data_6O5V
# 
_entry.id   6O5V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6O5V         
WWPDB D_1000240073 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6o5r unspecified 
PDB . 6o5s unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6O5V 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gerlits, O.'    1 ? 
'Kovalevsky, A.' 2 ? 
'Radic, Z.'      3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            294 
_citation.language                  ? 
_citation.page_first                10607 
_citation.page_last                 10618 
_citation.title                     
;Productive reorientation of a bound oxime reactivator revealed in room temperature X-ray structures of native and VX-inhibited human acetylcholinesterase.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA119.008725 
_citation.pdbx_database_id_PubMed   31138650 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gerlits, O.'      1 ?                   
primary 'Kong, X.'         2 ?                   
primary 'Cheng, X.'        3 ?                   
primary 'Wymore, T.'       4 ?                   
primary 'Blumenthal, D.K.' 5 0000-0002-8614-1167 
primary 'Taylor, P.'       6 0000-0002-3081-131X 
primary 'Radic, Z.'        7 ?                   
primary 'Kovalevsky, A.'   8 0000-0003-4459-9142 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6O5V 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     124.442 
_cell.length_a_esd                 ? 
_cell.length_b                     124.442 
_cell.length_b_esd                 ? 
_cell.length_c                     129.804 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6O5V 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                   60287.977 2   3.1.1.7 ? 
'residues 32-578' ? 
2 non-polymer syn '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' 274.298   2   ?       ? ? 
? 
3 non-polymer syn 'NITRATE ION'                                                                          62.005    2   ?       ? ? 
? 
4 non-polymer syn GLYCEROL                                                                               92.094    4   ?       ? ? 
? 
5 water       nat water                                                                                  18.015    921 ?       ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLU n 
1 5   GLY n 
1 6   ARG n 
1 7   GLU n 
1 8   ASP n 
1 9   ALA n 
1 10  GLU n 
1 11  LEU n 
1 12  LEU n 
1 13  VAL n 
1 14  THR n 
1 15  VAL n 
1 16  ARG n 
1 17  GLY n 
1 18  GLY n 
1 19  ARG n 
1 20  LEU n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  ARG n 
1 25  LEU n 
1 26  LYS n 
1 27  THR n 
1 28  PRO n 
1 29  GLY n 
1 30  GLY n 
1 31  PRO n 
1 32  VAL n 
1 33  SER n 
1 34  ALA n 
1 35  PHE n 
1 36  LEU n 
1 37  GLY n 
1 38  ILE n 
1 39  PRO n 
1 40  PHE n 
1 41  ALA n 
1 42  GLU n 
1 43  PRO n 
1 44  PRO n 
1 45  MET n 
1 46  GLY n 
1 47  PRO n 
1 48  ARG n 
1 49  ARG n 
1 50  PHE n 
1 51  LEU n 
1 52  PRO n 
1 53  PRO n 
1 54  GLU n 
1 55  PRO n 
1 56  LYS n 
1 57  GLN n 
1 58  PRO n 
1 59  TRP n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  VAL n 
1 64  ASP n 
1 65  ALA n 
1 66  THR n 
1 67  THR n 
1 68  PHE n 
1 69  GLN n 
1 70  SER n 
1 71  VAL n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  TYR n 
1 76  VAL n 
1 77  ASP n 
1 78  THR n 
1 79  LEU n 
1 80  TYR n 
1 81  PRO n 
1 82  GLY n 
1 83  PHE n 
1 84  GLU n 
1 85  GLY n 
1 86  THR n 
1 87  GLU n 
1 88  MET n 
1 89  TRP n 
1 90  ASN n 
1 91  PRO n 
1 92  ASN n 
1 93  ARG n 
1 94  GLU n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  ASP n 
1 99  CYS n 
1 100 LEU n 
1 101 TYR n 
1 102 LEU n 
1 103 ASN n 
1 104 VAL n 
1 105 TRP n 
1 106 THR n 
1 107 PRO n 
1 108 TYR n 
1 109 PRO n 
1 110 ARG n 
1 111 PRO n 
1 112 THR n 
1 113 SER n 
1 114 PRO n 
1 115 THR n 
1 116 PRO n 
1 117 VAL n 
1 118 LEU n 
1 119 VAL n 
1 120 TRP n 
1 121 ILE n 
1 122 TYR n 
1 123 GLY n 
1 124 GLY n 
1 125 GLY n 
1 126 PHE n 
1 127 TYR n 
1 128 SER n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 SER n 
1 133 LEU n 
1 134 ASP n 
1 135 VAL n 
1 136 TYR n 
1 137 ASP n 
1 138 GLY n 
1 139 ARG n 
1 140 PHE n 
1 141 LEU n 
1 142 VAL n 
1 143 GLN n 
1 144 ALA n 
1 145 GLU n 
1 146 ARG n 
1 147 THR n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 SER n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ARG n 
1 156 VAL n 
1 157 GLY n 
1 158 ALA n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 LEU n 
1 163 ALA n 
1 164 LEU n 
1 165 PRO n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 GLU n 
1 170 ALA n 
1 171 PRO n 
1 172 GLY n 
1 173 ASN n 
1 174 VAL n 
1 175 GLY n 
1 176 LEU n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 ARG n 
1 181 LEU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 TRP n 
1 186 VAL n 
1 187 GLN n 
1 188 GLU n 
1 189 ASN n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 GLY n 
1 195 GLY n 
1 196 ASP n 
1 197 PRO n 
1 198 THR n 
1 199 SER n 
1 200 VAL n 
1 201 THR n 
1 202 LEU n 
1 203 PHE n 
1 204 GLY n 
1 205 GLU n 
1 206 SER n 
1 207 ALA n 
1 208 GLY n 
1 209 ALA n 
1 210 ALA n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 MET n 
1 215 HIS n 
1 216 LEU n 
1 217 LEU n 
1 218 SER n 
1 219 PRO n 
1 220 PRO n 
1 221 SER n 
1 222 ARG n 
1 223 GLY n 
1 224 LEU n 
1 225 PHE n 
1 226 HIS n 
1 227 ARG n 
1 228 ALA n 
1 229 VAL n 
1 230 LEU n 
1 231 GLN n 
1 232 SER n 
1 233 GLY n 
1 234 ALA n 
1 235 PRO n 
1 236 ASN n 
1 237 GLY n 
1 238 PRO n 
1 239 TRP n 
1 240 ALA n 
1 241 THR n 
1 242 VAL n 
1 243 GLY n 
1 244 MET n 
1 245 GLY n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 ARG n 
1 250 ARG n 
1 251 ALA n 
1 252 THR n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 HIS n 
1 257 LEU n 
1 258 VAL n 
1 259 GLY n 
1 260 CYS n 
1 261 PRO n 
1 262 PRO n 
1 263 GLY n 
1 264 GLY n 
1 265 THR n 
1 266 GLY n 
1 267 GLY n 
1 268 ASN n 
1 269 ASP n 
1 270 THR n 
1 271 GLU n 
1 272 LEU n 
1 273 VAL n 
1 274 ALA n 
1 275 CYS n 
1 276 LEU n 
1 277 ARG n 
1 278 THR n 
1 279 ARG n 
1 280 PRO n 
1 281 ALA n 
1 282 GLN n 
1 283 VAL n 
1 284 LEU n 
1 285 VAL n 
1 286 ASN n 
1 287 HIS n 
1 288 GLU n 
1 289 TRP n 
1 290 HIS n 
1 291 VAL n 
1 292 LEU n 
1 293 PRO n 
1 294 GLN n 
1 295 GLU n 
1 296 SER n 
1 297 VAL n 
1 298 PHE n 
1 299 ARG n 
1 300 PHE n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 PRO n 
1 305 VAL n 
1 306 VAL n 
1 307 ASP n 
1 308 GLY n 
1 309 ASP n 
1 310 PHE n 
1 311 LEU n 
1 312 SER n 
1 313 ASP n 
1 314 THR n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 LEU n 
1 319 ILE n 
1 320 ASN n 
1 321 ALA n 
1 322 GLY n 
1 323 ASP n 
1 324 PHE n 
1 325 HIS n 
1 326 GLY n 
1 327 LEU n 
1 328 GLN n 
1 329 VAL n 
1 330 LEU n 
1 331 VAL n 
1 332 GLY n 
1 333 VAL n 
1 334 VAL n 
1 335 LYS n 
1 336 ASP n 
1 337 GLU n 
1 338 GLY n 
1 339 SER n 
1 340 TYR n 
1 341 PHE n 
1 342 LEU n 
1 343 VAL n 
1 344 TYR n 
1 345 GLY n 
1 346 ALA n 
1 347 PRO n 
1 348 GLY n 
1 349 PHE n 
1 350 SER n 
1 351 LYS n 
1 352 ASP n 
1 353 ASN n 
1 354 GLU n 
1 355 SER n 
1 356 LEU n 
1 357 ILE n 
1 358 SER n 
1 359 ARG n 
1 360 ALA n 
1 361 GLU n 
1 362 PHE n 
1 363 LEU n 
1 364 ALA n 
1 365 GLY n 
1 366 VAL n 
1 367 ARG n 
1 368 VAL n 
1 369 GLY n 
1 370 VAL n 
1 371 PRO n 
1 372 GLN n 
1 373 VAL n 
1 374 SER n 
1 375 ASP n 
1 376 LEU n 
1 377 ALA n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 LEU n 
1 384 HIS n 
1 385 TYR n 
1 386 THR n 
1 387 ASP n 
1 388 TRP n 
1 389 LEU n 
1 390 HIS n 
1 391 PRO n 
1 392 GLU n 
1 393 ASP n 
1 394 PRO n 
1 395 ALA n 
1 396 ARG n 
1 397 LEU n 
1 398 ARG n 
1 399 GLU n 
1 400 ALA n 
1 401 LEU n 
1 402 SER n 
1 403 ASP n 
1 404 VAL n 
1 405 VAL n 
1 406 GLY n 
1 407 ASP n 
1 408 HIS n 
1 409 ASN n 
1 410 VAL n 
1 411 VAL n 
1 412 CYS n 
1 413 PRO n 
1 414 VAL n 
1 415 ALA n 
1 416 GLN n 
1 417 LEU n 
1 418 ALA n 
1 419 GLY n 
1 420 ARG n 
1 421 LEU n 
1 422 ALA n 
1 423 ALA n 
1 424 GLN n 
1 425 GLY n 
1 426 ALA n 
1 427 ARG n 
1 428 VAL n 
1 429 TYR n 
1 430 ALA n 
1 431 TYR n 
1 432 VAL n 
1 433 PHE n 
1 434 GLU n 
1 435 HIS n 
1 436 ARG n 
1 437 ALA n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 SER n 
1 442 TRP n 
1 443 PRO n 
1 444 LEU n 
1 445 TRP n 
1 446 MET n 
1 447 GLY n 
1 448 VAL n 
1 449 PRO n 
1 450 HIS n 
1 451 GLY n 
1 452 TYR n 
1 453 GLU n 
1 454 ILE n 
1 455 GLU n 
1 456 PHE n 
1 457 ILE n 
1 458 PHE n 
1 459 GLY n 
1 460 ILE n 
1 461 PRO n 
1 462 LEU n 
1 463 ASP n 
1 464 PRO n 
1 465 SER n 
1 466 ARG n 
1 467 ASN n 
1 468 TYR n 
1 469 THR n 
1 470 ALA n 
1 471 GLU n 
1 472 GLU n 
1 473 LYS n 
1 474 ILE n 
1 475 PHE n 
1 476 ALA n 
1 477 GLN n 
1 478 ARG n 
1 479 LEU n 
1 480 MET n 
1 481 ARG n 
1 482 TYR n 
1 483 TRP n 
1 484 ALA n 
1 485 ASN n 
1 486 PHE n 
1 487 ALA n 
1 488 ARG n 
1 489 THR n 
1 490 GLY n 
1 491 ASP n 
1 492 PRO n 
1 493 ASN n 
1 494 GLU n 
1 495 PRO n 
1 496 ARG n 
1 497 ASP n 
1 498 PRO n 
1 499 LYS n 
1 500 ALA n 
1 501 PRO n 
1 502 GLN n 
1 503 TRP n 
1 504 PRO n 
1 505 PRO n 
1 506 TYR n 
1 507 THR n 
1 508 ALA n 
1 509 GLY n 
1 510 ALA n 
1 511 GLN n 
1 512 GLN n 
1 513 TYR n 
1 514 VAL n 
1 515 SER n 
1 516 LEU n 
1 517 ASP n 
1 518 LEU n 
1 519 ARG n 
1 520 PRO n 
1 521 LEU n 
1 522 GLU n 
1 523 VAL n 
1 524 ARG n 
1 525 ARG n 
1 526 GLY n 
1 527 LEU n 
1 528 ARG n 
1 529 ALA n 
1 530 GLN n 
1 531 ALA n 
1 532 CYS n 
1 533 ALA n 
1 534 PHE n 
1 535 TRP n 
1 536 ASN n 
1 537 ARG n 
1 538 PHE n 
1 539 LEU n 
1 540 PRO n 
1 541 LYS n 
1 542 LEU n 
1 543 LEU n 
1 544 SER n 
1 545 ALA n 
1 546 THR n 
1 547 ASP n 
1 548 THR n 
1 549 LEU n 
1 550 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   550 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6O5V A 4 ? 550 ? P22303 32 ? 578 ? 1 547 
2 1 6O5V B 4 ? 550 ? P22303 32 ? 578 ? 1 547 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6O5V GLY A 1 ? UNP P22303 ? ? 'expression tag' -2 1 
1 6O5V PRO A 2 ? UNP P22303 ? ? 'expression tag' -1 2 
1 6O5V LEU A 3 ? UNP P22303 ? ? 'expression tag' 0  3 
2 6O5V GLY B 1 ? UNP P22303 ? ? 'expression tag' -2 4 
2 6O5V PRO B 2 ? UNP P22303 ? ? 'expression tag' -1 5 
2 6O5V LEU B 3 ? UNP P22303 ? ? 'expression tag' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                               ? 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ? 'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                                                               
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                  ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                ? 'C6 H13 N O2' 
131.173 
LND non-polymer         . '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' ? 
'C13 H16 N5 O2 1' 274.298 
LYS 'L-peptide linking' y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ? 'C5 H11 N O2 S' 
149.211 
NO3 non-polymer         . 'NITRATE ION'                                                                          ? 'N O3 -1' 
62.005  
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                 ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                              ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ? 'C5 H11 N O2' 
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6O5V 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         74.89 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10 mM sodium citrate, 100 mM HEPES, pH 7, and 6-8 % PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-17 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6O5V 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.15 
_reflns.d_resolution_low                 40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       107187 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.4 
_reflns.pdbx_Rmerge_I_obs                0.029 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.15 
_reflns_shell.d_res_low                   2.23 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           11506 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.460 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6O5V 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.152 
_refine.ls_d_res_low                             27.639 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     107187 
_refine.ls_number_reflns_R_free                  5358 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.95 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1946 
_refine.ls_R_factor_R_free                       0.2276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1928 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.98 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.80 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.27 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.152 
_refine_hist.d_res_low                        27.639 
_refine_hist.number_atoms_solvent             921 
_refine_hist.number_atoms_total               9369 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        8376 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 8782  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.956  ? 12001 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.541 ? 5153  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.054  ? 1261  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1593  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1522 2.1766  . . 85  1733 45.00 . . . 0.3028 . 0.2740 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1766 2.2022  . . 110 2141 56.00 . . . 0.2763 . 0.2822 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2022 2.2291  . . 152 2499 65.00 . . . 0.3210 . 0.2824 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2291 2.2573  . . 164 2858 75.00 . . . 0.3131 . 0.2735 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2573 2.2869  . . 165 3142 81.00 . . . 0.2999 . 0.2728 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2869 2.3183  . . 186 3316 87.00 . . . 0.2716 . 0.2707 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3183 2.3514  . . 206 3482 91.00 . . . 0.3133 . 0.2703 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3514 2.3864  . . 188 3607 93.00 . . . 0.2900 . 0.2680 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3864 2.4237  . . 174 3726 95.00 . . . 0.2985 . 0.2640 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4237 2.4634  . . 205 3640 95.00 . . . 0.2935 . 0.2410 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4634 2.5059  . . 183 3714 96.00 . . . 0.2581 . 0.2390 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5059 2.5514  . . 200 3692 96.00 . . . 0.2719 . 0.2287 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5514 2.6004  . . 195 3773 97.00 . . . 0.2584 . 0.2322 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6004 2.6535  . . 190 3687 96.00 . . . 0.2765 . 0.2377 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6535 2.7111  . . 206 3709 97.00 . . . 0.2963 . 0.2276 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7111 2.7741  . . 201 3756 97.00 . . . 0.2713 . 0.2247 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7741 2.8435  . . 172 3714 96.00 . . . 0.2655 . 0.2116 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8435 2.9202  . . 204 3694 96.00 . . . 0.2354 . 0.1973 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9202 3.0061  . . 175 3723 96.00 . . . 0.2223 . 0.2011 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0061 3.1030  . . 203 3765 96.00 . . . 0.2565 . 0.1938 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1030 3.2137  . . 205 3640 95.00 . . . 0.2449 . 0.1938 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2137 3.3422  . . 185 3661 94.00 . . . 0.2197 . 0.1929 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3422 3.4940  . . 210 3628 95.00 . . . 0.2337 . 0.1829 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4940 3.6778  . . 185 3585 93.00 . . . 0.2089 . 0.1733 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6778 3.9077  . . 185 3565 92.00 . . . 0.1880 . 0.1557 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9077 4.2084  . . 185 3535 91.00 . . . 0.1791 . 0.1462 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2084 4.6302  . . 175 3427 89.00 . . . 0.1438 . 0.1352 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6302 5.2961  . . 167 3331 86.00 . . . 0.1694 . 0.1393 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2961 6.6570  . . 174 3247 84.00 . . . 0.1960 . 0.1597 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.6570 27.6412 . . 123 2839 73.00 . . . 0.1586 . 0.1556 . . . . . . . . . . 
# 
_struct.entry_id                     6O5V 
_struct.title                        'Binary complex of native hAChE with oxime reactivator RS-170B' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6O5V 
_struct_keywords.text            'oxime reactivator, imidazole-based oxime, RS-170B, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 2 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 8   ? GLU A 10  ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 45  ? ARG A 49  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 83  ? MET A 88  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 133 ? ASP A 137 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 138 ? ARG A 146 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 156 ? LEU A 162 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 173 ? VAL A 190 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 191 ? PHE A 193 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 206 ? LEU A 217 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 218 ? GLY A 223 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 244 ? VAL A 258 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASN A 268 ? THR A 278 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 280 ? ASN A 286 ? PRO A 277 ASN A 283 1 ? 7  
HELX_P HELX_P14 AB5 HIS A 287 ? LEU A 292 ? HIS A 284 LEU A 289 5 ? 6  
HELX_P HELX_P15 AB6 THR A 314 ? GLY A 322 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 338 ? VAL A 343 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 358 ? VAL A 370 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 374 ? THR A 386 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 393 ? VAL A 410 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 410 ? GLN A 424 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 443 ? GLY A 447 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 453 ? PHE A 458 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 459 ? ASP A 463 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 469 ? GLY A 490 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 528 ? ARG A 537 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 537 ? ALA A 545 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 8   ? GLU B 10  ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 45  ? ARG B 49  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 83  ? MET B 88  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 133 ? ASP B 137 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 138 ? ARG B 146 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 156 ? LEU B 162 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 173 ? VAL B 190 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 191 ? PHE B 193 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 206 ? LEU B 217 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 218 ? GLY B 223 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 244 ? VAL B 258 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASN B 268 ? THR B 278 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 280 ? ASN B 286 ? PRO B 277 ASN B 283 1 ? 7  
HELX_P HELX_P40 AE4 HIS B 287 ? LEU B 292 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 AE5 THR B 314 ? GLY B 322 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 338 ? VAL B 343 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 358 ? VAL B 370 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 374 ? THR B 386 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 393 ? VAL B 410 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 410 ? GLN B 424 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 443 ? GLY B 447 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 453 ? PHE B 458 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 459 ? ASP B 463 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 469 ? GLY B 490 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 528 ? ARG B 537 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 537 ? ALA B 545 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 72  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf2 disulf ? ? A CYS 260 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.086 ? 
disulf3 disulf ? ? A CYS 412 SG ? ? ? 1_555 A CYS 532 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf4 disulf ? ? B CYS 72  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf5 disulf ? ? B CYS 260 SG ? ? ? 1_555 B CYS 275 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf6 disulf ? ? B CYS 412 SG ? ? ? 1_555 B CYS 532 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.056 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 108 A . ? TYR 105 A PRO 109 A ? PRO 106 A 1 -5.44 
2 CYS 260 A . ? CYS 257 A PRO 261 A ? PRO 258 A 1 0.21  
3 GLY 263 A . ? GLY 260 A GLY 264 A ? GLY 261 A 1 -5.70 
4 TYR 108 B . ? TYR 105 B PRO 109 B ? PRO 106 B 1 -3.37 
5 CYS 260 B . ? CYS 257 B PRO 261 B ? PRO 258 B 1 -2.73 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
AA7 ? 2  ? 
AA8 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
AA8 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 12  ? VAL A 15  ? LEU A 9   VAL A 12  
AA1 2  GLY A 18  ? ARG A 21  ? GLY A 15  ARG A 18  
AA1 3  VAL A 62  ? ASP A 64  ? VAL A 59  ASP A 61  
AA2 1  ILE A 23  ? LEU A 25  ? ILE A 20  LEU A 22  
AA2 2  VAL A 32  ? PRO A 39  ? VAL A 29  PRO A 36  
AA2 3  TYR A 101 ? PRO A 107 ? TYR A 98  PRO A 104 
AA2 4  VAL A 148 ? MET A 152 ? VAL A 145 MET A 149 
AA2 5  THR A 115 ? ILE A 121 ? THR A 112 ILE A 118 
AA2 6  GLY A 195 ? GLU A 205 ? GLY A 192 GLU A 202 
AA2 7  ARG A 227 ? GLN A 231 ? ARG A 224 GLN A 228 
AA2 8  GLN A 328 ? VAL A 334 ? GLN A 325 VAL A 331 
AA2 9  ARG A 427 ? PHE A 433 ? ARG A 424 PHE A 430 
AA2 10 GLN A 512 ? LEU A 516 ? GLN A 509 LEU A 513 
AA2 11 GLU A 522 ? ARG A 525 ? GLU A 519 ARG A 522 
AA3 1  VAL A 71  ? CYS A 72  ? VAL A 68  CYS A 69  
AA3 2  LEU A 95  ? SER A 96  ? LEU A 92  SER A 93  
AA4 1  VAL A 242 ? GLY A 243 ? VAL A 239 GLY A 240 
AA4 2  VAL A 305 ? VAL A 306 ? VAL A 302 VAL A 303 
AA5 1  LEU B 12  ? VAL B 15  ? LEU B 9   VAL B 12  
AA5 2  GLY B 18  ? ARG B 21  ? GLY B 15  ARG B 18  
AA5 3  VAL B 62  ? ASP B 64  ? VAL B 59  ASP B 61  
AA6 1  ILE B 23  ? LEU B 25  ? ILE B 20  LEU B 22  
AA6 2  VAL B 32  ? PRO B 39  ? VAL B 29  PRO B 36  
AA6 3  TYR B 101 ? PRO B 107 ? TYR B 98  PRO B 104 
AA6 4  VAL B 148 ? MET B 152 ? VAL B 145 MET B 149 
AA6 5  THR B 115 ? ILE B 121 ? THR B 112 ILE B 118 
AA6 6  GLY B 195 ? GLU B 205 ? GLY B 192 GLU B 202 
AA6 7  ARG B 227 ? GLN B 231 ? ARG B 224 GLN B 228 
AA6 8  GLN B 328 ? VAL B 334 ? GLN B 325 VAL B 331 
AA6 9  ARG B 427 ? PHE B 433 ? ARG B 424 PHE B 430 
AA6 10 GLN B 512 ? LEU B 516 ? GLN B 509 LEU B 513 
AA6 11 GLU B 522 ? ARG B 525 ? GLU B 519 ARG B 522 
AA7 1  VAL B 71  ? CYS B 72  ? VAL B 68  CYS B 69  
AA7 2  LEU B 95  ? SER B 96  ? LEU B 92  SER B 93  
AA8 1  VAL B 242 ? GLY B 243 ? VAL B 239 GLY B 240 
AA8 2  VAL B 305 ? VAL B 306 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 13  ? N VAL A 10  O LEU A 20  ? O LEU A 17  
AA1 2  3  N ARG A 19  ? N ARG A 16  O VAL A 63  ? O VAL A 60  
AA2 1  2  N ILE A 23  ? N ILE A 20  O ALA A 34  ? O ALA A 31  
AA2 2  3  N SER A 33  ? N SER A 30  O THR A 106 ? O THR A 103 
AA2 3  4  N TRP A 105 ? N TRP A 102 O LEU A 149 ? O LEU A 146 
AA2 4  5  O VAL A 148 ? O VAL A 145 N LEU A 118 ? N LEU A 115 
AA2 5  6  N THR A 115 ? N THR A 112 O ASP A 196 ? O ASP A 193 
AA2 6  7  N GLY A 204 ? N GLY A 201 O GLN A 231 ? O GLN A 228 
AA2 7  8  N LEU A 230 ? N LEU A 227 O LEU A 330 ? O LEU A 327 
AA2 8  9  N VAL A 333 ? N VAL A 330 O PHE A 433 ? O PHE A 430 
AA2 9  10 N VAL A 432 ? N VAL A 429 O LEU A 516 ? O LEU A 513 
AA2 10 11 N TYR A 513 ? N TYR A 510 O ARG A 524 ? O ARG A 521 
AA3 1  2  N VAL A 71  ? N VAL A 68  O SER A 96  ? O SER A 93  
AA4 1  2  N VAL A 242 ? N VAL A 239 O VAL A 306 ? O VAL A 303 
AA5 1  2  N VAL B 15  ? N VAL B 12  O GLY B 18  ? O GLY B 15  
AA5 2  3  N ARG B 19  ? N ARG B 16  O VAL B 63  ? O VAL B 60  
AA6 1  2  N LEU B 25  ? N LEU B 22  O VAL B 32  ? O VAL B 29  
AA6 2  3  N PHE B 35  ? N PHE B 32  O VAL B 104 ? O VAL B 101 
AA6 3  4  N ASN B 103 ? N ASN B 100 O SER B 151 ? O SER B 148 
AA6 4  5  O VAL B 148 ? O VAL B 145 N LEU B 118 ? N LEU B 115 
AA6 5  6  N THR B 115 ? N THR B 112 O ASP B 196 ? O ASP B 193 
AA6 6  7  N GLY B 204 ? N GLY B 201 O GLN B 231 ? O GLN B 228 
AA6 7  8  N LEU B 230 ? N LEU B 227 O LEU B 330 ? O LEU B 327 
AA6 8  9  N VAL B 333 ? N VAL B 330 O PHE B 433 ? O PHE B 430 
AA6 9  10 N VAL B 432 ? N VAL B 429 O LEU B 516 ? O LEU B 513 
AA6 10 11 N TYR B 513 ? N TYR B 510 O ARG B 524 ? O ARG B 521 
AA7 1  2  N VAL B 71  ? N VAL B 68  O SER B 96  ? O SER B 93  
AA8 1  2  N VAL B 242 ? N VAL B 239 O VAL B 306 ? O VAL B 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A LND 601 ? 11 'binding site for residue LND A 601' 
AC2 Software A NO3 602 ? 3  'binding site for residue NO3 A 602' 
AC3 Software A NO3 603 ? 4  'binding site for residue NO3 A 603' 
AC4 Software A GOL 604 ? 4  'binding site for residue GOL A 604' 
AC5 Software A GOL 605 ? 8  'binding site for residue GOL A 605' 
AC6 Software B LND 601 ? 11 'binding site for residue LND B 601' 
AC7 Software B GOL 602 ? 5  'binding site for residue GOL B 602' 
AC8 Software B GOL 603 ? 8  'binding site for residue GOL B 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 TYR A 75  ? TYR A 72   . ? 1_555 ? 
2  AC1 11 TYR A 127 ? TYR A 124  . ? 1_555 ? 
3  AC1 11 TRP A 289 ? TRP A 286  . ? 1_555 ? 
4  AC1 11 VAL A 297 ? VAL A 294  . ? 1_555 ? 
5  AC1 11 PHE A 298 ? PHE A 295  . ? 1_555 ? 
6  AC1 11 PHE A 300 ? PHE A 297  . ? 1_555 ? 
7  AC1 11 PHE A 341 ? PHE A 338  . ? 1_555 ? 
8  AC1 11 TYR A 344 ? TYR A 341  . ? 1_555 ? 
9  AC1 11 GOL F .   ? GOL A 604  . ? 1_555 ? 
10 AC1 11 HOH K .   ? HOH A 718  . ? 1_555 ? 
11 AC1 11 HOH K .   ? HOH A 741  . ? 1_555 ? 
12 AC2 3  ASP A 336 ? ASP A 333  . ? 1_555 ? 
13 AC2 3  TRP A 445 ? TRP A 442  . ? 1_555 ? 
14 AC2 3  HOH K .   ? HOH A 784  . ? 1_555 ? 
15 AC3 4  GLY A 46  ? GLY A 43   . ? 1_555 ? 
16 AC3 4  PRO A 47  ? PRO A 44   . ? 1_555 ? 
17 AC3 4  ARG A 277 ? ARG A 274  . ? 1_555 ? 
18 AC3 4  HOH K .   ? HOH A 887  . ? 1_555 ? 
19 AC4 4  GLU A 205 ? GLU A 202  . ? 1_555 ? 
20 AC4 4  LND C .   ? LND A 601  . ? 1_555 ? 
21 AC4 4  HOH K .   ? HOH A 718  . ? 1_555 ? 
22 AC4 4  HOH K .   ? HOH A 803  . ? 1_555 ? 
23 AC5 8  GLU A 84  ? GLU A 81   . ? 1_555 ? 
24 AC5 8  MET A 88  ? MET A 85   . ? 1_555 ? 
25 AC5 8  THR A 439 ? THR A 436  . ? 1_555 ? 
26 AC5 8  LEU A 440 ? LEU A 437  . ? 1_555 ? 
27 AC5 8  SER A 441 ? SER A 438  . ? 1_555 ? 
28 AC5 8  TYR A 452 ? TYR A 449  . ? 1_555 ? 
29 AC5 8  GLU A 455 ? GLU A 452  . ? 1_555 ? 
30 AC5 8  HOH K .   ? HOH A 1011 . ? 1_555 ? 
31 AC6 11 TYR B 75  ? TYR B 72   . ? 1_555 ? 
32 AC6 11 TYR B 127 ? TYR B 124  . ? 1_555 ? 
33 AC6 11 TRP B 289 ? TRP B 286  . ? 1_555 ? 
34 AC6 11 VAL B 297 ? VAL B 294  . ? 1_555 ? 
35 AC6 11 PHE B 298 ? PHE B 295  . ? 1_555 ? 
36 AC6 11 PHE B 300 ? PHE B 297  . ? 1_555 ? 
37 AC6 11 TYR B 340 ? TYR B 337  . ? 1_555 ? 
38 AC6 11 PHE B 341 ? PHE B 338  . ? 1_555 ? 
39 AC6 11 TYR B 344 ? TYR B 341  . ? 1_555 ? 
40 AC6 11 GOL I .   ? GOL B 602  . ? 1_555 ? 
41 AC6 11 HOH L .   ? HOH B 710  . ? 1_555 ? 
42 AC7 5  GLU B 205 ? GLU B 202  . ? 1_555 ? 
43 AC7 5  TYR B 340 ? TYR B 337  . ? 1_555 ? 
44 AC7 5  LND H .   ? LND B 601  . ? 1_555 ? 
45 AC7 5  HOH L .   ? HOH B 744  . ? 1_555 ? 
46 AC7 5  HOH L .   ? HOH B 893  . ? 1_555 ? 
47 AC8 8  GLU B 84  ? GLU B 81   . ? 1_555 ? 
48 AC8 8  MET B 88  ? MET B 85   . ? 1_555 ? 
49 AC8 8  ALA B 437 ? ALA B 434  . ? 1_555 ? 
50 AC8 8  THR B 439 ? THR B 436  . ? 1_555 ? 
51 AC8 8  LEU B 440 ? LEU B 437  . ? 1_555 ? 
52 AC8 8  SER B 441 ? SER B 438  . ? 1_555 ? 
53 AC8 8  TYR B 452 ? TYR B 449  . ? 1_555 ? 
54 AC8 8  GLU B 455 ? GLU B 452  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6O5V 
_atom_sites.fract_transf_matrix[1][1]   0.008036 
_atom_sites.fract_transf_matrix[1][2]   0.004640 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009279 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007704 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 7   ? 127.102 77.806 22.946  1.00 84.42  ? 4    GLU A N   1 
ATOM   2    C CA  . GLU A 1 7   ? 125.810 77.158 23.162  1.00 85.92  ? 4    GLU A CA  1 
ATOM   3    C C   . GLU A 1 7   ? 125.061 77.809 24.322  1.00 84.82  ? 4    GLU A C   1 
ATOM   4    O O   . GLU A 1 7   ? 125.678 78.259 25.299  1.00 79.93  ? 4    GLU A O   1 
ATOM   5    C CB  . GLU A 1 7   ? 125.989 75.659 23.440  1.00 75.20  ? 4    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 7   ? 126.428 74.823 22.236  1.00 75.31  ? 4    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 7   ? 127.028 73.477 22.647  1.00 79.63  ? 4    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 7   ? 128.167 73.162 22.216  1.00 68.88  ? 4    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 7   ? 126.366 72.741 23.417  1.00 76.96  ? 4    GLU A OE2 1 
ATOM   10   N N   . ASP A 1 8   ? 123.733 77.865 24.218  1.00 80.45  ? 5    ASP A N   1 
ATOM   11   C CA  . ASP A 1 8   ? 122.928 78.240 25.369  1.00 69.84  ? 5    ASP A CA  1 
ATOM   12   C C   . ASP A 1 8   ? 122.844 77.071 26.335  1.00 62.36  ? 5    ASP A C   1 
ATOM   13   O O   . ASP A 1 8   ? 122.643 75.920 25.927  1.00 52.93  ? 5    ASP A O   1 
ATOM   14   C CB  . ASP A 1 8   ? 121.523 78.675 24.969  1.00 63.97  ? 5    ASP A CB  1 
ATOM   15   C CG  . ASP A 1 8   ? 120.668 79.004 26.181  1.00 66.28  ? 5    ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 8   ? 120.721 80.167 26.653  1.00 65.81  ? 5    ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 8   ? 119.965 78.090 26.679  1.00 62.94  ? 5    ASP A OD2 1 
ATOM   18   N N   . ALA A 1 9   ? 122.996 77.387 27.625  1.00 60.87  ? 6    ALA A N   1 
ATOM   19   C CA  . ALA A 1 9   ? 123.117 76.357 28.651  1.00 64.24  ? 6    ALA A CA  1 
ATOM   20   C C   . ALA A 1 9   ? 121.850 75.522 28.754  1.00 58.92  ? 6    ALA A C   1 
ATOM   21   O O   . ALA A 1 9   ? 121.908 74.310 29.015  1.00 55.11  ? 6    ALA A O   1 
ATOM   22   C CB  . ALA A 1 9   ? 123.433 77.007 30.000  1.00 58.43  ? 6    ALA A CB  1 
ATOM   23   N N   . GLU A 1 10  ? 120.693 76.152 28.566  1.00 48.69  ? 7    GLU A N   1 
ATOM   24   C CA  . GLU A 1 10  ? 119.442 75.473 28.846  1.00 51.81  ? 7    GLU A CA  1 
ATOM   25   C C   . GLU A 1 10  ? 118.981 74.576 27.709  1.00 46.97  ? 7    GLU A C   1 
ATOM   26   O O   . GLU A 1 10  ? 117.986 73.865 27.880  1.00 37.21  ? 7    GLU A O   1 
ATOM   27   C CB  . GLU A 1 10  ? 118.367 76.492 29.225  1.00 53.45  ? 7    GLU A CB  1 
ATOM   28   C CG  . GLU A 1 10  ? 118.637 77.063 30.607  1.00 57.90  ? 7    GLU A CG  1 
ATOM   29   C CD  . GLU A 1 10  ? 117.584 78.054 31.054  1.00 55.23  ? 7    GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 10  ? 117.767 78.677 32.121  1.00 55.56  ? 7    GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 10  ? 116.581 78.223 30.334  1.00 50.48  ? 7    GLU A OE2 1 
ATOM   32   N N   . LEU A 1 11  ? 119.694 74.556 26.582  1.00 42.85  ? 8    LEU A N   1 
ATOM   33   C CA  . LEU A 1 11  ? 119.471 73.525 25.582  1.00 39.26  ? 8    LEU A CA  1 
ATOM   34   C C   . LEU A 1 11  ? 120.180 72.220 25.915  1.00 37.46  ? 8    LEU A C   1 
ATOM   35   O O   . LEU A 1 11  ? 120.077 71.264 25.141  1.00 35.62  ? 8    LEU A O   1 
ATOM   36   C CB  . LEU A 1 11  ? 119.908 74.013 24.205  1.00 36.70  ? 8    LEU A CB  1 
ATOM   37   C CG  . LEU A 1 11  ? 119.112 75.208 23.680  1.00 44.87  ? 8    LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 11  ? 119.502 75.499 22.237  1.00 33.01  ? 8    LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 11  ? 117.589 74.981 23.816  1.00 36.30  ? 8    LEU A CD2 1 
ATOM   40   N N   . LEU A 1 12  ? 120.877 72.146 27.046  1.00 39.70  ? 9    LEU A N   1 
ATOM   41   C CA  . LEU A 1 12  ? 121.547 70.926 27.481  1.00 37.79  ? 9    LEU A CA  1 
ATOM   42   C C   . LEU A 1 12  ? 120.902 70.444 28.767  1.00 35.33  ? 9    LEU A C   1 
ATOM   43   O O   . LEU A 1 12  ? 120.756 71.215 29.719  1.00 41.99  ? 9    LEU A O   1 
ATOM   44   C CB  . LEU A 1 12  ? 123.039 71.160 27.706  1.00 38.90  ? 9    LEU A CB  1 
ATOM   45   C CG  . LEU A 1 12  ? 123.852 71.607 26.503  1.00 43.09  ? 9    LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 12  ? 125.249 72.032 26.958  1.00 39.39  ? 9    LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 12  ? 123.924 70.471 25.487  1.00 38.55  ? 9    LEU A CD2 1 
ATOM   48   N N   . VAL A 1 13  ? 120.516 69.175 28.796  1.00 36.51  ? 10   VAL A N   1 
ATOM   49   C CA  . VAL A 1 13  ? 119.765 68.631 29.919  1.00 34.11  ? 10   VAL A CA  1 
ATOM   50   C C   . VAL A 1 13  ? 120.178 67.183 30.099  1.00 30.91  ? 10   VAL A C   1 
ATOM   51   O O   . VAL A 1 13  ? 120.426 66.469 29.124  1.00 35.14  ? 10   VAL A O   1 
ATOM   52   C CB  . VAL A 1 13  ? 118.235 68.760 29.688  1.00 37.15  ? 10   VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 13  ? 117.459 67.854 30.612  1.00 30.59  ? 10   VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 13  ? 117.783 70.211 29.872  1.00 34.67  ? 10   VAL A CG2 1 
ATOM   55   N N   . THR A 1 14  ? 120.228 66.741 31.345  1.00 29.71  ? 11   THR A N   1 
ATOM   56   C CA  . THR A 1 14  ? 120.494 65.349 31.658  1.00 28.73  ? 11   THR A CA  1 
ATOM   57   C C   . THR A 1 14  ? 119.240 64.710 32.244  1.00 31.61  ? 11   THR A C   1 
ATOM   58   O O   . THR A 1 14  ? 118.544 65.321 33.060  1.00 32.48  ? 11   THR A O   1 
ATOM   59   C CB  . THR A 1 14  ? 121.674 65.245 32.636  1.00 35.48  ? 11   THR A CB  1 
ATOM   60   O OG1 . THR A 1 14  ? 122.786 65.993 32.108  1.00 35.15  ? 11   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 14  ? 122.081 63.797 32.847  1.00 25.09  ? 11   THR A CG2 1 
ATOM   62   N N   . VAL A 1 15  ? 118.941 63.497 31.788  1.00 26.64  ? 12   VAL A N   1 
ATOM   63   C CA  . VAL A 1 15  ? 117.846 62.681 32.284  1.00 31.99  ? 12   VAL A CA  1 
ATOM   64   C C   . VAL A 1 15  ? 118.445 61.347 32.701  1.00 30.81  ? 12   VAL A C   1 
ATOM   65   O O   . VAL A 1 15  ? 119.634 61.110 32.511  1.00 39.23  ? 12   VAL A O   1 
ATOM   66   C CB  . VAL A 1 15  ? 116.707 62.495 31.241  1.00 31.19  ? 12   VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 15  ? 115.971 63.800 30.975  1.00 27.07  ? 12   VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 15  ? 117.235 61.919 29.917  1.00 25.43  ? 12   VAL A CG2 1 
ATOM   69   N N   . ARG A 1 16  ? 117.608 60.467 33.252  1.00 33.16  ? 13   ARG A N   1 
ATOM   70   C CA  . ARG A 1 16  ? 118.131 59.257 33.879  1.00 36.79  ? 13   ARG A CA  1 
ATOM   71   C C   . ARG A 1 16  ? 118.968 58.419 32.930  1.00 37.38  ? 13   ARG A C   1 
ATOM   72   O O   . ARG A 1 16  ? 119.934 57.779 33.365  1.00 42.45  ? 13   ARG A O   1 
ATOM   73   C CB  . ARG A 1 16  ? 116.999 58.414 34.450  1.00 36.37  ? 13   ARG A CB  1 
ATOM   74   C CG  . ARG A 1 16  ? 116.335 59.084 35.627  1.00 46.38  ? 13   ARG A CG  1 
ATOM   75   C CD  . ARG A 1 16  ? 115.737 58.076 36.585  1.00 51.19  ? 13   ARG A CD  1 
ATOM   76   N NE  . ARG A 1 16  ? 114.951 58.767 37.604  1.00 59.07  ? 13   ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 16  ? 114.200 58.155 38.512  1.00 54.35  ? 13   ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 16  ? 114.142 56.823 38.537  1.00 45.90  ? 13   ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 16  ? 113.514 58.880 39.391  1.00 47.96  ? 13   ARG A NH2 1 
ATOM   80   N N   . GLY A 1 17  ? 118.625 58.403 31.646  1.00 36.59  ? 14   GLY A N   1 
ATOM   81   C CA  . GLY A 1 17  ? 119.337 57.566 30.701  1.00 30.37  ? 14   GLY A CA  1 
ATOM   82   C C   . GLY A 1 17  ? 120.579 58.184 30.081  1.00 29.52  ? 14   GLY A C   1 
ATOM   83   O O   . GLY A 1 17  ? 121.371 57.472 29.459  1.00 32.83  ? 14   GLY A O   1 
ATOM   84   N N   . GLY A 1 18  ? 120.771 59.489 30.193  1.00 28.13  ? 15   GLY A N   1 
ATOM   85   C CA  . GLY A 1 18  ? 121.883 60.111 29.502  1.00 23.54  ? 15   GLY A CA  1 
ATOM   86   C C   . GLY A 1 18  ? 121.604 61.578 29.265  1.00 30.76  ? 15   GLY A C   1 
ATOM   87   O O   . GLY A 1 18  ? 120.634 62.127 29.781  1.00 28.97  ? 15   GLY A O   1 
ATOM   88   N N   . ARG A 1 19  ? 122.461 62.191 28.439  1.00 28.67  ? 16   ARG A N   1 
ATOM   89   C CA  . ARG A 1 19  ? 122.375 63.617 28.152  1.00 27.46  ? 16   ARG A CA  1 
ATOM   90   C C   . ARG A 1 19  ? 121.745 63.911 26.788  1.00 29.91  ? 16   ARG A C   1 
ATOM   91   O O   . ARG A 1 19  ? 121.834 63.122 25.839  1.00 25.32  ? 16   ARG A O   1 
ATOM   92   C CB  . ARG A 1 19  ? 123.761 64.264 28.210  1.00 36.81  ? 16   ARG A CB  1 
ATOM   93   C CG  . ARG A 1 19  ? 124.475 64.123 29.550  1.00 47.29  ? 16   ARG A CG  1 
ATOM   94   C CD  . ARG A 1 19  ? 125.943 64.546 29.442  1.00 46.76  ? 16   ARG A CD  1 
ATOM   95   N NE  . ARG A 1 19  ? 126.801 63.447 28.996  1.00 51.49  ? 16   ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 19  ? 127.834 63.590 28.168  1.00 49.92  ? 16   ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 19  ? 128.148 64.791 27.675  1.00 40.62  ? 16   ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 19  ? 128.552 62.521 27.803  1.00 47.62  ? 16   ARG A NH2 1 
ATOM   99   N N   . LEU A 1 20  ? 121.155 65.096 26.700  1.00 26.67  ? 17   LEU A N   1 
ATOM   100  C CA  . LEU A 1 20  ? 120.359 65.531 25.567  1.00 36.25  ? 17   LEU A CA  1 
ATOM   101  C C   . LEU A 1 20  ? 120.791 66.923 25.152  1.00 27.81  ? 17   LEU A C   1 
ATOM   102  O O   . LEU A 1 20  ? 121.164 67.741 25.995  1.00 36.37  ? 17   LEU A O   1 
ATOM   103  C CB  . LEU A 1 20  ? 118.849 65.586 25.921  1.00 24.21  ? 17   LEU A CB  1 
ATOM   104  C CG  . LEU A 1 20  ? 118.216 64.293 26.404  1.00 30.32  ? 17   LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 20  ? 116.855 64.643 27.040  1.00 24.61  ? 17   LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 20  ? 118.082 63.292 25.257  1.00 24.81  ? 17   LEU A CD2 1 
ATOM   107  N N   . ARG A 1 21  ? 120.694 67.203 23.853  1.00 25.63  ? 18   ARG A N   1 
ATOM   108  C CA  . ARG A 1 21  ? 120.770 68.567 23.338  1.00 30.50  ? 18   ARG A CA  1 
ATOM   109  C C   . ARG A 1 21  ? 119.447 68.907 22.656  1.00 29.59  ? 18   ARG A C   1 
ATOM   110  O O   . ARG A 1 21  ? 119.040 68.232 21.701  1.00 25.92  ? 18   ARG A O   1 
ATOM   111  C CB  . ARG A 1 21  ? 121.936 68.762 22.352  1.00 22.37  ? 18   ARG A CB  1 
ATOM   112  C CG  . ARG A 1 21  ? 121.890 70.141 21.686  1.00 31.60  ? 18   ARG A CG  1 
ATOM   113  C CD  . ARG A 1 21  ? 123.045 70.409 20.730  1.00 39.87  ? 18   ARG A CD  1 
ATOM   114  N NE  . ARG A 1 21  ? 124.270 70.780 21.444  1.00 46.59  ? 18   ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 21  ? 125.250 69.929 21.731  1.00 48.47  ? 18   ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 21  ? 125.161 68.656 21.355  1.00 49.79  ? 18   ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 21  ? 126.325 70.346 22.388  1.00 53.29  ? 18   ARG A NH2 1 
ATOM   118  N N   . GLY A 1 22  ? 118.807 69.971 23.118  1.00 29.32  ? 19   GLY A N   1 
ATOM   119  C CA  . GLY A 1 22  ? 117.564 70.436 22.566  1.00 29.70  ? 19   GLY A CA  1 
ATOM   120  C C   . GLY A 1 22  ? 117.766 71.558 21.577  1.00 30.36  ? 19   GLY A C   1 
ATOM   121  O O   . GLY A 1 22  ? 118.877 71.805 21.091  1.00 34.30  ? 19   GLY A O   1 
ATOM   122  N N   . ILE A 1 23  ? 116.680 72.256 21.264  1.00 24.62  ? 20   ILE A N   1 
ATOM   123  C CA  . ILE A 1 23  ? 116.736 73.364 20.317  1.00 26.59  ? 20   ILE A CA  1 
ATOM   124  C C   . ILE A 1 23  ? 115.791 74.494 20.711  1.00 29.06  ? 20   ILE A C   1 
ATOM   125  O O   . ILE A 1 23  ? 114.758 74.264 21.339  1.00 29.72  ? 20   ILE A O   1 
ATOM   126  C CB  . ILE A 1 23  ? 116.398 72.902 18.888  1.00 32.49  ? 20   ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 23  ? 117.099 73.790 17.859  1.00 28.09  ? 20   ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 23  ? 114.893 72.910 18.668  1.00 24.24  ? 20   ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 23  ? 116.558 73.642 16.454  1.00 31.17  ? 20   ILE A CD1 1 
ATOM   130  N N   . ARG A 1 24  ? 116.154 75.717 20.335  1.00 30.62  ? 21   ARG A N   1 
ATOM   131  C CA  . ARG A 1 24  ? 115.341 76.887 20.642  1.00 35.09  ? 21   ARG A CA  1 
ATOM   132  C C   . ARG A 1 24  ? 114.344 77.162 19.521  1.00 38.06  ? 21   ARG A C   1 
ATOM   133  O O   . ARG A 1 24  ? 114.724 77.291 18.357  1.00 36.26  ? 21   ARG A O   1 
ATOM   134  C CB  . ARG A 1 24  ? 116.229 78.112 20.869  1.00 37.20  ? 21   ARG A CB  1 
ATOM   135  C CG  . ARG A 1 24  ? 115.479 79.337 21.367  1.00 41.97  ? 21   ARG A CG  1 
ATOM   136  C CD  . ARG A 1 24  ? 114.954 79.128 22.778  1.00 56.22  ? 21   ARG A CD  1 
ATOM   137  N NE  . ARG A 1 24  ? 115.946 78.496 23.643  1.00 54.03  ? 21   ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 24  ? 116.898 79.157 24.294  1.00 57.17  ? 21   ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 24  ? 117.758 78.499 25.060  1.00 54.28  ? 21   ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 24  ? 116.990 80.474 24.180  1.00 63.32  ? 21   ARG A NH2 1 
ATOM   141  N N   . LEU A 1 25  ? 113.068 77.250 19.880  1.00 31.76  ? 22   LEU A N   1 
ATOM   142  C CA  . LEU A 1 25  ? 112.015 77.505 18.906  1.00 32.57  ? 22   LEU A CA  1 
ATOM   143  C C   . LEU A 1 25  ? 111.489 78.921 19.086  1.00 27.17  ? 22   LEU A C   1 
ATOM   144  O O   . LEU A 1 25  ? 111.211 79.343 20.211  1.00 31.35  ? 22   LEU A O   1 
ATOM   145  C CB  . LEU A 1 25  ? 110.874 76.493 19.061  1.00 29.43  ? 22   LEU A CB  1 
ATOM   146  C CG  . LEU A 1 25  ? 111.275 75.025 18.970  1.00 30.64  ? 22   LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 25  ? 110.055 74.145 19.141  1.00 26.00  ? 22   LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 25  ? 111.966 74.741 17.632  1.00 27.39  ? 22   LEU A CD2 1 
ATOM   149  N N   . LYS A 1 26  ? 111.349 79.645 17.983  1.00 27.77  ? 23   LYS A N   1 
ATOM   150  C CA  . LYS A 1 26  ? 110.803 80.992 18.022  1.00 34.93  ? 23   LYS A CA  1 
ATOM   151  C C   . LYS A 1 26  ? 109.279 80.968 18.029  1.00 39.29  ? 23   LYS A C   1 
ATOM   152  O O   . LYS A 1 26  ? 108.643 80.098 17.424  1.00 33.34  ? 23   LYS A O   1 
ATOM   153  C CB  . LYS A 1 26  ? 111.265 81.802 16.811  1.00 32.83  ? 23   LYS A CB  1 
ATOM   154  C CG  . LYS A 1 26  ? 112.764 81.813 16.580  1.00 46.98  ? 23   LYS A CG  1 
ATOM   155  C CD  . LYS A 1 26  ? 113.415 83.072 17.152  1.00 52.49  ? 23   LYS A CD  1 
ATOM   156  C CE  . LYS A 1 26  ? 114.308 83.733 16.109  1.00 57.87  ? 23   LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 26  ? 115.131 82.721 15.371  1.00 58.80  ? 23   LYS A NZ  1 
ATOM   158  N N   . THR A 1 27  ? 108.704 81.942 18.720  1.00 33.38  ? 24   THR A N   1 
