
ATOM   8301  P  P     . DC  I 5 116 ? 130.265 135.394 167.729 1.00 90.63  ? 116  DC  I P     1 
ATOM   8302  O  OP1   . DC  I 5 116 ? 129.592 135.097 169.011 1.00 90.63  ? 116  DC  I OP1   1 
ATOM   8303  O  OP2   . DC  I 5 116 ? 129.517 136.109 166.673 1.00 90.63  ? 116  DC  I OP2   1 
ATOM   8304  O  "O5'" . DC  I 5 116 ? 131.606 136.226 167.987 1.00 90.63  ? 116  DC  I "O5'" 1 
ATOM   8305  C  "C5'" . DC  I 5 116 ? 132.725 135.593 168.621 1.00 90.63  ? 116  DC  I "C5'" 1 
ATOM   8306  C  "C4'" . DC  I 5 116 ? 133.999 136.425 168.492 1.00 90.63  ? 116  DC  I "C4'" 1 
ATOM   8307  O  "O4'" . DC  I 5 116 ? 134.680 136.116 167.248 1.00 90.63  ? 116  DC  I "O4'" 1 
ATOM   8308  C  "C3'" . DC  I 5 116 ? 133.817 137.942 168.502 1.00 90.63  ? 116  DC  I "C3'" 1 
ATOM   8309  O  "O3'" . DC  I 5 116 ? 134.894 138.522 169.210 1.00 90.63  ? 116  DC  I "O3'" 1 
ATOM   8310  C  "C2'" . DC  I 5 116 ? 133.895 138.284 167.024 1.00 90.63  ? 116  DC  I "C2'" 1 
ATOM   8311  C  "C1'" . DC  I 5 116 ? 134.975 137.322 166.590 1.00 90.63  ? 116  DC  I "C1'" 1 
ATOM   8312  N  N1    . DC  I 5 116 ? 135.025 137.066 165.134 1.00 90.63  ? 116  DC  I N1    1 
ATOM   8313  C  C2    . DC  I 5 116 ? 136.258 136.986 164.516 1.00 90.63  ? 116  DC  I C2    1 
ATOM   8314  O  O2    . DC  I 5 116 ? 137.261 137.179 165.199 1.00 90.63  ? 116  DC  I O2    1 
ATOM   8315  N  N3    . DC  I 5 116 ? 136.316 136.738 163.192 1.00 90.63  ? 116  DC  I N3    1 
ATOM   8316  C  C4    . DC  I 5 116 ? 135.196 136.541 162.505 1.00 90.63  ? 116  DC  I C4    1 
ATOM   8317  N  N4    . DC  I 5 116 ? 135.299 136.301 161.200 1.00 90.63  ? 116  DC  I N4    1 
ATOM   8318  C  C5    . DC  I 5 116 ? 133.919 136.597 163.124 1.00 90.63  ? 116  DC  I C5    1 
ATOM   8319  C  C6    . DC  I 5 116 ? 133.882 136.850 164.434 1.00 90.63  ? 116  DC  I C6    1 
ATOM   8320  P  P     . DT  I 5 117 ? 134.764 139.979 169.870 1.00 88.77  ? 117  DT  I P     1 
ATOM   8321  O  OP1   . DT  I 5 117 ? 134.845 139.804 171.337 1.00 88.77  ? 117  DT  I OP1   1 
ATOM   8322  O  OP2   . DT  I 5 117 ? 133.591 140.659 169.275 1.00 88.77  ? 117  DT  I OP2   1 
ATOM   8323  O  "O5'" . DT  I 5 117 ? 136.094 140.726 169.385 1.00 88.77  ? 117  DT  I "O5'" 1 
ATOM   8324  C  "C5'" . DT  I 5 117 ? 137.322 139.999 169.263 1.00 88.77  ? 117  DT  I "C5'" 1 
ATOM   8325  C  "C4'" . DT  I 5 117 ? 138.313 140.739 168.377 1.00 88.77  ? 117  DT  I "C4'" 1 
ATOM   8326  O  "O4'" . DT  I 5 117 ? 138.232 140.252 167.010 1.00 88.77  ? 117  DT  I "O4'" 1 
ATOM   8327  C  "C3'" . DT  I 5 117 ? 138.123 142.251 168.297 1.00 88.77  ? 117  DT  I "C3'" 1 
ATOM   8328  O  "O3'" . DT  I 5 117 ? 139.392 142.881 168.266 1.00 88.77  ? 117  DT  I "O3'" 1 
ATOM   8329  C  "C2'" . DT  I 5 117 ? 137.391 142.428 166.967 1.00 88.77  ? 117  DT  I "C2'" 1 
ATOM   8330  C  "C1'" . DT  I 5 117 ? 138.050 141.346 166.138 1.00 88.77  ? 117  DT  I "C1'" 1 
ATOM   8331  N  N1    . DT  I 5 117 ? 137.261 140.901 164.959 1.00 88.77  ? 117  DT  I N1    1 
ATOM   8332  C  C2    . DT  I 5 117 ? 137.933 140.515 163.836 1.00 88.77  ? 117  DT  I C2    1 
ATOM   8333  O  O2    . DT  I 5 117 ? 139.143 140.544 163.747 1.00 88.77  ? 117  DT  I O2    1 
ATOM   8334  N  N3    . DT  I 5 117 ? 137.138 140.107 162.806 1.00 88.77  ? 117  DT  I N3    1 
ATOM   8335  C  C4    . DT  I 5 117 ? 135.767 140.040 162.793 1.00 88.77  ? 117  DT  I C4    1 
ATOM   8336  O  O4    . DT  I 5 117 ? 135.138 139.657 161.816 1.00 88.77  ? 117  DT  I O4    1 
ATOM   8337  C  C5    . DT  I 5 117 ? 135.120 140.449 164.004 1.00 88.77  ? 117  DT  I C5    1 
ATOM   8338  C  C7    . DT  I 5 117 ? 133.628 140.421 164.090 1.00 88.77  ? 117  DT  I C7    1 
ATOM   8339  C  C6    . DT  I 5 117 ? 135.887 140.854 165.025 1.00 88.77  ? 117  DT  I C6    1 
ATOM   8340  P  P     . DC  I 5 118 ? 139.537 144.443 168.605 1.00 85.51  ? 118  DC  I P     1 
ATOM   8341  O  OP1   . DC  I 5 118 ? 140.546 144.534 169.681 1.00 85.51  ? 118  DC  I OP1   1 
ATOM   8342  O  OP2   . DC  I 5 118 ? 138.194 145.033 168.794 1.00 85.51  ? 118  DC  I OP2   1 
ATOM   8343  O  "O5'" . DC  I 5 118 ? 140.189 145.067 167.289 1.00 85.51  ? 118  DC  I "O5'" 1 
ATOM   8344  C  "C5'" . DC  I 5 118 ? 141.225 144.384 166.631 1.00 85.51  ? 118  DC  I "C5'" 1 
ATOM   8345  C  "C4'" . DC  I 5 118 ? 141.366 144.834 165.183 1.00 85.51  ? 118  DC  I "C4'" 1 
ATOM   8346  O  "O4'" . DC  I 5 118 ? 140.382 144.202 164.314 1.00 85.51  ? 118  DC  I "O4'" 1 
ATOM   8347  C  "C3'" . DC  I 5 118 ? 141.227 146.338 164.940 1.00 85.51  ? 118  DC  I "C3'" 1 
ATOM   8348  O  "O3'" . DC  I 5 118 ? 142.213 146.728 164.010 1.00 85.51  ? 118  DC  I "O3'" 1 
ATOM   8349  C  "C2'" . DC  I 5 118 ? 139.830 146.458 164.327 1.00 85.51  ? 118  DC  I "C2'" 1 
ATOM   8350  C  "C1'" . DC  I 5 118 ? 139.824 145.204 163.487 1.00 85.51  ? 118  DC  I "C1'" 1 
ATOM   8351  N  N1    . DC  I 5 118 ? 138.517 144.767 162.966 1.00 85.51  ? 118  DC  I N1    1 
ATOM   8352  C  C2    . DC  I 5 118 ? 138.473 144.191 161.704 1.00 85.51  ? 118  DC  I C2    1 
ATOM   8353  O  O2    . DC  I 5 118 ? 139.527 144.077 161.072 1.00 85.51  ? 118  DC  I O2    1 
ATOM   8354  N  N3    . DC  I 5 118 ? 137.291 143.774 161.211 1.00 85.51  ? 118  DC  I N3    1 
ATOM   8355  C  C4    . DC  I 5 118 ? 136.190 143.918 161.933 1.00 85.51  ? 118  DC  I C4    1 
ATOM   8356  N  N4    . DC  I 5 118 ? 135.042 143.491 161.408 1.00 85.51  ? 118  DC  I N4    1 
ATOM   8357  C  C5    . DC  I 5 118 ? 136.214 144.508 163.228 1.00 85.51  ? 118  DC  I C5    1 
ATOM   8358  C  C6    . DC  I 5 118 ? 137.393 144.918 163.701 1.00 85.51  ? 118  DC  I C6    1 
ATOM   8359  P  P     . DC  I 5 119 ? 143.079 148.052 164.245 1.00 78.30  ? 119  DC  I P     1 
ATOM   8360  O  OP1   . DC  I 5 119 ? 144.306 147.662 164.965 1.00 78.30  ? 119  DC  I OP1   1 
ATOM   8361  O  OP2   . DC  I 5 119 ? 142.184 149.074 164.820 1.00 78.30  ? 119  DC  I OP2   1 
ATOM   8362  O  "O5'" . DC  I 5 119 ? 143.480 148.507 162.768 1.00 78.30  ? 119  DC  I "O5'" 1 
ATOM   8363  C  "C5'" . DC  I 5 119 ? 143.775 147.526 161.776 1.00 78.30  ? 119  DC  I "C5'" 1 
ATOM   8364  C  "C4'" . DC  I 5 119 ? 143.235 147.927 160.412 1.00 78.30  ? 119  DC  I "C4'" 1 
ATOM   8365  O  "O4'" . DC  I 5 119 ? 141.867 147.473 160.212 1.00 78.30  ? 119  DC  I "O4'" 1 
ATOM   8366  C  "C3'" . DC  I 5 119 ? 143.225 149.431 160.138 1.00 78.30  ? 119  DC  I "C3'" 1 
ATOM   8367  O  "O3'" . DC  I 5 119 ? 143.736 149.659 158.843 1.00 78.30  ? 119  DC  I "O3'" 1 
ATOM   8368  C  "C2'" . DC  I 5 119 ? 141.740 149.781 160.230 1.00 78.30  ? 119  DC  I "C2'" 1 
ATOM   8369  C  "C1'" . DC  I 5 119 ? 141.142 148.531 159.631 1.00 78.30  ? 119  DC  I "C1'" 1 
ATOM   8370  N  N1    . DC  I 5 119 ? 139.695 148.339 159.881 1.00 78.30  ? 119  DC  I N1    1 
ATOM   8371  C  C2    . DC  I 5 119 ? 138.935 147.603 158.972 1.00 78.30  ? 119  DC  I C2    1 
ATOM   8372  O  O2    . DC  I 5 119 ? 139.474 147.156 157.953 1.00 78.30  ? 119  DC  I O2    1 
ATOM   8373  N  N3    . DC  I 5 119 ? 137.619 147.426 159.213 1.00 78.30  ? 119  DC  I N3    1 
ATOM   8374  C  C4    . DC  I 5 119 ? 137.083 147.917 160.317 1.00 78.30  ? 119  DC  I C4    1 
ATOM   8375  N  N4    . DC  I 5 119 ? 135.781 147.718 160.508 1.00 78.30  ? 119  DC  I N4    1 
ATOM   8376  C  C5    . DC  I 5 119 ? 137.839 148.662 161.257 1.00 78.30  ? 119  DC  I C5    1 
ATOM   8377  C  C6    . DC  I 5 119 ? 139.133 148.838 161.006 1.00 78.30  ? 119  DC  I C6    1 
ATOM   8378  P  P     . DA  I 5 120 ? 145.264 150.112 158.655 1.00 71.95  ? 120  DA  I P     1 
ATOM   8379  O  OP1   . DA  I 5 120 ? 146.124 149.306 159.545 1.00 71.95  ? 120  DA  I OP1   1 
ATOM   8380  O  OP2   . DA  I 5 120 ? 145.286 151.583 158.768 1.00 71.95  ? 120  DA  I OP2   1 
ATOM   8381  O  "O5'" . DA  I 5 120 ? 145.580 149.748 157.135 1.00 71.95  ? 120  DA  I "O5'" 1 
ATOM   8382  C  "C5'" . DA  I 5 120 ? 145.258 148.445 156.629 1.00 71.95  ? 120  DA  I "C5'" 1 
ATOM   8383  C  "C4'" . DA  I 5 120 ? 144.384 148.503 155.376 1.00 71.95  ? 120  DA  I "C4'" 1 
ATOM   8384  O  "O4'" . DA  I 5 120 ? 142.982 148.556 155.732 1.00 71.95  ? 120  DA  I "O4'" 1 
ATOM   8385  C  "C3'" . DA  I 5 120 ? 144.605 149.678 154.436 1.00 71.95  ? 120  DA  I "C3'" 1 
ATOM   8386  O  "O3'" . DA  I 5 120 ? 144.331 149.243 153.124 1.00 71.95  ? 120  DA  I "O3'" 1 
ATOM   8387  C  "C2'" . DA  I 5 120 ? 143.526 150.645 154.904 1.00 71.95  ? 120  DA  I "C2'" 1 
ATOM   8388  C  "C1'" . DA  I 5 120 ? 142.398 149.663 155.096 1.00 71.95  ? 120  DA  I "C1'" 1 
ATOM   8389  N  N9    . DA  I 5 120 ? 141.332 150.120 155.941 1.00 71.95  ? 120  DA  I N9    1 
ATOM   8390  C  C8    . DA  I 5 120 ? 141.422 150.995 156.970 1.00 71.95  ? 120  DA  I C8    1 
ATOM   8391  N  N7    . DA  I 5 120 ? 140.281 151.218 157.567 1.00 71.95  ? 120  DA  I N7    1 
ATOM   8392  C  C5    . DA  I 5 120 ? 139.385 150.454 156.855 1.00 71.95  ? 120  DA  I C5    1 
ATOM   8393  C  C6    . DA  I 5 120 ? 138.007 150.258 156.982 1.00 71.95  ? 120  DA  I C6    1 
ATOM   8394  N  N6    . DA  I 5 120 ? 137.273 150.844 157.925 1.00 71.95  ? 120  DA  I N6    1 
ATOM   8395  N  N1    . DA  I 5 120 ? 137.408 149.433 156.105 1.00 71.95  ? 120  DA  I N1    1 
ATOM   8396  C  C2    . DA  I 5 120 ? 138.158 148.840 155.172 1.00 71.95  ? 120  DA  I C2    1 
ATOM   8397  N  N3    . DA  I 5 120 ? 139.465 148.948 154.960 1.00 71.95  ? 120  DA  I N3    1 
ATOM   8398  C  C4    . DA  I 5 120 ? 140.019 149.776 155.845 1.00 71.95  ? 120  DA  I C4    1 
ATOM   8399  P  P     . DG  I 5 121 ? 145.510 148.960 152.079 1.00 70.53  ? 121  DG  I P     1 
ATOM   8400  O  OP1   . DG  I 5 121 ? 146.496 148.103 152.766 1.00 70.53  ? 121  DG  I OP1   1 
ATOM   8401  O  OP2   . DG  I 5 121 ? 145.915 150.258 151.508 1.00 70.53  ? 121  DG  I OP2   1 
ATOM   8402  O  "O5'" . DG  I 5 121 ? 144.797 148.129 150.910 1.00 70.53  ? 121  DG  I "O5'" 1 
ATOM   8403  C  "C5'" . DG  I 5 121 ? 144.008 146.984 151.227 1.00 70.53  ? 121  DG  I "C5'" 1 
ATOM   8404  C  "C4'" . DG  I 5 121 ? 142.773 146.841 150.328 1.00 70.53  ? 121  DG  I "C4'" 1 
ATOM   8405  O  "O4'" . DG  I 5 121 ? 141.633 147.516 150.899 1.00 70.53  ? 121  DG  I "O4'" 1 
ATOM   8406  C  "C3'" . DG  I 5 121 ? 142.863 147.344 148.907 1.00 70.53  ? 121  DG  I "C3'" 1 
ATOM   8407  O  "O3'" . DG  I 5 121 ? 142.027 146.505 148.114 1.00 70.53  ? 121  DG  I "O3'" 1 
ATOM   8408  C  "C2'" . DG  I 5 121 ? 142.314 148.762 149.027 1.00 70.53  ? 121  DG  I "C2'" 1 
ATOM   8409  C  "C1'" . DG  I 5 121 ? 141.234 148.592 150.076 1.00 70.53  ? 121  DG  I "C1'" 1 
ATOM   8410  N  N9    . DG  I 5 121 ? 141.100 149.711 150.975 1.00 70.53  ? 121  DG  I N9    1 
ATOM   8411  C  C8    . DG  I 5 121 ? 142.105 150.490 151.463 1.00 70.53  ? 121  DG  I C8    1 
ATOM   8412  N  N7    . DG  I 5 121 ? 141.695 151.388 152.303 1.00 70.53  ? 121  DG  I N7    1 
ATOM   8413  C  C5    . DG  I 5 121 ? 140.338 151.175 152.391 1.00 70.53  ? 121  DG  I C5    1 
ATOM   8414  C  C6    . DG  I 5 121 ? 139.365 151.849 153.144 1.00 70.53  ? 121  DG  I C6    1 
ATOM   8415  O  O6    . DG  I 5 121 ? 139.515 152.790 153.923 1.00 70.53  ? 121  DG  I O6    1 
ATOM   8416  N  N1    . DG  I 5 121 ? 138.102 151.332 152.928 1.00 70.53  ? 121  DG  I N1    1 
ATOM   8417  C  C2    . DG  I 5 121 ? 137.813 150.295 152.086 1.00 70.53  ? 121  DG  I C2    1 
ATOM   8418  N  N2    . DG  I 5 121 ? 136.525 149.932 152.007 1.00 70.53  ? 121  DG  I N2    1 
ATOM   8419  N  N3    . DG  I 5 121 ? 138.719 149.654 151.373 1.00 70.53  ? 121  DG  I N3    1 
ATOM   8420  C  C4    . DG  I 5 121 ? 139.956 150.144 151.581 1.00 70.53  ? 121  DG  I C4    1 
ATOM   8421  P  P     . DG  I 5 122 ? 141.958 146.631 146.517 1.00 68.24  ? 122  DG  I P     1 
ATOM   8422  O  OP1   . DG  I 5 122 ? 142.029 145.250 145.997 1.00 68.24  ? 122  DG  I OP1   1 
ATOM   8423  O  OP2   . DG  I 5 122 ? 142.965 147.613 146.067 1.00 68.24  ? 122  DG  I OP2   1 
ATOM   8424  O  "O5'" . DG  I 5 122 ? 140.483 147.198 146.234 1.00 68.24  ? 122  DG  I "O5'" 1 
ATOM   8425  C  "C5'" . DG  I 5 122 ? 139.326 146.485 146.707 1.00 68.24  ? 122  DG  I "C5'" 1 
ATOM   8426  C  "C4'" . DG  I 5 122 ? 138.050 147.303 146.572 1.00 68.24  ? 122  DG  I "C4'" 1 
ATOM   8427  O  "O4'" . DG  I 5 122 ? 138.028 148.336 147.564 1.00 68.24  ? 122  DG  I "O4'" 1 
ATOM   8428  C  "C3'" . DG  I 5 122 ? 137.821 148.005 145.241 1.00 68.24  ? 122  DG  I "C3'" 1 
ATOM   8429  O  "O3'" . DG  I 5 122 ? 136.435 148.034 144.963 1.00 68.24  ? 122  DG  I "O3'" 1 
ATOM   8430  C  "C2'" . DG  I 5 122 ? 138.316 149.403 145.536 1.00 68.24  ? 122  DG  I "C2'" 1 
ATOM   8431  C  "C1'" . DG  I 5 122 ? 137.795 149.569 146.941 1.00 68.24  ? 122  DG  I "C1'" 1 
ATOM   8432  N  N9    . DG  I 5 122 ? 138.520 150.543 147.709 1.00 68.24  ? 122  DG  I N9    1 
ATOM   8433  C  C8    . DG  I 5 122 ? 139.863 150.746 147.684 1.00 68.24  ? 122  DG  I C8    1 
ATOM   8434  N  N7    . DG  I 5 122 ? 140.265 151.656 148.510 1.00 68.24  ? 122  DG  I N7    1 
ATOM   8435  C  C5    . DG  I 5 122 ? 139.105 152.103 149.099 1.00 68.24  ? 122  DG  I C5    1 
ATOM   8436  C  C6    . DG  I 5 122 ? 138.927 153.094 150.059 1.00 68.24  ? 122  DG  I C6    1 
ATOM   8437  O  O6    . DG  I 5 122 ? 139.793 153.791 150.598 1.00 68.24  ? 122  DG  I O6    1 
ATOM   8438  N  N1    . DG  I 5 122 ? 137.597 153.238 150.397 1.00 68.24  ? 122  DG  I N1    1 
ATOM   8439  C  C2    . DG  I 5 122 ? 136.564 152.508 149.859 1.00 68.24  ? 122  DG  I C2    1 
ATOM   8440  N  N2    . DG  I 5 122 ? 135.341 152.793 150.308 1.00 68.24  ? 122  DG  I N2    1 
ATOM   8441  N  N3    . DG  I 5 122 ? 136.723 151.572 148.951 1.00 68.24  ? 122  DG  I N3    1 
ATOM   8442  C  C4    . DG  I 5 122 ? 138.019 151.417 148.629 1.00 68.24  ? 122  DG  I C4    1 
ATOM   8443  P  P     . DC  I 5 123 ? 135.904 148.120 143.453 1.00 71.02  ? 123  DC  I P     1 
ATOM   8444  O  OP1   . DC  I 5 123 ? 135.460 146.761 143.092 1.00 71.02  ? 123  DC  I OP1   1 
ATOM   8445  O  OP2   . DC  I 5 123 ? 136.915 148.788 142.619 1.00 71.02  ? 123  DC  I OP2   1 
ATOM   8446  O  "O5'" . DC  I 5 123 ? 134.621 149.070 143.545 1.00 71.02  ? 123  DC  I "O5'" 1 
ATOM   8447  C  "C5'" . DC  I 5 123 ? 133.732 148.942 144.631 1.00 71.02  ? 123  DC  I "C5'" 1 
ATOM   8448  C  "C4'" . DC  I 5 123 ? 133.079 150.268 144.985 1.00 71.02  ? 123  DC  I "C4'" 1 
ATOM   8449  O  "O4'" . DC  I 5 123 ? 133.949 151.045 145.833 1.00 71.02  ? 123  DC  I "O4'" 1 
ATOM   8450  C  "C3'" . DC  I 5 123 ? 132.710 151.158 143.802 1.00 71.02  ? 123  DC  I "C3'" 1 
ATOM   8451  O  "O3'" . DC  I 5 123 ? 131.342 151.611 143.942 1.00 71.02  ? 123  DC  I "O3'" 1 
ATOM   8452  C  "C2'" . DC  I 5 123 ? 133.717 152.303 143.916 1.00 71.02  ? 123  DC  I "C2'" 1 
ATOM   8453  C  "C1'" . DC  I 5 123 ? 133.933 152.377 145.412 1.00 71.02  ? 123  DC  I "C1'" 1 
ATOM   8454  N  N1    . DC  I 5 123 ? 135.209 152.938 145.791 1.00 71.02  ? 123  DC  I N1    1 
ATOM   8455  C  C2    . DC  I 5 123 ? 135.284 153.967 146.724 1.00 71.02  ? 123  DC  I C2    1 
ATOM   8456  O  O2    . DC  I 5 123 ? 134.250 154.442 147.187 1.00 71.02  ? 123  DC  I O2    1 
ATOM   8457  N  N3    . DC  I 5 123 ? 136.502 154.438 147.077 1.00 71.02  ? 123  DC  I N3    1 
ATOM   8458  C  C4    . DC  I 5 123 ? 137.593 153.910 146.546 1.00 71.02  ? 123  DC  I C4    1 
ATOM   8459  N  N4    . DC  I 5 123 ? 138.779 154.395 146.914 1.00 71.02  ? 123  DC  I N4    1 
ATOM   8460  C  C5    . DC  I 5 123 ? 137.525 152.860 145.607 1.00 71.02  ? 123  DC  I C5    1 
ATOM   8461  C  C6    . DC  I 5 123 ? 136.326 152.398 145.279 1.00 71.02  ? 123  DC  I C6    1 
ATOM   8462  P  P     . DA  I 5 124 ? 130.581 152.354 142.734 1.00 84.50  ? 124  DA  I P     1 
ATOM   8463  O  OP1   . DA  I 5 124 ? 129.264 151.711 142.624 1.00 84.50  ? 124  DA  I OP1   1 
ATOM   8464  O  OP2   . DA  I 5 124 ? 131.456 152.394 141.550 1.00 84.50  ? 124  DA  I OP2   1 
ATOM   8465  O  "O5'" . DA  I 5 124 ? 130.337 153.847 143.244 1.00 84.50  ? 124  DA  I "O5'" 1 
ATOM   8466  C  "C5'" . DA  I 5 124 ? 129.641 154.079 144.455 1.00 84.50  ? 124  DA  I "C5'" 1 
ATOM   8467  C  "C4'" . DA  I 5 124 ? 129.382 155.568 144.729 1.00 84.50  ? 124  DA  I "C4'" 1 
ATOM   8468  O  "O4'" . DA  I 5 124 ? 130.505 156.154 145.422 1.00 84.50  ? 124  DA  I "O4'" 1 
ATOM   8469  C  "C3'" . DA  I 5 124 ? 129.126 156.476 143.529 1.00 84.50  ? 124  DA  I "C3'" 1 
ATOM   8470  O  "O3'" . DA  I 5 124 ? 128.264 157.550 143.924 1.00 84.50  ? 124  DA  I "O3'" 1 
ATOM   8471  C  "C2'" . DA  I 5 124 ? 130.517 157.002 143.203 1.00 84.50  ? 124  DA  I "C2'" 1 
ATOM   8472  C  "C1'" . DA  I 5 124 ? 131.182 157.051 144.570 1.00 84.50  ? 124  DA  I "C1'" 1 