ATOM   159  C CA  . THR A 1 27  ? 107.303 82.316 18.629  1.00 35.11  ? 24   THR A CA  1 
ATOM   160  C C   . THR A 1 27  ? 107.257 83.833 18.660  1.00 41.89  ? 24   THR A C   1 
ATOM   161  O O   . THR A 1 27  ? 108.208 84.475 19.115  1.00 36.70  ? 24   THR A O   1 
ATOM   162  C CB  . THR A 1 27  ? 106.452 81.778 19.789  1.00 35.66  ? 24   THR A CB  1 
ATOM   163  O OG1 . THR A 1 27  ? 106.448 82.747 20.848  1.00 36.27  ? 24   THR A OG1 1 
ATOM   164  C CG2 . THR A 1 27  ? 106.969 80.436 20.306  1.00 33.09  ? 24   THR A CG2 1 
ATOM   165  N N   . PRO A 1 28  ? 106.158 84.437 18.205  1.00 41.96  ? 25   PRO A N   1 
ATOM   166  C CA  . PRO A 1 28  ? 106.062 85.903 18.275  1.00 40.91  ? 25   PRO A CA  1 
ATOM   167  C C   . PRO A 1 28  ? 106.222 86.456 19.685  1.00 47.42  ? 25   PRO A C   1 
ATOM   168  O O   . PRO A 1 28  ? 106.534 87.646 19.840  1.00 41.53  ? 25   PRO A O   1 
ATOM   169  C CB  . PRO A 1 28  ? 104.659 86.190 17.718  1.00 43.55  ? 25   PRO A CB  1 
ATOM   170  C CG  . PRO A 1 28  ? 104.342 84.999 16.864  1.00 42.24  ? 25   PRO A CG  1 
ATOM   171  C CD  . PRO A 1 28  ? 104.982 83.836 17.549  1.00 40.67  ? 25   PRO A CD  1 
ATOM   172  N N   . GLY A 1 29  ? 106.037 85.636 20.715  1.00 42.20  ? 26   GLY A N   1 
ATOM   173  C CA  . GLY A 1 29  ? 106.079 86.140 22.069  1.00 41.50  ? 26   GLY A CA  1 
ATOM   174  C C   . GLY A 1 29  ? 107.392 85.873 22.766  1.00 44.35  ? 26   GLY A C   1 
ATOM   175  O O   . GLY A 1 29  ? 107.592 86.314 23.899  1.00 47.20  ? 26   GLY A O   1 
ATOM   176  N N   . GLY A 1 30  ? 108.286 85.138 22.114  1.00 41.15  ? 27   GLY A N   1 
ATOM   177  C CA  . GLY A 1 30  ? 109.541 84.773 22.722  1.00 34.30  ? 27   GLY A CA  1 
ATOM   178  C C   . GLY A 1 30  ? 109.858 83.310 22.511  1.00 41.73  ? 27   GLY A C   1 
ATOM   179  O O   . GLY A 1 30  ? 109.021 82.530 22.047  1.00 39.56  ? 27   GLY A O   1 
ATOM   180  N N   . PRO A 1 31  ? 111.076 82.907 22.851  1.00 40.73  ? 28   PRO A N   1 
ATOM   181  C CA  . PRO A 1 31  ? 111.509 81.538 22.570  1.00 35.19  ? 28   PRO A CA  1 
ATOM   182  C C   . PRO A 1 31  ? 110.971 80.540 23.583  1.00 33.59  ? 28   PRO A C   1 
ATOM   183  O O   . PRO A 1 31  ? 110.453 80.882 24.645  1.00 36.09  ? 28   PRO A O   1 
ATOM   184  C CB  . PRO A 1 31  ? 113.038 81.623 22.657  1.00 37.71  ? 28   PRO A CB  1 
ATOM   185  C CG  . PRO A 1 31  ? 113.265 82.698 23.657  1.00 37.38  ? 28   PRO A CG  1 
ATOM   186  C CD  . PRO A 1 31  ? 112.192 83.736 23.335  1.00 40.20  ? 28   PRO A CD  1 
ATOM   187  N N   . VAL A 1 32  ? 111.152 79.274 23.218  1.00 30.81  ? 29   VAL A N   1 
ATOM   188  C CA  . VAL A 1 32  ? 110.769 78.109 23.993  1.00 28.86  ? 29   VAL A CA  1 
ATOM   189  C C   . VAL A 1 32  ? 111.884 77.104 23.762  1.00 26.37  ? 29   VAL A C   1 
ATOM   190  O O   . VAL A 1 32  ? 112.581 77.166 22.746  1.00 34.32  ? 29   VAL A O   1 
ATOM   191  C CB  . VAL A 1 32  ? 109.384 77.569 23.533  1.00 33.97  ? 29   VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 32  ? 109.202 76.128 23.900  1.00 26.67  ? 29   VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 32  ? 108.234 78.429 24.110  1.00 26.33  ? 29   VAL A CG2 1 
ATOM   194  N N   . SER A 1 33  ? 112.092 76.199 24.708  1.00 23.86  ? 30   SER A N   1 
ATOM   195  C CA  . SER A 1 33  ? 113.128 75.188 24.572  1.00 25.50  ? 30   SER A CA  1 
ATOM   196  C C   . SER A 1 33  ? 112.463 73.841 24.329  1.00 31.76  ? 30   SER A C   1 
ATOM   197  O O   . SER A 1 33  ? 111.578 73.432 25.088  1.00 27.11  ? 30   SER A O   1 
ATOM   198  C CB  . SER A 1 33  ? 114.033 75.132 25.807  1.00 28.92  ? 30   SER A CB  1 
ATOM   199  O OG  . SER A 1 33  ? 114.654 76.392 26.024  1.00 35.99  ? 30   SER A OG  1 
ATOM   200  N N   . ALA A 1 34  ? 112.880 73.167 23.263  1.00 24.14  ? 31   ALA A N   1 
ATOM   201  C CA  . ALA A 1 34  ? 112.259 71.930 22.839  1.00 24.83  ? 31   ALA A CA  1 
ATOM   202  C C   . ALA A 1 34  ? 113.301 70.834 22.800  1.00 24.47  ? 31   ALA A C   1 
ATOM   203  O O   . ALA A 1 34  ? 114.430 71.048 22.343  1.00 31.30  ? 31   ALA A O   1 
ATOM   204  C CB  . ALA A 1 34  ? 111.599 72.087 21.465  1.00 18.93  ? 31   ALA A CB  1 
ATOM   205  N N   . PHE A 1 35  ? 112.914 69.670 23.285  1.00 24.63  ? 32   PHE A N   1 
ATOM   206  C CA  . PHE A 1 35  ? 113.730 68.466 23.249  1.00 20.31  ? 32   PHE A CA  1 
ATOM   207  C C   . PHE A 1 35  ? 112.899 67.433 22.491  1.00 29.77  ? 32   PHE A C   1 
ATOM   208  O O   . PHE A 1 35  ? 112.000 66.800 23.058  1.00 24.22  ? 32   PHE A O   1 
ATOM   209  C CB  . PHE A 1 35  ? 114.099 68.033 24.662  1.00 22.69  ? 32   PHE A CB  1 
ATOM   210  C CG  . PHE A 1 35  ? 114.879 69.086 25.414  1.00 31.36  ? 32   PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 35  ? 114.235 70.187 25.973  1.00 27.67  ? 32   PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 35  ? 116.261 68.994 25.528  1.00 30.28  ? 32   PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 35  ? 114.951 71.168 26.638  1.00 30.71  ? 32   PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 35  ? 116.982 69.963 26.194  1.00 30.69  ? 32   PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 35  ? 116.327 71.057 26.747  1.00 32.62  ? 32   PHE A CZ  1 
ATOM   216  N N   . LEU A 1 36  ? 113.191 67.288 21.198  1.00 29.55  ? 33   LEU A N   1 
ATOM   217  C CA  . LEU A 1 36  ? 112.387 66.493 20.282  1.00 23.57  ? 33   LEU A CA  1 
ATOM   218  C C   . LEU A 1 36  ? 113.083 65.172 19.982  1.00 25.82  ? 33   LEU A C   1 
ATOM   219  O O   . LEU A 1 36  ? 114.272 65.150 19.646  1.00 27.28  ? 33   LEU A O   1 
ATOM   220  C CB  . LEU A 1 36  ? 112.148 67.270 18.992  1.00 20.22  ? 33   LEU A CB  1 
ATOM   221  C CG  . LEU A 1 36  ? 111.730 68.716 19.198  1.00 24.19  ? 33   LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 36  ? 111.458 69.394 17.867  1.00 25.42  ? 33   LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 36  ? 110.494 68.775 20.103  1.00 26.21  ? 33   LEU A CD2 1 
ATOM   224  N N   . GLY A 1 37  ? 112.341 64.078 20.092  1.00 23.14  ? 34   GLY A N   1 
ATOM   225  C CA  . GLY A 1 37  ? 112.871 62.773 19.756  1.00 17.89  ? 34   GLY A CA  1 
ATOM   226  C C   . GLY A 1 37  ? 113.656 62.088 20.850  1.00 27.04  ? 34   GLY A C   1 
ATOM   227  O O   . GLY A 1 37  ? 114.635 61.384 20.558  1.00 25.34  ? 34   GLY A O   1 
ATOM   228  N N   . ILE A 1 38  ? 113.248 62.244 22.103  1.00 24.72  ? 35   ILE A N   1 
ATOM   229  C CA  . ILE A 1 38  ? 113.894 61.519 23.195  1.00 19.33  ? 35   ILE A CA  1 
ATOM   230  C C   . ILE A 1 38  ? 113.478 60.058 23.159  1.00 22.19  ? 35   ILE A C   1 
ATOM   231  O O   . ILE A 1 38  ? 112.282 59.768 23.227  1.00 26.73  ? 35   ILE A O   1 
ATOM   232  C CB  . ILE A 1 38  ? 113.537 62.120 24.559  1.00 19.16  ? 35   ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 38  ? 113.771 63.630 24.573  1.00 18.11  ? 35   ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 38  ? 114.284 61.382 25.655  1.00 20.18  ? 35   ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 38  ? 113.418 64.270 25.898  1.00 21.55  ? 35   ILE A CD1 1 
ATOM   236  N N   . PRO A 1 39  ? 114.401 59.104 23.092  1.00 25.77  ? 36   PRO A N   1 
ATOM   237  C CA  . PRO A 1 39  ? 113.990 57.694 23.162  1.00 19.62  ? 36   PRO A CA  1 
ATOM   238  C C   . PRO A 1 39  ? 113.509 57.342 24.564  1.00 29.79  ? 36   PRO A C   1 
ATOM   239  O O   . PRO A 1 39  ? 114.168 57.671 25.556  1.00 25.28  ? 36   PRO A O   1 
ATOM   240  C CB  . PRO A 1 39  ? 115.274 56.930 22.807  1.00 21.86  ? 36   PRO A CB  1 
ATOM   241  C CG  . PRO A 1 39  ? 116.375 57.843 23.261  1.00 20.79  ? 36   PRO A CG  1 
ATOM   242  C CD  . PRO A 1 39  ? 115.868 59.257 23.011  1.00 23.06  ? 36   PRO A CD  1 
ATOM   243  N N   . PHE A 1 40  ? 112.364 56.648 24.650  1.00 21.74  ? 37   PHE A N   1 
ATOM   244  C CA  . PHE A 1 40  ? 111.888 56.200 25.948  1.00 15.56  ? 37   PHE A CA  1 
ATOM   245  C C   . PHE A 1 40  ? 111.744 54.699 26.027  1.00 18.16  ? 37   PHE A C   1 
ATOM   246  O O   . PHE A 1 40  ? 111.531 54.167 27.117  1.00 24.27  ? 37   PHE A O   1 
ATOM   247  C CB  . PHE A 1 40  ? 110.569 56.900 26.323  1.00 24.53  ? 37   PHE A CB  1 
ATOM   248  C CG  . PHE A 1 40  ? 109.356 56.510 25.467  1.00 21.38  ? 37   PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 40  ? 108.578 55.401 25.791  1.00 22.21  ? 37   PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 40  ? 108.977 57.295 24.391  1.00 15.16  ? 37   PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 40  ? 107.431 55.069 25.033  1.00 23.15  ? 37   PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 40  ? 107.841 56.973 23.618  1.00 20.24  ? 37   PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 40  ? 107.077 55.862 23.939  1.00 23.56  ? 37   PHE A CZ  1 
ATOM   254  N N   . ALA A 1 41  ? 111.924 53.996 24.926  1.00 17.57  ? 38   ALA A N   1 
ATOM   255  C CA  . ALA A 1 41  ? 111.839 52.555 24.922  1.00 22.39  ? 38   ALA A CA  1 
ATOM   256  C C   . ALA A 1 41  ? 112.923 52.021 24.002  1.00 23.57  ? 38   ALA A C   1 
ATOM   257  O O   . ALA A 1 41  ? 113.404 52.722 23.108  1.00 22.13  ? 38   ALA A O   1 
ATOM   258  C CB  . ALA A 1 41  ? 110.447 52.073 24.440  1.00 19.06  ? 38   ALA A CB  1 
ATOM   259  N N   . GLU A 1 42  ? 113.275 50.764 24.210  1.00 23.28  ? 39   GLU A N   1 
ATOM   260  C CA  . GLU A 1 42  ? 114.035 50.051 23.200  1.00 29.83  ? 39   GLU A CA  1 
ATOM   261  C C   . GLU A 1 42  ? 113.205 49.931 21.922  1.00 32.84  ? 39   GLU A C   1 
ATOM   262  O O   . GLU A 1 42  ? 111.984 49.749 21.993  1.00 32.36  ? 39   GLU A O   1 
ATOM   263  C CB  . GLU A 1 42  ? 114.426 48.660 23.706  1.00 26.31  ? 39   GLU A CB  1 
ATOM   264  C CG  . GLU A 1 42  ? 115.541 48.669 24.787  1.00 42.68  ? 39   GLU A CG  1 
ATOM   265  C CD  . GLU A 1 42  ? 116.853 49.333 24.318  1.00 39.23  ? 39   GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 42  ? 117.370 48.954 23.239  1.00 48.11  ? 39   GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 42  ? 117.362 50.240 25.027  1.00 36.10  ? 39   GLU A OE2 1 
ATOM   268  N N   . PRO A 1 43  ? 113.826 50.016 20.748  1.00 33.04  ? 40   PRO A N   1 
ATOM   269  C CA  . PRO A 1 43  ? 113.084 49.862 19.490  1.00 25.57  ? 40   PRO A CA  1 
ATOM   270  C C   . PRO A 1 43  ? 112.334 48.544 19.433  1.00 30.55  ? 40   PRO A C   1 
ATOM   271  O O   . PRO A 1 43  ? 112.934 47.458 19.478  1.00 27.45  ? 40   PRO A O   1 
ATOM   272  C CB  . PRO A 1 43  ? 114.190 49.924 18.428  1.00 27.81  ? 40   PRO A CB  1 
ATOM   273  C CG  . PRO A 1 43  ? 115.202 50.867 19.049  1.00 26.11  ? 40   PRO A CG  1 
ATOM   274  C CD  . PRO A 1 43  ? 115.210 50.485 20.517  1.00 27.54  ? 40   PRO A CD  1 
ATOM   275  N N   . PRO A 1 44  ? 110.975 48.600 19.301  1.00 30.55  ? 41   PRO A N   1 
ATOM   276  C CA  . PRO A 1 44  ? 110.155 47.377 19.275  1.00 26.23  ? 41   PRO A CA  1 
ATOM   277  C C   . PRO A 1 44  ? 110.203 46.676 17.920  1.00 29.71  ? 41   PRO A C   1 
ATOM   278  O O   . PRO A 1 44  ? 109.187 46.486 17.253  1.00 30.87  ? 41   PRO A O   1 
ATOM   279  C CB  . PRO A 1 44  ? 108.758 47.915 19.613  1.00 23.17  ? 41   PRO A CB  1 
ATOM   280  C CG  . PRO A 1 44  ? 108.742 49.305 19.065  1.00 23.13  ? 41   PRO A CG  1 
ATOM   281  C CD  . PRO A 1 44  ? 110.166 49.828 19.166  1.00 24.56  ? 41   PRO A CD  1 
ATOM   282  N N   . MET A 1 45  ? 111.400 46.254 17.523  1.00 30.48  ? 42   MET A N   1 
ATOM   283  C CA  . MET A 1 45  ? 111.640 45.656 16.222  1.00 30.10  ? 42   MET A CA  1 
ATOM   284  C C   . MET A 1 45  ? 111.993 44.184 16.356  1.00 31.99  ? 42   MET A C   1 
ATOM   285  O O   . MET A 1 45  ? 112.337 43.700 17.439  1.00 33.03  ? 42   MET A O   1 
ATOM   286  C CB  . MET A 1 45  ? 112.775 46.378 15.506  1.00 32.67  ? 42   MET A CB  1 
ATOM   287  C CG  . MET A 1 45  ? 112.543 47.848 15.372  1.00 29.11  ? 42   MET A CG  1 
ATOM   288  S SD  . MET A 1 45  ? 113.789 48.483 14.300  1.00 58.06  ? 42   MET A SD  1 
ATOM   289  C CE  . MET A 1 45  ? 113.623 47.307 12.941  1.00 40.38  ? 42   MET A CE  1 
ATOM   290  N N   . GLY A 1 46  ? 111.927 43.483 15.221  1.00 28.61  ? 43   GLY A N   1 
ATOM   291  C CA  . GLY A 1 46  ? 112.267 42.082 15.152  1.00 30.08  ? 43   GLY A CA  1 
ATOM   292  C C   . GLY A 1 46  ? 111.464 41.219 16.102  1.00 35.78  ? 43   GLY A C   1 
ATOM   293  O O   . GLY A 1 46  ? 110.229 41.189 16.059  1.00 35.30  ? 43   GLY A O   1 
ATOM   294  N N   . PRO A 1 47  ? 112.160 40.486 16.976  1.00 35.54  ? 44   PRO A N   1 
ATOM   295  C CA  . PRO A 1 47  ? 111.458 39.666 17.980  1.00 33.51  ? 44   PRO A CA  1 
ATOM   296  C C   . PRO A 1 47  ? 110.611 40.477 18.939  1.00 28.05  ? 44   PRO A C   1 
ATOM   297  O O   . PRO A 1 47  ? 109.738 39.913 19.607  1.00 35.57  ? 44   PRO A O   1 
ATOM   298  C CB  . PRO A 1 47  ? 112.604 38.956 18.717  1.00 36.02  ? 44   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 47  ? 113.803 39.853 18.498  1.00 34.69  ? 44   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 47  ? 113.626 40.400 17.111  1.00 32.10  ? 44   PRO A CD  1 
ATOM   301  N N   . ARG A 1 48  ? 110.835 41.786 19.026  1.00 32.01  ? 45   ARG A N   1 
ATOM   302  C CA  . ARG A 1 48  ? 110.059 42.647 19.908  1.00 35.42  ? 45   ARG A CA  1 
ATOM   303  C C   . ARG A 1 48  ? 108.767 43.151 19.282  1.00 31.32  ? 45   ARG A C   1 
ATOM   304  O O   . ARG A 1 48  ? 108.017 43.859 19.962  1.00 30.34  ? 45   ARG A O   1 
ATOM   305  C CB  . ARG A 1 48  ? 110.877 43.863 20.314  1.00 33.93  ? 45   ARG A CB  1 
ATOM   306  C CG  . ARG A 1 48  ? 111.781 43.664 21.519  1.00 41.19  ? 45   ARG A CG  1 
ATOM   307  C CD  . ARG A 1 48  ? 112.928 44.656 21.396  1.00 45.84  ? 45   ARG A CD  1 
ATOM   308  N NE  . ARG A 1 48  ? 113.653 44.855 22.635  1.00 59.54  ? 45   ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 48  ? 114.640 44.069 23.034  1.00 64.61  ? 45   ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 48  ? 115.247 44.336 24.183  1.00 63.64  ? 45   ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 48  ? 115.013 43.013 22.308  1.00 64.73  ? 45   ARG A NH2 1 
ATOM   312  N N   . ARG A 1 49  ? 108.527 42.874 18.006  1.00 25.45  ? 46   ARG A N   1 
ATOM   313  C CA  . ARG A 1 49  ? 107.277 43.285 17.388  1.00 29.50  ? 46   ARG A CA  1 
ATOM   314  C C   . ARG A 1 49  ? 106.115 42.570 18.070  1.00 26.04  ? 46   ARG A C   1 
ATOM   315  O O   . ARG A 1 49  ? 106.169 41.355 18.286  1.00 22.48  ? 46   ARG A O   1 
ATOM   316  C CB  . ARG A 1 49  ? 107.302 42.974 15.891  1.00 24.29  ? 46   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 49  ? 106.034 43.399 15.150  1.00 23.53  ? 46   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 49  ? 106.003 42.823 13.742  1.00 22.39  ? 46   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 49  ? 106.800 43.612 12.807  1.00 22.98  ? 46   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 49  ? 107.002 43.269 11.537  1.00 23.20  ? 46   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 49  ? 106.477 42.150 11.058  1.00 24.33  ? 46   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 49  ? 107.733 44.037 10.746  1.00 23.04  ? 46   ARG A NH2 1 
ATOM   323  N N   . PHE A 1 50  ? 105.080 43.334 18.427  1.00 22.09  ? 47   PHE A N   1 
ATOM   324  C CA  . PHE A 1 50  ? 103.842 42.896 19.114  1.00 21.88  ? 47   PHE A CA  1 
ATOM   325  C C   . PHE A 1 50  ? 104.043 42.754 20.620  1.00 28.97  ? 47   PHE A C   1 
ATOM   326  O O   . PHE A 1 50  ? 103.093 42.419 21.320  1.00 28.83  ? 47   PHE A O   1 
ATOM   327  C CB  . PHE A 1 50  ? 103.276 41.573 18.566  1.00 18.22  ? 47   PHE A CB  1 
ATOM   328  C CG  . PHE A 1 50  ? 103.071 41.581 17.075  1.00 18.15  ? 47   PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 50  ? 102.415 42.636 16.462  1.00 20.52  ? 47   PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 50  ? 103.541 40.545 16.291  1.00 20.74  ? 47   PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 50  ? 102.215 42.656 15.091  1.00 18.93  ? 47   PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 50  ? 103.365 40.565 14.908  1.00 23.69  ? 47   PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 50  ? 102.703 41.625 14.313  1.00 21.31  ? 47   PHE A CZ  1 
ATOM   334  N N   . LEU A 1 51  ? 105.294 43.000 21.158  1.00 28.43  ? 48   LEU A N   1 
ATOM   335  C CA  . LEU A 1 51  ? 105.561 42.799 22.564  1.00 27.19  ? 48   LEU A CA  1 
ATOM   336  C C   . LEU A 1 51  ? 105.465 44.115 23.312  1.00 25.79  ? 48   LEU A C   1 
ATOM   337  O O   . LEU A 1 51  ? 105.604 45.188 22.711  1.00 25.08  ? 48   LEU A O   1 
ATOM   338  C CB  . LEU A 1 51  ? 106.954 42.192 22.773  1.00 31.58  ? 48   LEU A CB  1 
ATOM   339  C CG  . LEU A 1 51  ? 107.114 40.763 22.263  1.00 31.07  ? 48   LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 51  ? 108.473 40.198 22.682  1.00 31.22  ? 48   LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 51  ? 105.971 39.883 22.754  1.00 31.11  ? 48   LEU A CD2 1 
ATOM   342  N N   . PRO A 1 52  ? 105.200 44.051 24.614  1.00 27.60  ? 49   PRO A N   1 
ATOM   343  C CA  . PRO A 1 52  ? 105.189 45.267 25.416  1.00 23.53  ? 49   PRO A CA  1 
ATOM   344  C C   . PRO A 1 52  ? 106.520 45.983 25.309  1.00 25.19  ? 49   PRO A C   1 
ATOM   345  O O   . PRO A 1 52  ? 107.574 45.348 25.115  1.00 24.02  ? 49   PRO A O   1 
ATOM   346  C CB  . PRO A 1 52  ? 104.939 44.755 26.841  1.00 24.46  ? 49   PRO A CB  1 
ATOM   347  C CG  . PRO A 1 52  ? 104.178 43.499 26.658  1.00 26.77  ? 49   PRO A CG  1 
ATOM   348  C CD  . PRO A 1 52  ? 104.755 42.874 25.383  1.00 24.62  ? 49   PRO A CD  1 
ATOM   349  N N   . PRO A 1 53  ? 106.527 47.304 25.441  1.00 20.41  ? 50   PRO A N   1 
ATOM   350  C CA  . PRO A 1 53  ? 107.786 48.041 25.342  1.00 22.57  ? 50   PRO A CA  1 
ATOM   351  C C   . PRO A 1 53  ? 108.683 47.729 26.528  1.00 36.38  ? 50   PRO A C   1 
ATOM   352  O O   . PRO A 1 53  ? 108.216 47.368 27.614  1.00 27.59  ? 50   PRO A O   1 
ATOM   353  C CB  . PRO A 1 53  ? 107.341 49.505 25.362  1.00 22.72  ? 50   PRO A CB  1 
ATOM   354  C CG  . PRO A 1 53  ? 106.070 49.476 26.213  1.00 21.96  ? 50   PRO A CG  1 
ATOM   355  C CD  . PRO A 1 53  ? 105.410 48.148 25.891  1.00 17.40  ? 50   PRO A CD  1 
ATOM   356  N N   . GLU A 1 54  ? 110.013 47.852 26.294  1.00 33.50  ? 51   GLU A N   1 
ATOM   357  C CA  . GLU A 1 54  ? 111.055 47.789 27.306  1.00 30.64  ? 51   GLU A CA  1 
ATOM   358  C C   . GLU A 1 54  ? 111.674 49.161 27.461  1.00 27.14  ? 51   GLU A C   1 
ATOM   359  O O   . GLU A 1 54  ? 111.865 49.865 26.461  1.00 28.52  ? 51   GLU A O   1 
ATOM   360  C CB  . GLU A 1 54  ? 112.170 46.801 26.951  1.00 37.18  ? 51   GLU A CB  1 
ATOM   361  C CG  . GLU A 1 54  ? 111.887 45.348 27.212  1.00 48.43  ? 51   GLU A CG  1 
ATOM   362  C CD  . GLU A 1 54  ? 112.855 44.470 26.433  1.00 57.25  ? 51   GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 54  ? 113.331 43.451 26.974  1.00 73.58  ? 51   GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 54  ? 113.155 44.814 25.276  1.00 56.02  ? 51   GLU A OE2 1 
ATOM   365  N N   . PRO A 1 55  ? 112.001 49.572 28.682  1.00 29.93  ? 52   PRO A N   1 
ATOM   366  C CA  . PRO A 1 55  ? 112.624 50.890 28.865  1.00 29.75  ? 52   PRO A CA  1 
ATOM   367  C C   . PRO A 1 55  ? 113.908 51.017 28.049  1.00 26.69  ? 52   PRO A C   1 
ATOM   368  O O   . PRO A 1 55  ? 114.620 50.042 27.794  1.00 32.02  ? 52   PRO A O   1 
ATOM   369  C CB  . PRO A 1 55  ? 112.902 50.951 30.375  1.00 32.22  ? 52   PRO A CB  1 
ATOM   370  C CG  . PRO A 1 55  ? 111.993 49.917 30.990  1.00 29.62  ? 52   PRO A CG  1 
ATOM   371  C CD  . PRO A 1 55  ? 111.867 48.828 29.948  1.00 33.31  ? 52   PRO A CD  1 
ATOM   372  N N   . LYS A 1 56  ? 114.164 52.235 27.597  1.00 28.58  ? 53   LYS A N   1 
ATOM   373  C CA  . LYS A 1 56  ? 115.376 52.550 26.857  1.00 33.05  ? 53   LYS A CA  1 
ATOM   374  C C   . LYS A 1 56  ? 116.587 52.481 27.791  1.00 32.84  ? 53   LYS A C   1 
ATOM   375  O O   . LYS A 1 56  ? 116.633 53.195 28.798  1.00 28.41  ? 53   LYS A O   1 
ATOM   376  C CB  . LYS A 1 56  ? 115.232 53.943 26.255  1.00 27.04  ? 53   LYS A CB  1 
ATOM   377  C CG  . LYS A 1 56  ? 116.503 54.515 25.637  1.00 27.36  ? 53   LYS A CG  1 
ATOM   378  C CD  . LYS A 1 56  ? 116.928 53.722 24.410  1.00 26.41  ? 53   LYS A CD  1 
ATOM   379  C CE  . LYS A 1 56  ? 117.991 54.495 23.633  1.00 28.33  ? 53   LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 56  ? 118.391 53.760 22.386  1.00 29.25  ? 53   LYS A NZ  1 
ATOM   381  N N   . GLN A 1 57  ? 117.559 51.625 27.457  1.00 39.19  ? 54   GLN A N   1 
ATOM   382  C CA  . GLN A 1 57  ? 118.793 51.520 28.232  1.00 33.88  ? 54   GLN A CA  1 
ATOM   383  C C   . GLN A 1 57  ? 119.580 52.829 28.156  1.00 32.12  ? 54   GLN A C   1 
ATOM   384  O O   . GLN A 1 57  ? 119.535 53.531 27.141  1.00 35.04  ? 54   GLN A O   1 
ATOM   385  C CB  . GLN A 1 57  ? 119.654 50.372 27.714  1.00 36.70  ? 54   GLN A CB  1 
ATOM   386  C CG  . GLN A 1 57  ? 118.925 49.048 27.534  1.00 38.71  ? 54   GLN A CG  1 
ATOM   387  C CD  . GLN A 1 57  ? 118.605 48.348 28.848  1.00 55.36  ? 54   GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 57  ? 118.001 48.930 29.760  1.00 52.51  ? 54   GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 57  ? 119.007 47.083 28.948  1.00 58.22  ? 54   GLN A NE2 1 
ATOM   390  N N   . PRO A 1 58  ? 120.309 53.194 29.214  1.00 32.18  ? 55   PRO A N   1 
ATOM   391  C CA  . PRO A 1 58  ? 121.015 54.483 29.194  1.00 34.64  ? 55   PRO A CA  1 
ATOM   392  C C   . PRO A 1 58  ? 122.106 54.489 28.128  1.00 31.86  ? 55   PRO A C   1 
ATOM   393  O O   . PRO A 1 58  ? 122.565 53.442 27.659  1.00 28.71  ? 55   PRO A O   1 
ATOM   394  C CB  . PRO A 1 58  ? 121.609 54.605 30.612  1.00 32.18  ? 55   PRO A CB  1 
ATOM   395  C CG  . PRO A 1 58  ? 121.004 53.486 31.415  1.00 29.38  ? 55   PRO A CG  1 
ATOM   396  C CD  . PRO A 1 58  ? 120.628 52.417 30.425  1.00 33.68  ? 55   PRO A CD  1 
ATOM   397  N N   . TRP A 1 59  ? 122.517 55.693 27.740  1.00 32.71  ? 56   TRP A N   1 
ATOM   398  C CA  . TRP A 1 59  ? 123.391 55.879 26.593  1.00 35.77  ? 56   TRP A CA  1 
ATOM   399  C C   . TRP A 1 59  ? 124.564 56.779 26.957  1.00 39.85  ? 56   TRP A C   1 
ATOM   400  O O   . TRP A 1 59  ? 124.493 57.574 27.900  1.00 32.30  ? 56   TRP A O   1 
ATOM   401  C CB  . TRP A 1 59  ? 122.640 56.497 25.419  1.00 26.62  ? 56   TRP A CB  1 
ATOM   402  C CG  . TRP A 1 59  ? 122.035 57.837 25.743  1.00 31.04  ? 56   TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 59  ? 122.626 59.067 25.616  1.00 29.28  ? 56   TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 59  ? 120.708 58.077 26.237  1.00 28.44  ? 56   TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 59  ? 121.744 60.063 26.010  1.00 31.32  ? 56   TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 59  ? 120.559 59.478 26.385  1.00 30.59  ? 56   TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 59  ? 119.630 57.245 26.562  1.00 28.48  ? 56   TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 59  ? 119.373 60.061 26.851  1.00 27.17  ? 56   TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 59  ? 118.452 57.828 27.026  1.00 27.52  ? 56   TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 59  ? 118.335 59.220 27.162  1.00 27.49  ? 56   TRP A CH2 1 
ATOM   411  N N   . SER A 1 60  ? 125.639 56.659 26.174  1.00 41.24  ? 57   SER A N   1 
ATOM   412  C CA  . SER A 1 60  ? 126.819 57.500 26.340  1.00 41.62  ? 57   SER A CA  1 
ATOM   413  C C   . SER A 1 60  ? 126.678 58.759 25.496  1.00 39.09  ? 57   SER A C   1 
ATOM   414  O O   . SER A 1 60  ? 126.000 58.769 24.468  1.00 43.42  ? 57   SER A O   1 
ATOM   415  C CB  . SER A 1 60  ? 128.094 56.754 25.934  1.00 42.18  ? 57   SER A CB  1 
ATOM   416  O OG  . SER A 1 60  ? 128.050 55.385 26.300  1.00 41.93  ? 57   SER A OG  1 
ATOM   417  N N   . GLY A 1 61  ? 127.322 59.823 25.938  1.00 36.91  ? 58   GLY A N   1 
ATOM   418  C CA  . GLY A 1 61  ? 127.335 60.966 25.056  1.00 37.74  ? 58   GLY A CA  1 
ATOM   419  C C   . GLY A 1 61  ? 126.016 61.719 25.051  1.00 42.69  ? 58   GLY A C   1 
ATOM   420  O O   . GLY A 1 61  ? 125.128 61.513 25.885  1.00 42.57  ? 58   GLY A O   1 
ATOM   421  N N   . VAL A 1 62  ? 125.904 62.617 24.086  1.00 34.77  ? 59   VAL A N   1 
ATOM   422  C CA  . VAL A 1 62  ? 124.757 63.500 23.952  1.00 37.91  ? 59   VAL A CA  1 
ATOM   423  C C   . VAL A 1 62  ? 123.878 62.978 22.818  1.00 37.63  ? 59   VAL A C   1 
ATOM   424  O O   . VAL A 1 62  ? 124.294 62.959 21.651  1.00 36.89  ? 59   VAL A O   1 
ATOM   425  C CB  . VAL A 1 62  ? 125.198 64.943 23.702  1.00 34.25  ? 59   VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 62  ? 124.014 65.917 23.878  1.00 28.40  ? 59   VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 62  ? 126.368 65.290 24.623  1.00 34.50  ? 59   VAL A CG2 1 
ATOM   428  N N   . VAL A 1 63  ? 122.662 62.544 23.160  1.00 30.90  ? 60   VAL A N   1 
ATOM   429  C CA  . VAL A 1 63  ? 121.647 62.279 22.144  1.00 31.24  ? 60   VAL A CA  1 
ATOM   430  C C   . VAL A 1 63  ? 121.135 63.609 21.599  1.00 31.14  ? 60   VAL A C   1 
ATOM   431  O O   . VAL A 1 63  ? 120.840 64.538 22.363  1.00 29.00  ? 60   VAL A O   1 
ATOM   432  C CB  . VAL A 1 63  ? 120.509 61.428 22.731  1.00 33.66  ? 60   VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 63  ? 119.266 61.489 21.847  1.00 31.27  ? 60   VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 63  ? 120.947 59.996 22.883  1.00 28.02  ? 60   VAL A CG2 1 
ATOM   435  N N   . ASP A 1 64  ? 121.083 63.730 20.267  1.00 31.38  ? 61   ASP A N   1 
ATOM   436  C CA  . ASP A 1 64  ? 120.539 64.931 19.640  1.00 34.24  ? 61   ASP A CA  1 
ATOM   437  C C   . ASP A 1 64  ? 119.018 64.888 19.748  1.00 36.65  ? 61   ASP A C   1 
ATOM   438  O O   . ASP A 1 64  ? 118.385 63.925 19.297  1.00 32.27  ? 61   ASP A O   1 
ATOM   439  C CB  . ASP A 1 64  ? 120.961 65.042 18.174  1.00 39.03  ? 61   ASP A CB  1 
ATOM   440  C CG  . ASP A 1 64  ? 120.656 66.418 17.577  1.00 42.07  ? 61   ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 64  ? 119.516 66.633 17.112  1.00 41.02  ? 61   ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 64  ? 121.554 67.294 17.565  1.00 49.03  ? 61   ASP A OD2 1 
ATOM   443  N N   . ALA A 1 65  ? 118.444 65.911 20.369  1.00 32.62  ? 62   ALA A N   1 
ATOM   444  C CA  . ALA A 1 65  ? 117.005 66.048 20.535  1.00 28.33  ? 62   ALA A CA  1 
ATOM   445  C C   . ALA A 1 65  ? 116.544 67.315 19.856  1.00 24.55  ? 62   ALA A C   1 
ATOM   446  O O   . ALA A 1 65  ? 115.759 68.084 20.399  1.00 28.88  ? 62   ALA A O   1 
ATOM   447  C CB  . ALA A 1 65  ? 116.602 66.049 22.009  1.00 26.47  ? 62   ALA A CB  1 
ATOM   448  N N   . THR A 1 66  ? 117.059 67.561 18.653  1.00 25.51  ? 63   THR A N   1 
ATOM   449  C CA  . THR A 1 66  ? 116.748 68.785 17.938  1.00 27.65  ? 63   THR A CA  1 
ATOM   450  C C   . THR A 1 66  ? 115.685 68.598 16.860  1.00 24.57  ? 63   THR A C   1 
ATOM   451  O O   . THR A 1 66  ? 115.237 69.590 16.288  1.00 23.94  ? 63   THR A O   1 
ATOM   452  C CB  . THR A 1 66  ? 118.021 69.371 17.302  1.00 31.61  ? 63   THR A CB  1 
ATOM   453  O OG1 . THR A 1 66  ? 118.521 68.464 16.308  1.00 27.62  ? 63   THR A OG1 1 
ATOM   454  C CG2 . THR A 1 66  ? 119.104 69.586 18.369  1.00 23.13  ? 63   THR A CG2 1 
ATOM   455  N N   . THR A 1 67  ? 115.257 67.371 16.572  1.00 22.84  ? 64   THR A N   1 
ATOM   456  C CA  . THR A 1 67  ? 114.250 67.202 15.533  1.00 25.28  ? 64   THR A CA  1 
ATOM   457  C C   . THR A 1 67  ? 113.369 66.001 15.866  1.00 20.71  ? 64   THR A C   1 
ATOM   458  O O   . THR A 1 67  ? 113.752 65.119 16.639  1.00 21.66  ? 64   THR A O   1 
ATOM   459  C CB  . THR A 1 67  ? 114.917 67.060 14.151  1.00 25.81  ? 64   THR A CB  1 
ATOM   460  O OG1 . THR A 1 67  ? 113.912 67.097 13.126  1.00 37.61  ? 64   THR A OG1 1 
ATOM   461  C CG2 . THR A 1 67  ? 115.681 65.751 14.073  1.00 19.26  ? 64   THR A CG2 1 
ATOM   462  N N   . PHE A 1 68  ? 112.169 65.977 15.289  1.00 23.19  ? 65   PHE A N   1 
ATOM   463  C CA  . PHE A 1 68  ? 111.274 64.855 15.534  1.00 20.39  ? 65   PHE A CA  1 
ATOM   464  C C   . PHE A 1 68  ? 111.855 63.575 14.964  1.00 20.80  ? 65   PHE A C   1 
ATOM   465  O O   . PHE A 1 68  ? 112.541 63.572 13.940  1.00 22.98  ? 65   PHE A O   1 
ATOM   466  C CB  . PHE A 1 68  ? 109.891 65.092 14.914  1.00 22.91  ? 65   PHE A CB  1 
ATOM   467  C CG  . PHE A 1 68  ? 109.090 66.136 15.614  1.00 15.54  ? 65   PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 68  ? 108.594 65.901 16.886  1.00 20.26  ? 65   PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 68  ? 108.828 67.344 15.007  1.00 23.15  ? 65   PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 68  ? 107.857 66.872 17.540  1.00 20.17  ? 65   PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 68  ? 108.088 68.320 15.656  1.00 23.28  ? 65   PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 68  ? 107.607 68.076 16.924  1.00 21.17  ? 65   PHE A CZ  1 
ATOM   473  N N   . GLN A 1 69  ? 111.555 62.481 15.625  1.00 16.89  ? 66   GLN A N   1 
ATOM   474  C CA  . GLN A 1 69  ? 111.993 61.178 15.164  1.00 21.98  ? 66   GLN A CA  1 
ATOM   475  C C   . GLN A 1 69  ? 110.933 60.559 14.250  1.00 24.28  ? 66   GLN A C   1 
ATOM   476  O O   . GLN A 1 69  ? 109.974 61.215 13.836  1.00 20.92  ? 66   GLN A O   1 
ATOM   477  C CB  . GLN A 1 69  ? 112.305 60.286 16.357  1.00 18.62  ? 66   GLN A CB  1 
ATOM   478  C CG  . GLN A 1 69  ? 113.747 60.359 16.770  1.00 29.56  ? 66   GLN A CG  1 
ATOM   479  C CD  . GLN A 1 69  ? 114.617 59.457 15.902  1.00 31.63  ? 66   GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 69  ? 114.133 58.804 14.962  1.00 34.65  ? 66   GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 69  ? 115.896 59.408 16.218  1.00 30.37  ? 66   GLN A NE2 1 
ATOM   482  N N   . SER A 1 70  ? 111.096 59.275 13.957  1.00 20.25  ? 67   SER A N   1 
ATOM   483  C CA  . SER A 1 70  ? 110.320 58.607 12.925  1.00 25.19  ? 67   SER A CA  1 
ATOM   484  C C   . SER A 1 70  ? 108.874 58.389 13.368  1.00 25.85  ? 67   SER A C   1 
ATOM   485  O O   . SER A 1 70  ? 108.580 58.254 14.559  1.00 20.56  ? 67   SER A O   1 
ATOM   486  C CB  . SER A 1 70  ? 110.963 57.260 12.573  1.00 22.68  ? 67   SER A CB  1 
ATOM   487  O OG  . SER A 1 70  ? 112.225 57.433 11.931  1.00 28.17  ? 67   SER A OG  1 
ATOM   488  N N   . VAL A 1 71  ? 107.976 58.319 12.381  1.00 21.25  ? 68   VAL A N   1 
ATOM   489  C CA  . VAL A 1 71  ? 106.566 58.018 12.628  1.00 20.65  ? 68   VAL A CA  1 
ATOM   490  C C   . VAL A 1 71  ? 106.382 56.511 12.683  1.00 17.83  ? 68   VAL A C   1 
ATOM   491  O O   . VAL A 1 71  ? 107.009 55.768 11.918  1.00 20.19  ? 68   VAL A O   1 
ATOM   492  C CB  . VAL A 1 71  ? 105.692 58.661 11.536  1.00 23.47  ? 68   VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 71  ? 104.200 58.222 11.656  1.00 21.11  ? 68   VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 71  ? 105.835 60.158 11.602  1.00 18.92  ? 68   VAL A CG2 1 
ATOM   495  N N   . CYS A 1 72  ? 105.540 56.037 13.605  1.00 18.24  ? 69   CYS A N   1 
ATOM   496  C CA  . CYS A 1 72  ? 105.283 54.602 13.680  1.00 14.85  ? 69   CYS A CA  1 
ATOM   497  C C   . CYS A 1 72  ? 104.560 54.154 12.409  1.00 17.95  ? 69   CYS A C   1 
ATOM   498  O O   . CYS A 1 72  ? 103.723 54.885 11.869  1.00 16.94  ? 69   CYS A O   1 
ATOM   499  C CB  . CYS A 1 72  ? 104.452 54.261 14.925  1.00 19.30  ? 69   CYS A CB  1 
ATOM   500  S SG  . CYS A 1 72  ? 105.229 54.652 16.544  1.00 23.36  ? 69   CYS A SG  1 
ATOM   501  N N   . TYR A 1 73  ? 104.902 52.959 11.933  1.00 18.22  ? 70   TYR A N   1 
ATOM   502  C CA  . TYR A 1 73  ? 104.358 52.436 10.683  1.00 21.38  ? 70   TYR A CA  1 
ATOM   503  C C   . TYR A 1 73  ? 102.840 52.506 10.672  1.00 23.92  ? 70   TYR A C   1 
ATOM   504  O O   . TYR A 1 73  ? 102.175 52.066 11.610  1.00 19.41  ? 70   TYR A O   1 
ATOM   505  C CB  . TYR A 1 73  ? 104.783 50.985 10.473  1.00 21.06  ? 70   TYR A CB  1 
ATOM   506  C CG  . TYR A 1 73  ? 105.849 50.849 9.432   1.00 30.23  ? 70   TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 73  ? 105.540 50.828 8.073   1.00 21.14  ? 70   TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 73  ? 107.184 50.777 9.812   1.00 29.87  ? 70   TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 73  ? 106.554 50.727 7.117   1.00 24.09  ? 70   TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 73  ? 108.177 50.671 8.885   1.00 28.44  ? 70   TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 73  ? 107.869 50.647 7.552   1.00 30.06  ? 70   TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 73  ? 108.919 50.528 6.674   1.00 45.37  ? 70   TYR A OH  1 
ATOM   513  N N   . GLN A 1 74  ? 102.294 53.034 9.591   1.00 22.19  ? 71   GLN A N   1 
ATOM   514  C CA  . GLN A 1 74  ? 100.862 53.252 9.589   1.00 19.66  ? 71   GLN A CA  1 
ATOM   515  C C   . GLN A 1 74  ? 100.402 53.469 8.158   1.00 21.10  ? 71   GLN A C   1 
ATOM   516  O O   . GLN A 1 74  ? 101.176 53.855 7.267   1.00 16.46  ? 71   GLN A O   1 
ATOM   517  C CB  . GLN A 1 74  ? 100.481 54.440 10.487  1.00 12.45  ? 71   GLN A CB  1 
ATOM   518  C CG  . GLN A 1 74  ? 100.963 55.776 9.980   1.00 12.90  ? 71   GLN A CG  1 
ATOM   519  C CD  . GLN A 1 74  ? 100.845 56.861 11.023  1.00 16.17  ? 71   GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 74  ? 100.190 57.900 10.814  1.00 15.27  ? 71   GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 74  ? 101.486 56.636 12.165  1.00 13.89  ? 71   GLN A NE2 1 
ATOM   522  N N   . TYR A 1 75  ? 99.116  53.206 7.971   1.00 21.21  ? 72   TYR A N   1 
ATOM   523  C CA  . TYR A 1 75  ? 98.445  53.507 6.728   1.00 19.03  ? 72   TYR A CA  1 
ATOM   524  C C   . TYR A 1 75  ? 98.513  55.006 6.460   1.00 18.75  ? 72   TYR A C   1 
ATOM   525  O O   . TYR A 1 75  ? 98.493  55.826 7.388   1.00 26.62  ? 72   TYR A O   1 
ATOM   526  C CB  . TYR A 1 75  ? 97.002  53.009 6.815   1.00 20.32  ? 72   TYR A CB  1 
ATOM   527  C CG  . TYR A 1 75  ? 96.165  53.411 5.643   1.00 17.52  ? 72   TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 75  ? 96.150  52.652 4.478   1.00 23.78  ? 72   TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 75  ? 95.402  54.571 5.689   1.00 21.39  ? 72   TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 75  ? 95.387  53.043 3.390   1.00 26.90  ? 72   TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 75  ? 94.652  54.970 4.616   1.00 24.27  ? 72   TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 75  ? 94.637  54.200 3.472   1.00 27.64  ? 72   TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 75  ? 93.869  54.612 2.412   1.00 41.02  ? 72   TYR A OH  1 
ATOM   534  N N   . VAL A 1 76  ? 98.647  55.357 5.184   1.00 15.31  ? 73   VAL A N   1 
ATOM   535  C CA  . VAL A 1 76  ? 98.749  56.734 4.719   1.00 16.09  ? 73   VAL A CA  1 
ATOM   536  C C   . VAL A 1 76  ? 97.516  57.026 3.886   1.00 21.87  ? 73   VAL A C   1 
ATOM   537  O O   . VAL A 1 76  ? 97.221  56.292 2.934   1.00 21.57  ? 73   VAL A O   1 
ATOM   538  C CB  . VAL A 1 76  ? 100.030 56.962 3.891   1.00 19.04  ? 73   VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 76  ? 99.949  58.263 3.102   1.00 18.76  ? 73   VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 76  ? 101.251 56.983 4.789   1.00 17.06  ? 73   VAL A CG2 1 
ATOM   541  N N   . ASP A 1 77  ? 96.813  58.103 4.228   1.00 24.04  ? 74   ASP A N   1 
ATOM   542  C CA  . ASP A 1 77  ? 95.565  58.436 3.551   1.00 23.98  ? 74   ASP A CA  1 
ATOM   543  C C   . ASP A 1 77  ? 95.840  58.951 2.149   1.00 26.01  ? 74   ASP A C   1 
ATOM   544  O O   . ASP A 1 77  ? 96.581  59.927 1.969   1.00 24.80  ? 74   ASP A O   1 
ATOM   545  C CB  . ASP A 1 77  ? 94.800  59.491 4.339   1.00 23.21  ? 74   ASP A CB  1 
ATOM   546  C CG  . ASP A 1 77  ? 93.350  59.647 3.871   1.00 28.44  ? 74   ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 77  ? 93.111  60.288 2.827   1.00 33.37  ? 74   ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 77  ? 92.448  59.141 4.569   1.00 32.17  ? 74   ASP A OD2 1 
ATOM   549  N N   . THR A 1 78  ? 95.196  58.319 1.161   1.00 24.75  ? 75   THR A N   1 
ATOM   550  C CA  . THR A 1 78  ? 95.283  58.713 -0.242  1.00 30.99  ? 75   THR A CA  1 
ATOM   551  C C   . THR A 1 78  ? 93.927  59.096 -0.853  1.00 33.87  ? 75   THR A C   1 
ATOM   552  O O   . THR A 1 78  ? 93.838  59.262 -2.075  1.00 40.89  ? 75   THR A O   1 
ATOM   553  C CB  . THR A 1 78  ? 95.936  57.578 -1.052  1.00 35.78  ? 75   THR A CB  1 
ATOM   554  O OG1 . THR A 1 78  ? 95.250  56.340 -0.789  1.00 40.12  ? 75   THR A OG1 1 
ATOM   555  C CG2 . THR A 1 78  ? 97.391  57.419 -0.656  1.00 29.85  ? 75   THR A CG2 1 
ATOM   556  N N   . LEU A 1 79  ? 92.866  59.246 -0.049  1.00 37.22  ? 76   LEU A N   1 
ATOM   557  C CA  . LEU A 1 79  ? 91.556  59.568 -0.622  1.00 34.48  ? 76   LEU A CA  1 
ATOM   558  C C   . LEU A 1 79  ? 91.604  60.849 -1.454  1.00 44.12  ? 76   LEU A C   1 
ATOM   559  O O   . LEU A 1 79  ? 90.917  60.940 -2.478  1.00 42.93  ? 76   LEU A O   1 
ATOM   560  C CB  . LEU A 1 79  ? 90.495  59.684 0.482   1.00 33.80  ? 76   LEU A CB  1 
ATOM   561  C CG  . LEU A 1 79  ? 89.019  59.743 0.025   1.00 47.31  ? 76   LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 79  ? 88.649  58.495 -0.766  1.00 49.73  ? 76   LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 79  ? 87.981  59.976 1.158   1.00 37.46  ? 76   LEU A CD2 1 
ATOM   564  N N   . TYR A 1 80  ? 92.445  61.819 -1.071  1.00 42.73  ? 77   TYR A N   1 
ATOM   565  C CA  . TYR A 1 80  ? 92.528  63.115 -1.751  1.00 29.40  ? 77   TYR A CA  1 
ATOM   566  C C   . TYR A 1 80  ? 93.961  63.605 -1.817  1.00 29.76  ? 77   TYR A C   1 
ATOM   567  O O   . TYR A 1 80  ? 94.383  64.455 -1.017  1.00 31.72  ? 77   TYR A O   1 
ATOM   568  C CB  . TYR A 1 80  ? 91.671  64.156 -1.042  1.00 24.70  ? 77   TYR A CB  1 
ATOM   569  C CG  . TYR A 1 80  ? 90.225  63.811 -0.931  1.00 32.25  ? 77   TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 80  ? 89.421  63.741 -2.063  1.00 26.68  ? 77   TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 80  ? 89.641  63.604 0.304   1.00 30.53  ? 77   TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 80  ? 88.079  63.452 -1.965  1.00 33.28  ? 77   TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 80  ? 88.296  63.316 0.413   1.00 37.70  ? 77   TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 80  ? 87.515  63.237 -0.721  1.00 43.56  ? 77   TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 80  ? 86.163  62.950 -0.611  1.00 42.65  ? 77   TYR A OH  1 
ATOM   576  N N   . PRO A 1 81  ? 94.734  63.121 -2.788  1.00 36.68  ? 78   PRO A N   1 
ATOM   577  C CA  . PRO A 1 81  ? 96.155  63.507 -2.888  1.00 27.38  ? 78   PRO A CA  1 
ATOM   578  C C   . PRO A 1 81  ? 96.353  65.016 -2.978  1.00 28.72  ? 78   PRO A C   1 
ATOM   579  O O   . PRO A 1 81  ? 95.693  65.703 -3.755  1.00 35.43  ? 78   PRO A O   1 
ATOM   580  C CB  . PRO A 1 81  ? 96.615  62.806 -4.174  1.00 32.43  ? 78   PRO A CB  1 
ATOM   581  C CG  . PRO A 1 81  ? 95.702  61.614 -4.296  1.00 32.94  ? 78   PRO A CG  1 
ATOM   582  C CD  . PRO A 1 81  ? 94.368  62.037 -3.722  1.00 36.16  ? 78   PRO A CD  1 
ATOM   583  N N   . GLY A 1 82  ? 97.276  65.536 -2.171  1.00 31.75  ? 79   GLY A N   1 
ATOM   584  C CA  . GLY A 1 82  ? 97.554  66.962 -2.160  1.00 31.10  ? 79   GLY A CA  1 
ATOM   585  C C   . GLY A 1 82  ? 96.589  67.822 -1.357  1.00 31.50  ? 79   GLY A C   1 
ATOM   586  O O   . GLY A 1 82  ? 96.829  69.027 -1.219  1.00 31.65  ? 79   GLY A O   1 
ATOM   587  N N   . PHE A 1 83  ? 95.512  67.253 -0.823  1.00 25.09  ? 80   PHE A N   1 
ATOM   588  C CA  . PHE A 1 83  ? 94.513  68.034 -0.103  1.00 27.94  ? 80   PHE A CA  1 
ATOM   589  C C   . PHE A 1 83  ? 94.976  68.290 1.331   1.00 25.07  ? 80   PHE A C   1 
ATOM   590  O O   . PHE A 1 83  ? 95.334  67.358 2.056   1.00 20.09  ? 80   PHE A O   1 
ATOM   591  C CB  . PHE A 1 83  ? 93.173  67.296 -0.122  1.00 19.03  ? 80   PHE A CB  1 
ATOM   592  C CG  . PHE A 1 83  ? 92.075  67.979 0.629   1.00 19.19  ? 80   PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 83  ? 91.679  69.267 0.303   1.00 20.59  ? 80   PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 83  ? 91.396  67.305 1.636   1.00 15.33  ? 80   PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 83  ? 90.636  69.896 1.005   1.00 21.84  ? 80   PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 83  ? 90.348  67.909 2.327   1.00 17.44  ? 80   PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 83  ? 89.973  69.213 2.015   1.00 20.45  ? 80   PHE A CZ  1 
ATOM   598  N N   . GLU A 1 84  ? 94.961  69.559 1.731   1.00 22.08  ? 81   GLU A N   1 
ATOM   599  C CA  . GLU A 1 84  ? 95.435  69.939 3.057   1.00 24.98  ? 81   GLU A CA  1 
ATOM   600  C C   . GLU A 1 84  ? 94.604  69.281 4.156   1.00 26.51  ? 81   GLU A C   1 
ATOM   601  O O   . GLU A 1 84  ? 95.141  68.864 5.195   1.00 20.02  ? 81   GLU A O   1 
ATOM   602  C CB  . GLU A 1 84  ? 95.404  71.464 3.159   1.00 22.59  ? 81   GLU A CB  1 
ATOM   603  C CG  . GLU A 1 84  ? 95.378  72.084 4.558   1.00 38.68  ? 81   GLU A CG  1 
ATOM   604  C CD  . GLU A 1 84  ? 94.975  73.563 4.471   1.00 41.27  ? 81   GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 84  ? 95.385  74.211 3.487   1.00 48.06  ? 81   GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 84  ? 94.219  74.070 5.328   1.00 39.03  ? 81   GLU A OE2 1 
ATOM   607  N N   . GLY A 1 85  ? 93.295  69.135 3.922   1.00 22.32  ? 82   GLY A N   1 
ATOM   608  C CA  . GLY A 1 85  ? 92.416  68.623 4.959   1.00 22.49  ? 82   GLY A CA  1 
ATOM   609  C C   . GLY A 1 85  ? 92.745  67.212 5.392   1.00 21.02  ? 82   GLY A C   1 
ATOM   610  O O   . GLY A 1 85  ? 92.574  66.867 6.561   1.00 21.58  ? 82   GLY A O   1 
ATOM   611  N N   . THR A 1 86  ? 93.227  66.374 4.475   1.00 18.99  ? 83   THR A N   1 
ATOM   612  C CA  . THR A 1 86  ? 93.644  65.027 4.873   1.00 17.06  ? 83   THR A CA  1 
ATOM   613  C C   . THR A 1 86  ? 95.134  64.918 5.138   1.00 19.20  ? 83   THR A C   1 
ATOM   614  O O   . THR A 1 86  ? 95.553  64.145 6.006   1.00 15.32  ? 83   THR A O   1 
ATOM   615  C CB  . THR A 1 86  ? 93.291  63.987 3.797   1.00 22.40  ? 83   THR A CB  1 
ATOM   616  O OG1 . THR A 1 86  ? 93.621  64.504 2.506   1.00 19.65  ? 83   THR A OG1 1 
ATOM   617  C CG2 . THR A 1 86  ? 91.817  63.598 3.851   1.00 20.19  ? 83   THR A CG2 1 
ATOM   618  N N   . GLU A 1 87  ? 95.952  65.634 4.370   1.00 15.94  ? 84   GLU A N   1 
ATOM   619  C CA  . GLU A 1 87  ? 97.380  65.418 4.486   1.00 22.68  ? 84   GLU A CA  1 
ATOM   620  C C   . GLU A 1 87  ? 97.957  66.005 5.763   1.00 19.60  ? 84   GLU A C   1 
ATOM   621  O O   . GLU A 1 87  ? 99.010  65.540 6.201   1.00 18.43  ? 84   GLU A O   1 
ATOM   622  C CB  . GLU A 1 87  ? 98.082  65.959 3.250   1.00 28.50  ? 84   GLU A CB  1 
ATOM   623  C CG  . GLU A 1 87  ? 98.331  64.783 2.312   1.00 35.40  ? 84   GLU A CG  1 
ATOM   624  C CD  . GLU A 1 87  ? 98.561  65.184 0.899   1.00 39.98  ? 84   GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 87  ? 98.319  64.328 0.005   1.00 38.72  ? 84   GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 87  ? 98.987  66.349 0.693   1.00 45.05  ? 84   GLU A OE2 1 
ATOM   627  N N   . MET A 1 88  ? 97.266  66.970 6.392   1.00 20.57  ? 85   MET A N   1 
ATOM   628  C CA  . MET A 1 88  ? 97.675  67.472 7.708   1.00 21.15  ? 85   MET A CA  1 
ATOM   629  C C   . MET A 1 88  ? 97.779  66.371 8.749   1.00 17.92  ? 85   MET A C   1 
ATOM   630  O O   . MET A 1 88  ? 98.459  66.554 9.765   1.00 21.10  ? 85   MET A O   1 
ATOM   631  C CB  . MET A 1 88  ? 96.705  68.551 8.199   1.00 20.66  ? 85   MET A CB  1 
ATOM   632  C CG  . MET A 1 88  ? 95.282  68.058 8.528   1.00 18.77  ? 85   MET A CG  1 
ATOM   633  S SD  . MET A 1 88  ? 94.241  69.473 8.918   1.00 20.12  ? 85   MET A SD  1 
ATOM   634  C CE  . MET A 1 88  ? 94.644  69.718 10.663  1.00 18.49  ? 85   MET A CE  1 
ATOM   635  N N   . TRP A 1 89  ? 97.129  65.232 8.530   1.00 19.53  ? 86   TRP A N   1 
ATOM   636  C CA  . TRP A 1 89  ? 97.167  64.125 9.477   1.00 17.22  ? 86   TRP A CA  1 
ATOM   637  C C   . TRP A 1 89  ? 98.144  63.032 9.059   1.00 19.22  ? 86   TRP A C   1 
ATOM   638  O O   . TRP A 1 89  ? 98.433  62.130 9.859   1.00 15.84  ? 86   TRP A O   1 
ATOM   639  C CB  . TRP A 1 89  ? 95.750  63.519 9.651   1.00 17.11  ? 86   TRP A CB  1 
ATOM   640  C CG  . TRP A 1 89  ? 94.681  64.551 9.939   1.00 21.41  ? 86   TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 89  ? 93.732  65.024 9.059   1.00 22.10  ? 86   TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 89  ? 94.466  65.262 11.175  1.00 22.69  ? 86   TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 89  ? 92.943  65.975 9.677   1.00 21.43  ? 86   TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 89  ? 93.363  66.129 10.976  1.00 21.77  ? 86   TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 89  ? 95.086  65.238 12.435  1.00 22.60  ? 86   TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 89  ? 92.873  66.971 11.989  1.00 19.84  ? 86   TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 89  ? 94.591  66.075 13.445  1.00 24.87  ? 86   TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 89  ? 93.497  66.930 13.209  1.00 21.63  ? 86   TRP A CH2 1 
ATOM   649  N N   . ASN A 1 90  ? 98.647  63.083 7.833   1.00 16.32  ? 87   ASN A N   1 
ATOM   650  C CA  . ASN A 1 90  ? 99.515  62.031 7.331   1.00 20.19  ? 87   ASN A CA  1 
ATOM   651  C C   . ASN A 1 90  ? 100.922 62.154 7.927   1.00 16.94  ? 87   ASN A C   1 
ATOM   652  O O   . ASN A 1 90  ? 101.312 63.221 8.397   1.00 18.04  ? 87   ASN A O   1 
ATOM   653  C CB  . ASN A 1 90  ? 99.563  62.091 5.804   1.00 17.74  ? 87   ASN A CB  1 
ATOM   654  C CG  . ASN A 1 90  ? 98.415  61.317 5.145   1.00 20.25  ? 87   ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 90  ? 97.825  60.410 5.748   1.00 21.64  ? 87   ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 90  ? 98.129  61.642 3.895   1.00 18.19  ? 87   ASN A ND2 1 
ATOM   657  N N   . PRO A 1 91  ? 101.690 61.064 7.934   1.00 18.56  ? 88   PRO A N   1 
ATOM   658  C CA  . PRO A 1 91  ? 103.055 61.112 8.472   1.00 21.23  ? 88   PRO A CA  1 
ATOM   659  C C   . PRO A 1 91  ? 103.880 62.208 7.815   1.00 21.11  ? 88   PRO A C   1 
ATOM   660  O O   . PRO A 1 91  ? 103.868 62.377 6.596   1.00 18.13  ? 88   PRO A O   1 
ATOM   661  C CB  . PRO A 1 91  ? 103.612 59.727 8.129   1.00 16.76  ? 88   PRO A CB  1 
ATOM   662  C CG  . PRO A 1 91  ? 102.386 58.857 8.113   1.00 19.47  ? 88   PRO A CG  1 
ATOM   663  C CD  . PRO A 1 91  ? 101.307 59.703 7.521   1.00 16.80  ? 88   PRO A CD  1 
ATOM   664  N N   . ASN A 1 92  ? 104.606 62.962 8.635   1.00 20.12  ? 89   ASN A N   1 
ATOM   665  C CA  . ASN A 1 92  ? 105.470 64.014 8.120   1.00 19.80  ? 89   ASN A CA  1 
ATOM   666  C C   . ASN A 1 92  ? 106.928 63.737 8.443   1.00 20.39  ? 89   ASN A C   1 
ATOM   667  O O   . ASN A 1 92  ? 107.751 64.646 8.349   1.00 25.21  ? 89   ASN A O   1 
ATOM   668  C CB  . ASN A 1 92  ? 105.041 65.378 8.665   1.00 23.56  ? 89   ASN A CB  1 
ATOM   669  C CG  . ASN A 1 92  ? 105.252 65.500 10.176  1.00 21.18  ? 89   ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 92  ? 105.347 64.494 10.889  1.00 18.07  ? 89   ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 92  ? 105.328 66.734 10.662  1.00 23.77  ? 89   ASN A ND2 1 
ATOM   672  N N   . ARG A 1 93  ? 107.242 62.524 8.883   1.00 20.03  ? 90   ARG A N   1 
ATOM   673  C CA  . ARG A 1 93  ? 108.584 61.979 8.983   1.00 17.77  ? 90   ARG A CA  1 
ATOM   674  C C   . ARG A 1 93  ? 108.521 60.573 8.411   1.00 24.60  ? 90   ARG A C   1 
ATOM   675  O O   . ARG A 1 93  ? 107.441 60.029 8.190   1.00 22.14  ? 90   ARG A O   1 
ATOM   676  C CB  . ARG A 1 93  ? 109.100 61.946 10.430  1.00 25.34  ? 90   ARG A CB  1 
ATOM   677  C CG  . ARG A 1 93  ? 109.250 63.323 11.100  1.00 30.89  ? 90   ARG A CG  1 
ATOM   678  C CD  . ARG A 1 93  ? 110.367 64.143 10.456  1.00 28.69  ? 90   ARG A CD  1 
ATOM   679  N NE  . ARG A 1 93  ? 110.642 65.409 11.144  1.00 25.28  ? 90   ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 93  ? 109.980 66.534 10.915  1.00 26.17  ? 90   ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 93  ? 108.992 66.535 10.038  1.00 27.21  ? 90   ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 93  ? 110.290 67.659 11.566  1.00 31.94  ? 90   ARG A NH2 1 
ATOM   683  N N   . GLU A 1 94  ? 109.674 59.962 8.174   1.00 24.81  ? 91   GLU A N   1 
ATOM   684  C CA  . GLU A 1 94  ? 109.653 58.651 7.550   1.00 22.93  ? 91   GLU A CA  1 
ATOM   685  C C   . GLU A 1 94  ? 109.099 57.612 8.522   1.00 26.35  ? 91   GLU A C   1 
ATOM   686  O O   . GLU A 1 94  ? 109.171 57.773 9.743   1.00 27.13  ? 91   GLU A O   1 
ATOM   687  C CB  . GLU A 1 94  ? 111.052 58.267 7.062   1.00 30.69  ? 91   GLU A CB  1 
ATOM   688  C CG  . GLU A 1 94  ? 112.045 57.915 8.136   1.00 38.38  ? 91   GLU A CG  1 
ATOM   689  C CD  . GLU A 1 94  ? 113.412 57.474 7.572   1.00 59.46  ? 91   GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 94  ? 114.362 58.293 7.617   1.00 62.86  ? 91   GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 94  ? 113.532 56.317 7.085   1.00 59.24  ? 91   GLU A OE2 1 
ATOM   692  N N   . LEU A 1 95  ? 108.547 56.532 7.963   1.00 21.22  ? 92   LEU A N   1 
ATOM   693  C CA  . LEU A 1 95  ? 107.970 55.455 8.753   1.00 22.02  ? 92   LEU A CA  1 
ATOM   694  C C   . LEU A 1 95  ? 109.042 54.492 9.235   1.00 25.95  ? 92   LEU A C   1 
ATOM   695  O O   . LEU A 1 95  ? 109.948 54.123 8.488   1.00 25.44  ? 92   LEU A O   1 
ATOM   696  C CB  . LEU A 1 95  ? 106.929 54.687 7.933   1.00 27.32  ? 92   LEU A CB  1 
ATOM   697  C CG  . LEU A 1 95  ? 105.756 55.514 7.384   1.00 25.58  ? 92   LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 95  ? 104.772 54.632 6.593   1.00 20.58  ? 92   LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 95  ? 105.067 56.210 8.526   1.00 21.72  ? 92   LEU A CD2 1 
ATOM   700  N N   . SER A 1 96  ? 108.917 54.054 10.483  1.00 22.05  ? 93   SER A N   1 
ATOM   701  C CA  . SER A 1 96  ? 109.859 53.081 11.016  1.00 23.18  ? 93   SER A CA  1 
ATOM   702  C C   . SER A 1 96  ? 109.203 52.352 12.177  1.00 21.86  ? 93   SER A C   1 
ATOM   703  O O   . SER A 1 96  ? 108.387 52.928 12.895  1.00 22.29  ? 93   SER A O   1 
ATOM   704  C CB  . SER A 1 96  ? 111.160 53.762 11.486  1.00 18.88  ? 93   SER A CB  1 
ATOM   705  O OG  . SER A 1 96  ? 112.005 52.829 12.126  1.00 18.65  ? 93   SER A OG  1 
ATOM   706  N N   . GLU A 1 97  ? 109.579 51.088 12.373  1.00 19.81  ? 94   GLU A N   1 
ATOM   707  C CA  . GLU A 1 97  ? 109.198 50.429 13.615  1.00 18.32  ? 94   GLU A CA  1 
ATOM   708  C C   . GLU A 1 97  ? 109.966 50.990 14.806  1.00 26.23  ? 94   GLU A C   1 
ATOM   709  O O   . GLU A 1 97  ? 109.518 50.850 15.952  1.00 23.51  ? 94   GLU A O   1 
ATOM   710  C CB  . GLU A 1 97  ? 109.407 48.929 13.493  1.00 18.63  ? 94   GLU A CB  1 
ATOM   711  C CG  . GLU A 1 97  ? 108.361 48.289 12.613  1.00 23.15  ? 94   GLU A CG  1 
ATOM   712  C CD  . GLU A 1 97  ? 108.351 46.808 12.721  1.00 24.07  ? 94   GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 97  ? 107.702 46.279 13.652  1.00 26.08  ? 94   GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 97  ? 109.007 46.158 11.881  1.00 29.01  ? 94   GLU A OE2 1 
ATOM   715  N N   . ASP A 1 98  ? 111.102 51.638 14.552  1.00 22.20  ? 95   ASP A N   1 
ATOM   716  C CA  . ASP A 1 98  ? 111.896 52.324 15.567  1.00 23.25  ? 95   ASP A CA  1 
ATOM   717  C C   . ASP A 1 98  ? 111.296 53.714 15.742  1.00 22.17  ? 95   ASP A C   1 
ATOM   718  O O   . ASP A 1 98  ? 111.747 54.703 15.165  1.00 20.41  ? 95   ASP A O   1 
ATOM   719  C CB  . ASP A 1 98  ? 113.360 52.382 15.138  1.00 25.33  ? 95   ASP A CB  1 
ATOM   720  C CG  . ASP A 1 98  ? 114.271 53.026 16.183  1.00 29.38  ? 95   ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 98  ? 113.788 53.641 17.177  1.00 22.38  ? 95   ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 98  ? 115.500 52.917 15.986  1.00 30.17  ? 95   ASP A OD2 1 
ATOM   723  N N   . CYS A 1 99  ? 110.246 53.794 16.571  1.00 19.21  ? 96   CYS A N   1 
ATOM   724  C CA  . CYS A 1 99  ? 109.487 55.032 16.638  1.00 19.42  ? 96   CYS A CA  1 
ATOM   725  C C   . CYS A 1 99  ? 109.134 55.487 18.046  1.00 15.54  ? 96   CYS A C   1 
ATOM   726  O O   . CYS A 1 99  ? 108.454 56.509 18.181  1.00 16.24  ? 96   CYS A O   1 
ATOM   727  C CB  . CYS A 1 99  ? 108.177 54.893 15.819  1.00 18.72  ? 96   CYS A CB  1 
ATOM   728  S SG  . CYS A 1 99  ? 107.030 53.608 16.465  1.00 23.37  ? 96   CYS A SG  1 
ATOM   729  N N   . LEU A 1 100 ? 109.575 54.790 19.091  1.00 17.86  ? 97   LEU A N   1 
ATOM   730  C CA  . LEU A 1 100 ? 109.159 55.120 20.460  1.00 19.73  ? 97   LEU A CA  1 
ATOM   731  C C   . LEU A 1 100 ? 110.030 56.245 21.010  1.00 18.75  ? 97   LEU A C   1 
ATOM   732  O O   . LEU A 1 100 ? 110.968 56.044 21.790  1.00 20.12  ? 97   LEU A O   1 
ATOM   733  C CB  . LEU A 1 100 ? 109.181 53.877 21.342  1.00 17.46  ? 97   LEU A CB  1 
ATOM   734  C CG  . LEU A 1 100 ? 108.140 52.852 20.849  1.00 24.10  ? 97   LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 100 ? 108.045 51.649 21.777  1.00 19.89  ? 97   LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 100 ? 106.739 53.510 20.613  1.00 15.97  ? 97   LEU A CD2 1 
ATOM   737  N N   . TYR A 1 101 ? 109.656 57.468 20.635  1.00 20.64  ? 98   TYR A N   1 
ATOM   738  C CA  . TYR A 1 101 ? 110.333 58.689 21.053  1.00 21.69  ? 98   TYR A CA  1 
ATOM   739  C C   . TYR A 1 101 ? 109.292 59.657 21.592  1.00 27.56  ? 98   TYR A C   1 
ATOM   740  O O   . TYR A 1 101 ? 108.135 59.655 21.142  1.00 24.40  ? 98   TYR A O   1 
ATOM   741  C CB  . TYR A 1 101 ? 111.109 59.353 19.865  1.00 17.42  ? 98   TYR A CB  1 
ATOM   742  C CG  . TYR A 1 101 ? 112.156 58.412 19.325  1.00 25.35  ? 98   TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 101 ? 111.815 57.410 18.420  1.00 19.92  ? 98   TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 101 ? 113.484 58.480 19.775  1.00 24.86  ? 98   TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 101 ? 112.767 56.515 17.950  1.00 23.80  ? 98   TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 101 ? 114.448 57.592 19.314  1.00 23.15  ? 98   TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 101 ? 114.090 56.619 18.397  1.00 25.16  ? 98   TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 101 ? 115.035 55.727 17.955  1.00 21.77  ? 98   TYR A OH  1 
ATOM   749  N N   . LEU A 1 102 ? 109.701 60.498 22.547  1.00 18.34  ? 99   LEU A N   1 
ATOM   750  C CA  . LEU A 1 102 ? 108.802 61.520 23.070  1.00 19.27  ? 99   LEU A CA  1 
ATOM   751  C C   . LEU A 1 102 ? 109.463 62.882 22.956  1.00 20.38  ? 99   LEU A C   1 
ATOM   752  O O   . LEU A 1 102 ? 110.661 62.999 22.673  1.00 22.41  ? 99   LEU A O   1 
ATOM   753  C CB  . LEU A 1 102 ? 108.372 61.214 24.514  1.00 18.11  ? 99   LEU A CB  1 
ATOM   754  C CG  . LEU A 1 102 ? 109.383 60.969 25.634  1.00 20.40  ? 99   LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 102 ? 109.957 62.301 26.150  1.00 19.23  ? 99   LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 102 ? 108.780 60.130 26.770  1.00 16.59  ? 99   LEU A CD2 1 
ATOM   757  N N   . ASN A 1 103 ? 108.662 63.917 23.181  1.00 16.52  ? 100  ASN A N   1 
ATOM   758  C CA  . ASN A 1 103 ? 109.075 65.298 23.027  1.00 17.28  ? 100  ASN A CA  1 
ATOM   759  C C   . ASN A 1 103 ? 108.727 66.079 24.288  1.00 22.57  ? 100  ASN A C   1 
ATOM   760  O O   . ASN A 1 103 ? 107.713 65.805 24.935  1.00 24.67  ? 100  ASN A O   1 
ATOM   761  C CB  . ASN A 1 103 ? 108.398 65.913 21.802  1.00 20.26  ? 100  ASN A CB  1 
ATOM   762  C CG  . ASN A 1 103 ? 108.359 64.940 20.625  1.00 26.04  ? 100  ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 103 ? 109.379 64.685 19.982  1.00 21.77  ? 100  ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 103 ? 107.185 64.367 20.362  1.00 17.14  ? 100  ASN A ND2 1 
ATOM   765  N N   . VAL A 1 104 ? 109.584 67.027 24.652  1.00 23.11  ? 101  VAL A N   1 
ATOM   766  C CA  . VAL A 1 104 ? 109.366 67.899 25.800  1.00 17.95  ? 101  VAL A CA  1 
ATOM   767  C C   . VAL A 1 104 ? 109.566 69.326 25.337  1.00 19.74  ? 101  VAL A C   1 
ATOM   768  O O   . VAL A 1 104 ? 110.640 69.673 24.838  1.00 30.26  ? 101  VAL A O   1 
ATOM   769  C CB  . VAL A 1 104 ? 110.306 67.577 26.970  1.00 26.84  ? 101  VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 104 ? 110.037 68.531 28.167  1.00 22.82  ? 101  VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 104 ? 110.171 66.123 27.382  1.00 18.52  ? 101  VAL A CG2 1 
ATOM   772  N N   . TRP A 1 105 ? 108.537 70.140 25.452  1.00 18.12  ? 102  TRP A N   1 
ATOM   773  C CA  . TRP A 1 105 ? 108.692 71.576 25.296  1.00 19.75  ? 102  TRP A CA  1 
ATOM   774  C C   . TRP A 1 105 ? 108.675 72.214 26.677  1.00 29.62  ? 102  TRP A C   1 
ATOM   775  O O   . TRP A 1 105 ? 107.881 71.819 27.539  1.00 26.47  ? 102  TRP A O   1 
ATOM   776  C CB  . TRP A 1 105 ? 107.575 72.201 24.467  1.00 20.00  ? 102  TRP A CB  1 
ATOM   777  C CG  . TRP A 1 105 ? 107.456 71.802 23.037  1.00 24.41  ? 102  TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 105 ? 107.821 72.540 21.948  1.00 21.84  ? 102  TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 105 ? 106.871 70.603 22.533  1.00 24.41  ? 102  TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 105 ? 107.508 71.865 20.791  1.00 20.63  ? 102  TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 105 ? 106.926 70.673 21.120  1.00 24.74  ? 102  TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 105 ? 106.302 69.477 23.133  1.00 20.17  ? 102  TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 105 ? 106.437 69.659 20.301  1.00 21.90  ? 102  TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 105 ? 105.807 68.469 22.313  1.00 24.79  ? 102  TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 105 ? 105.886 68.569 20.913  1.00 20.76  ? 102  TRP A CH2 1 
ATOM   786  N N   . THR A 1 106 ? 109.538 73.206 26.879  1.00 30.90  ? 103  THR A N   1 
ATOM   787  C CA  . THR A 1 106 ? 109.655 73.857 28.173  1.00 28.01  ? 103  THR A CA  1 
ATOM   788  C C   . THR A 1 106 ? 109.899 75.346 27.973  1.00 27.38  ? 103  THR A C   1 
ATOM   789  O O   . THR A 1 106 ? 110.488 75.757 26.961  1.00 29.40  ? 103  THR A O   1 
ATOM   790  C CB  . THR A 1 106 ? 110.771 73.219 29.011  1.00 31.69  ? 103  THR A CB  1 
ATOM   791  O OG1 . THR A 1 106 ? 110.595 73.569 30.390  1.00 36.02  ? 103  THR A OG1 1 
ATOM   792  C CG2 . THR A 1 106 ? 112.155 73.656 28.516  1.00 26.49  ? 103  THR A CG2 1 
ATOM   793  N N   . PRO A 1 107 ? 109.406 76.183 28.888  1.00 29.40  ? 104  PRO A N   1 
ATOM   794  C CA  . PRO A 1 107 ? 109.506 77.633 28.678  1.00 32.86  ? 104  PRO A CA  1 
ATOM   795  C C   . PRO A 1 107 ? 110.950 78.115 28.743  1.00 33.63  ? 104  PRO A C   1 
ATOM   796  O O   . PRO A 1 107 ? 111.824 77.475 29.336  1.00 24.20  ? 104  PRO A O   1 
ATOM   797  C CB  . PRO A 1 107 ? 108.667 78.227 29.822  1.00 30.86  ? 104  PRO A CB  1 
ATOM   798  C CG  . PRO A 1 107 ? 107.835 77.091 30.344  1.00 31.63  ? 104  PRO A CG  1 
ATOM   799  C CD  . PRO A 1 107 ? 108.661 75.857 30.118  1.00 29.33  ? 104  PRO A CD  1 
ATOM   800  N N   . TYR A 1 108 ? 111.198 79.224 28.062  1.00 33.77  ? 105  TYR A N   1 
ATOM   801  C CA  . TYR A 1 108 ? 112.444 79.935 28.221  1.00 37.79  ? 105  TYR A CA  1 
ATOM   802  C C   . TYR A 1 108 ? 112.178 81.282 28.885  1.00 42.33  ? 105  TYR A C   1 
ATOM   803  O O   . TYR A 1 108 ? 111.328 82.042 28.419  1.00 39.01  ? 105  TYR A O   1 
ATOM   804  C CB  . TYR A 1 108 ? 113.167 80.164 26.893  1.00 40.86  ? 105  TYR A CB  1 
ATOM   805  C CG  . TYR A 1 108 ? 114.473 80.887 27.135  1.00 45.63  ? 105  TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 108 ? 115.618 80.184 27.528  1.00 48.67  ? 105  TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 108 ? 114.550 82.272 27.043  1.00 49.11  ? 105  TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 108 ? 116.810 80.839 27.782  1.00 54.13  ? 105  TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 108 ? 115.737 82.939 27.297  1.00 52.08  ? 105  TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 108 ? 116.862 82.221 27.663  1.00 58.98  ? 105  TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 108 ? 118.036 82.893 27.914  1.00 69.81  ? 105  TYR A OH  1 
ATOM   812  N N   . PRO A 1 109 ? 112.917 81.584 29.967  1.00 45.54  ? 106  PRO A N   1 
ATOM   813  C CA  . PRO A 1 109 ? 113.856 80.640 30.579  1.00 39.21  ? 106  PRO A CA  1 
ATOM   814  C C   . PRO A 1 109 ? 113.159 79.498 31.293  1.00 35.54  ? 106  PRO A C   1 
ATOM   815  O O   . PRO A 1 109 ? 111.974 79.591 31.612  1.00 38.59  ? 106  PRO A O   1 
ATOM   816  C CB  . PRO A 1 109 ? 114.638 81.508 31.580  1.00 41.19  ? 106  PRO A CB  1 
ATOM   817  C CG  . PRO A 1 109 ? 113.797 82.671 31.823  1.00 46.07  ? 106  PRO A CG  1 
ATOM   818  C CD  . PRO A 1 109 ? 113.062 82.933 30.534  1.00 46.43  ? 106  PRO A CD  1 
ATOM   819  N N   . ARG A 1 110 ? 113.909 78.430 31.498  1.00 25.58  ? 107  ARG A N   1 
ATOM   820  C CA  . ARG A 1 110 ? 113.398 77.251 32.161  1.00 34.14  ? 107  ARG A CA  1 
ATOM   821  C C   . ARG A 1 110 ? 112.770 77.634 33.497  1.00 40.61  ? 107  ARG A C   1 
ATOM   822  O O   . ARG A 1 110 ? 113.314 78.482 34.217  1.00 45.49  ? 107  ARG A O   1 
ATOM   823  C CB  . ARG A 1 110 ? 114.530 76.249 32.381  1.00 33.00  ? 107  ARG A CB  1 
ATOM   824  C CG  . ARG A 1 110 ? 114.084 74.990 33.065  1.00 35.77  ? 107  ARG A CG  1 
ATOM   825  C CD  . ARG A 1 110 ? 115.169 73.970 33.024  1.00 35.40  ? 107  ARG A CD  1 
ATOM   826  N NE  . ARG A 1 110 ? 115.895 74.052 31.766  1.00 43.52  ? 107  ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 110 ? 116.971 73.332 31.489  1.00 41.49  ? 107  ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 110 ? 117.446 72.477 32.381  1.00 42.63  ? 107  ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 110 ? 117.568 73.462 30.322  1.00 48.28  ? 107  ARG A NH2 1 
ATOM   830  N N   . PRO A 1 111 ? 111.623 77.057 33.846  1.00 46.96  ? 108  PRO A N   1 
ATOM   831  C CA  . PRO A 1 111 ? 111.026 77.343 35.156  1.00 45.43  ? 108  PRO A CA  1 
ATOM   832  C C   . PRO A 1 111 ? 111.947 76.891 36.281  1.00 47.02  ? 108  PRO A C   1 
ATOM   833  O O   . PRO A 1 111 ? 112.676 75.901 36.158  1.00 39.27  ? 108  PRO A O   1 
ATOM   834  C CB  . PRO A 1 111 ? 109.721 76.538 35.138  1.00 44.17  ? 108  PRO A CB  1 
ATOM   835  C CG  . PRO A 1 111 ? 109.439 76.289 33.657  1.00 38.49  ? 108  PRO A CG  1 
ATOM   836  C CD  . PRO A 1 111 ? 110.785 76.157 33.028  1.00 36.55  ? 108  PRO A CD  1 
ATOM   837  N N   . THR A 1 112 ? 111.918 77.647 37.382  1.00 49.00  ? 109  THR A N   1 
ATOM   838  C CA  . THR A 1 112 ? 112.781 77.384 38.530  1.00 49.65  ? 109  THR A CA  1 
ATOM   839  C C   . THR A 1 112 ? 112.056 76.691 39.674  1.00 49.67  ? 109  THR A C   1 
ATOM   840  O O   . THR A 1 112 ? 112.697 76.009 40.487  1.00 48.54  ? 109  THR A O   1 
ATOM   841  C CB  . THR A 1 112 ? 113.411 78.692 39.032  1.00 43.38  ? 109  THR A CB  1 
ATOM   842  O OG1 . THR A 1 112 ? 112.453 79.758 38.956  1.00 49.21  ? 109  THR A OG1 1 
ATOM   843  C CG2 . THR A 1 112 ? 114.607 79.053 38.177  1.00 44.55  ? 109  THR A CG2 1 
ATOM   844  N N   . SER A 1 113 ? 110.756 76.843 39.744  1.00 47.75  ? 110  SER A N   1 
ATOM   845  C CA  . SER A 1 113 ? 109.833 76.102 40.588  1.00 53.71  ? 110  SER A CA  1 
ATOM   846  C C   . SER A 1 113 ? 109.054 75.094 39.748  1.00 49.11  ? 110  SER A C   1 
ATOM   847  O O   . SER A 1 113 ? 108.787 75.340 38.569  1.00 46.29  ? 110  SER A O   1 
ATOM   848  C CB  . SER A 1 113 ? 108.857 77.059 41.278  1.00 49.56  ? 110  SER A CB  1 
ATOM   849  O OG  . SER A 1 113 ? 108.504 78.106 40.390  1.00 62.10  ? 110  SER A OG  1 
ATOM   850  N N   . PRO A 1 114 ? 108.693 73.950 40.319  1.00 45.10  ? 111  PRO A N   1 
ATOM   851  C CA  . PRO A 1 114 ? 107.971 72.931 39.546  1.00 39.29  ? 111  PRO A CA  1 
ATOM   852  C C   . PRO A 1 114 ? 106.734 73.491 38.842  1.00 45.87  ? 111  PRO A C   1 
ATOM   853  O O   . PRO A 1 114 ? 105.989 74.309 39.385  1.00 42.23  ? 111  PRO A O   1 
ATOM   854  C CB  . PRO A 1 114 ? 107.611 71.890 40.606  1.00 47.32  ? 111  PRO A CB  1 
ATOM   855  C CG  . PRO A 1 114 ? 108.745 72.006 41.621  1.00 46.38  ? 111  PRO A CG  1 
ATOM   856  C CD  . PRO A 1 114 ? 109.054 73.483 41.669  1.00 40.83  ? 111  PRO A CD  1 
ATOM   857  N N   . THR A 1 115 ? 106.539 73.070 37.595  1.00 40.44  ? 112  THR A N   1 
ATOM   858  C CA  . THR A 1 115 ? 105.484 73.617 36.766  1.00 43.21  ? 112  THR A CA  1 
ATOM   859  C C   . THR A 1 115 ? 104.550 72.509 36.295  1.00 41.34  ? 112  THR A C   1 
ATOM   860  O O   . THR A 1 115 ? 104.999 71.380 36.062  1.00 32.11  ? 112  THR A O   1 
ATOM   861  C CB  . THR A 1 115 ? 106.092 74.342 35.567  1.00 44.26  ? 112  THR A CB  1 
ATOM   862  O OG1 . THR A 1 115 ? 107.001 75.322 36.063  1.00 46.83  ? 112  THR A OG1 1 
ATOM   863  C CG2 . THR A 1 115 ? 105.043 75.039 34.730  1.00 38.95  ? 112  THR A CG2 1 
ATOM   864  N N   . PRO A 1 116 ? 103.249 72.785 36.191  1.00 39.44  ? 113  PRO A N   1 
ATOM   865  C CA  . PRO A 1 116 ? 102.310 71.749 35.741  1.00 39.72  ? 113  PRO A CA  1 
ATOM   866  C C   . PRO A 1 116 ? 102.644 71.236 34.345  1.00 31.76  ? 113  PRO A C   1 
ATOM   867  O O   . PRO A 1 116 ? 103.125 71.974 33.484  1.00 28.79  ? 113  PRO A O   1 
ATOM   868  C CB  . PRO A 1 116 ? 100.957 72.466 35.772  1.00 37.52  ? 113  PRO A CB  1 
ATOM   869  C CG  . PRO A 1 116 ? 101.128 73.495 36.857  1.00 39.66  ? 113  PRO A CG  1 
ATOM   870  C CD  . PRO A 1 116 ? 102.550 73.970 36.723  1.00 43.54  ? 113  PRO A CD  1 
ATOM   871  N N   . VAL A 1 117 ? 102.376 69.949 34.141  1.00 31.65  ? 114  VAL A N   1 
ATOM   872  C CA  . VAL A 1 117 ? 102.729 69.228 32.927  1.00 29.96  ? 114  VAL A CA  1 
ATOM   873  C C   . VAL A 1 117 ? 101.454 68.855 32.178  1.00 33.28  ? 114  VAL A C   1 
ATOM   874  O O   . VAL A 1 117 ? 100.556 68.216 32.744  1.00 29.76  ? 114  VAL A O   1 
ATOM   875  C CB  . VAL A 1 117 ? 103.546 67.966 33.256  1.00 32.36  ? 114  VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 117 ? 103.963 67.243 31.965  1.00 29.14  ? 114  VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 117 ? 104.768 68.302 34.146  1.00 27.71  ? 114  VAL A CG2 1 
ATOM   878  N N   . LEU A 1 118 ? 101.384 69.247 30.905  1.00 30.89  ? 115  LEU A N   1 
ATOM   879  C CA  . LEU A 1 118 ? 100.379 68.765 29.959  1.00 27.83  ? 115  LEU A CA  1 
ATOM   880  C C   . LEU A 1 118 ? 101.005 67.695 29.078  1.00 27.96  ? 115  LEU A C   1 
ATOM   881  O O   . LEU A 1 118 ? 102.072 67.917 28.496  1.00 26.46  ? 115  LEU A O   1 
ATOM   882  C CB  . LEU A 1 118 ? 99.857  69.908 29.088  1.00 27.83  ? 115  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 118 ? 98.786  70.782 29.729  1.00 27.27  ? 115  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 118 ? 98.652  72.098 28.988  1.00 28.49  ? 115  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 118 ? 97.476  70.017 29.707  1.00 29.23  ? 115  LEU A CD2 1 
ATOM   886  N N   . VAL A 1 119 ? 100.344 66.546 28.977  1.00 25.61  ? 116  VAL A N   1 
ATOM   887  C CA  . VAL A 1 119 ? 100.825 65.408 28.201  1.00 19.95  ? 116  VAL A CA  1 
ATOM   888  C C   . VAL A 1 119 ? 99.789  65.118 27.107  1.00 28.63  ? 116  VAL A C   1 
ATOM   889  O O   . VAL A 1 119 ? 98.658  64.694 27.402  1.00 23.52  ? 116  VAL A O   1 
ATOM   890  C CB  . VAL A 1 119 ? 101.058 64.175 29.080  1.00 20.60  ? 116  VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 119 ? 101.517 62.978 28.235  1.00 15.47  ? 116  VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 119 ? 102.039 64.486 30.194  1.00 23.72  ? 116  VAL A CG2 1 
ATOM   893  N N   . TRP A 1 120 ? 100.182 65.331 25.847  1.00 20.42  ? 117  TRP A N   1 
ATOM   894  C CA  . TRP A 1 120 ? 99.341  65.103 24.681  1.00 19.33  ? 117  TRP A CA  1 
ATOM   895  C C   . TRP A 1 120 ? 99.433  63.665 24.183  1.00 24.41  ? 117  TRP A C   1 
ATOM   896  O O   . TRP A 1 120 ? 100.536 63.139 23.991  1.00 23.03  ? 117  TRP A O   1 
ATOM   897  C CB  . TRP A 1 120 ? 99.750  66.051 23.573  1.00 18.69  ? 117  TRP A CB  1 
ATOM   898  C CG  . TRP A 1 120 ? 98.981  65.876 22.318  1.00 26.34  ? 117  TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 120 ? 99.460  65.437 21.124  1.00 19.97  ? 117  TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 120 ? 97.585  66.154 22.114  1.00 25.80  ? 117  TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 120 ? 98.459  65.428 20.184  1.00 22.59  ? 117  TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 120 ? 97.296  65.860 20.762  1.00 21.92  ? 117  TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 120 ? 96.559  66.630 22.934  1.00 23.95  ? 117  TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 120 ? 96.031  66.030 20.215  1.00 20.73  ? 117  TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 120 ? 95.291  66.794 22.391  1.00 23.61  ? 117  TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 120 ? 95.039  66.496 21.043  1.00 22.64  ? 117  TRP A CH2 1 
ATOM   907  N N   . ILE A 1 121 ? 98.272  63.043 23.958  1.00 16.66  ? 118  ILE A N   1 
ATOM   908  C CA  . ILE A 1 121 ? 98.155  61.747 23.291  1.00 18.53  ? 118  ILE A CA  1 
ATOM   909  C C   . ILE A 1 121 ? 97.352  61.947 22.016  1.00 23.92  ? 118  ILE A C   1 
ATOM   910  O O   . ILE A 1 121 ? 96.161  62.283 22.088  1.00 18.67  ? 118  ILE A O   1 
ATOM   911  C CB  . ILE A 1 121 ? 97.472  60.696 24.172  1.00 22.55  ? 118  ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 121 ? 98.172  60.597 25.528  1.00 27.67  ? 118  ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 121 ? 97.489  59.358 23.462  1.00 18.33  ? 118  ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 121 ? 97.584  59.518 26.427  1.00 26.90  ? 118  ILE A CD1 1 
ATOM   915  N N   . TYR A 1 122 ? 97.980  61.715 20.851  1.00 17.81  ? 119  TYR A N   1 
ATOM   916  C CA  . TYR A 1 122 ? 97.289  61.967 19.580  1.00 19.93  ? 119  TYR A CA  1 
ATOM   917  C C   . TYR A 1 122 ? 96.246  60.891 19.281  1.00 16.28  ? 119  TYR A C   1 
ATOM   918  O O   . TYR A 1 122 ? 96.337  59.753 19.748  1.00 16.68  ? 119  TYR A O   1 
ATOM   919  C CB  . TYR A 1 122 ? 98.270  62.064 18.395  1.00 18.03  ? 119  TYR A CB  1 
ATOM   920  C CG  . TYR A 1 122 ? 99.182  60.858 18.200  1.00 15.47  ? 119  TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 122 ? 98.707  59.671 17.633  1.00 14.07  ? 119  TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 122 ? 100.539 60.915 18.564  1.00 17.24  ? 119  TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 122 ? 99.548  58.545 17.467  1.00 15.61  ? 119  TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 122 ? 101.409 59.795 18.389  1.00 13.62  ? 119  TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 122 ? 100.917 58.628 17.841  1.00 19.99  ? 119  TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 122 ? 101.773 57.540 17.677  1.00 17.17  ? 119  TYR A OH  1 
ATOM   927  N N   . GLY A 1 123 ? 95.250  61.269 18.484  1.00 15.34  ? 120  GLY A N   1 
ATOM   928  C CA  . GLY A 1 123 ? 94.293  60.332 17.934  1.00 18.36  ? 120  GLY A CA  1 
ATOM   929  C C   . GLY A 1 123 ? 94.700  59.889 16.542  1.00 28.19  ? 120  GLY A C   1 
ATOM   930  O O   . GLY A 1 123 ? 95.843  60.085 16.107  1.00 20.57  ? 120  GLY A O   1 
ATOM   931  N N   . GLY A 1 124 ? 93.739  59.286 15.833  1.00 21.79  ? 121  GLY A N   1 
ATOM   932  C CA  . GLY A 1 124 ? 93.995  58.650 14.548  1.00 15.02  ? 121  GLY A CA  1 
ATOM   933  C C   . GLY A 1 124 ? 93.412  57.252 14.516  1.00 21.63  ? 121  GLY A C   1 
ATOM   934  O O   . GLY A 1 124 ? 93.958  56.343 13.864  1.00 18.80  ? 121  GLY A O   1 
ATOM   935  N N   . GLY A 1 125 ? 92.304  57.064 15.243  1.00 17.40  ? 122  GLY A N   1 
ATOM   936  C CA  . GLY A 1 125 ? 91.593  55.796 15.242  1.00 14.73  ? 122  GLY A CA  1 
ATOM   937  C C   . GLY A 1 125 ? 92.400  54.595 15.670  1.00 15.94  ? 122  GLY A C   1 
ATOM   938  O O   . GLY A 1 125 ? 92.057  53.465 15.307  1.00 18.32  ? 122  GLY A O   1 
ATOM   939  N N   . PHE A 1 126 ? 93.477  54.798 16.425  1.00 18.02  ? 123  PHE A N   1 
ATOM   940  C CA  . PHE A 1 126 ? 94.422  53.749 16.820  1.00 19.33  ? 123  PHE A CA  1 
ATOM   941  C C   . PHE A 1 126 ? 95.162  53.110 15.637  1.00 16.13  ? 123  PHE A C   1 
ATOM   942  O O   . PHE A 1 126 ? 95.872  52.122 15.837  1.00 16.70  ? 123  PHE A O   1 
ATOM   943  C CB  . PHE A 1 126 ? 93.751  52.633 17.658  1.00 15.84  ? 123  PHE A CB  1 
ATOM   944  C CG  . PHE A 1 126 ? 93.213  53.101 18.997  1.00 21.57  ? 123  PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 126 ? 94.082  53.406 20.050  1.00 15.66  ? 123  PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 126 ? 91.834  53.224 19.211  1.00 19.83  ? 123  PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 126 ? 93.598  53.840 21.277  1.00 20.72  ? 123  PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 126 ? 91.334  53.659 20.462  1.00 19.28  ? 123  PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 126 ? 92.216  53.958 21.492  1.00 20.50  ? 123  PHE A CZ  1 
ATOM   950  N N   . TYR A 1 127 ? 95.014  53.623 14.402  1.00 13.61  ? 124  TYR A N   1 
ATOM   951  C CA  . TYR A 1 127 ? 95.752  53.076 13.259  1.00 17.17  ? 124  TYR A CA  1 
ATOM   952  C C   . TYR A 1 127 ? 96.719  54.076 12.643  1.00 15.61  ? 124  TYR A C   1 
ATOM   953  O O   . TYR A 1 127 ? 97.452  53.718 11.714  1.00 19.40  ? 124  TYR A O   1 
ATOM   954  C CB  . TYR A 1 127 ? 94.798  52.578 12.146  1.00 18.88  ? 124  TYR A CB  1 
ATOM   955  C CG  . TYR A 1 127 ? 94.145  53.715 11.391  1.00 17.74  ? 124  TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 127 ? 94.750  54.277 10.265  1.00 21.98  ? 124  TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 127 ? 92.941  54.256 11.827  1.00 18.32  ? 124  TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 127 ? 94.174  55.358 9.603   1.00 18.79  ? 124  TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 127 ? 92.355  55.309 11.162  1.00 20.06  ? 124  TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 127 ? 92.974  55.859 10.061  1.00 25.91  ? 124  TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 127 ? 92.381  56.916 9.417   1.00 24.76  ? 124  TYR A OH  1 
ATOM   962  N N   . SER A 1 128 ? 96.708  55.322 13.093  1.00 18.01  ? 125  SER A N   1 
ATOM   963  C CA  . SER A 1 128 ? 97.523  56.364 12.501  1.00 18.78  ? 125  SER A CA  1 
ATOM   964  C C   . SER A 1 128 ? 97.812  57.409 13.568  1.00 19.19  ? 125  SER A C   1 
ATOM   965  O O   . SER A 1 128 ? 97.274  57.362 14.682  1.00 18.33  ? 125  SER A O   1 
ATOM   966  C CB  . SER A 1 128 ? 96.807  57.006 11.317  1.00 19.54  ? 125  SER A CB  1 
ATOM   967  O OG  . SER A 1 128 ? 95.604  57.633 11.763  1.00 14.60  ? 125  SER A OG  1 
ATOM   968  N N   . GLY A 1 129 ? 98.633  58.382 13.192  1.00 14.27  ? 126  GLY A N   1 
ATOM   969  C CA  . GLY A 1 129 ? 98.978  59.486 14.071  1.00 19.58  ? 126  GLY A CA  1 
ATOM   970  C C   . GLY A 1 129 ? 100.469 59.586 14.348  1.00 19.01  ? 126  GLY A C   1 
ATOM   971  O O   . GLY A 1 129 ? 101.197 58.597 14.212  1.00 19.94  ? 126  GLY A O   1 
ATOM   972  N N   . ALA A 1 130 ? 100.924 60.774 14.749  1.00 19.07  ? 127  ALA A N   1 
ATOM   973  C CA  . ALA A 1 130 ? 102.317 61.038 15.088  1.00 20.80  ? 127  ALA A CA  1 
ATOM   974  C C   . ALA A 1 130 ? 102.390 62.274 15.975  1.00 15.98  ? 127  ALA A C   1 
ATOM   975  O O   . ALA A 1 130 ? 101.622 63.221 15.798  1.00 18.01  ? 127  ALA A O   1 
ATOM   976  C CB  . ALA A 1 130 ? 103.170 61.261 13.828  1.00 17.70  ? 127  ALA A CB  1 
ATOM   977  N N   . SER A 1 131 ? 103.353 62.291 16.905  1.00 20.40  ? 128  SER A N   1 
ATOM   978  C CA  . SER A 1 131 ? 103.498 63.493 17.732  1.00 21.42  ? 128  SER A CA  1 
ATOM   979  C C   . SER A 1 131 ? 104.173 64.638 16.993  1.00 18.65  ? 128  SER A C   1 
ATOM   980  O O   . SER A 1 131 ? 104.160 65.776 17.487  1.00 18.97  ? 128  SER A O   1 
ATOM   981  C CB  . SER A 1 131 ? 104.270 63.181 19.018  1.00 22.95  ? 128  SER A CB  1 
ATOM   982  O OG  . SER A 1 131 ? 105.532 62.628 18.718  1.00 20.80  ? 128  SER A OG  1 
ATOM   983  N N   . SER A 1 132 ? 104.708 64.382 15.799  1.00 22.34  ? 129  SER A N   1 
ATOM   984  C CA  . SER A 1 132 ? 105.432 65.380 15.022  1.00 19.28  ? 129  SER A CA  1 
ATOM   985  C C   . SER A 1 132 ? 104.540 66.241 14.133  1.00 23.20  ? 129  SER A C   1 
ATOM   986  O O   . SER A 1 132 ? 105.053 67.168 13.488  1.00 18.26  ? 129  SER A O   1 
ATOM   987  C CB  . SER A 1 132 ? 106.474 64.682 14.137  1.00 19.95  ? 129  SER A CB  1 
ATOM   988  O OG  . SER A 1 132 ? 105.899 63.637 13.363  1.00 18.79  ? 129  SER A OG  1 
ATOM   989  N N   . LEU A 1 133 ? 103.241 65.949 14.042  1.00 16.56  ? 130  LEU A N   1 
ATOM   990  C CA  . LEU A 1 133 ? 102.389 66.692 13.113  1.00 19.21  ? 130  LEU A CA  1 
ATOM   991  C C   . LEU A 1 133 ? 102.401 68.179 13.441  1.00 17.41  ? 130  LEU A C   1 
ATOM   992  O O   . LEU A 1 133 ? 102.374 68.568 14.612  1.00 17.24  ? 130  LEU A O   1 
ATOM   993  C CB  . LEU A 1 133 ? 100.943 66.167 13.148  1.00 14.78  ? 130  LEU A CB  1 
ATOM   994  C CG  . LEU A 1 133 ? 100.692 64.699 12.786  1.00 19.31  ? 130  LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 133 ? 99.178  64.391 12.777  1.00 15.51  ? 130  LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 133 ? 101.341 64.352 11.447  1.00 19.09  ? 130  LEU A CD2 1 
ATOM   997  N N   . ASP A 1 134 ? 102.413 69.015 12.389  1.00 19.29  ? 131  ASP A N   1 
ATOM   998  C CA  . ASP A 1 134 ? 102.468 70.468 12.581  1.00 23.29  ? 131  ASP A CA  1 
ATOM   999  C C   . ASP A 1 134 ? 101.369 70.965 13.508  1.00 27.51  ? 131  ASP A C   1 
ATOM   1000 O O   . ASP A 1 134 ? 101.563 71.934 14.252  1.00 22.88  ? 131  ASP A O   1 
ATOM   1001 C CB  . ASP A 1 134 ? 102.348 71.198 11.241  1.00 19.03  ? 131  ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 134 ? 103.550 70.982 10.345  1.00 23.41  ? 131  ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 134 ? 104.571 70.409 10.805  1.00 24.27  ? 131  ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 134 ? 103.470 71.392 9.180   1.00 30.54  ? 131  ASP A OD2 1 
ATOM   1005 N N   . VAL A 1 135 ? 100.192 70.335 13.451  1.00 23.18  ? 132  VAL A N   1 
ATOM   1006 C CA  . VAL A 1 135 ? 99.054  70.805 14.230  1.00 24.59  ? 132  VAL A CA  1 
ATOM   1007 C C   . VAL A 1 135 ? 99.219  70.498 15.716  1.00 20.18  ? 132  VAL A C   1 
ATOM   1008 O O   . VAL A 1 135 ? 98.457  71.007 16.537  1.00 20.37  ? 132  VAL A O   1 
ATOM   1009 C CB  . VAL A 1 135 ? 97.762  70.223 13.600  1.00 24.61  ? 132  VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 135 ? 97.606  68.737 13.896  1.00 19.12  ? 132  VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 135 ? 96.546  70.989 14.046  1.00 24.01  ? 132  VAL A CG2 1 
ATOM   1012 N N   . TYR A 1 136 ? 100.232 69.718 16.100  1.00 20.83  ? 133  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 136 ? 100.524 69.487 17.510  1.00 20.50  ? 133  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 136 ? 101.764 70.250 17.995  1.00 23.53  ? 133  TYR A C   1 
ATOM   1015 O O   . TYR A 1 136 ? 102.352 69.879 19.015  1.00 27.53  ? 133  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 136 ? 100.697 67.998 17.774  1.00 18.01  ? 133  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 136 ? 99.561  67.098 17.278  1.00 23.44  ? 133  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 136 ? 98.226  67.546 17.230  1.00 17.44  ? 133  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 136 ? 99.829  65.798 16.877  1.00 16.47  ? 133  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 136 ? 97.205  66.706 16.790  1.00 19.58  ? 133  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 136 ? 98.827  64.959 16.430  1.00 22.45  ? 133  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 136 ? 97.511  65.414 16.397  1.00 22.42  ? 133  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 136 ? 96.535  64.557 15.954  1.00 17.40  ? 133  TYR A OH  1 
ATOM   1024 N N   . ASP A 1 137 ? 102.184 71.288 17.271  1.00 25.24  ? 134  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 137 ? 103.351 72.082 17.645  1.00 25.60  ? 134  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 137 ? 103.150 72.725 19.016  1.00 24.66  ? 134  ASP A C   1 
ATOM   1027 O O   . ASP A 1 137 ? 102.380 73.676 19.159  1.00 24.05  ? 134  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 137 ? 103.613 73.143 16.571  1.00 27.83  ? 134  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 137 ? 104.936 73.899 16.775  1.00 32.72  ? 134  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 137 ? 105.612 73.716 17.818  1.00 31.88  ? 134  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 137 ? 105.268 74.709 15.888  1.00 28.32  ? 134  ASP A OD2 1 
ATOM   1032 N N   . GLY A 1 138 ? 103.848 72.231 20.031  1.00 27.42  ? 135  GLY A N   1 
ATOM   1033 C CA  . GLY A 1 138 ? 103.627 72.730 21.377  1.00 25.71  ? 135  GLY A CA  1 
ATOM   1034 C C   . GLY A 1 138 ? 104.227 74.085 21.706  1.00 30.24  ? 135  GLY A C   1 
ATOM   1035 O O   . GLY A 1 138 ? 104.121 74.517 22.857  1.00 29.97  ? 135  GLY A O   1 
ATOM   1036 N N   . ARG A 1 139 ? 104.820 74.789 20.746  1.00 29.13  ? 136  ARG A N   1 
ATOM   1037 C CA  . ARG A 1 139 ? 105.569 75.991 21.100  1.00 33.03  ? 136  ARG A CA  1 
ATOM   1038 C C   . ARG A 1 139 ? 104.655 77.105 21.607  1.00 30.89  ? 136  ARG A C   1 
ATOM   1039 O O   . ARG A 1 139 ? 105.003 77.806 22.562  1.00 32.42  ? 136  ARG A O   1 
ATOM   1040 C CB  . ARG A 1 139 ? 106.409 76.464 19.909  1.00 21.42  ? 136  ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 139 ? 105.687 77.272 18.861  1.00 30.87  ? 136  ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 139 ? 106.632 77.637 17.742  1.00 26.09  ? 136  ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 139 ? 107.153 76.441 17.091  1.00 24.22  ? 136  ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 139 ? 108.208 76.420 16.281  1.00 34.26  ? 136  ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 139 ? 108.888 77.532 16.046  1.00 30.18  ? 136  ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 139 ? 108.590 75.280 15.713  1.00 32.92  ? 136  ARG A NH2 1 
ATOM   1047 N N   . PHE A 1 140 ? 103.490 77.297 20.989  1.00 30.11  ? 137  PHE A N   1 
ATOM   1048 C CA  . PHE A 1 140 ? 102.675 78.448 21.360  1.00 28.51  ? 137  PHE A CA  1 
ATOM   1049 C C   . PHE A 1 140 ? 101.988 78.244 22.707  1.00 29.08  ? 137  PHE A C   1 
ATOM   1050 O O   . PHE A 1 140 ? 101.781 79.211 23.450  1.00 24.25  ? 137  PHE A O   1 
ATOM   1051 C CB  . PHE A 1 140 ? 101.660 78.753 20.264  1.00 26.69  ? 137  PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 140 ? 102.280 78.898 18.910  1.00 31.34  ? 137  PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 140 ? 102.886 80.088 18.533  1.00 32.18  ? 137  PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 140 ? 102.289 77.841 18.026  1.00 31.11  ? 137  PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 140 ? 103.480 80.223 17.284  1.00 35.25  ? 137  PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 140 ? 102.890 77.963 16.767  1.00 30.36  ? 137  PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 140 ? 103.482 79.155 16.398  1.00 31.42  ? 137  PHE A CZ  1 
ATOM   1058 N N   . LEU A 1 141 ? 101.642 77.007 23.047  1.00 33.66  ? 138  LEU A N   1 
ATOM   1059 C CA  . LEU A 1 141 ? 101.019 76.747 24.339  1.00 31.50  ? 138  LEU A CA  1 
ATOM   1060 C C   . LEU A 1 141 ? 102.011 76.969 25.468  1.00 32.50  ? 138  LEU A C   1 
ATOM   1061 O O   . LEU A 1 141 ? 101.663 77.513 26.526  1.00 30.88  ? 138  LEU A O   1 
ATOM   1062 C CB  . LEU A 1 141 ? 100.483 75.317 24.364  1.00 24.57  ? 138  LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 141 ? 99.769  74.751 25.583  1.00 34.43  ? 138  LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 141 ? 98.447  75.468 25.819  1.00 32.13  ? 138  LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 141 ? 99.547  73.260 25.373  1.00 33.63  ? 138  LEU A CD2 1 
ATOM   1066 N N   . VAL A 1 142 ? 103.250 76.531 25.266  1.00 32.68  ? 139  VAL A N   1 
ATOM   1067 C CA  . VAL A 1 142 ? 104.249 76.624 26.314  1.00 29.32  ? 139  VAL A CA  1 
ATOM   1068 C C   . VAL A 1 142 ? 104.681 78.076 26.505  1.00 31.72  ? 139  VAL A C   1 
ATOM   1069 O O   . VAL A 1 142 ? 104.799 78.562 27.632  1.00 33.40  ? 139  VAL A O   1 
ATOM   1070 C CB  . VAL A 1 142 ? 105.418 75.679 25.986  1.00 30.91  ? 139  VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 142 ? 106.645 75.998 26.827  1.00 28.36  ? 139  VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 142 ? 104.981 74.239 26.226  1.00 24.75  ? 139  VAL A CG2 1 
ATOM   1073 N N   . GLN A 1 143 ? 104.845 78.815 25.419  1.00 31.01  ? 140  GLN A N   1 
ATOM   1074 C CA  . GLN A 1 143 ? 105.223 80.214 25.559  1.00 34.74  ? 140  GLN A CA  1 
ATOM   1075 C C   . GLN A 1 143 ? 104.123 81.014 26.240  1.00 36.70  ? 140  GLN A C   1 
ATOM   1076 O O   . GLN A 1 143 ? 104.392 81.788 27.161  1.00 39.27  ? 140  GLN A O   1 
ATOM   1077 C CB  . GLN A 1 143 ? 105.542 80.816 24.194  1.00 30.59  ? 140  GLN A CB  1 
ATOM   1078 C CG  . GLN A 1 143 ? 106.241 82.153 24.260  1.00 35.87  ? 140  GLN A CG  1 
ATOM   1079 C CD  . GLN A 1 143 ? 105.310 83.306 24.584  1.00 41.49  ? 140  GLN A CD  1 
ATOM   1080 O OE1 . GLN A 1 143 ? 104.118 83.274 24.265  1.00 42.68  ? 140  GLN A OE1 1 
ATOM   1081 N NE2 . GLN A 1 143 ? 105.852 84.332 25.232  1.00 44.29  ? 140  GLN A NE2 1 
ATOM   1082 N N   . ALA A 1 144 ? 102.877 80.853 25.780  1.00 35.81  ? 141  ALA A N   1 
ATOM   1083 C CA  . ALA A 1 144 ? 101.783 81.703 26.239  1.00 34.49  ? 141  ALA A CA  1 
ATOM   1084 C C   . ALA A 1 144 ? 101.385 81.411 27.680  1.00 35.00  ? 141  ALA A C   1 
ATOM   1085 O O   . ALA A 1 144 ? 101.003 82.332 28.411  1.00 34.31  ? 141  ALA A O   1 
ATOM   1086 C CB  . ALA A 1 144 ? 100.576 81.547 25.321  1.00 30.83  ? 141  ALA A CB  1 
ATOM   1087 N N   . GLU A 1 145 ? 101.469 80.156 28.113  1.00 29.81  ? 142  GLU A N   1 
ATOM   1088 C CA  . GLU A 1 145 ? 100.934 79.764 29.404  1.00 31.76  ? 142  GLU A CA  1 
ATOM   1089 C C   . GLU A 1 145 ? 101.982 79.173 30.321  1.00 35.87  ? 142  GLU A C   1 
ATOM   1090 O O   . GLU A 1 145 ? 101.638 78.752 31.431  1.00 33.57  ? 142  GLU A O   1 
ATOM   1091 C CB  . GLU A 1 145 ? 99.784  78.760 29.225  1.00 35.28  ? 142  GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 145 ? 98.531  79.356 28.590  1.00 34.81  ? 142  GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 145 ? 97.860  80.391 29.481  1.00 38.65  ? 142  GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 145 ? 97.720  80.119 30.692  1.00 36.29  ? 142  GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 145 ? 97.477  81.467 28.971  1.00 38.30  ? 142  GLU A OE2 1 