ATOM   8473  N  N9    . DA  I 5 124 ? 132.578 156.707 144.526 1.00 84.50  ? 124  DA  I N9    1 
ATOM   8474  C  C8    . DA  I 5 124 ? 133.141 155.701 143.820 1.00 84.50  ? 124  DA  I C8    1 
ATOM   8475  N  N7    . DA  I 5 124 ? 134.436 155.637 143.937 1.00 84.50  ? 124  DA  I N7    1 
ATOM   8476  C  C5    . DA  I 5 124 ? 134.740 156.704 144.744 1.00 84.50  ? 124  DA  I C5    1 
ATOM   8477  C  C6    . DA  I 5 124 ? 135.950 157.193 145.234 1.00 84.50  ? 124  DA  I C6    1 
ATOM   8478  N  N6    . DA  I 5 124 ? 137.121 156.629 144.959 1.00 84.50  ? 124  DA  I N6    1 
ATOM   8479  N  N1    . DA  I 5 124 ? 135.912 158.286 146.025 1.00 84.50  ? 124  DA  I N1    1 
ATOM   8480  C  C2    . DA  I 5 124 ? 134.728 158.850 146.288 1.00 84.50  ? 124  DA  I C2    1 
ATOM   8481  N  N3    . DA  I 5 124 ? 133.522 158.469 145.884 1.00 84.50  ? 124  DA  I N3    1 
ATOM   8482  C  C4    . DA  I 5 124 ? 133.604 157.382 145.108 1.00 84.50  ? 124  DA  I C4    1 
ATOM   8483  P  P     . DC  I 5 125 ? 127.952 158.784 142.936 1.00 96.93  ? 125  DC  I P     1 
ATOM   8484  O  OP1   . DC  I 5 125 ? 126.674 159.355 143.403 1.00 96.93  ? 125  DC  I OP1   1 
ATOM   8485  O  OP2   . DC  I 5 125 ? 128.099 158.347 141.532 1.00 96.93  ? 125  DC  I OP2   1 
ATOM   8486  O  "O5'" . DC  I 5 125 ? 129.070 159.879 143.255 1.00 96.93  ? 125  DC  I "O5'" 1 
ATOM   8487  C  "C5'" . DC  I 5 125 ? 129.307 160.265 144.587 1.00 96.93  ? 125  DC  I "C5'" 1 
ATOM   8488  C  "C4'" . DC  I 5 125 ? 130.414 161.308 144.678 1.00 96.93  ? 125  DC  I "C4'" 1 
ATOM   8489  O  "O4'" . DC  I 5 125 ? 131.719 160.665 144.638 1.00 96.93  ? 125  DC  I "O4'" 1 
ATOM   8490  C  "C3'" . DC  I 5 125 ? 130.432 162.369 143.571 1.00 96.93  ? 125  DC  I "C3'" 1 
ATOM   8491  O  "O3'" . DC  I 5 125 ? 130.702 163.643 144.148 1.00 96.93  ? 125  DC  I "O3'" 1 
ATOM   8492  C  "C2'" . DC  I 5 125 ? 131.588 161.917 142.691 1.00 96.93  ? 125  DC  I "C2'" 1 
ATOM   8493  C  "C1'" . DC  I 5 125 ? 132.532 161.372 143.740 1.00 96.93  ? 125  DC  I "C1'" 1 
ATOM   8494  N  N1    . DC  I 5 125 ? 133.561 160.478 143.201 1.00 96.93  ? 125  DC  I N1    1 
ATOM   8495  C  C2    . DC  I 5 125 ? 134.897 160.723 143.503 1.00 96.93  ? 125  DC  I C2    1 
ATOM   8496  O  O2    . DC  I 5 125 ? 135.186 161.685 144.217 1.00 96.93  ? 125  DC  I O2    1 
ATOM   8497  N  N3    . DC  I 5 125 ? 135.842 159.906 143.000 1.00 96.93  ? 125  DC  I N3    1 
ATOM   8498  C  C4    . DC  I 5 125 ? 135.491 158.880 142.230 1.00 96.93  ? 125  DC  I C4    1 
ATOM   8499  N  N4    . DC  I 5 125 ? 136.463 158.103 141.755 1.00 96.93  ? 125  DC  I N4    1 
ATOM   8500  C  C5    . DC  I 5 125 ? 134.129 158.611 141.907 1.00 96.93  ? 125  DC  I C5    1 
ATOM   8501  C  C6    . DC  I 5 125 ? 133.204 159.430 142.411 1.00 96.93  ? 125  DC  I C6    1 
ATOM   8502  P  P     . DG  I 5 126 ? 129.922 164.952 143.641 1.00 107.13 ? 126  DG  I P     1 
ATOM   8503  O  OP1   . DG  I 5 126 ? 128.628 165.004 144.357 1.00 107.13 ? 126  DG  I OP1   1 
ATOM   8504  O  OP2   . DG  I 5 126 ? 129.937 164.936 142.161 1.00 107.13 ? 126  DG  I OP2   1 
ATOM   8505  O  "O5'" . DG  I 5 126 ? 130.850 166.174 144.111 1.00 107.13 ? 126  DG  I "O5'" 1 
ATOM   8506  C  "C5'" . DG  I 5 126 ? 131.695 166.831 143.168 1.00 107.13 ? 126  DG  I "C5'" 1 
ATOM   8507  C  "C4'" . DG  I 5 126 ? 133.147 166.894 143.624 1.00 107.13 ? 126  DG  I "C4'" 1 
ATOM   8508  O  "O4'" . DG  I 5 126 ? 133.796 165.618 143.362 1.00 107.13 ? 126  DG  I "O4'" 1 
ATOM   8509  C  "C3'" . DG  I 5 126 ? 133.973 167.944 142.876 1.00 107.13 ? 126  DG  I "C3'" 1 
ATOM   8510  O  "O3'" . DG  I 5 126 ? 134.881 168.609 143.733 1.00 107.13 ? 126  DG  I "O3'" 1 
ATOM   8511  C  "C2'" . DG  I 5 126 ? 134.702 167.125 141.823 1.00 107.13 ? 126  DG  I "C2'" 1 
ATOM   8512  C  "C1'" . DG  I 5 126 ? 134.940 165.820 142.555 1.00 107.13 ? 126  DG  I "C1'" 1 
ATOM   8513  N  N9    . DG  I 5 126 ? 135.063 164.684 141.652 1.00 107.13 ? 126  DG  I N9    1 
ATOM   8514  C  C8    . DG  I 5 126 ? 134.037 163.969 141.093 1.00 107.13 ? 126  DG  I C8    1 
ATOM   8515  N  N7    . DG  I 5 126 ? 134.437 163.007 140.317 1.00 107.13 ? 126  DG  I N7    1 
ATOM   8516  C  C5    . DG  I 5 126 ? 135.818 163.097 140.353 1.00 107.13 ? 126  DG  I C5    1 
ATOM   8517  C  C6    . DG  I 5 126 ? 136.795 162.313 139.703 1.00 107.13 ? 126  DG  I C6    1 
ATOM   8518  O  O6    . DG  I 5 126 ? 136.623 161.356 138.940 1.00 107.13 ? 126  DG  I O6    1 
ATOM   8519  N  N1    . DG  I 5 126 ? 138.079 162.734 140.008 1.00 107.13 ? 126  DG  I N1    1 
ATOM   8520  C  C2    . DG  I 5 126 ? 138.380 163.791 140.821 1.00 107.13 ? 126  DG  I C2    1 
ATOM   8521  N  N2    . DG  I 5 126 ? 139.677 164.043 141.010 1.00 107.13 ? 126  DG  I N2    1 
ATOM   8522  N  N3    . DG  I 5 126 ? 137.475 164.526 141.452 1.00 107.13 ? 126  DG  I N3    1 
ATOM   8523  C  C4    . DG  I 5 126 ? 136.219 164.127 141.166 1.00 107.13 ? 126  DG  I C4    1 
ATOM   8524  P  P     . DT  I 5 127 ? 135.444 170.054 143.305 1.00 109.55 ? 127  DT  I P     1 
ATOM   8525  O  OP1   . DT  I 5 127 ? 135.933 170.724 144.526 1.00 109.55 ? 127  DT  I OP1   1 
ATOM   8526  O  OP2   . DT  I 5 127 ? 134.424 170.703 142.455 1.00 109.55 ? 127  DT  I OP2   1 
ATOM   8527  O  "O5'" . DT  I 5 127 ? 136.681 169.731 142.344 1.00 109.55 ? 127  DT  I "O5'" 1 
ATOM   8528  C  "C5'" . DT  I 5 127 ? 137.835 169.084 142.861 1.00 109.55 ? 127  DT  I "C5'" 1 
ATOM   8529  C  "C4'" . DT  I 5 127 ? 138.891 168.920 141.783 1.00 109.55 ? 127  DT  I "C4'" 1 
ATOM   8530  O  "O4'" . DT  I 5 127 ? 138.682 167.675 141.074 1.00 109.55 ? 127  DT  I "O4'" 1 
ATOM   8531  C  "C3'" . DT  I 5 127 ? 138.920 170.014 140.713 1.00 109.55 ? 127  DT  I "C3'" 1 
ATOM   8532  O  "O3'" . DT  I 5 127 ? 140.254 170.426 140.520 1.00 109.55 ? 127  DT  I "O3'" 1 
ATOM   8533  C  "C2'" . DT  I 5 127 ? 138.373 169.310 139.475 1.00 109.55 ? 127  DT  I "C2'" 1 
ATOM   8534  C  "C1'" . DT  I 5 127 ? 138.874 167.906 139.703 1.00 109.55 ? 127  DT  I "C1'" 1 
ATOM   8535  N  N1    . DT  I 5 127 ? 138.131 166.889 138.944 1.00 109.55 ? 127  DT  I N1    1 
ATOM   8536  C  C2    . DT  I 5 127 ? 138.834 165.939 138.249 1.00 109.55 ? 127  DT  I C2    1 
ATOM   8537  O  O2    . DT  I 5 127 ? 140.050 165.880 138.237 1.00 109.55 ? 127  DT  I O2    1 
ATOM   8538  N  N3    . DT  I 5 127 ? 138.066 165.040 137.579 1.00 109.55 ? 127  DT  I N3    1 
ATOM   8539  C  C4    . DT  I 5 127 ? 136.690 165.003 137.524 1.00 109.55 ? 127  DT  I C4    1 
ATOM   8540  O  O4    . DT  I 5 127 ? 136.088 164.149 136.888 1.00 109.55 ? 127  DT  I O4    1 
ATOM   8541  C  C5    . DT  I 5 127 ? 136.013 166.034 138.265 1.00 109.55 ? 127  DT  I C5    1 
ATOM   8542  C  C7    . DT  I 5 127 ? 134.520 166.091 138.271 1.00 109.55 ? 127  DT  I C7    1 
ATOM   8543  C  C6    . DT  I 5 127 ? 136.757 166.923 138.927 1.00 109.55 ? 127  DT  I C6    1 
ATOM   8544  P  P     . DG  I 5 128 ? 140.617 171.741 139.671 1.00 109.06 ? 128  DG  I P     1 
ATOM   8545  O  OP1   . DG  I 5 128 ? 141.471 172.582 140.534 1.00 109.06 ? 128  DG  I OP1   1 
ATOM   8546  O  OP2   . DG  I 5 128 ? 139.403 172.343 139.080 1.00 109.06 ? 128  DG  I OP2   1 
ATOM   8547  O  "O5'" . DG  I 5 128 ? 141.530 171.153 138.505 1.00 109.06 ? 128  DG  I "O5'" 1 
ATOM   8548  C  "C5'" . DG  I 5 128 ? 142.692 170.422 138.848 1.00 109.06 ? 128  DG  I "C5'" 1 
ATOM   8549  C  "C4'" . DG  I 5 128 ? 143.096 169.490 137.728 1.00 109.06 ? 128  DG  I "C4'" 1 
ATOM   8550  O  "O4'" . DG  I 5 128 ? 141.998 168.599 137.428 1.00 109.06 ? 128  DG  I "O4'" 1 
ATOM   8551  C  "C3'" . DG  I 5 128 ? 143.455 170.193 136.421 1.00 109.06 ? 128  DG  I "C3'" 1 
ATOM   8552  O  "O3'" . DG  I 5 128 ? 144.767 169.799 136.008 1.00 109.06 ? 128  DG  I "O3'" 1 
ATOM   8553  C  "C2'" . DG  I 5 128 ? 142.366 169.748 135.436 1.00 109.06 ? 128  DG  I "C2'" 1 
ATOM   8554  C  "C1'" . DG  I 5 128 ? 141.902 168.437 136.041 1.00 109.06 ? 128  DG  I "C1'" 1 
ATOM   8555  N  N9    . DG  I 5 128 ? 140.524 168.061 135.713 1.00 109.06 ? 128  DG  I N9    1 
ATOM   8556  C  C8    . DG  I 5 128 ? 139.363 168.657 136.145 1.00 109.06 ? 128  DG  I C8    1 
ATOM   8557  N  N7    . DG  I 5 128 ? 138.283 168.078 135.691 1.00 109.06 ? 128  DG  I N7    1 
ATOM   8558  C  C5    . DG  I 5 128 ? 138.763 167.034 134.914 1.00 109.06 ? 128  DG  I C5    1 
ATOM   8559  C  C6    . DG  I 5 128 ? 138.071 166.055 134.166 1.00 109.06 ? 128  DG  I C6    1 
ATOM   8560  O  O6    . DG  I 5 128 ? 136.852 165.906 134.034 1.00 109.06 ? 128  DG  I O6    1 
ATOM   8561  N  N1    . DG  I 5 128 ? 138.944 165.179 133.528 1.00 109.06 ? 128  DG  I N1    1 
ATOM   8562  C  C2    . DG  I 5 128 ? 140.308 165.247 133.604 1.00 109.06 ? 128  DG  I C2    1 
ATOM   8563  N  N2    . DG  I 5 128 ? 141.000 164.326 132.922 1.00 109.06 ? 128  DG  I N2    1 
ATOM   8564  N  N3    . DG  I 5 128 ? 140.963 166.156 134.300 1.00 109.06 ? 128  DG  I N3    1 
ATOM   8565  C  C4    . DG  I 5 128 ? 140.133 167.011 134.925 1.00 109.06 ? 128  DG  I C4    1 
ATOM   8566  P  P     . DT  I 5 129 ? 145.485 170.527 134.767 1.00 110.22 ? 129  DT  I P     1 
ATOM   8567  O  OP1   . DT  I 5 129 ? 146.941 170.525 135.043 1.00 110.22 ? 129  DT  I OP1   1 
ATOM   8568  O  OP2   . DT  I 5 129 ? 144.787 171.808 134.523 1.00 110.22 ? 129  DT  I OP2   1 
ATOM   8569  O  "O5'" . DT  I 5 129 ? 145.185 169.575 133.521 1.00 110.22 ? 129  DT  I "O5'" 1 
ATOM   8570  C  "C5'" . DT  I 5 129 ? 145.662 168.247 133.530 1.00 110.22 ? 129  DT  I "C5'" 1 
ATOM   8571  C  "C4'" . DT  I 5 129 ? 145.261 167.520 132.266 1.00 110.22 ? 129  DT  I "C4'" 1 
ATOM   8572  O  "O4'" . DT  I 5 129 ? 143.852 167.197 132.307 1.00 110.22 ? 129  DT  I "O4'" 1 
ATOM   8573  C  "C3'" . DT  I 5 129 ? 145.481 168.289 130.967 1.00 110.22 ? 129  DT  I "C3'" 1 
ATOM   8574  O  "O3'" . DT  I 5 129 ? 146.080 167.423 130.013 1.00 110.22 ? 129  DT  I "O3'" 1 
ATOM   8575  C  "C2'" . DT  I 5 129 ? 144.064 168.680 130.560 1.00 110.22 ? 129  DT  I "C2'" 1 
ATOM   8576  C  "C1'" . DT  I 5 129 ? 143.284 167.480 131.056 1.00 110.22 ? 129  DT  I "C1'" 1 
ATOM   8577  N  N1    . DT  I 5 129 ? 141.818 167.707 131.250 1.00 110.22 ? 129  DT  I N1    1 
ATOM   8578  C  C2    . DT  I 5 129 ? 140.927 166.822 130.695 1.00 110.22 ? 129  DT  I C2    1 
ATOM   8579  O  O2    . DT  I 5 129 ? 141.267 165.850 130.051 1.00 110.22 ? 129  DT  I O2    1 
ATOM   8580  N  N3    . DT  I 5 129 ? 139.614 167.099 130.948 1.00 110.22 ? 129  DT  I N3    1 
ATOM   8581  C  C4    . DT  I 5 129 ? 139.114 168.159 131.667 1.00 110.22 ? 129  DT  I C4    1 
ATOM   8582  O  O4    . DT  I 5 129 ? 137.919 168.331 131.833 1.00 110.22 ? 129  DT  I O4    1 
ATOM   8583  C  C5    . DT  I 5 129 ? 140.090 169.051 132.210 1.00 110.22 ? 129  DT  I C5    1 
ATOM   8584  C  C7    . DT  I 5 129 ? 139.649 170.238 133.004 1.00 110.22 ? 129  DT  I C7    1 
ATOM   8585  C  C6    . DT  I 5 129 ? 141.384 168.788 131.984 1.00 110.22 ? 129  DT  I C6    1 
ATOM   8586  P  P     . DC  I 5 130 ? 146.856 168.012 128.738 1.00 116.63 ? 130  DC  I P     1 
ATOM   8587  O  OP1   . DC  I 5 130 ? 148.221 167.455 128.750 1.00 116.63 ? 130  DC  I OP1   1 
ATOM   8588  O  OP2   . DC  I 5 130 ? 146.641 169.470 128.677 1.00 116.63 ? 130  DC  I OP2   1 
ATOM   8589  O  "O5'" . DC  I 5 130 ? 146.103 167.360 127.503 1.00 116.63 ? 130  DC  I "O5'" 1 
ATOM   8590  C  "C5'" . DC  I 5 130 ? 146.164 165.961 127.303 1.00 116.63 ? 130  DC  I "C5'" 1 
ATOM   8591  C  "C4'" . DC  I 5 130 ? 145.047 165.470 126.387 1.00 116.63 ? 130  DC  I "C4'" 1 
ATOM   8592  O  "O4'" . DC  I 5 130 ? 143.752 165.737 126.987 1.00 116.63 ? 130  DC  I "O4'" 1 
ATOM   8593  C  "C3'" . DC  I 5 130 ? 144.991 166.105 124.993 1.00 116.63 ? 130  DC  I "C3'" 1 
ATOM   8594  O  "O3'" . DC  I 5 130 ? 144.560 165.138 124.071 1.00 116.63 ? 130  DC  I "O3'" 1 
ATOM   8595  C  "C2'" . DC  I 5 130 ? 143.927 167.171 125.174 1.00 116.63 ? 130  DC  I "C2'" 1 
ATOM   8596  C  "C1'" . DC  I 5 130 ? 142.951 166.415 126.051 1.00 116.63 ? 130  DC  I "C1'" 1 
ATOM   8597  N  N1    . DC  I 5 130 ? 142.013 167.281 126.770 1.00 116.63 ? 130  DC  I N1    1 
ATOM   8598  C  C2    . DC  I 5 130 ? 140.666 166.981 126.743 1.00 116.63 ? 130  DC  I C2    1 
ATOM   8599  O  O2    . DC  I 5 130 ? 140.301 165.985 126.126 1.00 116.63 ? 130  DC  I O2    1 
ATOM   8600  N  N3    . DC  I 5 130 ? 139.801 167.785 127.397 1.00 116.63 ? 130  DC  I N3    1 
ATOM   8601  C  C4    . DC  I 5 130 ? 140.252 168.850 128.051 1.00 116.63 ? 130  DC  I C4    1 
ATOM   8602  N  N4    . DC  I 5 130 ? 139.366 169.625 128.685 1.00 116.63 ? 130  DC  I N4    1 
ATOM   8603  C  C5    . DC  I 5 130 ? 141.628 169.175 128.077 1.00 116.63 ? 130  DC  I C5    1 
ATOM   8604  C  C6    . DC  I 5 130 ? 142.466 168.370 127.427 1.00 116.63 ? 130  DC  I C6    1 
ATOM   8605  P  P     . DA  I 5 131 ? 145.625 164.387 123.138 1.00 125.33 ? 131  DA  I P     1 
ATOM   8606  O  OP1   . DA  I 5 131 ? 146.579 163.646 123.990 1.00 125.33 ? 131  DA  I OP1   1 
ATOM   8607  O  OP2   . DA  I 5 131 ? 146.112 165.392 122.169 1.00 125.33 ? 131  DA  I OP2   1 
ATOM   8608  O  "O5'" . DA  I 5 131 ? 144.740 163.339 122.327 1.00 125.33 ? 131  DA  I "O5'" 1 
ATOM   8609  C  "C5'" . DA  I 5 131 ? 144.300 163.647 121.030 1.00 125.33 ? 131  DA  I "C5'" 1 
ATOM   8610  C  "C4'" . DA  I 5 131 ? 143.028 162.896 120.709 1.00 125.33 ? 131  DA  I "C4'" 1 
ATOM   8611  O  "O4'" . DA  I 5 131 ? 141.947 163.393 121.537 1.00 125.33 ? 131  DA  I "O4'" 1 
ATOM   8612  C  "C3'" . DA  I 5 131 ? 142.533 163.091 119.307 1.00 125.33 ? 131  DA  I "C3'" 1 
ATOM   8613  O  "O3'" . DA  I 5 131 ? 141.614 162.068 118.988 1.00 125.33 ? 131  DA  I "O3'" 1 
ATOM   8614  C  "C2'" . DA  I 5 131 ? 141.842 164.431 119.432 1.00 125.33 ? 131  DA  I "C2'" 1 
ATOM   8615  C  "C1'" . DA  I 5 131 ? 141.169 164.320 120.799 1.00 125.33 ? 131  DA  I "C1'" 1 
ATOM   8616  N  N9    . DA  I 5 131 ? 141.136 165.574 121.550 1.00 125.33 ? 131  DA  I N9    1 
ATOM   8617  C  C8    . DA  I 5 131 ? 142.215 166.300 121.959 1.00 125.33 ? 131  DA  I C8    1 
ATOM   8618  N  N7    . DA  I 5 131 ? 141.908 167.378 122.627 1.00 125.33 ? 131  DA  I N7    1 
ATOM   8619  C  C5    . DA  I 5 131 ? 140.535 167.355 122.693 1.00 125.33 ? 131  DA  I C5    1 
ATOM   8620  C  C6    . DA  I 5 131 ? 139.609 168.229 123.289 1.00 125.33 ? 131  DA  I C6    1 
ATOM   8621  N  N6    . DA  I 5 131 ? 139.967 169.334 123.945 1.00 125.33 ? 131  DA  I N6    1 
ATOM   8622  N  N1    . DA  I 5 131 ? 138.301 167.933 123.168 1.00 125.33 ? 131  DA  I N1    1 
ATOM   8623  C  C2    . DA  I 5 131 ? 137.949 166.821 122.508 1.00 125.33 ? 131  DA  I C2    1 
ATOM   8624  N  N3    . DA  I 5 131 ? 138.736 165.920 121.901 1.00 125.33 ? 131  DA  I N3    1 
ATOM   8625  C  C4    . DA  I 5 131 ? 140.031 166.248 122.036 1.00 125.33 ? 131  DA  I C4    1 
ATOM   8626  P  P     . DG  I 5 132 ? 141.071 161.916 117.487 1.00 134.07 ? 132  DG  I P     1 
ATOM   8627  O  OP1   . DG  I 5 132 ? 140.535 160.545 117.327 1.00 134.07 ? 132  DG  I OP1   1 
ATOM   8628  O  OP2   . DG  I 5 132 ? 142.129 162.436 116.591 1.00 134.07 ? 132  DG  I OP2   1 
ATOM   8629  O  "O5'" . DG  I 5 132 ? 139.830 162.913 117.434 1.00 134.07 ? 132  DG  I "O5'" 1 
ATOM   8630  C  "C5'" . DG  I 5 132 ? 138.631 162.547 118.052 1.00 134.07 ? 132  DG  I "C5'" 1 
ATOM   8631  C  "C4'" . DG  I 5 132 ? 137.611 163.661 117.957 1.00 134.07 ? 132  DG  I "C4'" 1 
ATOM   8632  O  "O4'" . DG  I 5 132 ? 137.980 164.765 118.823 1.00 134.07 ? 132  DG  I "O4'" 1 
ATOM   8633  C  "C3'" . DG  I 5 132 ? 137.421 164.258 116.562 1.00 134.07 ? 132  DG  I "C3'" 1 
ATOM   8634  O  "O3'" . DG  I 5 132 ? 136.043 164.367 116.321 1.00 134.07 ? 132  DG  I "O3'" 1 
ATOM   8635  C  "C2'" . DG  I 5 132 ? 138.080 165.639 116.688 1.00 134.07 ? 132  DG  I "C2'" 1 
ATOM   8636  C  "C1'" . DG  I 5 132 ? 137.759 165.966 118.127 1.00 134.07 ? 132  DG  I "C1'" 1 
ATOM   8637  N  N9    . DG  I 5 132 ? 138.575 167.013 118.720 1.00 134.07 ? 132  DG  I N9    1 
ATOM   8638  C  C8    . DG  I 5 132 ? 139.938 167.100 118.749 1.00 134.07 ? 132  DG  I C8    1 
ATOM   8639  N  N7    . DG  I 5 132 ? 140.382 168.136 119.393 1.00 134.07 ? 132  DG  I N7    1 
ATOM   8640  C  C5    . DG  I 5 132 ? 139.233 168.775 119.817 1.00 134.07 ? 132  DG  I C5    1 
ATOM   8641  C  C6    . DG  I 5 132 ? 139.076 169.959 120.552 1.00 134.07 ? 132  DG  I C6    1 
ATOM   8642  O  O6    . DG  I 5 132 ? 139.952 170.704 120.999 1.00 134.07 ? 132  DG  I O6    1 
ATOM   8643  N  N1    . DG  I 5 132 ? 137.735 170.251 120.768 1.00 134.07 ? 132  DG  I N1    1 
ATOM   8644  C  C2    . DG  I 5 132 ? 136.684 169.488 120.329 1.00 134.07 ? 132  DG  I C2    1 