ATOM   1096 N N   . ARG A 1 146 ? 103.242 79.125 29.882  1.00 36.84  ? 143  ARG A N   1 
ATOM   1097 C CA  . ARG A 1 146 ? 104.387 78.739 30.711  1.00 32.54  ? 143  ARG A CA  1 
ATOM   1098 C C   . ARG A 1 146 ? 104.116 77.446 31.464  1.00 30.80  ? 143  ARG A C   1 
ATOM   1099 O O   . ARG A 1 146 ? 104.328 77.326 32.671  1.00 42.44  ? 143  ARG A O   1 
ATOM   1100 C CB  . ARG A 1 146 ? 104.793 79.872 31.648  1.00 37.06  ? 143  ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 146 ? 105.261 81.103 30.871  1.00 38.31  ? 143  ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 146 ? 106.141 82.037 31.713  1.00 38.58  ? 143  ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 146 ? 107.416 81.430 32.081  1.00 39.35  ? 143  ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 146 ? 108.540 81.573 31.382  1.00 42.10  ? 143  ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 146 ? 108.547 82.307 30.274  1.00 39.25  ? 143  ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 146 ? 109.662 80.984 31.788  1.00 41.15  ? 143  ARG A NH2 1 
ATOM   1107 N N   . THR A 1 147 ? 103.629 76.477 30.717  1.00 32.13  ? 144  THR A N   1 
ATOM   1108 C CA  . THR A 1 147 ? 103.456 75.086 31.096  1.00 32.18  ? 144  THR A CA  1 
ATOM   1109 C C   . THR A 1 147 ? 104.601 74.268 30.504  1.00 26.52  ? 144  THR A C   1 
ATOM   1110 O O   . THR A 1 147 ? 105.258 74.696 29.553  1.00 30.37  ? 144  THR A O   1 
ATOM   1111 C CB  . THR A 1 147 ? 102.111 74.592 30.548  1.00 33.49  ? 144  THR A CB  1 
ATOM   1112 O OG1 . THR A 1 147 ? 101.097 75.532 30.919  1.00 45.97  ? 144  THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 147 ? 101.750 73.228 31.079  1.00 34.98  ? 144  THR A CG2 1 
ATOM   1114 N N   . VAL A 1 148 ? 104.834 73.087 31.063  1.00 25.63  ? 145  VAL A N   1 
ATOM   1115 C CA  . VAL A 1 148 ? 105.634 72.070 30.388  1.00 32.69  ? 145  VAL A CA  1 
ATOM   1116 C C   . VAL A 1 148 ? 104.691 71.176 29.583  1.00 33.66  ? 145  VAL A C   1 
ATOM   1117 O O   . VAL A 1 148 ? 103.618 70.792 30.075  1.00 31.67  ? 145  VAL A O   1 
ATOM   1118 C CB  . VAL A 1 148 ? 106.463 71.254 31.396  1.00 28.71  ? 145  VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 148 ? 107.068 70.042 30.722  1.00 28.16  ? 145  VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 148 ? 107.575 72.118 31.986  1.00 29.31  ? 145  VAL A CG2 1 
ATOM   1121 N N   . LEU A 1 149 ? 105.070 70.864 28.336  1.00 28.47  ? 146  LEU A N   1 
ATOM   1122 C CA  . LEU A 1 149 ? 104.266 70.023 27.450  1.00 26.36  ? 146  LEU A CA  1 
ATOM   1123 C C   . LEU A 1 149 ? 105.080 68.838 26.963  1.00 26.25  ? 146  LEU A C   1 
ATOM   1124 O O   . LEU A 1 149 ? 106.172 69.015 26.412  1.00 27.98  ? 146  LEU A O   1 
ATOM   1125 C CB  . LEU A 1 149 ? 103.726 70.806 26.243  1.00 27.47  ? 146  LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 149 ? 102.963 69.932 25.223  1.00 29.42  ? 146  LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 149 ? 101.641 69.441 25.761  1.00 23.37  ? 146  LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 149 ? 102.708 70.674 23.951  1.00 32.37  ? 146  LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 150 ? 104.542 67.638 27.169  1.00 17.50  ? 147  VAL A N   1 
ATOM   1130 C CA  . VAL A 1 150 ? 105.112 66.389 26.677  1.00 21.96  ? 147  VAL A CA  1 
ATOM   1131 C C   . VAL A 1 150 ? 104.154 65.758 25.666  1.00 28.38  ? 147  VAL A C   1 
ATOM   1132 O O   . VAL A 1 150 ? 102.928 65.854 25.820  1.00 24.22  ? 147  VAL A O   1 
ATOM   1133 C CB  . VAL A 1 150 ? 105.381 65.414 27.836  1.00 19.90  ? 147  VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 150 ? 106.207 64.223 27.347  1.00 18.04  ? 147  VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 150 ? 106.083 66.139 28.977  1.00 21.84  ? 147  VAL A CG2 1 
ATOM   1136 N N   . SER A 1 151 ? 104.707 65.098 24.642  1.00 22.72  ? 148  SER A N   1 
ATOM   1137 C CA  . SER A 1 151 ? 103.911 64.264 23.742  1.00 20.83  ? 148  SER A CA  1 
ATOM   1138 C C   . SER A 1 151 ? 104.752 63.078 23.312  1.00 25.12  ? 148  SER A C   1 
ATOM   1139 O O   . SER A 1 151 ? 105.966 63.199 23.168  1.00 24.86  ? 148  SER A O   1 
ATOM   1140 C CB  . SER A 1 151 ? 103.422 65.048 22.526  1.00 19.19  ? 148  SER A CB  1 
ATOM   1141 O OG  . SER A 1 151 ? 104.484 65.441 21.652  1.00 19.52  ? 148  SER A OG  1 
ATOM   1142 N N   . MET A 1 152 ? 104.111 61.918 23.126  1.00 17.62  ? 149  MET A N   1 
ATOM   1143 C CA  . MET A 1 152 ? 104.844 60.704 22.784  1.00 17.28  ? 149  MET A CA  1 
ATOM   1144 C C   . MET A 1 152 ? 104.289 60.085 21.505  1.00 26.50  ? 149  MET A C   1 
ATOM   1145 O O   . MET A 1 152 ? 103.116 60.275 21.160  1.00 21.55  ? 149  MET A O   1 
ATOM   1146 C CB  . MET A 1 152 ? 104.814 59.660 23.925  1.00 14.99  ? 149  MET A CB  1 
ATOM   1147 C CG  . MET A 1 152 ? 103.557 58.741 24.033  1.00 21.22  ? 149  MET A CG  1 
ATOM   1148 S SD  . MET A 1 152 ? 102.048 59.694 24.294  1.00 21.71  ? 149  MET A SD  1 
ATOM   1149 C CE  . MET A 1 152 ? 102.166 60.154 26.050  1.00 23.30  ? 149  MET A CE  1 
ATOM   1150 N N   . ASN A 1 153 ? 105.153 59.373 20.781  1.00 22.04  ? 150  ASN A N   1 
ATOM   1151 C CA  . ASN A 1 153 ? 104.661 58.426 19.791  1.00 22.17  ? 150  ASN A CA  1 
ATOM   1152 C C   . ASN A 1 153 ? 104.340 57.107 20.479  1.00 20.80  ? 150  ASN A C   1 
ATOM   1153 O O   . ASN A 1 153 ? 105.001 56.722 21.447  1.00 20.38  ? 150  ASN A O   1 
ATOM   1154 C CB  . ASN A 1 153 ? 105.684 58.163 18.688  1.00 17.40  ? 150  ASN A CB  1 
ATOM   1155 C CG  . ASN A 1 153 ? 105.712 59.228 17.633  1.00 21.63  ? 150  ASN A CG  1 
ATOM   1156 O OD1 . ASN A 1 153 ? 105.021 60.256 17.714  1.00 20.85  ? 150  ASN A OD1 1 
ATOM   1157 N ND2 . ASN A 1 153 ? 106.527 58.988 16.604  1.00 20.57  ? 150  ASN A ND2 1 
ATOM   1158 N N   . TYR A 1 154 ? 103.320 56.413 19.970  1.00 18.52  ? 151  TYR A N   1 
ATOM   1159 C CA  . TYR A 1 154 ? 102.954 55.084 20.451  1.00 15.96  ? 151  TYR A CA  1 
ATOM   1160 C C   . TYR A 1 154 ? 102.573 54.251 19.234  1.00 18.64  ? 151  TYR A C   1 
ATOM   1161 O O   . TYR A 1 154 ? 102.166 54.800 18.205  1.00 18.55  ? 151  TYR A O   1 
ATOM   1162 C CB  . TYR A 1 154 ? 101.793 55.140 21.492  1.00 17.00  ? 151  TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 154 ? 100.463 55.717 20.959  1.00 17.14  ? 151  TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 154 ? 100.199 57.087 21.032  1.00 20.67  ? 151  TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 154 ? 99.491  54.892 20.382  1.00 17.11  ? 151  TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 154 ? 99.012  57.628 20.554  1.00 16.76  ? 151  TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 154 ? 98.282  55.426 19.899  1.00 17.75  ? 151  TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 154 ? 98.064  56.792 19.988  1.00 16.24  ? 151  TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 154 ? 96.920  57.351 19.501  1.00 15.97  ? 151  TYR A OH  1 
ATOM   1170 N N   . ARG A 1 155 ? 102.724 52.932 19.342  1.00 14.01  ? 152  ARG A N   1 
ATOM   1171 C CA  . ARG A 1 155 ? 102.485 52.068 18.189  1.00 18.51  ? 152  ARG A CA  1 
ATOM   1172 C C   . ARG A 1 155 ? 101.004 52.006 17.849  1.00 22.92  ? 152  ARG A C   1 
ATOM   1173 O O   . ARG A 1 155 ? 100.162 51.846 18.740  1.00 17.06  ? 152  ARG A O   1 
ATOM   1174 C CB  . ARG A 1 155 ? 102.997 50.650 18.458  1.00 19.62  ? 152  ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 155 ? 104.485 50.447 18.177  1.00 19.84  ? 152  ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 155 ? 104.981 49.110 18.743  1.00 18.74  ? 152  ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 155 ? 105.053 49.176 20.203  1.00 19.41  ? 152  ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 155 ? 105.266 48.131 20.994  1.00 21.97  ? 152  ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 155 ? 105.419 46.918 20.472  1.00 17.74  ? 152  ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 155 ? 105.304 48.306 22.315  1.00 24.93  ? 152  ARG A NH2 1 
ATOM   1181 N N   . VAL A 1 156 ? 100.691 52.085 16.547  1.00 17.72  ? 153  VAL A N   1 
ATOM   1182 C CA  . VAL A 1 156 ? 99.315  52.056 16.060  1.00 13.28  ? 153  VAL A CA  1 
ATOM   1183 C C   . VAL A 1 156 ? 99.149  50.873 15.112  1.00 20.41  ? 153  VAL A C   1 
ATOM   1184 O O   . VAL A 1 156 ? 100.110 50.172 14.775  1.00 19.32  ? 153  VAL A O   1 
ATOM   1185 C CB  . VAL A 1 156 ? 98.904  53.373 15.368  1.00 19.12  ? 153  VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 156 ? 98.925  54.505 16.366  1.00 15.48  ? 153  VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 156 ? 99.819  53.689 14.144  1.00 12.58  ? 153  VAL A CG2 1 
ATOM   1188 N N   . GLY A 1 157 ? 97.900  50.650 14.689  1.00 17.74  ? 154  GLY A N   1 
ATOM   1189 C CA  . GLY A 1 157 ? 97.571  49.542 13.799  1.00 14.54  ? 154  GLY A CA  1 
ATOM   1190 C C   . GLY A 1 157 ? 97.953  48.206 14.406  1.00 16.90  ? 154  GLY A C   1 
ATOM   1191 O O   . GLY A 1 157 ? 97.997  48.033 15.627  1.00 17.51  ? 154  GLY A O   1 
ATOM   1192 N N   . ALA A 1 158 ? 98.261  47.244 13.535  1.00 11.67  ? 155  ALA A N   1 
ATOM   1193 C CA  . ALA A 1 158 ? 98.626  45.912 14.014  1.00 17.65  ? 155  ALA A CA  1 
ATOM   1194 C C   . ALA A 1 158 ? 99.797  45.951 14.998  1.00 22.47  ? 155  ALA A C   1 
ATOM   1195 O O   . ALA A 1 158 ? 99.841  45.156 15.950  1.00 19.12  ? 155  ALA A O   1 
ATOM   1196 C CB  . ALA A 1 158 ? 98.963  45.008 12.832  1.00 16.10  ? 155  ALA A CB  1 
ATOM   1197 N N   . PHE A 1 159 ? 100.769 46.852 14.775  1.00 20.10  ? 156  PHE A N   1 
ATOM   1198 C CA  . PHE A 1 159 ? 101.973 46.881 15.613  1.00 20.77  ? 156  PHE A CA  1 
ATOM   1199 C C   . PHE A 1 159 ? 101.639 47.254 17.049  1.00 18.66  ? 156  PHE A C   1 
ATOM   1200 O O   . PHE A 1 159 ? 102.295 46.776 17.986  1.00 20.52  ? 156  PHE A O   1 
ATOM   1201 C CB  . PHE A 1 159 ? 103.004 47.850 15.016  1.00 18.49  ? 156  PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 159 ? 103.250 47.609 13.545  1.00 19.43  ? 156  PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 159 ? 104.166 46.663 13.131  1.00 20.55  ? 156  PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 159 ? 102.499 48.268 12.580  1.00 18.14  ? 156  PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 159 ? 104.379 46.414 11.767  1.00 21.98  ? 156  PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 159 ? 102.691 48.017 11.225  1.00 18.36  ? 156  PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 159 ? 103.626 47.081 10.826  1.00 20.74  ? 156  PHE A CZ  1 
ATOM   1208 N N   . GLY A 1 160 ? 100.619 48.086 17.247  1.00 20.87  ? 157  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 160 ? 100.206 48.451 18.592  1.00 21.32  ? 157  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 160 ? 99.078  47.607 19.163  1.00 24.70  ? 157  GLY A C   1 
ATOM   1211 O O   . GLY A 1 160 ? 98.934  47.512 20.385  1.00 21.45  ? 157  GLY A O   1 
ATOM   1212 N N   . PHE A 1 161 ? 98.246  46.994 18.314  1.00 20.75  ? 158  PHE A N   1 
ATOM   1213 C CA  . PHE A 1 161 ? 96.997  46.463 18.845  1.00 20.86  ? 158  PHE A CA  1 
ATOM   1214 C C   . PHE A 1 161 ? 96.545  45.153 18.228  1.00 25.24  ? 158  PHE A C   1 
ATOM   1215 O O   . PHE A 1 161 ? 95.459  44.684 18.575  1.00 24.25  ? 158  PHE A O   1 
ATOM   1216 C CB  . PHE A 1 161 ? 95.886  47.520 18.707  1.00 15.87  ? 158  PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 161 ? 96.184  48.779 19.461  1.00 20.01  ? 158  PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 161 ? 95.968  48.841 20.838  1.00 18.54  ? 158  PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 161 ? 96.731  49.882 18.816  1.00 15.48  ? 158  PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 161 ? 96.277  49.996 21.550  1.00 18.86  ? 158  PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 161 ? 97.039  51.043 19.525  1.00 14.50  ? 158  PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 161 ? 96.819  51.098 20.895  1.00 17.38  ? 158  PHE A CZ  1 
ATOM   1223 N N   . LEU A 1 162 ? 97.332  44.537 17.345  1.00 16.26  ? 159  LEU A N   1 
ATOM   1224 C CA  . LEU A 1 162 ? 97.050  43.160 16.998  1.00 21.24  ? 159  LEU A CA  1 
ATOM   1225 C C   . LEU A 1 162 ? 97.099  42.343 18.275  1.00 27.76  ? 159  LEU A C   1 
ATOM   1226 O O   . LEU A 1 162 ? 98.002  42.520 19.092  1.00 25.90  ? 159  LEU A O   1 
ATOM   1227 C CB  . LEU A 1 162 ? 98.056  42.630 15.987  1.00 20.68  ? 159  LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 162 ? 97.724  41.235 15.471  1.00 19.95  ? 159  LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 162 ? 97.920  41.157 13.961  1.00 19.73  ? 159  LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 162 ? 98.558  40.185 16.186  1.00 22.66  ? 159  LEU A CD2 1 
ATOM   1231 N N   . ALA A 1 163 ? 96.120  41.458 18.458  1.00 25.83  ? 160  ALA A N   1 
ATOM   1232 C CA  . ALA A 1 163 ? 95.979  40.741 19.719  1.00 26.67  ? 160  ALA A CA  1 
ATOM   1233 C C   . ALA A 1 163 ? 95.515  39.322 19.448  1.00 32.68  ? 160  ALA A C   1 
ATOM   1234 O O   . ALA A 1 163 ? 94.478  39.110 18.804  1.00 31.81  ? 160  ALA A O   1 
ATOM   1235 C CB  . ALA A 1 163 ? 94.997  41.464 20.646  1.00 27.42  ? 160  ALA A CB  1 
ATOM   1236 N N   . LEU A 1 164 ? 96.306  38.352 19.898  1.00 29.20  ? 161  LEU A N   1 
ATOM   1237 C CA  . LEU A 1 164 ? 95.863  36.968 20.003  1.00 28.72  ? 161  LEU A CA  1 
ATOM   1238 C C   . LEU A 1 164 ? 95.661  36.737 21.492  1.00 34.97  ? 161  LEU A C   1 
ATOM   1239 O O   . LEU A 1 164 ? 96.611  36.392 22.207  1.00 36.24  ? 161  LEU A O   1 
ATOM   1240 C CB  . LEU A 1 164 ? 96.873  35.985 19.412  1.00 35.63  ? 161  LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 164 ? 97.002  36.020 17.888  1.00 32.10  ? 161  LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 164 ? 98.071  35.064 17.435  1.00 35.97  ? 161  LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 164 ? 95.685  35.679 17.233  1.00 30.44  ? 161  LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 165 ? 94.454  36.959 22.009  1.00 34.90  ? 162  PRO A N   1 
ATOM   1245 C CA  . PRO A 1 165 ? 94.252  36.978 23.467  1.00 40.60  ? 162  PRO A CA  1 
ATOM   1246 C C   . PRO A 1 165 ? 94.717  35.697 24.152  1.00 37.33  ? 162  PRO A C   1 
ATOM   1247 O O   . PRO A 1 165 ? 94.503  34.584 23.664  1.00 33.46  ? 162  PRO A O   1 
ATOM   1248 C CB  . PRO A 1 165 ? 92.740  37.178 23.606  1.00 38.56  ? 162  PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 165 ? 92.346  37.909 22.337  1.00 32.82  ? 162  PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 165 ? 93.232  37.308 21.265  1.00 28.91  ? 162  PRO A CD  1 
ATOM   1251 N N   . GLY A 1 166 ? 95.381  35.871 25.290  1.00 45.97  ? 163  GLY A N   1 
ATOM   1252 C CA  . GLY A 1 166 ? 95.930  34.739 26.007  1.00 42.38  ? 163  GLY A CA  1 
ATOM   1253 C C   . GLY A 1 166 ? 97.410  34.549 25.751  1.00 48.05  ? 163  GLY A C   1 
ATOM   1254 O O   . GLY A 1 166 ? 98.186  34.336 26.689  1.00 48.87  ? 163  GLY A O   1 
ATOM   1255 N N   . SER A 1 167 ? 97.816  34.641 24.487  1.00 38.74  ? 164  SER A N   1 
ATOM   1256 C CA  . SER A 1 167 ? 99.194  34.351 24.120  1.00 39.03  ? 164  SER A CA  1 
ATOM   1257 C C   . SER A 1 167 ? 100.161 35.332 24.787  1.00 38.54  ? 164  SER A C   1 
ATOM   1258 O O   . SER A 1 167 ? 99.804  36.458 25.149  1.00 40.40  ? 164  SER A O   1 
ATOM   1259 C CB  . SER A 1 167 ? 99.364  34.424 22.604  1.00 43.58  ? 164  SER A CB  1 
ATOM   1260 O OG  . SER A 1 167 ? 99.427  35.784 22.185  1.00 41.39  ? 164  SER A OG  1 
ATOM   1261 N N   . ARG A 1 168 ? 101.407 34.889 24.948  1.00 40.38  ? 165  ARG A N   1 
ATOM   1262 C CA  . ARG A 1 168 ? 102.477 35.805 25.330  1.00 44.66  ? 165  ARG A CA  1 
ATOM   1263 C C   . ARG A 1 168 ? 103.110 36.505 24.132  1.00 36.50  ? 165  ARG A C   1 
ATOM   1264 O O   . ARG A 1 168 ? 103.745 37.554 24.308  1.00 35.53  ? 165  ARG A O   1 
ATOM   1265 C CB  . ARG A 1 168 ? 103.570 35.063 26.113  1.00 50.90  ? 165  ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 168 ? 103.129 34.503 27.478  1.00 69.15  ? 165  ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 168 ? 102.970 35.593 28.546  1.00 64.20  ? 165  ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 168 ? 101.567 35.861 28.870  1.00 76.09  ? 165  ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 168 ? 100.821 35.109 29.678  1.00 79.78  ? 165  ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 168 ? 101.343 34.032 30.256  1.00 79.96  ? 165  ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 168 ? 99.552  35.436 29.913  1.00 76.50  ? 165  ARG A NH2 1 
ATOM   1272 N N   . GLU A 1 169 ? 102.932 35.961 22.921  1.00 36.06  ? 166  GLU A N   1 
ATOM   1273 C CA  . GLU A 1 169 ? 103.611 36.486 21.737  1.00 39.44  ? 166  GLU A CA  1 
ATOM   1274 C C   . GLU A 1 169 ? 102.936 37.731 21.174  1.00 36.69  ? 166  GLU A C   1 
ATOM   1275 O O   . GLU A 1 169 ? 103.606 38.550 20.534  1.00 36.64  ? 166  GLU A O   1 
ATOM   1276 C CB  . GLU A 1 169 ? 103.692 35.412 20.653  1.00 38.39  ? 166  GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 169 ? 104.572 34.212 21.014  1.00 43.74  ? 166  GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 169 ? 103.803 33.081 21.689  1.00 53.07  ? 166  GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 169 ? 104.366 31.958 21.796  1.00 45.79  ? 166  GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 169 ? 102.638 33.317 22.104  1.00 50.32  ? 166  GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 170 ? 101.631 37.897 21.399  1.00 33.41  ? 167  ALA A N   1 
ATOM   1282 C CA  . ALA A 1 170 ? 100.905 39.086 20.946  1.00 31.12  ? 167  ALA A CA  1 
ATOM   1283 C C   . ALA A 1 170 ? 99.721  39.313 21.865  1.00 32.37  ? 167  ALA A C   1 
ATOM   1284 O O   . ALA A 1 170 ? 98.575  38.987 21.532  1.00 35.04  ? 167  ALA A O   1 
ATOM   1285 C CB  . ALA A 1 170 ? 100.450 38.945 19.492  1.00 27.29  ? 167  ALA A CB  1 
ATOM   1286 N N   . PRO A 1 171 ? 99.962  39.885 23.044  1.00 31.20  ? 168  PRO A N   1 
ATOM   1287 C CA  . PRO A 1 171 ? 98.888  40.009 24.040  1.00 37.23  ? 168  PRO A CA  1 
ATOM   1288 C C   . PRO A 1 171 ? 97.899  41.118 23.757  1.00 38.64  ? 168  PRO A C   1 
ATOM   1289 O O   . PRO A 1 171 ? 96.835  41.133 24.384  1.00 43.49  ? 168  PRO A O   1 
ATOM   1290 C CB  . PRO A 1 171 ? 99.654  40.309 25.332  1.00 32.56  ? 168  PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 171 ? 100.845 41.092 24.833  1.00 31.11  ? 168  PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 171 ? 101.244 40.406 23.550  1.00 32.45  ? 168  PRO A CD  1 
ATOM   1293 N N   . GLY A 1 172 ? 98.217  42.056 22.865  1.00 37.38  ? 169  GLY A N   1 
ATOM   1294 C CA  . GLY A 1 172 ? 97.363  43.193 22.601  1.00 27.48  ? 169  GLY A CA  1 
ATOM   1295 C C   . GLY A 1 172 ? 97.684  44.386 23.481  1.00 25.32  ? 169  GLY A C   1 
ATOM   1296 O O   . GLY A 1 172 ? 98.420  44.301 24.464  1.00 27.21  ? 169  GLY A O   1 
ATOM   1297 N N   . ASN A 1 173 ? 97.144  45.541 23.083  1.00 22.44  ? 170  ASN A N   1 
ATOM   1298 C CA  . ASN A 1 173 ? 97.208  46.779 23.868  1.00 23.39  ? 170  ASN A CA  1 
ATOM   1299 C C   . ASN A 1 173 ? 98.631  47.305 24.071  1.00 25.25  ? 170  ASN A C   1 
ATOM   1300 O O   . ASN A 1 173 ? 98.845  48.183 24.924  1.00 24.40  ? 170  ASN A O   1 
ATOM   1301 C CB  . ASN A 1 173 ? 96.541  46.609 25.238  1.00 22.35  ? 170  ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 173 ? 95.053  46.279 25.132  1.00 33.44  ? 170  ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 173 ? 94.356  46.773 24.240  1.00 22.72  ? 170  ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 173 ? 94.562  45.438 26.047  1.00 26.78  ? 170  ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 174 ? 99.617  46.835 23.294  1.00 25.06  ? 171  VAL A N   1 
ATOM   1306 C CA  . VAL A 1 174 ? 100.989 47.279 23.571  1.00 22.99  ? 171  VAL A CA  1 
ATOM   1307 C C   . VAL A 1 174 ? 101.154 48.760 23.252  1.00 24.01  ? 171  VAL A C   1 
ATOM   1308 O O   . VAL A 1 174 ? 101.958 49.450 23.890  1.00 23.14  ? 171  VAL A O   1 
ATOM   1309 C CB  . VAL A 1 174 ? 102.023 46.376 22.858  1.00 28.09  ? 171  VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 174 ? 101.870 44.939 23.365  1.00 22.71  ? 171  VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 174 ? 101.909 46.422 21.317  1.00 23.05  ? 171  VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 175 ? 100.337 49.307 22.346  1.00 24.95  ? 172  GLY A N   1 
ATOM   1313 C CA  . GLY A 1 175 ? 100.373 50.743 22.127  1.00 18.17  ? 172  GLY A CA  1 
ATOM   1314 C C   . GLY A 1 175 ? 99.946  51.518 23.359  1.00 23.35  ? 172  GLY A C   1 
ATOM   1315 O O   . GLY A 1 175 ? 100.449 52.621 23.631  1.00 18.90  ? 172  GLY A O   1 
ATOM   1316 N N   . LEU A 1 176 ? 98.991  50.971 24.114  1.00 22.17  ? 173  LEU A N   1 
ATOM   1317 C CA  . LEU A 1 176 ? 98.629  51.615 25.372  1.00 22.31  ? 173  LEU A CA  1 
ATOM   1318 C C   . LEU A 1 176 ? 99.769  51.482 26.383  1.00 18.03  ? 173  LEU A C   1 
ATOM   1319 O O   . LEU A 1 176 ? 100.024 52.399 27.168  1.00 21.42  ? 173  LEU A O   1 
ATOM   1320 C CB  . LEU A 1 176 ? 97.321  51.019 25.910  1.00 26.82  ? 173  LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 176 ? 96.002  51.475 25.250  1.00 26.56  ? 173  LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 176 ? 94.827  50.590 25.669  1.00 20.66  ? 173  LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 176 ? 95.707  52.914 25.599  1.00 20.43  ? 173  LEU A CD2 1 
ATOM   1324 N N   . LEU A 1 177 ? 100.478 50.355 26.352  1.00 20.48  ? 174  LEU A N   1 
ATOM   1325 C CA  . LEU A 1 177 ? 101.659 50.196 27.190  1.00 20.29  ? 174  LEU A CA  1 
ATOM   1326 C C   . LEU A 1 177 ? 102.772 51.165 26.781  1.00 27.27  ? 174  LEU A C   1 
ATOM   1327 O O   . LEU A 1 177 ? 103.469 51.710 27.649  1.00 25.36  ? 174  LEU A O   1 
ATOM   1328 C CB  . LEU A 1 177 ? 102.122 48.740 27.147  1.00 21.51  ? 174  LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 177 ? 101.144 47.798 27.855  1.00 24.41  ? 174  LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 177 ? 101.623 46.363 27.867  1.00 22.62  ? 174  LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 177 ? 100.894 48.266 29.281  1.00 21.95  ? 174  LEU A CD2 1 
ATOM   1332 N N   . ASP A 1 178 ? 102.932 51.433 25.474  1.00 20.71  ? 175  ASP A N   1 
ATOM   1333 C CA  . ASP A 1 178 ? 103.869 52.472 25.062  1.00 19.09  ? 175  ASP A CA  1 
ATOM   1334 C C   . ASP A 1 178 ? 103.525 53.786 25.744  1.00 18.16  ? 175  ASP A C   1 
ATOM   1335 O O   . ASP A 1 178 ? 104.404 54.483 26.271  1.00 23.03  ? 175  ASP A O   1 
ATOM   1336 C CB  . ASP A 1 178 ? 103.869 52.661 23.526  1.00 17.76  ? 175  ASP A CB  1 
ATOM   1337 C CG  . ASP A 1 178 ? 104.286 51.403 22.747  1.00 22.97  ? 175  ASP A CG  1 
ATOM   1338 O OD1 . ASP A 1 178 ? 104.923 50.471 23.321  1.00 20.24  ? 175  ASP A OD1 1 
ATOM   1339 O OD2 . ASP A 1 178 ? 103.969 51.349 21.529  1.00 20.58  ? 175  ASP A OD2 1 
ATOM   1340 N N   . GLN A 1 179 ? 102.244 54.159 25.719  1.00 22.65  ? 176  GLN A N   1 
ATOM   1341 C CA  . GLN A 1 179 ? 101.821 55.422 26.323  1.00 23.19  ? 176  GLN A CA  1 
ATOM   1342 C C   . GLN A 1 179 ? 102.113 55.433 27.821  1.00 21.07  ? 176  GLN A C   1 
ATOM   1343 O O   . GLN A 1 179 ? 102.515 56.457 28.376  1.00 21.49  ? 176  GLN A O   1 
ATOM   1344 C CB  . GLN A 1 179 ? 100.328 55.658 26.084  1.00 21.13  ? 176  GLN A CB  1 
ATOM   1345 C CG  . GLN A 1 179 ? 99.880  55.745 24.640  1.00 20.79  ? 176  GLN A CG  1 
ATOM   1346 C CD  . GLN A 1 179 ? 98.347  55.805 24.536  1.00 26.37  ? 176  GLN A CD  1 
ATOM   1347 O OE1 . GLN A 1 179 ? 97.655  55.922 25.557  1.00 22.39  ? 176  GLN A OE1 1 
ATOM   1348 N NE2 . GLN A 1 179 ? 97.817  55.717 23.308  1.00 15.40  ? 176  GLN A NE2 1 
ATOM   1349 N N   . ARG A 1 180 ? 101.916 54.300 28.489  1.00 19.78  ? 177  ARG A N   1 
ATOM   1350 C CA  . ARG A 1 180 ? 102.149 54.249 29.924  1.00 26.76  ? 177  ARG A CA  1 
ATOM   1351 C C   . ARG A 1 180 ? 103.631 54.418 30.232  1.00 25.62  ? 177  ARG A C   1 
ATOM   1352 O O   . ARG A 1 180 ? 104.004 55.204 31.111  1.00 25.25  ? 177  ARG A O   1 
ATOM   1353 C CB  . ARG A 1 180 ? 101.621 52.936 30.491  1.00 26.40  ? 177  ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 180 ? 101.930 52.729 31.974  1.00 32.59  ? 177  ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 180 ? 101.521 51.334 32.400  1.00 25.82  ? 177  ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 180 ? 100.066 51.268 32.516  1.00 30.66  ? 177  ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 180 ? 99.364  50.141 32.604  1.00 31.04  ? 177  ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 180 ? 99.973  48.963 32.585  1.00 29.10  ? 177  ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 180 ? 98.040  50.200 32.702  1.00 28.21  ? 177  ARG A NH2 1 
ATOM   1360 N N   . LEU A 1 181 ? 104.486 53.710 29.486  1.00 26.53  ? 178  LEU A N   1 
ATOM   1361 C CA  . LEU A 1 181 ? 105.926 53.848 29.663  1.00 27.20  ? 178  LEU A CA  1 
ATOM   1362 C C   . LEU A 1 181 ? 106.329 55.304 29.546  1.00 22.68  ? 178  LEU A C   1 
ATOM   1363 O O   . LEU A 1 181 ? 107.068 55.822 30.393  1.00 30.59  ? 178  LEU A O   1 
ATOM   1364 C CB  . LEU A 1 181 ? 106.670 52.968 28.658  1.00 22.82  ? 178  LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 181 ? 108.195 52.871 28.775  1.00 30.90  ? 178  LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 181 ? 108.598 52.261 30.127  1.00 27.98  ? 178  LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 181 ? 108.759 52.045 27.637  1.00 21.88  ? 178  LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 182 ? 105.777 56.009 28.557  1.00 22.74  ? 179  ALA A N   1 
ATOM   1369 C CA  . ALA A 1 182 ? 106.021 57.444 28.436  1.00 21.62  ? 179  ALA A CA  1 
ATOM   1370 C C   . ALA A 1 182 ? 105.553 58.218 29.664  1.00 26.00  ? 179  ALA A C   1 
ATOM   1371 O O   . ALA A 1 182 ? 106.152 59.243 30.012  1.00 24.15  ? 179  ALA A O   1 
ATOM   1372 C CB  . ALA A 1 182 ? 105.329 57.999 27.195  1.00 16.17  ? 179  ALA A CB  1 
ATOM   1373 N N   . LEU A 1 183 ? 104.461 57.783 30.306  1.00 28.09  ? 180  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 183 ? 104.002 58.495 31.498  1.00 30.65  ? 180  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 183 ? 104.919 58.201 32.684  1.00 22.56  ? 180  LEU A C   1 
ATOM   1376 O O   . LEU A 1 183 ? 105.191 59.086 33.503  1.00 24.72  ? 180  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 183 ? 102.539 58.129 31.817  1.00 22.98  ? 180  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 183 ? 101.483 58.448 30.743  1.00 26.65  ? 180  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 183 ? 100.091 58.004 31.167  1.00 27.67  ? 180  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 183 ? 101.482 59.919 30.411  1.00 24.57  ? 180  LEU A CD2 1 
ATOM   1381 N N   . GLN A 1 184 ? 105.395 56.962 32.790  1.00 18.46  ? 181  GLN A N   1 
ATOM   1382 C CA  . GLN A 1 184 ? 106.431 56.640 33.765  1.00 23.37  ? 181  GLN A CA  1 
ATOM   1383 C C   . GLN A 1 184 ? 107.683 57.483 33.540  1.00 30.58  ? 181  GLN A C   1 
ATOM   1384 O O   . GLN A 1 184 ? 108.319 57.935 34.500  1.00 32.94  ? 181  GLN A O   1 
ATOM   1385 C CB  . GLN A 1 184 ? 106.754 55.155 33.687  1.00 22.14  ? 181  GLN A CB  1 
ATOM   1386 C CG  . GLN A 1 184 ? 105.639 54.280 34.220  1.00 32.37  ? 181  GLN A CG  1 
ATOM   1387 C CD  . GLN A 1 184 ? 105.782 52.836 33.804  1.00 36.27  ? 181  GLN A CD  1 
ATOM   1388 O OE1 . GLN A 1 184 ? 106.662 52.491 33.009  1.00 37.53  ? 181  GLN A OE1 1 
ATOM   1389 N NE2 . GLN A 1 184 ? 104.916 51.976 34.336  1.00 37.20  ? 181  GLN A NE2 1 
ATOM   1390 N N   . TRP A 1 185 ? 108.028 57.740 32.273  1.00 27.65  ? 182  TRP A N   1 
ATOM   1391 C CA  . TRP A 1 185 ? 109.187 58.569 31.968  1.00 25.84  ? 182  TRP A CA  1 
ATOM   1392 C C   . TRP A 1 185 ? 108.979 60.000 32.430  1.00 29.41  ? 182  TRP A C   1 
ATOM   1393 O O   . TRP A 1 185 ? 109.932 60.661 32.866  1.00 27.45  ? 182  TRP A O   1 
ATOM   1394 C CB  . TRP A 1 185 ? 109.473 58.533 30.463  1.00 25.76  ? 182  TRP A CB  1 
ATOM   1395 C CG  . TRP A 1 185 ? 110.769 59.159 30.041  1.00 20.94  ? 182  TRP A CG  1 
ATOM   1396 C CD1 . TRP A 1 185 ? 111.944 58.501 29.737  1.00 23.06  ? 182  TRP A CD1 1 
ATOM   1397 C CD2 . TRP A 1 185 ? 111.021 60.550 29.803  1.00 19.87  ? 182  TRP A CD2 1 
ATOM   1398 N NE1 . TRP A 1 185 ? 112.908 59.411 29.354  1.00 22.02  ? 182  TRP A NE1 1 
ATOM   1399 C CE2 . TRP A 1 185 ? 112.372 60.669 29.386  1.00 19.26  ? 182  TRP A CE2 1 
ATOM   1400 C CE3 . TRP A 1 185 ? 110.244 61.702 29.889  1.00 18.74  ? 182  TRP A CE3 1 
ATOM   1401 C CZ2 . TRP A 1 185 ? 112.949 61.895 29.078  1.00 19.17  ? 182  TRP A CZ2 1 
ATOM   1402 C CZ3 . TRP A 1 185 ? 110.826 62.922 29.586  1.00 19.40  ? 182  TRP A CZ3 1 
ATOM   1403 C CH2 . TRP A 1 185 ? 112.161 63.009 29.180  1.00 19.21  ? 182  TRP A CH2 1 
ATOM   1404 N N   . VAL A 1 186 ? 107.757 60.522 32.300  1.00 24.28  ? 183  VAL A N   1 
ATOM   1405 C CA  . VAL A 1 186 ? 107.515 61.885 32.765  1.00 24.84  ? 183  VAL A CA  1 
ATOM   1406 C C   . VAL A 1 186 ? 107.673 61.952 34.281  1.00 30.39  ? 183  VAL A C   1 
ATOM   1407 O O   . VAL A 1 186 ? 108.197 62.931 34.832  1.00 26.28  ? 183  VAL A O   1 
ATOM   1408 C CB  . VAL A 1 186 ? 106.124 62.364 32.306  1.00 28.60  ? 183  VAL A CB  1 
ATOM   1409 C CG1 . VAL A 1 186 ? 105.758 63.717 32.936  1.00 23.99  ? 183  VAL A CG1 1 
ATOM   1410 C CG2 . VAL A 1 186 ? 106.080 62.453 30.779  1.00 23.30  ? 183  VAL A CG2 1 
ATOM   1411 N N   . GLN A 1 187 ? 107.253 60.896 34.974  1.00 27.82  ? 184  GLN A N   1 
ATOM   1412 C CA  . GLN A 1 187 ? 107.398 60.861 36.424  1.00 37.96  ? 184  GLN A CA  1 
ATOM   1413 C C   . GLN A 1 187 ? 108.866 60.931 36.823  1.00 35.67  ? 184  GLN A C   1 
ATOM   1414 O O   . GLN A 1 187 ? 109.243 61.698 37.718  1.00 39.44  ? 184  GLN A O   1 
ATOM   1415 C CB  . GLN A 1 187 ? 106.736 59.597 36.987  1.00 31.59  ? 184  GLN A CB  1 
ATOM   1416 C CG  . GLN A 1 187 ? 105.214 59.690 37.094  1.00 31.26  ? 184  GLN A CG  1 
ATOM   1417 C CD  . GLN A 1 187 ? 104.768 60.929 37.838  1.00 33.77  ? 184  GLN A CD  1 
ATOM   1418 O OE1 . GLN A 1 187 ? 105.097 61.118 39.009  1.00 34.08  ? 184  GLN A OE1 1 
ATOM   1419 N NE2 . GLN A 1 187 ? 104.029 61.790 37.159  1.00 32.88  ? 184  GLN A NE2 1 
ATOM   1420 N N   . GLU A 1 188 ? 109.715 60.183 36.126  1.00 35.25  ? 185  GLU A N   1 
ATOM   1421 C CA  . GLU A 1 188 ? 111.118 60.063 36.493  1.00 33.95  ? 185  GLU A CA  1 
ATOM   1422 C C   . GLU A 1 188 ? 112.000 61.180 35.952  1.00 32.86  ? 185  GLU A C   1 
ATOM   1423 O O   . GLU A 1 188 ? 113.122 61.334 36.441  1.00 41.72  ? 185  GLU A O   1 
ATOM   1424 C CB  . GLU A 1 188 ? 111.659 58.719 36.020  1.00 33.94  ? 185  GLU A CB  1 
ATOM   1425 C CG  . GLU A 1 188 ? 110.915 57.537 36.597  1.00 36.80  ? 185  GLU A CG  1 
ATOM   1426 C CD  . GLU A 1 188 ? 111.526 56.225 36.155  1.00 44.73  ? 185  GLU A CD  1 
ATOM   1427 O OE1 . GLU A 1 188 ? 111.088 55.150 36.624  1.00 45.07  ? 185  GLU A OE1 1 
ATOM   1428 O OE2 . GLU A 1 188 ? 112.457 56.282 35.329  1.00 43.93  ? 185  GLU A OE2 1 
ATOM   1429 N N   . ASN A 1 189 ? 111.542 61.976 34.986  1.00 26.73  ? 186  ASN A N   1 
ATOM   1430 C CA  . ASN A 1 189 ? 112.474 62.885 34.320  1.00 23.89  ? 186  ASN A CA  1 
ATOM   1431 C C   . ASN A 1 189 ? 111.954 64.281 34.099  1.00 25.70  ? 186  ASN A C   1 
ATOM   1432 O O   . ASN A 1 189 ? 112.758 65.156 33.765  1.00 26.53  ? 186  ASN A O   1 
ATOM   1433 C CB  . ASN A 1 189 ? 112.897 62.330 32.949  1.00 29.30  ? 186  ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 189 ? 113.586 60.993 33.054  1.00 28.97  ? 186  ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 189 ? 114.711 60.903 33.543  1.00 37.05  ? 186  ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 189 ? 112.937 59.953 32.569  1.00 25.03  ? 186  ASN A ND2 1 
ATOM   1437 N N   . VAL A 1 190 ? 110.655 64.535 34.234  1.00 21.98  ? 187  VAL A N   1 
ATOM   1438 C CA  . VAL A 1 190 ? 110.171 65.834 33.793  1.00 23.46  ? 187  VAL A CA  1 
ATOM   1439 C C   . VAL A 1 190 ? 110.655 66.938 34.713  1.00 26.57  ? 187  VAL A C   1 
ATOM   1440 O O   . VAL A 1 190 ? 110.709 68.104 34.295  1.00 27.03  ? 187  VAL A O   1 
ATOM   1441 C CB  . VAL A 1 190 ? 108.633 65.839 33.681  1.00 26.15  ? 187  VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 190 ? 107.977 65.992 35.074  1.00 23.61  ? 187  VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 190 ? 108.182 66.949 32.761  1.00 21.79  ? 187  VAL A CG2 1 
ATOM   1444 N N   . ALA A 1 191 ? 111.001 66.609 35.968  1.00 27.71  ? 188  ALA A N   1 
ATOM   1445 C CA  . ALA A 1 191 ? 111.572 67.631 36.846  1.00 34.21  ? 188  ALA A CA  1 
ATOM   1446 C C   . ALA A 1 191 ? 112.840 68.224 36.244  1.00 31.55  ? 188  ALA A C   1 
ATOM   1447 O O   . ALA A 1 191 ? 113.092 69.428 36.384  1.00 29.99  ? 188  ALA A O   1 
ATOM   1448 C CB  . ALA A 1 191 ? 111.855 67.053 38.236  1.00 26.79  ? 188  ALA A CB  1 
ATOM   1449 N N   . ALA A 1 192 ? 113.613 67.412 35.513  1.00 31.84  ? 189  ALA A N   1 
ATOM   1450 C CA  . ALA A 1 192 ? 114.829 67.913 34.883  1.00 28.98  ? 189  ALA A CA  1 
ATOM   1451 C C   . ALA A 1 192 ? 114.543 69.032 33.889  1.00 35.19  ? 189  ALA A C   1 
ATOM   1452 O O   . ALA A 1 192 ? 115.451 69.808 33.569  1.00 38.63  ? 189  ALA A O   1 
ATOM   1453 C CB  . ALA A 1 192 ? 115.580 66.763 34.216  1.00 24.84  ? 189  ALA A CB  1 
ATOM   1454 N N   . PHE A 1 193 ? 113.299 69.169 33.425  1.00 31.98  ? 190  PHE A N   1 
ATOM   1455 C CA  . PHE A 1 193 ? 112.932 70.253 32.522  1.00 28.48  ? 190  PHE A CA  1 
ATOM   1456 C C   . PHE A 1 193 ? 112.193 71.375 33.228  1.00 28.90  ? 190  PHE A C   1 
ATOM   1457 O O   . PHE A 1 193 ? 111.734 72.311 32.564  1.00 31.30  ? 190  PHE A O   1 
ATOM   1458 C CB  . PHE A 1 193 ? 112.083 69.720 31.364  1.00 28.94  ? 190  PHE A CB  1 
ATOM   1459 C CG  . PHE A 1 193 ? 112.748 68.633 30.587  1.00 23.86  ? 190  PHE A CG  1 
ATOM   1460 C CD1 . PHE A 1 193 ? 112.744 67.331 31.052  1.00 21.80  ? 190  PHE A CD1 1 
ATOM   1461 C CD2 . PHE A 1 193 ? 113.387 68.919 29.387  1.00 23.05  ? 190  PHE A CD2 1 
ATOM   1462 C CE1 . PHE A 1 193 ? 113.376 66.320 30.330  1.00 26.31  ? 190  PHE A CE1 1 
ATOM   1463 C CE2 . PHE A 1 193 ? 114.015 67.927 28.665  1.00 24.61  ? 190  PHE A CE2 1 
ATOM   1464 C CZ  . PHE A 1 193 ? 114.016 66.626 29.132  1.00 22.56  ? 190  PHE A CZ  1 
ATOM   1465 N N   . GLY A 1 194 ? 112.077 71.308 34.556  1.00 33.08  ? 191  GLY A N   1 
ATOM   1466 C CA  . GLY A 1 194 ? 111.274 72.250 35.311  1.00 30.05  ? 191  GLY A CA  1 
ATOM   1467 C C   . GLY A 1 194 ? 109.825 71.847 35.504  1.00 35.83  ? 191  GLY A C   1 
ATOM   1468 O O   . GLY A 1 194 ? 109.024 72.677 35.951  1.00 34.49  ? 191  GLY A O   1 
ATOM   1469 N N   . GLY A 1 195 ? 109.464 70.604 35.169  1.00 33.33  ? 192  GLY A N   1 
ATOM   1470 C CA  . GLY A 1 195 ? 108.088 70.160 35.254  1.00 30.57  ? 192  GLY A CA  1 
ATOM   1471 C C   . GLY A 1 195 ? 107.801 69.478 36.583  1.00 37.89  ? 192  GLY A C   1 
ATOM   1472 O O   . GLY A 1 195 ? 108.683 68.888 37.202  1.00 37.17  ? 192  GLY A O   1 
ATOM   1473 N N   . ASP A 1 196 ? 106.538 69.559 37.009  1.00 33.02  ? 193  ASP A N   1 
ATOM   1474 C CA  . ASP A 1 196 ? 106.108 69.068 38.310  1.00 31.24  ? 193  ASP A CA  1 
ATOM   1475 C C   . ASP A 1 196 ? 105.439 67.721 38.148  1.00 33.73  ? 193  ASP A C   1 
ATOM   1476 O O   . ASP A 1 196 ? 104.254 67.665 37.786  1.00 33.98  ? 193  ASP A O   1 
ATOM   1477 C CB  . ASP A 1 196 ? 105.145 70.066 38.954  1.00 34.96  ? 193  ASP A CB  1 
ATOM   1478 C CG  . ASP A 1 196 ? 104.745 69.680 40.384  1.00 33.01  ? 193  ASP A CG  1 
ATOM   1479 O OD1 . ASP A 1 196 ? 105.016 68.547 40.834  1.00 31.59  ? 193  ASP A OD1 1 
ATOM   1480 O OD2 . ASP A 1 196 ? 104.125 70.530 41.051  1.00 36.66  ? 193  ASP A OD2 1 
ATOM   1481 N N   . PRO A 1 197 ? 106.112 66.612 38.452  1.00 27.93  ? 194  PRO A N   1 
ATOM   1482 C CA  . PRO A 1 197 ? 105.463 65.301 38.308  1.00 27.15  ? 194  PRO A CA  1 
ATOM   1483 C C   . PRO A 1 197 ? 104.232 65.101 39.211  1.00 33.27  ? 194  PRO A C   1 
ATOM   1484 O O   . PRO A 1 197 ? 103.523 64.096 39.039  1.00 35.65  ? 194  PRO A O   1 
ATOM   1485 C CB  . PRO A 1 197 ? 106.588 64.311 38.661  1.00 27.60  ? 194  PRO A CB  1 
ATOM   1486 C CG  . PRO A 1 197 ? 107.543 65.104 39.543  1.00 26.04  ? 194  PRO A CG  1 
ATOM   1487 C CD  . PRO A 1 197 ? 107.465 66.522 39.026  1.00 33.35  ? 194  PRO A CD  1 
ATOM   1488 N N   . THR A 1 198 ? 103.968 65.981 40.181  1.00 34.70  ? 195  THR A N   1 
ATOM   1489 C CA  . THR A 1 198 ? 102.754 65.842 40.988  1.00 36.81  ? 195  THR A CA  1 
ATOM   1490 C C   . THR A 1 198 ? 101.555 66.543 40.357  1.00 36.52  ? 195  THR A C   1 
ATOM   1491 O O   . THR A 1 198 ? 100.454 66.490 40.912  1.00 44.69  ? 195  THR A O   1 
ATOM   1492 C CB  . THR A 1 198 ? 102.957 66.375 42.424  1.00 26.47  ? 195  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 198 ? 103.234 67.788 42.410  1.00 30.51  ? 195  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 198 ? 104.064 65.618 43.148  1.00 21.74  ? 195  THR A CG2 1 
ATOM   1495 N N   . SER A 1 199 ? 101.733 67.178 39.208  1.00 34.67  ? 196  SER A N   1 
ATOM   1496 C CA  . SER A 1 199 ? 100.658 67.876 38.532  1.00 36.10  ? 196  SER A CA  1 
ATOM   1497 C C   . SER A 1 199 ? 100.732 67.570 37.023  1.00 36.14  ? 196  SER A C   1 
ATOM   1498 O O   . SER A 1 199 ? 101.120 68.400 36.198  1.00 34.47  ? 196  SER A O   1 
ATOM   1499 C CB  . SER A 1 199 ? 100.742 69.371 38.820  1.00 28.02  ? 196  SER A CB  1 
ATOM   1500 O OG  . SER A 1 199 ? 99.626  70.066 38.325  1.00 37.56  ? 196  SER A OG  1 
ATOM   1501 N N   . VAL A 1 200 ? 100.336 66.355 36.649  1.00 29.75  ? 197  VAL A N   1 
ATOM   1502 C CA  . VAL A 1 200 ? 100.338 65.910 35.256  1.00 29.83  ? 197  VAL A CA  1 
ATOM   1503 C C   . VAL A 1 200 ? 98.902  65.804 34.754  1.00 29.41  ? 197  VAL A C   1 
ATOM   1504 O O   . VAL A 1 200 ? 98.106  65.020 35.283  1.00 28.62  ? 197  VAL A O   1 
ATOM   1505 C CB  . VAL A 1 200 ? 101.062 64.569 35.099  1.00 27.52  ? 197  VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 200 ? 101.082 64.170 33.641  1.00 27.82  ? 197  VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 200 ? 102.469 64.677 35.644  1.00 24.49  ? 197  VAL A CG2 1 
ATOM   1508 N N   . THR A 1 201 ? 98.582  66.571 33.718  1.00 29.04  ? 198  THR A N   1 
ATOM   1509 C CA  . THR A 1 201 ? 97.289  66.513 33.052  1.00 24.12  ? 198  THR A CA  1 
ATOM   1510 C C   . THR A 1 201 ? 97.444  65.861 31.677  1.00 25.59  ? 198  THR A C   1 
ATOM   1511 O O   . THR A 1 201 ? 98.104  66.420 30.797  1.00 23.70  ? 198  THR A O   1 
ATOM   1512 C CB  . THR A 1 201 ? 96.706  67.921 32.931  1.00 26.33  ? 198  THR A CB  1 
ATOM   1513 O OG1 . THR A 1 201 ? 96.502  68.463 34.243  1.00 30.37  ? 198  THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 201 ? 95.378  67.917 32.192  1.00 22.72  ? 198  THR A CG2 1 
ATOM   1515 N N   . LEU A 1 202 ? 96.830  64.687 31.492  1.00 21.19  ? 199  LEU A N   1 
ATOM   1516 C CA  . LEU A 1 202 ? 96.702  64.079 30.168  1.00 24.66  ? 199  LEU A CA  1 
ATOM   1517 C C   . LEU A 1 202 ? 95.605  64.754 29.367  1.00 31.20  ? 199  LEU A C   1 
ATOM   1518 O O   . LEU A 1 202 ? 94.500  64.939 29.882  1.00 30.36  ? 199  LEU A O   1 
ATOM   1519 C CB  . LEU A 1 202 ? 96.345  62.610 30.281  1.00 21.91  ? 199  LEU A CB  1 
ATOM   1520 C CG  . LEU A 1 202 ? 97.135  61.786 31.268  1.00 26.72  ? 199  LEU A CG  1 
ATOM   1521 C CD1 . LEU A 1 202 ? 96.752  60.326 31.076  1.00 22.39  ? 199  LEU A CD1 1 
ATOM   1522 C CD2 . LEU A 1 202 ? 98.615  62.031 30.947  1.00 29.01  ? 199  LEU A CD2 1 
ATOM   1523 N N   . PHE A 1 203 ? 95.899  65.114 28.109  1.00 25.94  ? 200  PHE A N   1 
ATOM   1524 C CA  . PHE A 1 203 ? 94.860  65.463 27.148  1.00 23.12  ? 200  PHE A CA  1 
ATOM   1525 C C   . PHE A 1 203 ? 95.116  64.761 25.821  1.00 30.37  ? 200  PHE A C   1 
ATOM   1526 O O   . PHE A 1 203 ? 96.247  64.392 25.487  1.00 23.17  ? 200  PHE A O   1 
ATOM   1527 C CB  . PHE A 1 203 ? 94.671  67.000 26.938  1.00 22.01  ? 200  PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 203 ? 95.838  67.744 26.316  1.00 26.10  ? 200  PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 203 ? 97.156  67.504 26.690  1.00 25.88  ? 200  PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 203 ? 95.588  68.761 25.393  1.00 24.11  ? 200  PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 203 ? 98.197  68.233 26.134  1.00 21.69  ? 200  PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 203 ? 96.640  69.494 24.822  1.00 27.66  ? 200  PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 203 ? 97.948  69.220 25.198  1.00 21.77  ? 200  PHE A CZ  1 
ATOM   1534 N N   . GLY A 1 204 ? 94.028  64.537 25.098  1.00 26.53  ? 201  GLY A N   1 
ATOM   1535 C CA  . GLY A 1 204 ? 94.034  63.704 23.911  1.00 24.05  ? 201  GLY A CA  1 
ATOM   1536 C C   . GLY A 1 204 ? 92.757  63.940 23.138  1.00 27.33  ? 201  GLY A C   1 
ATOM   1537 O O   . GLY A 1 204 ? 91.739  64.363 23.698  1.00 22.78  ? 201  GLY A O   1 
ATOM   1538 N N   . GLU A 1 205 ? 92.821  63.684 21.831  1.00 22.51  ? 202  GLU A N   1 
ATOM   1539 C CA  . GLU A 1 205 ? 91.674  63.891 20.952  1.00 17.79  ? 202  GLU A CA  1 
ATOM   1540 C C   . GLU A 1 205 ? 91.365  62.595 20.221  1.00 22.10  ? 202  GLU A C   1 
ATOM   1541 O O   . GLU A 1 205 ? 92.273  61.813 19.902  1.00 22.70  ? 202  GLU A O   1 
ATOM   1542 C CB  . GLU A 1 205 ? 91.912  65.055 19.973  1.00 19.07  ? 202  GLU A CB  1 
ATOM   1543 C CG  . GLU A 1 205 ? 90.678  65.523 19.202  1.00 17.23  ? 202  GLU A CG  1 
ATOM   1544 C CD  . GLU A 1 205 ? 90.549  64.833 17.840  1.00 25.84  ? 202  GLU A CD  1 
ATOM   1545 O OE1 . GLU A 1 205 ? 91.448  64.055 17.483  1.00 25.60  ? 202  GLU A OE1 1 
ATOM   1546 O OE2 . GLU A 1 205 ? 89.556  65.061 17.113  1.00 29.37  ? 202  GLU A OE2 1 
ATOM   1547 N N   . SER A 1 206 ? 90.067  62.338 20.032  1.00 17.99  ? 203  SER A N   1 
ATOM   1548 C CA  . SER A 1 206 ? 89.587  61.133 19.362  1.00 17.79  ? 203  SER A CA  1 
ATOM   1549 C C   . SER A 1 206 ? 90.191  59.869 19.974  1.00 18.75  ? 203  SER A C   1 
ATOM   1550 O O   . SER A 1 206 ? 89.961  59.602 21.152  1.00 19.87  ? 203  SER A O   1 
ATOM   1551 C CB  . SER A 1 206 ? 89.870  61.228 17.864  1.00 23.06  ? 203  SER A CB  1 
ATOM   1552 O OG  . SER A 1 206 ? 89.156  60.233 17.155  1.00 29.02  ? 203  SER A OG  1 
ATOM   1553 N N   . ALA A 1 207 ? 90.959  59.073 19.220  1.00 17.60  ? 204  ALA A N   1 
ATOM   1554 C CA  . ALA A 1 207 ? 91.519  57.868 19.838  1.00 18.65  ? 204  ALA A CA  1 
ATOM   1555 C C   . ALA A 1 207 ? 92.478  58.212 20.985  1.00 19.49  ? 204  ALA A C   1 
ATOM   1556 O O   . ALA A 1 207 ? 92.663  57.402 21.904  1.00 18.75  ? 204  ALA A O   1 
ATOM   1557 C CB  . ALA A 1 207 ? 92.217  56.985 18.801  1.00 17.41  ? 204  ALA A CB  1 
ATOM   1558 N N   . GLY A 1 208 ? 93.071  59.411 20.965  1.00 18.43  ? 205  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 208 ? 93.843  59.857 22.114  1.00 20.94  ? 205  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 208 ? 92.980  60.135 23.331  1.00 23.14  ? 205  GLY A C   1 
ATOM   1561 O O   . GLY A 1 208 ? 93.403  59.884 24.465  1.00 23.70  ? 205  GLY A O   1 
ATOM   1562 N N   . ALA A 1 209 ? 91.759  60.644 23.119  1.00 24.75  ? 206  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 209 ? 90.828  60.809 24.235  1.00 21.76  ? 206  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 209 ? 90.359  59.458 24.753  1.00 21.05  ? 206  ALA A C   1 
ATOM   1565 O O   . ALA A 1 209 ? 90.282  59.240 25.967  1.00 22.78  ? 206  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 209 ? 89.649  61.683 23.804  1.00 21.40  ? 206  ALA A CB  1 
ATOM   1567 N N   . ALA A 1 210 ? 90.069  58.520 23.852  1.00 21.69  ? 207  ALA A N   1 
ATOM   1568 C CA  . ALA A 1 210 ? 89.779  57.167 24.302  1.00 20.14  ? 207  ALA A CA  1 
ATOM   1569 C C   . ALA A 1 210 ? 90.943  56.608 25.109  1.00 26.30  ? 207  ALA A C   1 
ATOM   1570 O O   . ALA A 1 210 ? 90.727  55.922 26.115  1.00 21.33  ? 207  ALA A O   1 
ATOM   1571 C CB  . ALA A 1 210 ? 89.454  56.263 23.117  1.00 16.21  ? 207  ALA A CB  1 
ATOM   1572 N N   . SER A 1 211 ? 92.187  56.917 24.692  1.00 25.40  ? 208  SER A N   1 
ATOM   1573 C CA  . SER A 1 211 ? 93.377  56.471 25.421  1.00 21.53  ? 208  SER A CA  1 
ATOM   1574 C C   . SER A 1 211 ? 93.425  57.080 26.818  1.00 22.12  ? 208  SER A C   1 
ATOM   1575 O O   . SER A 1 211 ? 93.699  56.385 27.802  1.00 22.13  ? 208  SER A O   1 
ATOM   1576 C CB  . SER A 1 211 ? 94.655  56.847 24.652  1.00 22.37  ? 208  SER A CB  1 
ATOM   1577 O OG  . SER A 1 211 ? 94.849  56.068 23.481  1.00 18.10  ? 208  SER A OG  1 
ATOM   1578 N N   . VAL A 1 212 ? 93.217  58.395 26.911  1.00 20.43  ? 209  VAL A N   1 
ATOM   1579 C CA  . VAL A 1 212 ? 93.190  59.062 28.207  1.00 18.32  ? 209  VAL A CA  1 
ATOM   1580 C C   . VAL A 1 212 ? 92.164  58.397 29.103  1.00 29.83  ? 209  VAL A C   1 
ATOM   1581 O O   . VAL A 1 212 ? 92.431  58.111 30.277  1.00 28.53  ? 209  VAL A O   1 
ATOM   1582 C CB  . VAL A 1 212 ? 92.903  60.563 28.018  1.00 25.13  ? 209  VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 212 ? 92.598  61.249 29.356  1.00 22.64  ? 209  VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 212 ? 94.092  61.227 27.332  1.00 16.92  ? 209  VAL A CG2 1 
ATOM   1585 N N   . GLY A 1 213 ? 90.990  58.084 28.538  1.00 21.26  ? 210  GLY A N   1 
ATOM   1586 C CA  . GLY A 1 213 ? 89.966  57.403 29.300  1.00 25.62  ? 210  GLY A CA  1 
ATOM   1587 C C   . GLY A 1 213 ? 90.388  56.027 29.769  1.00 28.32  ? 210  GLY A C   1 
ATOM   1588 O O   . GLY A 1 213 ? 90.084  55.637 30.901  1.00 25.64  ? 210  GLY A O   1 
ATOM   1589 N N   . MET A 1 214 ? 91.068  55.256 28.903  1.00 23.10  ? 211  MET A N   1 
ATOM   1590 C CA  A MET A 1 214 ? 91.505  53.944 29.351  0.39 22.01  ? 211  MET A CA  1 
ATOM   1591 C CA  B MET A 1 214 ? 91.585  53.941 29.294  0.61 21.99  ? 211  MET A CA  1 
ATOM   1592 C C   . MET A 1 214 ? 92.579  54.038 30.435  1.00 25.59  ? 211  MET A C   1 
ATOM   1593 O O   . MET A 1 214 ? 92.701  53.111 31.241  1.00 27.21  ? 211  MET A O   1 
ATOM   1594 C CB  A MET A 1 214 ? 91.972  53.118 28.156  0.39 25.69  ? 211  MET A CB  1 
ATOM   1595 C CB  B MET A 1 214 ? 92.304  53.241 28.140  0.61 25.51  ? 211  MET A CB  1 
ATOM   1596 C CG  A MET A 1 214 ? 90.864  52.953 27.113  0.39 25.90  ? 211  MET A CG  1 
ATOM   1597 C CG  B MET A 1 214 ? 91.719  53.416 26.778  0.61 28.38  ? 211  MET A CG  1 
ATOM   1598 S SD  A MET A 1 214 ? 91.226  51.781 25.792  0.39 36.67  ? 211  MET A SD  1 
ATOM   1599 S SD  B MET A 1 214 ? 91.248  51.846 26.081  0.61 37.51  ? 211  MET A SD  1 
ATOM   1600 C CE  A MET A 1 214 ? 90.011  52.243 24.540  0.39 19.59  ? 211  MET A CE  1 
ATOM   1601 C CE  B MET A 1 214 ? 89.968  51.408 27.220  0.61 19.33  ? 211  MET A CE  1 
ATOM   1602 N N   . HIS A 1 215 ? 93.349  55.131 30.486  1.00 23.71  ? 212  HIS A N   1 
ATOM   1603 C CA  . HIS A 1 215 ? 94.325  55.262 31.569  1.00 30.60  ? 212  HIS A CA  1 
ATOM   1604 C C   . HIS A 1 215 ? 93.631  55.590 32.893  1.00 27.46  ? 212  HIS A C   1 
ATOM   1605 O O   . HIS A 1 215 ? 94.099  55.158 33.949  1.00 27.23  ? 212  HIS A O   1 
ATOM   1606 C CB  . HIS A 1 215 ? 95.400  56.312 31.222  1.00 19.73  ? 212  HIS A CB  1 
ATOM   1607 C CG  . HIS A 1 215 ? 96.313  55.890 30.109  1.00 26.11  ? 212  HIS A CG  1 
ATOM   1608 N ND1 . HIS A 1 215 ? 97.087  54.746 30.168  1.00 30.14  ? 212  HIS A ND1 1 
ATOM   1609 C CD2 . HIS A 1 215 ? 96.538  56.434 28.887  1.00 22.82  ? 212  HIS A CD2 1 
ATOM   1610 C CE1 . HIS A 1 215 ? 97.753  54.608 29.035  1.00 28.14  ? 212  HIS A CE1 1 
ATOM   1611 N NE2 . HIS A 1 215 ? 97.430  55.615 28.237  1.00 27.90  ? 212  HIS A NE2 1 
ATOM   1612 N N   . LEU A 1 216 ? 92.510  56.329 32.851  1.00 27.86  ? 213  LEU A N   1 
ATOM   1613 C CA  . LEU A 1 216 ? 91.674  56.510 34.040  1.00 28.43  ? 213  LEU A CA  1 
ATOM   1614 C C   . LEU A 1 216 ? 91.229  55.172 34.611  1.00 30.57  ? 213  LEU A C   1 
ATOM   1615 O O   . LEU A 1 216 ? 91.244  54.973 35.828  1.00 35.23  ? 213  LEU A O   1 
ATOM   1616 C CB  . LEU A 1 216 ? 90.451  57.355 33.703  1.00 28.87  ? 213  LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 216 ? 90.766  58.821 33.484  1.00 31.88  ? 213  LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 216 ? 89.542  59.549 32.959  1.00 32.16  ? 213  LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 216 ? 91.274  59.441 34.795  1.00 31.99  ? 213  LEU A CD2 1 
ATOM   1620 N N   . LEU A 1 217 ? 90.849  54.240 33.750  1.00 26.70  ? 214  LEU A N   1 
ATOM   1621 C CA  . LEU A 1 217 ? 90.239  52.987 34.170  1.00 29.87  ? 214  LEU A CA  1 
ATOM   1622 C C   . LEU A 1 217 ? 91.251  51.868 34.376  1.00 30.49  ? 214  LEU A C   1 
ATOM   1623 O O   . LEU A 1 217 ? 90.847  50.738 34.665  1.00 31.76  ? 214  LEU A O   1 
ATOM   1624 C CB  . LEU A 1 217 ? 89.178  52.559 33.139  1.00 23.72  ? 214  LEU A CB  1 
ATOM   1625 C CG  . LEU A 1 217 ? 88.138  53.629 32.783  1.00 28.11  ? 214  LEU A CG  1 
ATOM   1626 C CD1 . LEU A 1 217 ? 87.359  53.272 31.511  1.00 21.79  ? 214  LEU A CD1 1 
ATOM   1627 C CD2 . LEU A 1 217 ? 87.172  53.839 33.952  1.00 30.56  ? 214  LEU A CD2 1 
ATOM   1628 N N   . SER A 1 218 ? 92.544  52.145 34.231  1.00 27.86  ? 215  SER A N   1 
ATOM   1629 C CA  . SER A 1 218 ? 93.591  51.145 34.458  1.00 33.03  ? 215  SER A CA  1 
ATOM   1630 C C   . SER A 1 218 ? 94.387  51.538 35.698  1.00 34.03  ? 215  SER A C   1 
ATOM   1631 O O   . SER A 1 218 ? 95.036  52.598 35.693  1.00 33.72  ? 215  SER A O   1 
ATOM   1632 C CB  . SER A 1 218 ? 94.520  51.040 33.241  1.00 32.49  ? 215  SER A CB  1 
ATOM   1633 O OG  . SER A 1 218 ? 95.179  49.780 33.205  1.00 32.85  ? 215  SER A OG  1 
ATOM   1634 N N   . PRO A 1 219 ? 94.349  50.757 36.779  1.00 37.20  ? 216  PRO A N   1 
ATOM   1635 C CA  . PRO A 1 219 ? 95.026  51.160 38.035  1.00 38.74  ? 216  PRO A CA  1 
ATOM   1636 C C   . PRO A 1 219 ? 96.518  51.423 37.864  1.00 32.00  ? 216  PRO A C   1 
ATOM   1637 O O   . PRO A 1 219 ? 97.024  52.396 38.439  1.00 32.48  ? 216  PRO A O   1 
ATOM   1638 C CB  . PRO A 1 219 ? 94.765  49.969 38.973  1.00 39.73  ? 216  PRO A CB  1 
ATOM   1639 C CG  . PRO A 1 219 ? 93.471  49.404 38.483  1.00 38.96  ? 216  PRO A CG  1 
ATOM   1640 C CD  . PRO A 1 219 ? 93.487  49.577 36.974  1.00 34.13  ? 216  PRO A CD  1 
ATOM   1641 N N   . PRO A 1 220 ? 97.272  50.610 37.104  1.00 30.88  ? 217  PRO A N   1 
ATOM   1642 C CA  . PRO A 1 220 ? 98.704  50.946 36.926  1.00 30.41  ? 217  PRO A CA  1 
ATOM   1643 C C   . PRO A 1 220 ? 98.950  52.297 36.260  1.00 36.34  ? 217  PRO A C   1 
ATOM   1644 O O   . PRO A 1 220 ? 99.967  52.942 36.544  1.00 32.98  ? 217  PRO A O   1 
ATOM   1645 C CB  . PRO A 1 220 ? 99.239  49.790 36.070  1.00 28.11  ? 217  PRO A CB  1 
ATOM   1646 C CG  . PRO A 1 220 ? 98.305  48.644 36.379  1.00 30.38  ? 217  PRO A CG  1 
ATOM   1647 C CD  . PRO A 1 220 ? 96.959  49.302 36.492  1.00 32.04  ? 217  PRO A CD  1 
ATOM   1648 N N   . SER A 1 221 ? 98.049  52.760 35.390  1.00 33.48  ? 218  SER A N   1 
ATOM   1649 C CA  . SER A 1 221 ? 98.268  54.056 34.763  1.00 30.49  ? 218  SER A CA  1 
ATOM   1650 C C   . SER A 1 221 ? 97.781  55.179 35.650  1.00 33.05  ? 218  SER A C   1 
ATOM   1651 O O   . SER A 1 221 ? 98.344  56.281 35.626  1.00 28.85  ? 218  SER A O   1 
ATOM   1652 C CB  . SER A 1 221 ? 97.560  54.137 33.397  1.00 22.24  ? 218  SER A CB  1 
ATOM   1653 O OG  . SER A 1 221 ? 97.871  53.015 32.572  1.00 30.41  ? 218  SER A OG  1 
ATOM   1654 N N   . ARG A 1 222 ? 96.741  54.907 36.440  1.00 35.58  ? 219  ARG A N   1 
ATOM   1655 C CA  . ARG A 1 222 ? 95.970  55.980 37.055  1.00 38.59  ? 219  ARG A CA  1 
ATOM   1656 C C   . ARG A 1 222 ? 96.813  56.779 38.046  1.00 38.39  ? 219  ARG A C   1 
ATOM   1657 O O   . ARG A 1 222 ? 96.605  57.990 38.211  1.00 39.93  ? 219  ARG A O   1 
ATOM   1658 C CB  . ARG A 1 222 ? 94.711  55.373 37.699  1.00 38.13  ? 219  ARG A CB  1 
ATOM   1659 C CG  . ARG A 1 222 ? 93.876  56.321 38.520  1.00 35.56  ? 219  ARG A CG  1 
ATOM   1660 C CD  . ARG A 1 222 ? 93.350  57.484 37.718  1.00 35.04  ? 219  ARG A CD  1 
ATOM   1661 N NE  . ARG A 1 222 ? 92.683  58.488 38.551  1.00 44.93  ? 219  ARG A NE  1 
ATOM   1662 C CZ  . ARG A 1 222 ? 93.258  59.612 38.983  1.00 49.10  ? 219  ARG A CZ  1 
ATOM   1663 N NH1 . ARG A 1 222 ? 94.519  59.881 38.657  1.00 37.60  ? 219  ARG A NH1 1 
ATOM   1664 N NH2 . ARG A 1 222 ? 92.571  60.480 39.728  1.00 42.60  ? 219  ARG A NH2 1 
ATOM   1665 N N   . GLY A 1 223 ? 97.801  56.139 38.674  1.00 35.20  ? 220  GLY A N   1 
ATOM   1666 C CA  . GLY A 1 223 ? 98.714  56.878 39.532  1.00 31.20  ? 220  GLY A CA  1 
ATOM   1667 C C   . GLY A 1 223 ? 99.744  57.743 38.825  1.00 37.98  ? 220  GLY A C   1 
ATOM   1668 O O   . GLY A 1 223 ? 100.449 58.499 39.496  1.00 35.05  ? 220  GLY A O   1 
ATOM   1669 N N   . LEU A 1 224 ? 99.847  57.682 37.495  1.00 33.33  ? 221  LEU A N   1 
ATOM   1670 C CA  . LEU A 1 224 ? 100.848 58.471 36.789  1.00 26.13  ? 221  LEU A CA  1 
ATOM   1671 C C   . LEU A 1 224 ? 100.372 59.870 36.444  1.00 35.05  ? 221  LEU A C   1 
ATOM   1672 O O   . LEU A 1 224 ? 101.139 60.637 35.851  1.00 31.90  ? 221  LEU A O   1 
ATOM   1673 C CB  . LEU A 1 224 ? 101.284 57.745 35.526  1.00 28.13  ? 221  LEU A CB  1 
ATOM   1674 C CG  . LEU A 1 224 ? 101.769 56.337 35.868  1.00 27.02  ? 221  LEU A CG  1 
ATOM   1675 C CD1 . LEU A 1 224 ? 101.974 55.467 34.629  1.00 29.10  ? 221  LEU A CD1 1 
ATOM   1676 C CD2 . LEU A 1 224 ? 103.057 56.457 36.707  1.00 26.66  ? 221  LEU A CD2 1 
ATOM   1677 N N   . PHE A 1 225 ? 99.142  60.231 36.810  1.00 26.48  ? 222  PHE A N   1 
ATOM   1678 C CA  . PHE A 1 225 ? 98.616  61.542 36.451  1.00 26.90  ? 222  PHE A CA  1 
ATOM   1679 C C   . PHE A 1 225 ? 97.483  61.896 37.409  1.00 29.42  ? 222  PHE A C   1 
ATOM   1680 O O   . PHE A 1 225 ? 97.028  61.070 38.201  1.00 31.32  ? 222  PHE A O   1 
ATOM   1681 C CB  . PHE A 1 225 ? 98.133  61.569 34.990  1.00 26.46  ? 222  PHE A CB  1 
ATOM   1682 C CG  . PHE A 1 225 ? 97.035  60.571 34.704  1.00 25.27  ? 222  PHE A CG  1 
ATOM   1683 C CD1 . PHE A 1 225 ? 97.315  59.221 34.601  1.00 25.61  ? 222  PHE A CD1 1 
ATOM   1684 C CD2 . PHE A 1 225 ? 95.723  60.987 34.564  1.00 29.52  ? 222  PHE A CD2 1 
ATOM   1685 C CE1 . PHE A 1 225 ? 96.309  58.310 34.341  1.00 31.50  ? 222  PHE A CE1 1 
ATOM   1686 C CE2 . PHE A 1 225 ? 94.716  60.082 34.311  1.00 28.39  ? 222  PHE A CE2 1 
ATOM   1687 C CZ  . PHE A 1 225 ? 95.006  58.743 34.206  1.00 28.17  ? 222  PHE A CZ  1 
ATOM   1688 N N   . HIS A 1 226 ? 96.998  63.129 37.274  1.00 30.57  ? 223  HIS A N   1 
ATOM   1689 C CA  . HIS A 1 226 ? 96.078  63.735 38.225  1.00 36.25  ? 223  HIS A CA  1 
ATOM   1690 C C   . HIS A 1 226 ? 94.847  64.356 37.594  1.00 35.09  ? 223  HIS A C   1 
ATOM   1691 O O   . HIS A 1 226 ? 93.828  64.484 38.281  1.00 36.34  ? 223  HIS A O   1 
ATOM   1692 C CB  . HIS A 1 226 ? 96.840  64.788 39.041  1.00 33.92  ? 223  HIS A CB  1 
ATOM   1693 C CG  . HIS A 1 226 ? 98.169  64.280 39.486  1.00 42.48  ? 223  HIS A CG  1 
ATOM   1694 N ND1 . HIS A 1 226 ? 99.319  64.467 38.747  1.00 41.29  ? 223  HIS A ND1 1 
ATOM   1695 C CD2 . HIS A 1 226 ? 98.507  63.460 40.510  1.00 42.19  ? 223  HIS A CD2 1 
ATOM   1696 C CE1 . HIS A 1 226 ? 100.321 63.838 39.335  1.00 39.68  ? 223  HIS A CE1 1 
ATOM   1697 N NE2 . HIS A 1 226 ? 99.856  63.224 40.409  1.00 42.33  ? 223  HIS A NE2 1 
ATOM   1698 N N   . ARG A 1 227 ? 94.893  64.730 36.318  1.00 34.43  ? 224  ARG A N   1 
ATOM   1699 C CA  . ARG A 1 227 ? 93.742  65.271 35.616  1.00 26.90  ? 224  ARG A CA  1 
ATOM   1700 C C   . ARG A 1 227 ? 93.681  64.666 34.220  1.00 34.61  ? 224  ARG A C   1 
ATOM   1701 O O   . ARG A 1 227 ? 94.627  64.005 33.762  1.00 33.87  ? 224  ARG A O   1 
ATOM   1702 C CB  . ARG A 1 227 ? 93.810  66.789 35.541  1.00 30.66  ? 224  ARG A CB  1 
ATOM   1703 C CG  . ARG A 1 227 ? 94.003  67.455 36.883  1.00 35.31  ? 224  ARG A CG  1 
ATOM   1704 C CD  . ARG A 1 227 ? 93.980  68.939 36.712  1.00 28.10  ? 224  ARG A CD  1 
ATOM   1705 N NE  . ARG A 1 227 ? 94.381  69.625 37.928  1.00 46.90  ? 224  ARG A NE  1 
ATOM   1706 C CZ  . ARG A 1 227 ? 95.635  69.685 38.368  1.00 52.15  ? 224  ARG A CZ  1 
ATOM   1707 N NH1 . ARG A 1 227 ? 96.626  69.088 37.692  1.00 48.32  ? 224  ARG A NH1 1 
ATOM   1708 N NH2 . ARG A 1 227 ? 95.899  70.344 39.483  1.00 48.43  ? 224  ARG A NH2 1 
ATOM   1709 N N   . ALA A 1 228 ? 92.553  64.914 33.539  1.00 31.37  ? 225  ALA A N   1 
ATOM   1710 C CA  . ALA A 1 228 ? 92.252  64.316 32.242  1.00 24.21  ? 225  ALA A CA  1 
ATOM   1711 C C   . ALA A 1 228 ? 91.410  65.271 31.404  1.00 29.00  ? 225  ALA A C   1 
ATOM   1712 O O   . ALA A 1 228 ? 90.477  65.900 31.913  1.00 27.13  ? 225  ALA A O   1 
ATOM   1713 C CB  . ALA A 1 228 ? 91.524  62.984 32.405  1.00 22.64  ? 225  ALA A CB  1 
ATOM   1714 N N   . VAL A 1 229 ? 91.766  65.392 30.125  1.00 24.18  ? 226  VAL A N   1 
ATOM   1715 C CA  . VAL A 1 229 ? 90.968  66.095 29.127  1.00 25.10  ? 226  VAL A CA  1 
ATOM   1716 C C   . VAL A 1 229 ? 90.687  65.112 27.996  1.00 30.23  ? 226  VAL A C   1 
ATOM   1717 O O   . VAL A 1 229 ? 91.621  64.554 27.402  1.00 28.30  ? 226  VAL A O   1 
ATOM   1718 C CB  . VAL A 1 229 ? 91.667  67.350 28.597  1.00 24.10  ? 226  VAL A CB  1 
ATOM   1719 C CG1 . VAL A 1 229 ? 90.743  68.120 27.654  1.00 24.25  ? 226  VAL A CG1 1 
ATOM   1720 C CG2 . VAL A 1 229 ? 92.137  68.218 29.740  1.00 23.21  ? 226  VAL A CG2 1 
ATOM   1721 N N   . LEU A 1 230 ? 89.405  64.877 27.719  1.00 26.01  ? 227  LEU A N   1 
ATOM   1722 C CA  . LEU A 1 230 ? 88.974  63.971 26.653  1.00 25.36  ? 227  LEU A CA  1 
ATOM   1723 C C   . LEU A 1 230 ? 88.275  64.813 25.596  1.00 23.37  ? 227  LEU A C   1 
ATOM   1724 O O   . LEU A 1 230 ? 87.135  65.246 25.785  1.00 26.99  ? 227  LEU A O   1 
ATOM   1725 C CB  . LEU A 1 230 ? 88.070  62.868 27.187  1.00 22.56  ? 227  LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 230 ? 88.734  61.826 28.085  1.00 21.22  ? 227  LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 230 ? 88.844  62.343 29.512  1.00 26.65  ? 227  LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 230 ? 87.952  60.529 28.044  1.00 18.91  ? 227  LEU A CD2 1 
ATOM   1729 N N   . GLN A 1 231 ? 88.968  65.062 24.490  1.00 23.69  ? 228  GLN A N   1 
ATOM   1730 C CA  . GLN A 1 231 ? 88.441  65.867 23.394  1.00 21.43  ? 228  GLN A CA  1 
ATOM   1731 C C   . GLN A 1 231 ? 87.920  64.941 22.296  1.00 25.31  ? 228  GLN A C   1 
ATOM   1732 O O   . GLN A 1 231 ? 88.703  64.226 21.657  1.00 18.66  ? 228  GLN A O   1 
ATOM   1733 C CB  . GLN A 1 231 ? 89.522  66.793 22.846  1.00 22.75  ? 228  GLN A CB  1 
ATOM   1734 C CG  . GLN A 1 231 ? 90.215  67.642 23.904  1.00 22.73  ? 228  GLN A CG  1 
ATOM   1735 C CD  . GLN A 1 231 ? 91.408  68.389 23.341  1.00 22.27  ? 228  GLN A CD  1 
ATOM   1736 O OE1 . GLN A 1 231 ? 92.256  68.872 24.090  1.00 25.99  ? 228  GLN A OE1 1 
ATOM   1737 N NE2 . GLN A 1 231 ? 91.487  68.478 22.015  1.00 22.31  ? 228  GLN A NE2 1 
ATOM   1738 N N   . SER A 1 232 ? 86.598  64.969 22.073  1.00 23.11  ? 229  SER A N   1 
ATOM   1739 C CA  . SER A 1 232 ? 85.933  64.207 21.004  1.00 20.16  ? 229  SER A CA  1 
ATOM   1740 C C   . SER A 1 232 ? 86.272  62.722 21.024  1.00 20.13  ? 229  SER A C   1 
ATOM   1741 O O   . SER A 1 232 ? 86.624  62.148 19.994  1.00 20.88  ? 229  SER A O   1 
ATOM   1742 C CB  . SER A 1 232 ? 86.256  64.766 19.622  1.00 16.04  ? 229  SER A CB  1 
ATOM   1743 O OG  . SER A 1 232 ? 85.919  66.124 19.504  1.00 20.27  ? 229  SER A OG  1 
ATOM   1744 N N   . GLY A 1 233 ? 86.137  62.085 22.180  1.00 18.53  ? 230  GLY A N   1 
ATOM   1745 C CA  . GLY A 1 233 ? 86.372  60.652 22.235  1.00 17.73  ? 230  GLY A CA  1 
ATOM   1746 C C   . GLY A 1 233 ? 86.217  60.150 23.653  1.00 17.56  ? 230  GLY A C   1 
ATOM   1747 O O   . GLY A 1 233 ? 86.312  60.910 24.614  1.00 23.67  ? 230  GLY A O   1 
ATOM   1748 N N   . ALA A 1 234 ? 86.013  58.840 23.764  1.00 19.77  ? 231  ALA A N   1 
ATOM   1749 C CA  . ALA A 1 234 ? 85.798  58.208 25.060  1.00 24.23  ? 231  ALA A CA  1 
ATOM   1750 C C   . ALA A 1 234 ? 86.150  56.743 24.930  1.00 18.13  ? 231  ALA A C   1 
ATOM   1751 O O   . ALA A 1 234 ? 86.053  56.189 23.827  1.00 16.19  ? 231  ALA A O   1 
ATOM   1752 C CB  . ALA A 1 234 ? 84.341  58.366 25.526  1.00 26.56  ? 231  ALA A CB  1 
ATOM   1753 N N   . PRO A 1 235 ? 86.558  56.085 26.025  1.00 18.58  ? 232  PRO A N   1 
ATOM   1754 C CA  . PRO A 1 235 ? 86.894  54.650 25.942  1.00 16.73  ? 232  PRO A CA  1 
ATOM   1755 C C   . PRO A 1 235 ? 85.699  53.738 25.763  1.00 25.15  ? 232  PRO A C   1 
ATOM   1756 O O   . PRO A 1 235 ? 85.894  52.575 25.361  1.00 20.14  ? 232  PRO A O   1 
ATOM   1757 C CB  . PRO A 1 235 ? 87.592  54.368 27.285  1.00 19.83  ? 232  PRO A CB  1 
ATOM   1758 C CG  . PRO A 1 235 ? 87.100  55.433 28.202  1.00 19.87  ? 232  PRO A CG  1 
ATOM   1759 C CD  . PRO A 1 235 ? 86.806  56.646 27.367  1.00 18.27  ? 232  PRO A CD  1 
ATOM   1760 N N   . ASN A 1 236 ? 84.483  54.201 26.094  1.00 25.40  ? 233  ASN A N   1 
ATOM   1761 C CA  . ASN A 1 236 ? 83.253  53.435 25.900  1.00 28.89  ? 233  ASN A CA  1 
ATOM   1762 C C   . ASN A 1 236 ? 82.643  53.590 24.493  1.00 27.53  ? 233  ASN A C   1 
ATOM   1763 O O   . ASN A 1 236 ? 81.632  52.938 24.192  1.00 28.00  ? 233  ASN A O   1 
ATOM   1764 C CB  . ASN A 1 236 ? 82.212  53.826 26.973  1.00 24.54  ? 233  ASN A CB  1 
ATOM   1765 C CG  . ASN A 1 236 ? 82.076  55.321 27.130  1.00 25.74  ? 233  ASN A CG  1 
ATOM   1766 O OD1 . ASN A 1 236 ? 83.074  56.026 27.263  1.00 30.66  ? 233  ASN A OD1 1 
ATOM   1767 N ND2 . ASN A 1 236 ? 80.848  55.823 27.096  1.00 31.66  ? 233  ASN A ND2 1 
ATOM   1768 N N   . GLY A 1 237 ? 83.226  54.413 23.617  1.00 29.46  ? 234  GLY A N   1 
ATOM   1769 C CA  . GLY A 1 237 ? 82.811  54.455 22.219  1.00 31.07  ? 234  GLY A CA  1 
ATOM   1770 C C   . GLY A 1 237 ? 82.708  53.092 21.542  1.00 30.77  ? 234  GLY A C   1 
ATOM   1771 O O   . GLY A 1 237 ? 83.490  52.180 21.839  1.00 35.89  ? 234  GLY A O   1 
ATOM   1772 N N   . PRO A 1 238 ? 81.740  52.915 20.624  1.00 25.82  ? 235  PRO A N   1 
ATOM   1773 C CA  . PRO A 1 238 ? 81.606  51.610 19.941  1.00 25.96  ? 235  PRO A CA  1 
ATOM   1774 C C   . PRO A 1 238 ? 82.805  51.235 19.071  1.00 27.35  ? 235  PRO A C   1 
ATOM   1775 O O   . PRO A 1 238 ? 82.936  50.063 18.696  1.00 25.62  ? 235  PRO A O   1 
ATOM   1776 C CB  . PRO A 1 238 ? 80.347  51.789 19.081  1.00 21.86  ? 235  PRO A CB  1 
ATOM   1777 C CG  . PRO A 1 238 ? 80.309  53.255 18.789  1.00 23.96  ? 235  PRO A CG  1 
ATOM   1778 C CD  . PRO A 1 238 ? 80.841  53.930 20.043  1.00 21.83  ? 235  PRO A CD  1 
ATOM   1779 N N   . TRP A 1 239 ? 83.668  52.193 18.719  1.00 21.80  ? 236  TRP A N   1 
ATOM   1780 C CA  . TRP A 1 239 ? 84.833  51.940 17.883  1.00 23.72  ? 236  TRP A CA  1 
ATOM   1781 C C   . TRP A 1 239 ? 86.115  51.733 18.689  1.00 27.06  ? 236  TRP A C   1 
ATOM   1782 O O   . TRP A 1 239 ? 87.123  51.307 18.116  1.00 24.59  ? 236  TRP A O   1 
ATOM   1783 C CB  . TRP A 1 239 ? 85.045  53.117 16.924  1.00 20.00  ? 236  TRP A CB  1 
ATOM   1784 C CG  . TRP A 1 239 ? 85.056  54.413 17.697  1.00 24.21  ? 236  TRP A CG  1 
ATOM   1785 C CD1 . TRP A 1 239 ? 83.977  55.196 17.985  1.00 18.09  ? 236  TRP A CD1 1 
ATOM   1786 C CD2 . TRP A 1 239 ? 86.193  55.035 18.337  1.00 19.68  ? 236  TRP A CD2 1 
ATOM   1787 N NE1 . TRP A 1 239 ? 84.373  56.287 18.734  1.00 20.69  ? 236  TRP A NE1 1 
ATOM   1788 C CE2 . TRP A 1 239 ? 85.727  56.211 18.958  1.00 20.53  ? 236  TRP A CE2 1 
ATOM   1789 C CE3 . TRP A 1 239 ? 87.570  54.735 18.396  1.00 19.01  ? 236  TRP A CE3 1 
ATOM   1790 C CZ2 . TRP A 1 239 ? 86.582  57.079 19.664  1.00 24.37  ? 236  TRP A CZ2 1 
ATOM   1791 C CZ3 . TRP A 1 239 ? 88.408  55.587 19.088  1.00 17.28  ? 236  TRP A CZ3 1 
ATOM   1792 C CH2 . TRP A 1 239 ? 87.916  56.747 19.717  1.00 21.38  ? 236  TRP A CH2 1 
ATOM   1793 N N   . ALA A 1 240 ? 86.096  52.009 19.995  1.00 20.30  ? 237  ALA A N   1 
ATOM   1794 C CA  . ALA A 1 240 ? 87.320  52.209 20.759  1.00 19.86  ? 237  ALA A CA  1 
ATOM   1795 C C   . ALA A 1 240 ? 87.883  50.929 21.357  1.00 22.53  ? 237  ALA A C   1 
ATOM   1796 O O   . ALA A 1 240 ? 89.057  50.913 21.746  1.00 22.92  ? 237  ALA A O   1 
ATOM   1797 C CB  . ALA A 1 240 ? 87.085  53.226 21.877  1.00 17.31  ? 237  ALA A CB  1 
ATOM   1798 N N   . THR A 1 241 ? 87.091  49.866 21.441  1.00 16.64  ? 238  THR A N   1 
ATOM   1799 C CA  . THR A 1 241 ? 87.544  48.601 21.988  1.00 18.67  ? 238  THR A CA  1 
ATOM   1800 C C   . THR A 1 241 ? 86.932  47.501 21.158  1.00 19.63  ? 238  THR A C   1 
ATOM   1801 O O   . THR A 1 241 ? 86.006  47.719 20.380  1.00 23.95  ? 238  THR A O   1 
ATOM   1802 C CB  . THR A 1 241 ? 87.166  48.392 23.470  1.00 23.10  ? 238  THR A CB  1 
ATOM   1803 O OG1 . THR A 1 241 ? 85.738  48.349 23.612  1.00 25.50  ? 238  THR A OG1 1 
ATOM   1804 C CG2 . THR A 1 241 ? 87.693  49.526 24.341  1.00 17.38  ? 238  THR A CG2 1 
ATOM   1805 N N   . VAL A 1 242 ? 87.453  46.300 21.349  1.00 24.01  ? 239  VAL A N   1 
ATOM   1806 C CA  . VAL A 1 242 ? 87.020  45.153 20.582  1.00 25.54  ? 239  VAL A CA  1 
ATOM   1807 C C   . VAL A 1 242 ? 87.095  43.956 21.517  1.00 26.68  ? 239  VAL A C   1 
ATOM   1808 O O   . VAL A 1 242 ? 87.833  43.975 22.506  1.00 27.72  ? 239  VAL A O   1 
ATOM   1809 C CB  . VAL A 1 242 ? 87.890  45.011 19.305  1.00 29.24  ? 239  VAL A CB  1 
ATOM   1810 C CG1 . VAL A 1 242 ? 89.249  44.326 19.611  1.00 21.91  ? 239  VAL A CG1 1 
ATOM   1811 C CG2 . VAL A 1 242 ? 87.130  44.323 18.200  1.00 30.10  ? 239  VAL A CG2 1 
ATOM   1812 N N   . GLY A 1 243 ? 86.278  42.931 21.238  1.00 31.42  ? 240  GLY A N   1 
ATOM   1813 C CA  . GLY A 1 243 ? 86.256  41.755 22.089  1.00 26.95  ? 240  GLY A CA  1 
ATOM   1814 C C   . GLY A 1 243 ? 87.324  40.733 21.717  1.00 31.70  ? 240  GLY A C   1 
ATOM   1815 O O   . GLY A 1 243 ? 87.878  40.728 20.613  1.00 29.24  ? 240  GLY A O   1 
ATOM   1816 N N   . MET A 1 244 ? 87.603  39.842 22.672  1.00 31.59  ? 241  MET A N   1 
ATOM   1817 C CA  . MET A 1 244 ? 88.666  38.859 22.494  1.00 34.17  ? 241  MET A CA  1 
ATOM   1818 C C   . MET A 1 244 ? 88.470  38.046 21.220  1.00 38.46  ? 241  MET A C   1 
ATOM   1819 O O   . MET A 1 244 ? 89.399  37.900 20.413  1.00 33.79  ? 241  MET A O   1 
ATOM   1820 C CB  . MET A 1 244 ? 88.740  37.938 23.713  1.00 32.99  ? 241  MET A CB  1 
ATOM   1821 C CG  . MET A 1 244 ? 89.608  38.463 24.849  1.00 41.79  ? 241  MET A CG  1 
ATOM   1822 S SD  . MET A 1 244 ? 89.453  37.414 26.320  1.00 53.73  ? 241  MET A SD  1 
ATOM   1823 C CE  . MET A 1 244 ? 91.130  37.329 26.923  1.00 53.52  ? 241  MET A CE  1 
ATOM   1824 N N   . GLY A 1 245 ? 87.261  37.512 21.018  1.00 34.42  ? 242  GLY A N   1 
ATOM   1825 C CA  . GLY A 1 245 ? 87.014  36.703 19.837  1.00 33.80  ? 242  GLY A CA  1 
ATOM   1826 C C   . GLY A 1 245 ? 87.163  37.483 18.543  1.00 33.18  ? 242  GLY A C   1 
ATOM   1827 O O   . GLY A 1 245 ? 87.728  36.985 17.563  1.00 30.13  ? 242  GLY A O   1 
ATOM   1828 N N   . GLU A 1 246 ? 86.655  38.715 18.512  1.00 31.17  ? 243  GLU A N   1 
ATOM   1829 C CA  . GLU A 1 246 ? 86.774  39.498 17.284  1.00 36.27  ? 243  GLU A CA  1 
ATOM   1830 C C   . GLU A 1 246 ? 88.232  39.913 17.039  1.00 29.33  ? 243  GLU A C   1 
ATOM   1831 O O   . GLU A 1 246 ? 88.702  39.891 15.896  1.00 25.00  ? 243  GLU A O   1 
ATOM   1832 C CB  . GLU A 1 246 ? 85.819  40.697 17.336  1.00 27.91  ? 243  GLU A CB  1 
ATOM   1833 C CG  . GLU A 1 246 ? 85.806  41.610 16.099  1.00 32.04  ? 243  GLU A CG  1 
ATOM   1834 C CD  . GLU A 1 246 ? 85.448  40.908 14.788  1.00 35.04  ? 243  GLU A CD  1 
ATOM   1835 O OE1 . GLU A 1 246 ? 85.010  39.735 14.801  1.00 37.32  ? 243  GLU A OE1 1 
ATOM   1836 O OE2 . GLU A 1 246 ? 85.622  41.538 13.723  1.00 35.98  ? 243  GLU A OE2 1 
ATOM   1837 N N   . ALA A 1 247 ? 88.979  40.209 18.110  1.00 28.40  ? 244  ALA A N   1 
ATOM   1838 C CA  . ALA A 1 247 ? 90.402  40.516 17.973  1.00 26.30  ? 244  ALA A CA  1 
ATOM   1839 C C   . ALA A 1 247 ? 91.170  39.326 17.419  1.00 28.36  ? 244  ALA A C   1 
ATOM   1840 O O   . ALA A 1 247 ? 91.977  39.468 16.492  1.00 30.29  ? 244  ALA A O   1 
ATOM   1841 C CB  . ALA A 1 247 ? 90.985  40.940 19.320  1.00 24.87  ? 244  ALA A CB  1 
ATOM   1842 N N   . ARG A 1 248 ? 90.929  38.137 17.971  1.00 25.35  ? 245  ARG A N   1 
ATOM   1843 C CA  . ARG A 1 248 ? 91.571  36.944 17.438  1.00 24.19  ? 245  ARG A CA  1 
ATOM   1844 C C   . ARG A 1 248 ? 91.196  36.712 15.974  1.00 29.80  ? 245  ARG A C   1 
ATOM   1845 O O   . ARG A 1 248 ? 92.041  36.297 15.168  1.00 26.28  ? 245  ARG A O   1 
ATOM   1846 C CB  . ARG A 1 248 ? 91.214  35.732 18.303  1.00 28.77  ? 245  ARG A CB  1 
ATOM   1847 C CG  . ARG A 1 248 ? 91.496  34.373 17.658  1.00 25.94  ? 245  ARG A CG  1 
ATOM   1848 C CD  . ARG A 1 248 ? 91.347  33.254 18.687  1.00 28.89  ? 245  ARG A CD  1 
ATOM   1849 N NE  . ARG A 1 248 ? 92.162  33.530 19.869  1.00 31.50  ? 245  ARG A NE  1 
ATOM   1850 C CZ  . ARG A 1 248 ? 93.430  33.150 19.991  1.00 35.26  ? 245  ARG A CZ  1 
ATOM   1851 N NH1 . ARG A 1 248 ? 94.009  32.474 19.003  1.00 32.29  ? 245  ARG A NH1 1 
ATOM   1852 N NH2 . ARG A 1 248 ? 94.120  33.438 21.094  1.00 38.37  ? 245  ARG A NH2 1 
ATOM   1853 N N   . ARG A 1 249 ? 89.935  36.967 15.609  1.00 27.81  ? 246  ARG A N   1 
ATOM   1854 C CA  . ARG A 1 249 ? 89.523  36.760 14.224  1.00 30.68  ? 246  ARG A CA  1 
ATOM   1855 C C   . ARG A 1 249 ? 90.253  37.718 13.291  1.00 28.14  ? 246  ARG A C   1 
ATOM   1856 O O   . ARG A 1 249 ? 90.632  37.350 12.174  1.00 27.65  ? 246  ARG A O   1 
ATOM   1857 C CB  . ARG A 1 249 ? 88.008  36.940 14.079  1.00 28.80  ? 246  ARG A CB  1 
ATOM   1858 C CG  . ARG A 1 249 ? 87.488  36.435 12.753  1.00 28.32  ? 246  ARG A CG  1 
ATOM   1859 C CD  . ARG A 1 249 ? 86.126  37.021 12.360  1.00 35.27  ? 246  ARG A CD  1 
ATOM   1860 N NE  . ARG A 1 249 ? 86.132  38.482 12.231  1.00 35.79  ? 246  ARG A NE  1 
ATOM   1861 C CZ  . ARG A 1 249 ? 86.609  39.153 11.186  1.00 37.44  ? 246  ARG A CZ  1 
ATOM   1862 N NH1 . ARG A 1 249 ? 87.139  38.501 10.152  1.00 33.44  ? 246  ARG A NH1 1 
ATOM   1863 N NH2 . ARG A 1 249 ? 86.561  40.480 11.177  1.00 35.32  ? 246  ARG A NH2 1 
ATOM   1864 N N   . ARG A 1 250 ? 90.462  38.954 13.735  1.00 25.93  ? 247  ARG A N   1 
ATOM   1865 C CA  . ARG A 1 250 ? 91.097  39.932 12.866  1.00 29.21  ? 247  ARG A CA  1 
ATOM   1866 C C   . ARG A 1 250 ? 92.585  39.643 12.722  1.00 25.48  ? 247  ARG A C   1 
ATOM   1867 O O   . ARG A 1 250 ? 93.116  39.663 11.606  1.00 21.90  ? 247  ARG A O   1 
ATOM   1868 C CB  . ARG A 1 250 ? 90.833  41.342 13.389  1.00 24.89  ? 247  ARG A CB  1 
ATOM   1869 C CG  . ARG A 1 250 ? 89.358  41.728 13.347  1.00 23.41  ? 247  ARG A CG  1 
ATOM   1870 C CD  . ARG A 1 250 ? 89.135  43.153 13.863  1.00 29.35  ? 247  ARG A CD  1 
ATOM   1871 N NE  . ARG A 1 250 ? 87.717  43.508 13.917  1.00 24.46  ? 247  ARG A NE  1 
ATOM   1872 C CZ  . ARG A 1 250 ? 87.250  44.678 14.347  1.00 29.87  ? 247  ARG A CZ  1 
ATOM   1873 N NH1 . ARG A 1 250 ? 88.086  45.634 14.764  1.00 26.95  ? 247  ARG A NH1 1 
ATOM   1874 N NH2 . ARG A 1 250 ? 85.942  44.900 14.372  1.00 24.63  ? 247  ARG A NH2 1 
ATOM   1875 N N   . ALA A 1 251 ? 93.257  39.310 13.824  1.00 25.88  ? 248  ALA A N   1 
ATOM   1876 C CA  . ALA A 1 251 ? 94.675  38.959 13.748  1.00 26.26  ? 248  ALA A CA  1 
ATOM   1877 C C   . ALA A 1 251 ? 94.896  37.760 12.835  1.00 29.20  ? 248  ALA A C   1 
ATOM   1878 O O   . ALA A 1 251 ? 95.857  37.730 12.046  1.00 23.35  ? 248  ALA A O   1 
ATOM   1879 C CB  . ALA A 1 251 ? 95.229  38.685 15.148  1.00 19.73  ? 248  ALA A CB  1 
ATOM   1880 N N   . THR A 1 252 ? 93.990  36.782 12.898  1.00 26.56  ? 249  THR A N   1 
ATOM   1881 C CA  . THR A 1 252 ? 94.142  35.561 12.113  1.00 24.06  ? 249  THR A CA  1 
ATOM   1882 C C   . THR A 1 252 ? 93.894  35.818 10.633  1.00 24.50  ? 249  THR A C   1 
ATOM   1883 O O   . THR A 1 252 ? 94.575  35.249 9.769   1.00 23.45  ? 249  THR A O   1 
ATOM   1884 C CB  . THR A 1 252 ? 93.189  34.494 12.645  1.00 25.96  ? 249  THR A CB  1 
ATOM   1885 O OG1 . THR A 1 252 ? 93.466  34.278 14.030  1.00 27.80  ? 249  THR A OG1 1 
ATOM   1886 C CG2 . THR A 1 252 ? 93.343  33.189 11.879  1.00 29.09  ? 249  THR A CG2 1 
ATOM   1887 N N   . GLN A 1 253 ? 92.929  36.673 10.321  1.00 25.63  ? 250  GLN A N   1 
ATOM   1888 C CA  . GLN A 1 253 ? 92.713  37.018 8.926   1.00 28.44  ? 250  GLN A CA  1 
ATOM   1889 C C   . GLN A 1 253 ? 93.864  37.849 8.365   1.00 27.98  ? 250  GLN A C   1 
ATOM   1890 O O   . GLN A 1 253 ? 94.282  37.634 7.219   1.00 27.56  ? 250  GLN A O   1 
ATOM   1891 C CB  . GLN A 1 253 ? 91.398  37.760 8.756   1.00 27.40  ? 250  GLN A CB  1 
ATOM   1892 C CG  . GLN A 1 253 ? 91.293  38.288 7.343   1.00 33.06  ? 250  GLN A CG  1 
ATOM   1893 C CD  . GLN A 1 253 ? 89.886  38.477 6.884   1.00 48.17  ? 250  GLN A CD  1 
ATOM   1894 O OE1 . GLN A 1 253 ? 89.109  39.236 7.482   1.00 50.76  ? 250  GLN A OE1 1 
ATOM   1895 N NE2 . GLN A 1 253 ? 89.534  37.790 5.806   1.00 55.10  ? 250  GLN A NE2 1 
ATOM   1896 N N   . LEU A 1 254 ? 94.377  38.815 9.139   1.00 24.50  ? 251  LEU A N   1 
ATOM   1897 C CA  . LEU A 1 254 ? 95.584  39.514 8.707   1.00 27.00  ? 251  LEU A CA  1 
ATOM   1898 C C   . LEU A 1 254 ? 96.693  38.517 8.401   1.00 26.27  ? 251  LEU A C   1 
ATOM   1899 O O   . LEU A 1 254 ? 97.323  38.570 7.335   1.00 26.59  ? 251  LEU A O   1 
ATOM   1900 C CB  . LEU A 1 254 ? 96.052  40.519 9.764   1.00 19.87  ? 251  LEU A CB  1 
ATOM   1901 C CG  . LEU A 1 254 ? 97.265  41.324 9.243   1.00 26.49  ? 251  LEU A CG  1 
ATOM   1902 C CD1 . LEU A 1 254 ? 96.848  42.265 8.091   1.00 20.68  ? 251  LEU A CD1 1 
ATOM   1903 C CD2 . LEU A 1 254 ? 97.971  42.112 10.351  1.00 19.94  ? 251  LEU A CD2 1 
ATOM   1904 N N   . ALA A 1 255 ? 96.927  37.580 9.324   1.00 24.49  ? 252  ALA A N   1 
ATOM   1905 C CA  . ALA A 1 255 ? 97.922  36.539 9.101   1.00 26.89  ? 252  ALA A CA  1 
ATOM   1906 C C   . ALA A 1 255 ? 97.671  35.811 7.787   1.00 24.78  ? 252  ALA A C   1 
ATOM   1907 O O   . ALA A 1 255 ? 98.592  35.604 6.990   1.00 27.30  ? 252  ALA A O   1 
ATOM   1908 C CB  . ALA A 1 255 ? 97.919  35.553 10.279  1.00 24.32  ? 252  ALA A CB  1 
ATOM   1909 N N   . HIS A 1 256 ? 96.420  35.417 7.545   1.00 25.20  ? 253  HIS A N   1 
ATOM   1910 C CA  . HIS A 1 256 ? 96.071  34.741 6.296   1.00 27.14  ? 253  HIS A CA  1 
ATOM   1911 C C   . HIS A 1 256 ? 96.371  35.621 5.083   1.00 25.98  ? 253  HIS A C   1 
ATOM   1912 O O   . HIS A 1 256 ? 96.928  35.157 4.085   1.00 26.88  ? 253  HIS A O   1 
ATOM   1913 C CB  . HIS A 1 256 ? 94.587  34.342 6.313   1.00 23.66  ? 253  HIS A CB  1 
ATOM   1914 C CG  . HIS A 1 256 ? 94.066  33.883 4.979   1.00 30.87  ? 253  HIS A CG  1 
ATOM   1915 N ND1 . HIS A 1 256 ? 94.299  32.619 4.478   1.00 35.39  ? 253  HIS A ND1 1 
ATOM   1916 C CD2 . HIS A 1 256 ? 93.335  34.529 4.036   1.00 30.51  ? 253  HIS A CD2 1 
ATOM   1917 C CE1 . HIS A 1 256 ? 93.732  32.504 3.289   1.00 32.89  ? 253  HIS A CE1 1 
ATOM   1918 N NE2 . HIS A 1 256 ? 93.141  33.649 2.997   1.00 32.83  ? 253  HIS A NE2 1 
ATOM   1919 N N   . LEU A 1 257 ? 95.990  36.896 5.143   1.00 24.43  ? 254  LEU A N   1 
ATOM   1920 C CA  . LEU A 1 257 ? 96.156  37.744 3.976   1.00 26.84  ? 254  LEU A CA  1 
ATOM   1921 C C   . LEU A 1 257 ? 97.619  37.880 3.583   1.00 27.78  ? 254  LEU A C   1 
ATOM   1922 O O   . LEU A 1 257 ? 97.915  38.136 2.408   1.00 24.77  ? 254  LEU A O   1 
ATOM   1923 C CB  . LEU A 1 257 ? 95.531  39.115 4.237   1.00 23.98  ? 254  LEU A CB  1 
ATOM   1924 C CG  . LEU A 1 257 ? 93.997  39.119 4.259   1.00 26.27  ? 254  LEU A CG  1 
ATOM   1925 C CD1 . LEU A 1 257 ? 93.501  40.442 4.779   1.00 22.19  ? 254  LEU A CD1 1 
ATOM   1926 C CD2 . LEU A 1 257 ? 93.422  38.843 2.860   1.00 22.81  ? 254  LEU A CD2 1 
ATOM   1927 N N   . VAL A 1 258 ? 98.539  37.677 4.520   1.00 22.94  ? 255  VAL A N   1 
ATOM   1928 C CA  . VAL A 1 258 ? 99.955  37.798 4.222   1.00 23.39  ? 255  VAL A CA  1 
ATOM   1929 C C   . VAL A 1 258 ? 100.621 36.427 4.174   1.00 27.85  ? 255  VAL A C   1 
ATOM   1930 O O   . VAL A 1 258 ? 101.832 36.318 4.340   1.00 29.42  ? 255  VAL A O   1 
ATOM   1931 C CB  . VAL A 1 258 ? 100.655 38.750 5.205   1.00 23.85  ? 255  VAL A CB  1 
ATOM   1932 C CG1 . VAL A 1 258 ? 100.043 40.137 5.088   1.00 25.74  ? 255  VAL A CG1 1 
ATOM   1933 C CG2 . VAL A 1 258 ? 100.549 38.244 6.657   1.00 22.85  ? 255  VAL A CG2 1 
ATOM   1934 N N   . GLY A 1 259 ? 99.842  35.377 3.935   1.00 27.44  ? 256  GLY A N   1 
ATOM   1935 C CA  . GLY A 1 259 ? 100.416 34.053 3.793   1.00 32.34  ? 256  GLY A CA  1 
ATOM   1936 C C   . GLY A 1 259 ? 100.849 33.375 5.073   1.00 35.32  ? 256  GLY A C   1 
ATOM   1937 O O   . GLY A 1 259 ? 101.702 32.488 5.021   1.00 34.96  ? 256  GLY A O   1 
ATOM   1938 N N   . CYS A 1 260 ? 100.293 33.760 6.220   1.00 36.11  ? 257  CYS A N   1 
ATOM   1939 C CA  . CYS A 1 260 ? 100.612 33.114 7.495   1.00 37.90  ? 257  CYS A CA  1 
ATOM   1940 C C   . CYS A 1 260 ? 99.413  32.325 8.046   1.00 40.75  ? 257  CYS A C   1 
ATOM   1941 O O   . CYS A 1 260 ? 98.319  32.864 8.175   1.00 39.68  ? 257  CYS A O   1 
ATOM   1942 C CB  . CYS A 1 260 ? 101.071 34.160 8.515   1.00 33.05  ? 257  CYS A CB  1 
ATOM   1943 S SG  . CYS A 1 260 ? 102.720 34.888 8.171   1.00 43.76  ? 257  CYS A SG  1 
ATOM   1944 N N   . PRO A 1 261 ? 99.611  31.040 8.383   1.00 48.70  ? 258  PRO A N   1 
ATOM   1945 C CA  . PRO A 1 261 ? 100.863 30.291 8.288   1.00 52.31  ? 258  PRO A CA  1 
ATOM   1946 C C   . PRO A 1 261 ? 101.042 29.692 6.890   1.00 57.11  ? 258  PRO A C   1 
ATOM   1947 O O   . PRO A 1 261 ? 100.063 29.585 6.139   1.00 48.42  ? 258  PRO A O   1 
ATOM   1948 C CB  . PRO A 1 261 ? 100.675 29.200 9.340   1.00 55.45  ? 258  PRO A CB  1 
ATOM   1949 C CG  . PRO A 1 261 ? 99.214  28.874 9.221   1.00 56.42  ? 258  PRO A CG  1 
ATOM   1950 C CD  . PRO A 1 261 ? 98.518  30.188 8.895   1.00 52.69  ? 258  PRO A CD  1 
ATOM   1951 N N   . PRO A 1 262 ? 102.270 29.311 6.538   1.00 61.28  ? 259  PRO A N   1 
ATOM   1952 C CA  . PRO A 1 262 ? 102.489 28.673 5.228   1.00 65.31  ? 259  PRO A CA  1 
ATOM   1953 C C   . PRO A 1 262 ? 101.760 27.340 5.171   1.00 73.25  ? 259  PRO A C   1 
ATOM   1954 O O   . PRO A 1 262 ? 102.004 26.448 5.984   1.00 76.67  ? 259  PRO A O   1 
ATOM   1955 C CB  . PRO A 1 262 ? 104.014 28.497 5.167   1.00 63.60  ? 259  PRO A CB  1 
ATOM   1956 C CG  . PRO A 1 262 ? 104.568 29.391 6.260   1.00 58.23  ? 259  PRO A CG  1 
ATOM   1957 C CD  . PRO A 1 262 ? 103.515 29.409 7.321   1.00 57.77  ? 259  PRO A CD  1 
ATOM   1958 N N   . GLY A 1 263 ? 100.842 27.215 4.216   1.00 72.17  ? 260  GLY A N   1 
ATOM   1959 C CA  . GLY A 1 263 ? 100.024 26.016 4.109   1.00 71.94  ? 260  GLY A CA  1 
ATOM   1960 C C   . GLY A 1 263 ? 100.817 24.725 3.970   1.00 80.00  ? 260  GLY A C   1 
ATOM   1961 O O   . GLY A 1 263 ? 101.791 24.667 3.220   1.00 83.76  ? 260  GLY A O   1 
ATOM   1962 N N   . GLY A 1 264 ? 100.427 23.698 4.720   1.00 82.32  ? 261  GLY A N   1 
ATOM   1963 C CA  . GLY A 1 264 ? 99.381  23.819 5.719   1.00 85.54  ? 261  GLY A CA  1 
ATOM   1964 C C   . GLY A 1 264 ? 99.987  23.812 7.108   1.00 91.36  ? 261  GLY A C   1 
ATOM   1965 O O   . GLY A 1 264 ? 99.268  23.773 8.113   1.00 93.67  ? 261  GLY A O   1 
ATOM   1966 N N   . THR A 1 265 ? 101.320 23.854 7.155   1.00 88.59  ? 262  THR A N   1 
ATOM   1967 C CA  . THR A 1 265 ? 102.042 23.859 8.422   1.00 85.23  ? 262  THR A CA  1 
ATOM   1968 C C   . THR A 1 265 ? 101.689 25.094 9.246   1.00 84.68  ? 262  THR A C   1 
ATOM   1969 O O   . THR A 1 265 ? 101.704 26.223 8.746   1.00 84.43  ? 262  THR A O   1 
ATOM   1970 C CB  . THR A 1 265 ? 103.560 23.785 8.170   1.00 84.92  ? 262  THR A CB  1 
ATOM   1971 O OG1 . THR A 1 265 ? 104.237 23.448 9.386   1.00 96.72  ? 262  THR A OG1 1 
ATOM   1972 C CG2 . THR A 1 265 ? 104.126 25.093 7.636   1.00 75.56  ? 262  THR A CG2 1 
ATOM   1973 N N   . GLY A 1 266 ? 101.339 24.877 10.505  1.00 82.37  ? 263  GLY A N   1 
ATOM   1974 C CA  . GLY A 1 266 ? 101.123 25.966 11.434  1.00 73.34  ? 263  GLY A CA  1 
ATOM   1975 C C   . GLY A 1 266 ? 99.669  26.083 11.858  1.00 76.18  ? 263  GLY A C   1 
ATOM   1976 O O   . GLY A 1 266 ? 98.761  25.467 11.292  1.00 84.14  ? 263  GLY A O   1 
ATOM   1977 N N   . GLY A 1 267 ? 99.468  26.906 12.884  1.00 67.23  ? 264  GLY A N   1 
ATOM   1978 C CA  . GLY A 1 267 ? 98.142  27.133 13.421  1.00 67.24  ? 264  GLY A CA  1 
ATOM   1979 C C   . GLY A 1 267 ? 98.126  27.817 14.775  1.00 62.58  ? 264  GLY A C   1 
ATOM   1980 O O   . GLY A 1 267 ? 97.438  28.831 14.939  1.00 57.42  ? 264  GLY A O   1 
ATOM   1981 N N   . ASN A 1 268 ? 98.871  27.283 15.749  1.00 55.66  ? 265  ASN A N   1 
ATOM   1982 C CA  . ASN A 1 268 ? 98.824  27.841 17.092  1.00 54.12  ? 265  ASN A CA  1 
ATOM   1983 C C   . ASN A 1 268 ? 99.389  29.262 17.093  1.00 50.87  ? 265  ASN A C   1 
ATOM   1984 O O   . ASN A 1 268 ? 99.987  29.731 16.119  1.00 49.07  ? 265  ASN A O   1 
ATOM   1985 C CB  . ASN A 1 268 ? 99.534  26.922 18.106  1.00 52.73  ? 265  ASN A CB  1 
ATOM   1986 C CG  . ASN A 1 268 ? 101.064 26.851 17.936  1.00 57.97  ? 265  ASN A CG  1 
ATOM   1987 O OD1 . ASN A 1 268 ? 101.732 27.849 17.657  1.00 50.92  ? 265  ASN A OD1 1 
ATOM   1988 N ND2 . ASN A 1 268 ? 101.621 25.652 18.151  1.00 54.95  ? 265  ASN A ND2 1 
ATOM   1989 N N   . ASP A 1 269 ? 99.158  29.964 18.201  1.00 43.63  ? 266  ASP A N   1 
ATOM   1990 C CA  . ASP A 1 269 ? 99.505  31.376 18.257  1.00 42.67  ? 266  ASP A CA  1 
ATOM   1991 C C   . ASP A 1 269 ? 101.009 31.602 18.149  1.00 45.19  ? 266  ASP A C   1 
ATOM   1992 O O   . ASP A 1 269 ? 101.441 32.612 17.576  1.00 40.25  ? 266  ASP A O   1 
ATOM   1993 C CB  . ASP A 1 269 ? 98.956  31.996 19.540  1.00 40.20  ? 266  ASP A CB  1 
ATOM   1994 C CG  . ASP A 1 269 ? 97.433  32.007 19.577  1.00 45.66  ? 266  ASP A CG  1 
ATOM   1995 O OD1 . ASP A 1 269 ? 96.801  31.700 18.534  1.00 43.87  ? 266  ASP A OD1 1 
ATOM   1996 O OD2 . ASP A 1 269 ? 96.873  32.332 20.650  1.00 45.52  ? 266  ASP A OD2 1 
ATOM   1997 N N   . THR A 1 270 ? 101.820 30.691 18.688  1.00 42.89  ? 267  THR A N   1 
ATOM   1998 C CA  . THR A 1 270 ? 103.266 30.860 18.589  1.00 44.07  ? 267  THR A CA  1 
ATOM   1999 C C   . THR A 1 270 ? 103.702 30.871 17.131  1.00 42.22  ? 267  THR A C   1 
ATOM   2000 O O   . THR A 1 270 ? 104.431 31.770 16.695  1.00 40.68  ? 267  THR A O   1 
ATOM   2001 C CB  . THR A 1 270 ? 103.983 29.756 19.368  1.00 44.21  ? 267  THR A CB  1 
ATOM   2002 O OG1 . THR A 1 270 ? 103.590 29.816 20.743  1.00 47.20  ? 267  THR A OG1 1 
ATOM   2003 C CG2 . THR A 1 270 ? 105.489 29.933 19.284  1.00 42.01  ? 267  THR A CG2 1 
ATOM   2004 N N   . GLU A 1 271 ? 103.213 29.906 16.350  1.00 39.41  ? 268  GLU A N   1 
ATOM   2005 C CA  . GLU A 1 271 ? 103.572 29.830 14.939  1.00 43.76  ? 268  GLU A CA  1 
ATOM   2006 C C   . GLU A 1 271 ? 103.031 31.022 14.153  1.00 43.35  ? 268  GLU A C   1 
ATOM   2007 O O   . GLU A 1 271 ? 103.718 31.551 13.270  1.00 44.60  ? 268  GLU A O   1 
ATOM   2008 C CB  . GLU A 1 271 ? 103.062 28.516 14.353  1.00 48.54  ? 268  GLU A CB  1 
ATOM   2009 C CG  . GLU A 1 271 ? 103.738 27.280 14.948  1.00 56.31  ? 268  GLU A CG  1 
ATOM   2010 C CD  . GLU A 1 271 ? 102.874 26.027 14.861  1.00 62.78  ? 268  GLU A CD  1 
ATOM   2011 O OE1 . GLU A 1 271 ? 101.630 26.159 14.875  1.00 57.09  ? 268  GLU A OE1 1 
ATOM   2012 O OE2 . GLU A 1 271 ? 103.440 24.911 14.786  1.00 69.21  ? 268  GLU A OE2 1 
ATOM   2013 N N   . LEU A 1 272 ? 101.810 31.464 14.460  1.00 40.02  ? 269  LEU A N   1 
ATOM   2014 C CA  . LEU A 1 272 ? 101.215 32.581 13.728  1.00 40.52  ? 269  LEU A CA  1 
ATOM   2015 C C   . LEU A 1 272 ? 102.020 33.859 13.928  1.00 33.88  ? 269  LEU A C   1 
ATOM   2016 O O   . LEU A 1 272 ? 102.358 34.555 12.966  1.00 36.51  ? 269  LEU A O   1 
ATOM   2017 C CB  . LEU A 1 272 ? 99.771  32.786 14.183  1.00 41.70  ? 269  LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 272 ? 98.700  33.027 13.130  1.00 46.11  ? 269  LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 272 ? 98.824  32.041 11.977  1.00 42.67  ? 269  LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 272 ? 97.339  32.908 13.798  1.00 36.37  ? 269  LEU A CD2 1 
ATOM   2021 N N   . VAL A 1 273 ? 102.328 34.187 15.177  1.00 35.16  ? 270  VAL A N   1 
ATOM   2022 C CA  . VAL A 1 273 ? 103.060 35.414 15.452  1.00 32.07  ? 270  VAL A CA  1 
ATOM   2023 C C   . VAL A 1 273 ? 104.477 35.337 14.892  1.00 35.24  ? 270  VAL A C   1 
ATOM   2024 O O   . VAL A 1 273 ? 105.004 36.324 14.364  1.00 33.46  ? 270  VAL A O   1 
ATOM   2025 C CB  . VAL A 1 273 ? 103.054 35.692 16.961  1.00 32.47  ? 270  VAL A CB  1 
ATOM   2026 C CG1 . VAL A 1 273 ? 103.807 36.963 17.258  1.00 32.05  ? 270  VAL A CG1 1 
ATOM   2027 C CG2 . VAL A 1 273 ? 101.629 35.799 17.444  1.00 31.40  ? 270  VAL A CG2 1 
ATOM   2028 N N   . ALA A 1 274 ? 105.121 34.174 14.998  1.00 34.39  ? 271  ALA A N   1 
ATOM   2029 C CA  . ALA A 1 274 ? 106.467 34.046 14.458  1.00 34.36  ? 271  ALA A CA  1 
ATOM   2030 C C   . ALA A 1 274 ? 106.473 34.306 12.958  1.00 37.18  ? 271  ALA A C   1 
ATOM   2031 O O   . ALA A 1 274 ? 107.377 34.972 12.440  1.00 38.68  ? 271  ALA A O   1 
ATOM   2032 C CB  . ALA A 1 274 ? 107.036 32.664 14.768  1.00 34.71  ? 271  ALA A CB  1 
ATOM   2033 N N   . CYS A 1 275 ? 105.459 33.809 12.246  1.00 33.33  ? 272  CYS A N   1 
ATOM   2034 C CA  . CYS A 1 275 ? 105.376 34.062 10.814  1.00 29.08  ? 272  CYS A CA  1 
ATOM   2035 C C   . CYS A 1 275 ? 105.061 35.528 10.530  1.00 30.04  ? 272  CYS A C   1 
ATOM   2036 O O   . CYS A 1 275 ? 105.558 36.093 9.552   1.00 31.33  ? 272  CYS A O   1 
ATOM   2037 C CB  . CYS A 1 275 ? 104.328 33.138 10.186  1.00 30.88  ? 272  CYS A CB  1 
ATOM   2038 S SG  . CYS A 1 275 ? 104.089 33.331 8.403   1.00 46.18  ? 272  CYS A SG  1 
ATOM   2039 N N   . LEU A 1 276 ? 104.228 36.158 11.364  1.00 27.48  ? 273  LEU A N   1 
ATOM   2040 C CA  . LEU A 1 276 ? 103.950 37.582 11.200  1.00 27.34  ? 273  LEU A CA  1 
ATOM   2041 C C   . LEU A 1 276 ? 105.191 38.436 11.425  1.00 31.08  ? 273  LEU A C   1 
ATOM   2042 O O   . LEU A 1 276 ? 105.335 39.505 10.813  1.00 26.66  ? 273  LEU A O   1 
ATOM   2043 C CB  . LEU A 1 276 ? 102.864 38.021 12.172  1.00 24.81  ? 273  LEU A CB  1 
ATOM   2044 C CG  . LEU A 1 276 ? 101.408 37.693 11.865  1.00 27.40  ? 273  LEU A CG  1 