ATOM   8645  N  N2    . DG  I 5 132 ? 135.459 169.927 120.624 1.00 134.07 ? 132  DG  I N2    1 
ATOM   8646  N  N3    . DG  I 5 132 ? 136.820 168.384 119.628 1.00 134.07 ? 132  DG  I N3    1 
ATOM   8647  C  C4    . DG  I 5 132 ? 138.116 168.091 119.411 1.00 134.07 ? 132  DG  I C4    1 
ATOM   8648  P  P     . DA  I 5 133 ? 135.466 164.695 114.861 1.00 141.56 ? 133  DA  I P     1 
ATOM   8649  O  OP1   . DA  I 5 133 ? 134.588 163.556 114.520 1.00 141.56 ? 133  DA  I OP1   1 
ATOM   8650  O  OP2   . DA  I 5 133 ? 136.556 165.056 113.930 1.00 141.56 ? 133  DA  I OP2   1 
ATOM   8651  O  "O5'" . DA  I 5 133 ? 134.548 165.974 115.135 1.00 141.56 ? 133  DA  I "O5'" 1 
ATOM   8652  C  "C5'" . DA  I 5 133 ? 133.428 165.833 115.997 1.00 141.56 ? 133  DA  I "C5'" 1 
ATOM   8653  C  "C4'" . DA  I 5 133 ? 132.892 167.171 116.470 1.00 141.56 ? 133  DA  I "C4'" 1 
ATOM   8654  O  "O4'" . DA  I 5 133 ? 133.928 167.899 117.179 1.00 141.56 ? 133  DA  I "O4'" 1 
ATOM   8655  C  "C3'" . DA  I 5 133 ? 132.391 168.104 115.376 1.00 141.56 ? 133  DA  I "C3'" 1 
ATOM   8656  O  "O3'" . DA  I 5 133 ? 131.208 168.739 115.826 1.00 141.56 ? 133  DA  I "O3'" 1 
ATOM   8657  C  "C2'" . DA  I 5 133 ? 133.544 169.094 115.208 1.00 141.56 ? 133  DA  I "C2'" 1 
ATOM   8658  C  "C1'" . DA  I 5 133 ? 134.082 169.186 116.622 1.00 141.56 ? 133  DA  I "C1'" 1 
ATOM   8659  N  N9    . DA  I 5 133 ? 135.493 169.537 116.702 1.00 141.56 ? 133  DA  I N9    1 
ATOM   8660  C  C8    . DA  I 5 133 ? 136.540 168.826 116.208 1.00 141.56 ? 133  DA  I C8    1 
ATOM   8661  N  N7    . DA  I 5 133 ? 137.707 169.368 116.449 1.00 141.56 ? 133  DA  I N7    1 
ATOM   8662  C  C5    . DA  I 5 133 ? 137.402 170.504 117.168 1.00 141.56 ? 133  DA  I C5    1 
ATOM   8663  C  C6    . DA  I 5 133 ? 138.203 171.518 117.728 1.00 141.56 ? 133  DA  I C6    1 
ATOM   8664  N  N6    . DA  I 5 133 ? 139.537 171.535 117.644 1.00 141.56 ? 133  DA  I N6    1 
ATOM   8665  N  N1    . DA  I 5 133 ? 137.581 172.515 118.388 1.00 141.56 ? 133  DA  I N1    1 
ATOM   8666  C  C2    . DA  I 5 133 ? 136.249 172.494 118.478 1.00 141.56 ? 133  DA  I C2    1 
ATOM   8667  N  N3    . DA  I 5 133 ? 135.394 171.598 117.986 1.00 141.56 ? 133  DA  I N3    1 
ATOM   8668  C  C4    . DA  I 5 133 ? 136.041 170.623 117.335 1.00 141.56 ? 133  DA  I C4    1 
ATOM   8669  P  P     . DT  I 5 134 ? 130.373 169.729 114.876 1.00 148.96 ? 134  DT  I P     1 
ATOM   8670  O  OP1   . DT  I 5 134 ? 128.940 169.571 115.205 1.00 148.96 ? 134  DT  I OP1   1 
ATOM   8671  O  OP2   . DT  I 5 134 ? 130.804 169.565 113.474 1.00 148.96 ? 134  DT  I OP2   1 
ATOM   8672  O  "O5'" . DT  I 5 134 ? 130.868 171.159 115.358 1.00 148.96 ? 134  DT  I "O5'" 1 
ATOM   8673  C  "C5'" . DT  I 5 134 ? 130.760 171.505 116.730 1.00 148.96 ? 134  DT  I "C5'" 1 
ATOM   8674  C  "C4'" . DT  I 5 134 ? 130.925 172.996 116.950 1.00 148.96 ? 134  DT  I "C4'" 1 
ATOM   8675  O  "O4'" . DT  I 5 134 ? 132.322 173.328 117.121 1.00 148.96 ? 134  DT  I "O4'" 1 
ATOM   8676  C  "C3'" . DT  I 5 134 ? 130.420 173.889 115.825 1.00 148.96 ? 134  DT  I "C3'" 1 
ATOM   8677  O  "O3'" . DT  I 5 134 ? 129.830 175.072 116.392 1.00 148.96 ? 134  DT  I "O3'" 1 
ATOM   8678  C  "C2'" . DT  I 5 134 ? 131.704 174.199 115.060 1.00 148.96 ? 134  DT  I "C2'" 1 
ATOM   8679  C  "C1'" . DT  I 5 134 ? 132.685 174.337 116.202 1.00 148.96 ? 134  DT  I "C1'" 1 
ATOM   8680  N  N1    . DT  I 5 134 ? 134.086 174.110 115.845 1.00 148.96 ? 134  DT  I N1    1 
ATOM   8681  C  C2    . DT  I 5 134 ? 135.046 174.949 116.351 1.00 148.96 ? 134  DT  I C2    1 
ATOM   8682  O  O2    . DT  I 5 134 ? 134.790 175.907 117.054 1.00 148.96 ? 134  DT  I O2    1 
ATOM   8683  N  N3    . DT  I 5 134 ? 136.323 174.628 116.002 1.00 148.96 ? 134  DT  I N3    1 
ATOM   8684  C  C4    . DT  I 5 134 ? 136.725 173.570 115.222 1.00 148.96 ? 134  DT  I C4    1 
ATOM   8685  O  O4    . DT  I 5 134 ? 137.898 173.358 114.959 1.00 148.96 ? 134  DT  I O4    1 
ATOM   8686  C  C5    . DT  I 5 134 ? 135.669 172.725 114.733 1.00 148.96 ? 134  DT  I C5    1 
ATOM   8687  C  C7    . DT  I 5 134 ? 135.992 171.545 113.871 1.00 148.96 ? 134  DT  I C7    1 
ATOM   8688  C  C6    . DT  I 5 134 ? 134.413 173.028 115.072 1.00 148.96 ? 134  DT  I C6    1 
ATOM   8689  P  P     . DA  I 5 135 ? 128.646 175.842 115.628 1.00 160.34 ? 135  DA  I P     1 
ATOM   8690  O  OP1   . DA  I 5 135 ? 127.414 175.567 116.392 1.00 160.34 ? 135  DA  I OP1   1 
ATOM   8691  O  OP2   . DA  I 5 135 ? 128.709 175.496 114.193 1.00 160.34 ? 135  DA  I OP2   1 
ATOM   8692  O  "O5'" . DA  I 5 135 ? 129.014 177.395 115.770 1.00 160.34 ? 135  DA  I "O5'" 1 
ATOM   8693  C  "C5'" . DA  I 5 135 ? 129.036 178.018 117.057 1.00 160.34 ? 135  DA  I "C5'" 1 
ATOM   8694  C  "C4'" . DA  I 5 135 ? 130.091 179.125 117.144 1.00 160.34 ? 135  DA  I "C4'" 1 
ATOM   8695  O  "O4'" . DA  I 5 135 ? 131.392 178.616 116.760 1.00 160.34 ? 135  DA  I "O4'" 1 
ATOM   8696  C  "C3'" . DA  I 5 135 ? 129.871 180.368 116.282 1.00 160.34 ? 135  DA  I "C3'" 1 
ATOM   8697  O  "O3'" . DA  I 5 135 ? 130.409 181.480 116.961 1.00 160.34 ? 135  DA  I "O3'" 1 
ATOM   8698  C  "C2'" . DA  I 5 135 ? 130.702 180.053 115.043 1.00 160.34 ? 135  DA  I "C2'" 1 
ATOM   8699  C  "C1'" . DA  I 5 135 ? 131.900 179.368 115.671 1.00 160.34 ? 135  DA  I "C1'" 1 
ATOM   8700  N  N9    . DA  I 5 135 ? 132.562 178.439 114.790 1.00 160.34 ? 135  DA  I N9    1 
ATOM   8701  C  C8    . DA  I 5 135 ? 131.979 177.457 114.060 1.00 160.34 ? 135  DA  I C8    1 
ATOM   8702  N  N7    . DA  I 5 135 ? 132.825 176.750 113.360 1.00 160.34 ? 135  DA  I N7    1 
ATOM   8703  C  C5    . DA  I 5 135 ? 134.046 177.288 113.685 1.00 160.34 ? 135  DA  I C5    1 
ATOM   8704  C  C6    . DA  I 5 135 ? 135.347 176.979 113.279 1.00 160.34 ? 135  DA  I C6    1 
ATOM   8705  N  N6    . DA  I 5 135 ? 135.632 175.993 112.429 1.00 160.34 ? 135  DA  I N6    1 
ATOM   8706  N  N1    . DA  I 5 135 ? 136.349 177.723 113.780 1.00 160.34 ? 135  DA  I N1    1 
ATOM   8707  C  C2    . DA  I 5 135 ? 136.054 178.714 114.626 1.00 160.34 ? 135  DA  I C2    1 
ATOM   8708  N  N3    . DA  I 5 135 ? 134.867 179.094 115.082 1.00 160.34 ? 135  DA  I N3    1 
ATOM   8709  C  C4    . DA  I 5 135 ? 133.900 178.332 114.567 1.00 160.34 ? 135  DA  I C4    1 
ATOM   8710  P  P     . DT  I 5 136 ? 130.240 182.972 116.396 1.00 173.31 ? 136  DT  I P     1 
ATOM   8711  O  OP1   . DT  I 5 136 ? 129.941 183.841 117.552 1.00 173.31 ? 136  DT  I OP1   1 
ATOM   8712  O  OP2   . DT  I 5 136 ? 129.301 182.966 115.257 1.00 173.31 ? 136  DT  I OP2   1 
ATOM   8713  O  "O5'" . DT  I 5 136 ? 131.714 183.316 115.867 1.00 173.31 ? 136  DT  I "O5'" 1 
ATOM   8714  C  "C5'" . DT  I 5 136 ? 132.847 183.000 116.686 1.00 173.31 ? 136  DT  I "C5'" 1 
ATOM   8715  C  "C4'" . DT  I 5 136 ? 134.171 183.405 116.039 1.00 173.31 ? 136  DT  I "C4'" 1 
ATOM   8716  O  "O4'" . DT  I 5 136 ? 134.741 182.327 115.236 1.00 173.31 ? 136  DT  I "O4'" 1 
ATOM   8717  C  "C3'" . DT  I 5 136 ? 134.124 184.622 115.121 1.00 173.31 ? 136  DT  I "C3'" 1 
ATOM   8718  O  "O3'" . DT  I 5 136 ? 135.314 185.351 115.308 1.00 173.31 ? 136  DT  I "O3'" 1 
ATOM   8719  C  "C2'" . DT  I 5 136 ? 134.092 183.979 113.738 1.00 173.31 ? 136  DT  I "C2'" 1 
ATOM   8720  C  "C1'" . DT  I 5 136 ? 135.074 182.846 113.962 1.00 173.31 ? 136  DT  I "C1'" 1 
ATOM   8721  N  N1    . DT  I 5 136 ? 135.041 181.751 112.955 1.00 173.31 ? 136  DT  I N1    1 
ATOM   8722  C  C2    . DT  I 5 136 ? 136.223 181.313 112.400 1.00 173.31 ? 136  DT  I C2    1 
ATOM   8723  O  O2    . DT  I 5 136 ? 137.302 181.798 112.667 1.00 173.31 ? 136  DT  I O2    1 
ATOM   8724  N  N3    . DT  I 5 136 ? 136.093 180.292 111.505 1.00 173.31 ? 136  DT  I N3    1 
ATOM   8725  C  C4    . DT  I 5 136 ? 134.927 179.669 111.123 1.00 173.31 ? 136  DT  I C4    1 
ATOM   8726  O  O4    . DT  I 5 136 ? 134.908 178.756 110.305 1.00 173.31 ? 136  DT  I O4    1 
ATOM   8727  C  C5    . DT  I 5 136 ? 133.725 180.166 111.749 1.00 173.31 ? 136  DT  I C5    1 
ATOM   8728  C  C7    . DT  I 5 136 ? 132.392 179.572 111.398 1.00 173.31 ? 136  DT  I C7    1 
ATOM   8729  C  C6    . DT  I 5 136 ? 133.840 181.169 112.630 1.00 173.31 ? 136  DT  I C6    1 
ATOM   8730  P  P     . DA  I 5 137 ? 135.281 186.944 115.452 1.00 189.01 ? 137  DA  I P     1 
ATOM   8731  O  OP1   . DA  I 5 137 ? 134.735 187.248 116.794 1.00 189.01 ? 137  DA  I OP1   1 
ATOM   8732  O  OP2   . DA  I 5 137 ? 134.601 187.474 114.251 1.00 189.01 ? 137  DA  I OP2   1 
ATOM   8733  O  "O5'" . DA  I 5 137 ? 136.826 187.366 115.371 1.00 189.01 ? 137  DA  I "O5'" 1 
ATOM   8734  C  "C5'" . DA  I 5 137 ? 137.272 188.190 114.311 1.00 189.01 ? 137  DA  I "C5'" 1 
ATOM   8735  C  "C4'" . DA  I 5 137 ? 138.559 187.669 113.696 1.00 189.01 ? 137  DA  I "C4'" 1 
ATOM   8736  O  "O4'" . DA  I 5 137 ? 138.401 186.293 113.253 1.00 189.01 ? 137  DA  I "O4'" 1 
ATOM   8737  C  "C3'" . DA  I 5 137 ? 139.033 188.445 112.472 1.00 189.01 ? 137  DA  I "C3'" 1 
ATOM   8738  O  "O3'" . DA  I 5 137 ? 140.453 188.472 112.425 1.00 189.01 ? 137  DA  I "O3'" 1 
ATOM   8739  C  "C2'" . DA  I 5 137 ? 138.462 187.628 111.325 1.00 189.01 ? 137  DA  I "C2'" 1 
ATOM   8740  C  "C1'" . DA  I 5 137 ? 138.648 186.219 111.858 1.00 189.01 ? 137  DA  I "C1'" 1 
ATOM   8741  N  N9    . DA  I 5 137 ? 137.747 185.247 111.262 1.00 189.01 ? 137  DA  I N9    1 
ATOM   8742  C  C8    . DA  I 5 137 ? 136.416 185.112 111.503 1.00 189.01 ? 137  DA  I C8    1 
ATOM   8743  N  N7    . DA  I 5 137 ? 135.847 184.152 110.822 1.00 189.01 ? 137  DA  I N7    1 
ATOM   8744  C  C5    . DA  I 5 137 ? 136.876 183.634 110.067 1.00 189.01 ? 137  DA  I C5    1 
ATOM   8745  C  C6    . DA  I 5 137 ? 136.925 182.595 109.131 1.00 189.01 ? 137  DA  I C6    1 
ATOM   8746  N  N6    . DA  I 5 137 ? 135.859 181.870 108.789 1.00 189.01 ? 137  DA  I N6    1 
ATOM   8747  N  N1    . DA  I 5 137 ? 138.113 182.330 108.553 1.00 189.01 ? 137  DA  I N1    1 
ATOM   8748  C  C2    . DA  I 5 137 ? 139.180 183.071 108.893 1.00 189.01 ? 137  DA  I C2    1 
ATOM   8749  N  N3    . DA  I 5 137 ? 139.253 184.065 109.773 1.00 189.01 ? 137  DA  I N3    1 
ATOM   8750  C  C4    . DA  I 5 137 ? 138.056 184.301 110.322 1.00 189.01 ? 137  DA  I C4    1 
ATOM   8751  P  P     . DT  I 5 138 ? 141.210 189.513 111.463 1.00 204.75 ? 138  DT  I P     1 
ATOM   8752  O  OP1   . DT  I 5 138 ? 142.602 189.612 111.958 1.00 204.75 ? 138  DT  I OP1   1 
ATOM   8753  O  OP2   . DT  I 5 138 ? 140.375 190.729 111.346 1.00 204.75 ? 138  DT  I OP2   1 
ATOM   8754  O  "O5'" . DT  I 5 138 ? 141.232 188.783 110.037 1.00 204.75 ? 138  DT  I "O5'" 1 
ATOM   8755  C  "C5'" . DT  I 5 138 ? 141.804 187.495 109.918 1.00 204.75 ? 138  DT  I "C5'" 1 
ATOM   8756  C  "C4'" . DT  I 5 138 ? 141.805 187.025 108.477 1.00 204.75 ? 138  DT  I "C4'" 1 
ATOM   8757  O  "O4'" . DT  I 5 138 ? 140.692 186.122 108.236 1.00 204.75 ? 138  DT  I "O4'" 1 
ATOM   8758  C  "C3'" . DT  I 5 138 ? 141.693 188.130 107.416 1.00 204.75 ? 138  DT  I "C3'" 1 
ATOM   8759  O  "O3'" . DT  I 5 138 ? 142.688 187.916 106.414 1.00 204.75 ? 138  DT  I "O3'" 1 
ATOM   8760  C  "C2'" . DT  I 5 138 ? 140.281 187.934 106.864 1.00 204.75 ? 138  DT  I "C2'" 1 
ATOM   8761  C  "C1'" . DT  I 5 138 ? 140.146 186.435 106.983 1.00 204.75 ? 138  DT  I "C1'" 1 
ATOM   8762  N  N1    . DT  I 5 138 ? 138.762 185.920 106.883 1.00 204.75 ? 138  DT  I N1    1 
ATOM   8763  C  C2    . DT  I 5 138 ? 138.506 184.910 105.996 1.00 204.75 ? 138  DT  I C2    1 
ATOM   8764  O  O2    . DT  I 5 138 ? 139.363 184.405 105.294 1.00 204.75 ? 138  DT  I O2    1 
ATOM   8765  N  N3    . DT  I 5 138 ? 137.210 184.496 105.958 1.00 204.75 ? 138  DT  I N3    1 
ATOM   8766  C  C4    . DT  I 5 138 ? 136.157 184.989 106.699 1.00 204.75 ? 138  DT  I C4    1 
ATOM   8767  O  O4    . DT  I 5 138 ? 135.020 184.548 106.591 1.00 204.75 ? 138  DT  I O4    1 
ATOM   8768  C  C5    . DT  I 5 138 ? 136.487 186.054 107.610 1.00 204.75 ? 138  DT  I C5    1 
ATOM   8769  C  C7    . DT  I 5 138 ? 135.419 186.668 108.466 1.00 204.75 ? 138  DT  I C7    1 
ATOM   8770  C  C6    . DT  I 5 138 ? 137.764 186.468 107.657 1.00 204.75 ? 138  DT  I C6    1 
ATOM   8771  P  P     . DA  I 5 139 ? 143.151 189.105 105.437 1.00 218.52 ? 139  DA  I P     1 
ATOM   8772  O  OP1   . DA  I 5 139 ? 144.487 189.524 105.908 1.00 218.52 ? 139  DA  I OP1   1 
ATOM   8773  O  OP2   . DA  I 5 139 ? 142.067 190.107 105.320 1.00 218.52 ? 139  DA  I OP2   1 
ATOM   8774  O  "O5'" . DA  I 5 139 ? 143.310 188.410 104.000 1.00 218.52 ? 139  DA  I "O5'" 1 
ATOM   8775  C  "C5'" . DA  I 5 139 ? 144.240 187.321 103.817 1.00 218.52 ? 139  DA  I "C5'" 1 
ATOM   8776  C  "C4'" . DA  I 5 139 ? 143.855 186.468 102.616 1.00 218.52 ? 139  DA  I "C4'" 1 
ATOM   8777  O  "O4'" . DA  I 5 139 ? 142.553 185.900 102.856 1.00 218.52 ? 139  DA  I "O4'" 1 
ATOM   8778  C  "C3'" . DA  I 5 139 ? 143.770 187.221 101.292 1.00 218.52 ? 139  DA  I "C3'" 1 
ATOM   8779  O  "O3'" . DA  I 5 139 ? 144.369 186.466 100.244 1.00 218.52 ? 139  DA  I "O3'" 1 
ATOM   8780  C  "C2'" . DA  I 5 139 ? 142.278 187.400 101.085 1.00 218.52 ? 139  DA  I "C2'" 1 
ATOM   8781  C  "C1'" . DA  I 5 139 ? 141.691 186.195 101.799 1.00 218.52 ? 139  DA  I "C1'" 1 
ATOM   8782  N  N9    . DA  I 5 139 ? 140.419 186.512 102.405 1.00 218.52 ? 139  DA  I N9    1 
ATOM   8783  C  C8    . DA  I 5 139 ? 140.189 187.455 103.362 1.00 218.52 ? 139  DA  I C8    1 
ATOM   8784  N  N7    . DA  I 5 139 ? 138.937 187.544 103.727 1.00 218.52 ? 139  DA  I N7    1 
ATOM   8785  C  C5    . DA  I 5 139 ? 138.304 186.601 102.948 1.00 218.52 ? 139  DA  I C5    1 
ATOM   8786  C  C6    . DA  I 5 139 ? 136.964 186.203 102.850 1.00 218.52 ? 139  DA  I C6    1 
ATOM   8787  N  N6    . DA  I 5 139 ? 135.985 186.736 103.585 1.00 218.52 ? 139  DA  I N6    1 
ATOM   8788  N  N1    . DA  I 5 139 ? 136.668 185.228 101.965 1.00 218.52 ? 139  DA  I N1    1 
ATOM   8789  C  C2    . DA  I 5 139 ? 137.653 184.696 101.232 1.00 218.52 ? 139  DA  I C2    1 
ATOM   8790  N  N3    . DA  I 5 139 ? 138.947 184.989 101.237 1.00 218.52 ? 139  DA  I N3    1 
ATOM   8791  C  C4    . DA  I 5 139 ? 139.207 185.956 102.124 1.00 218.52 ? 139  DA  I C4    1 
ATOM   8792  P  P     . DC  I 5 140 ? 144.623 187.153 98.812  1.00 230.03 ? 140  DC  I P     1 
ATOM   8793  O  OP1   . DC  I 5 140 ? 145.862 186.560 98.264  1.00 230.03 ? 140  DC  I OP1   1 
ATOM   8794  O  OP2   . DC  I 5 140 ? 144.535 188.616 99.018  1.00 230.03 ? 140  DC  I OP2   1 
ATOM   8795  O  "O5'" . DC  I 5 140 ? 143.390 186.680 97.895  1.00 230.03 ? 140  DC  I "O5'" 1 
ATOM   8796  C  "C5'" . DC  I 5 140 ? 143.205 185.292 97.615  1.00 230.03 ? 140  DC  I "C5'" 1 
ATOM   8797  C  "C4'" . DC  I 5 140 ? 141.894 185.041 96.885  1.00 230.03 ? 140  DC  I "C4'" 1 
ATOM   8798  O  "O4'" . DC  I 5 140 ? 140.798 185.308 97.790  1.00 230.03 ? 140  DC  I "O4'" 1 
ATOM   8799  C  "C3'" . DC  I 5 140 ? 141.623 185.884 95.626  1.00 230.03 ? 140  DC  I "C3'" 1 
ATOM   8800  O  "O3'" . DC  I 5 140 ? 141.236 185.000 94.528  1.00 230.03 ? 140  DC  I "O3'" 1 
ATOM   8801  C  "C2'" . DC  I 5 140 ? 140.485 186.805 96.062  1.00 230.03 ? 140  DC  I "C2'" 1 
ATOM   8802  C  "C1'" . DC  I 5 140 ? 139.775 185.946 97.087  1.00 230.03 ? 140  DC  I "C1'" 1 
ATOM   8803  N  N1    . DC  I 5 140 ? 138.996 186.726 98.040  1.00 230.03 ? 140  DC  I N1    1 
ATOM   8804  C  C2    . DC  I 5 140 ? 137.631 186.497 98.156  1.00 230.03 ? 140  DC  I C2    1 
ATOM   8805  O  O2    . DC  I 5 140 ? 137.106 185.634 97.446  1.00 230.03 ? 140  DC  I O2    1 
ATOM   8806  N  N3    . DC  I 5 140 ? 136.912 187.238 99.036  1.00 230.03 ? 140  DC  I N3    1 
ATOM   8807  C  C4    . DC  I 5 140 ? 137.519 188.165 99.778  1.00 230.03 ? 140  DC  I C4    1 
ATOM   8808  N  N4    . DC  I 5 140 ? 136.774 188.867 100.637 1.00 230.03 ? 140  DC  I N4    1 
ATOM   8809  C  C5    . DC  I 5 140 ? 138.920 188.412 99.668  1.00 230.03 ? 140  DC  I C5    1 
ATOM   8810  C  C6    . DC  I 5 140 ? 139.608 187.680 98.788  1.00 230.03 ? 140  DC  I C6    1 
ATOM   8811  P  P     . DA  I 5 141 ? 141.001 185.531 93.019  1.00 243.34 ? 141  DA  I P     1 
ATOM   8812  O  OP1   . DA  I 5 141 ? 141.742 184.609 92.136  1.00 243.34 ? 141  DA  I OP1   1 
ATOM   8813  O  OP2   . DA  I 5 141 ? 141.281 186.979 92.938  1.00 243.34 ? 141  DA  I OP2   1 
ATOM   8814  O  "O5'" . DA  I 5 141 ? 139.431 185.295 92.749  1.00 243.34 ? 141  DA  I "O5'" 1 
ATOM   8815  C  "C5'" . DA  I 5 141 ? 138.897 183.954 92.722  1.00 243.34 ? 141  DA  I "C5'" 1 
ATOM   8816  C  "C4'" . DA  I 5 141 ? 137.370 183.938 92.826  1.00 243.34 ? 141  DA  I "C4'" 1 
ATOM   8817  O  "O4'" . DA  I 5 141 ? 136.966 184.637 94.031  1.00 243.34 ? 141  DA  I "O4'" 1 