ATOM   2045 C CD1 . LEU A 1 276 ? 100.567 38.048 13.074  1.00 26.70  ? 273  LEU A CD1 1 
ATOM   2046 C CD2 . LEU A 1 276 ? 100.950 38.470 10.632  1.00 27.20  ? 273  LEU A CD2 1 
ATOM   2047 N N   . ARG A 1 277 ? 106.080 38.003 12.325  1.00 28.66  ? 274  ARG A N   1 
ATOM   2048 C CA  . ARG A 1 277 ? 107.262 38.792 12.637  1.00 30.91  ? 274  ARG A CA  1 
ATOM   2049 C C   . ARG A 1 277 ? 108.281 38.777 11.503  1.00 26.27  ? 274  ARG A C   1 
ATOM   2050 O O   . ARG A 1 277 ? 109.137 39.661 11.452  1.00 33.30  ? 274  ARG A O   1 
ATOM   2051 C CB  . ARG A 1 277 ? 107.894 38.305 13.951  1.00 30.35  ? 274  ARG A CB  1 
ATOM   2052 C CG  . ARG A 1 277 ? 107.062 38.665 15.188  1.00 28.70  ? 274  ARG A CG  1 
ATOM   2053 C CD  . ARG A 1 277 ? 107.886 38.704 16.484  1.00 33.44  ? 274  ARG A CD  1 
ATOM   2054 N NE  . ARG A 1 277 ? 107.605 37.552 17.333  1.00 45.17  ? 274  ARG A NE  1 
ATOM   2055 C CZ  . ARG A 1 277 ? 106.988 37.595 18.517  1.00 43.41  ? 274  ARG A CZ  1 
ATOM   2056 N NH1 . ARG A 1 277 ? 106.584 38.746 19.056  1.00 35.91  ? 274  ARG A NH1 1 
ATOM   2057 N NH2 . ARG A 1 277 ? 106.783 36.462 19.175  1.00 45.60  ? 274  ARG A NH2 1 
ATOM   2058 N N   . THR A 1 278 ? 108.192 37.824 10.579  1.00 26.98  ? 275  THR A N   1 
ATOM   2059 C CA  . THR A 1 278 ? 109.076 37.806 9.418   1.00 27.90  ? 275  THR A CA  1 
ATOM   2060 C C   . THR A 1 278 ? 108.585 38.670 8.262   1.00 28.85  ? 275  THR A C   1 
ATOM   2061 O O   . THR A 1 278 ? 109.295 38.786 7.256   1.00 31.36  ? 275  THR A O   1 
ATOM   2062 C CB  . THR A 1 278 ? 109.256 36.381 8.906   1.00 31.35  ? 275  THR A CB  1 
ATOM   2063 O OG1 . THR A 1 278 ? 108.063 35.973 8.221   1.00 34.14  ? 275  THR A OG1 1 
ATOM   2064 C CG2 . THR A 1 278 ? 109.526 35.439 10.068  1.00 34.49  ? 275  THR A CG2 1 
ATOM   2065 N N   . ARG A 1 279 ? 107.414 39.264 8.365   1.00 29.61  ? 276  ARG A N   1 
ATOM   2066 C CA  . ARG A 1 279 ? 106.928 40.079 7.253   1.00 25.92  ? 276  ARG A CA  1 
ATOM   2067 C C   . ARG A 1 279 ? 107.422 41.515 7.338   1.00 23.43  ? 276  ARG A C   1 
ATOM   2068 O O   . ARG A 1 279 ? 107.471 42.101 8.424   1.00 26.05  ? 276  ARG A O   1 
ATOM   2069 C CB  . ARG A 1 279 ? 105.402 40.076 7.192   1.00 30.82  ? 276  ARG A CB  1 
ATOM   2070 C CG  . ARG A 1 279 ? 104.835 38.649 7.114   1.00 29.65  ? 276  ARG A CG  1 
ATOM   2071 C CD  . ARG A 1 279 ? 104.905 38.101 5.680   1.00 35.58  ? 276  ARG A CD  1 
ATOM   2072 N NE  . ARG A 1 279 ? 104.315 36.777 5.530   1.00 39.01  ? 276  ARG A NE  1 
ATOM   2073 C CZ  . ARG A 1 279 ? 105.024 35.667 5.359   1.00 44.34  ? 276  ARG A CZ  1 
ATOM   2074 N NH1 . ARG A 1 279 ? 106.358 35.683 5.320   1.00 44.07  ? 276  ARG A NH1 1 
ATOM   2075 N NH2 . ARG A 1 279 ? 104.377 34.503 5.218   1.00 48.21  ? 276  ARG A NH2 1 
ATOM   2076 N N   . PRO A 1 280 ? 107.760 42.102 6.198   1.00 30.47  ? 277  PRO A N   1 
ATOM   2077 C CA  . PRO A 1 280 ? 108.030 43.545 6.183   1.00 27.81  ? 277  PRO A CA  1 
ATOM   2078 C C   . PRO A 1 280 ? 106.834 44.301 6.750   1.00 24.77  ? 277  PRO A C   1 
ATOM   2079 O O   . PRO A 1 280 ? 105.682 43.983 6.444   1.00 26.16  ? 277  PRO A O   1 
ATOM   2080 C CB  . PRO A 1 280 ? 108.246 43.859 4.693   1.00 25.31  ? 277  PRO A CB  1 
ATOM   2081 C CG  . PRO A 1 280 ? 108.563 42.541 4.037   1.00 24.80  ? 277  PRO A CG  1 
ATOM   2082 C CD  . PRO A 1 280 ? 107.828 41.492 4.854   1.00 29.00  ? 277  PRO A CD  1 
ATOM   2083 N N   . ALA A 1 281 ? 107.116 45.300 7.592   1.00 22.68  ? 278  ALA A N   1 
ATOM   2084 C CA  . ALA A 1 281 ? 106.048 46.084 8.219   1.00 25.43  ? 278  ALA A CA  1 
ATOM   2085 C C   . ALA A 1 281 ? 105.032 46.603 7.201   1.00 22.51  ? 278  ALA A C   1 
ATOM   2086 O O   . ALA A 1 281 ? 103.816 46.526 7.432   1.00 18.14  ? 278  ALA A O   1 
ATOM   2087 C CB  . ALA A 1 281 ? 106.644 47.254 9.000   1.00 21.87  ? 278  ALA A CB  1 
ATOM   2088 N N   . GLN A 1 282 ? 105.511 47.138 6.072   1.00 21.62  ? 279  GLN A N   1 
ATOM   2089 C CA  . GLN A 1 282 ? 104.608 47.693 5.065   1.00 23.78  ? 279  GLN A CA  1 
ATOM   2090 C C   . GLN A 1 282 ? 103.638 46.639 4.543   1.00 20.95  ? 279  GLN A C   1 
ATOM   2091 O O   . GLN A 1 282 ? 102.488 46.954 4.206   1.00 20.92  ? 279  GLN A O   1 
ATOM   2092 C CB  . GLN A 1 282 ? 105.411 48.290 3.898   1.00 18.71  ? 279  GLN A CB  1 
ATOM   2093 C CG  . GLN A 1 282 ? 104.524 49.036 2.904   1.00 19.40  ? 279  GLN A CG  1 
ATOM   2094 C CD  . GLN A 1 282 ? 103.928 50.300 3.513   1.00 24.12  ? 279  GLN A CD  1 
ATOM   2095 O OE1 . GLN A 1 282 ? 104.645 51.124 4.085   1.00 24.62  ? 279  GLN A OE1 1 
ATOM   2096 N NE2 . GLN A 1 282 ? 102.618 50.453 3.398   1.00 25.33  ? 279  GLN A NE2 1 
ATOM   2097 N N   . VAL A 1 283 ? 104.071 45.382 4.490   1.00 17.47  ? 280  VAL A N   1 
ATOM   2098 C CA  . VAL A 1 283 ? 103.169 44.324 4.047   1.00 23.16  ? 280  VAL A CA  1 
ATOM   2099 C C   . VAL A 1 283 ? 101.989 44.192 5.003   1.00 24.11  ? 280  VAL A C   1 
ATOM   2100 O O   . VAL A 1 283 ? 100.843 44.046 4.564   1.00 24.22  ? 280  VAL A O   1 
ATOM   2101 C CB  . VAL A 1 283 ? 103.949 43.013 3.869   1.00 23.54  ? 280  VAL A CB  1 
ATOM   2102 C CG1 . VAL A 1 283 ? 103.006 41.819 3.672   1.00 23.18  ? 280  VAL A CG1 1 
ATOM   2103 C CG2 . VAL A 1 283 ? 104.863 43.168 2.662   1.00 16.95  ? 280  VAL A CG2 1 
ATOM   2104 N N   . LEU A 1 284 ? 102.231 44.309 6.321   1.00 21.87  ? 281  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 284 ? 101.115 44.274 7.267   1.00 22.27  ? 281  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 284 ? 100.189 45.469 7.054   1.00 26.66  ? 281  LEU A C   1 
ATOM   2107 O O   . LEU A 1 284 ? 98.961  45.310 6.952   1.00 23.19  ? 281  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 284 ? 101.626 44.234 8.707   1.00 20.25  ? 281  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 284 ? 102.488 43.018 9.050   1.00 25.31  ? 281  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 284 ? 102.723 42.890 10.557  1.00 21.05  ? 281  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 284 ? 101.878 41.755 8.510   1.00 21.66  ? 281  LEU A CD2 1 
ATOM   2112 N N   . VAL A 1 285 ? 100.766 46.673 6.962   1.00 20.63  ? 282  VAL A N   1 
ATOM   2113 C CA  . VAL A 1 285 ? 99.968  47.873 6.753   1.00 23.22  ? 282  VAL A CA  1 
ATOM   2114 C C   . VAL A 1 285 ? 99.044  47.705 5.548   1.00 26.17  ? 282  VAL A C   1 
ATOM   2115 O O   . VAL A 1 285 ? 97.875  48.108 5.583   1.00 23.47  ? 282  VAL A O   1 
ATOM   2116 C CB  . VAL A 1 285 ? 100.890 49.099 6.604   1.00 24.59  ? 282  VAL A CB  1 
ATOM   2117 C CG1 . VAL A 1 285 ? 100.098 50.287 6.121   1.00 20.61  ? 282  VAL A CG1 1 
ATOM   2118 C CG2 . VAL A 1 285 ? 101.605 49.418 7.947   1.00 19.74  ? 282  VAL A CG2 1 
ATOM   2119 N N   . ASN A 1 286 ? 99.535  47.060 4.483   1.00 23.53  ? 283  ASN A N   1 
ATOM   2120 C CA  . ASN A 1 286 ? 98.818  47.037 3.206   1.00 24.33  ? 283  ASN A CA  1 
ATOM   2121 C C   . ASN A 1 286 ? 97.543  46.195 3.243   1.00 30.62  ? 283  ASN A C   1 
ATOM   2122 O O   . ASN A 1 286 ? 96.751  46.258 2.299   1.00 26.08  ? 283  ASN A O   1 
ATOM   2123 C CB  . ASN A 1 286 ? 99.721  46.500 2.093   1.00 22.10  ? 283  ASN A CB  1 
ATOM   2124 C CG  . ASN A 1 286 ? 100.807 47.490 1.673   1.00 27.12  ? 283  ASN A CG  1 
ATOM   2125 O OD1 . ASN A 1 286 ? 100.794 48.677 2.045   1.00 24.32  ? 283  ASN A OD1 1 
ATOM   2126 N ND2 . ASN A 1 286 ? 101.761 46.998 0.899   1.00 24.18  ? 283  ASN A ND2 1 
ATOM   2127 N N   . HIS A 1 287 ? 97.337  45.392 4.285   1.00 24.12  ? 284  HIS A N   1 
ATOM   2128 C CA  . HIS A 1 287 ? 96.151  44.549 4.383   1.00 31.01  ? 284  HIS A CA  1 
ATOM   2129 C C   . HIS A 1 287 ? 95.307  44.903 5.591   1.00 26.95  ? 284  HIS A C   1 
ATOM   2130 O O   . HIS A 1 287 ? 94.340  44.198 5.895   1.00 28.79  ? 284  HIS A O   1 
ATOM   2131 C CB  . HIS A 1 287 ? 96.561  43.075 4.414   1.00 21.82  ? 284  HIS A CB  1 
ATOM   2132 C CG  . HIS A 1 287 ? 97.225  42.645 3.150   1.00 23.21  ? 284  HIS A CG  1 
ATOM   2133 N ND1 . HIS A 1 287 ? 96.509  42.335 2.016   1.00 22.35  ? 284  HIS A ND1 1 
ATOM   2134 C CD2 . HIS A 1 287 ? 98.532  42.520 2.818   1.00 23.74  ? 284  HIS A CD2 1 
ATOM   2135 C CE1 . HIS A 1 287 ? 97.345  42.022 1.041   1.00 26.22  ? 284  HIS A CE1 1 
ATOM   2136 N NE2 . HIS A 1 287 ? 98.579  42.133 1.499   1.00 22.56  ? 284  HIS A NE2 1 
ATOM   2137 N N   . GLU A 1 288 ? 95.634  45.999 6.264   1.00 28.05  ? 285  GLU A N   1 
ATOM   2138 C CA  . GLU A 1 288 ? 94.991  46.304 7.530   1.00 33.56  ? 285  GLU A CA  1 
ATOM   2139 C C   . GLU A 1 288 ? 93.484  46.507 7.375   1.00 31.80  ? 285  GLU A C   1 
ATOM   2140 O O   . GLU A 1 288 ? 92.704  46.005 8.193   1.00 25.19  ? 285  GLU A O   1 
ATOM   2141 C CB  . GLU A 1 288 ? 95.637  47.532 8.144   1.00 27.10  ? 285  GLU A CB  1 
ATOM   2142 C CG  . GLU A 1 288 ? 95.000  47.918 9.446   1.00 30.98  ? 285  GLU A CG  1 
ATOM   2143 C CD  . GLU A 1 288 ? 95.556  49.218 9.992   1.00 30.15  ? 285  GLU A CD  1 
ATOM   2144 O OE1 . GLU A 1 288 ? 96.726  49.553 9.715   1.00 35.52  ? 285  GLU A OE1 1 
ATOM   2145 O OE2 . GLU A 1 288 ? 94.807  49.914 10.685  1.00 37.77  ? 285  GLU A OE2 1 
ATOM   2146 N N   . TRP A 1 289 ? 93.053  47.238 6.342   1.00 25.68  ? 286  TRP A N   1 
ATOM   2147 C CA  . TRP A 1 289 ? 91.630  47.550 6.222   1.00 36.81  ? 286  TRP A CA  1 
ATOM   2148 C C   . TRP A 1 289 ? 90.799  46.343 5.805   1.00 38.44  ? 286  TRP A C   1 
ATOM   2149 O O   . TRP A 1 289 ? 89.583  46.350 6.013   1.00 38.69  ? 286  TRP A O   1 
ATOM   2150 C CB  . TRP A 1 289 ? 91.405  48.705 5.243   1.00 30.12  ? 286  TRP A CB  1 
ATOM   2151 C CG  . TRP A 1 289 ? 91.886  50.011 5.799   1.00 42.54  ? 286  TRP A CG  1 
ATOM   2152 C CD1 . TRP A 1 289 ? 93.023  50.693 5.441   1.00 39.84  ? 286  TRP A CD1 1 
ATOM   2153 C CD2 . TRP A 1 289 ? 91.271  50.781 6.846   1.00 45.36  ? 286  TRP A CD2 1 
ATOM   2154 N NE1 . TRP A 1 289 ? 93.144  51.838 6.194   1.00 38.46  ? 286  TRP A NE1 1 
ATOM   2155 C CE2 . TRP A 1 289 ? 92.086  51.919 7.062   1.00 41.80  ? 286  TRP A CE2 1 
ATOM   2156 C CE3 . TRP A 1 289 ? 90.113  50.624 7.619   1.00 37.95  ? 286  TRP A CE3 1 
ATOM   2157 C CZ2 . TRP A 1 289 ? 91.774  52.893 8.012   1.00 36.04  ? 286  TRP A CZ2 1 
ATOM   2158 C CZ3 . TRP A 1 289 ? 89.810  51.596 8.567   1.00 30.80  ? 286  TRP A CZ3 1 
ATOM   2159 C CH2 . TRP A 1 289 ? 90.637  52.708 8.754   1.00 34.95  ? 286  TRP A CH2 1 
ATOM   2160 N N   . HIS A 1 290 ? 91.425  45.300 5.264   1.00 35.73  ? 287  HIS A N   1 
ATOM   2161 C CA  . HIS A 1 290 ? 90.703  44.146 4.750   1.00 32.13  ? 287  HIS A CA  1 
ATOM   2162 C C   . HIS A 1 290 ? 90.297  43.163 5.825   1.00 33.92  ? 287  HIS A C   1 
ATOM   2163 O O   . HIS A 1 290 ? 89.851  42.068 5.477   1.00 42.94  ? 287  HIS A O   1 
ATOM   2164 C CB  . HIS A 1 290 ? 91.541  43.411 3.694   1.00 32.33  ? 287  HIS A CB  1 
ATOM   2165 C CG  . HIS A 1 290 ? 92.023  44.294 2.586   1.00 48.09  ? 287  HIS A CG  1 
ATOM   2166 N ND1 . HIS A 1 290 ? 93.142  44.002 1.830   1.00 56.71  ? 287  HIS A ND1 1 
ATOM   2167 C CD2 . HIS A 1 290 ? 91.542  45.469 2.113   1.00 52.36  ? 287  HIS A CD2 1 
ATOM   2168 C CE1 . HIS A 1 290 ? 93.328  44.964 0.940   1.00 55.57  ? 287  HIS A CE1 1 
ATOM   2169 N NE2 . HIS A 1 290 ? 92.370  45.865 1.090   1.00 52.86  ? 287  HIS A NE2 1 
ATOM   2170 N N   . VAL A 1 291 ? 90.434  43.479 7.110   1.00 31.93  ? 288  VAL A N   1 
ATOM   2171 C CA  . VAL A 1 291 ? 89.963  42.551 8.131   1.00 31.25  ? 288  VAL A CA  1 
ATOM   2172 C C   . VAL A 1 291 ? 88.735  43.053 8.856   1.00 32.75  ? 288  VAL A C   1 
ATOM   2173 O O   . VAL A 1 291 ? 88.235  42.348 9.743   1.00 32.52  ? 288  VAL A O   1 
ATOM   2174 C CB  . VAL A 1 291 ? 91.062  42.202 9.151   1.00 30.21  ? 288  VAL A CB  1 
ATOM   2175 C CG1 . VAL A 1 291 ? 92.307  41.662 8.441   1.00 27.87  ? 288  VAL A CG1 1 
ATOM   2176 C CG2 . VAL A 1 291 ? 91.360  43.389 10.045  1.00 22.70  ? 288  VAL A CG2 1 
ATOM   2177 N N   . LEU A 1 292 ? 88.245  44.250 8.541   1.00 29.99  ? 289  LEU A N   1 
ATOM   2178 C CA  . LEU A 1 292 ? 87.043  44.730 9.206   1.00 36.83  ? 289  LEU A CA  1 
ATOM   2179 C C   . LEU A 1 292 ? 85.848  43.862 8.804   1.00 40.42  ? 289  LEU A C   1 
ATOM   2180 O O   . LEU A 1 292 ? 85.742  43.451 7.641   1.00 36.67  ? 289  LEU A O   1 
ATOM   2181 C CB  . LEU A 1 292 ? 86.772  46.188 8.861   1.00 29.83  ? 289  LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 292 ? 87.582  47.265 9.586   1.00 27.67  ? 289  LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 292 ? 87.366  48.589 8.883   1.00 30.68  ? 289  LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 292 ? 87.183  47.385 11.056  1.00 25.82  ? 289  LEU A CD2 1 
ATOM   2185 N N   . PRO A 1 293 ? 84.936  43.565 9.740   1.00 40.27  ? 290  PRO A N   1 
ATOM   2186 C CA  . PRO A 1 293 ? 83.878  42.580 9.442   1.00 40.65  ? 290  PRO A CA  1 
ATOM   2187 C C   . PRO A 1 293 ? 82.885  43.026 8.373   1.00 46.91  ? 290  PRO A C   1 
ATOM   2188 O O   . PRO A 1 293 ? 82.411  42.179 7.605   1.00 52.16  ? 290  PRO A O   1 
ATOM   2189 C CB  . PRO A 1 293 ? 83.195  42.368 10.804  1.00 40.28  ? 290  PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 293 ? 83.485  43.621 11.580  1.00 41.94  ? 290  PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 293 ? 84.858  44.073 11.121  1.00 40.02  ? 290  PRO A CD  1 
ATOM   2192 N N   . GLN A 1 294 ? 82.550  44.308 8.282   1.00 40.61  ? 291  GLN A N   1 
ATOM   2193 C CA  . GLN A 1 294 ? 81.641  44.751 7.232   1.00 44.48  ? 291  GLN A CA  1 
ATOM   2194 C C   . GLN A 1 294 ? 82.001  46.166 6.804   1.00 44.22  ? 291  GLN A C   1 
ATOM   2195 O O   . GLN A 1 294 ? 82.867  46.820 7.398   1.00 43.32  ? 291  GLN A O   1 
ATOM   2196 C CB  . GLN A 1 294 ? 80.176  44.704 7.684   1.00 47.23  ? 291  GLN A CB  1 
ATOM   2197 C CG  . GLN A 1 294 ? 79.856  45.668 8.817   1.00 41.95  ? 291  GLN A CG  1 
ATOM   2198 C CD  . GLN A 1 294 ? 80.305  45.140 10.159  1.00 54.61  ? 291  GLN A CD  1 
ATOM   2199 O OE1 . GLN A 1 294 ? 80.166  43.946 10.438  1.00 57.50  ? 291  GLN A OE1 1 
ATOM   2200 N NE2 . GLN A 1 294 ? 80.864  46.019 10.996  1.00 52.86  ? 291  GLN A NE2 1 
ATOM   2201 N N   . GLU A 1 295 ? 81.323  46.652 5.775   1.00 35.64  ? 292  GLU A N   1 
ATOM   2202 C CA  . GLU A 1 295 ? 81.380  48.009 5.285   1.00 34.76  ? 292  GLU A CA  1 
ATOM   2203 C C   . GLU A 1 295 ? 80.920  48.902 6.408   1.00 36.78  ? 292  GLU A C   1 
ATOM   2204 O O   . GLU A 1 295 ? 79.953  48.593 7.041   1.00 39.66  ? 292  GLU A O   1 
ATOM   2205 C CB  . GLU A 1 295 ? 80.434  48.123 4.089   1.00 42.60  ? 292  GLU A CB  1 
ATOM   2206 C CG  . GLU A 1 295 ? 80.548  49.343 3.184   1.00 54.42  ? 292  GLU A CG  1 
ATOM   2207 C CD  . GLU A 1 295 ? 79.395  49.494 2.160   1.00 63.75  ? 292  GLU A CD  1 
ATOM   2208 O OE1 . GLU A 1 295 ? 79.432  50.413 1.344   1.00 62.04  ? 292  GLU A OE1 1 
ATOM   2209 O OE2 . GLU A 1 295 ? 78.442  48.700 2.155   1.00 64.16  ? 292  GLU A OE2 1 
ATOM   2210 N N   . SER A 1 296 ? 81.632  49.988 6.660   1.00 32.91  ? 293  SER A N   1 
ATOM   2211 C CA  . SER A 1 296 ? 81.414  50.822 7.833   1.00 30.89  ? 293  SER A CA  1 
ATOM   2212 C C   . SER A 1 296 ? 82.161  52.129 7.645   1.00 28.96  ? 293  SER A C   1 
ATOM   2213 O O   . SER A 1 296 ? 83.056  52.235 6.807   1.00 23.38  ? 293  SER A O   1 
ATOM   2214 C CB  . SER A 1 296 ? 81.909  50.126 9.101   1.00 28.84  ? 293  SER A CB  1 
ATOM   2215 O OG  . SER A 1 296 ? 83.308  49.866 8.978   1.00 32.69  ? 293  SER A OG  1 
ATOM   2216 N N   . VAL A 1 297 ? 81.768  53.126 8.423   1.00 26.12  ? 294  VAL A N   1 
ATOM   2217 C CA  . VAL A 1 297 ? 82.621  54.267 8.700   1.00 23.67  ? 294  VAL A CA  1 
ATOM   2218 C C   . VAL A 1 297 ? 82.847  54.280 10.210  1.00 26.49  ? 294  VAL A C   1 
ATOM   2219 O O   . VAL A 1 297 ? 82.078  53.695 10.980  1.00 23.04  ? 294  VAL A O   1 
ATOM   2220 C CB  . VAL A 1 297 ? 82.018  55.603 8.210   1.00 24.46  ? 294  VAL A CB  1 
ATOM   2221 C CG1 . VAL A 1 297 ? 81.869  55.613 6.692   1.00 26.33  ? 294  VAL A CG1 1 
ATOM   2222 C CG2 . VAL A 1 297 ? 80.669  55.871 8.891   1.00 22.09  ? 294  VAL A CG2 1 
ATOM   2223 N N   . PHE A 1 298 ? 83.924  54.942 10.628  1.00 23.43  ? 295  PHE A N   1 
ATOM   2224 C CA  . PHE A 1 298 ? 84.255  55.106 12.048  1.00 21.20  ? 295  PHE A CA  1 
ATOM   2225 C C   . PHE A 1 298 ? 84.474  53.755 12.734  1.00 19.19  ? 295  PHE A C   1 
ATOM   2226 O O   . PHE A 1 298 ? 84.111  53.566 13.890  1.00 23.03  ? 295  PHE A O   1 
ATOM   2227 C CB  . PHE A 1 298 ? 83.182  55.930 12.779  1.00 19.46  ? 295  PHE A CB  1 
ATOM   2228 C CG  . PHE A 1 298 ? 83.735  56.896 13.812  1.00 20.89  ? 295  PHE A CG  1 
ATOM   2229 C CD1 . PHE A 1 298 ? 84.746  56.505 14.692  1.00 19.35  ? 295  PHE A CD1 1 
ATOM   2230 C CD2 . PHE A 1 298 ? 83.242  58.206 13.895  1.00 15.32  ? 295  PHE A CD2 1 
ATOM   2231 C CE1 . PHE A 1 298 ? 85.259  57.408 15.643  1.00 15.92  ? 295  PHE A CE1 1 
ATOM   2232 C CE2 . PHE A 1 298 ? 83.735  59.095 14.832  1.00 18.57  ? 295  PHE A CE2 1 
ATOM   2233 C CZ  . PHE A 1 298 ? 84.752  58.698 15.708  1.00 14.69  ? 295  PHE A CZ  1 
ATOM   2234 N N   . ARG A 1 299 ? 85.070  52.804 12.017  1.00 17.71  ? 296  ARG A N   1 
ATOM   2235 C CA  . ARG A 1 299 ? 85.506  51.535 12.587  1.00 21.16  ? 296  ARG A CA  1 
ATOM   2236 C C   . ARG A 1 299 ? 86.940  51.257 12.151  1.00 19.85  ? 296  ARG A C   1 
ATOM   2237 O O   . ARG A 1 299 ? 87.305  51.509 11.000  1.00 18.96  ? 296  ARG A O   1 
ATOM   2238 C CB  . ARG A 1 299 ? 84.603  50.346 12.152  1.00 18.71  ? 296  ARG A CB  1 
ATOM   2239 C CG  . ARG A 1 299 ? 83.160  50.431 12.679  1.00 22.66  ? 296  ARG A CG  1 
ATOM   2240 C CD  . ARG A 1 299 ? 83.095  50.336 14.210  1.00 24.51  ? 296  ARG A CD  1 
ATOM   2241 N NE  . ARG A 1 299 ? 81.716  50.315 14.701  1.00 25.71  ? 296  ARG A NE  1 
ATOM   2242 C CZ  . ARG A 1 299 ? 81.020  51.391 15.066  1.00 22.72  ? 296  ARG A CZ  1 
ATOM   2243 N NH1 . ARG A 1 299 ? 81.567  52.600 15.032  1.00 18.98  ? 296  ARG A NH1 1 
ATOM   2244 N NH2 . ARG A 1 299 ? 79.772  51.254 15.499  1.00 25.20  ? 296  ARG A NH2 1 
ATOM   2245 N N   . PHE A 1 300 ? 87.723  50.664 13.049  1.00 20.74  ? 297  PHE A N   1 
ATOM   2246 C CA  . PHE A 1 300 ? 89.154  50.496 12.845  1.00 23.03  ? 297  PHE A CA  1 
ATOM   2247 C C   . PHE A 1 300 ? 89.545  49.079 13.242  1.00 22.45  ? 297  PHE A C   1 
ATOM   2248 O O   . PHE A 1 300 ? 88.979  48.531 14.190  1.00 26.24  ? 297  PHE A O   1 
ATOM   2249 C CB  . PHE A 1 300 ? 89.917  51.552 13.657  1.00 14.75  ? 297  PHE A CB  1 
ATOM   2250 C CG  . PHE A 1 300 ? 89.295  52.927 13.585  1.00 18.22  ? 297  PHE A CG  1 
ATOM   2251 C CD1 . PHE A 1 300 ? 89.302  53.649 12.405  1.00 18.41  ? 297  PHE A CD1 1 
ATOM   2252 C CD2 . PHE A 1 300 ? 88.688  53.494 14.701  1.00 17.73  ? 297  PHE A CD2 1 
ATOM   2253 C CE1 . PHE A 1 300 ? 88.720  54.907 12.339  1.00 19.60  ? 297  PHE A CE1 1 
ATOM   2254 C CE2 . PHE A 1 300 ? 88.105  54.739 14.634  1.00 12.65  ? 297  PHE A CE2 1 
ATOM   2255 C CZ  . PHE A 1 300 ? 88.125  55.449 13.453  1.00 16.26  ? 297  PHE A CZ  1 
ATOM   2256 N N   . SER A 1 301 ? 90.510  48.492 12.513  1.00 15.19  ? 298  SER A N   1 
ATOM   2257 C CA  . SER A 1 301 ? 90.777  47.049 12.589  1.00 22.68  ? 298  SER A CA  1 
ATOM   2258 C C   . SER A 1 301 ? 91.418  46.654 13.915  1.00 21.79  ? 298  SER A C   1 
ATOM   2259 O O   . SER A 1 301 ? 91.039  45.648 14.525  1.00 22.99  ? 298  SER A O   1 
ATOM   2260 C CB  . SER A 1 301 ? 91.699  46.605 11.439  1.00 24.31  ? 298  SER A CB  1 
ATOM   2261 O OG  . SER A 1 301 ? 91.079  46.706 10.171  1.00 27.57  ? 298  SER A OG  1 
ATOM   2262 N N   . PHE A 1 302 ? 92.428  47.402 14.353  1.00 21.14  ? 299  PHE A N   1 
ATOM   2263 C CA  . PHE A 1 302 ? 93.234  47.016 15.511  1.00 22.65  ? 299  PHE A CA  1 
ATOM   2264 C C   . PHE A 1 302 ? 93.139  48.110 16.566  1.00 22.59  ? 299  PHE A C   1 
ATOM   2265 O O   . PHE A 1 302 ? 93.773  49.170 16.449  1.00 19.65  ? 299  PHE A O   1 
ATOM   2266 C CB  . PHE A 1 302 ? 94.672  46.730 15.092  1.00 20.62  ? 299  PHE A CB  1 
ATOM   2267 C CG  . PHE A 1 302 ? 94.778  45.582 14.129  1.00 19.74  ? 299  PHE A CG  1 
ATOM   2268 C CD1 . PHE A 1 302 ? 94.501  44.297 14.552  1.00 18.45  ? 299  PHE A CD1 1 
ATOM   2269 C CD2 . PHE A 1 302 ? 95.116  45.794 12.789  1.00 21.63  ? 299  PHE A CD2 1 
ATOM   2270 C CE1 . PHE A 1 302 ? 94.566  43.229 13.666  1.00 19.47  ? 299  PHE A CE1 1 
ATOM   2271 C CE2 . PHE A 1 302 ? 95.186  44.726 11.903  1.00 25.61  ? 299  PHE A CE2 1 
ATOM   2272 C CZ  . PHE A 1 302 ? 94.917  43.443 12.348  1.00 18.84  ? 299  PHE A CZ  1 
ATOM   2273 N N   . VAL A 1 303 ? 92.347  47.830 17.597  1.00 17.77  ? 300  VAL A N   1 
ATOM   2274 C CA  . VAL A 1 303 ? 92.052  48.792 18.655  1.00 16.29  ? 300  VAL A CA  1 
ATOM   2275 C C   . VAL A 1 303 ? 92.248  48.070 19.988  1.00 19.04  ? 300  VAL A C   1 
ATOM   2276 O O   . VAL A 1 303 ? 92.456  46.844 19.999  1.00 18.65  ? 300  VAL A O   1 
ATOM   2277 C CB  . VAL A 1 303 ? 90.626  49.362 18.503  1.00 24.70  ? 300  VAL A CB  1 
ATOM   2278 C CG1 . VAL A 1 303 ? 90.427  50.053 17.136  1.00 17.41  ? 300  VAL A CG1 1 
ATOM   2279 C CG2 . VAL A 1 303 ? 89.566  48.262 18.771  1.00 18.65  ? 300  VAL A CG2 1 
ATOM   2280 N N   . PRO A 1 304 ? 92.200  48.769 21.123  1.00 16.46  ? 301  PRO A N   1 
ATOM   2281 C CA  . PRO A 1 304 ? 92.333  48.088 22.422  1.00 19.68  ? 301  PRO A CA  1 
ATOM   2282 C C   . PRO A 1 304 ? 91.369  46.914 22.587  1.00 22.12  ? 301  PRO A C   1 
ATOM   2283 O O   . PRO A 1 304 ? 90.202  46.968 22.187  1.00 18.78  ? 301  PRO A O   1 
ATOM   2284 C CB  . PRO A 1 304 ? 92.029  49.198 23.425  1.00 17.68  ? 301  PRO A CB  1 
ATOM   2285 C CG  . PRO A 1 304 ? 92.468  50.430 22.732  1.00 19.48  ? 301  PRO A CG  1 
ATOM   2286 C CD  . PRO A 1 304 ? 92.175  50.233 21.272  1.00 15.42  ? 301  PRO A CD  1 
ATOM   2287 N N   . VAL A 1 305 ? 91.875  45.834 23.158  1.00 17.60  ? 302  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 305 ? 91.113  44.606 23.324  1.00 24.53  ? 302  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 305 ? 90.774  44.474 24.803  1.00 32.48  ? 302  VAL A C   1 
ATOM   2290 O O   . VAL A 1 305 ? 91.598  44.792 25.673  1.00 25.85  ? 302  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 305 ? 91.898  43.385 22.798  1.00 23.60  ? 302  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 305 ? 93.182  43.181 23.584  1.00 26.46  ? 302  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 305 ? 91.053  42.126 22.812  1.00 27.12  ? 302  VAL A CG2 1 
ATOM   2294 N N   . VAL A 1 306 ? 89.537  44.072 25.084  1.00 35.86  ? 303  VAL A N   1 
ATOM   2295 C CA  . VAL A 1 306 ? 89.076  43.852 26.453  1.00 35.61  ? 303  VAL A CA  1 
ATOM   2296 C C   . VAL A 1 306 ? 89.415  42.406 26.789  1.00 36.63  ? 303  VAL A C   1 
ATOM   2297 O O   . VAL A 1 306 ? 88.710  41.479 26.386  1.00 38.73  ? 303  VAL A O   1 
ATOM   2298 C CB  . VAL A 1 306 ? 87.577  44.124 26.605  1.00 39.84  ? 303  VAL A CB  1 
ATOM   2299 C CG1 . VAL A 1 306 ? 87.202  44.139 28.076  1.00 34.45  ? 303  VAL A CG1 1 
ATOM   2300 C CG2 . VAL A 1 306 ? 87.188  45.436 25.929  1.00 34.29  ? 303  VAL A CG2 1 
ATOM   2301 N N   . ASP A 1 307 ? 90.505  42.198 27.514  1.00 39.23  ? 304  ASP A N   1 
ATOM   2302 C CA  . ASP A 1 307 ? 90.977  40.837 27.726  1.00 39.71  ? 304  ASP A CA  1 
ATOM   2303 C C   . ASP A 1 307 ? 91.190  40.480 29.187  1.00 40.19  ? 304  ASP A C   1 
ATOM   2304 O O   . ASP A 1 307 ? 91.633  39.361 29.471  1.00 41.30  ? 304  ASP A O   1 
ATOM   2305 C CB  . ASP A 1 307 ? 92.276  40.594 26.948  1.00 37.06  ? 304  ASP A CB  1 
ATOM   2306 C CG  . ASP A 1 307 ? 93.421  41.498 27.395  1.00 42.40  ? 304  ASP A CG  1 
ATOM   2307 O OD1 . ASP A 1 307 ? 93.181  42.514 28.089  1.00 40.94  ? 304  ASP A OD1 1 
ATOM   2308 O OD2 . ASP A 1 307 ? 94.576  41.182 27.028  1.00 53.34  ? 304  ASP A OD2 1 
ATOM   2309 N N   . GLY A 1 308 ? 90.884  41.386 30.113  1.00 34.85  ? 305  GLY A N   1 
ATOM   2310 C CA  . GLY A 1 308 ? 91.087  41.149 31.527  1.00 50.04  ? 305  GLY A CA  1 
ATOM   2311 C C   . GLY A 1 308 ? 92.408  41.636 32.088  1.00 49.36  ? 305  GLY A C   1 
ATOM   2312 O O   . GLY A 1 308 ? 92.617  41.534 33.306  1.00 49.51  ? 305  GLY A O   1 
ATOM   2313 N N   . ASP A 1 309 ? 93.303  42.165 31.250  1.00 45.55  ? 306  ASP A N   1 
ATOM   2314 C CA  . ASP A 1 309 ? 94.605  42.599 31.737  1.00 39.71  ? 306  ASP A CA  1 
ATOM   2315 C C   . ASP A 1 309 ? 94.659  44.122 31.832  1.00 39.50  ? 306  ASP A C   1 
ATOM   2316 O O   . ASP A 1 309 ? 94.408  44.676 32.906  1.00 37.86  ? 306  ASP A O   1 
ATOM   2317 C CB  . ASP A 1 309 ? 95.707  42.044 30.832  1.00 48.60  ? 306  ASP A CB  1 
ATOM   2318 C CG  . ASP A 1 309 ? 97.095  42.382 31.323  1.00 49.38  ? 306  ASP A CG  1 
ATOM   2319 O OD1 . ASP A 1 309 ? 98.060  42.012 30.634  1.00 57.34  ? 306  ASP A OD1 1 
ATOM   2320 O OD2 . ASP A 1 309 ? 97.229  43.021 32.390  1.00 59.97  ? 306  ASP A OD2 1 
ATOM   2321 N N   . PHE A 1 310 ? 94.977  44.820 30.731  1.00 37.00  ? 307  PHE A N   1 
ATOM   2322 C CA  . PHE A 1 310 ? 95.016  46.279 30.797  1.00 34.84  ? 307  PHE A CA  1 
ATOM   2323 C C   . PHE A 1 310 ? 93.678  46.834 31.276  1.00 31.22  ? 307  PHE A C   1 
ATOM   2324 O O   . PHE A 1 310 ? 93.640  47.811 32.036  1.00 34.14  ? 307  PHE A O   1 
ATOM   2325 C CB  . PHE A 1 310 ? 95.389  46.881 29.438  1.00 27.12  ? 307  PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 310 ? 95.737  48.341 29.511  1.00 27.29  ? 307  PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 310 ? 94.747  49.300 29.603  1.00 24.52  ? 307  PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 310 ? 97.054  48.755 29.497  1.00 26.39  ? 307  PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 310 ? 95.055  50.638 29.676  1.00 23.62  ? 307  PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 310 ? 97.369  50.105 29.573  1.00 25.03  ? 307  PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 310 ? 96.360  51.048 29.668  1.00 26.42  ? 307  PHE A CZ  1 
ATOM   2332 N N   . LEU A 1 311 ? 92.574  46.229 30.829  1.00 33.06  ? 308  LEU A N   1 
ATOM   2333 C CA  . LEU A 1 311 ? 91.230  46.508 31.325  1.00 41.82  ? 308  LEU A CA  1 
ATOM   2334 C C   . LEU A 1 311 ? 90.687  45.231 31.943  1.00 42.90  ? 308  LEU A C   1 
ATOM   2335 O O   . LEU A 1 311 ? 90.464  44.245 31.229  1.00 41.10  ? 308  LEU A O   1 
ATOM   2336 C CB  . LEU A 1 311 ? 90.294  46.968 30.204  1.00 35.82  ? 308  LEU A CB  1 
ATOM   2337 C CG  . LEU A 1 311 ? 90.693  48.196 29.398  1.00 39.65  ? 308  LEU A CG  1 
ATOM   2338 C CD1 . LEU A 1 311 ? 90.220  48.041 27.943  1.00 40.22  ? 308  LEU A CD1 1 
ATOM   2339 C CD2 . LEU A 1 311 ? 90.112  49.444 30.057  1.00 36.53  ? 308  LEU A CD2 1 
ATOM   2340 N N   . SER A 1 312 ? 90.464  45.253 33.263  1.00 43.40  ? 309  SER A N   1 
ATOM   2341 C CA  . SER A 1 312 ? 89.895  44.092 33.943  1.00 41.79  ? 309  SER A CA  1 
ATOM   2342 C C   . SER A 1 312 ? 88.463  43.802 33.504  1.00 44.57  ? 309  SER A C   1 
ATOM   2343 O O   . SER A 1 312 ? 87.967  42.697 33.744  1.00 52.38  ? 309  SER A O   1 
ATOM   2344 C CB  . SER A 1 312 ? 89.961  44.286 35.462  1.00 44.16  ? 309  SER A CB  1 
ATOM   2345 O OG  . SER A 1 312 ? 89.425  45.537 35.870  1.00 44.72  ? 309  SER A OG  1 
ATOM   2346 N N   . ASP A 1 313 ? 87.808  44.754 32.841  1.00 43.71  ? 310  ASP A N   1 
ATOM   2347 C CA  . ASP A 1 313 ? 86.442  44.605 32.356  1.00 42.69  ? 310  ASP A CA  1 
ATOM   2348 C C   . ASP A 1 313 ? 86.243  45.656 31.271  1.00 41.09  ? 310  ASP A C   1 
ATOM   2349 O O   . ASP A 1 313 ? 87.100  46.518 31.066  1.00 38.93  ? 310  ASP A O   1 
ATOM   2350 C CB  . ASP A 1 313 ? 85.426  44.775 33.500  1.00 44.50  ? 310  ASP A CB  1 
ATOM   2351 C CG  . ASP A 1 313 ? 84.133  43.973 33.289  1.00 53.31  ? 310  ASP A CG  1 
ATOM   2352 O OD1 . ASP A 1 313 ? 83.699  43.776 32.129  1.00 47.35  ? 310  ASP A OD1 1 
ATOM   2353 O OD2 . ASP A 1 313 ? 83.541  43.544 34.304  1.00 58.99  ? 310  ASP A OD2 1 
ATOM   2354 N N   . THR A 1 314 ? 85.095  45.593 30.590  1.00 35.53  ? 311  THR A N   1 
ATOM   2355 C CA  . THR A 1 314 ? 84.805  46.581 29.559  1.00 35.46  ? 311  THR A CA  1 
ATOM   2356 C C   . THR A 1 314 ? 84.885  47.988 30.136  1.00 33.27  ? 311  THR A C   1 
ATOM   2357 O O   . THR A 1 314 ? 84.629  48.194 31.325  1.00 37.91  ? 311  THR A O   1 
ATOM   2358 C CB  . THR A 1 314 ? 83.415  46.392 28.972  1.00 37.51  ? 311  THR A CB  1 
ATOM   2359 O OG1 . THR A 1 314 ? 82.451  46.818 29.946  1.00 40.82  ? 311  THR A OG1 1 
ATOM   2360 C CG2 . THR A 1 314 ? 83.185  44.947 28.587  1.00 34.00  ? 311  THR A CG2 1 
ATOM   2361 N N   . PRO A 1 315 ? 85.235  48.978 29.319  1.00 31.03  ? 312  PRO A N   1 
ATOM   2362 C CA  . PRO A 1 315 ? 85.174  50.361 29.813  1.00 34.49  ? 312  PRO A CA  1 
ATOM   2363 C C   . PRO A 1 315 ? 83.811  50.720 30.384  1.00 33.12  ? 312  PRO A C   1 
ATOM   2364 O O   . PRO A 1 315 ? 83.744  51.435 31.390  1.00 33.29  ? 312  PRO A O   1 
ATOM   2365 C CB  . PRO A 1 315 ? 85.522  51.194 28.575  1.00 24.76  ? 312  PRO A CB  1 
ATOM   2366 C CG  . PRO A 1 315 ? 86.386  50.273 27.751  1.00 33.59  ? 312  PRO A CG  1 
ATOM   2367 C CD  . PRO A 1 315 ? 85.800  48.893 27.960  1.00 31.44  ? 312  PRO A CD  1 
ATOM   2368 N N   . GLU A 1 316 ? 82.723  50.231 29.783  1.00 35.81  ? 313  GLU A N   1 
ATOM   2369 C CA  . GLU A 1 316 ? 81.390  50.542 30.302  1.00 39.02  ? 313  GLU A CA  1 
ATOM   2370 C C   . GLU A 1 316 ? 81.226  50.033 31.734  1.00 35.99  ? 313  GLU A C   1 
ATOM   2371 O O   . GLU A 1 316 ? 80.786  50.769 32.621  1.00 35.00  ? 313  GLU A O   1 
ATOM   2372 C CB  . GLU A 1 316 ? 80.312  49.954 29.388  1.00 37.42  ? 313  GLU A CB  1 
ATOM   2373 C CG  . GLU A 1 316 ? 79.014  50.752 29.396  1.00 48.72  ? 313  GLU A CG  1 
ATOM   2374 C CD  . GLU A 1 316 ? 77.745  49.896 29.332  1.00 56.42  ? 313  GLU A CD  1 
ATOM   2375 O OE1 . GLU A 1 316 ? 77.763  48.789 28.745  1.00 48.20  ? 313  GLU A OE1 1 
ATOM   2376 O OE2 . GLU A 1 316 ? 76.714  50.348 29.883  1.00 66.50  ? 313  GLU A OE2 1 
ATOM   2377 N N   . ALA A 1 317 ? 81.604  48.781 31.981  1.00 36.21  ? 314  ALA A N   1 
ATOM   2378 C CA  . ALA A 1 317 ? 81.492  48.222 33.323  1.00 33.36  ? 314  ALA A CA  1 
ATOM   2379 C C   . ALA A 1 317 ? 82.368  48.980 34.318  1.00 41.00  ? 314  ALA A C   1 
ATOM   2380 O O   . ALA A 1 317 ? 81.924  49.320 35.425  1.00 40.88  ? 314  ALA A O   1 
ATOM   2381 C CB  . ALA A 1 317 ? 81.857  46.740 33.291  1.00 32.37  ? 314  ALA A CB  1 
ATOM   2382 N N   . LEU A 1 318 ? 83.621  49.258 33.938  1.00 36.97  ? 315  LEU A N   1 
ATOM   2383 C CA  . LEU A 1 318 ? 84.535  49.962 34.836  1.00 31.27  ? 315  LEU A CA  1 
ATOM   2384 C C   . LEU A 1 318 ? 84.109  51.401 35.070  1.00 32.19  ? 315  LEU A C   1 
ATOM   2385 O O   . LEU A 1 318 ? 84.346  51.945 36.157  1.00 34.78  ? 315  LEU A O   1 
ATOM   2386 C CB  . LEU A 1 318 ? 85.965  49.920 34.282  1.00 33.26  ? 315  LEU A CB  1 
ATOM   2387 C CG  . LEU A 1 318 ? 86.593  48.528 34.155  1.00 33.51  ? 315  LEU A CG  1 
ATOM   2388 C CD1 . LEU A 1 318 ? 87.870  48.597 33.333  1.00 37.89  ? 315  LEU A CD1 1 
ATOM   2389 C CD2 . LEU A 1 318 ? 86.881  47.945 35.530  1.00 32.82  ? 315  LEU A CD2 1 
ATOM   2390 N N   . ILE A 1 319 ? 83.504  52.044 34.067  1.00 29.41  ? 316  ILE A N   1 
ATOM   2391 C CA  . ILE A 1 319 ? 83.032  53.415 34.259  1.00 32.75  ? 316  ILE A CA  1 
ATOM   2392 C C   . ILE A 1 319 ? 81.877  53.442 35.253  1.00 39.17  ? 316  ILE A C   1 
ATOM   2393 O O   . ILE A 1 319 ? 81.761  54.366 36.067  1.00 38.28  ? 316  ILE A O   1 
ATOM   2394 C CB  . ILE A 1 319 ? 82.624  54.040 32.914  1.00 30.07  ? 316  ILE A CB  1 
ATOM   2395 C CG1 . ILE A 1 319 ? 83.849  54.365 32.056  1.00 30.99  ? 316  ILE A CG1 1 
ATOM   2396 C CG2 . ILE A 1 319 ? 81.788  55.299 33.125  1.00 32.53  ? 316  ILE A CG2 1 
ATOM   2397 C CD1 . ILE A 1 319 ? 83.497  54.688 30.621  1.00 29.40  ? 316  ILE A CD1 1 
ATOM   2398 N N   . ASN A 1 320 ? 81.004  52.431 35.199  1.00 34.74  ? 317  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 320 ? 79.804  52.440 36.029  1.00 41.33  ? 317  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 320 ? 80.146  52.140 37.479  1.00 37.62  ? 317  ASN A C   1 
ATOM   2401 O O   . ASN A 1 320 ? 79.606  52.774 38.389  1.00 41.14  ? 317  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 320 ? 78.783  51.432 35.500  1.00 33.75  ? 317  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 320 ? 78.158  51.870 34.203  1.00 33.59  ? 317  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 320 ? 78.181  53.050 33.855  1.00 37.58  ? 317  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 320 ? 77.587  50.921 33.477  1.00 38.48  ? 317  ASN A ND2 1 
ATOM   2406 N N   . ALA A 1 321 ? 81.069  51.200 37.702  1.00 34.18  ? 318  ALA A N   1 
ATOM   2407 C CA  . ALA A 1 321 ? 81.493  50.817 39.038  1.00 29.55  ? 318  ALA A CA  1 
ATOM   2408 C C   . ALA A 1 321 ? 82.503  51.777 39.671  1.00 42.12  ? 318  ALA A C   1 
ATOM   2409 O O   . ALA A 1 321 ? 82.680  51.742 40.890  1.00 48.22  ? 318  ALA A O   1 
ATOM   2410 C CB  . ALA A 1 321 ? 82.084  49.408 38.983  1.00 30.70  ? 318  ALA A CB  1 
ATOM   2411 N N   . GLY A 1 322 ? 83.152  52.645 38.895  1.00 48.04  ? 319  GLY A N   1 
ATOM   2412 C CA  . GLY A 1 322 ? 84.330  53.338 39.393  1.00 36.33  ? 319  GLY A CA  1 
ATOM   2413 C C   . GLY A 1 322 ? 84.022  54.402 40.433  1.00 40.71  ? 319  GLY A C   1 
ATOM   2414 O O   . GLY A 1 322 ? 82.942  54.995 40.467  1.00 37.85  ? 319  GLY A O   1 
ATOM   2415 N N   . ASP A 1 323 ? 85.012  54.650 41.292  1.00 40.44  ? 320  ASP A N   1 
ATOM   2416 C CA  . ASP A 1 323 ? 85.001  55.745 42.253  1.00 38.67  ? 320  ASP A CA  1 
ATOM   2417 C C   . ASP A 1 323 ? 85.982  56.790 41.752  1.00 39.31  ? 320  ASP A C   1 
ATOM   2418 O O   . ASP A 1 323 ? 87.185  56.525 41.675  1.00 46.06  ? 320  ASP A O   1 
ATOM   2419 C CB  . ASP A 1 323 ? 85.382  55.252 43.656  1.00 42.74  ? 320  ASP A CB  1 
ATOM   2420 C CG  . ASP A 1 323 ? 85.471  56.378 44.703  1.00 42.35  ? 320  ASP A CG  1 
ATOM   2421 O OD1 . ASP A 1 323 ? 85.291  57.576 44.388  1.00 44.91  ? 320  ASP A OD1 1 
ATOM   2422 O OD2 . ASP A 1 323 ? 85.733  56.048 45.879  1.00 58.75  ? 320  ASP A OD2 1 
ATOM   2423 N N   . PHE A 1 324 ? 85.470  57.971 41.417  1.00 34.92  ? 321  PHE A N   1 
ATOM   2424 C CA  . PHE A 1 324 ? 86.262  59.000 40.764  1.00 34.82  ? 321  PHE A CA  1 
ATOM   2425 C C   . PHE A 1 324 ? 86.457  60.226 41.634  1.00 39.58  ? 321  PHE A C   1 
ATOM   2426 O O   . PHE A 1 324 ? 86.772  61.300 41.111  1.00 32.40  ? 321  PHE A O   1 
ATOM   2427 C CB  . PHE A 1 324 ? 85.628  59.378 39.423  1.00 34.60  ? 321  PHE A CB  1 
ATOM   2428 C CG  . PHE A 1 324 ? 85.605  58.244 38.451  1.00 36.40  ? 321  PHE A CG  1 
ATOM   2429 C CD1 . PHE A 1 324 ? 86.784  57.812 37.849  1.00 38.81  ? 321  PHE A CD1 1 
ATOM   2430 C CD2 . PHE A 1 324 ? 84.426  57.573 38.176  1.00 28.25  ? 321  PHE A CD2 1 
ATOM   2431 C CE1 . PHE A 1 324 ? 86.776  56.744 36.971  1.00 32.56  ? 321  PHE A CE1 1 
ATOM   2432 C CE2 . PHE A 1 324 ? 84.406  56.514 37.301  1.00 31.87  ? 321  PHE A CE2 1 
ATOM   2433 C CZ  . PHE A 1 324 ? 85.587  56.092 36.695  1.00 34.82  ? 321  PHE A CZ  1 
ATOM   2434 N N   . HIS A 1 325 ? 86.296  60.082 42.952  1.00 40.45  ? 322  HIS A N   1 
ATOM   2435 C CA  . HIS A 1 325 ? 86.615  61.174 43.866  1.00 39.93  ? 322  HIS A CA  1 
ATOM   2436 C C   . HIS A 1 325 ? 88.078  61.573 43.740  1.00 31.29  ? 322  HIS A C   1 
ATOM   2437 O O   . HIS A 1 325 ? 88.959  60.725 43.602  1.00 37.26  ? 322  HIS A O   1 
ATOM   2438 C CB  . HIS A 1 325 ? 86.302  60.768 45.308  1.00 38.42  ? 322  HIS A CB  1 
ATOM   2439 C CG  . HIS A 1 325 ? 84.835  60.710 45.596  1.00 40.46  ? 322  HIS A CG  1 
ATOM   2440 N ND1 . HIS A 1 325 ? 84.109  59.539 45.530  1.00 38.96  ? 322  HIS A ND1 1 
ATOM   2441 C CD2 . HIS A 1 325 ? 83.950  61.690 45.897  1.00 34.63  ? 322  HIS A CD2 1 
ATOM   2442 C CE1 . HIS A 1 325 ? 82.843  59.796 45.805  1.00 41.70  ? 322  HIS A CE1 1 
ATOM   2443 N NE2 . HIS A 1 325 ? 82.719  61.093 46.031  1.00 46.22  ? 322  HIS A NE2 1 
ATOM   2444 N N   . GLY A 1 326 ? 88.330  62.877 43.771  1.00 36.01  ? 323  GLY A N   1 
ATOM   2445 C CA  . GLY A 1 326 ? 89.673  63.396 43.632  1.00 36.03  ? 323  GLY A CA  1 
ATOM   2446 C C   . GLY A 1 326 ? 90.108  63.678 42.207  1.00 45.71  ? 323  GLY A C   1 
ATOM   2447 O O   . GLY A 1 326 ? 91.205  64.218 42.006  1.00 41.93  ? 323  GLY A O   1 
ATOM   2448 N N   . LEU A 1 327 ? 89.287  63.340 41.217  1.00 39.95  ? 324  LEU A N   1 
ATOM   2449 C CA  . LEU A 1 327 ? 89.613  63.533 39.813  1.00 34.63  ? 324  LEU A CA  1 
ATOM   2450 C C   . LEU A 1 327 ? 88.902  64.770 39.283  1.00 37.69  ? 324  LEU A C   1 
ATOM   2451 O O   . LEU A 1 327 ? 87.740  65.014 39.617  1.00 39.26  ? 324  LEU A O   1 
ATOM   2452 C CB  . LEU A 1 327 ? 89.207  62.293 39.010  1.00 38.40  ? 324  LEU A CB  1 
ATOM   2453 C CG  . LEU A 1 327 ? 89.335  62.307 37.488  1.00 36.16  ? 324  LEU A CG  1 
ATOM   2454 C CD1 . LEU A 1 327 ? 90.779  62.574 37.085  1.00 37.59  ? 324  LEU A CD1 1 
ATOM   2455 C CD2 . LEU A 1 327 ? 88.847  60.988 36.922  1.00 36.73  ? 324  LEU A CD2 1 
ATOM   2456 N N   . GLN A 1 328 ? 89.614  65.571 38.489  1.00 32.71  ? 325  GLN A N   1 
ATOM   2457 C CA  . GLN A 1 328 ? 88.993  66.602 37.669  1.00 30.52  ? 325  GLN A CA  1 
ATOM   2458 C C   . GLN A 1 328 ? 89.137  66.231 36.199  1.00 36.81  ? 325  GLN A C   1 
ATOM   2459 O O   . GLN A 1 328 ? 90.213  65.803 35.760  1.00 29.79  ? 325  GLN A O   1 
ATOM   2460 C CB  . GLN A 1 328 ? 89.596  67.982 37.903  1.00 31.79  ? 325  GLN A CB  1 
ATOM   2461 C CG  . GLN A 1 328 ? 89.509  68.470 39.333  1.00 42.16  ? 325  GLN A CG  1 
ATOM   2462 C CD  . GLN A 1 328 ? 90.562  67.832 40.194  1.00 38.25  ? 325  GLN A CD  1 
ATOM   2463 O OE1 . GLN A 1 328 ? 91.747  67.908 39.883  1.00 43.03  ? 325  GLN A OE1 1 
ATOM   2464 N NE2 . GLN A 1 328 ? 90.141  67.164 41.260  1.00 39.32  ? 325  GLN A NE2 1 
ATOM   2465 N N   . VAL A 1 329 ? 88.045  66.392 35.444  1.00 31.68  ? 326  VAL A N   1 
ATOM   2466 C CA  . VAL A 1 329 ? 88.003  66.049 34.027  1.00 27.86  ? 326  VAL A CA  1 
ATOM   2467 C C   . VAL A 1 329 ? 87.428  67.207 33.228  1.00 33.85  ? 326  VAL A C   1 
ATOM   2468 O O   . VAL A 1 329 ? 86.477  67.866 33.657  1.00 32.36  ? 326  VAL A O   1 
ATOM   2469 C CB  . VAL A 1 329 ? 87.180  64.778 33.766  1.00 28.73  ? 326  VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 329 ? 87.230  64.438 32.292  1.00 27.68  ? 326  VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 329 ? 87.722  63.628 34.577  1.00 31.88  ? 326  VAL A CG2 1 
ATOM   2472 N N   . LEU A 1 330 ? 88.017  67.455 32.066  1.00 24.27  ? 327  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 330 ? 87.458  68.322 31.050  1.00 23.86  ? 327  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 330 ? 87.128  67.449 29.842  1.00 33.30  ? 327  LEU A C   1 
ATOM   2475 O O   . LEU A 1 330 ? 87.957  66.625 29.433  1.00 28.26  ? 327  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 330 ? 88.461  69.417 30.702  1.00 26.05  ? 327  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 330 ? 88.124  70.480 29.668  1.00 32.44  ? 327  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 330 ? 86.967  71.319 30.148  1.00 36.14  ? 327  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 330 ? 89.340  71.358 29.434  1.00 30.82  ? 327  LEU A CD2 1 
ATOM   2480 N N   . VAL A 1 331 ? 85.897  67.568 29.320  1.00 25.53  ? 328  VAL A N   1 
ATOM   2481 C CA  . VAL A 1 331 ? 85.448  66.796 28.165  1.00 19.85  ? 328  VAL A CA  1 
ATOM   2482 C C   . VAL A 1 331 ? 84.668  67.722 27.248  1.00 23.91  ? 328  VAL A C   1 
ATOM   2483 O O   . VAL A 1 331 ? 84.211  68.795 27.647  1.00 29.16  ? 328  VAL A O   1 
ATOM   2484 C CB  . VAL A 1 331 ? 84.587  65.568 28.529  1.00 22.42  ? 328  VAL A CB  1 
ATOM   2485 C CG1 . VAL A 1 331 ? 85.361  64.634 29.393  1.00 25.05  ? 328  VAL A CG1 1 
ATOM   2486 C CG2 . VAL A 1 331 ? 83.302  65.997 29.240  1.00 29.38  ? 328  VAL A CG2 1 
ATOM   2487 N N   . GLY A 1 332 ? 84.533  67.310 25.996  1.00 20.30  ? 329  GLY A N   1 
ATOM   2488 C CA  . GLY A 1 332 ? 83.885  68.185 25.034  1.00 22.60  ? 329  GLY A CA  1 
ATOM   2489 C C   . GLY A 1 332 ? 83.870  67.555 23.664  1.00 21.36  ? 329  GLY A C   1 
ATOM   2490 O O   . GLY A 1 332 ? 84.443  66.488 23.435  1.00 19.88  ? 329  GLY A O   1 
ATOM   2491 N N   . VAL A 1 333 ? 83.188  68.236 22.751  1.00 21.56  ? 330  VAL A N   1 
ATOM   2492 C CA  . VAL A 1 333 ? 82.969  67.740 21.403  1.00 18.24  ? 330  VAL A CA  1 
ATOM   2493 C C   . VAL A 1 333 ? 82.983  68.955 20.502  1.00 19.49  ? 330  VAL A C   1 
ATOM   2494 O O   . VAL A 1 333 ? 82.881  70.089 20.969  1.00 23.78  ? 330  VAL A O   1 
ATOM   2495 C CB  . VAL A 1 333 ? 81.624  66.990 21.268  1.00 22.42  ? 330  VAL A CB  1 
ATOM   2496 C CG1 . VAL A 1 333 ? 81.590  65.773 22.202  1.00 19.92  ? 330  VAL A CG1 1 
ATOM   2497 C CG2 . VAL A 1 333 ? 80.465  67.958 21.582  1.00 18.03  ? 330  VAL A CG2 1 
ATOM   2498 N N   . VAL A 1 334 ? 83.116  68.710 19.197  1.00 19.44  ? 331  VAL A N   1 
ATOM   2499 C CA  . VAL A 1 334 ? 82.986  69.767 18.200  1.00 21.68  ? 331  VAL A CA  1 
ATOM   2500 C C   . VAL A 1 334 ? 81.541  69.780 17.718  1.00 18.95  ? 331  VAL A C   1 
ATOM   2501 O O   . VAL A 1 334 ? 80.777  68.839 17.972  1.00 22.16  ? 331  VAL A O   1 
ATOM   2502 C CB  . VAL A 1 334 ? 83.960  69.572 17.015  1.00 22.36  ? 331  VAL A CB  1 
ATOM   2503 C CG1 . VAL A 1 334 ? 85.405  69.575 17.493  1.00 22.53  ? 331  VAL A CG1 1 
ATOM   2504 C CG2 . VAL A 1 334 ? 83.652  68.288 16.258  1.00 19.82  ? 331  VAL A CG2 1 
ATOM   2505 N N   . LYS A 1 335 ? 81.166  70.820 16.993  1.00 19.51  ? 332  LYS A N   1 
ATOM   2506 C CA  . LYS A 1 335 ? 79.778  70.951 16.573  1.00 22.07  ? 332  LYS A CA  1 
ATOM   2507 C C   . LYS A 1 335 ? 79.337  69.839 15.622  1.00 29.09  ? 332  LYS A C   1 
ATOM   2508 O O   . LYS A 1 335 ? 78.180  69.412 15.683  1.00 28.41  ? 332  LYS A O   1 
ATOM   2509 C CB  . LYS A 1 335 ? 79.569  72.313 15.932  1.00 29.12  ? 332  LYS A CB  1 
ATOM   2510 C CG  . LYS A 1 335 ? 78.106  72.724 15.833  1.00 33.07  ? 332  LYS A CG  1 
ATOM   2511 C CD  . LYS A 1 335 ? 77.974  74.115 15.245  1.00 33.55  ? 332  LYS A CD  1 
ATOM   2512 C CE  . LYS A 1 335 ? 76.631  74.264 14.533  1.00 41.87  ? 332  LYS A CE  1 
ATOM   2513 N NZ  . LYS A 1 335 ? 75.785  75.322 15.150  1.00 52.65  ? 332  LYS A NZ  1 
ATOM   2514 N N   . ASP A 1 336 ? 80.230  69.335 14.750  1.00 25.71  ? 333  ASP A N   1 
ATOM   2515 C CA  . ASP A 1 336 ? 79.836  68.410 13.679  1.00 20.49  ? 333  ASP A CA  1 
ATOM   2516 C C   . ASP A 1 336 ? 80.725  67.164 13.700  1.00 23.49  ? 333  ASP A C   1 
ATOM   2517 O O   . ASP A 1 336 ? 81.491  66.908 12.770  1.00 25.36  ? 333  ASP A O   1 
ATOM   2518 C CB  . ASP A 1 336 ? 79.881  69.091 12.317  1.00 20.70  ? 333  ASP A CB  1 
ATOM   2519 C CG  . ASP A 1 336 ? 78.954  70.294 12.239  1.00 29.61  ? 333  ASP A CG  1 
ATOM   2520 O OD1 . ASP A 1 336 ? 77.741  70.104 11.995  1.00 31.74  ? 333  ASP A OD1 1 
ATOM   2521 O OD2 . ASP A 1 336 ? 79.436  71.434 12.421  1.00 27.26  ? 333  ASP A OD2 1 
ATOM   2522 N N   . GLU A 1 337 ? 80.551  66.347 14.732  1.00 19.02  ? 334  GLU A N   1 
ATOM   2523 C CA  . GLU A 1 337 ? 81.428  65.201 14.940  1.00 25.60  ? 334  GLU A CA  1 
ATOM   2524 C C   . GLU A 1 337 ? 81.365  64.196 13.800  1.00 26.14  ? 334  GLU A C   1 
ATOM   2525 O O   . GLU A 1 337 ? 82.354  63.484 13.544  1.00 20.87  ? 334  GLU A O   1 
ATOM   2526 C CB  . GLU A 1 337 ? 81.082  64.519 16.266  1.00 19.32  ? 334  GLU A CB  1 
ATOM   2527 C CG  . GLU A 1 337 ? 81.487  65.342 17.503  1.00 24.62  ? 334  GLU A CG  1 
ATOM   2528 C CD  . GLU A 1 337 ? 82.995  65.259 17.780  1.00 25.61  ? 334  GLU A CD  1 
ATOM   2529 O OE1 . GLU A 1 337 ? 83.679  64.513 17.052  1.00 21.06  ? 334  GLU A OE1 1 
ATOM   2530 O OE2 . GLU A 1 337 ? 83.494  65.938 18.708  1.00 26.39  ? 334  GLU A OE2 1 
ATOM   2531 N N   . GLY A 1 338 ? 80.226  64.106 13.113  1.00 21.49  ? 335  GLY A N   1 
ATOM   2532 C CA  . GLY A 1 338 ? 80.043  63.026 12.163  1.00 16.70  ? 335  GLY A CA  1 
ATOM   2533 C C   . GLY A 1 338 ? 80.447  63.321 10.728  1.00 17.90  ? 335  GLY A C   1 
ATOM   2534 O O   . GLY A 1 338 ? 80.665  62.391 9.944   1.00 22.33  ? 335  GLY A O   1 
ATOM   2535 N N   . SER A 1 339 ? 80.553  64.598 10.360  1.00 18.62  ? 336  SER A N   1 
ATOM   2536 C CA  . SER A 1 339 ? 80.534  64.956 8.939   1.00 22.75  ? 336  SER A CA  1 
ATOM   2537 C C   . SER A 1 339 ? 81.757  64.417 8.200   1.00 25.60  ? 336  SER A C   1 
ATOM   2538 O O   . SER A 1 339 ? 81.636  63.913 7.074   1.00 26.21  ? 336  SER A O   1 
ATOM   2539 C CB  . SER A 1 339 ? 80.430  66.474 8.781   1.00 23.07  ? 336  SER A CB  1 
ATOM   2540 O OG  . SER A 1 339 ? 81.508  67.131 9.422   1.00 21.80  ? 336  SER A OG  1 
ATOM   2541 N N   . TYR A 1 340 ? 82.931  64.510 8.831   1.00 24.51  ? 337  TYR A N   1 
ATOM   2542 C CA  . TYR A 1 340 ? 84.194  64.048 8.263   1.00 27.10  ? 337  TYR A CA  1 
ATOM   2543 C C   . TYR A 1 340 ? 84.097  62.610 7.770   1.00 24.78  ? 337  TYR A C   1 
ATOM   2544 O O   . TYR A 1 340 ? 84.528  62.277 6.658   1.00 27.67  ? 337  TYR A O   1 
ATOM   2545 C CB  . TYR A 1 340 ? 85.275  64.172 9.350   1.00 33.28  ? 337  TYR A CB  1 
ATOM   2546 C CG  . TYR A 1 340 ? 86.693  63.831 8.952   1.00 29.80  ? 337  TYR A CG  1 
ATOM   2547 C CD1 . TYR A 1 340 ? 87.166  62.524 9.007   1.00 36.26  ? 337  TYR A CD1 1 
ATOM   2548 C CD2 . TYR A 1 340 ? 87.571  64.827 8.578   1.00 37.05  ? 337  TYR A CD2 1 
ATOM   2549 C CE1 . TYR A 1 340 ? 88.473  62.221 8.653   1.00 42.22  ? 337  TYR A CE1 1 
ATOM   2550 C CE2 . TYR A 1 340 ? 88.883  64.544 8.238   1.00 39.26  ? 337  TYR A CE2 1 
ATOM   2551 C CZ  . TYR A 1 340 ? 89.329  63.248 8.268   1.00 45.15  ? 337  TYR A CZ  1 
ATOM   2552 O OH  . TYR A 1 340 ? 90.645  63.009 7.915   1.00 49.35  ? 337  TYR A OH  1 
ATOM   2553 N N   . PHE A 1 341 ? 83.516  61.745 8.587   1.00 23.52  ? 338  PHE A N   1 
ATOM   2554 C CA  . PHE A 1 341 ? 83.495  60.329 8.291   1.00 22.50  ? 338  PHE A CA  1 
ATOM   2555 C C   . PHE A 1 341 ? 82.573  59.956 7.139   1.00 23.07  ? 338  PHE A C   1 
ATOM   2556 O O   . PHE A 1 341 ? 82.672  58.833 6.642   1.00 20.08  ? 338  PHE A O   1 
ATOM   2557 C CB  . PHE A 1 341 ? 83.114  59.593 9.559   1.00 22.35  ? 338  PHE A CB  1 
ATOM   2558 C CG  . PHE A 1 341 ? 84.038  59.888 10.684  1.00 29.28  ? 338  PHE A CG  1 
ATOM   2559 C CD1 . PHE A 1 341 ? 85.192  59.137 10.857  1.00 28.32  ? 338  PHE A CD1 1 
ATOM   2560 C CD2 . PHE A 1 341 ? 83.802  60.959 11.534  1.00 21.85  ? 338  PHE A CD2 1 
ATOM   2561 C CE1 . PHE A 1 341 ? 86.080  59.426 11.892  1.00 26.79  ? 338  PHE A CE1 1 
ATOM   2562 C CE2 . PHE A 1 341 ? 84.696  61.251 12.563  1.00 25.94  ? 338  PHE A CE2 1 
ATOM   2563 C CZ  . PHE A 1 341 ? 85.830  60.481 12.738  1.00 24.48  ? 338  PHE A CZ  1 
ATOM   2564 N N   . LEU A 1 342 ? 81.682  60.844 6.694   1.00 23.43  ? 339  LEU A N   1 
ATOM   2565 C CA  . LEU A 1 342 ? 80.697  60.372 5.727   1.00 22.97  ? 339  LEU A CA  1 
ATOM   2566 C C   . LEU A 1 342 ? 81.302  60.235 4.335   1.00 26.06  ? 339  LEU A C   1 
ATOM   2567 O O   . LEU A 1 342 ? 80.837  59.406 3.541   1.00 20.90  ? 339  LEU A O   1 
ATOM   2568 C CB  . LEU A 1 342 ? 79.480  61.296 5.714   1.00 19.83  ? 339  LEU A CB  1 
ATOM   2569 C CG  . LEU A 1 342 ? 78.755  61.435 7.060   1.00 24.80  ? 339  LEU A CG  1 
ATOM   2570 C CD1 . LEU A 1 342 ? 77.623  62.472 6.977   1.00 21.49  ? 339  LEU A CD1 1 
ATOM   2571 C CD2 . LEU A 1 342 ? 78.226  60.096 7.497   1.00 22.95  ? 339  LEU A CD2 1 
ATOM   2572 N N   . VAL A 1 343 ? 82.351  61.008 4.026   1.00 24.74  ? 340  VAL A N   1 
ATOM   2573 C CA  . VAL A 1 343 ? 83.004  60.882 2.721   1.00 26.61  ? 340  VAL A CA  1 
ATOM   2574 C C   . VAL A 1 343 ? 83.912  59.669 2.644   1.00 26.22  ? 340  VAL A C   1 
ATOM   2575 O O   . VAL A 1 343 ? 84.530  59.445 1.599   1.00 30.72  ? 340  VAL A O   1 
ATOM   2576 C CB  . VAL A 1 343 ? 83.801  62.148 2.347   1.00 26.46  ? 340  VAL A CB  1 
ATOM   2577 C CG1 . VAL A 1 343 ? 82.863  63.329 2.292   1.00 25.24  ? 340  VAL A CG1 1 
ATOM   2578 C CG2 . VAL A 1 343 ? 84.957  62.393 3.337   1.00 28.25  ? 340  VAL A CG2 1 
ATOM   2579 N N   . TYR A 1 344 ? 83.981  58.861 3.703   1.00 21.06  ? 341  TYR A N   1 
ATOM   2580 C CA  . TYR A 1 344 ? 84.759  57.635 3.709   1.00 26.94  ? 341  TYR A CA  1 
ATOM   2581 C C   . TYR A 1 344 ? 83.895  56.388 3.571   1.00 30.40  ? 341  TYR A C   1 
ATOM   2582 O O   . TYR A 1 344 ? 84.347  55.297 3.927   1.00 34.75  ? 341  TYR A O   1 
ATOM   2583 C CB  . TYR A 1 344 ? 85.607  57.538 4.982   1.00 27.06  ? 341  TYR A CB  1 
ATOM   2584 C CG  . TYR A 1 344 ? 86.806  58.430 4.927   1.00 30.40  ? 341  TYR A CG  1 
ATOM   2585 C CD1 . TYR A 1 344 ? 87.960  58.018 4.283   1.00 34.93  ? 341  TYR A CD1 1 
ATOM   2586 C CD2 . TYR A 1 344 ? 86.774  59.712 5.463   1.00 30.76  ? 341  TYR A CD2 1 
ATOM   2587 C CE1 . TYR A 1 344 ? 89.072  58.834 4.215   1.00 32.30  ? 341  TYR A CE1 1 
ATOM   2588 C CE2 . TYR A 1 344 ? 87.871  60.546 5.383   1.00 32.17  ? 341  TYR A CE2 1 
ATOM   2589 C CZ  . TYR A 1 344 ? 89.018  60.095 4.751   1.00 34.10  ? 341  TYR A CZ  1 
ATOM   2590 O OH  . TYR A 1 344 ? 90.121  60.894 4.657   1.00 38.53  ? 341  TYR A OH  1 
ATOM   2591 N N   . GLY A 1 345 ? 82.672  56.512 3.063   1.00 31.25  ? 342  GLY A N   1 
ATOM   2592 C CA  . GLY A 1 345 ? 81.901  55.304 2.819   1.00 35.39  ? 342  GLY A CA  1 
ATOM   2593 C C   . GLY A 1 345 ? 80.405  55.477 2.623   1.00 35.61  ? 342  GLY A C   1 
ATOM   2594 O O   . GLY A 1 345 ? 79.776  54.649 1.959   1.00 41.96  ? 342  GLY A O   1 
ATOM   2595 N N   . ALA A 1 346 ? 79.825  56.516 3.202   1.00 26.83  ? 343  ALA A N   1 
ATOM   2596 C CA  . ALA A 1 346 ? 78.389  56.714 3.095   1.00 30.38  ? 343  ALA A CA  1 
ATOM   2597 C C   . ALA A 1 346 ? 78.043  57.050 1.648   1.00 31.70  ? 343  ALA A C   1 
ATOM   2598 O O   . ALA A 1 346 ? 78.668  57.952 1.061   1.00 26.03  ? 343  ALA A O   1 
ATOM   2599 C CB  . ALA A 1 346 ? 77.922  57.829 4.039   1.00 24.26  ? 343  ALA A CB  1 
ATOM   2600 N N   . PRO A 1 347 ? 77.079  56.348 1.034   1.00 29.01  ? 344  PRO A N   1 
ATOM   2601 C CA  . PRO A 1 347 ? 76.779  56.599 -0.388  1.00 29.11  ? 344  PRO A CA  1 
ATOM   2602 C C   . PRO A 1 347 ? 76.210  57.994 -0.610  1.00 27.87  ? 344  PRO A C   1 
ATOM   2603 O O   . PRO A 1 347 ? 75.492  58.539 0.231   1.00 25.29  ? 344  PRO A O   1 
ATOM   2604 C CB  . PRO A 1 347 ? 75.767  55.500 -0.752  1.00 27.66  ? 344  PRO A CB  1 
ATOM   2605 C CG  . PRO A 1 347 ? 75.221  54.997 0.564   1.00 32.42  ? 344  PRO A CG  1 
ATOM   2606 C CD  . PRO A 1 347 ? 76.315  55.213 1.588   1.00 30.52  ? 344  PRO A CD  1 
ATOM   2607 N N   . GLY A 1 348 ? 76.573  58.584 -1.749  1.00 30.69  ? 345  GLY A N   1 
ATOM   2608 C CA  . GLY A 1 348 ? 76.145  59.916 -2.111  1.00 27.47  ? 345  GLY A CA  1 
ATOM   2609 C C   . GLY A 1 348 ? 77.000  61.046 -1.569  1.00 30.54  ? 345  GLY A C   1 
ATOM   2610 O O   . GLY A 1 348 ? 76.737  62.212 -1.894  1.00 24.70  ? 345  GLY A O   1 
ATOM   2611 N N   . PHE A 1 349 ? 78.002  60.757 -0.747  1.00 28.75  ? 346  PHE A N   1 
ATOM   2612 C CA  . PHE A 1 349 ? 78.800  61.815 -0.146  1.00 29.04  ? 346  PHE A CA  1 
ATOM   2613 C C   . PHE A 1 349 ? 80.084  62.035 -0.935  1.00 30.72  ? 346  PHE A C   1 
ATOM   2614 O O   . PHE A 1 349 ? 80.663  61.098 -1.485  1.00 33.27  ? 346  PHE A O   1 
ATOM   2615 C CB  . PHE A 1 349 ? 79.117  61.498 1.316   1.00 22.62  ? 346  PHE A CB  1 
ATOM   2616 C CG  . PHE A 1 349 ? 77.988  61.828 2.249   1.00 23.47  ? 346  PHE A CG  1 
ATOM   2617 C CD1 . PHE A 1 349 ? 76.994  60.900 2.507   1.00 23.68  ? 346  PHE A CD1 1 
ATOM   2618 C CD2 . PHE A 1 349 ? 77.912  63.070 2.846   1.00 21.41  ? 346  PHE A CD2 1 
ATOM   2619 C CE1 . PHE A 1 349 ? 75.957  61.194 3.348   1.00 23.66  ? 346  PHE A CE1 1 
ATOM   2620 C CE2 . PHE A 1 349 ? 76.869  63.373 3.694   1.00 28.89  ? 346  PHE A CE2 1 
ATOM   2621 C CZ  . PHE A 1 349 ? 75.889  62.430 3.937   1.00 26.96  ? 346  PHE A CZ  1 
ATOM   2622 N N   . SER A 1 350 ? 80.515  63.294 -0.986  1.00 32.19  ? 347  SER A N   1 
ATOM   2623 C CA  . SER A 1 350 ? 81.726  63.702 -1.689  1.00 26.87  ? 347  SER A CA  1 
ATOM   2624 C C   . SER A 1 350 ? 82.155  65.040 -1.108  1.00 25.36  ? 347  SER A C   1 
ATOM   2625 O O   . SER A 1 350 ? 81.310  65.897 -0.862  1.00 23.88  ? 347  SER A O   1 
ATOM   2626 C CB  . SER A 1 350 ? 81.485  63.816 -3.200  1.00 27.66  ? 347  SER A CB  1 
ATOM   2627 O OG  . SER A 1 350 ? 82.442  64.651 -3.841  1.00 34.11  ? 347  SER A OG  1 
ATOM   2628 N N   . LYS A 1 351 ? 83.455  65.219 -0.864  1.00 27.15  ? 348  LYS A N   1 
ATOM   2629 C CA  . LYS A 1 351 ? 83.871  66.508 -0.312  1.00 21.17  ? 348  LYS A CA  1 
ATOM   2630 C C   . LYS A 1 351 ? 83.803  67.599 -1.356  1.00 20.71  ? 348  LYS A C   1 
ATOM   2631 O O   . LYS A 1 351 ? 83.829  68.781 -1.002  1.00 20.93  ? 348  LYS A O   1 
ATOM   2632 C CB  . LYS A 1 351 ? 85.284  66.448 0.267   1.00 25.03  ? 348  LYS A CB  1 
ATOM   2633 C CG  . LYS A 1 351 ? 86.400  66.834 -0.723  1.00 22.39  ? 348  LYS A CG  1 
ATOM   2634 C CD  . LYS A 1 351 ? 87.780  66.789 -0.037  1.00 24.41  ? 348  LYS A CD  1 
ATOM   2635 C CE  . LYS A 1 351 ? 88.925  67.074 -1.025  1.00 17.36  ? 348  LYS A CE  1 
ATOM   2636 N NZ  . LYS A 1 351 ? 88.670  68.395 -1.655  1.00 24.38  ? 348  LYS A NZ  1 
ATOM   2637 N N   . ASP A 1 352 ? 83.715  67.224 -2.633  1.00 19.73  ? 349  ASP A N   1 
ATOM   2638 C CA  . ASP A 1 352 ? 83.753  68.175 -3.730  1.00 23.17  ? 349  ASP A CA  1 
ATOM   2639 C C   . ASP A 1 352 ? 82.369  68.510 -4.289  1.00 26.18  ? 349  ASP A C   1 
ATOM   2640 O O   . ASP A 1 352 ? 82.277  69.180 -5.324  1.00 25.02  ? 349  ASP A O   1 
ATOM   2641 C CB  . ASP A 1 352 ? 84.684  67.646 -4.824  1.00 20.91  ? 349  ASP A CB  1 
ATOM   2642 C CG  . ASP A 1 352 ? 86.130  67.535 -4.338  1.00 20.78  ? 349  ASP A CG  1 
ATOM   2643 O OD1 . ASP A 1 352 ? 86.619  68.498 -3.708  1.00 20.43  ? 349  ASP A OD1 1 
ATOM   2644 O OD2 . ASP A 1 352 ? 86.752  66.469 -4.525  1.00 22.48  ? 349  ASP A OD2 1 
ATOM   2645 N N   . ASN A 1 353 ? 81.294  68.088 -3.627  1.00 21.62  ? 350  ASN A N   1 
ATOM   2646 C CA  . ASN A 1 353 ? 79.971  68.614 -3.977  1.00 30.02  ? 350  ASN A CA  1 
ATOM   2647 C C   . ASN A 1 353 ? 79.197  68.843 -2.679  1.00 28.40  ? 350  ASN A C   1 
ATOM   2648 O O   . ASN A 1 353 ? 79.751  68.748 -1.578  1.00 28.16  ? 350  ASN A O   1 
ATOM   2649 C CB  . ASN A 1 353 ? 79.235  67.723 -5.000  1.00 20.43  ? 350  ASN A CB  1 
ATOM   2650 C CG  . ASN A 1 353 ? 78.771  66.388 -4.438  1.00 28.06  ? 350  ASN A CG  1 
ATOM   2651 O OD1 . ASN A 1 353 ? 78.516  66.242 -3.241  1.00 27.94  ? 350  ASN A OD1 1 
ATOM   2652 N ND2 . ASN A 1 353 ? 78.642  65.394 -5.323  1.00 29.99  ? 350  ASN A ND2 1 
ATOM   2653 N N   . GLU A 1 354 ? 77.911  69.180 -2.812  1.00 29.69  ? 351  GLU A N   1 
ATOM   2654 C CA  . GLU A 1 354 ? 77.102  69.546 -1.656  1.00 31.85  ? 351  GLU A CA  1 
ATOM   2655 C C   . GLU A 1 354 ? 76.613  68.343 -0.879  1.00 22.59  ? 351  GLU A C   1 
ATOM   2656 O O   . GLU A 1 354 ? 76.031  68.531 0.193   1.00 25.40  ? 351  GLU A O   1 
ATOM   2657 C CB  . GLU A 1 354 ? 75.890  70.389 -2.074  1.00 30.20  ? 351  GLU A CB  1 
ATOM   2658 C CG  . GLU A 1 354 ? 76.235  71.754 -2.618  1.00 34.15  ? 351  GLU A CG  1 
ATOM   2659 C CD  . GLU A 1 354 ? 77.322  72.412 -1.806  1.00 47.07  ? 351  GLU A CD  1 
ATOM   2660 O OE1 . GLU A 1 354 ? 78.448  72.574 -2.338  1.00 45.30  ? 351  GLU A OE1 1 
ATOM   2661 O OE2 . GLU A 1 354 ? 77.056  72.747 -0.626  1.00 55.47  ? 351  GLU A OE2 1 
ATOM   2662 N N   . SER A 1 355 ? 76.820  67.134 -1.401  1.00 23.10  ? 352  SER A N   1 
ATOM   2663 C CA  . SER A 1 355 ? 76.408  65.886 -0.754  1.00 23.87  ? 352  SER A CA  1 
ATOM   2664 C C   . SER A 1 355 ? 74.924  65.915 -0.370  1.00 27.93  ? 352  SER A C   1 
ATOM   2665 O O   . SER A 1 355 ? 74.526  65.519 0.731   1.00 24.30  ? 352  SER A O   1 
ATOM   2666 C CB  . SER A 1 355 ? 77.291  65.589 0.465   1.00 25.55  ? 352  SER A CB  1 
ATOM   2667 O OG  . SER A 1 355 ? 78.589  65.165 0.066   1.00 26.93  ? 352  SER A OG  1 
ATOM   2668 N N   . LEU A 1 356 ? 74.095  66.393 -1.297  1.00 26.32  ? 353  LEU A N   1 
ATOM   2669 C CA  . LEU A 1 356 ? 72.648  66.462 -1.072  1.00 30.13  ? 353  LEU A CA  1 
ATOM   2670 C C   . LEU A 1 356 ? 72.076  65.087 -1.381  1.00 25.38  ? 353  LEU A C   1 
ATOM   2671 O O   . LEU A 1 356 ? 71.734  64.774 -2.517  1.00 31.58  ? 353  LEU A O   1 
ATOM   2672 C CB  . LEU A 1 356 ? 72.018  67.546 -1.933  1.00 29.04  ? 353  LEU A CB  1 
ATOM   2673 C CG  . LEU A 1 356 ? 72.526  68.947 -1.617  1.00 29.95  ? 353  LEU A CG  1 
ATOM   2674 C CD1 . LEU A 1 356 ? 72.118  69.915 -2.713  1.00 36.97  ? 353  LEU A CD1 1 
ATOM   2675 C CD2 . LEU A 1 356 ? 71.993  69.396 -0.282  1.00 27.06  ? 353  LEU A CD2 1 
ATOM   2676 N N   . ILE A 1 357 ? 71.999  64.240 -0.359  1.00 23.02  ? 354  ILE A N   1 
ATOM   2677 C CA  . ILE A 1 357 ? 71.684  62.842 -0.597  1.00 24.43  ? 354  ILE A CA  1 
ATOM   2678 C C   . ILE A 1 357 ? 70.176  62.662 -0.719  1.00 33.14  ? 354  ILE A C   1 
ATOM   2679 O O   . ILE A 1 357 ? 69.375  63.486 -0.255  1.00 25.64  ? 354  ILE A O   1 
ATOM   2680 C CB  . ILE A 1 357 ? 72.265  61.942 0.508   1.00 23.37  ? 354  ILE A CB  1 
ATOM   2681 C CG1 . ILE A 1 357 ? 71.894  62.499 1.880   1.00 25.69  ? 354  ILE A CG1 1 
ATOM   2682 C CG2 . ILE A 1 357 ? 73.787  61.814 0.357   1.00 25.27  ? 354  ILE A CG2 1 
ATOM   2683 C CD1 . ILE A 1 357 ? 72.102  61.521 2.982   1.00 24.12  ? 354  ILE A CD1 1 
ATOM   2684 N N   . SER A 1 358 ? 69.793  61.562 -1.356  1.00 32.18  ? 355  SER A N   1 
ATOM   2685 C CA  . SER A 1 358 ? 68.407  61.144 -1.453  1.00 27.25  ? 355  SER A CA  1 
ATOM   2686 C C   . SER A 1 358 ? 68.040  60.313 -0.232  1.00 33.80  ? 355  SER A C   1 
ATOM   2687 O O   . SER A 1 358 ? 68.899  59.896 0.553   1.00 30.96  ? 355  SER A O   1 
ATOM   2688 C CB  . SER A 1 358 ? 68.195  60.325 -2.709  1.00 23.44  ? 355  SER A CB  1 
ATOM   2689 O OG  . SER A 1 358 ? 68.796  59.058 -2.519  1.00 28.30  ? 355  SER A OG  1 
ATOM   2690 N N   . ARG A 1 359 ? 66.743  60.066 -0.077  1.00 34.35  ? 356  ARG A N   1 
ATOM   2691 C CA  . ARG A 1 359 ? 66.243  59.275 1.039   1.00 27.80  ? 356  ARG A CA  1 
ATOM   2692 C C   . ARG A 1 359 ? 66.857  57.881 1.007   1.00 26.70  ? 356  ARG A C   1 
ATOM   2693 O O   . ARG A 1 359 ? 67.282  57.354 2.036   1.00 29.44  ? 356  ARG A O   1 
ATOM   2694 C CB  . ARG A 1 359 ? 64.717  59.181 0.991   1.00 37.20  ? 356  ARG A CB  1 
ATOM   2695 C CG  . ARG A 1 359 ? 64.109  58.360 2.117   1.00 33.04  ? 356  ARG A CG  1 
ATOM   2696 C CD  . ARG A 1 359 ? 63.251  59.223 3.027   1.00 39.14  ? 356  ARG A CD  1 
ATOM   2697 N NE  . ARG A 1 359 ? 62.802  58.493 4.209   1.00 41.14  ? 356  ARG A NE  1 
ATOM   2698 C CZ  . ARG A 1 359 ? 63.178  58.777 5.451   1.00 31.30  ? 356  ARG A CZ  1 
ATOM   2699 N NH1 . ARG A 1 359 ? 64.015  59.780 5.679   1.00 33.99  ? 356  ARG A NH1 1 
ATOM   2700 N NH2 . ARG A 1 359 ? 62.718  58.059 6.466   1.00 32.41  ? 356  ARG A NH2 1 
ATOM   2701 N N   . ALA A 1 360 ? 66.900  57.287 -0.182  1.00 28.60  ? 357  ALA A N   1 
ATOM   2702 C CA  . ALA A 1 360 ? 67.472  55.958 -0.351  1.00 30.67  ? 357  ALA A CA  1 
ATOM   2703 C C   . ALA A 1 360 ? 68.900  55.941 0.178   1.00 29.37  ? 357  ALA A C   1 
ATOM   2704 O O   . ALA A 1 360 ? 69.279  55.056 0.945   1.00 32.13  ? 357  ALA A O   1 
ATOM   2705 C CB  . ALA A 1 360 ? 67.440  55.548 -1.815  1.00 22.87  ? 357  ALA A CB  1 
ATOM   2706 N N   . GLU A 1 361 ? 69.687  56.928 -0.238  1.00 30.37  ? 358  GLU A N   1 
ATOM   2707 C CA  . GLU A 1 361 ? 71.076  57.041 0.204   1.00 30.62  ? 358  GLU A CA  1 
ATOM   2708 C C   . GLU A 1 361 ? 71.166  57.168 1.718   1.00 26.40  ? 358  GLU A C   1 
ATOM   2709 O O   . GLU A 1 361 ? 71.968  56.478 2.357   1.00 25.59  ? 358  GLU A O   1 
ATOM   2710 C CB  . GLU A 1 361 ? 71.754  58.224 -0.492  1.00 27.50  ? 358  GLU A CB  1 
ATOM   2711 C CG  . GLU A 1 361 ? 72.220  57.846 -1.892  1.00 25.04  ? 358  GLU A CG  1 
ATOM   2712 C CD  . GLU A 1 361 ? 72.533  59.024 -2.773  1.00 29.27  ? 358  GLU A CD  1 
ATOM   2713 O OE1 . GLU A 1 361 ? 72.162  60.170 -2.434  1.00 31.97  ? 358  GLU A OE1 1 
ATOM   2714 O OE2 . GLU A 1 361 ? 73.156  58.801 -3.824  1.00 40.23  ? 358  GLU A OE2 1 
ATOM   2715 N N   . PHE A 1 362 ? 70.328  58.018 2.310   1.00 27.63  ? 359  PHE A N   1 
ATOM   2716 C CA  . PHE A 1 362 ? 70.293  58.132 3.763   1.00 28.13  ? 359  PHE A CA  1 
ATOM   2717 C C   . PHE A 1 362 ? 70.005  56.790 4.422   1.00 29.10  ? 359  PHE A C   1 
ATOM   2718 O O   . PHE A 1 362 ? 70.650  56.425 5.415   1.00 29.68  ? 359  PHE A O   1 
ATOM   2719 C CB  . PHE A 1 362 ? 69.262  59.178 4.183   1.00 27.03  ? 359  PHE A CB  1 
ATOM   2720 C CG  . PHE A 1 362 ? 68.994  59.218 5.665   1.00 25.67  ? 359  PHE A CG  1 
ATOM   2721 C CD1 . PHE A 1 362 ? 69.846  59.897 6.521   1.00 24.57  ? 359  PHE A CD1 1 
ATOM   2722 C CD2 . PHE A 1 362 ? 67.861  58.612 6.197   1.00 31.03  ? 359  PHE A CD2 1 
ATOM   2723 C CE1 . PHE A 1 362 ? 69.599  59.947 7.874   1.00 26.46  ? 359  PHE A CE1 1 
ATOM   2724 C CE2 . PHE A 1 362 ? 67.598  58.660 7.559   1.00 26.87  ? 359  PHE A CE2 1 
ATOM   2725 C CZ  . PHE A 1 362 ? 68.464  59.324 8.400   1.00 26.66  ? 359  PHE A CZ  1 
ATOM   2726 N N   . LEU A 1 363 ? 69.055  56.028 3.883   1.00 33.05  ? 360  LEU A N   1 
ATOM   2727 C CA  . LEU A 1 363 ? 68.728  54.748 4.507   1.00 32.28  ? 360  LEU A CA  1 
ATOM   2728 C C   . LEU A 1 363 ? 69.876  53.752 4.376   1.00 29.00  ? 360  LEU A C   1 
ATOM   2729 O O   . LEU A 1 363 ? 70.163  53.001 5.317   1.00 31.60  ? 360  LEU A O   1 
ATOM   2730 C CB  . LEU A 1 363 ? 67.442  54.181 3.908   1.00 33.87  ? 360  LEU A CB  1 
ATOM   2731 C CG  . LEU A 1 363 ? 66.193  54.997 4.240   1.00 30.92  ? 360  LEU A CG  1 
ATOM   2732 C CD1 . LEU A 1 363 ? 65.034  54.546 3.380   1.00 34.89  ? 360  LEU A CD1 1 
ATOM   2733 C CD2 . LEU A 1 363 ? 65.857  54.864 5.705   1.00 33.04  ? 360  LEU A CD2 1 
ATOM   2734 N N   . ALA A 1 364 ? 70.537  53.721 3.218   1.00 25.45  ? 361  ALA A N   1 
ATOM   2735 C CA  . ALA A 1 364 ? 71.735  52.895 3.084   1.00 32.14  ? 361  ALA A CA  1 
ATOM   2736 C C   . ALA A 1 364 ? 72.862  53.410 3.971   1.00 26.27  ? 361  ALA A C   1 
ATOM   2737 O O   . ALA A 1 364 ? 73.593  52.619 4.577   1.00 28.13  ? 361  ALA A O   1 
ATOM   2738 C CB  . ALA A 1 364 ? 72.189  52.846 1.622   1.00 27.34  ? 361  ALA A CB  1 
ATOM   2739 N N   . GLY A 1 365 ? 73.013  54.730 4.066   1.00 25.23  ? 362  GLY A N   1 
ATOM   2740 C CA  . GLY A 1 365 ? 74.047  55.285 4.927   1.00 24.86  ? 362  GLY A CA  1 
ATOM   2741 C C   . GLY A 1 365 ? 73.909  54.854 6.377   1.00 27.47  ? 362  GLY A C   1 
ATOM   2742 O O   . GLY A 1 365 ? 74.911  54.622 7.059   1.00 26.19  ? 362  GLY A O   1 
ATOM   2743 N N   . VAL A 1 366 ? 72.666  54.729 6.869   1.00 26.66  ? 363  VAL A N   1 
ATOM   2744 C CA  . VAL A 1 366 ? 72.463  54.333 8.263   1.00 22.65  ? 363  VAL A CA  1 
ATOM   2745 C C   . VAL A 1 366 ? 73.093  52.972 8.525   1.00 23.06  ? 363  VAL A C   1 
ATOM   2746 O O   . VAL A 1 366 ? 73.664  52.734 9.595   1.00 25.74  ? 363  VAL A O   1 
ATOM   2747 C CB  . VAL A 1 366 ? 70.963  54.358 8.633   1.00 28.36  ? 363  VAL A CB  1 
ATOM   2748 C CG1 . VAL A 1 366 ? 70.707  53.699 10.009  1.00 20.22  ? 363  VAL A CG1 1 
ATOM   2749 C CG2 . VAL A 1 366 ? 70.453  55.774 8.669   1.00 20.43  ? 363  VAL A CG2 1 
ATOM   2750 N N   . ARG A 1 367 ? 73.024  52.065 7.552   1.00 22.43  ? 364  ARG A N   1 
ATOM   2751 C CA  . ARG A 1 367 ? 73.612  50.745 7.756   1.00 26.51  ? 364  ARG A CA  1 
ATOM   2752 C C   . ARG A 1 367 ? 75.137  50.801 7.742   1.00 33.91  ? 364  ARG A C   1 
ATOM   2753 O O   . ARG A 1 367 ? 75.796  49.970 8.386   1.00 26.22  ? 364  ARG A O   1 
ATOM   2754 C CB  . ARG A 1 367 ? 73.126  49.760 6.689   1.00 30.77  ? 364  ARG A CB  1 
ATOM   2755 C CG  . ARG A 1 367 ? 71.609  49.599 6.583   1.00 32.74  ? 364  ARG A CG  1 
ATOM   2756 C CD  . ARG A 1 367 ? 70.900  49.687 7.930   1.00 33.19  ? 364  ARG A CD  1 
ATOM   2757 N NE  . ARG A 1 367 ? 71.037  48.477 8.744   1.00 38.12  ? 364  ARG A NE  1 
ATOM   2758 C CZ  . ARG A 1 367 ? 70.236  47.419 8.636   1.00 43.09  ? 364  ARG A CZ  1 
ATOM   2759 N NH1 . ARG A 1 367 ? 69.256  47.427 7.740   1.00 41.85  ? 364  ARG A NH1 1 
ATOM   2760 N NH2 . ARG A 1 367 ? 70.415  46.357 9.408   1.00 42.33  ? 364  ARG A NH2 1 
ATOM   2761 N N   . VAL A 1 368 ? 75.708  51.747 6.993   1.00 29.24  ? 365  VAL A N   1 
ATOM   2762 C CA  . VAL A 1 368 ? 77.151  51.938 6.988   1.00 29.43  ? 365  VAL A CA  1 
ATOM   2763 C C   . VAL A 1 368 ? 77.600  52.654 8.256   1.00 27.47  ? 365  VAL A C   1 
ATOM   2764 O O   . VAL A 1 368 ? 78.605  52.277 8.868   1.00 28.56  ? 365  VAL A O   1 
ATOM   2765 C CB  . VAL A 1 368 ? 77.558  52.689 5.706   1.00 29.94  ? 365  VAL A CB  1 
ATOM   2766 C CG1 . VAL A 1 368 ? 79.000  53.174 5.779   1.00 28.44  ? 365  VAL A CG1 1 
ATOM   2767 C CG2 . VAL A 1 368 ? 77.364  51.770 4.516   1.00 26.97  ? 365  VAL A CG2 1 
ATOM   2768 N N   . GLY A 1 369 ? 76.843  53.667 8.694   1.00 25.91  ? 366  GLY A N   1 
ATOM   2769 C CA  . GLY A 1 369 ? 77.184  54.389 9.909   1.00 24.89  ? 366  GLY A CA  1 
ATOM   2770 C C   . GLY A 1 369 ? 76.810  53.681 11.193  1.00 29.33  ? 366  GLY A C   1 
ATOM   2771 O O   . GLY A 1 369 ? 77.366  53.994 12.252  1.00 30.77  ? 366  GLY A O   1 
ATOM   2772 N N   . VAL A 1 370 ? 75.877  52.739 11.138  1.00 26.41  ? 367  VAL A N   1 
ATOM   2773 C CA  . VAL A 1 370 ? 75.573  51.950 12.325  1.00 27.34  ? 367  VAL A CA  1 
ATOM   2774 C C   . VAL A 1 370 ? 75.712  50.481 11.945  1.00 32.24  ? 367  VAL A C   1 
ATOM   2775 O O   . VAL A 1 370 ? 74.706  49.771 11.810  1.00 34.81  ? 367  VAL A O   1 
ATOM   2776 C CB  . VAL A 1 370 ? 74.182  52.290 12.888  1.00 29.30  ? 367  VAL A CB  1 
ATOM   2777 C CG1 . VAL A 1 370 ? 74.019  51.701 14.271  1.00 24.09  ? 367  VAL A CG1 1 
ATOM   2778 C CG2 . VAL A 1 370 ? 73.991  53.804 12.940  1.00 21.12  ? 367  VAL A CG2 1 
ATOM   2779 N N   . PRO A 1 371 ? 76.933  49.982 11.775  1.00 33.11  ? 368  PRO A N   1 
ATOM   2780 C CA  . PRO A 1 371 ? 77.115  48.629 11.241  1.00 29.68  ? 368  PRO A CA  1 
ATOM   2781 C C   . PRO A 1 371 ? 76.812  47.558 12.278  1.00 32.51  ? 368  PRO A C   1 
ATOM   2782 O O   . PRO A 1 371 ? 76.879  47.782 13.487  1.00 36.22  ? 368  PRO A O   1 
ATOM   2783 C CB  . PRO A 1 371 ? 78.598  48.607 10.848  1.00 35.02  ? 368  PRO A CB  1 
ATOM   2784 C CG  . PRO A 1 371 ? 79.247  49.585 11.791  1.00 29.37  ? 368  PRO A CG  1 
ATOM   2785 C CD  . PRO A 1 371 ? 78.217  50.660 12.052  1.00 31.22  ? 368  PRO A CD  1 
ATOM   2786 N N   . GLN A 1 372 ? 76.462  46.376 11.776  1.00 31.65  ? 369  GLN A N   1 
ATOM   2787 C CA  . GLN A 1 372 ? 76.250  45.192 12.621  1.00 46.98  ? 369  GLN A CA  1 
ATOM   2788 C C   . GLN A 1 372 ? 75.117  45.384 13.638  1.00 48.08  ? 369  GLN A C   1 
ATOM   2789 O O   . GLN A 1 372 ? 75.237  45.028 14.814  1.00 46.30  ? 369  GLN A O   1 
ATOM   2790 C CB  . GLN A 1 372 ? 77.548  44.792 13.331  1.00 48.31  ? 369  GLN A CB  1 
ATOM   2791 C CG  . GLN A 1 372 ? 78.234  43.566 12.730  1.00 59.32  ? 369  GLN A CG  1 
ATOM   2792 C CD  . GLN A 1 372 ? 79.612  43.290 13.333  1.00 63.82  ? 369  GLN A CD  1 
ATOM   2793 O OE1 . GLN A 1 372 ? 80.027  43.946 14.293  1.00 66.10  ? 369  GLN A OE1 1 
ATOM   2794 N NE2 . GLN A 1 372 ? 80.325  42.312 12.768  1.00 60.52  ? 369  GLN A NE2 1 
ATOM   2795 N N   . VAL A 1 373 ? 73.997  45.949 13.182  1.00 45.26  ? 370  VAL A N   1 
ATOM   2796 C CA  . VAL A 1 373 ? 72.789  45.976 13.993  1.00 43.67  ? 370  VAL A CA  1 
ATOM   2797 C C   . VAL A 1 373 ? 71.640  45.406 13.174  1.00 38.09  ? 370  VAL A C   1 
ATOM   2798 O O   . VAL A 1 373 ? 71.651  45.425 11.941  1.00 41.13  ? 370  VAL A O   1 
ATOM   2799 C CB  . VAL A 1 373 ? 72.423  47.386 14.513  1.00 38.93  ? 370  VAL A CB  1 
ATOM   2800 C CG1 . VAL A 1 373 ? 73.514  47.930 15.412  1.00 42.54  ? 370  VAL A CG1 1 
ATOM   2801 C CG2 . VAL A 1 373 ? 72.112  48.324 13.357  1.00 32.76  ? 370  VAL A CG2 1 
ATOM   2802 N N   . SER A 1 374 ? 70.633  44.909 13.891  1.00 41.66  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 374 ? 69.435  44.339 13.289  1.00 38.54  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 374 ? 68.695  45.368 12.437  1.00 38.59  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 374 ? 68.856  46.587 12.593  1.00 36.02  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 374 ? 68.497  43.820 14.375  1.00 33.95  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 374 ? 68.108  44.879 15.249  1.00 40.54  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 375 ? 67.851  44.850 11.536  1.00 38.32  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 375 ? 66.977  45.711 10.744  1.00 38.82  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 375 ? 66.081  46.554 11.636  1.00 38.64  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 375 ? 65.898  47.755 11.394  1.00 41.86  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 375 ? 66.124  44.868 9.798   1.00 50.94  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 375 ? 66.936  44.238 8.673   1.00 58.17  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 375 ? 67.983  44.812 8.281   1.00 59.17  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 375 ? 66.520  43.166 8.181   1.00 55.89  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 376 ? 65.516  45.943 12.679  1.00 33.37  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 376 ? 64.660  46.693 13.587  1.00 34.55  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 376 ? 65.426  47.835 14.246  1.00 37.57  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 376 ? 64.888  48.939 14.408  1.00 33.93  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 376 ? 64.067  45.754 14.636  1.00 37.73  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 376 ? 63.183  46.458 15.663  1.00 40.28  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 376 ? 61.966  47.041 14.967  1.00 42.20  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 376 ? 62.792  45.507 16.794  1.00 42.02  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 377 ? 66.691  47.590 14.620  1.00 37.30  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 377 ? 67.528  48.643 15.198  1.00 30.84  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 377 ? 67.742  49.781 14.208  1.00 25.24  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 377 ? 67.602  50.961 14.552  1.00 27.90  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 377 ? 68.869  48.060 15.639  1.00 33.63  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 378 ? 68.083  49.444 12.968  1.00 27.75  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 378 ? 68.212  50.474 11.946  1.00 28.73  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 378 ? 66.920  51.266 11.800  1.00 34.98  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 378 ? 66.950  52.499 11.688  1.00 32.11  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 378 ? 68.612  49.837 10.619  1.00 30.83  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 379 ? 65.767  50.575 11.809  1.00 36.98  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 379 ? 64.485  51.277 11.742  1.00 37.87  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 379 ? 64.330  52.263 12.895  1.00 32.67  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 379 ? 63.861  53.392 12.700  1.00 34.82  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 379 ? 63.322  50.274 11.738  1.00 42.30  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 379 ? 62.901  49.783 10.351  1.00 45.10  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 379 ? 62.602  50.932 9.377   1.00 59.77  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 379 ? 61.943  51.926 9.774   1.00 62.05  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 379 ? 63.032  50.840 8.205   1.00 65.50  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 380 ? 64.702  51.852 14.110  1.00 30.09  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 380 ? 64.656  52.783 15.233  1.00 27.94  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 380 ? 65.534  54.001 14.978  1.00 29.59  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 380 ? 65.137  55.130 15.293  1.00 29.89  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 380 ? 65.070  52.078 16.526  1.00 30.34  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 381 ? 66.731  53.801 14.401  1.00 29.33  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 381 ? 67.603  54.943 14.111  1.00 23.69  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 381 ? 66.930  55.868 13.104  1.00 26.56  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 381 ? 66.859  57.089 13.302  1.00 25.72  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 381 ? 68.990  54.472 13.621  1.00 27.77  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 381 ? 69.849  55.670 13.238  1.00 21.94  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 381 ? 69.699  53.659 14.700  1.00 19.75  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 382 ? 66.375  55.292 12.032  1.00 30.64  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 382 ? 65.681  56.105 11.032  1.00 28.66  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 382 ? 64.517  56.877 11.657  1.00 35.04  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 382 ? 64.316  58.064 11.365  1.00 34.94  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 382 ? 65.212  55.229 9.865   1.00 32.35  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 382 ? 64.425  56.079 8.896   1.00 34.99  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 382 ? 66.411  54.591 9.177   1.00 28.86  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 383 ? 63.733  56.228 12.526  1.00 36.82  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 383 ? 62.639  56.944 13.178  1.00 37.20  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 383 ? 63.163  58.162 13.921  1.00 37.55  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 383 ? 62.640  59.275 13.770  1.00 35.00  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 383 ? 61.877  56.034 14.152  1.00 35.50  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 383 ? 60.914  56.827 15.076  1.00 39.40  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 383 ? 59.581  57.172 14.375  1.00 32.17  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 383 ? 60.646  56.165 16.432  1.00 29.98  ? 380  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 384 ? 64.204  57.971 14.731  1.00 30.57  ? 381  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 384 ? 64.654  59.065 15.570  1.00 30.43  ? 381  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 384 ? 65.281  60.186 14.749  1.00 32.08  ? 381  HIS A C   1 
ATOM   2873 O O   . HIS A 1 384 ? 65.228  61.353 15.164  1.00 31.96  ? 381  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 384 ? 65.631  58.545 16.623  1.00 33.12  ? 381  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 384 ? 66.004  59.570 17.646  1.00 39.56  ? 381  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 384 ? 65.494  59.561 18.928  1.00 40.44  ? 381  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 384 ? 66.823  60.649 17.573  1.00 41.42  ? 381  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 384 ? 65.989  60.585 19.602  1.00 42.88  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 384 ? 66.794  61.264 18.801  1.00 48.64  ? 381  HIS A NE2 1 
ATOM   2880 N N   . TYR A 1 385 ? 65.843  59.878 13.573  1.00 27.98  ? 382  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 385 ? 66.645  60.868 12.851  1.00 34.63  ? 382  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 385 ? 65.959  61.443 11.624  1.00 34.61  ? 382  TYR A C   1 
ATOM   2883 O O   . TYR A 1 385 ? 66.537  62.308 10.961  1.00 41.84  ? 382  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 385 ? 68.027  60.279 12.485  1.00 26.28  ? 382  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 385 ? 68.902  60.298 13.722  1.00 26.77  ? 382  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 385 ? 69.584  61.459 14.093  1.00 27.12  ? 382  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 385 ? 68.973  59.200 14.567  1.00 23.98  ? 382  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 385 ? 70.343  61.505 15.249  1.00 23.58  ? 382  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 385 ? 69.728  59.248 15.741  1.00 27.74  ? 382  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 385 ? 70.409  60.408 16.065  1.00 24.14  ? 382  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 385 ? 71.165  60.475 17.214  1.00 27.23  ? 382  TYR A OH  1 
ATOM   2892 N N   . THR A 1 386 ? 64.735  61.030 11.322  1.00 34.01  ? 383  THR A N   1 
ATOM   2893 C CA  . THR A 1 386 ? 63.981  61.666 10.253  1.00 32.03  ? 383  THR A CA  1 
ATOM   2894 C C   . THR A 1 386 ? 63.158  62.816 10.806  1.00 33.46  ? 383  THR A C   1 
ATOM   2895 O O   . THR A 1 386 ? 62.544  62.693 11.866  1.00 32.85  ? 383  THR A O   1 
ATOM   2896 C CB  . THR A 1 386 ? 63.058  60.662 9.579   1.00 30.04  ? 383  THR A CB  1 
ATOM   2897 O OG1 . THR A 1 386 ? 63.830  59.560 9.086   1.00 28.43  ? 383  THR A OG1 1 
ATOM   2898 C CG2 . THR A 1 386 ? 62.279  61.333 8.440   1.00 29.86  ? 383  THR A CG2 1 
ATOM   2899 N N   . ASP A 1 387 ? 63.164  63.941 10.093  1.00 32.37  ? 384  ASP A N   1 
ATOM   2900 C CA  . ASP A 1 387 ? 62.139  64.964 10.275  1.00 35.08  ? 384  ASP A CA  1 
ATOM   2901 C C   . ASP A 1 387 ? 60.930  64.568 9.428   1.00 36.20  ? 384  ASP A C   1 
ATOM   2902 O O   . ASP A 1 387 ? 60.965  64.643 8.193   1.00 28.10  ? 384  ASP A O   1 
ATOM   2903 C CB  . ASP A 1 387 ? 62.680  66.335 9.884   1.00 37.07  ? 384  ASP A CB  1 
ATOM   2904 C CG  . ASP A 1 387 ? 61.652  67.449 10.045  1.00 42.24  ? 384  ASP A CG  1 
ATOM   2905 O OD1 . ASP A 1 387 ? 60.435  67.162 10.143  1.00 43.78  ? 384  ASP A OD1 1 
ATOM   2906 O OD2 . ASP A 1 387 ? 62.068  68.629 10.072  1.00 41.55  ? 384  ASP A OD2 1 
ATOM   2907 N N   . TRP A 1 388 ? 59.849  64.163 10.089  1.00 36.18  ? 385  TRP A N   1 
ATOM   2908 C CA  . TRP A 1 388 ? 58.712  63.577 9.387   1.00 37.79  ? 385  TRP A CA  1 
ATOM   2909 C C   . TRP A 1 388 ? 57.864  64.612 8.665   1.00 33.21  ? 385  TRP A C   1 
ATOM   2910 O O   . TRP A 1 388 ? 57.068  64.236 7.799   1.00 39.45  ? 385  TRP A O   1 
ATOM   2911 C CB  . TRP A 1 388 ? 57.888  62.736 10.371  1.00 34.84  ? 385  TRP A CB  1 
ATOM   2912 C CG  . TRP A 1 388 ? 58.686  61.528 10.725  1.00 27.40  ? 385  TRP A CG  1 
ATOM   2913 C CD1 . TRP A 1 388 ? 59.406  61.307 11.874  1.00 33.96  ? 385  TRP A CD1 1 
ATOM   2914 C CD2 . TRP A 1 388 ? 58.939  60.414 9.870   1.00 27.60  ? 385  TRP A CD2 1 
ATOM   2915 N NE1 . TRP A 1 388 ? 60.056  60.089 11.797  1.00 29.10  ? 385  TRP A NE1 1 
ATOM   2916 C CE2 . TRP A 1 388 ? 59.798  59.534 10.566  1.00 28.85  ? 385  TRP A CE2 1 
ATOM   2917 C CE3 . TRP A 1 388 ? 58.532  60.080 8.573   1.00 28.54  ? 385  TRP A CE3 1 
ATOM   2918 C CZ2 . TRP A 1 388 ? 60.235  58.336 10.016  1.00 30.49  ? 385  TRP A CZ2 1 
ATOM   2919 C CZ3 . TRP A 1 388 ? 58.961  58.881 8.031   1.00 29.53  ? 385  TRP A CZ3 1 
ATOM   2920 C CH2 . TRP A 1 388 ? 59.800  58.024 8.750   1.00 32.11  ? 385  TRP A CH2 1 
ATOM   2921 N N   . LEU A 1 389 ? 58.055  65.901 8.958   1.00 33.65  ? 386  LEU A N   1 
ATOM   2922 C CA  . LEU A 1 389 ? 57.535  66.953 8.093   1.00 35.44  ? 386  LEU A CA  1 
ATOM   2923 C C   . LEU A 1 389 ? 58.361  67.148 6.823   1.00 38.89  ? 386  LEU A C   1 
ATOM   2924 O O   . LEU A 1 389 ? 57.869  67.770 5.872   1.00 39.99  ? 386  LEU A O   1 
ATOM   2925 C CB  . LEU A 1 389 ? 57.484  68.277 8.849   1.00 37.23  ? 386  LEU A CB  1 
ATOM   2926 C CG  . LEU A 1 389 ? 56.125  68.737 9.355   1.00 47.81  ? 386  LEU A CG  1 
ATOM   2927 C CD1 . LEU A 1 389 ? 56.263  70.124 9.970   1.00 47.74  ? 386  LEU A CD1 1 
ATOM   2928 C CD2 . LEU A 1 389 ? 55.096  68.732 8.220   1.00 38.03  ? 386  LEU A CD2 1 
ATOM   2929 N N   . HIS A 1 390 ? 59.611  66.671 6.792   1.00 34.40  ? 387  HIS A N   1 
ATOM   2930 C CA  . HIS A 1 390 ? 60.493  66.856 5.636   1.00 33.62  ? 387  HIS A CA  1 
ATOM   2931 C C   . HIS A 1 390 ? 61.309  65.593 5.419   1.00 35.04  ? 387  HIS A C   1 
ATOM   2932 O O   . HIS A 1 390 ? 62.541  65.628 5.393   1.00 35.56  ? 387  HIS A O   1 
ATOM   2933 C CB  . HIS A 1 390 ? 61.422  68.051 5.834   1.00 36.82  ? 387  HIS A CB  1 
ATOM   2934 C CG  . HIS A 1 390 ? 60.730  69.316 6.229   1.00 36.30  ? 387  HIS A CG  1 
ATOM   2935 N ND1 . HIS A 1 390 ? 60.071  70.119 5.322   1.00 38.68  ? 387  HIS A ND1 1 
ATOM   2936 C CD2 . HIS A 1 390 ? 60.622  69.933 7.429   1.00 38.51  ? 387  HIS A CD2 1 
ATOM   2937 C CE1 . HIS A 1 390 ? 59.571  71.168 5.951   1.00 38.76  ? 387  HIS A CE1 1 
ATOM   2938 N NE2 . HIS A 1 390 ? 59.894  71.082 7.230   1.00 43.48  ? 387  HIS A NE2 1 
ATOM   2939 N N   . PRO A 1 391 ? 60.651  64.445 5.267   1.00 40.57  ? 388  PRO A N   1 
ATOM   2940 C CA  . PRO A 1 391 ? 61.395  63.179 5.296   1.00 34.18  ? 388  PRO A CA  1 
ATOM   2941 C C   . PRO A 1 391 ? 62.324  62.981 4.106   1.00 34.26  ? 388  PRO A C   1 
ATOM   2942 O O   . PRO A 1 391 ? 63.129  62.042 4.128   1.00 36.92  ? 388  PRO A O   1 
ATOM   2943 C CB  . PRO A 1 391 ? 60.284  62.123 5.326   1.00 36.97  ? 388  PRO A CB  1 
ATOM   2944 C CG  . PRO A 1 391 ? 59.149  62.770 4.603   1.00 33.95  ? 388  PRO A CG  1 
ATOM   2945 C CD  . PRO A 1 391 ? 59.232  64.251 4.911   1.00 34.62  ? 388  PRO A CD  1 
ATOM   2946 N N   . GLU A 1 392 ? 62.261  63.828 3.080   1.00 34.59  ? 389  GLU A N   1 
ATOM   2947 C CA  . GLU A 1 392 ? 63.048  63.601 1.873   1.00 38.48  ? 389  GLU A CA  1 
ATOM   2948 C C   . GLU A 1 392 ? 63.918  64.793 1.500   1.00 31.64  ? 389  GLU A C   1 
ATOM   2949 O O   . GLU A 1 392 ? 64.504  64.788 0.416   1.00 35.61  ? 389  GLU A O   1 
ATOM   2950 C CB  . GLU A 1 392 ? 62.141  63.253 0.687   1.00 38.64  ? 389  GLU A CB  1 
ATOM   2951 C CG  . GLU A 1 392 ? 61.080  62.230 1.005   1.00 41.40  ? 389  GLU A CG  1 
ATOM   2952 C CD  . GLU A 1 392 ? 61.210  61.010 0.146   1.00 47.19  ? 389  GLU A CD  1 
ATOM   2953 O OE1 . GLU A 1 392 ? 60.635  59.960 0.512   1.00 57.50  ? 389  GLU A OE1 1 
ATOM   2954 O OE2 . GLU A 1 392 ? 61.902  61.100 -0.892  1.00 47.56  ? 389  GLU A OE2 1 
ATOM   2955 N N   . ASP A 1 393 ? 63.991  65.812 2.346   1.00 28.41  ? 390  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 393 ? 64.784  66.996 2.047   1.00 32.57  ? 390  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 393 ? 66.270  66.656 2.105   1.00 32.40  ? 390  ASP A C   1 
ATOM   2958 O O   . ASP A 1 393 ? 66.768  66.284 3.181   1.00 24.98  ? 390  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 393 ? 64.457  68.101 3.031   1.00 31.37  ? 390  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 393 ? 65.239  69.345 2.765   1.00 37.87  ? 390  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 393 ? 65.564  69.584 1.586   1.00 47.64  ? 390  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 393 ? 65.539  70.080 3.723   1.00 37.67  ? 390  ASP A OD2 1 
ATOM   2963 N N   . PRO A 1 394 ? 67.004  66.751 0.985   1.00 33.93  ? 391  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 394 ? 68.403  66.267 0.973   1.00 30.09  ? 391  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 394 ? 69.291  66.891 2.035   1.00 22.63  ? 391  PRO A C   1 
ATOM   2966 O O   . PRO A 1 394 ? 70.024  66.161 2.705   1.00 25.63  ? 391  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 394 ? 68.873  66.611 -0.449  1.00 30.08  ? 391  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 394 ? 67.604  66.524 -1.280  1.00 33.41  ? 391  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 394 ? 66.519  67.089 -0.370  1.00 32.92  ? 391  PRO A CD  1 
ATOM   2970 N N   . ALA A 1 395 ? 69.212  68.203 2.245   1.00 23.23  ? 392  ALA A N   1 
ATOM   2971 C CA  . ALA A 1 395 ? 70.086  68.852 3.211   1.00 27.28  ? 392  ALA A CA  1 
ATOM   2972 C C   . ALA A 1 395 ? 69.800  68.390 4.633   1.00 33.17  ? 392  ALA A C   1 
ATOM   2973 O O   . ALA A 1 395 ? 70.729  68.238 5.438   1.00 30.03  ? 392  ALA A O   1 
ATOM   2974 C CB  . ALA A 1 395 ? 69.946  70.371 3.114   1.00 29.55  ? 392  ALA A CB  1 
ATOM   2975 N N   . ARG A 1 396 ? 68.521  68.201 4.982   1.00 29.88  ? 393  ARG A N   1 
ATOM   2976 C CA  . ARG A 1 396 ? 68.211  67.710 6.318   1.00 28.32  ? 393  ARG A CA  1 
ATOM   2977 C C   . ARG A 1 396 ? 68.703  66.287 6.480   1.00 25.58  ? 393  ARG A C   1 
ATOM   2978 O O   . ARG A 1 396 ? 69.185  65.909 7.551   1.00 30.81  ? 393  ARG A O   1 
ATOM   2979 C CB  . ARG A 1 396 ? 66.710  67.793 6.601   1.00 29.78  ? 393  ARG A CB  1 
ATOM   2980 C CG  . ARG A 1 396 ? 66.209  69.201 6.921   1.00 33.91  ? 393  ARG A CG  1 
ATOM   2981 C CD  . ARG A 1 396 ? 64.696  69.205 7.124   1.00 37.26  ? 393  ARG A CD  1 
ATOM   2982 N NE  . ARG A 1 396 ? 64.193  70.483 7.631   1.00 37.74  ? 393  ARG A NE  1 
ATOM   2983 C CZ  . ARG A 1 396 ? 63.753  71.472 6.856   1.00 38.05  ? 393  ARG A CZ  1 
ATOM   2984 N NH1 . ARG A 1 396 ? 63.757  71.338 5.539   1.00 40.80  ? 393  ARG A NH1 1 
ATOM   2985 N NH2 . ARG A 1 396 ? 63.305  72.595 7.395   1.00 40.38  ? 393  ARG A NH2 1 
ATOM   2986 N N   . LEU A 1 397 ? 68.608  65.493 5.420   1.00 24.92  ? 394  LEU A N   1 
ATOM   2987 C CA  . LEU A 1 397 ? 69.091  64.122 5.483   1.00 26.95  ? 394  LEU A CA  1 
ATOM   2988 C C   . LEU A 1 397 ? 70.615  64.072 5.620   1.00 29.17  ? 394  LEU A C   1 
ATOM   2989 O O   . LEU A 1 397 ? 71.156  63.216 6.339   1.00 24.18  ? 394  LEU A O   1 
ATOM   2990 C CB  . LEU A 1 397 ? 68.638  63.362 4.238   1.00 24.61  ? 394  LEU A CB  1 
ATOM   2991 C CG  . LEU A 1 397 ? 67.153  63.113 3.974   1.00 30.19  ? 394  LEU A CG  1 
ATOM   2992 C CD1 . LEU A 1 397 ? 66.986  62.359 2.649   1.00 27.45  ? 394  LEU A CD1 1 
ATOM   2993 C CD2 . LEU A 1 397 ? 66.515  62.333 5.109   1.00 24.26  ? 394  LEU A CD2 1 
ATOM   2994 N N   . ARG A 1 398 ? 71.323  64.970 4.925   1.00 27.74  ? 395  ARG A N   1 
ATOM   2995 C CA  . ARG A 1 398 ? 72.779  65.035 5.046   1.00 26.87  ? 395  ARG A CA  1 
ATOM   2996 C C   . ARG A 1 398 ? 73.180  65.338 6.484   1.00 25.12  ? 395  ARG A C   1 
ATOM   2997 O O   . ARG A 1 398 ? 73.998  64.628 7.076   1.00 24.91  ? 395  ARG A O   1 
ATOM   2998 C CB  . ARG A 1 398 ? 73.328  66.090 4.085   1.00 25.78  ? 395  ARG A CB  1 
ATOM   2999 C CG  . ARG A 1 398 ? 74.846  66.286 4.121   1.00 24.59  ? 395  ARG A CG  1 
ATOM   3000 C CD  . ARG A 1 398 ? 75.220  67.523 3.335   1.00 22.88  ? 395  ARG A CD  1 