ATOM   8818  C  "C3'" . DA  I 5 141 ? 136.580 184.590 91.685  1.00 243.34 ? 141  DA  I "C3'" 1 
ATOM   8819  O  "O3'" . DA  I 5 141 ? 135.390 183.807 91.435  1.00 243.34 ? 141  DA  I "O3'" 1 
ATOM   8820  C  "C2'" . DA  I 5 141 ? 136.243 185.955 92.259  1.00 243.34 ? 141  DA  I "C2'" 1 
ATOM   8821  C  "C1'" . DA  I 5 141 ? 135.994 185.605 93.709  1.00 243.34 ? 141  DA  I "C1'" 1 
ATOM   8822  N  N9    . DA  I 5 141 ? 136.164 186.732 94.608  1.00 243.34 ? 141  DA  I N9    1 
ATOM   8823  C  C8    . DA  I 5 141 ? 137.301 187.450 94.811  1.00 243.34 ? 141  DA  I C8    1 
ATOM   8824  N  N7    . DA  I 5 141 ? 137.171 188.412 95.687  1.00 243.34 ? 141  DA  I N7    1 
ATOM   8825  C  C5    . DA  I 5 141 ? 135.853 188.315 96.088  1.00 243.34 ? 141  DA  I C5    1 
ATOM   8826  C  C6    . DA  I 5 141 ? 135.088 189.047 97.011  1.00 243.34 ? 141  DA  I C6    1 
ATOM   8827  N  N6    . DA  I 5 141 ? 135.574 190.069 97.718  1.00 243.34 ? 141  DA  I N6    1 
ATOM   8828  N  N1    . DA  I 5 141 ? 133.798 188.688 97.178  1.00 243.34 ? 141  DA  I N1    1 
ATOM   8829  C  C2    . DA  I 5 141 ? 133.316 187.661 96.468  1.00 243.34 ? 141  DA  I C2    1 
ATOM   8830  N  N3    . DA  I 5 141 ? 133.941 186.896 95.577  1.00 243.34 ? 141  DA  I N3    1 
ATOM   8831  C  C4    . DA  I 5 141 ? 135.220 187.278 95.436  1.00 243.34 ? 141  DA  I C4    1 
ATOM   8832  P  P     . DT  I 5 142 ? 134.472 184.021 90.125  1.00 254.95 ? 142  DT  I P     1 
ATOM   8833  O  OP1   . DT  I 5 142 ? 134.581 182.788 89.319  1.00 254.95 ? 142  DT  I OP1   1 
ATOM   8834  O  OP2   . DT  I 5 142 ? 134.740 185.330 89.491  1.00 254.95 ? 142  DT  I OP2   1 
ATOM   8835  O  "O5'" . DT  I 5 142 ? 132.981 184.099 90.702  1.00 254.95 ? 142  DT  I "O5'" 1 
ATOM   8836  C  "C5'" . DT  I 5 142 ? 132.719 184.765 91.932  1.00 254.95 ? 142  DT  I "C5'" 1 
ATOM   8837  C  "C4'" . DT  I 5 142 ? 131.230 185.012 92.117  1.00 254.95 ? 142  DT  I "C4'" 1 
ATOM   8838  O  "O4'" . DT  I 5 142 ? 131.040 186.023 93.139  1.00 254.95 ? 142  DT  I "O4'" 1 
ATOM   8839  C  "C3'" . DT  I 5 142 ? 130.516 185.567 90.900  1.00 254.95 ? 142  DT  I "C3'" 1 
ATOM   8840  O  "O3'" . DT  I 5 142 ? 129.128 185.306 91.001  1.00 254.95 ? 142  DT  I "O3'" 1 
ATOM   8841  C  "C2'" . DT  I 5 142 ? 130.805 187.046 91.033  1.00 254.95 ? 142  DT  I "C2'" 1 
ATOM   8842  C  "C1'" . DT  I 5 142 ? 130.659 187.249 92.535  1.00 254.95 ? 142  DT  I "C1'" 1 
ATOM   8843  N  N1    . DT  I 5 142 ? 131.541 188.312 93.060  1.00 254.95 ? 142  DT  I N1    1 
ATOM   8844  C  C2    . DT  I 5 142 ? 131.064 189.188 94.001  1.00 254.95 ? 142  DT  I C2    1 
ATOM   8845  O  O2    . DT  I 5 142 ? 129.934 189.144 94.445  1.00 254.95 ? 142  DT  I O2    1 
ATOM   8846  N  N3    . DT  I 5 142 ? 131.974 190.124 94.410  1.00 254.95 ? 142  DT  I N3    1 
ATOM   8847  C  C4    . DT  I 5 142 ? 133.275 190.271 93.988  1.00 254.95 ? 142  DT  I C4    1 
ATOM   8848  O  O4    . DT  I 5 142 ? 134.013 191.143 94.421  1.00 254.95 ? 142  DT  I O4    1 
ATOM   8849  C  C5    . DT  I 5 142 ? 133.708 189.329 93.000  1.00 254.95 ? 142  DT  I C5    1 
ATOM   8850  C  C7    . DT  I 5 142 ? 135.107 189.400 92.464  1.00 254.95 ? 142  DT  I C7    1 
ATOM   8851  C  C6    . DT  I 5 142 ? 132.831 188.405 92.585  1.00 254.95 ? 142  DT  I C6    1 
ATOM   8852  P  P     . DC  I 5 143 ? 128.142 185.585 89.761  1.00 268.56 ? 143  DC  I P     1 
ATOM   8853  O  OP1   . DC  I 5 143 ? 127.271 184.396 89.657  1.00 268.56 ? 143  DC  I OP1   1 
ATOM   8854  O  OP2   . DC  I 5 143 ? 128.941 185.999 88.586  1.00 268.56 ? 143  DC  I OP2   1 
ATOM   8855  O  "O5'" . DC  I 5 143 ? 127.259 186.836 90.247  1.00 268.56 ? 143  DC  I "O5'" 1 
ATOM   8856  C  "C5'" . DC  I 5 143 ? 126.269 186.657 91.266  1.00 268.56 ? 143  DC  I "C5'" 1 
ATOM   8857  C  "C4'" . DC  I 5 143 ? 125.880 187.983 91.903  1.00 268.56 ? 143  DC  I "C4'" 1 
ATOM   8858  O  "O4'" . DC  I 5 143 ? 127.067 188.696 92.316  1.00 268.56 ? 143  DC  I "O4'" 1 
ATOM   8859  C  "C3'" . DC  I 5 143 ? 125.097 188.951 91.021  1.00 268.56 ? 143  DC  I "C3'" 1 
ATOM   8860  O  "O3'" . DC  I 5 143 ? 123.739 189.248 91.584  1.00 268.56 ? 143  DC  I "O3'" 1 
ATOM   8861  C  "C2'" . DC  I 5 143 ? 126.010 190.178 90.858  1.00 268.56 ? 143  DC  I "C2'" 1 
ATOM   8862  C  "C1'" . DC  I 5 143 ? 126.910 190.080 92.080  1.00 268.56 ? 143  DC  I "C1'" 1 
ATOM   8863  N  N1    . DC  I 5 143 ? 128.298 190.670 91.934  1.00 268.56 ? 143  DC  I N1    1 
ATOM   8864  C  C2    . DC  I 5 143 ? 128.698 191.737 92.756  1.00 268.56 ? 143  DC  I C2    1 
ATOM   8865  O  O2    . DC  I 5 143 ? 127.896 192.206 93.574  1.00 268.56 ? 143  DC  I O2    1 
ATOM   8866  N  N3    . DC  I 5 143 ? 129.967 192.213 92.639  1.00 268.56 ? 143  DC  I N3    1 
ATOM   8867  C  C4    . DC  I 5 143 ? 130.810 191.674 91.753  1.00 268.56 ? 143  DC  I C4    1 
ATOM   8868  N  N4    . DC  I 5 143 ? 132.044 192.183 91.671  1.00 268.56 ? 143  DC  I N4    1 
ATOM   8869  C  C5    . DC  I 5 143 ? 130.420 190.595 90.912  1.00 268.56 ? 143  DC  I C5    1 
ATOM   8870  C  C6    . DC  I 5 143 ? 129.168 190.133 91.033  1.00 268.56 ? 143  DC  I C6    1 
ATOM   8871  P  P     . DC  I 5 144 ? 123.435 189.915 93.037  1.00 282.66 ? 144  DC  I P     1 
ATOM   8872  O  OP1   . DC  I 5 144 ? 124.134 189.311 94.190  1.00 282.66 ? 144  DC  I OP1   1 
ATOM   8873  O  OP2   . DC  I 5 144 ? 121.961 189.956 93.107  1.00 282.66 ? 144  DC  I OP2   1 
ATOM   8874  O  "O5'" . DC  I 5 144 ? 123.904 191.431 92.902  1.00 282.66 ? 144  DC  I "O5'" 1 
ATOM   8875  C  "C5'" . DC  I 5 144 ? 123.897 192.281 94.038  1.00 282.66 ? 144  DC  I "C5'" 1 
ATOM   8876  C  "C4'" . DC  I 5 144 ? 123.884 193.743 93.624  1.00 282.66 ? 144  DC  I "C4'" 1 
ATOM   8877  O  "O4'" . DC  I 5 144 ? 125.224 194.157 93.249  1.00 282.66 ? 144  DC  I "O4'" 1 
ATOM   8878  C  "C3'" . DC  I 5 144 ? 122.989 194.077 92.432  1.00 282.66 ? 144  DC  I "C3'" 1 
ATOM   8879  O  "O3'" . DC  I 5 144 ? 122.321 195.290 92.671  1.00 282.66 ? 144  DC  I "O3'" 1 
ATOM   8880  C  "C2'" . DC  I 5 144 ? 123.979 194.221 91.279  1.00 282.66 ? 144  DC  I "C2'" 1 
ATOM   8881  C  "C1'" . DC  I 5 144 ? 125.194 194.793 91.990  1.00 282.66 ? 144  DC  I "C1'" 1 
ATOM   8882  N  N1    . DC  I 5 144 ? 126.487 194.510 91.296  1.00 282.66 ? 144  DC  I N1    1 
ATOM   8883  C  C2    . DC  I 5 144 ? 127.631 195.232 91.640  1.00 282.66 ? 144  DC  I C2    1 
ATOM   8884  O  O2    . DC  I 5 144 ? 127.555 196.090 92.530  1.00 282.66 ? 144  DC  I O2    1 
ATOM   8885  N  N3    . DC  I 5 144 ? 128.796 194.956 91.001  1.00 282.66 ? 144  DC  I N3    1 
ATOM   8886  C  C4    . DC  I 5 144 ? 128.830 194.017 90.052  1.00 282.66 ? 144  DC  I C4    1 
ATOM   8887  N  N4    . DC  I 5 144 ? 129.992 193.781 89.442  1.00 282.66 ? 144  DC  I N4    1 
ATOM   8888  C  C5    . DC  I 5 144 ? 127.672 193.280 89.687  1.00 282.66 ? 144  DC  I C5    1 
ATOM   8889  C  C6    . DC  I 5 144 ? 126.535 193.567 90.320  1.00 282.66 ? 144  DC  I C6    1 
ATOM   8890  P  P     . DT  I 5 145 ? 120.772 195.464 92.285  1.00 291.94 ? 145  DT  I P     1 
ATOM   8891  O  OP1   . DT  I 5 145 ? 119.966 194.943 93.410  1.00 291.94 ? 145  DT  I OP1   1 
ATOM   8892  O  OP2   . DT  I 5 145 ? 120.561 194.926 90.922  1.00 291.94 ? 145  DT  I OP2   1 
ATOM   8893  O  "O5'" . DT  I 5 145 ? 120.604 197.049 92.218  1.00 291.94 ? 145  DT  I "O5'" 1 
ATOM   8894  C  "C5'" . DT  I 5 145 ? 121.030 197.836 93.316  1.00 291.94 ? 145  DT  I "C5'" 1 
ATOM   8895  C  "C4'" . DT  I 5 145 ? 122.036 198.890 92.878  1.00 291.94 ? 145  DT  I "C4'" 1 
ATOM   8896  O  "O4'" . DT  I 5 145 ? 123.172 198.263 92.225  1.00 291.94 ? 145  DT  I "O4'" 1 
ATOM   8897  C  "C3'" . DT  I 5 145 ? 121.490 199.929 91.893  1.00 291.94 ? 145  DT  I "C3'" 1 
ATOM   8898  O  "O3'" . DT  I 5 145 ? 121.652 201.234 92.435  1.00 291.94 ? 145  DT  I "O3'" 1 
ATOM   8899  C  "C2'" . DT  I 5 145 ? 122.339 199.732 90.628  1.00 291.94 ? 145  DT  I "C2'" 1 
ATOM   8900  C  "C1'" . DT  I 5 145 ? 123.600 199.099 91.184  1.00 291.94 ? 145  DT  I "C1'" 1 
ATOM   8901  N  N1    . DT  I 5 145 ? 124.365 198.301 90.185  1.00 291.94 ? 145  DT  I N1    1 
ATOM   8902  C  C2    . DT  I 5 145 ? 125.686 198.596 89.978  1.00 291.94 ? 145  DT  I C2    1 
ATOM   8903  O  O2    . DT  I 5 145 ? 126.272 199.481 90.575  1.00 291.94 ? 145  DT  I O2    1 
ATOM   8904  N  N3    . DT  I 5 145 ? 126.307 197.824 89.038  1.00 291.94 ? 145  DT  I N3    1 
ATOM   8905  C  C4    . DT  I 5 145 ? 125.748 196.798 88.299  1.00 291.94 ? 145  DT  I C4    1 
ATOM   8906  O  O4    . DT  I 5 145 ? 126.391 196.159 87.473  1.00 291.94 ? 145  DT  I O4    1 
ATOM   8907  C  C5    . DT  I 5 145 ? 124.357 196.537 88.562  1.00 291.94 ? 145  DT  I C5    1 
ATOM   8908  C  C7    . DT  I 5 145 ? 123.645 195.449 87.814  1.00 291.94 ? 145  DT  I C7    1 
ATOM   8909  C  C6    . DT  I 5 145 ? 123.736 197.296 89.481  1.00 291.94 ? 145  DT  I C6    1 
ATOM   8910  P  P     . DG  I 5 146 ? 120.887 202.489 91.786  1.00 296.24 ? 146  DG  I P     1 
ATOM   8911  O  OP1   . DG  I 5 146 ? 120.367 203.304 92.906  1.00 296.24 ? 146  DG  I OP1   1 
ATOM   8912  O  OP2   . DG  I 5 146 ? 119.947 201.998 90.754  1.00 296.24 ? 146  DG  I OP2   1 
ATOM   8913  O  "O5'" . DG  I 5 146 ? 122.049 203.310 91.061  1.00 296.24 ? 146  DG  I "O5'" 1 
ATOM   8914  C  "C5'" . DG  I 5 146 ? 123.172 203.749 91.806  1.00 296.24 ? 146  DG  I "C5'" 1 
ATOM   8915  C  "C4'" . DG  I 5 146 ? 124.244 204.302 90.888  1.00 296.24 ? 146  DG  I "C4'" 1 
ATOM   8916  O  "O4'" . DG  I 5 146 ? 124.764 203.252 90.031  1.00 296.24 ? 146  DG  I "O4'" 1 
ATOM   8917  C  "C3'" . DG  I 5 146 ? 123.772 205.429 89.957  1.00 296.24 ? 146  DG  I "C3'" 1 
ATOM   8918  O  "O3'" . DG  I 5 146 ? 124.665 206.533 90.037  1.00 296.24 ? 146  DG  I "O3'" 1 
ATOM   8919  C  "C2'" . DG  I 5 146 ? 123.797 204.785 88.568  1.00 296.24 ? 146  DG  I "C2'" 1 
ATOM   8920  C  "C1'" . DG  I 5 146 ? 124.914 203.770 88.732  1.00 296.24 ? 146  DG  I "C1'" 1 
ATOM   8921  N  N9    . DG  I 5 146 ? 124.889 202.676 87.761  1.00 296.24 ? 146  DG  I N9    1 
ATOM   8922  C  C8    . DG  I 5 146 ? 123.849 201.819 87.483  1.00 296.24 ? 146  DG  I C8    1 
ATOM   8923  N  N7    . DG  I 5 146 ? 124.136 200.941 86.559  1.00 296.24 ? 146  DG  I N7    1 
ATOM   8924  C  C5    . DG  I 5 146 ? 125.445 201.237 86.206  1.00 296.24 ? 146  DG  I C5    1 
ATOM   8925  C  C6    . DG  I 5 146 ? 126.297 200.629 85.255  1.00 296.24 ? 146  DG  I C6    1 
ATOM   8926  O  O6    . DG  I 5 146 ? 126.061 199.670 84.511  1.00 296.24 ? 146  DG  I O6    1 
ATOM   8927  N  N1    . DG  I 5 146 ? 127.546 201.244 85.215  1.00 296.24 ? 146  DG  I N1    1 
ATOM   8928  C  C2    . DG  I 5 146 ? 127.924 202.311 85.996  1.00 296.24 ? 146  DG  I C2    1 
ATOM   8929  N  N2    . DG  I 5 146 ? 129.169 202.771 85.818  1.00 296.24 ? 146  DG  I N2    1 
ATOM   8930  N  N3    . DG  I 5 146 ? 127.138 202.887 86.888  1.00 296.24 ? 146  DG  I N3    1 
ATOM   8931  C  C4    . DG  I 5 146 ? 125.918 202.302 86.937  1.00 296.24 ? 146  DG  I C4    1 
ATOM   8932  P  P     . DC  J 6 4   ? 134.369 198.214 79.035  1.00 285.78 ? 2    DC  J P     1 
ATOM   8933  O  OP1   . DC  J 6 4   ? 135.358 198.756 78.078  1.00 285.78 ? 2    DC  J OP1   1 
ATOM   8934  O  OP2   . DC  J 6 4   ? 134.323 196.761 79.316  1.00 285.78 ? 2    DC  J OP2   1 
ATOM   8935  O  "O5'" . DC  J 6 4   ? 134.532 198.972 80.431  1.00 285.78 ? 2    DC  J "O5'" 1 
ATOM   8936  C  "C5'" . DC  J 6 4   ? 135.070 200.287 80.468  1.00 285.78 ? 2    DC  J "C5'" 1 
ATOM   8937  C  "C4'" . DC  J 6 4   ? 134.892 200.916 81.840  1.00 285.78 ? 2    DC  J "C4'" 1 
ATOM   8938  O  "O4'" . DC  J 6 4   ? 133.481 200.997 82.163  1.00 285.78 ? 2    DC  J "O4'" 1 
ATOM   8939  C  "C3'" . DC  J 6 4   ? 135.546 200.165 82.998  1.00 285.78 ? 2    DC  J "C3'" 1 
ATOM   8940  O  "O3'" . DC  J 6 4   ? 136.112 201.096 83.902  1.00 285.78 ? 2    DC  J "O3'" 1 
ATOM   8941  C  "C2'" . DC  J 6 4   ? 134.378 199.412 83.634  1.00 285.78 ? 2    DC  J "C2'" 1 
ATOM   8942  C  "C1'" . DC  J 6 4   ? 133.240 200.390 83.416  1.00 285.78 ? 2    DC  J "C1'" 1 
ATOM   8943  N  N1    . DC  J 6 4   ? 131.896 199.757 83.371  1.00 285.78 ? 2    DC  J N1    1 
ATOM   8944  C  C2    . DC  J 6 4   ? 130.881 200.254 84.185  1.00 285.78 ? 2    DC  J C2    1 
ATOM   8945  O  O2    . DC  J 6 4   ? 131.128 201.201 84.935  1.00 285.78 ? 2    DC  J O2    1 
ATOM   8946  N  N3    . DC  J 6 4   ? 129.654 199.684 84.128  1.00 285.78 ? 2    DC  J N3    1 
ATOM   8947  C  C4    . DC  J 6 4   ? 129.430 198.664 83.302  1.00 285.78 ? 2    DC  J C4    1 
ATOM   8948  N  N4    . DC  J 6 4   ? 128.203 198.133 83.281  1.00 285.78 ? 2    DC  J N4    1 
ATOM   8949  C  C5    . DC  J 6 4   ? 130.455 198.142 82.461  1.00 285.78 ? 2    DC  J C5    1 
ATOM   8950  C  C6    . DC  J 6 4   ? 131.661 198.715 82.526  1.00 285.78 ? 2    DC  J C6    1 
ATOM   8951  P  P     . DA  J 6 5   ? 137.275 200.645 84.912  1.00 284.96 ? 3    DA  J P     1 
ATOM   8952  O  OP1   . DA  J 6 5   ? 138.403 201.586 84.745  1.00 284.96 ? 3    DA  J OP1   1 
ATOM   8953  O  OP2   . DA  J 6 5   ? 137.500 199.192 84.745  1.00 284.96 ? 3    DA  J OP2   1 
ATOM   8954  O  "O5'" . DA  J 6 5   ? 136.627 200.894 86.351  1.00 284.96 ? 3    DA  J "O5'" 1 
ATOM   8955  C  "C5'" . DA  J 6 5   ? 136.222 202.202 86.730  1.00 284.96 ? 3    DA  J "C5'" 1 
ATOM   8956  C  "C4'" . DA  J 6 5   ? 135.244 202.151 87.889  1.00 284.96 ? 3    DA  J "C4'" 1 
ATOM   8957  O  "O4'" . DA  J 6 5   ? 133.973 201.630 87.439  1.00 284.96 ? 3    DA  J "O4'" 1 
ATOM   8958  C  "C3'" . DA  J 6 5   ? 135.691 201.266 89.052  1.00 284.96 ? 3    DA  J "C3'" 1 
ATOM   8959  O  "O3'" . DA  J 6 5   ? 135.677 201.994 90.266  1.00 284.96 ? 3    DA  J "O3'" 1 
ATOM   8960  C  "C2'" . DA  J 6 5   ? 134.680 200.118 89.065  1.00 284.96 ? 3    DA  J "C2'" 1 
ATOM   8961  C  "C1'" . DA  J 6 5   ? 133.467 200.754 88.411  1.00 284.96 ? 3    DA  J "C1'" 1 
ATOM   8962  N  N9    . DA  J 6 5   ? 132.579 199.797 87.762  1.00 284.96 ? 3    DA  J N9    1 
ATOM   8963  C  C8    . DA  J 6 5   ? 132.915 198.869 86.818  1.00 284.96 ? 3    DA  J C8    1 
ATOM   8964  N  N7    . DA  J 6 5   ? 131.905 198.136 86.414  1.00 284.96 ? 3    DA  J N7    1 
ATOM   8965  C  C5    . DA  J 6 5   ? 130.834 198.613 87.150  1.00 284.96 ? 3    DA  J C5    1 
ATOM   8966  C  C6    . DA  J 6 5   ? 129.475 198.253 87.192  1.00 284.96 ? 3    DA  J C6    1 
ATOM   8967  N  N6    . DA  J 6 5   ? 128.950 197.282 86.438  1.00 284.96 ? 3    DA  J N6    1 
ATOM   8968  N  N1    . DA  J 6 5   ? 128.670 198.931 88.041  1.00 284.96 ? 3    DA  J N1    1 
ATOM   8969  C  C2    . DA  J 6 5   ? 129.196 199.904 88.792  1.00 284.96 ? 3    DA  J C2    1 
ATOM   8970  N  N3    . DA  J 6 5   ? 130.455 200.329 88.840  1.00 284.96 ? 3    DA  J N3    1 
ATOM   8971  C  C4    . DA  J 6 5   ? 131.230 199.636 87.987  1.00 284.96 ? 3    DA  J C4    1 
ATOM   8972  P  P     . DG  J 6 6   ? 137.078 202.379 90.946  1.00 281.96 ? 4    DG  J P     1 
ATOM   8973  O  OP1   . DG  J 6 6   ? 136.873 203.593 91.766  1.00 281.96 ? 4    DG  J OP1   1 
ATOM   8974  O  OP2   . DG  J 6 6   ? 138.068 202.433 89.849  1.00 281.96 ? 4    DG  J OP2   1 
ATOM   8975  O  "O5'" . DG  J 6 6   ? 137.442 201.093 91.838  1.00 281.96 ? 4    DG  J "O5'" 1 
ATOM   8976  C  "C5'" . DG  J 6 6   ? 137.564 201.180 93.257  1.00 281.96 ? 4    DG  J "C5'" 1 
ATOM   8977  C  "C4'" . DG  J 6 6   ? 136.209 201.255 93.933  1.00 281.96 ? 4    DG  J "C4'" 1 
ATOM   8978  O  "O4'" . DG  J 6 6   ? 135.201 200.686 93.063  1.00 281.96 ? 4    DG  J "O4'" 1 
ATOM   8979  C  "C3'" . DG  J 6 6   ? 136.109 200.498 95.251  1.00 281.96 ? 4    DG  J "C3'" 1 
ATOM   8980  O  "O3'" . DG  J 6 6   ? 135.310 201.220 96.144  1.00 281.96 ? 4    DG  J "O3'" 1 
ATOM   8981  C  "C2'" . DG  J 6 6   ? 135.440 199.191 94.844  1.00 281.96 ? 4    DG  J "C2'" 1 
ATOM   8982  C  "C1'" . DG  J 6 6   ? 134.511 199.655 93.730  1.00 281.96 ? 4    DG  J "C1'" 1 
ATOM   8983  N  N9    . DG  J 6 6   ? 134.224 198.609 92.757  1.00 281.96 ? 4    DG  J N9    1 
ATOM   8984  C  C8    . DG  J 6 6   ? 135.125 197.992 91.926  1.00 281.96 ? 4    DG  J C8    1 
ATOM   8985  N  N7    . DG  J 6 6   ? 134.586 197.105 91.142  1.00 281.96 ? 4    DG  J N7    1 
ATOM   8986  C  C5    . DG  J 6 6   ? 133.236 197.162 91.448  1.00 281.96 ? 4    DG  J C5    1 
ATOM   8987  C  C6    . DG  J 6 6   ? 132.161 196.435 90.909  1.00 281.96 ? 4    DG  J C6    1 
ATOM   8988  O  O6    . DG  J 6 6   ? 132.194 195.570 90.025  1.00 281.96 ? 4    DG  J O6    1 
ATOM   8989  N  N1    . DG  J 6 6   ? 130.954 196.797 91.491  1.00 281.96 ? 4    DG  J N1    1 
ATOM   8990  C  C2    . DG  J 6 6   ? 130.806 197.743 92.477  1.00 281.96 ? 4    DG  J C2    1 
ATOM   8991  N  N2    . DG  J 6 6   ? 129.559 197.954 92.916  1.00 281.96 ? 4    DG  J N2    1 
ATOM   8992  N  N3    . DG  J 6 6   ? 131.810 198.434 92.992  1.00 281.96 ? 4    DG  J N3    1 
ATOM   8993  C  C4    . DG  J 6 6   ? 132.992 198.091 92.432  1.00 281.96 ? 4    DG  J C4    1 
ATOM   8994  P  P     . DG  J 6 7   ? 135.422 200.955 97.721  1.00 276.13 ? 5    DG  J P     1 
ATOM   8995  O  OP1   . DG  J 6 7   ? 135.490 202.263 98.409  1.00 276.13 ? 5    DG  J OP1   1 
ATOM   8996  O  OP2   . DG  J 6 7   ? 136.498 199.965 97.930  1.00 276.13 ? 5    DG  J OP2   1 
ATOM   8997  O  "O5'" . DG  J 6 7   ? 134.038 200.245 98.064  1.00 276.13 ? 5    DG  J "O5'" 1 
ATOM   8998  C  "C5'" . DG  J 6 7   ? 132.842 200.998 98.016  1.00 276.13 ? 5    DG  J "C5'" 1 
ATOM   8999  C  "C4'" . DG  J 6 7   ? 131.635 200.165 98.406  1.00 276.13 ? 5    DG  J "C4'" 1 
ATOM   9000  O  "O4'" . DG  J 6 7   ? 131.413 199.142 97.406  1.00 276.13 ? 5    DG  J "O4'" 1 
ATOM   9001  C  "C3'" . DG  J 6 7   ? 131.727 199.430 99.740  1.00 276.13 ? 5    DG  J "C3'" 1 
ATOM   9002  O  "O3'" . DG  J 6 7   ? 130.452 199.474 100.368 1.00 276.13 ? 5    DG  J "O3'" 1 
ATOM   9003  C  "C2'" . DG  J 6 7   ? 132.106 198.010 99.333  1.00 276.13 ? 5    DG  J "C2'" 1 
ATOM   9004  C  "C1'" . DG  J 6 7   ? 131.390 197.862 98.003  1.00 276.13 ? 5    DG  J "C1'" 1 
ATOM   9005  N  N9    . DG  J 6 7   ? 132.052 196.938 97.092  1.00 276.13 ? 5    DG  J N9    1 
ATOM   9006  C  C8    . DG  J 6 7   ? 133.393 196.884 96.799  1.00 276.13 ? 5    DG  J C8    1 
ATOM   9007  N  N7    . DG  J 6 7   ? 133.696 195.976 95.915  1.00 276.13 ? 5    DG  J N7    1 
ATOM   9008  C  C5    . DG  J 6 7   ? 132.471 195.420 95.566  1.00 276.13 ? 5    DG  J C5    1 
ATOM   9009  C  C6    . DG  J 6 7   ? 132.167 194.397 94.639  1.00 276.13 ? 5    DG  J C6    1 
ATOM   9010  O  O6    . DG  J 6 7   ? 132.945 193.758 93.920  1.00 276.13 ? 5    DG  J O6    1 
ATOM   9011  N  N1    . DG  J 6 7   ? 130.800 194.133 94.591  1.00 276.13 ? 5    DG  J N1    1 
ATOM   9012  C  C2    . DG  J 6 7   ? 129.845 194.778 95.339  1.00 276.13 ? 5    DG  J C2    1 
ATOM   9013  N  N2    . DG  J 6 7   ? 128.576 194.388 95.153  1.00 276.13 ? 5    DG  J N2    1 
ATOM   9014  N  N3    . DG  J 6 7   ? 130.116 195.742 96.211  1.00 276.13 ? 5    DG  J N3    1 
ATOM   9015  C  C4    . DG  J 6 7   ? 131.447 196.008 96.273  1.00 276.13 ? 5    DG  J C4    1 
ATOM   9016  P  P     . DA  J 6 8   ? 130.241 199.011 101.893 1.00 268.43 ? 6    DA  J P     1 
ATOM   9017  O  OP1   . DA  J 6 8   ? 129.370 200.019 102.540 1.00 268.43 ? 6    DA  J OP1   1 
ATOM   9018  O  OP2   . DA  J 6 8   ? 131.555 198.678 102.494 1.00 268.43 ? 6    DA  J OP2   1 
ATOM   9019  O  "O5'" . DA  J 6 8   ? 129.394 197.669 101.728 1.00 268.43 ? 6    DA  J "O5'" 1 
ATOM   9020  C  "C5'" . DA  J 6 8   ? 128.123 197.735 101.101 1.00 268.43 ? 6    DA  J "C5'" 1 
ATOM   9021  C  "C4'" . DA  J 6 8   ? 127.680 196.365 100.636 1.00 268.43 ? 6    DA  J "C4'" 1 
ATOM   9022  O  "O4'" . DA  J 6 8   ? 128.611 195.869 99.642  1.00 268.43 ? 6    DA  J "O4'" 1 
ATOM   9023  C  "C3'" . DA  J 6 8   ? 127.600 195.290 101.724 1.00 268.43 ? 6    DA  J "C3'" 1 
ATOM   9024  O  "O3'" . DA  J 6 8   ? 126.345 194.628 101.636 1.00 268.43 ? 6    DA  J "O3'" 1 
ATOM   9025  C  "C2'" . DA  J 6 8   ? 128.757 194.348 101.388 1.00 268.43 ? 6    DA  J "C2'" 1 
ATOM   9026  C  "C1'" . DA  J 6 8   ? 128.856 194.508 99.886  1.00 268.43 ? 6    DA  J "C1'" 1 
ATOM   9027  N  N9    . DA  J 6 8   ? 130.165 194.155 99.360  1.00 268.43 ? 6    DA  J N9    1 
ATOM   9028  C  C8    . DA  J 6 8   ? 131.368 194.684 99.714  1.00 268.43 ? 6    DA  J C8    1 
ATOM   9029  N  N7    . DA  J 6 8   ? 132.385 194.170 99.066  1.00 268.43 ? 6    DA  J N7    1 
ATOM   9030  C  C5    . DA  J 6 8   ? 131.800 193.246 98.224  1.00 268.43 ? 6    DA  J C5    1 
ATOM   9031  C  C6    . DA  J 6 8   ? 132.330 192.362 97.272  1.00 268.43 ? 6    DA  J C6    1 
ATOM   9032  N  N6    . DA  J 6 8   ? 133.631 192.274 97.002  1.00 268.43 ? 6    DA  J N6    1 
ATOM   9033  N  N1    . DA  J 6 8   ? 131.462 191.573 96.598  1.00 268.43 ? 6    DA  J N1    1 
ATOM   9034  C  C2    . DA  J 6 8   ? 130.157 191.671 96.866  1.00 268.43 ? 6    DA  J C2    1 
ATOM   9035  N  N3    . DA  J 6 8   ? 129.545 192.459 97.741  1.00 268.43 ? 6    DA  J N3    1 
ATOM   9036  C  C4    . DA  J 6 8   ? 130.431 193.230 98.390  1.00 268.43 ? 6    DA  J C4    1 
ATOM   9037  P  P     . DT  J 6 9   ? 125.960 193.443 102.652 1.00 255.31 ? 7    DT  J P     1 
ATOM   9038  O  OP1   . DT  J 6 9   ? 124.485 193.444 102.758 1.00 255.31 ? 7    DT  J OP1   1 
ATOM   9039  O  OP2   . DT  J 6 9   ? 126.770 193.567 103.884 1.00 255.31 ? 7    DT  J OP2   1 
ATOM   9040  O  "O5'" . DT  J 6 9   ? 126.412 192.127 101.863 1.00 255.31 ? 7    DT  J "O5'" 1 
ATOM   9041  C  "C5'" . DT  J 6 9   ? 125.914 191.893 100.557 1.00 255.31 ? 7    DT  J "C5'" 1 
ATOM   9042  C  "C4'" . DT  J 6 9   ? 126.475 190.611 99.971  1.00 255.31 ? 7    DT  J "C4'" 1 
ATOM   9043  O  "O4'" . DT  J 6 9   ? 127.853 190.796 99.561  1.00 255.31 ? 7    DT  J "O4'" 1 
ATOM   9044  C  "C3'" . DT  J 6 9   ? 126.460 189.401 100.915 1.00 255.31 ? 7    DT  J "C3'" 1 
ATOM   9045  O  "O3'" . DT  J 6 9   ? 125.803 188.311 100.273 1.00 255.31 ? 7    DT  J "O3'" 1 
ATOM   9046  C  "C2'" . DT  J 6 9   ? 127.949 189.109 101.139 1.00 255.31 ? 7    DT  J "C2'" 1 
ATOM   9047  C  "C1'" . DT  J 6 9   ? 128.549 189.613 99.841  1.00 255.31 ? 7    DT  J "C1'" 1 
ATOM   9048  N  N1    . DT  J 6 9   ? 130.016 189.891 99.894  1.00 255.31 ? 7    DT  J N1    1 
ATOM   9049  C  C2    . DT  J 6 9   ? 130.852 189.195 99.055  1.00 255.31 ? 7    DT  J C2    1 
ATOM   9050  O  O2    . DT  J 6 9   ? 130.456 188.361 98.263  1.00 255.31 ? 7    DT  J O2    1 
ATOM   9051  N  N3    . DT  J 6 9   ? 132.178 189.507 99.177  1.00 255.31 ? 7    DT  J N3    1 
ATOM   9052  C  C4    . DT  J 6 9   ? 132.746 190.424 100.032 1.00 255.31 ? 7    DT  J C4    1 
ATOM   9053  O  O4    . DT  J 6 9   ? 133.953 190.629 100.061 1.00 255.31 ? 7    DT  J O4    1 
ATOM   9054  C  C5    . DT  J 6 9   ? 131.821 191.123 100.889 1.00 255.31 ? 7    DT  J C5    1 
ATOM   9055  C  C7    . DT  J 6 9   ? 132.329 192.137 101.869 1.00 255.31 ? 7    DT  J C7    1 
ATOM   9056  C  C6    . DT  J 6 9   ? 130.511 190.824 100.785 1.00 255.31 ? 7    DT  J C6    1 
ATOM   9057  P  P     . DG  J 6 10  ? 125.397 186.986 101.088 1.00 235.87 ? 8    DG  J P     1 
ATOM   9058  O  OP1   . DG  J 6 10  ? 123.994 186.696 100.722 1.00 235.87 ? 8    DG  J OP1   1 
ATOM   9059  O  OP2   . DG  J 6 10  ? 125.747 187.155 102.515 1.00 235.87 ? 8    DG  J OP2   1 
ATOM   9060  O  "O5'" . DG  J 6 10  ? 126.327 185.846 100.457 1.00 235.87 ? 8    DG  J "O5'" 1 
ATOM   9061  C  "C5'" . DG  J 6 10  ? 126.157 185.465 99.094  1.00 235.87 ? 8    DG  J "C5'" 1 
ATOM   9062  C  "C4'" . DG  J 6 10  ? 127.339 184.649 98.591  1.00 235.87 ? 8    DG  J "C4'" 1 
ATOM   9063  O  "O4'" . DG  J 6 10  ? 128.559 185.430 98.677  1.00 235.87 ? 8    DG  J "O4'" 1 
ATOM   9064  C  "C3'" . DG  J 6 10  ? 127.619 183.346 99.346  1.00 235.87 ? 8    DG  J "C3'" 1 
ATOM   9065  O  "O3'" . DG  J 6 10  ? 127.961 182.321 98.407  1.00 235.87 ? 8    DG  J "O3'" 1 
ATOM   9066  C  "C2'" . DG  J 6 10  ? 128.809 183.718 100.227 1.00 235.87 ? 8    DG  J "C2'" 1 
ATOM   9067  C  "C1'" . DG  J 6 10  ? 129.558 184.658 99.307  1.00 235.87 ? 8    DG  J "C1'" 1 
ATOM   9068  N  N9    . DG  J 6 10  ? 130.484 185.544 99.997  1.00 235.87 ? 8    DG  J N9    1 
ATOM   9069  C  C8    . DG  J 6 10  ? 130.183 186.483 100.944 1.00 235.87 ? 8    DG  J C8    1 
ATOM   9070  N  N7    . DG  J 6 10  ? 131.224 187.137 101.372 1.00 235.87 ? 8    DG  J N7    1 
ATOM   9071  C  C5    . DG  J 6 10  ? 132.279 186.619 100.632 1.00 235.87 ? 8    DG  J C5    1 
ATOM   9072  C  C6    . DG  J 6 10  ? 133.654 186.947 100.648 1.00 235.87 ? 8    DG  J C6    1 
ATOM   9073  O  O6    . DG  J 6 10  ? 134.236 187.789 101.339 1.00 235.87 ? 8    DG  J O6    1 
ATOM   9074  N  N1    . DG  J 6 10  ? 134.372 186.177 99.750  1.00 235.87 ? 8    DG  J N1    1 
ATOM   9075  C  C2    . DG  J 6 10  ? 133.832 185.215 98.933  1.00 235.87 ? 8    DG  J C2    1 
ATOM   9076  N  N2    . DG  J 6 10  ? 134.685 184.574 98.126  1.00 235.87 ? 8    DG  J N2    1 
ATOM   9077  N  N3    . DG  J 6 10  ? 132.549 184.901 98.907  1.00 235.87 ? 8    DG  J N3    1 
ATOM   9078  C  C4    . DG  J 6 10  ? 131.835 185.642 99.779  1.00 235.87 ? 8    DG  J C4    1 
ATOM   9079  P  P     . DT  J 6 11  ? 127.990 180.766 98.825  1.00 219.43 ? 9    DT  J P     1 
ATOM   9080  O  OP1   . DT  J 6 11  ? 126.975 180.090 97.991  1.00 219.43 ? 9    DT  J OP1   1 
ATOM   9081  O  OP2   . DT  J 6 11  ? 127.942 180.612 100.295 1.00 219.43 ? 9    DT  J OP2   1 
ATOM   9082  O  "O5'" . DT  J 6 11  ? 129.433 180.277 98.348  1.00 219.43 ? 9    DT  J "O5'" 1 
ATOM   9083  C  "C5'" . DT  J 6 11  ? 130.490 181.217 98.234  1.00 219.43 ? 9    DT  J "C5'" 1 
ATOM   9084  C  "C4'" . DT  J 6 11  ? 131.841 180.536 98.221  1.00 219.43 ? 9    DT  J "C4'" 1 
ATOM   9085  O  "O4'" . DT  J 6 11  ? 132.832 181.446 98.763  1.00 219.43 ? 9    DT  J "O4'" 1 
ATOM   9086  C  "C3'" . DT  J 6 11  ? 131.942 179.279 99.068  1.00 219.43 ? 9    DT  J "C3'" 1 
ATOM   9087  O  "O3'" . DT  J 6 11  ? 132.941 178.441 98.521  1.00 219.43 ? 9    DT  J "O3'" 1 
ATOM   9088  C  "C2'" . DT  J 6 11  ? 132.358 179.852 100.415 1.00 219.43 ? 9    DT  J "C2'" 1 
ATOM   9089  C  "C1'" . DT  J 6 11  ? 133.327 180.942 99.986  1.00 219.43 ? 9    DT  J "C1'" 1 
ATOM   9090  N  N1    . DT  J 6 11  ? 133.399 182.059 100.944 1.00 219.43 ? 9    DT  J N1    1 
ATOM   9091  C  C2    . DT  J 6 11  ? 134.605 182.656 101.169 1.00 219.43 ? 9    DT  J C2    1 
ATOM   9092  O  O2    . DT  J 6 11  ? 135.626 182.326 100.600 1.00 219.43 ? 9    DT  J O2    1 
ATOM   9093  N  N3    . DT  J 6 11  ? 134.578 183.672 102.073 1.00 219.43 ? 9    DT  J N3    1 
ATOM   9094  C  C4    . DT  J 6 11  ? 133.490 184.138 102.776 1.00 219.43 ? 9    DT  J C4    1 
ATOM   9095  O  O4    . DT  J 6 11  ? 133.575 185.063 103.576 1.00 219.43 ? 9    DT  J O4    1 
ATOM   9096  C  C5    . DT  J 6 11  ? 132.248 183.460 102.506 1.00 219.43 ? 9    DT  J C5    1 
ATOM   9097  C  C7    . DT  J 6 11  ? 130.992 183.875 103.217 1.00 219.43 ? 9    DT  J C7    1 
ATOM   9098  C  C6    . DT  J 6 11  ? 132.262 182.458 101.613 1.00 219.43 ? 9    DT  J C6    1 
ATOM   9099  P  P     . DA  J 6 12  ? 133.118 176.924 99.014  1.00 200.47 ? 10   DA  J P     1 
ATOM   9100  O  OP1   . DA  J 6 12  ? 132.977 176.094 97.798  1.00 200.47 ? 10   DA  J OP1   1 
ATOM   9101  O  OP2   . DA  J 6 12  ? 132.240 176.646 100.171 1.00 200.47 ? 10   DA  J OP2   1 
ATOM   9102  O  "O5'" . DA  J 6 12  ? 134.645 176.876 99.490  1.00 200.47 ? 10   DA  J "O5'" 1 
ATOM   9103  C  "C5'" . DA  J 6 12  ? 135.670 177.023 98.511  1.00 200.47 ? 10   DA  J "C5'" 1 
ATOM   9104  C  "C4'" . DA  J 6 12  ? 137.027 177.326 99.125  1.00 200.47 ? 10   DA  J "C4'" 1 
ATOM   9105  O  "O4'" . DA  J 6 12  ? 136.938 178.525 99.924  1.00 200.47 ? 10   DA  J "O4'" 1 
ATOM   9106  C  "C3'" . DA  J 6 12  ? 137.618 176.259 100.031 1.00 200.47 ? 10   DA  J "C3'" 1 
ATOM   9107  O  "O3'" . DA  J 6 12  ? 139.019 176.226 99.810  1.00 200.47 ? 10   DA  J "O3'" 1 
ATOM   9108  C  "C2'" . DA  J 6 12  ? 137.267 176.766 101.428 1.00 200.47 ? 10   DA  J "C2'" 1 
ATOM   9109  C  "C1'" . DA  J 6 12  ? 137.364 178.271 101.242 1.00 200.47 ? 10   DA  J "C1'" 1 
ATOM   9110  N  N9    . DA  J 6 12  ? 136.474 179.016 102.120 1.00 200.47 ? 10   DA  J N9    1 
ATOM   9111  C  C8    . DA  J 6 12  ? 135.130 178.826 102.272 1.00 200.47 ? 10   DA  J C8    1 
ATOM   9112  N  N7    . DA  J 6 12  ? 134.566 179.669 103.102 1.00 200.47 ? 10   DA  J N7    1 
ATOM   9113  C  C5    . DA  J 6 12  ? 135.606 180.491 103.493 1.00 200.47 ? 10   DA  J C5    1 
ATOM   9114  C  C6    . DA  J 6 12  ? 135.663 181.597 104.352 1.00 200.47 ? 10   DA  J C6    1 
ATOM   9115  N  N6    . DA  J 6 12  ? 134.604 182.068 105.008 1.00 200.47 ? 10   DA  J N6    1 
ATOM   9116  N  N1    . DA  J 6 12  ? 136.856 182.193 104.526 1.00 200.47 ? 10   DA  J N1    1 
ATOM   9117  C  C2    . DA  J 6 12  ? 137.919 181.725 103.867 1.00 200.47 ? 10   DA  J C2    1 
ATOM   9118  N  N3    . DA  J 6 12  ? 137.990 180.691 103.035 1.00 200.47 ? 10   DA  J N3    1 
ATOM   9119  C  C4    . DA  J 6 12  ? 136.786 180.116 102.884 1.00 200.47 ? 10   DA  J C4    1 
ATOM   9120  P  P     . DT  J 6 13  ? 139.977 175.238 100.636 1.00 186.84 ? 11   DT  J P     1 
ATOM   9121  O  OP1   . DT  J 6 13  ? 141.177 174.959 99.819  1.00 186.84 ? 11   DT  J OP1   1 
ATOM   9122  O  OP2   . DT  J 6 13  ? 139.157 174.116 101.145 1.00 186.84 ? 11   DT  J OP2   1 
ATOM   9123  O  "O5'" . DT  J 6 13  ? 140.458 176.144 101.856 1.00 186.84 ? 11   DT  J "O5'" 1 
ATOM   9124  C  "C5'" . DT  J 6 13  ? 141.103 177.396 101.603 1.00 186.84 ? 11   DT  J "C5'" 1 
ATOM   9125  C  "C4'" . DT  J 6 13  ? 141.966 177.832 102.778 1.00 186.84 ? 11   DT  J "C4'" 1 
ATOM   9126  O  "O4'" . DT  J 6 13  ? 141.264 178.821 103.583 1.00 186.84 ? 11   DT  J "O4'" 1 
ATOM   9127  C  "C3'" . DT  J 6 13  ? 142.368 176.727 103.744 1.00 186.84 ? 11   DT  J "C3'" 1 
ATOM   9128  O  "O3'" . DT  J 6 13  ? 143.631 177.013 104.270 1.00 186.84 ? 11   DT  J "O3'" 1 
ATOM   9129  C  "C2'" . DT  J 6 13  ? 141.309 176.841 104.831 1.00 186.84 ? 11   DT  J "C2'" 1 
ATOM   9130  C  "C1'" . DT  J 6 13  ? 141.122 178.344 104.910 1.00 186.84 ? 11   DT  J "C1'" 1 
ATOM   9131  N  N1    . DT  J 6 13  ? 139.788 178.748 105.428 1.00 186.84 ? 11   DT  J N1    1 
ATOM   9132  C  C2    . DT  J 6 13  ? 139.679 179.877 106.208 1.00 186.84 ? 11   DT  J C2    1 
ATOM   9133  O  O2    . DT  J 6 13  ? 140.626 180.588 106.494 1.00 186.84 ? 11   DT  J O2    1 
ATOM   9134  N  N3    . DT  J 6 13  ? 138.407 180.153 106.635 1.00 186.84 ? 11   DT  J N3    1 
ATOM   9135  C  C4    . DT  J 6 13  ? 137.262 179.426 106.361 1.00 186.84 ? 11   DT  J C4    1 
ATOM   9136  O  O4    . DT  J 6 13  ? 136.160 179.749 106.789 1.00 186.84 ? 11   DT  J O4    1 
ATOM   9137  C  C5    . DT  J 6 13  ? 137.456 178.249 105.555 1.00 186.84 ? 11   DT  J C5    1 
ATOM   9138  C  C7    . DT  J 6 13  ? 136.291 177.376 105.205 1.00 186.84 ? 11   DT  J C7    1 
ATOM   9139  C  C6    . DT  J 6 13  ? 138.692 177.972 105.134 1.00 186.84 ? 11   DT  J C6    1 
ATOM   9140  P  P     . DA  J 6 14  ? 144.529 175.857 104.925 1.00 177.41 ? 12   DA  J P     1 
ATOM   9141  O  OP1   . DA  J 6 14  ? 145.742 175.723 104.088 1.00 177.41 ? 12   DA  J OP1   1 
ATOM   9142  O  OP2   . DA  J 6 14  ? 143.692 174.659 105.153 1.00 177.41 ? 12   DA  J OP2   1 
ATOM   9143  O  "O5'" . DA  J 6 14  ? 144.932 176.493 106.338 1.00 177.41 ? 12   DA  J "O5'" 1 
ATOM   9144  C  "C5'" . DA  J 6 14  ? 145.511 177.785 106.377 1.00 177.41 ? 12   DA  J "C5'" 1 
ATOM   9145  C  "C4'" . DA  J 6 14  ? 145.234 178.487 107.692 1.00 177.41 ? 12   DA  J "C4'" 1 
ATOM   9146  O  "O4'" . DA  J 6 14  ? 143.827 178.816 107.802 1.00 177.41 ? 12   DA  J "O4'" 1 
ATOM   9147  C  "C3'" . DA  J 6 14  ? 145.591 177.693 108.947 1.00 177.41 ? 12   DA  J "C3'" 1 
ATOM   9148  O  "O3'" . DA  J 6 14  ? 146.259 178.552 109.870 1.00 177.41 ? 12   DA  J "O3'" 1 
ATOM   9149  C  "C2'" . DA  J 6 14  ? 144.237 177.229 109.475 1.00 177.41 ? 12   DA  J "C2'" 1 
ATOM   9150  C  "C1'" . DA  J 6 14  ? 143.329 178.359 109.040 1.00 177.41 ? 12   DA  J "C1'" 1 
ATOM   9151  N  N9    . DA  J 6 14  ? 141.933 177.966 108.882 1.00 177.41 ? 12   DA  J N9    1 
ATOM   9152  C  C8    . DA  J 6 14  ? 141.459 176.874 108.226 1.00 177.41 ? 12   DA  J C8    1 
ATOM   9153  N  N7    . DA  J 6 14  ? 140.152 176.777 108.235 1.00 177.41 ? 12   DA  J N7    1 
ATOM   9154  C  C5    . DA  J 6 14  ? 139.743 177.872 108.972 1.00 177.41 ? 12   DA  J C5    1 
ATOM   9155  C  C6    . DA  J 6 14  ? 138.472 178.337 109.360 1.00 177.41 ? 12   DA  J C6    1 
ATOM   9156  N  N6    . DA  J 6 14  ? 137.338 177.716 109.039 1.00 177.41 ? 12   DA  J N6    1 
ATOM   9157  N  N1    . DA  J 6 14  ? 138.414 179.467 110.096 1.00 177.41 ? 12   DA  J N1    1 
ATOM   9158  C  C2    . DA  J 6 14  ? 139.553 180.078 110.423 1.00 177.41 ? 12   DA  J C2    1 
ATOM   9159  N  N3    . DA  J 6 14  ? 140.801 179.744 110.110 1.00 177.41 ? 12   DA  J N3    1 
ATOM   9160  C  C4    . DA  J 6 14  ? 140.826 178.617 109.380 1.00 177.41 ? 12   DA  J C4    1 
ATOM   9161  P  P     . DT  J 6 15  ? 146.713 178.037 111.324 1.00 163.14 ? 13   DT  J P     1 
ATOM   9162  O  OP1   . DT  J 6 15  ? 147.929 178.806 111.666 1.00 163.14 ? 13   DT  J OP1   1 
ATOM   9163  O  OP2   . DT  J 6 15  ? 146.773 176.561 111.360 1.00 163.14 ? 13   DT  J OP2   1 
ATOM   9164  O  "O5'" . DT  J 6 15  ? 145.541 178.516 112.294 1.00 163.14 ? 13   DT  J "O5'" 1 
ATOM   9165  C  "C5'" . DT  J 6 15  ? 145.061 179.851 112.216 1.00 163.14 ? 13   DT  J "C5'" 1 
ATOM   9166  C  "C4'" . DT  J 6 15  ? 144.072 180.131 113.328 1.00 163.14 ? 13   DT  J "C4'" 1 
ATOM   9167  O  "O4'" . DT  J 6 15  ? 142.736 179.789 112.901 1.00 163.14 ? 13   DT  J "O4'" 1 
ATOM   9168  C  "C3'" . DT  J 6 15  ? 144.320 179.347 114.617 1.00 163.14 ? 13   DT  J "C3'" 1 
ATOM   9169  O  "O3'" . DT  J 6 15  ? 144.175 180.199 115.741 1.00 163.14 ? 13   DT  J "O3'" 1 
ATOM   9170  C  "C2'" . DT  J 6 15  ? 143.226 178.288 114.587 1.00 163.14 ? 13   DT  J "C2'" 1 
ATOM   9171  C  "C1'" . DT  J 6 15  ? 142.108 179.063 113.924 1.00 163.14 ? 13   DT  J "C1'" 1 
ATOM   9172  N  N1    . DT  J 6 15  ? 141.086 178.210 113.312 1.00 163.14 ? 13   DT  J N1    1 
ATOM   9173  C  C2    . DT  J 6 15  ? 139.771 178.562 113.424 1.00 163.14 ? 13   DT  J C2    1 
ATOM   9174  O  O2    . DT  J 6 15  ? 139.398 179.569 113.994 1.00 163.14 ? 13   DT  J O2    1 
ATOM   9175  N  N3    . DT  J 6 15  ? 138.903 177.714 112.810 1.00 163.14 ? 13   DT  J N3    1 
ATOM   9176  C  C4    . DT  J 6 15  ? 139.212 176.558 112.134 1.00 163.14 ? 13   DT  J C4    1 
ATOM   9177  O  O4    . DT  J 6 15  ? 138.359 175.855 111.622 1.00 163.14 ? 13   DT  J O4    1 
ATOM   9178  C  C5    . DT  J 6 15  ? 140.609 176.238 112.064 1.00 163.14 ? 13   DT  J C5    1 
ATOM   9179  C  C7    . DT  J 6 15  ? 141.066 175.005 111.347 1.00 163.14 ? 13   DT  J C7    1 
ATOM   9180  C  C6    . DT  J 6 15  ? 141.470 177.069 112.653 1.00 163.14 ? 13   DT  J C6    1 
ATOM   9181  P  P     . DA  J 6 16  ? 145.358 180.321 116.819 1.00 151.36 ? 14   DA  J P     1 
ATOM   9182  O  OP1   . DA  J 6 16  ? 146.210 181.457 116.405 1.00 151.36 ? 14   DA  J OP1   1 
ATOM   9183  O  OP2   . DA  J 6 16  ? 145.939 178.976 117.016 1.00 151.36 ? 14   DA  J OP2   1 
ATOM   9184  O  "O5'" . DA  J 6 16  ? 144.613 180.742 118.163 1.00 151.36 ? 14   DA  J "O5'" 1 
ATOM   9185  C  "C5'" . DA  J 6 16  ? 143.902 181.959 118.220 1.00 151.36 ? 14   DA  J "C5'" 1 
ATOM   9186  C  "C4'" . DA  J 6 16  ? 142.605 181.794 118.992 1.00 151.36 ? 14   DA  J "C4'" 1 
ATOM   9187  O  "O4'" . DA  J 6 16  ? 141.722 180.902 118.260 1.00 151.36 ? 14   DA  J "O4'" 1 
ATOM   9188  C  "C3'" . DA  J 6 16  ? 142.747 181.204 120.397 1.00 151.36 ? 14   DA  J "C3'" 1 
ATOM   9189  O  "O3'" . DA  J 6 16  ? 141.908 181.908 121.302 1.00 151.36 ? 14   DA  J "O3'" 1 
ATOM   9190  C  "C2'" . DA  J 6 16  ? 142.288 179.761 120.222 1.00 151.36 ? 14   DA  J "C2'" 1 
ATOM   9191  C  "C1'" . DA  J 6 16  ? 141.272 179.863 119.100 1.00 151.36 ? 14   DA  J "C1'" 1 
ATOM   9192  N  N9    . DA  J 6 16  ? 141.212 178.637 118.324 1.00 151.36 ? 14   DA  J N9    1 
ATOM   9193  C  C8    . DA  J 6 16  ? 142.267 177.848 117.970 1.00 151.36 ? 14   DA  J C8    1 
ATOM   9194  N  N7    . DA  J 6 16  ? 141.929 176.799 117.272 1.00 151.36 ? 14   DA  J N7    1 
ATOM   9195  C  C5    . DA  J 6 16  ? 140.562 176.921 117.138 1.00 151.36 ? 14   DA  J C5    1 
ATOM   9196  C  C6    . DA  J 6 16  ? 139.608 176.127 116.492 1.00 151.36 ? 14   DA  J C6    1 
ATOM   9197  N  N6    . DA  J 6 16  ? 139.917 175.015 115.833 1.00 151.36 ? 14   DA  J N6    1 
ATOM   9198  N  N1    . DA  J 6 16  ? 138.325 176.523 116.547 1.00 151.36 ? 14   DA  J N1    1 
ATOM   9199  C  C2    . DA  J 6 16  ? 138.021 177.641 117.217 1.00 151.36 ? 14   DA  J C2    1 
ATOM   9200  N  N3    . DA  J 6 16  ? 138.834 178.475 117.859 1.00 151.36 ? 14   DA  J N3    1 
ATOM   9201  C  C4    . DA  J 6 16  ? 140.102 178.050 117.782 1.00 151.36 ? 14   DA  J C4    1 
ATOM   9202  P  P     . DT  J 6 17  ? 141.781 181.456 122.840 1.00 143.26 ? 15   DT  J P     1 
ATOM   9203  O  OP1   . DT  J 6 17  ? 141.445 182.667 123.616 1.00 143.26 ? 15   DT  J OP1   1 
ATOM   9204  O  OP2   . DT  J 6 17  ? 142.970 180.670 123.234 1.00 143.26 ? 15   DT  J OP2   1 
ATOM   9205  O  "O5'" . DT  J 6 17  ? 140.495 180.514 122.822 1.00 143.26 ? 15   DT  J "O5'" 1 
ATOM   9206  C  "C5'" . DT  J 6 17  ? 139.295 181.033 122.312 1.00 143.26 ? 15   DT  J "C5'" 1 
ATOM   9207  C  "C4'" . DT  J 6 17  ? 138.257 179.949 122.115 1.00 143.26 ? 15   DT  J "C4'" 1 
ATOM   9208  O  "O4'" . DT  J 6 17  ? 138.741 178.985 121.165 1.00 143.26 ? 15   DT  J "O4'" 1 
ATOM   9209  C  "C3'" . DT  J 6 17  ? 137.903 179.124 123.351 1.00 143.26 ? 15   DT  J "C3'" 1 
ATOM   9210  O  "O3'" . DT  J 6 17  ? 136.723 179.667 124.052 1.00 143.26 ? 15   DT  J "O3'" 1 
ATOM   9211  C  "C2'" . DT  J 6 17  ? 137.677 177.700 122.816 1.00 143.26 ? 15   DT  J "C2'" 1 
ATOM   9212  C  "C1'" . DT  J 6 17  ? 137.994 177.807 121.329 1.00 143.26 ? 15   DT  J "C1'" 1 
ATOM   9213  N  N1    . DT  J 6 17  ? 138.772 176.661 120.789 1.00 143.26 ? 15   DT  J N1    1 
ATOM   9214  C  C2    . DT  J 6 17  ? 138.127 175.722 120.028 1.00 143.26 ? 15   DT  J C2    1 
ATOM   9215  O  O2    . DT  J 6 17  ? 136.944 175.781 119.763 1.00 143.26 ? 15   DT  J O2    1 
ATOM   9216  N  N3    . DT  J 6 17  ? 138.923 174.714 119.564 1.00 143.26 ? 15   DT  J N3    1 
ATOM   9217  C  C4    . DT  J 6 17  ? 140.275 174.548 119.791 1.00 143.26 ? 15   DT  J C4    1 
ATOM   9218  O  O4    . DT  J 6 17  ? 140.907 173.600 119.332 1.00 143.26 ? 15   DT  J O4    1 
ATOM   9219  C  C5    . DT  J 6 17  ? 140.892 175.565 120.607 1.00 143.26 ? 15   DT  J C5    1 
ATOM   9220  C  C7    . DT  J 6 17  ? 142.357 175.490 120.922 1.00 143.26 ? 15   DT  J C7    1 
ATOM   9221  C  C6    . DT  J 6 17  ? 140.116 176.561 121.063 1.00 143.26 ? 15   DT  J C6    1 
ATOM   9222  P  P     . DC  J 6 18  ? 135.208 179.594 123.484 1.00 130.91 ? 16   DC  J P     1 
ATOM   9223  O  OP1   . DC  J 6 18  ? 135.080 179.677 122.016 1.00 130.91 ? 16   DC  J OP1   1 
ATOM   9224  O  OP2   . DC  J 6 18  ? 134.479 180.569 124.312 1.00 130.91 ? 16   DC  J OP2   1 
ATOM   9225  O  "O5'" . DC  J 6 18  ? 134.642 178.163 123.903 1.00 130.91 ? 16   DC  J "O5'" 1 
ATOM   9226  C  "C5'" . DC  J 6 18  ? 133.271 177.880 123.630 1.00 130.91 ? 16   DC  J "C5'" 1 
ATOM   9227  C  "C4'" . DC  J 6 18  ? 133.011 176.391 123.476 1.00 130.91 ? 16   DC  J "C4'" 1 
ATOM   9228  O  "O4'" . DC  J 6 18  ? 134.170 175.745 122.932 1.00 130.91 ? 16   DC  J "O4'" 1 
ATOM   9229  C  "C3'" . DC  J 6 18  ? 132.676 175.647 124.764 1.00 130.91 ? 16   DC  J "C3'" 1 
ATOM   9230  O  "O3'" . DC  J 6 18  ? 131.311 175.254 124.725 1.00 130.91 ? 16   DC  J "O3'" 1 
ATOM   9231  C  "C2'" . DC  J 6 18  ? 133.624 174.431 124.765 1.00 130.91 ? 16   DC  J "C2'" 1 
ATOM   9232  C  "C1'" . DC  J 6 18  ? 134.174 174.411 123.350 1.00 130.91 ? 16   DC  J "C1'" 1 
ATOM   9233  N  N1    . DC  J 6 18  ? 135.566 173.946 123.274 1.00 130.91 ? 16   DC  J N1    1 
ATOM   9234  C  C2    . DC  J 6 18  ? 135.889 172.855 122.481 1.00 130.91 ? 16   DC  J C2    1 
ATOM   9235  O  O2    . DC  J 6 18  ? 134.994 172.280 121.866 1.00 130.91 ? 16   DC  J O2    1 
ATOM   9236  N  N3    . DC  J 6 18  ? 137.178 172.460 122.410 1.00 130.91 ? 16   DC  J N3    1 
ATOM   9237  C  C4    . DC  J 6 18  ? 138.114 173.116 123.090 1.00 130.91 ? 16   DC  J C4    1 
ATOM   9238  N  N4    . DC  J 6 18  ? 139.375 172.688 122.995 1.00 130.91 ? 16   DC  J N4    1 
ATOM   9239  C  C5    . DC  J 6 18  ? 137.801 174.237 123.902 1.00 130.91 ? 16   DC  J C5    1 
ATOM   9240  C  C6    . DC  J 6 18  ? 136.526 174.608 123.966 1.00 130.91 ? 16   DC  J C6    1 
ATOM   9241  P  P     . DT  J 6 19  ? 130.643 174.440 125.938 1.00 123.30 ? 17   DT  J P     1 
ATOM   9242  O  OP1   . DT  J 6 19  ? 129.197 174.733 125.894 1.00 123.30 ? 17   DT  J OP1   1 
ATOM   9243  O  OP2   . DT  J 6 19  ? 131.397 174.693 127.185 1.00 123.30 ? 17   DT  J OP2   1 
ATOM   9244  O  "O5'" . DT  J 6 19  ? 130.830 172.920 125.498 1.00 123.30 ? 17   DT  J "O5'" 1 
ATOM   9245  C  "C5'" . DT  J 6 19  ? 130.408 172.513 124.209 1.00 123.30 ? 17   DT  J "C5'" 1 
ATOM   9246  C  "C4'" . DT  J 6 19  ? 130.795 171.071 123.945 1.00 123.30 ? 17   DT  J "C4'" 1 
ATOM   9247  O  "O4'" . DT  J 6 19  ? 132.231 170.950 123.779 1.00 123.30 ? 17   DT  J "O4'" 1 
ATOM   9248  C  "C3'" . DT  J 6 19  ? 130.412 170.091 125.047 1.00 123.30 ? 17   DT  J "C3'" 1 
ATOM   9249  O  "O3'" . DT  J 6 19  ? 129.762 168.984 124.480 1.00 123.30 ? 17   DT  J "O3'" 1 
ATOM   9250  C  "C2'" . DT  J 6 19  ? 131.752 169.703 125.668 1.00 123.30 ? 17   DT  J "C2'" 1 
ATOM   9251  C  "C1'" . DT  J 6 19  ? 132.680 169.818 124.483 1.00 123.30 ? 17   DT  J "C1'" 1 
ATOM   9252  N  N1    . DT  J 6 19  ? 134.117 170.007 124.821 1.00 123.30 ? 17   DT  J N1    1 
ATOM   9253  C  C2    . DT  J 6 19  ? 135.038 169.131 124.303 1.00 123.30 ? 17   DT  J C2    1 
ATOM   9254  O  O2    . DT  J 6 19  ? 134.739 168.206 123.579 1.00 123.30 ? 17   DT  J O2    1 
ATOM   9255  N  N3    . DT  J 6 19  ? 136.331 169.385 124.643 1.00 123.30 ? 17   DT  J N3    1 
ATOM   9256  C  C4    . DT  J 6 19  ? 136.788 170.403 125.444 1.00 123.30 ? 17   DT  J C4    1 
ATOM   9257  O  O4    . DT  J 6 19  ? 137.973 170.549 125.697 1.00 123.30 ? 17   DT  J O4    1 
ATOM   9258  C  C5    . DT  J 6 19  ? 135.773 171.286 125.961 1.00 123.30 ? 17   DT  J C5    1 
ATOM   9259  C  C7    . DT  J 6 19  ? 136.158 172.429 126.845 1.00 123.30 ? 17   DT  J C7    1 
ATOM   9260  C  C6    . DT  J 6 19  ? 134.498 171.047 125.630 1.00 123.30 ? 17   DT  J C6    1 
ATOM   9261  P  P     . DG  J 6 20  ? 128.673 168.179 125.332 1.00 115.05 ? 18   DG  J P     1 
ATOM   9262  O  OP1   . DG  J 6 20  ? 127.457 168.018 124.509 1.00 115.05 ? 18   DG  J OP1   1 
ATOM   9263  O  OP2   . DG  J 6 20  ? 128.580 168.816 126.660 1.00 115.05 ? 18   DG  J OP2   1 
ATOM   9264  O  "O5'" . DG  J 6 20  ? 129.347 166.750 125.513 1.00 115.05 ? 18   DG  J "O5'" 1 
ATOM   9265  C  "C5'" . DG  J 6 20  ? 129.706 166.001 124.365 1.00 115.05 ? 18   DG  J "C5'" 1 
ATOM   9266  C  "C4'" . DG  J 6 20  ? 130.818 165.015 124.667 1.00 115.05 ? 18   DG  J "C4'" 1 
ATOM   9267  O  "O4'" . DG  J 6 20  ? 132.017 165.714 125.051 1.00 115.05 ? 18   DG  J "O4'" 1 
ATOM   9268  C  "C3'" . DG  J 6 20  ? 130.517 164.036 125.798 1.00 115.05 ? 18   DG  J "C3'" 1 
ATOM   9269  O  "O3'" . DG  J 6 20  ? 130.968 162.764 125.435 1.00 115.05 ? 18   DG  J "O3'" 1 
ATOM   9270  C  "C2'" . DG  J 6 20  ? 131.335 164.598 126.956 1.00 115.05 ? 18   DG  J "C2'" 1 
ATOM   9271  C  "C1'" . DG  J 6 20  ? 132.536 165.130 126.214 1.00 115.05 ? 18   DG  J "C1'" 1 
ATOM   9272  N  N9    . DG  J 6 20  ? 133.259 166.155 126.925 1.00 115.05 ? 18   DG  J N9    1 
ATOM   9273  C  C8    . DG  J 6 20  ? 132.734 167.175 127.663 1.00 115.05 ? 18   DG  J C8    1 
ATOM   9274  N  N7    . DG  J 6 20  ? 133.638 167.988 128.138 1.00 115.05 ? 18   DG  J N7    1 
ATOM   9275  C  C5    . DG  J 6 20  ? 134.834 167.467 127.673 1.00 115.05 ? 18   DG  J C5    1 
ATOM   9276  C  C6    . DG  J 6 20  ? 136.151 167.916 127.856 1.00 115.05 ? 18   DG  J C6    1 
ATOM   9277  O  O6    . DG  J 6 20  ? 136.542 168.888 128.507 1.00 115.05 ? 18   DG  J O6    1 
ATOM   9278  N  N1    . DG  J 6 20  ? 137.064 167.095 127.215 1.00 115.05 ? 18   DG  J N1    1 
ATOM   9279  C  C2    . DG  J 6 20  ? 136.737 165.991 126.477 1.00 115.05 ? 18   DG  J C2    1 
ATOM   9280  N  N2    . DG  J 6 20  ? 137.744 165.321 125.920 1.00 115.05 ? 18   DG  J N2    1 
ATOM   9281  N  N3    . DG  J 6 20  ? 135.509 165.566 126.293 1.00 115.05 ? 18   DG  J N3    1 
ATOM   9282  C  C4    . DG  J 6 20  ? 134.612 166.351 126.913 1.00 115.05 ? 18   DG  J C4    1 
ATOM   9283  P  P     . DA  J 6 21  ? 130.385 161.460 126.160 1.00 103.25 ? 19   DA  J P     1 
ATOM   9284  O  OP1   . DA  J 6 21  ? 129.667 160.706 125.110 1.00 103.25 ? 19   DA  J OP1   1 
ATOM   9285  O  OP2   . DA  J 6 21  ? 129.651 161.855 127.381 1.00 103.25 ? 19   DA  J OP2   1 
ATOM   9286  O  "O5'" . DA  J 6 21  ? 131.703 160.647 126.570 1.00 103.25 ? 19   DA  J "O5'" 1 
ATOM   9287  C  "C5'" . DA  J 6 21  ? 132.605 160.216 125.556 1.00 103.25 ? 19   DA  J "C5'" 1 
ATOM   9288  C  "C4'" . DA  J 6 21  ? 134.036 160.168 126.056 1.00 103.25 ? 19   DA  J "C4'" 1 
ATOM   9289  O  "O4'" . DA  J 6 21  ? 134.473 161.489 126.473 1.00 103.25 ? 19   DA  J "O4'" 1 
ATOM   9290  C  "C3'" . DA  J 6 21  ? 134.279 159.244 127.245 1.00 103.25 ? 19   DA  J "C3'" 1 
ATOM   9291  O  "O3'" . DA  J 6 21  ? 135.433 158.487 127.013 1.00 103.25 ? 19   DA  J "O3'" 1 
ATOM   9292  C  "C2'" . DA  J 6 21  ? 134.495 160.211 128.399 1.00 103.25 ? 19   DA  J "C2'" 1 
ATOM   9293  C  "C1'" . DA  J 6 21  ? 135.158 161.374 127.695 1.00 103.25 ? 19   DA  J "C1'" 1 
ATOM   9294  N  N9    . DA  J 6 21  ? 135.050 162.618 128.439 1.00 103.25 ? 19   DA  J N9    1 
ATOM   9295  C  C8    . DA  J 6 21  ? 133.908 163.232 128.843 1.00 103.25 ? 19   DA  J C8    1 
ATOM   9296  N  N7    . DA  J 6 21  ? 134.109 164.348 129.491 1.00 103.25 ? 19   DA  J N7    1 
ATOM   9297  C  C5    . DA  J 6 21  ? 135.481 164.477 129.505 1.00 103.25 ? 19   DA  J C5    1 
ATOM   9298  C  C6    . DA  J 6 21  ? 136.325 165.452 130.036 1.00 103.25 ? 19   DA  J C6    1 
ATOM   9299  N  N6    . DA  J 6 21  ? 135.878 166.526 130.687 1.00 103.25 ? 19   DA  J N6    1 
ATOM   9300  N  N1    . DA  J 6 21  ? 137.652 165.290 129.874 1.00 103.25 ? 19   DA  J N1    1 
ATOM   9301  C  C2    . DA  J 6 21  ? 138.095 164.212 129.222 1.00 103.25 ? 19   DA  J C2    1 
ATOM   9302  N  N3    . DA  J 6 21  ? 137.391 163.227 128.678 1.00 103.25 ? 19   DA  J N3    1 
ATOM   9303  C  C4    . DA  J 6 21  ? 136.078 163.430 128.847 1.00 103.25 ? 19   DA  J C4    1 
ATOM   9304  P  P     . DC  J 6 22  ? 135.780 157.220 127.933 1.00 90.44  ? 20   DC  J P     1 
ATOM   9305  O  OP1   . DC  J 6 22  ? 136.138 156.119 127.017 1.00 90.44  ? 20   DC  J OP1   1 
ATOM   9306  O  OP2   . DC  J 6 22  ? 134.724 157.032 128.953 1.00 90.44  ? 20   DC  J OP2   1 
ATOM   9307  O  "O5'" . DC  J 6 22  ? 137.128 157.658 128.650 1.00 90.44  ? 20   DC  J "O5'" 1 
ATOM   9308  C  "C5'" . DC  J 6 22  ? 138.276 157.813 127.870 1.00 90.44  ? 20   DC  J "C5'" 1 
ATOM   9309  C  "C4'" . DC  J 6 22  ? 139.414 158.383 128.676 1.00 90.44  ? 20   DC  J "C4'" 1 
ATOM   9310  O  "O4'" . DC  J 6 22  ? 139.067 159.722 129.122 1.00 90.44  ? 20   DC  J "O4'" 1 
ATOM   9311  C  "C3'" . DC  J 6 22  ? 139.781 157.594 129.929 1.00 90.44  ? 20   DC  J "C3'" 1 
ATOM   9312  O  "O3'" . DC  J 6 22  ? 141.200 157.506 130.029 1.00 90.44  ? 20   DC  J "O3'" 1 
ATOM   9313  C  "C2'" . DC  J 6 22  ? 139.174 158.427 131.054 1.00 90.44  ? 20   DC  J "C2'" 1 
ATOM   9314  C  "C1'" . DC  J 6 22  ? 139.300 159.834 130.503 1.00 90.44  ? 20   DC  J "C1'" 1 
ATOM   9315  N  N1    . DC  J 6 22  ? 138.315 160.795 131.085 1.00 90.44  ? 20   DC  J N1    1 
ATOM   9316  C  C2    . DC  J 6 22  ? 138.775 161.920 131.764 1.00 90.44  ? 20   DC  J C2    1 
ATOM   9317  O  O2    . DC  J 6 22  ? 139.991 162.087 131.873 1.00 90.44  ? 20   DC  J O2    1 
ATOM   9318  N  N3    . DC  J 6 22  ? 137.873 162.781 132.300 1.00 90.44  ? 20   DC  J N3    1 
ATOM   9319  C  C4    . DC  J 6 22  ? 136.568 162.550 132.159 1.00 90.44  ? 20   DC  J C4    1 
ATOM   9320  N  N4    . DC  J 6 22  ? 135.714 163.427 132.693 1.00 90.44  ? 20   DC  J N4    1 
ATOM   9321  C  C5    . DC  J 6 22  ? 136.081 161.403 131.475 1.00 90.44  ? 20   DC  J C5    1 
ATOM   9322  C  C6    . DC  J 6 22  ? 136.981 160.565 130.954 1.00 90.44  ? 20   DC  J C6    1 
ATOM   9323  P  P     . DA  J 6 23  ? 141.892 156.464 131.036 1.00 92.32  ? 21   DA  J P     1 
ATOM   9324  O  OP1   . DA  J 6 23  ? 142.869 155.697 130.247 1.00 92.32  ? 21   DA  J OP1   1 
ATOM   9325  O  OP2   . DA  J 6 23  ? 140.840 155.754 131.791 1.00 92.32  ? 21   DA  J OP2   1 
ATOM   9326  O  "O5'" . DA  J 6 23  ? 142.717 157.375 132.052 1.00 92.32  ? 21   DA  J "O5'" 1 
ATOM   9327  C  "C5'" . DA  J 6 23  ? 143.910 158.031 131.610 1.00 92.32  ? 21   DA  J "C5'" 1 
ATOM   9328  C  "C4'" . DA  J 6 23  ? 144.447 158.975 132.673 1.00 92.32  ? 21   DA  J "C4'" 1 
ATOM   9329  O  "O4'" . DA  J 6 23  ? 143.460 159.999 132.938 1.00 92.32  ? 21   DA  J "O4'" 1 
ATOM   9330  C  "C3'" . DA  J 6 23  ? 144.770 158.327 134.018 1.00 92.32  ? 21   DA  J "C3'" 1 
ATOM   9331  O  "O3'" . DA  J 6 23  ? 145.980 158.865 134.548 1.00 92.32  ? 21   DA  J "O3'" 1 
ATOM   9332  C  "C2'" . DA  J 6 23  ? 143.566 158.707 134.877 1.00 92.32  ? 21   DA  J "C2'" 1 
ATOM   9333  C  "C1'" . DA  J 6 23  ? 143.196 160.069 134.315 1.00 92.32  ? 21   DA  J "C1'" 1 
ATOM   9334  N  N9    . DA  J 6 23  ? 141.785 160.348 134.437 1.00 92.32  ? 21   DA  J N9    1 
ATOM   9335  C  C8    . DA  J 6 23  ? 140.779 159.609 133.908 1.00 92.32  ? 21   DA  J C8    1 
ATOM   9336  N  N7    . DA  J 6 23  ? 139.587 160.075 134.159 1.00 92.32  ? 21   DA  J N7    1 
ATOM   9337  C  C5    . DA  J 6 23  ? 139.825 161.205 134.906 1.00 92.32  ? 21   DA  J C5    1 
ATOM   9338  C  C6    . DA  J 6 23  ? 138.964 162.151 135.485 1.00 92.32  ? 21   DA  J C6    1 
ATOM   9339  N  N6    . DA  J 6 23  ? 137.632 162.088 135.383 1.00 92.32  ? 21   DA  J N6    1 
ATOM   9340  N  N1    . DA  J 6 23  ? 139.526 163.164 136.176 1.00 92.32  ? 21   DA  J N1    1 
ATOM   9341  C  C2    . DA  J 6 23  ? 140.867 163.219 136.282 1.00 92.32  ? 21   DA  J C2    1 
ATOM   9342  N  N3    . DA  J 6 23  ? 141.779 162.385 135.776 1.00 92.32  ? 21   DA  J N3    1 
ATOM   9343  C  C4    . DA  J 6 23  ? 141.185 161.395 135.089 1.00 92.32  ? 21   DA  J C4    1 
ATOM   9344  P  P     . DC  J 6 24  ? 146.640 158.231 135.870 1.00 98.71  ? 22   DC  J P     1 
ATOM   9345  O  OP1   . DC  J 6 24  ? 148.105 158.364 135.735 1.00 98.71  ? 22   DC  J OP1   1 
ATOM   9346  O  OP2   . DC  J 6 24  ? 146.040 156.896 136.074 1.00 98.71  ? 22   DC  J OP2   1 
ATOM   9347  O  "O5'" . DC  J 6 24  ? 146.161 159.203 137.050 1.00 98.71  ? 22   DC  J "O5'" 1 
ATOM   9348  C  "C5'" . DC  J 6 24  ? 146.592 160.558 137.082 1.00 98.71  ? 22   DC  J "C5'" 1 
ATOM   9349  C  "C4'" . DC  J 6 24  ? 146.029 161.311 138.287 1.00 98.71  ? 22   DC  J "C4'" 1 
ATOM   9350  O  "O4'" . DC  J 6 24  ? 144.612 161.584 138.080 1.00 98.71  ? 22   DC  J "O4'" 1 
ATOM   9351  C  "C3'" . DC  J 6 24  ? 146.115 160.615 139.649 1.00 98.71  ? 22   DC  J "C3'" 1 
ATOM   9352  O  "O3'" . DC  J 6 24  ? 146.364 161.588 140.648 1.00 98.71  ? 22   DC  J "O3'" 1 
ATOM   9353  C  "C2'" . DC  J 6 24  ? 144.716 160.047 139.817 1.00 98.71  ? 22   DC  J "C2'" 1 
ATOM   9354  C  "C1'" . DC  J 6 24  ? 143.900 161.173 139.224 1.00 98.71  ? 22   DC  J "C1'" 1 
ATOM   9355  N  N1    . DC  J 6 24  ? 142.543 160.781 138.842 1.00 98.71  ? 22   DC  J N1    1 
ATOM   9356  C  C2    . DC  J 6 24  ? 141.466 161.544 139.281 1.00 98.71  ? 22   DC  J C2    1 
ATOM   9357  O  O2    . DC  J 6 24  ? 141.685 162.520 139.998 1.00 98.71  ? 22   DC  J O2    1 
ATOM   9358  N  N3    . DC  J 6 24  ? 140.214 161.163 138.948 1.00 98.71  ? 22   DC  J N3    1 
ATOM   9359  C  C4    . DC  J 6 24  ? 140.032 160.086 138.183 1.00 98.71  ? 22   DC  J C4    1 
ATOM   9360  N  N4    . DC  J 6 24  ? 138.780 159.752 137.859 1.00 98.71  ? 22   DC  J N4    1 
ATOM   9361  C  C5    . DC  J 6 24  ? 141.128 159.301 137.718 1.00 98.71  ? 22   DC  J C5    1 
ATOM   9362  C  C6    . DC  J 6 24  ? 142.354 159.686 138.069 1.00 98.71  ? 22   DC  J C6    1 
ATOM   9363  P  P     . DG  J 6 25  ? 147.084 161.188 142.024 1.00 100.35 ? 23   DG  J P     1 
ATOM   9364  O  OP1   . DG  J 6 25  ? 148.426 161.801 142.005 1.00 100.35 ? 23   DG  J OP1   1 
ATOM   9365  O  OP2   . DG  J 6 25  ? 146.938 159.730 142.210 1.00 100.35 ? 23   DG  J OP2   1 
ATOM   9366  O  "O5'" . DG  J 6 25  ? 146.212 161.920 143.150 1.00 100.35 ? 23   DG  J "O5'" 1 
ATOM   9367  C  "C5'" . DG  J 6 25  ? 146.116 163.343 143.173 1.00 100.35 ? 23   DG  J "C5'" 1 
ATOM   9368  C  "C4'" . DG  J 6 25  ? 144.916 163.838 143.988 1.00 100.35 ? 23   DG  J "C4'" 1 
ATOM   9369  O  "O4'" . DG  J 6 25  ? 143.674 163.525 143.322 1.00 100.35 ? 23   DG  J "O4'" 1 
ATOM   9370  C  "C3'" . DG  J 6 25  ? 144.770 163.293 145.405 1.00 100.35 ? 23   DG  J "C3'" 1 
ATOM   9371  O  "O3'" . DG  J 6 25  ? 144.202 164.302 146.225 1.00 100.35 ? 23   DG  J "O3'" 1 
ATOM   9372  C  "C2'" . DG  J 6 25  ? 143.793 162.149 145.219 1.00 100.35 ? 23   DG  J "C2'" 1 
ATOM   9373  C  "C1'" . DG  J 6 25  ? 142.868 162.748 144.182 1.00 100.35 ? 23   DG  J "C1'" 1 
ATOM   9374  N  N9    . DG  J 6 25  ? 142.153 161.787 143.374 1.00 100.35 ? 23   DG  J N9    1 
ATOM   9375  C  C8    . DG  J 6 25  ? 142.691 160.795 142.602 1.00 100.35 ? 23   DG  J C8    1 
ATOM   9376  N  N7    . DG  J 6 25  ? 141.798 160.082 141.987 1.00 100.35 ? 23   DG  J N7    1 
ATOM   9377  C  C5    . DG  J 6 25  ? 140.591 160.642 142.380 1.00 100.35 ? 23   DG  J C5    1 
ATOM   9378  C  C6    . DG  J 6 25  ? 139.270 160.293 142.033 1.00 100.35 ? 23   DG  J C6    1 
ATOM   9379  O  O6    . DG  J 6 25  ? 138.886 159.389 141.286 1.00 100.35 ? 23   DG  J O6    1 
ATOM   9380  N  N1    . DG  J 6 25  ? 138.342 161.108 142.662 1.00 100.35 ? 23   DG  J N1    1 
ATOM   9381  C  C2    . DG  J 6 25  ? 138.648 162.122 143.525 1.00 100.35 ? 23   DG  J C2    1 
ATOM   9382  N  N2    . DG  J 6 25  ? 137.612 162.805 144.018 1.00 100.35 ? 23   DG  J N2    1 
ATOM   9383  N  N3    . DG  J 6 25  ? 139.881 162.472 143.844 1.00 100.35 ? 23   DG  J N3    1 
ATOM   9384  C  C4    . DG  J 6 25  ? 140.797 161.690 143.233 1.00 100.35 ? 23   DG  J C4    1 
ATOM   9385  P  P     . DT  J 6 26  ? 144.285 164.188 147.821 1.00 98.27  ? 24   DT  J P     1 
ATOM   9386  O  OP1   . DT  J 6 26  ? 144.765 165.499 148.302 1.00 98.27  ? 24   DT  J OP1   1 
ATOM   9387  O  OP2   . DT  J 6 26  ? 145.018 162.948 148.159 1.00 98.27  ? 24   DT  J OP2   1 
ATOM   9388  O  "O5'" . DT  J 6 26  ? 142.769 164.013 148.317 1.00 98.27  ? 24   DT  J "O5'" 1 
ATOM   9389  C  "C5'" . DT  J 6 26  ? 141.779 165.033 148.093 1.00 98.27  ? 24   DT  J "C5'" 1 
ATOM   9390  C  "C4'" . DT  J 6 26  ? 140.402 164.568 148.571 1.00 98.27  ? 24   DT  J "C4'" 1 
ATOM   9391  O  "O4'" . DT  J 6 26  ? 139.766 163.716 147.579 1.00 98.27  ? 24   DT  J "O4'" 1 
ATOM   9392  C  "C3'" . DT  J 6 26  ? 140.416 163.761 149.880 1.00 98.27  ? 24   DT  J "C3'" 1 
ATOM   9393  O  "O3'" . DT  J 6 26  ? 139.347 164.152 150.756 1.00 98.27  ? 24   DT  J "O3'" 1 
ATOM   9394  C  "C2'" . DT  J 6 26  ? 140.222 162.325 149.395 1.00 98.27  ? 24   DT  J "C2'" 1 
ATOM   9395  C  "C1'" . DT  J 6 26  ? 139.288 162.556 148.227 1.00 98.27  ? 24   DT  J "C1'" 1 
ATOM   9396  N  N1    . DT  J 6 26  ? 139.224 161.444 147.262 1.00 98.27  ? 24   DT  J N1    1 
ATOM   9397  C  C2    . DT  J 6 26  ? 138.000 161.053 146.790 1.00 98.27  ? 24   DT  J C2    1 
ATOM   9398  O  O2    . DT  J 6 26  ? 136.955 161.557 147.153 1.00 98.27  ? 24   DT  J O2    1 
ATOM   9399  N  N3    . DT  J 6 26  ? 138.033 160.024 145.898 1.00 98.27  ? 24   DT  J N3    1 
ATOM   9400  C  C4    . DT  J 6 26  ? 139.150 159.374 145.422 1.00 98.27  ? 24   DT  J C4    1 
ATOM   9401  O  O4    . DT  J 6 26  ? 139.080 158.462 144.615 1.00 98.27  ? 24   DT  J O4    1 
ATOM   9402  C  C5    . DT  J 6 26  ? 140.406 159.836 145.947 1.00 98.27  ? 24   DT  J C5    1 
ATOM   9403  C  C7    . DT  J 6 26  ? 141.679 159.186 145.505 1.00 98.27  ? 24   DT  J C7    1 
ATOM   9404  C  C6    . DT  J 6 26  ? 140.387 160.846 146.829 1.00 98.27  ? 24   DT  J C6    1 
ATOM   9405  P  P     . DG  J 6 27  ? 139.577 164.098 152.347 1.00 86.32  ? 25   DG  J P     1 
ATOM   9406  O  OP1   . DG  J 6 27  ? 139.463 165.477 152.857 1.00 86.32  ? 25   DG  J OP1   1 
ATOM   9407  O  OP2   . DG  J 6 27  ? 140.814 163.327 152.599 1.00 86.32  ? 25   DG  J OP2   1 
ATOM   9408  O  "O5'" . DG  J 6 27  ? 138.326 163.270 152.916 1.00 86.32  ? 25   DG  J "O5'" 1 
ATOM   9409  C  "C5'" . DG  J 6 27  ? 136.991 163.718 152.704 1.00 86.32  ? 25   DG  J "C5'" 1 
ATOM   9410  C  "C4'" . DG  J 6 27  ? 135.981 162.567 152.771 1.00 86.32  ? 25   DG  J "C4'" 1 
ATOM   9411  O  "O4'" . DG  J 6 27  ? 136.212 161.614 151.708 1.00 86.32  ? 25   DG  J "O4'" 1 
ATOM   9412  C  "C3'" . DG  J 6 27  ? 135.958 161.742 154.058 1.00 86.32  ? 25   DG  J "C3'" 1 
ATOM   9413  O  "O3'" . DG  J 6 27  ? 134.611 161.372 154.336 1.00 86.32  ? 25   DG  J "O3'" 1 
ATOM   9414  C  "C2'" . DG  J 6 27  ? 136.799 160.522 153.674 1.00 86.32  ? 25   DG  J "C2'" 1 
ATOM   9415  C  "C1'" . DG  J 6 27  ? 136.320 160.310 152.255 1.00 86.32  ? 25   DG  J "C1'" 1 
ATOM   9416  N  N9    . DG  J 6 27  ? 137.224 159.574 151.395 1.00 86.32  ? 25   DG  J N9    1 
ATOM   9417  C  C8    . DG  J 6 27  ? 138.580 159.729 151.285 1.00 86.32  ? 25   DG  J C8    1 
ATOM   9418  N  N7    . DG  J 6 27  ? 139.109 158.977 150.363 1.00 86.32  ? 25   DG  J N7    1 
ATOM   9419  C  C5    . DG  J 6 27  ? 138.025 158.320 149.802 1.00 86.32  ? 25   DG  J C5    1 
ATOM   9420  C  C6    . DG  J 6 27  ? 137.975 157.381 148.760 1.00 86.32  ? 25   DG  J C6    1 
ATOM   9421  O  O6    . DG  J 6 27  ? 138.908 156.929 148.098 1.00 86.32  ? 25   DG  J O6    1 
ATOM   9422  N  N1    . DG  J 6 27  ? 136.680 156.963 148.504 1.00 86.32  ? 25   DG  J N1    1 
ATOM   9423  C  C2    . DG  J 6 27  ? 135.572 157.395 149.181 1.00 86.32  ? 25   DG  J C2    1 
ATOM   9424  N  N2    . DG  J 6 27  ? 134.396 156.876 148.792 1.00 86.32  ? 25   DG  J N2    1 
ATOM   9425  N  N3    . DG  J 6 27  ? 135.605 158.280 150.157 1.00 86.32  ? 25   DG  J N3    1 
ATOM   9426  C  C4    . DG  J 6 27  ? 136.861 158.693 150.415 1.00 86.32  ? 25   DG  J C4    1 
ATOM   9427  P  P     . DC  J 6 28  ? 134.155 160.939 155.814 1.00 79.09  ? 26   DC  J P     1 
ATOM   9428  O  OP1   . DC  J 6 28  ? 133.556 162.141 156.423 1.00 79.09  ? 26   DC  J OP1   1 
ATOM   9429  O  OP2   . DC  J 6 28  ? 135.256 160.241 156.510 1.00 79.09  ? 26   DC  J OP2   1 
ATOM   9430  O  "O5'" . DC  J 6 28  ? 133.005 159.861 155.548 1.00 79.09  ? 26   DC  J "O5'" 1 
ATOM   9431  C  "C5'" . DC  J 6 28  ? 132.699 159.477 154.210 1.00 79.09  ? 26   DC  J "C5'" 1 
ATOM   9432  C  "C4'" . DC  J 6 28  ? 132.489 157.974 154.074 1.00 79.09  ? 26   DC  J "C4'" 1 
ATOM   9433  O  "O4'" . DC  J 6 28  ? 133.512 157.435 153.206 1.00 79.09  ? 26   DC  J "O4'" 1 
ATOM   9434  C  "C3'" . DC  J 6 28  ? 132.585 157.161 155.362 1.00 79.09  ? 26   DC  J "C3'" 1 
ATOM   9435  O  "O3'" . DC  J 6 28  ? 131.770 156.000 155.250 1.00 79.09  ? 26   DC  J "O3'" 1 
ATOM   9436  C  "C2'" . DC  J 6 28  ? 134.050 156.762 155.344 1.00 79.09  ? 26   DC  J "C2'" 1 
ATOM   9437  C  "C1'" . DC  J 6 28  ? 134.183 156.406 153.878 1.00 79.09  ? 26   DC  J "C1'" 1 
ATOM   9438  N  N1    . DC  J 6 28  ? 135.556 156.386 153.389 1.00 79.09  ? 26   DC  J N1    1 
ATOM   9439  C  C2    . DC  J 6 28  ? 135.819 155.744 152.199 1.00 79.09  ? 26   DC  J C2    1 
ATOM   9440  O  O2    . DC  J 6 28  ? 134.893 155.217 151.587 1.00 79.09  ? 26   DC  J O2    1 
ATOM   9441  N  N3    . DC  J 6 28  ? 137.076 155.702 151.739 1.00 79.09  ? 26   DC  J N3    1 
ATOM   9442  C  C4    . DC  J 6 28  ? 138.051 156.279 152.429 1.00 79.09  ? 26   DC  J C4    1 
ATOM   9443  N  N4    . DC  J 6 28  ? 139.274 156.209 151.930 1.00 79.09  ? 26   DC  J N4    1 
ATOM   9444  C  C5    . DC  J 6 28  ? 137.812 156.941 153.660 1.00 79.09  ? 26   DC  J C5    1 
ATOM   9445  C  C6    . DC  J 6 28  ? 136.556 156.965 154.103 1.00 79.09  ? 26   DC  J C6    1 
ATOM   9446  P  P     . DC  J 6 29  ? 130.313 155.939 155.919 1.00 72.17  ? 27   DC  J P     1 
ATOM   9447  O  OP1   . DC  J 6 29  ? 129.480 156.937 155.219 1.00 72.17  ? 27   DC  J OP1   1 
ATOM   9448  O  OP2   . DC  J 6 29  ? 130.464 155.980 157.388 1.00 72.17  ? 27   DC  J OP2   1 
ATOM   9449  O  "O5'" . DC  J 6 29  ? 129.784 154.491 155.514 1.00 72.17  ? 27   DC  J "O5'" 1 
ATOM   9450  C  "C5'" . DC  J 6 29  ? 129.989 154.027 154.206 1.00 72.17  ? 27   DC  J "C5'" 1 
ATOM   9451  C  "C4'" . DC  J 6 29  ? 130.487 152.594 154.194 1.00 72.17  ? 27   DC  J "C4'" 1 
ATOM   9452  O  "O4'" . DC  J 6 29  ? 131.931 152.578 154.049 1.00 72.17  ? 27   DC  J "O4'" 1 
ATOM   9453  C  "C3'" . DC  J 6 29  ? 130.196 151.780 155.455 1.00 72.17  ? 27   DC  J "C3'" 1 
ATOM   9454  O  "O3'" . DC  J 6 29  ? 129.923 150.451 155.097 1.00 72.17  ? 27   DC  J "O3'" 1 
ATOM   9455  C  "C2'" . DC  J 6 29  ? 131.523 151.840 156.193 1.00 72.17  ? 27   DC  J "C2'" 1 
ATOM   9456  C  "C1'" . DC  J 6 29  ? 132.473 151.725 155.024 1.00 72.17  ? 27   DC  J "C1'" 1 
ATOM   9457  N  N1    . DC  J 6 29  ? 133.839 152.162 155.319 1.00 72.17  ? 27   DC  J N1    1 
ATOM   9458  C  C2    . DC  J 6 29  ? 134.856 151.819 154.449 1.00 72.17  ? 27   DC  J C2    1 
ATOM   9459  O  O2    . DC  J 6 29  ? 134.579 151.191 153.431 1.00 72.17  ? 27   DC  J O2    1 
ATOM   9460  N  N3    . DC  J 6 29  ? 136.114 152.214 154.724 1.00 72.17  ? 27   DC  J N3    1 
ATOM   9461  C  C4    . DC  J 6 29  ? 136.367 152.915 155.821 1.00 72.17  ? 27   DC  J C4    1 
ATOM   9462  N  N4    . DC  J 6 29  ? 137.631 153.274 156.056 1.00 72.17  ? 27   DC  J N4    1 
ATOM   9463  C  C5    . DC  J 6 29  ? 135.344 153.248 156.744 1.00 72.17  ? 27   DC  J C5    1 
ATOM   9464  C  C6    . DC  J 6 29  ? 134.105 152.853 156.455 1.00 72.17  ? 27   DC  J C6    1 
ATOM   9465  P  P     . DT  J 6 30  ? 128.416 149.943 154.908 1.00 72.74  ? 28   DT  J P     1 
ATOM   9466  O  OP1   . DT  J 6 30  ? 127.639 150.966 154.180 1.00 72.74  ? 28   DT  J OP1   1 
ATOM   9467  O  OP2   . DT  J 6 30  ? 127.950 149.457 156.222 1.00 72.74  ? 28   DT  J OP2   1 
ATOM   9468  O  "O5'" . DT  J 6 30  ? 128.589 148.691 153.947 1.00 72.74  ? 28   DT  J "O5'" 1 
ATOM   9469  C  "C5'" . DT  J 6 30  ? 129.568 148.736 152.934 1.00 72.74  ? 28   DT  J "C5'" 1 
ATOM   9470  C  "C4'" . DT  J 6 30  ? 130.482 147.529 152.987 1.00 72.74  ? 28   DT  J "C4'" 1 
ATOM   9471  O  "O4'" . DT  J 6 30  ? 131.739 147.860 153.642 1.00 72.74  ? 28   DT  J "O4'" 1 
ATOM   9472  C  "C3'" . DT  J 6 30  ? 129.934 146.326 153.740 1.00 72.74  ? 28   DT  J "C3'" 1 
ATOM   9473  O  "O3'" . DT  J 6 30  ? 130.420 145.189 153.140 1.00 72.74  ? 28   DT  J "O3'" 1 
ATOM   9474  C  "C2'" . DT  J 6 30  ? 130.591 146.481 155.104 1.00 72.74  ? 28   DT  J "C2'" 1 
ATOM   9475  C  "C1'" . DT  J 6 30  ? 131.974 146.925 154.671 1.00 72.74  ? 28   DT  J "C1'" 1 
ATOM   9476  N  N1    . DT  J 6 30  ? 132.793 147.552 155.747 1.00 72.74  ? 28   DT  J N1    1 
ATOM   9477  C  C2    . DT  J 6 30  ? 134.144 147.689 155.566 1.00 72.74  ? 28   DT  J C2    1 
ATOM   9478  O  O2    . DT  J 6 30  ? 134.713 147.353 154.555 1.00 72.74  ? 28   DT  J O2    1 
ATOM   9479  N  N3    . DT  J 6 30  ? 134.804 148.264 156.609 1.00 72.74  ? 28   DT  J N3    1 
ATOM   9480  C  C4    . DT  J 6 30  ? 134.260 148.688 157.799 1.00 72.74  ? 28   DT  J C4    1 
ATOM   9481  O  O4    . DT  J 6 30  ? 134.930 149.200 158.675 1.00 72.74  ? 28   DT  J O4    1 
ATOM   9482  C  C5    . DT  J 6 30  ? 132.846 148.501 157.933 1.00 72.74  ? 28   DT  J C5    1 
ATOM   9483  C  C7    . DT  J 6 30  ? 132.151 148.927 159.188 1.00 72.74  ? 28   DT  J C7    1 
ATOM   9484  C  C6    . DT  J 6 30  ? 132.187 147.941 156.916 1.00 72.74  ? 28   DT  J C6    1 
ATOM   9485  P  P     . DG  J 6 31  ? 129.548 144.338 152.102 1.00 72.28  ? 29   DG  J P     1 
ATOM   9486  O  OP1   . DG  J 6 31  ? 129.062 145.232 151.033 1.00 72.28  ? 29   DG  J OP1   1 
ATOM   9487  O  OP2   . DG  J 6 31  ? 128.595 143.487 152.839 1.00 72.28  ? 29   DG  J OP2   1 
ATOM   9488  O  "O5'" . DG  J 6 31  ? 130.670 143.414 151.492 1.00 72.28  ? 29   DG  J "O5'" 1 
ATOM   9489  C  "C5'" . DG  J 6 31  ? 131.746 144.058 150.899 1.00 72.28  ? 29   DG  J "C5'" 1 
ATOM   9490  C  "C4'" . DG  J 6 31  ? 133.092 143.574 151.413 1.00 72.28  ? 29   DG  J "C4'" 1 
ATOM   9491  O  "O4'" . DG  J 6 31  ? 133.463 144.223 152.665 1.00 72.28  ? 29   DG  J "O4'" 1 
ATOM   9492  C  "C3'" . DG  J 6 31  ? 133.229 142.085 151.672 1.00 72.28  ? 29   DG  J "C3'" 1 
ATOM   9493  O  "O3'" . DG  J 6 31  ? 134.513 141.762 151.323 1.00 72.28  ? 29   DG  J "O3'" 1 
ATOM   9494  C  "C2'" . DG  J 6 31  ? 133.079 142.004 153.187 1.00 72.28  ? 29   DG  J "C2'" 1 
ATOM   9495  C  "C1'" . DG  J 6 31  ? 133.879 143.226 153.569 1.00 72.28  ? 29   DG  J "C1'" 1 
ATOM   9496  N  N9    . DG  J 6 31  ? 133.736 143.687 154.946 1.00 72.28  ? 29   DG  J N9    1 
ATOM   9497  C  C8    . DG  J 6 31  ? 132.618 143.641 155.724 1.00 72.28  ? 29   DG  J C8    1 
ATOM   9498  N  N7    . DG  J 6 31  ? 132.798 144.141 156.913 1.00 72.28  ? 29   DG  J N7    1 
ATOM   9499  C  C5    . DG  J 6 31  ? 134.125 144.535 156.922 1.00 72.28  ? 29   DG  J C5    1 
ATOM   9500  C  C6    . DG  J 6 31  ? 134.886 145.140 157.941 1.00 72.28  ? 29   DG  J C6    1 
ATOM   9501  O  O6    . DG  J 6 31  ? 134.532 145.458 159.077 1.00 72.28  ? 29   DG  J O6    1 
ATOM   9502  N  N1    . DG  J 6 31  ? 136.186 145.375 157.545 1.00 72.28  ? 29   DG  J N1    1 
ATOM   9503  C  C2    . DG  J 6 31  ? 136.692 145.064 156.318 1.00 72.28  ? 29   DG  J C2    1 
ATOM   9504  N  N2    . DG  J 6 31  ? 137.985 145.368 156.116 1.00 72.28  ? 29   DG  J N2    1 
ATOM   9505  N  N3    . DG  J 6 31  ? 135.987 144.499 155.351 1.00 72.28  ? 29   DG  J N3    1 
ATOM   9506  C  C4    . DG  J 6 31  ? 134.714 144.269 155.723 1.00 72.28  ? 29   DG  J C4    1 
ATOM   9507  P  P     . DG  J 6 32  ? 134.829 140.445 150.488 1.00 66.77  ? 30   DG  J P     1 
ATOM   9508  O  OP1   . DG  J 6 32  ? 134.544 140.748 149.073 1.00 66.77  ? 30   DG  J OP1   1 
ATOM   9509  O  OP2   . DG  J 6 32  ? 134.163 139.306 151.149 1.00 66.77  ? 30   DG  J OP2   1 
ATOM   9510  O  "O5'" . DG  J 6 32  ? 136.390 140.298 150.701 1.00 66.77  ? 30   DG  J "O5'" 1 
ATOM   9511  C  "C5'" . DG  J 6 32  ? 137.214 141.433 150.525 1.00 66.77  ? 30   DG  J "C5'" 1 
ATOM   9512  C  "C4'" . DG  J 6 32  ? 138.353 141.460 151.533 1.00 66.77  ? 30   DG  J "C4'" 1 
ATOM   9513  O  "O4'" . DG  J 6 32  ? 137.911 141.970 152.811 1.00 66.77  ? 30   DG  J "O4'" 1 
ATOM   9514  C  "C3'" . DG  J 6 32  ? 139.011 140.123 151.821 1.00 66.77  ? 30   DG  J "C3'" 1 
ATOM   9515  O  "O3'" . DG  J 6 32  ? 140.373 140.334 151.999 1.00 66.77  ? 30   DG  J "O3'" 1 
ATOM   9516  C  "C2'" . DG  J 6 32  ? 138.359 139.715 153.138 1.00 66.77  ? 30   DG  J "C2'" 1 
ATOM   9517  C  "C1'" . DG  J 6 32  ? 138.274 141.060 153.822 1.00 66.77  ? 30   DG  J "C1'" 1 
ATOM   9518  N  N9    . DG  J 6 32  ? 137.289 141.162 154.893 1.00 66.77  ? 30   DG  J N9    1 
ATOM   9519  C  C8    . DG  J 6 32  ? 135.974 140.786 154.851 1.00 66.77  ? 30   DG  J C8    1 
ATOM   9520  N  N7    . DG  J 6 32  ? 135.328 141.035 155.954 1.00 66.77  ? 30   DG  J N7    1 
ATOM   9521  C  C5    . DG  J 6 32  ? 136.284 141.587 156.785 1.00 66.77  ? 30   DG  J C5    1 
ATOM   9522  C  C6    . DG  J 6 32  ? 136.170 142.054 158.099 1.00 66.77  ? 30   DG  J C6    1 
ATOM   9523  O  O6    . DG  J 6 32  ? 135.176 142.048 158.825 1.00 66.77  ? 30   DG  J O6    1 
ATOM   9524  N  N1    . DG  J 6 32  ? 137.376 142.540 158.579 1.00 66.77  ? 30   DG  J N1    1 
ATOM   9525  C  C2    . DG  J 6 32  ? 138.542 142.587 157.862 1.00 66.77  ? 30   DG  J C2    1 
ATOM   9526  N  N2    . DG  J 6 32  ? 139.608 143.099 158.484 1.00 66.77  ? 30   DG  J N2    1 
ATOM   9527  N  N3    . DG  J 6 32  ? 138.657 142.164 156.620 1.00 66.77  ? 30   DG  J N3    1 
ATOM   9528  C  C4    . DG  J 6 32  ? 137.489 141.690 156.143 1.00 66.77  ? 30   DG  J C4    1 
ATOM   9529  P  P     . DA  J 6 33  ? 141.419 139.173 151.669 1.00 68.70  ? 31   DA  J P     1 
ATOM   9530  O  OP1   . DA  J 6 33  ? 142.237 139.641 150.533 1.00 68.70  ? 31   DA  J OP1   1 
ATOM   9531  O  OP2   . DA  J 6 33  ? 140.699 137.886 151.598 1.00 68.70  ? 31   DA  J OP2   1 
ATOM   9532  O  "O5'" . DA  J 6 33  ? 142.358 139.176 152.946 1.00 68.70  ? 31   DA  J "O5'" 1 
ATOM   9533  C  "C5'" . DA  J 6 33  ? 142.767 140.404 153.494 1.00 68.70  ? 31   DA  J "C5'" 1 
ATOM   9534  C  "C4'" . DA  J 6 33  ? 143.238 140.242 154.926 1.00 68.70  ? 31   DA  J "C4'" 1 
ATOM   9535  O  "O4'" . DA  J 6 33  ? 142.157 140.494 155.852 1.00 68.70  ? 31   DA  J "O4'" 1 
ATOM   9536  C  "C3'" . DA  J 6 33  ? 143.804 138.878 155.280 1.00 68.70  ? 31   DA  J "C3'" 1 
ATOM   9537  O  "O3'" . DA  J 6 33  ? 144.904 139.074 156.110 1.00 68.70  ? 31   DA  J "O3'" 1 
ATOM   9538  C  "C2'" . DA  J 6 33  ? 142.644 138.222 156.028 1.00 68.70  ? 31   DA  J "C2'" 1 
ATOM   9539  C  "C1'" . DA  J 6 33  ? 142.028 139.410 156.734 1.00 68.70  ? 31   DA  J "C1'" 1 
ATOM   9540  N  N9    . DA  J 6 33  ? 140.616 139.253 157.056 1.00 68.70  ? 31   DA  J N9    1 
ATOM   9541  C  C8    . DA  J 6 33  ? 139.625 138.854 156.221 1.00 68.70  ? 31   DA  J C8    1 
ATOM   9542  N  N7    . DA  J 6 33  ? 138.444 138.803 156.781 1.00 68.70  ? 31   DA  J N7    1 
ATOM   9543  C  C5    . DA  J 6 33  ? 138.682 139.199 158.076 1.00 68.70  ? 31   DA  J C5    1 
ATOM   9544  C  C6    . DA  J 6 33  ? 137.842 139.357 159.180 1.00 68.70  ? 31   DA  J C6    1 
ATOM   9545  N  N6    . DA  J 6 33  ? 136.533 139.112 159.143 1.00 68.70  ? 31   DA  J N6    1 
ATOM   9546  N  N1    . DA  J 6 33  ? 138.399 139.755 160.340 1.00 68.70  ? 31   DA  J N1    1 
ATOM   9547  C  C2    . DA  J 6 33  ? 139.709 139.997 160.372 1.00 68.70  ? 31   DA  J C2    1 
ATOM   9548  N  N3    . DA  J 6 33  ? 140.600 139.877 159.397 1.00 68.70  ? 31   DA  J N3    1 
ATOM   9549  C  C4    . DA  J 6 33  ? 140.012 139.491 158.262 1.00 68.70  ? 31   DA  J C4    1 
ATOM   9550  P  P     . DG  J 6 34  ? 145.976 137.913 156.375 1.00 78.00  ? 32   DG  J P     1 
ATOM   9551  O  OP1   . DG  J 6 34  ? 147.208 138.329 155.683 1.00 78.00  ? 32   DG  J OP1   1 
ATOM   9552  O  OP2   . DG  J 6 34  ? 145.415 136.590 156.045 1.00 78.00  ? 32   DG  J OP2   1 
ATOM   9553  O  "O5'" . DG  J 6 34  ? 146.222 138.035 157.949 1.00 78.00  ? 32   DG  J "O5'" 1 
ATOM   9554  C  "C5'" . DG  J 6 34  ? 145.422 138.949 158.702 1.00 78.00  ? 32   DG  J "C5'" 1 
ATOM   9555  C  "C4'" . DG  J 6 34  ? 145.428 138.626 160.184 1.00 78.00  ? 32   DG  J "C4'" 1 
ATOM   9556  O  "O4'" . DG  J 6 34  ? 144.072 138.603 160.689 1.00 78.00  ? 32   DG  J "O4'" 1 
ATOM   9557  C  "C3'" . DG  J 6 34  ? 146.004 137.282 160.574 1.00 78.00  ? 32   DG  J "C3'" 1 
ATOM   9558  O  "O3'" . DG  J 6 34  ? 146.413 137.363 161.922 1.00 78.00  ? 32   DG  J "O3'" 1 
ATOM   9559  C  "C2'" . DG  J 6 34  ? 144.789 136.383 160.420 1.00 78.00  ? 32   DG  J "C2'" 1 
ATOM   9560  C  "C1'" . DG  J 6 34  ? 143.719 137.274 161.015 1.00 78.00  ? 32   DG  J "C1'" 1 
ATOM   9561  N  N9    . DG  J 6 34  ? 142.400 137.038 160.489 1.00 78.00  ? 32   DG  J N9    1 
ATOM   9562  C  C8    . DG  J 6 34  ? 142.059 136.804 159.190 1.00 78.00  ? 32   DG  J C8    1 
ATOM   9563  N  N7    . DG  J 6 34  ? 140.785 136.619 159.018 1.00 78.00  ? 32   DG  J N7    1 
ATOM   9564  C  C5    . DG  J 6 34  ? 140.259 136.724 160.289 1.00 78.00  ? 32   DG  J C5    1 
ATOM   9565  C  C6    . DG  J 6 34  ? 138.932 136.635 160.730 1.00 78.00  ? 32   DG  J C6    1 
ATOM   9566  O  O6    . DG  J 6 34  ? 137.923 136.404 160.066 1.00 78.00  ? 32   DG  J O6    1 
ATOM   9567  N  N1    . DG  J 6 34  ? 138.836 136.798 162.098 1.00 78.00  ? 32   DG  J N1    1 
ATOM   9568  C  C2    . DG  J 6 34  ? 139.894 137.041 162.932 1.00 78.00  ? 32   DG  J C2    1 
ATOM   9569  N  N2    . DG  J 6 34  ? 139.621 137.171 164.230 1.00 78.00  ? 32   DG  J N2    1 
ATOM   9570  N  N3    . DG  J 6 34  ? 141.141 137.137 162.528 1.00 78.00  ? 32   DG  J N3    1 
ATOM   9571  C  C4    . DG  J 6 34  ? 141.244 136.987 161.199 1.00 78.00  ? 32   DG  J C4    1 
ATOM   9572  P  P     . DA  J 6 35  ? 147.387 136.268 162.570 1.00 85.66  ? 33   DA  J P     1 
ATOM   9573  O  OP1   . DA  J 6 35  ? 148.592 137.001 163.008 1.00 85.66  ? 33   DA  J OP1   1 
ATOM   9574  O  OP2   . DA  J 6 35  ? 147.529 135.123 161.645 1.00 85.66  ? 33   DA  J OP2   1 
ATOM   9575  O  "O5'" . DA  J 6 35  ? 146.590 135.784 163.873 1.00 85.66  ? 33   DA  J "O5'" 1 
ATOM   9576  C  "C5'" . DA  J 6 35  ? 145.435 136.500 164.320 1.00 85.66  ? 33   DA  J "C5'" 1 
ATOM   9577  C  "C4'" . DA  J 6 35  ? 144.721 135.736 165.427 1.00 85.66  ? 33   DA  J "C4'" 1 
ATOM   9578  O  "O4'" . DA  J 6 35  ? 143.321 135.582 165.086 1.00 85.66  ? 33   DA  J "O4'" 1 
ATOM   9579  C  "C3'" . DA  J 6 35  ? 145.244 134.328 165.673 1.00 85.66  ? 33   DA  J "C3'" 1 
ATOM   9580  O  "O3'" . DA  J 6 35  ? 145.095 133.982 167.047 1.00 85.66  ? 33   DA  J "O3'" 1 
ATOM   9581  C  "C2'" . DA  J 6 35  ? 144.338 133.495 164.778 1.00 85.66  ? 33   DA  J "C2'" 1 
ATOM   9582  C  "C1'" . DA  J 6 35  ? 143.015 134.214 164.938 1.00 85.66  ? 33   DA  J "C1'" 1 
ATOM   9583  N  N9    . DA  J 6 35  ? 142.167 134.085 163.775 1.00 85.66  ? 33   DA  J N9    1 
ATOM   9584  C  C8    . DA  J 6 35  ? 142.568 134.071 162.476 1.00 85.66  ? 33   DA  J C8    1 
ATOM   9585  N  N7    . DA  J 6 35  ? 141.591 133.924 161.628 1.00 85.66  ? 33   DA  J N7    1 
ATOM   9586  C  C5    . DA  J 6 35  ? 140.474 133.835 162.426 1.00 85.66  ? 33   DA  J C5    1 
ATOM   9587  C  C6    . DA  J 6 35  ? 139.118 133.660 162.132 1.00 85.66  ? 33   DA  J C6    1 
ATOM   9588  N  N6    . DA  J 6 35  ? 138.651 133.551 160.889 1.00 85.66  ? 33   DA  J N6    1 
ATOM   9589  N  N1    . DA  J 6 35  ? 138.257 133.597 163.161 1.00 85.66  ? 33   DA  J N1    1 
ATOM   9590  C  C2    . DA  J 6 35  ? 138.725 133.697 164.407 1.00 85.66  ? 33   DA  J C2    1 
ATOM   9591  N  N3    . DA  J 6 35  ? 139.982 133.859 164.807 1.00 85.66  ? 33   DA  J N3    1 
ATOM   9592  C  C4    . DA  J 6 35  ? 140.812 133.919 163.755 1.00 85.66  ? 33   DA  J C4    1 
ATOM   9593  P  P     . DC  J 6 36  ? 145.734 132.618 167.614 1.00 90.17  ? 34   DC  J P     1 
ATOM   9594  O  OP1   . DC  J 6 36  ? 146.396 132.959 168.890 1.00 90.17  ? 34   DC  J OP1   1 
ATOM   9595  O  OP2   . DC  J 6 36  ? 146.533 131.953 166.563 1.00 90.17  ? 34   DC  J OP2   1 
ATOM   9596  O  "O5'" . DC  J 6 36  ? 144.467 131.710 167.945 1.00 90.17  ? 34   DC  J "O5'" 1 
ATOM   9597  C  "C5'" . DC  J 6 36  ? 143.392 132.266 168.677 1.00 90.17  ? 34   DC  J "C5'" 1 
ATOM   9598  C  "C4'" . DC  J 6 36  ? 142.233 131.293 168.777 1.00 90.17  ? 34   DC  J "C4'" 1 
ATOM   9599  O  "O4'" . DC  J 6 36  ? 141.379 131.449 167.619 1.00 90.17  ? 34   DC  J "O4'" 1 
ATOM   9600  C  "C3'" . DC  J 6 36  ? 142.613 129.810 168.831 1.00 90.17  ? 34   DC  J "C3'" 1 
ATOM   9601  O  "O3'" . DC  J 6 36  ? 141.848 129.169 169.846 1.00 90.17  ? 34   DC  J "O3'" 1 
ATOM   9602  C  "C2'" . DC  J 6 36  ? 142.231 129.314 167.438 1.00 90.17  ? 34   DC  J "C2'" 1 
ATOM   9603  C  "C1'" . DC  J 6 36  ? 141.030 130.186 167.124 1.00 90.17  ? 34   DC  J "C1'" 1 
ATOM   9604  N  N1    . DC  J 6 36  ? 140.793 130.335 165.675 1.00 90.17  ? 34   DC  J N1    1 
ATOM   9605  C  C2    . DC  J 6 36  ? 139.488 130.324 165.173 1.00 90.17  ? 34   DC  J C2    1 
ATOM   9606  O  O2    . DC  J 6 36  ? 138.534 130.201 165.956 1.00 90.17  ? 34   DC  J O2    1 
ATOM   9607  N  N3    . DC  J 6 36  ? 139.306 130.474 163.841 1.00 90.17  ? 34   DC  J N3    1 
ATOM   9608  C  C4    . DC  J 6 36  ? 140.361 130.612 163.038 1.00 90.17  ? 34   DC  J C4    1 
ATOM   9609  N  N4    . DC  J 6 36  ? 140.139 130.743 161.732 1.00 90.17  ? 34   DC  J N4    1 
ATOM   9610  C  C5    . DC  J 6 36  ? 141.690 130.614 163.532 1.00 90.17  ? 34   DC  J C5    1 
ATOM   9611  C  C6    . DC  J 6 36  ? 141.858 130.481 164.842 1.00 90.17  ? 34   DC  J C6    1 
ATOM   9612  P  P     . DT  J 6 37  ? 142.215 127.700 170.391 1.00 88.35  ? 35   DT  J P     1 
ATOM   9613  O  OP1   . DT  J 6 37  ? 142.405 127.815 171.852 1.00 88.35  ? 35   DT  J OP1   1 
ATOM   9614  O  OP2   . DT  J 6 37  ? 143.290 127.102 169.571 1.00 88.35  ? 35   DT  J OP2   1 
ATOM   9615  O  "O5'" . DT  J 6 37  ? 140.857 126.896 170.133 1.00 88.35  ? 35   DT  J "O5'" 1 
ATOM   9616  C  "C5'" . DT  J 6 37  ? 139.612 127.538 170.434 1.00 88.35  ? 35   DT  J "C5'" 1 
ATOM   9617  C  "C4'" . DT  J 6 37  ? 138.427 126.844 169.779 1.00 88.35  ? 35   DT  J "C4'" 1 
ATOM   9618  O  "O4'" . DT  J 6 37  ? 138.273 127.341 168.423 1.00 88.35  ? 35   DT  J "O4'" 1 
ATOM   9619  C  "C3'" . DT  J 6 37  ? 138.523 125.321 169.672 1.00 88.35  ? 35   DT  J "C3'" 1 
ATOM   9620  O  "O3'" . DT  J 6 37  ? 137.249 124.742 169.969 1.00 88.35  ? 35   DT  J "O3'" 1 
ATOM   9621  C  "C2'" . DT  J 6 37  ? 138.894 125.118 168.206 1.00 88.35  ? 35   DT  J "C2'" 1 
ATOM   9622  C  "C1'" . DT  J 6 37  ? 138.121 126.253 167.555 1.00 88.35  ? 35   DT  J "C1'" 1 
ATOM   9623  N  N1    . DT  J 6 37  ? 138.646 126.630 166.221 1.00 88.35  ? 35   DT  J N1    1 
ATOM   9624  C  C2    . DT  J 6 37  ? 137.766 126.934 165.215 1.00 88.35  ? 35   DT  J C2    1 
ATOM   9625  O  O2    . DT  J 6 37  ? 136.562 126.933 165.362 1.00 88.35  ? 35   DT  J O2    1 
ATOM   9626  N  N3    . DT  J 6 37  ? 138.350 127.257 164.025 1.00 88.35  ? 35   DT  J N3    1 
ATOM   9627  C  C4    . DT  J 6 37  ? 139.700 127.294 163.748 1.00 88.35  ? 35   DT  J C4    1 
ATOM   9628  O  O4    . DT  J 6 37  ? 140.133 127.591 162.651 1.00 88.35  ? 35   DT  J O4    1 
ATOM   9629  C  C5    . DT  J 6 37  ? 140.565 126.956 164.840 1.00 88.35  ? 35   DT  J C5    1 
ATOM   9630  C  C7    . DT  J 6 37  ? 142.047 126.951 164.644 1.00 88.35  ? 35   DT  J C7    1 
ATOM   9631  C  C6    . DT  J 6 37  ? 140.006 126.638 166.011 1.00 88.35  ? 35   DT  J C6    1 
ATOM   9632  P  P     . DA  J 6 38  ? 137.142 123.249 170.561 1.00 85.50  ? 36   DA  J P     1 
ATOM   9633  O  OP1   . DA  J 6 38  ? 136.734 123.398 171.972 1.00 85.50  ? 36   DA  J OP1   1 
ATOM   9634  O  OP2   . DA  J 6 38  ? 138.381 122.510 170.234 1.00 85.50  ? 36   DA  J OP2   1 
ATOM   9635  O  "O5'" . DA  J 6 38  ? 135.933 122.572 169.751 1.00 85.50  ? 36   DA  J "O5'" 1 
ATOM   9636  C  "C5'" . DA  J 6 38  ? 134.820 123.355 169.302 1.00 85.50  ? 36   DA  J "C5'" 1 
ATOM   9637  C  "C4'" . DA  J 6 38  ? 134.155 122.742 168.065 1.00 85.50  ? 36   DA  J "C4'" 1 
ATOM   9638  O  "O4'" . DA  J 6 38  ? 134.877 123.161 166.885 1.00 85.50  ? 36   DA  J "O4'" 1 
ATOM   9639  C  "C3'" . DA  J 6 38  ? 134.093 121.210 167.996 1.00 85.50  ? 36   DA  J "C3'" 1 
ATOM   9640  O  "O3'" . DA  J 6 38  ? 132.863 120.796 167.364 1.00 85.50  ? 36   DA  J "O3'" 1 
ATOM   9641  C  "C2'" . DA  J 6 38  ? 135.292 120.868 167.121 1.00 85.50  ? 36   DA  J "C2'" 1 
ATOM   9642  C  "C1'" . DA  J 6 38  ? 135.292 122.035 166.150 1.00 85.50  ? 36   DA  J "C1'" 1 
ATOM   9643  N  N9    . DA  J 6 38  ? 136.603 122.328 165.634 1.00 85.50  ? 36   DA  J N9    1 
ATOM   9644  C  C8    . DA  J 6 38  ? 137.771 122.289 166.323 1.00 85.50  ? 36   DA  J C8    1 
ATOM   9645  N  N7    . DA  J 6 38  ? 138.810 122.618 165.609 1.00 85.50  ? 36   DA  J N7    1 
ATOM   9646  C  C5    . DA  J 6 38  ? 138.277 122.894 164.370 1.00 85.50  ? 36   DA  J C5    1 
ATOM   9647  C  C6    . DA  J 6 38  ? 138.859 123.299 163.173 1.00 85.50  ? 36   DA  J C6    1 
ATOM   9648  N  N6    . DA  J 6 38  ? 140.169 123.501 163.037 1.00 85.50  ? 36   DA  J N6    1 
ATOM   9649  N  N1    . DA  J 6 38  ? 138.051 123.491 162.115 1.00 85.50  ? 36   DA  J N1    1 
ATOM   9650  C  C2    . DA  J 6 38  ? 136.743 123.287 162.259 1.00 85.50  ? 36   DA  J C2    1 
ATOM   9651  N  N3    . DA  J 6 38  ? 136.082 122.903 163.343 1.00 85.50  ? 36   DA  J N3    1 
ATOM   9652  C  C4    . DA  J 6 38  ? 136.918 122.724 164.370 1.00 85.50  ? 36   DA  J C4    1 
ATOM   9653  P  P     . DG  J 6 39  ? 132.194 119.376 167.713 1.00 81.71  ? 37   DG  J P     1 
ATOM   9654  O  OP1   . DG  J 6 39  ? 131.041 119.658 168.586 1.00 81.71  ? 37   DG  J OP1   1 
ATOM   9655  O  OP2   . DG  J 6 39  ? 133.260 118.464 168.176 1.00 81.71  ? 37   DG  J OP2   1 
ATOM   9656  O  "O5'" . DG  J 6 39  ? 131.607 118.830 166.318 1.00 81.71  ? 37   DG  J "O5'" 1 
ATOM   9657  C  "C5'" . DG  J 6 39  ? 131.377 119.714 165.225 1.00 81.71  ? 37   DG  J "C5'" 1 
ATOM   9658  C  "C4'" . DG  J 6 39  ? 131.809 119.100 163.892 1.00 81.71  ? 37   DG  J "C4'" 1 
ATOM   9659  O  "O4'" . DG  J 6 39  ? 133.200 119.426 163.612 1.00 81.71  ? 37   DG  J "O4'" 1 
ATOM   9660  C  "C3'" . DG  J 6 39  ? 131.728 117.575 163.784 1.00 81.71  ? 37   DG  J "C3'" 1 
ATOM   9661  O  "O3'" . DG  J 6 39  ? 131.348 117.228 162.469 1.00 81.71  ? 37   DG  J "O3'" 1 
ATOM   9662  C  "C2'" . DG  J 6 39  ? 133.178 117.164 164.013 1.00 81.71  ? 37   DG  J "C2'" 1 
ATOM   9663  C  "C1'" . DG  J 6 39  ? 133.865 118.248 163.223 1.00 81.71  ? 37   DG  J "C1'" 1 
ATOM   9664  N  N9    . DG  J 6 39  ? 135.274 118.391 163.516 1.00 81.71  ? 37   DG  J N9    1 
ATOM   9665  C  C8    . DG  J 6 39  ? 135.900 118.155 164.707 1.00 81.71  ? 37   DG  J C8    1 
ATOM   9666  N  N7    . DG  J 6 39  ? 137.179 118.381 164.670 1.00 81.71  ? 37   DG  J N7    1 
ATOM   9667  C  C5    . DG  J 6 39  ? 137.407 118.802 163.374 1.00 81.71  ? 37   DG  J C5    1 
ATOM   9668  C  C6    . DG  J 6 39  ? 138.604 119.190 162.746 1.00 81.71  ? 37   DG  J C6    1 
ATOM   9669  O  O6    . DG  J 6 39  ? 139.732 119.255 163.231 1.00 81.71  ? 37   DG  J O6    1 
ATOM   9670  N  N1    . DG  J 6 39  ? 138.402 119.550 161.420 1.00 81.71  ? 37   DG  J N1    1 
ATOM   9671  C  C2    . DG  J 6 39  ? 137.188 119.537 160.783 1.00 81.71  ? 37   DG  J C2    1 
ATOM   9672  N  N2    . DG  J 6 39  ? 137.185 119.913 159.498 1.00 81.71  ? 37   DG  J N2    1 
ATOM   9673  N  N3    . DG  J 6 39  ? 136.054 119.168 161.362 1.00 81.71  ? 37   DG  J N3    1 
ATOM   9674  C  C4    . DG  J 6 39  ? 136.243 118.817 162.654 1.00 81.71  ? 37   DG  J C4    1 
ATOM   9675  P  P     . DG  J 6 40  ? 129.946 116.517 162.156 1.00 77.03  ? 38   DG  J P     1 
ATOM   9676  O  OP1   . DG  J 6 40  ? 128.889 117.481 162.526 1.00 77.03  ? 38   DG  J OP1   1 
ATOM   9677  O  OP2   . DG  J 6 40  ? 129.951 115.154 162.729 1.00 77.03  ? 38   DG  J OP2   1 
ATOM   9678  O  "O5'" . DG  J 6 40  ? 129.958 1