ATOM   3001 N NE  . ARG A 1 398 ? 74.649  68.730 3.926   1.00 25.20  ? 395  ARG A NE  1 
ATOM   3002 C CZ  . ARG A 1 398 ? 74.405  69.854 3.257   1.00 26.53  ? 395  ARG A CZ  1 
ATOM   3003 N NH1 . ARG A 1 398 ? 74.667  69.924 1.956   1.00 21.68  ? 395  ARG A NH1 1 
ATOM   3004 N NH2 . ARG A 1 398 ? 73.888  70.907 3.884   1.00 21.59  ? 395  ARG A NH2 1 
ATOM   3005 N N   . GLU A 1 399 ? 72.571  66.373 7.075   1.00 26.62  ? 396  GLU A N   1 
ATOM   3006 C CA  . GLU A 1 399 ? 72.821  66.717 8.472   1.00 24.86  ? 396  GLU A CA  1 
ATOM   3007 C C   . GLU A 1 399 ? 72.378  65.609 9.425   1.00 29.68  ? 396  GLU A C   1 
ATOM   3008 O O   . GLU A 1 399 ? 73.000  65.405 10.478  1.00 25.23  ? 396  GLU A O   1 
ATOM   3009 C CB  . GLU A 1 399 ? 72.121  68.041 8.817   1.00 27.25  ? 396  GLU A CB  1 
ATOM   3010 C CG  . GLU A 1 399 ? 72.927  69.328 8.509   1.00 35.88  ? 396  GLU A CG  1 
ATOM   3011 C CD  . GLU A 1 399 ? 73.205  69.595 7.017   1.00 46.77  ? 396  GLU A CD  1 
ATOM   3012 O OE1 . GLU A 1 399 ? 72.395  70.312 6.373   1.00 46.42  ? 396  GLU A OE1 1 
ATOM   3013 O OE2 . GLU A 1 399 ? 74.257  69.117 6.501   1.00 43.43  ? 396  GLU A OE2 1 
ATOM   3014 N N   . ALA A 1 400 ? 71.314  64.880 9.083   1.00 27.95  ? 397  ALA A N   1 
ATOM   3015 C CA  . ALA A 1 400 ? 70.839  63.831 9.974   1.00 25.44  ? 397  ALA A CA  1 
ATOM   3016 C C   . ALA A 1 400 ? 71.806  62.652 10.016  1.00 21.14  ? 397  ALA A C   1 
ATOM   3017 O O   . ALA A 1 400 ? 72.062  62.094 11.090  1.00 23.63  ? 397  ALA A O   1 
ATOM   3018 C CB  . ALA A 1 400 ? 69.439  63.372 9.554   1.00 28.15  ? 397  ALA A CB  1 
ATOM   3019 N N   . LEU A 1 401 ? 72.338  62.232 8.863   1.00 21.64  ? 398  LEU A N   1 
ATOM   3020 C CA  . LEU A 1 401 ? 73.310  61.139 8.896   1.00 27.36  ? 398  LEU A CA  1 
ATOM   3021 C C   . LEU A 1 401 ? 74.586  61.567 9.627   1.00 18.18  ? 398  LEU A C   1 
ATOM   3022 O O   . LEU A 1 401 ? 75.173  60.788 10.384  1.00 21.43  ? 398  LEU A O   1 
ATOM   3023 C CB  . LEU A 1 401 ? 73.625  60.649 7.482   1.00 23.99  ? 398  LEU A CB  1 
ATOM   3024 C CG  . LEU A 1 401 ? 74.341  59.292 7.468   1.00 23.51  ? 398  LEU A CG  1 
ATOM   3025 C CD1 . LEU A 1 401 ? 73.507  58.230 8.204   1.00 20.44  ? 398  LEU A CD1 1 
ATOM   3026 C CD2 . LEU A 1 401 ? 74.657  58.851 6.036   1.00 21.02  ? 398  LEU A CD2 1 
ATOM   3027 N N   . SER A 1 402 ? 75.003  62.812 9.444   1.00 20.60  ? 399  SER A N   1 
ATOM   3028 C CA  . SER A 1 402 ? 76.110  63.321 10.237  1.00 26.78  ? 399  SER A CA  1 
ATOM   3029 C C   . SER A 1 402 ? 75.808  63.222 11.730  1.00 26.29  ? 399  SER A C   1 
ATOM   3030 O O   . SER A 1 402 ? 76.673  62.818 12.520  1.00 22.40  ? 399  SER A O   1 
ATOM   3031 C CB  . SER A 1 402 ? 76.414  64.757 9.833   1.00 21.34  ? 399  SER A CB  1 
ATOM   3032 O OG  . SER A 1 402 ? 77.394  65.296 10.689  1.00 27.70  ? 399  SER A OG  1 
ATOM   3033 N N   . ASP A 1 403 ? 74.583  63.580 12.134  1.00 23.58  ? 400  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 403 ? 74.200  63.435 13.537  1.00 24.42  ? 400  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 403 ? 74.219  61.977 13.955  1.00 22.25  ? 400  ASP A C   1 
ATOM   3036 O O   . ASP A 1 403 ? 74.667  61.650 15.063  1.00 20.59  ? 400  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 403 ? 72.810  64.023 13.803  1.00 32.67  ? 400  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 403 ? 72.787  65.540 13.763  1.00 30.78  ? 400  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 403 ? 73.799  66.186 14.102  1.00 32.18  ? 400  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 403 ? 71.728  66.088 13.402  1.00 36.12  ? 400  ASP A OD2 1 
ATOM   3041 N N   . VAL A 1 404 ? 73.720  61.083 13.094  1.00 19.27  ? 401  VAL A N   1 
ATOM   3042 C CA  . VAL A 1 404 ? 73.718  59.660 13.439  1.00 19.65  ? 401  VAL A CA  1 
ATOM   3043 C C   . VAL A 1 404 ? 75.133  59.197 13.776  1.00 23.30  ? 401  VAL A C   1 
ATOM   3044 O O   . VAL A 1 404 ? 75.365  58.545 14.807  1.00 20.45  ? 401  VAL A O   1 
ATOM   3045 C CB  . VAL A 1 404 ? 73.114  58.814 12.301  1.00 22.69  ? 401  VAL A CB  1 
ATOM   3046 C CG1 . VAL A 1 404 ? 73.314  57.337 12.583  1.00 13.72  ? 401  VAL A CG1 1 
ATOM   3047 C CG2 . VAL A 1 404 ? 71.620  59.116 12.102  1.00 22.29  ? 401  VAL A CG2 1 
ATOM   3048 N N   . VAL A 1 405 ? 76.100  59.525 12.907  1.00 20.19  ? 402  VAL A N   1 
ATOM   3049 C CA  . VAL A 1 405 ? 77.458  59.006 13.078  1.00 20.49  ? 402  VAL A CA  1 
ATOM   3050 C C   . VAL A 1 405 ? 78.138  59.673 14.268  1.00 16.63  ? 402  VAL A C   1 
ATOM   3051 O O   . VAL A 1 405 ? 78.804  59.007 15.070  1.00 18.44  ? 402  VAL A O   1 
ATOM   3052 C CB  . VAL A 1 405 ? 78.258  59.178 11.768  1.00 24.92  ? 402  VAL A CB  1 
ATOM   3053 C CG1 . VAL A 1 405 ? 79.782  58.930 11.983  1.00 21.76  ? 402  VAL A CG1 1 
ATOM   3054 C CG2 . VAL A 1 405 ? 77.697  58.235 10.696  1.00 20.16  ? 402  VAL A CG2 1 
ATOM   3055 N N   . GLY A 1 406 ? 77.909  60.975 14.447  1.00 16.34  ? 403  GLY A N   1 
ATOM   3056 C CA  . GLY A 1 406 ? 78.564  61.701 15.520  1.00 17.37  ? 403  GLY A CA  1 
ATOM   3057 C C   . GLY A 1 406 ? 78.011  61.374 16.895  1.00 23.55  ? 403  GLY A C   1 
ATOM   3058 O O   . GLY A 1 406 ? 78.775  61.249 17.862  1.00 19.66  ? 403  GLY A O   1 
ATOM   3059 N N   . ASP A 1 407 ? 76.675  61.244 17.008  1.00 22.44  ? 404  ASP A N   1 
ATOM   3060 C CA  . ASP A 1 407 ? 76.059  60.920 18.297  1.00 19.73  ? 404  ASP A CA  1 
ATOM   3061 C C   . ASP A 1 407 ? 76.458  59.522 18.729  1.00 18.16  ? 404  ASP A C   1 
ATOM   3062 O O   . ASP A 1 407 ? 76.891  59.306 19.864  1.00 22.33  ? 404  ASP A O   1 
ATOM   3063 C CB  . ASP A 1 407 ? 74.525  61.015 18.215  1.00 24.08  ? 404  ASP A CB  1 
ATOM   3064 C CG  . ASP A 1 407 ? 74.019  62.422 17.878  1.00 29.15  ? 404  ASP A CG  1 
ATOM   3065 O OD1 . ASP A 1 407 ? 74.763  63.424 18.014  1.00 28.96  ? 404  ASP A OD1 1 
ATOM   3066 O OD2 . ASP A 1 407 ? 72.846  62.523 17.475  1.00 34.13  ? 404  ASP A OD2 1 
ATOM   3067 N N   . HIS A 1 408 ? 76.319  58.565 17.814  1.00 17.84  ? 405  HIS A N   1 
ATOM   3068 C CA  . HIS A 1 408 ? 76.621  57.169 18.088  1.00 20.83  ? 405  HIS A CA  1 
ATOM   3069 C C   . HIS A 1 408 ? 78.094  56.975 18.464  1.00 23.38  ? 405  HIS A C   1 
ATOM   3070 O O   . HIS A 1 408 ? 78.418  56.281 19.437  1.00 19.68  ? 405  HIS A O   1 
ATOM   3071 C CB  . HIS A 1 408 ? 76.236  56.360 16.848  1.00 21.02  ? 405  HIS A CB  1 
ATOM   3072 C CG  . HIS A 1 408 ? 76.678  54.934 16.870  1.00 20.87  ? 405  HIS A CG  1 
ATOM   3073 N ND1 . HIS A 1 408 ? 76.326  54.053 17.872  1.00 26.14  ? 405  HIS A ND1 1 
ATOM   3074 C CD2 . HIS A 1 408 ? 77.413  54.224 15.984  1.00 20.61  ? 405  HIS A CD2 1 
ATOM   3075 C CE1 . HIS A 1 408 ? 76.827  52.859 17.599  1.00 22.37  ? 405  HIS A CE1 1 
ATOM   3076 N NE2 . HIS A 1 408 ? 77.478  52.934 16.451  1.00 23.37  ? 405  HIS A NE2 1 
ATOM   3077 N N   . ASN A 1 409 ? 79.004  57.608 17.722  1.00 23.66  ? 406  ASN A N   1 
ATOM   3078 C CA  . ASN A 1 409 ? 80.418  57.319 17.936  1.00 22.89  ? 406  ASN A CA  1 
ATOM   3079 C C   . ASN A 1 409 ? 81.095  58.232 18.946  1.00 17.06  ? 406  ASN A C   1 
ATOM   3080 O O   . ASN A 1 409 ? 82.059  57.804 19.593  1.00 20.32  ? 406  ASN A O   1 
ATOM   3081 C CB  . ASN A 1 409 ? 81.180  57.392 16.617  1.00 19.22  ? 406  ASN A CB  1 
ATOM   3082 C CG  . ASN A 1 409 ? 80.858  56.242 15.713  1.00 19.49  ? 406  ASN A CG  1 
ATOM   3083 O OD1 . ASN A 1 409 ? 81.183  55.082 16.013  1.00 20.33  ? 406  ASN A OD1 1 
ATOM   3084 N ND2 . ASN A 1 409 ? 80.246  56.550 14.571  1.00 18.33  ? 406  ASN A ND2 1 
ATOM   3085 N N   . VAL A 1 410 ? 80.637  59.467 19.107  1.00 18.48  ? 407  VAL A N   1 
ATOM   3086 C CA  . VAL A 1 410 ? 81.374  60.419 19.931  1.00 18.74  ? 407  VAL A CA  1 
ATOM   3087 C C   . VAL A 1 410 ? 80.496  61.055 21.004  1.00 24.43  ? 407  VAL A C   1 
ATOM   3088 O O   . VAL A 1 410 ? 80.816  60.963 22.195  1.00 20.56  ? 407  VAL A O   1 
ATOM   3089 C CB  . VAL A 1 410 ? 82.023  61.528 19.070  1.00 22.78  ? 407  VAL A CB  1 
ATOM   3090 C CG1 . VAL A 1 410 ? 82.803  62.510 19.965  1.00 18.94  ? 407  VAL A CG1 1 
ATOM   3091 C CG2 . VAL A 1 410 ? 82.928  60.929 17.958  1.00 17.44  ? 407  VAL A CG2 1 
ATOM   3092 N N   . VAL A 1 411 ? 79.419  61.751 20.601  1.00 21.08  ? 408  VAL A N   1 
ATOM   3093 C CA  . VAL A 1 411 ? 78.731  62.635 21.550  1.00 20.88  ? 408  VAL A CA  1 
ATOM   3094 C C   . VAL A 1 411 ? 78.096  61.834 22.683  1.00 23.04  ? 408  VAL A C   1 
ATOM   3095 O O   . VAL A 1 411 ? 78.272  62.145 23.868  1.00 26.72  ? 408  VAL A O   1 
ATOM   3096 C CB  . VAL A 1 411 ? 77.682  63.508 20.843  1.00 26.08  ? 408  VAL A CB  1 
ATOM   3097 C CG1 . VAL A 1 411 ? 76.936  64.336 21.885  1.00 29.25  ? 408  VAL A CG1 1 
ATOM   3098 C CG2 . VAL A 1 411 ? 78.326  64.402 19.825  1.00 23.40  ? 408  VAL A CG2 1 
ATOM   3099 N N   . CYS A 1 412 ? 77.374  60.798 22.347  1.00 21.42  ? 409  CYS A N   1 
ATOM   3100 C CA  . CYS A 1 412 ? 76.660  60.077 23.388  1.00 26.76  ? 409  CYS A CA  1 
ATOM   3101 C C   . CYS A 1 412 ? 77.586  59.202 24.239  1.00 28.15  ? 409  CYS A C   1 
ATOM   3102 O O   . CYS A 1 412 ? 77.334  59.075 25.445  1.00 26.83  ? 409  CYS A O   1 
ATOM   3103 C CB  . CYS A 1 412 ? 75.516  59.269 22.758  1.00 22.94  ? 409  CYS A CB  1 
ATOM   3104 S SG  . CYS A 1 412 ? 74.323  60.391 21.936  1.00 30.33  ? 409  CYS A SG  1 
ATOM   3105 N N   . PRO A 1 413 ? 78.656  58.589 23.695  1.00 24.18  ? 410  PRO A N   1 
ATOM   3106 C CA  . PRO A 1 413 ? 79.646  57.970 24.606  1.00 26.35  ? 410  PRO A CA  1 
ATOM   3107 C C   . PRO A 1 413 ? 80.316  58.976 25.540  1.00 21.77  ? 410  PRO A C   1 
ATOM   3108 O O   . PRO A 1 413 ? 80.551  58.670 26.715  1.00 21.05  ? 410  PRO A O   1 
ATOM   3109 C CB  . PRO A 1 413 ? 80.644  57.302 23.640  1.00 27.42  ? 410  PRO A CB  1 
ATOM   3110 C CG  . PRO A 1 413 ? 79.804  56.987 22.405  1.00 24.32  ? 410  PRO A CG  1 
ATOM   3111 C CD  . PRO A 1 413 ? 78.896  58.201 22.288  1.00 25.03  ? 410  PRO A CD  1 
ATOM   3112 N N   . VAL A 1 414 ? 80.590  60.187 25.066  1.00 23.04  ? 411  VAL A N   1 
ATOM   3113 C CA  . VAL A 1 414 ? 81.164  61.209 25.938  1.00 24.28  ? 411  VAL A CA  1 
ATOM   3114 C C   . VAL A 1 414 ? 80.152  61.658 26.999  1.00 27.17  ? 411  VAL A C   1 
ATOM   3115 O O   . VAL A 1 414 ? 80.475  61.729 28.190  1.00 26.55  ? 411  VAL A O   1 
ATOM   3116 C CB  . VAL A 1 414 ? 81.672  62.390 25.097  1.00 25.19  ? 411  VAL A CB  1 
ATOM   3117 C CG1 . VAL A 1 414 ? 81.927  63.608 25.977  1.00 18.91  ? 411  VAL A CG1 1 
ATOM   3118 C CG2 . VAL A 1 414 ? 82.941  61.975 24.308  1.00 22.94  ? 411  VAL A CG2 1 
ATOM   3119 N N   . ALA A 1 415 ? 78.921  62.003 26.588  1.00 26.59  ? 412  ALA A N   1 
ATOM   3120 C CA  . ALA A 1 415 ? 77.920  62.432 27.574  1.00 28.28  ? 412  ALA A CA  1 
ATOM   3121 C C   . ALA A 1 415 ? 77.717  61.360 28.640  1.00 22.48  ? 412  ALA A C   1 
ATOM   3122 O O   . ALA A 1 415 ? 77.670  61.655 29.836  1.00 25.52  ? 412  ALA A O   1 
ATOM   3123 C CB  . ALA A 1 415 ? 76.593  62.768 26.887  1.00 22.79  ? 412  ALA A CB  1 
ATOM   3124 N N   . GLN A 1 416 ? 77.659  60.104 28.215  1.00 24.70  ? 413  GLN A N   1 
ATOM   3125 C CA  . GLN A 1 416 ? 77.538  58.986 29.134  1.00 26.40  ? 413  GLN A CA  1 
ATOM   3126 C C   . GLN A 1 416 ? 78.670  58.975 30.154  1.00 35.09  ? 413  GLN A C   1 
ATOM   3127 O O   . GLN A 1 416 ? 78.430  58.905 31.369  1.00 28.47  ? 413  GLN A O   1 
ATOM   3128 C CB  . GLN A 1 416 ? 77.523  57.694 28.328  1.00 27.47  ? 413  GLN A CB  1 
ATOM   3129 C CG  . GLN A 1 416 ? 77.629  56.446 29.156  1.00 33.52  ? 413  GLN A CG  1 
ATOM   3130 C CD  . GLN A 1 416 ? 76.298  55.879 29.498  1.00 45.13  ? 413  GLN A CD  1 
ATOM   3131 O OE1 . GLN A 1 416 ? 75.661  55.241 28.658  1.00 56.76  ? 413  GLN A OE1 1 
ATOM   3132 N NE2 . GLN A 1 416 ? 75.850  56.102 30.737  1.00 50.06  ? 413  GLN A NE2 1 
ATOM   3133 N N   . LEU A 1 417 ? 79.920  59.010 29.670  1.00 31.57  ? 414  LEU A N   1 
ATOM   3134 C CA  . LEU A 1 417 ? 81.071  59.055 30.567  1.00 28.20  ? 414  LEU A CA  1 
ATOM   3135 C C   . LEU A 1 417 ? 80.999  60.269 31.487  1.00 25.12  ? 414  LEU A C   1 
ATOM   3136 O O   . LEU A 1 417 ? 81.205  60.158 32.700  1.00 24.17  ? 414  LEU A O   1 
ATOM   3137 C CB  . LEU A 1 417 ? 82.372  59.077 29.753  1.00 27.72  ? 414  LEU A CB  1 
ATOM   3138 C CG  . LEU A 1 417 ? 83.721  59.251 30.474  1.00 28.59  ? 414  LEU A CG  1 
ATOM   3139 C CD1 . LEU A 1 417 ? 84.016  58.078 31.382  1.00 22.56  ? 414  LEU A CD1 1 
ATOM   3140 C CD2 . LEU A 1 417 ? 84.860  59.399 29.463  1.00 26.85  ? 414  LEU A CD2 1 
ATOM   3141 N N   . ALA A 1 418 ? 80.684  61.436 30.920  1.00 22.16  ? 415  ALA A N   1 
ATOM   3142 C CA  . ALA A 1 418 ? 80.680  62.672 31.693  1.00 23.07  ? 415  ALA A CA  1 
ATOM   3143 C C   . ALA A 1 418 ? 79.721  62.601 32.880  1.00 30.20  ? 415  ALA A C   1 
ATOM   3144 O O   . ALA A 1 418 ? 80.038  63.096 33.969  1.00 28.11  ? 415  ALA A O   1 
ATOM   3145 C CB  . ALA A 1 418 ? 80.318  63.846 30.788  1.00 18.64  ? 415  ALA A CB  1 
ATOM   3146 N N   . GLY A 1 419 ? 78.535  62.024 32.684  1.00 30.19  ? 416  GLY A N   1 
ATOM   3147 C CA  . GLY A 1 419 ? 77.548  61.983 33.750  1.00 30.85  ? 416  GLY A CA  1 
ATOM   3148 C C   . GLY A 1 419 ? 77.897  60.960 34.809  1.00 31.22  ? 416  GLY A C   1 
ATOM   3149 O O   . GLY A 1 419 ? 77.727  61.208 36.007  1.00 32.40  ? 416  GLY A O   1 
ATOM   3150 N N   . ARG A 1 420 ? 78.382  59.794 34.379  1.00 29.80  ? 417  ARG A N   1 
ATOM   3151 C CA  . ARG A 1 420 ? 78.796  58.786 35.346  1.00 31.86  ? 417  ARG A CA  1 
ATOM   3152 C C   . ARG A 1 420 ? 79.978  59.271 36.183  1.00 39.33  ? 417  ARG A C   1 
ATOM   3153 O O   . ARG A 1 420 ? 80.018  59.045 37.399  1.00 39.06  ? 417  ARG A O   1 
ATOM   3154 C CB  . ARG A 1 420 ? 79.120  57.480 34.628  1.00 30.48  ? 417  ARG A CB  1 
ATOM   3155 C CG  . ARG A 1 420 ? 77.881  56.705 34.200  1.00 41.08  ? 417  ARG A CG  1 
ATOM   3156 C CD  . ARG A 1 420 ? 76.927  56.480 35.388  1.00 44.52  ? 417  ARG A CD  1 
ATOM   3157 N NE  . ARG A 1 420 ? 76.335  55.137 35.401  1.00 42.95  ? 417  ARG A NE  1 
ATOM   3158 C CZ  . ARG A 1 420 ? 76.480  54.251 36.387  1.00 41.09  ? 417  ARG A CZ  1 
ATOM   3159 N NH1 . ARG A 1 420 ? 77.182  54.551 37.466  1.00 42.71  ? 417  ARG A NH1 1 
ATOM   3160 N NH2 . ARG A 1 420 ? 75.908  53.056 36.304  1.00 50.13  ? 417  ARG A NH2 1 
ATOM   3161 N N   . LEU A 1 421 ? 80.940  59.965 35.563  1.00 35.84  ? 418  LEU A N   1 
ATOM   3162 C CA  . LEU A 1 421 ? 82.074  60.494 36.323  1.00 35.14  ? 418  LEU A CA  1 
ATOM   3163 C C   . LEU A 1 421 ? 81.616  61.536 37.338  1.00 36.51  ? 418  LEU A C   1 
ATOM   3164 O O   . LEU A 1 421 ? 82.022  61.500 38.504  1.00 34.44  ? 418  LEU A O   1 
ATOM   3165 C CB  . LEU A 1 421 ? 83.115  61.113 35.386  1.00 37.78  ? 418  LEU A CB  1 
ATOM   3166 C CG  . LEU A 1 421 ? 84.038  60.261 34.513  1.00 34.92  ? 418  LEU A CG  1 
ATOM   3167 C CD1 . LEU A 1 421 ? 84.749  61.148 33.506  1.00 34.13  ? 418  LEU A CD1 1 
ATOM   3168 C CD2 . LEU A 1 421 ? 85.027  59.539 35.350  1.00 33.39  ? 418  LEU A CD2 1 
ATOM   3169 N N   . ALA A 1 422 ? 80.793  62.495 36.896  1.00 32.77  ? 419  ALA A N   1 
ATOM   3170 C CA  . ALA A 1 422 ? 80.359  63.578 37.775  1.00 34.35  ? 419  ALA A CA  1 
ATOM   3171 C C   . ALA A 1 422 ? 79.503  63.050 38.913  1.00 37.87  ? 419  ALA A C   1 
ATOM   3172 O O   . ALA A 1 422 ? 79.664  63.465 40.068  1.00 40.80  ? 419  ALA A O   1 
ATOM   3173 C CB  . ALA A 1 422 ? 79.585  64.632 36.980  1.00 33.65  ? 419  ALA A CB  1 
ATOM   3174 N N   . ALA A 1 423 ? 78.587  62.132 38.607  1.00 37.88  ? 420  ALA A N   1 
ATOM   3175 C CA  . ALA A 1 423 ? 77.741  61.538 39.634  1.00 40.07  ? 420  ALA A CA  1 
ATOM   3176 C C   . ALA A 1 423 ? 78.521  60.644 40.579  1.00 42.27  ? 420  ALA A C   1 
ATOM   3177 O O   . ALA A 1 423 ? 78.008  60.307 41.650  1.00 44.01  ? 420  ALA A O   1 
ATOM   3178 C CB  . ALA A 1 423 ? 76.605  60.734 38.999  1.00 33.09  ? 420  ALA A CB  1 
ATOM   3179 N N   . GLN A 1 424 ? 79.744  60.255 40.225  1.00 41.46  ? 421  GLN A N   1 
ATOM   3180 C CA  . GLN A 1 424 ? 80.492  59.312 41.046  1.00 34.85  ? 421  GLN A CA  1 
ATOM   3181 C C   . GLN A 1 424 ? 81.767  59.908 41.633  1.00 30.93  ? 421  GLN A C   1 
ATOM   3182 O O   . GLN A 1 424 ? 82.675  59.157 42.001  1.00 36.39  ? 421  GLN A O   1 
ATOM   3183 C CB  . GLN A 1 424 ? 80.790  58.046 40.250  1.00 31.34  ? 421  GLN A CB  1 
ATOM   3184 C CG  . GLN A 1 424 ? 79.532  57.261 39.999  1.00 30.11  ? 421  GLN A CG  1 
ATOM   3185 C CD  . GLN A 1 424 ? 79.640  56.271 38.859  1.00 39.26  ? 421  GLN A CD  1 
ATOM   3186 O OE1 . GLN A 1 424 ? 78.695  56.112 38.097  1.00 46.35  ? 421  GLN A OE1 1 
ATOM   3187 N NE2 . GLN A 1 424 ? 80.779  55.588 38.743  1.00 36.54  ? 421  GLN A NE2 1 
ATOM   3188 N N   . GLY A 1 425 ? 81.852  61.234 41.746  1.00 32.29  ? 422  GLY A N   1 
ATOM   3189 C CA  . GLY A 1 425 ? 82.862  61.888 42.564  1.00 33.08  ? 422  GLY A CA  1 
ATOM   3190 C C   . GLY A 1 425 ? 83.776  62.855 41.837  1.00 40.91  ? 422  GLY A C   1 
ATOM   3191 O O   . GLY A 1 425 ? 84.421  63.690 42.493  1.00 31.24  ? 422  GLY A O   1 
ATOM   3192 N N   . ALA A 1 426 ? 83.870  62.775 40.511  1.00 33.21  ? 423  ALA A N   1 
ATOM   3193 C CA  . ALA A 1 426 ? 84.748  63.665 39.767  1.00 30.54  ? 423  ALA A CA  1 
ATOM   3194 C C   . ALA A 1 426 ? 84.124  65.044 39.605  1.00 27.88  ? 423  ALA A C   1 
ATOM   3195 O O   . ALA A 1 426 ? 82.906  65.193 39.500  1.00 35.71  ? 423  ALA A O   1 
ATOM   3196 C CB  . ALA A 1 426 ? 85.061  63.078 38.385  1.00 29.71  ? 423  ALA A CB  1 
ATOM   3197 N N   . ARG A 1 427 ? 84.972  66.060 39.575  1.00 23.95  ? 424  ARG A N   1 
ATOM   3198 C CA  . ARG A 1 427 ? 84.579  67.381 39.115  1.00 27.49  ? 424  ARG A CA  1 
ATOM   3199 C C   . ARG A 1 427 ? 84.792  67.442 37.594  1.00 39.84  ? 424  ARG A C   1 
ATOM   3200 O O   . ARG A 1 427 ? 85.913  67.228 37.114  1.00 34.14  ? 424  ARG A O   1 
ATOM   3201 C CB  . ARG A 1 427 ? 85.399  68.433 39.854  1.00 31.00  ? 424  ARG A CB  1 
ATOM   3202 C CG  . ARG A 1 427 ? 85.575  69.714 39.110  1.00 37.97  ? 424  ARG A CG  1 
ATOM   3203 C CD  . ARG A 1 427 ? 84.288  70.494 39.094  1.00 39.41  ? 424  ARG A CD  1 
ATOM   3204 N NE  . ARG A 1 427 ? 83.785  70.688 40.446  1.00 48.06  ? 424  ARG A NE  1 
ATOM   3205 C CZ  . ARG A 1 427 ? 84.343  71.500 41.338  1.00 55.88  ? 424  ARG A CZ  1 
ATOM   3206 N NH1 . ARG A 1 427 ? 85.433  72.200 41.026  1.00 49.96  ? 424  ARG A NH1 1 
ATOM   3207 N NH2 . ARG A 1 427 ? 83.811  71.604 42.551  1.00 65.50  ? 424  ARG A NH2 1 
ATOM   3208 N N   . VAL A 1 428 ? 83.719  67.711 36.837  1.00 30.74  ? 425  VAL A N   1 
ATOM   3209 C CA  . VAL A 1 428 ? 83.710  67.573 35.382  1.00 27.93  ? 425  VAL A CA  1 
ATOM   3210 C C   . VAL A 1 428 ? 83.319  68.904 34.763  1.00 34.35  ? 425  VAL A C   1 
ATOM   3211 O O   . VAL A 1 428 ? 82.414  69.586 35.262  1.00 32.81  ? 425  VAL A O   1 
ATOM   3212 C CB  . VAL A 1 428 ? 82.735  66.462 34.927  1.00 30.10  ? 425  VAL A CB  1 
ATOM   3213 C CG1 . VAL A 1 428 ? 82.682  66.352 33.386  1.00 27.39  ? 425  VAL A CG1 1 
ATOM   3214 C CG2 . VAL A 1 428 ? 83.095  65.132 35.539  1.00 25.80  ? 425  VAL A CG2 1 
ATOM   3215 N N   . TYR A 1 429 ? 84.012  69.289 33.692  1.00 25.81  ? 426  TYR A N   1 
ATOM   3216 C CA  . TYR A 1 429 ? 83.639  70.444 32.874  1.00 25.54  ? 426  TYR A CA  1 
ATOM   3217 C C   . TYR A 1 429 ? 83.467  70.001 31.430  1.00 30.00  ? 426  TYR A C   1 
ATOM   3218 O O   . TYR A 1 429 ? 84.204  69.134 30.952  1.00 31.40  ? 426  TYR A O   1 
ATOM   3219 C CB  . TYR A 1 429 ? 84.679  71.555 32.929  1.00 28.85  ? 426  TYR A CB  1 
ATOM   3220 C CG  . TYR A 1 429 ? 84.912  72.105 34.297  1.00 31.34  ? 426  TYR A CG  1 
ATOM   3221 C CD1 . TYR A 1 429 ? 85.741  71.446 35.193  1.00 31.37  ? 426  TYR A CD1 1 
ATOM   3222 C CD2 . TYR A 1 429 ? 84.306  73.287 34.701  1.00 35.08  ? 426  TYR A CD2 1 
ATOM   3223 C CE1 . TYR A 1 429 ? 85.960  71.933 36.454  1.00 34.63  ? 426  TYR A CE1 1 
ATOM   3224 C CE2 . TYR A 1 429 ? 84.520  73.791 35.977  1.00 38.36  ? 426  TYR A CE2 1 
ATOM   3225 C CZ  . TYR A 1 429 ? 85.351  73.107 36.842  1.00 35.71  ? 426  TYR A CZ  1 
ATOM   3226 O OH  . TYR A 1 429 ? 85.578  73.586 38.104  1.00 38.11  ? 426  TYR A OH  1 
ATOM   3227 N N   . ALA A 1 430 ? 82.506  70.600 30.729  1.00 27.78  ? 427  ALA A N   1 
ATOM   3228 C CA  . ALA A 1 430 ? 82.136  70.117 29.410  1.00 22.56  ? 427  ALA A CA  1 
ATOM   3229 C C   . ALA A 1 430 ? 81.974  71.295 28.475  1.00 23.32  ? 427  ALA A C   1 
ATOM   3230 O O   . ALA A 1 430 ? 81.593  72.389 28.897  1.00 23.81  ? 427  ALA A O   1 
ATOM   3231 C CB  . ALA A 1 430 ? 80.846  69.290 29.447  1.00 28.77  ? 427  ALA A CB  1 
ATOM   3232 N N   . TYR A 1 431 ? 82.278  71.065 27.197  1.00 21.18  ? 428  TYR A N   1 
ATOM   3233 C CA  . TYR A 1 431 ? 82.186  72.120 26.197  1.00 23.02  ? 428  TYR A CA  1 
ATOM   3234 C C   . TYR A 1 431 ? 81.666  71.538 24.891  1.00 21.32  ? 428  TYR A C   1 
ATOM   3235 O O   . TYR A 1 431 ? 81.731  70.336 24.650  1.00 22.80  ? 428  TYR A O   1 
ATOM   3236 C CB  . TYR A 1 431 ? 83.551  72.803 25.944  1.00 24.67  ? 428  TYR A CB  1 
ATOM   3237 C CG  . TYR A 1 431 ? 84.570  71.857 25.324  1.00 21.71  ? 428  TYR A CG  1 
ATOM   3238 C CD1 . TYR A 1 431 ? 84.578  71.614 23.948  1.00 22.94  ? 428  TYR A CD1 1 
ATOM   3239 C CD2 . TYR A 1 431 ? 85.515  71.199 26.113  1.00 25.16  ? 428  TYR A CD2 1 
ATOM   3240 C CE1 . TYR A 1 431 ? 85.507  70.737 23.370  1.00 26.20  ? 428  TYR A CE1 1 
ATOM   3241 C CE2 . TYR A 1 431 ? 86.454  70.316 25.543  1.00 26.70  ? 428  TYR A CE2 1 
ATOM   3242 C CZ  . TYR A 1 431 ? 86.440  70.098 24.171  1.00 19.41  ? 428  TYR A CZ  1 
ATOM   3243 O OH  . TYR A 1 431 ? 87.310  69.209 23.604  1.00 23.55  ? 428  TYR A OH  1 
ATOM   3244 N N   . VAL A 1 432 ? 81.169  72.415 24.034  1.00 25.97  ? 429  VAL A N   1 
ATOM   3245 C CA  . VAL A 1 432 ? 80.978  72.107 22.624  1.00 27.37  ? 429  VAL A CA  1 
ATOM   3246 C C   . VAL A 1 432 ? 81.718  73.173 21.838  1.00 29.37  ? 429  VAL A C   1 
ATOM   3247 O O   . VAL A 1 432 ? 81.524  74.373 22.076  1.00 24.23  ? 429  VAL A O   1 
ATOM   3248 C CB  . VAL A 1 432 ? 79.488  72.063 22.218  1.00 27.14  ? 429  VAL A CB  1 
ATOM   3249 C CG1 . VAL A 1 432 ? 79.377  71.974 20.722  1.00 28.82  ? 429  VAL A CG1 1 
ATOM   3250 C CG2 . VAL A 1 432 ? 78.810  70.853 22.841  1.00 26.93  ? 429  VAL A CG2 1 
ATOM   3251 N N   . PHE A 1 433 ? 82.582  72.738 20.922  1.00 25.60  ? 430  PHE A N   1 
ATOM   3252 C CA  . PHE A 1 433 ? 83.423  73.658 20.170  1.00 23.86  ? 430  PHE A CA  1 
ATOM   3253 C C   . PHE A 1 433 ? 82.695  74.003 18.874  1.00 24.25  ? 430  PHE A C   1 
ATOM   3254 O O   . PHE A 1 433 ? 82.369  73.116 18.079  1.00 21.98  ? 430  PHE A O   1 
ATOM   3255 C CB  . PHE A 1 433 ? 84.802  73.036 19.917  1.00 21.20  ? 430  PHE A CB  1 
ATOM   3256 C CG  . PHE A 1 433 ? 85.787  73.973 19.275  1.00 22.47  ? 430  PHE A CG  1 
ATOM   3257 C CD1 . PHE A 1 433 ? 85.851  74.096 17.885  1.00 22.70  ? 430  PHE A CD1 1 
ATOM   3258 C CD2 . PHE A 1 433 ? 86.653  74.731 20.053  1.00 22.57  ? 430  PHE A CD2 1 
ATOM   3259 C CE1 . PHE A 1 433 ? 86.759  74.963 17.280  1.00 27.35  ? 430  PHE A CE1 1 
ATOM   3260 C CE2 . PHE A 1 433 ? 87.573  75.591 19.461  1.00 24.38  ? 430  PHE A CE2 1 
ATOM   3261 C CZ  . PHE A 1 433 ? 87.624  75.718 18.074  1.00 22.95  ? 430  PHE A CZ  1 
ATOM   3262 N N   . GLU A 1 434 ? 82.423  75.287 18.671  1.00 26.49  ? 431  GLU A N   1 
ATOM   3263 C CA  . GLU A 1 434 ? 81.491  75.701 17.632  1.00 26.39  ? 431  GLU A CA  1 
ATOM   3264 C C   . GLU A 1 434 ? 82.079  76.691 16.644  1.00 29.75  ? 431  GLU A C   1 
ATOM   3265 O O   . GLU A 1 434 ? 81.329  77.247 15.836  1.00 30.38  ? 431  GLU A O   1 
ATOM   3266 C CB  . GLU A 1 434 ? 80.237  76.320 18.253  1.00 28.78  ? 431  GLU A CB  1 
ATOM   3267 C CG  . GLU A 1 434 ? 79.460  75.416 19.178  1.00 34.88  ? 431  GLU A CG  1 
ATOM   3268 C CD  . GLU A 1 434 ? 78.012  75.877 19.336  1.00 42.92  ? 431  GLU A CD  1 
ATOM   3269 O OE1 . GLU A 1 434 ? 77.106  75.028 19.195  1.00 41.25  ? 431  GLU A OE1 1 
ATOM   3270 O OE2 . GLU A 1 434 ? 77.783  77.089 19.569  1.00 40.90  ? 431  GLU A OE2 1 
ATOM   3271 N N   . HIS A 1 435 ? 83.383  76.953 16.682  1.00 26.68  ? 432  HIS A N   1 
ATOM   3272 C CA  . HIS A 1 435 ? 83.975  77.883 15.730  1.00 26.65  ? 432  HIS A CA  1 
ATOM   3273 C C   . HIS A 1 435 ? 84.593  77.099 14.580  1.00 24.19  ? 432  HIS A C   1 
ATOM   3274 O O   . HIS A 1 435 ? 85.380  76.177 14.809  1.00 26.79  ? 432  HIS A O   1 
ATOM   3275 C CB  . HIS A 1 435 ? 85.032  78.774 16.380  1.00 27.55  ? 432  HIS A CB  1 
ATOM   3276 C CG  . HIS A 1 435 ? 85.789  79.598 15.391  1.00 24.06  ? 432  HIS A CG  1 
ATOM   3277 N ND1 . HIS A 1 435 ? 85.203  80.621 14.678  1.00 28.56  ? 432  HIS A ND1 1 
ATOM   3278 C CD2 . HIS A 1 435 ? 87.072  79.528 14.965  1.00 26.64  ? 432  HIS A CD2 1 
ATOM   3279 C CE1 . HIS A 1 435 ? 86.098  81.159 13.866  1.00 29.30  ? 432  HIS A CE1 1 
ATOM   3280 N NE2 . HIS A 1 435 ? 87.238  80.509 14.016  1.00 29.61  ? 432  HIS A NE2 1 
ATOM   3281 N N   . ARG A 1 436 ? 84.223  77.460 13.353  1.00 25.89  ? 433  ARG A N   1 
ATOM   3282 C CA  . ARG A 1 436 ? 84.809  76.881 12.151  1.00 25.19  ? 433  ARG A CA  1 
ATOM   3283 C C   . ARG A 1 436 ? 85.956  77.770 11.683  1.00 28.25  ? 433  ARG A C   1 
ATOM   3284 O O   . ARG A 1 436 ? 85.734  78.932 11.328  1.00 27.22  ? 433  ARG A O   1 
ATOM   3285 C CB  . ARG A 1 436 ? 83.765  76.739 11.046  1.00 24.48  ? 433  ARG A CB  1 
ATOM   3286 C CG  . ARG A 1 436 ? 84.353  76.388 9.691   1.00 30.33  ? 433  ARG A CG  1 
ATOM   3287 C CD  . ARG A 1 436 ? 83.273  76.290 8.604   1.00 30.11  ? 433  ARG A CD  1 
ATOM   3288 N NE  . ARG A 1 436 ? 83.865  76.151 7.274   1.00 28.71  ? 433  ARG A NE  1 
ATOM   3289 C CZ  . ARG A 1 436 ? 83.978  74.997 6.627   1.00 31.27  ? 433  ARG A CZ  1 
ATOM   3290 N NH1 . ARG A 1 436 ? 83.523  73.874 7.190   1.00 25.35  ? 433  ARG A NH1 1 
ATOM   3291 N NH2 . ARG A 1 436 ? 84.537  74.963 5.417   1.00 28.12  ? 433  ARG A NH2 1 
ATOM   3292 N N   . ALA A 1 437 ? 87.173  77.214 11.672  1.00 25.72  ? 434  ALA A N   1 
ATOM   3293 C CA  . ALA A 1 437 ? 88.360  77.951 11.249  1.00 24.76  ? 434  ALA A CA  1 
ATOM   3294 C C   . ALA A 1 437 ? 88.149  78.677 9.924   1.00 27.51  ? 434  ALA A C   1 
ATOM   3295 O O   . ALA A 1 437 ? 87.596  78.125 8.966   1.00 27.13  ? 434  ALA A O   1 
ATOM   3296 C CB  . ALA A 1 437 ? 89.552  76.997 11.133  1.00 21.19  ? 434  ALA A CB  1 
ATOM   3297 N N   . SER A 1 438 ? 88.612  79.929 9.873   1.00 26.23  ? 435  SER A N   1 
ATOM   3298 C CA  . SER A 1 438 ? 88.551  80.714 8.646   1.00 25.65  ? 435  SER A CA  1 
ATOM   3299 C C   . SER A 1 438 ? 89.323  80.069 7.511   1.00 27.84  ? 435  SER A C   1 
ATOM   3300 O O   . SER A 1 438 ? 89.053  80.369 6.343   1.00 27.52  ? 435  SER A O   1 
ATOM   3301 C CB  . SER A 1 438 ? 89.122  82.108 8.881   1.00 24.96  ? 435  SER A CB  1 
ATOM   3302 O OG  . SER A 1 438 ? 90.512  82.000 9.167   1.00 28.00  ? 435  SER A OG  1 
ATOM   3303 N N   . THR A 1 439 ? 90.283  79.210 7.830   1.00 23.70  ? 436  THR A N   1 
ATOM   3304 C CA  . THR A 1 439 ? 91.171  78.610 6.854   1.00 26.66  ? 436  THR A CA  1 
ATOM   3305 C C   . THR A 1 439 ? 90.787  77.179 6.522   1.00 28.56  ? 436  THR A C   1 
ATOM   3306 O O   . THR A 1 439 ? 91.492  76.535 5.738   1.00 30.97  ? 436  THR A O   1 
ATOM   3307 C CB  . THR A 1 439 ? 92.612  78.643 7.382   1.00 29.62  ? 436  THR A CB  1 
ATOM   3308 O OG1 . THR A 1 439 ? 92.624  78.113 8.715   1.00 25.23  ? 436  THR A OG1 1 
ATOM   3309 C CG2 . THR A 1 439 ? 93.144  80.072 7.404   1.00 26.80  ? 436  THR A CG2 1 
ATOM   3310 N N   . LEU A 1 440 ? 89.693  76.667 7.093   1.00 25.10  ? 437  LEU A N   1 
ATOM   3311 C CA  . LEU A 1 440 ? 89.371  75.248 6.955   1.00 29.97  ? 437  LEU A CA  1 
ATOM   3312 C C   . LEU A 1 440 ? 89.149  74.879 5.488   1.00 29.00  ? 437  LEU A C   1 
ATOM   3313 O O   . LEU A 1 440 ? 88.427  75.565 4.760   1.00 24.74  ? 437  LEU A O   1 
ATOM   3314 C CB  . LEU A 1 440 ? 88.151  74.893 7.810   1.00 27.11  ? 437  LEU A CB  1 
ATOM   3315 C CG  . LEU A 1 440 ? 87.770  73.410 7.978   1.00 32.59  ? 437  LEU A CG  1 
ATOM   3316 C CD1 . LEU A 1 440 ? 88.958  72.492 8.077   1.00 27.38  ? 437  LEU A CD1 1 
ATOM   3317 C CD2 . LEU A 1 440 ? 86.940  73.257 9.218   1.00 34.88  ? 437  LEU A CD2 1 
ATOM   3318 N N   . SER A 1 441 ? 89.805  73.799 5.052   1.00 23.86  ? 438  SER A N   1 
ATOM   3319 C CA  . SER A 1 441 ? 89.802  73.427 3.644   1.00 23.66  ? 438  SER A CA  1 
ATOM   3320 C C   . SER A 1 441 ? 88.695  72.441 3.290   1.00 21.58  ? 438  SER A C   1 
ATOM   3321 O O   . SER A 1 441 ? 88.391  72.277 2.110   1.00 20.25  ? 438  SER A O   1 
ATOM   3322 C CB  . SER A 1 441 ? 91.159  72.825 3.255   1.00 23.56  ? 438  SER A CB  1 
ATOM   3323 O OG  . SER A 1 441 ? 91.374  71.608 3.943   1.00 23.93  ? 438  SER A OG  1 
ATOM   3324 N N   . TRP A 1 442 ? 88.122  71.756 4.275   1.00 24.81  ? 439  TRP A N   1 
ATOM   3325 C CA  . TRP A 1 442 ? 86.960  70.922 4.039   1.00 24.87  ? 439  TRP A CA  1 
ATOM   3326 C C   . TRP A 1 442 ? 85.775  71.787 3.612   1.00 22.91  ? 439  TRP A C   1 
ATOM   3327 O O   . TRP A 1 442 ? 85.735  72.984 3.911   1.00 23.26  ? 439  TRP A O   1 
ATOM   3328 C CB  . TRP A 1 442 ? 86.620  70.142 5.301   1.00 19.11  ? 439  TRP A CB  1 
ATOM   3329 C CG  . TRP A 1 442 ? 87.611  69.089 5.637   1.00 20.84  ? 439  TRP A CG  1 
ATOM   3330 C CD1 . TRP A 1 442 ? 88.599  69.163 6.583   1.00 20.28  ? 439  TRP A CD1 1 
ATOM   3331 C CD2 . TRP A 1 442 ? 87.722  67.782 5.039   1.00 21.78  ? 439  TRP A CD2 1 
ATOM   3332 N NE1 . TRP A 1 442 ? 89.306  67.981 6.621   1.00 20.50  ? 439  TRP A NE1 1 
ATOM   3333 C CE2 . TRP A 1 442 ? 88.785  67.116 5.690   1.00 19.62  ? 439  TRP A CE2 1 
ATOM   3334 C CE3 . TRP A 1 442 ? 87.019  67.108 4.022   1.00 18.60  ? 439  TRP A CE3 1 
ATOM   3335 C CZ2 . TRP A 1 442 ? 89.176  65.812 5.346   1.00 22.46  ? 439  TRP A CZ2 1 
ATOM   3336 C CZ3 . TRP A 1 442 ? 87.399  65.824 3.687   1.00 15.95  ? 439  TRP A CZ3 1 
ATOM   3337 C CH2 . TRP A 1 442 ? 88.473  65.182 4.346   1.00 22.09  ? 439  TRP A CH2 1 
ATOM   3338 N N   . PRO A 1 443 ? 84.789  71.203 2.922   1.00 25.72  ? 440  PRO A N   1 
ATOM   3339 C CA  . PRO A 1 443 ? 83.656  72.008 2.437   1.00 26.88  ? 440  PRO A CA  1 
ATOM   3340 C C   . PRO A 1 443 ? 82.824  72.585 3.575   1.00 24.87  ? 440  PRO A C   1 
ATOM   3341 O O   . PRO A 1 443 ? 82.774  72.056 4.688   1.00 25.05  ? 440  PRO A O   1 
ATOM   3342 C CB  . PRO A 1 443 ? 82.837  71.015 1.601   1.00 22.45  ? 440  PRO A CB  1 
ATOM   3343 C CG  . PRO A 1 443 ? 83.197  69.667 2.153   1.00 21.43  ? 440  PRO A CG  1 
ATOM   3344 C CD  . PRO A 1 443 ? 84.657  69.784 2.538   1.00 22.57  ? 440  PRO A CD  1 
ATOM   3345 N N   . LEU A 1 444 ? 82.150  73.693 3.264   1.00 27.06  ? 441  LEU A N   1 
ATOM   3346 C CA  . LEU A 1 444 ? 81.306  74.369 4.244   1.00 28.11  ? 441  LEU A CA  1 
ATOM   3347 C C   . LEU A 1 444 ? 80.219  73.450 4.804   1.00 29.14  ? 441  LEU A C   1 
ATOM   3348 O O   . LEU A 1 444 ? 79.878  73.556 5.989   1.00 28.86  ? 441  LEU A O   1 
ATOM   3349 C CB  . LEU A 1 444 ? 80.694  75.625 3.613   1.00 26.60  ? 441  LEU A CB  1 
ATOM   3350 C CG  . LEU A 1 444 ? 79.760  76.484 4.465   1.00 35.13  ? 441  LEU A CG  1 
ATOM   3351 C CD1 . LEU A 1 444 ? 80.483  76.964 5.704   1.00 35.11  ? 441  LEU A CD1 1 
ATOM   3352 C CD2 . LEU A 1 444 ? 79.221  77.669 3.653   1.00 36.88  ? 441  LEU A CD2 1 
ATOM   3353 N N   . TRP A 1 445 ? 79.682  72.520 4.005   1.00 23.64  ? 442  TRP A N   1 
ATOM   3354 C CA  . TRP A 1 445 ? 78.616  71.686 4.559   1.00 27.35  ? 442  TRP A CA  1 
ATOM   3355 C C   . TRP A 1 445 ? 79.090  70.815 5.720   1.00 29.52  ? 442  TRP A C   1 
ATOM   3356 O O   . TRP A 1 445 ? 78.258  70.374 6.514   1.00 31.69  ? 442  TRP A O   1 
ATOM   3357 C CB  . TRP A 1 445 ? 77.945  70.811 3.487   1.00 21.65  ? 442  TRP A CB  1 
ATOM   3358 C CG  . TRP A 1 445 ? 78.749  69.667 2.877   1.00 25.21  ? 442  TRP A CG  1 
ATOM   3359 C CD1 . TRP A 1 445 ? 79.309  69.643 1.623   1.00 24.64  ? 442  TRP A CD1 1 
ATOM   3360 C CD2 . TRP A 1 445 ? 79.016  68.372 3.457   1.00 21.22  ? 442  TRP A CD2 1 
ATOM   3361 N NE1 . TRP A 1 445 ? 79.920  68.422 1.398   1.00 22.19  ? 442  TRP A NE1 1 
ATOM   3362 C CE2 . TRP A 1 445 ? 79.761  67.631 2.506   1.00 20.28  ? 442  TRP A CE2 1 
ATOM   3363 C CE3 . TRP A 1 445 ? 78.708  67.774 4.684   1.00 22.41  ? 442  TRP A CE3 1 
ATOM   3364 C CZ2 . TRP A 1 445 ? 80.201  66.329 2.749   1.00 20.35  ? 442  TRP A CZ2 1 
ATOM   3365 C CZ3 . TRP A 1 445 ? 79.143  66.472 4.924   1.00 19.15  ? 442  TRP A CZ3 1 
ATOM   3366 C CH2 . TRP A 1 445 ? 79.884  65.767 3.963   1.00 21.83  ? 442  TRP A CH2 1 
ATOM   3367 N N   . MET A 1 446 ? 80.397  70.571 5.860   1.00 27.01  ? 443  MET A N   1 
ATOM   3368 C CA  . MET A 1 446 ? 80.879  69.761 6.976   1.00 22.40  ? 443  MET A CA  1 
ATOM   3369 C C   . MET A 1 446 ? 80.911  70.511 8.305   1.00 23.16  ? 443  MET A C   1 
ATOM   3370 O O   . MET A 1 446 ? 81.083  69.875 9.352   1.00 24.77  ? 443  MET A O   1 
ATOM   3371 C CB  . MET A 1 446 ? 82.268  69.208 6.661   1.00 23.67  ? 443  MET A CB  1 
ATOM   3372 C CG  . MET A 1 446 ? 82.252  68.008 5.717   1.00 23.98  ? 443  MET A CG  1 
ATOM   3373 S SD  . MET A 1 446 ? 83.906  67.292 5.537   1.00 27.60  ? 443  MET A SD  1 
ATOM   3374 C CE  . MET A 1 446 ? 83.593  65.997 4.376   1.00 28.04  ? 443  MET A CE  1 
ATOM   3375 N N   . GLY A 1 447 ? 80.751  71.831 8.296   1.00 20.59  ? 444  GLY A N   1 
ATOM   3376 C CA  . GLY A 1 447 ? 80.667  72.583 9.530   1.00 25.62  ? 444  GLY A CA  1 
ATOM   3377 C C   . GLY A 1 447 ? 81.966  72.625 10.313  1.00 27.62  ? 444  GLY A C   1 
ATOM   3378 O O   . GLY A 1 447 ? 82.993  73.077 9.797   1.00 25.01  ? 444  GLY A O   1 
ATOM   3379 N N   . VAL A 1 448 ? 81.919  72.192 11.571  1.00 25.54  ? 445  VAL A N   1 
ATOM   3380 C CA  . VAL A 1 448 ? 83.089  72.119 12.442  1.00 21.54  ? 445  VAL A CA  1 
ATOM   3381 C C   . VAL A 1 448 ? 83.444  70.648 12.600  1.00 19.53  ? 445  VAL A C   1 
ATOM   3382 O O   . VAL A 1 448 ? 82.975  69.997 13.544  1.00 19.32  ? 445  VAL A O   1 
ATOM   3383 C CB  . VAL A 1 448 ? 82.825  72.775 13.808  1.00 26.27  ? 445  VAL A CB  1 
ATOM   3384 C CG1 . VAL A 1 448 ? 84.128  72.865 14.613  1.00 23.10  ? 445  VAL A CG1 1 
ATOM   3385 C CG2 . VAL A 1 448 ? 82.193  74.136 13.641  1.00 20.00  ? 445  VAL A CG2 1 
ATOM   3386 N N   . PRO A 1 449 ? 84.254  70.077 11.713  1.00 21.64  ? 446  PRO A N   1 
ATOM   3387 C CA  . PRO A 1 449 ? 84.437  68.621 11.724  1.00 20.29  ? 446  PRO A CA  1 
ATOM   3388 C C   . PRO A 1 449 ? 85.290  68.161 12.898  1.00 17.96  ? 446  PRO A C   1 
ATOM   3389 O O   . PRO A 1 449 ? 85.954  68.948 13.581  1.00 16.34  ? 446  PRO A O   1 
ATOM   3390 C CB  . PRO A 1 449 ? 85.130  68.329 10.383  1.00 19.48  ? 446  PRO A CB  1 
ATOM   3391 C CG  . PRO A 1 449 ? 85.058  69.607 9.596   1.00 20.91  ? 446  PRO A CG  1 
ATOM   3392 C CD  . PRO A 1 449 ? 84.979  70.713 10.604  1.00 22.32  ? 446  PRO A CD  1 
ATOM   3393 N N   . HIS A 1 450 ? 85.211  66.854 13.146  1.00 18.70  ? 447  HIS A N   1 
ATOM   3394 C CA  . HIS A 1 450 ? 86.071  66.107 14.057  1.00 18.97  ? 447  HIS A CA  1 
ATOM   3395 C C   . HIS A 1 450 ? 87.530  66.495 13.859  1.00 24.76  ? 447  HIS A C   1 
ATOM   3396 O O   . HIS A 1 450 ? 88.064  66.381 12.749  1.00 21.06  ? 447  HIS A O   1 
ATOM   3397 C CB  . HIS A 1 450 ? 85.878  64.621 13.756  1.00 18.87  ? 447  HIS A CB  1 
ATOM   3398 C CG  . HIS A 1 450 ? 86.488  63.679 14.748  1.00 22.48  ? 447  HIS A CG  1 
ATOM   3399 N ND1 . HIS A 1 450 ? 86.037  63.560 16.046  1.00 22.48  ? 447  HIS A ND1 1 
ATOM   3400 C CD2 . HIS A 1 450 ? 87.450  62.734 14.601  1.00 23.43  ? 447  HIS A CD2 1 
ATOM   3401 C CE1 . HIS A 1 450 ? 86.711  62.602 16.663  1.00 21.77  ? 447  HIS A CE1 1 
ATOM   3402 N NE2 . HIS A 1 450 ? 87.578  62.086 15.811  1.00 21.30  ? 447  HIS A NE2 1 
ATOM   3403 N N   . GLY A 1 451 ? 88.177  66.971 14.933  1.00 23.31  ? 448  GLY A N   1 
ATOM   3404 C CA  . GLY A 1 451 ? 89.589  67.306 14.917  1.00 20.92  ? 448  GLY A CA  1 
ATOM   3405 C C   . GLY A 1 451 ? 89.925  68.778 14.734  1.00 21.69  ? 448  GLY A C   1 
ATOM   3406 O O   . GLY A 1 451 ? 91.082  69.157 14.933  1.00 24.52  ? 448  GLY A O   1 
ATOM   3407 N N   . TYR A 1 452 ? 88.972  69.626 14.355  1.00 16.41  ? 449  TYR A N   1 
ATOM   3408 C CA  . TYR A 1 452 ? 89.330  70.978 13.963  1.00 15.97  ? 449  TYR A CA  1 
ATOM   3409 C C   . TYR A 1 452 ? 89.199  71.989 15.101  1.00 18.20  ? 449  TYR A C   1 
ATOM   3410 O O   . TYR A 1 452 ? 89.162  73.200 14.855  1.00 19.28  ? 449  TYR A O   1 
ATOM   3411 C CB  . TYR A 1 452 ? 88.553  71.372 12.703  1.00 20.19  ? 449  TYR A CB  1 
ATOM   3412 C CG  . TYR A 1 452 ? 89.170  70.571 11.585  1.00 22.73  ? 449  TYR A CG  1 
ATOM   3413 C CD1 . TYR A 1 452 ? 90.364  71.000 10.989  1.00 21.40  ? 449  TYR A CD1 1 
ATOM   3414 C CD2 . TYR A 1 452 ? 88.664  69.314 11.234  1.00 19.43  ? 449  TYR A CD2 1 
ATOM   3415 C CE1 . TYR A 1 452 ? 90.999  70.241 10.011  1.00 20.67  ? 449  TYR A CE1 1 
ATOM   3416 C CE2 . TYR A 1 452 ? 89.296  68.540 10.252  1.00 20.59  ? 449  TYR A CE2 1 
ATOM   3417 C CZ  . TYR A 1 452 ? 90.466  69.019 9.650   1.00 25.56  ? 449  TYR A CZ  1 
ATOM   3418 O OH  . TYR A 1 452 ? 91.106  68.279 8.695   1.00 23.77  ? 449  TYR A OH  1 
ATOM   3419 N N   . GLU A 1 453 ? 89.205  71.518 16.341  1.00 17.86  ? 450  GLU A N   1 
ATOM   3420 C CA  . GLU A 1 453 ? 89.509  72.386 17.470  1.00 25.17  ? 450  GLU A CA  1 
ATOM   3421 C C   . GLU A 1 453 ? 90.967  72.295 17.887  1.00 23.73  ? 450  GLU A C   1 
ATOM   3422 O O   . GLU A 1 453 ? 91.453  73.191 18.593  1.00 23.08  ? 450  GLU A O   1 
ATOM   3423 C CB  . GLU A 1 453 ? 88.623  72.039 18.679  1.00 15.77  ? 450  GLU A CB  1 
ATOM   3424 C CG  . GLU A 1 453 ? 89.156  70.961 19.579  1.00 15.71  ? 450  GLU A CG  1 
ATOM   3425 C CD  . GLU A 1 453 ? 89.145  69.570 18.957  1.00 23.32  ? 450  GLU A CD  1 
ATOM   3426 O OE1 . GLU A 1 453 ? 88.937  69.449 17.725  1.00 23.78  ? 450  GLU A OE1 1 
ATOM   3427 O OE2 . GLU A 1 453 ? 89.359  68.585 19.714  1.00 20.83  ? 450  GLU A OE2 1 
ATOM   3428 N N   . ILE A 1 454 ? 91.662  71.232 17.468  1.00 20.55  ? 451  ILE A N   1 
ATOM   3429 C CA  . ILE A 1 454 ? 93.025  71.005 17.938  1.00 27.93  ? 451  ILE A CA  1 
ATOM   3430 C C   . ILE A 1 454 ? 93.916  72.196 17.610  1.00 20.72  ? 451  ILE A C   1 
ATOM   3431 O O   . ILE A 1 454 ? 94.666  72.675 18.466  1.00 24.51  ? 451  ILE A O   1 
ATOM   3432 C CB  . ILE A 1 454 ? 93.577  69.698 17.354  1.00 24.63  ? 451  ILE A CB  1 
ATOM   3433 C CG1 . ILE A 1 454 ? 92.792  68.516 17.919  1.00 21.39  ? 451  ILE A CG1 1 
ATOM   3434 C CG2 . ILE A 1 454 ? 95.054  69.564 17.661  1.00 21.75  ? 451  ILE A CG2 1 
ATOM   3435 C CD1 . ILE A 1 454 ? 93.122  67.220 17.219  1.00 21.39  ? 451  ILE A CD1 1 
ATOM   3436 N N   . GLU A 1 455 ? 93.810  72.727 16.393  1.00 20.64  ? 452  GLU A N   1 
ATOM   3437 C CA  . GLU A 1 455 ? 94.670  73.838 15.999  1.00 27.07  ? 452  GLU A CA  1 
ATOM   3438 C C   . GLU A 1 455 ? 94.441  75.084 16.853  1.00 29.18  ? 452  GLU A C   1 
ATOM   3439 O O   . GLU A 1 455 ? 95.336  75.937 16.946  1.00 27.19  ? 452  GLU A O   1 
ATOM   3440 C CB  . GLU A 1 455 ? 94.475  74.164 14.514  1.00 23.13  ? 452  GLU A CB  1 
ATOM   3441 C CG  . GLU A 1 455 ? 93.071  74.611 14.105  1.00 21.82  ? 452  GLU A CG  1 
ATOM   3442 C CD  . GLU A 1 455 ? 92.834  74.428 12.617  1.00 27.12  ? 452  GLU A CD  1 
ATOM   3443 O OE1 . GLU A 1 455 ? 92.817  75.441 11.868  1.00 27.52  ? 452  GLU A OE1 1 
ATOM   3444 O OE2 . GLU A 1 455 ? 92.691  73.257 12.192  1.00 21.51  ? 452  GLU A OE2 1 
ATOM   3445 N N   . PHE A 1 456 ? 93.271  75.214 17.478  1.00 25.60  ? 453  PHE A N   1 
ATOM   3446 C CA  . PHE A 1 456 ? 93.035  76.362 18.346  1.00 23.32  ? 453  PHE A CA  1 
ATOM   3447 C C   . PHE A 1 456 ? 93.575  76.119 19.743  1.00 22.40  ? 453  PHE A C   1 
ATOM   3448 O O   . PHE A 1 456 ? 94.092  77.052 20.366  1.00 25.34  ? 453  PHE A O   1 
ATOM   3449 C CB  . PHE A 1 456 ? 91.542  76.704 18.367  1.00 22.70  ? 453  PHE A CB  1 
ATOM   3450 C CG  . PHE A 1 456 ? 91.080  77.314 17.084  1.00 22.12  ? 453  PHE A CG  1 
ATOM   3451 C CD1 . PHE A 1 456 ? 91.233  78.661 16.865  1.00 22.74  ? 453  PHE A CD1 1 
ATOM   3452 C CD2 . PHE A 1 456 ? 90.582  76.516 16.057  1.00 24.14  ? 453  PHE A CD2 1 
ATOM   3453 C CE1 . PHE A 1 456 ? 90.867  79.220 15.663  1.00 25.53  ? 453  PHE A CE1 1 
ATOM   3454 C CE2 . PHE A 1 456 ? 90.215  77.068 14.846  1.00 25.04  ? 453  PHE A CE2 1 
ATOM   3455 C CZ  . PHE A 1 456 ? 90.349  78.418 14.651  1.00 26.74  ? 453  PHE A CZ  1 
ATOM   3456 N N   . ILE A 1 457 ? 93.518  74.869 20.213  1.00 17.86  ? 454  ILE A N   1 
ATOM   3457 C CA  . ILE A 1 457 ? 94.016  74.531 21.538  1.00 20.33  ? 454  ILE A CA  1 
ATOM   3458 C C   . ILE A 1 457 ? 95.533  74.663 21.592  1.00 28.04  ? 454  ILE A C   1 
ATOM   3459 O O   . ILE A 1 457 ? 96.092  75.063 22.624  1.00 26.43  ? 454  ILE A O   1 
ATOM   3460 C CB  . ILE A 1 457 ? 93.561  73.110 21.930  1.00 22.37  ? 454  ILE A CB  1 
ATOM   3461 C CG1 . ILE A 1 457 ? 92.026  72.993 21.914  1.00 24.85  ? 454  ILE A CG1 1 
ATOM   3462 C CG2 . ILE A 1 457 ? 94.092  72.730 23.289  1.00 19.16  ? 454  ILE A CG2 1 
ATOM   3463 C CD1 . ILE A 1 457 ? 91.325  73.920 22.888  1.00 26.02  ? 454  ILE A CD1 1 
ATOM   3464 N N   . PHE A 1 458 ? 96.226  74.340 20.495  1.00 25.09  ? 455  PHE A N   1 
ATOM   3465 C CA  . PHE A 1 458 ? 97.677  74.471 20.445  1.00 30.79  ? 455  PHE A CA  1 
ATOM   3466 C C   . PHE A 1 458 ? 98.124  75.859 19.995  1.00 25.58  ? 455  PHE A C   1 
ATOM   3467 O O   . PHE A 1 458 ? 99.321  76.089 19.829  1.00 29.49  ? 455  PHE A O   1 
ATOM   3468 C CB  . PHE A 1 458 ? 98.275  73.387 19.536  1.00 21.16  ? 455  PHE A CB  1 
ATOM   3469 C CG  . PHE A 1 458 ? 98.362  72.037 20.180  1.00 25.01  ? 455  PHE A CG  1 
ATOM   3470 C CD1 . PHE A 1 458 ? 97.274  71.171 20.172  1.00 21.65  ? 455  PHE A CD1 1 
ATOM   3471 C CD2 . PHE A 1 458 ? 99.524  71.623 20.790  1.00 21.79  ? 455  PHE A CD2 1 
ATOM   3472 C CE1 . PHE A 1 458 ? 97.348  69.927 20.770  1.00 22.62  ? 455  PHE A CE1 1 
ATOM   3473 C CE2 . PHE A 1 458 ? 99.606  70.378 21.392  1.00 24.53  ? 455  PHE A CE2 1 
ATOM   3474 C CZ  . PHE A 1 458 ? 98.519  69.520 21.376  1.00 26.33  ? 455  PHE A CZ  1 
ATOM   3475 N N   . GLY A 1 459 ? 97.200  76.787 19.787  1.00 26.44  ? 456  GLY A N   1 
ATOM   3476 C CA  . GLY A 1 459 ? 97.611  78.147 19.483  1.00 27.94  ? 456  GLY A CA  1 
ATOM   3477 C C   . GLY A 1 459 ? 98.170  78.371 18.099  1.00 27.48  ? 456  GLY A C   1 
ATOM   3478 O O   . GLY A 1 459 ? 98.756  79.426 17.843  1.00 30.73  ? 456  GLY A O   1 
ATOM   3479 N N   . ILE A 1 460 ? 97.961  77.434 17.180  1.00 30.07  ? 457  ILE A N   1 
ATOM   3480 C CA  . ILE A 1 460 ? 98.455  77.532 15.805  1.00 22.96  ? 457  ILE A CA  1 
ATOM   3481 C C   . ILE A 1 460 ? 98.070  78.854 15.143  1.00 28.12  ? 457  ILE A C   1 
ATOM   3482 O O   . ILE A 1 460 ? 98.846  79.354 14.313  1.00 29.27  ? 457  ILE A O   1 
ATOM   3483 C CB  . ILE A 1 460 ? 97.979  76.329 14.967  1.00 24.74  ? 457  ILE A CB  1 
ATOM   3484 C CG1 . ILE A 1 460 ? 98.381  75.014 15.639  1.00 22.50  ? 457  ILE A CG1 1 
ATOM   3485 C CG2 . ILE A 1 460 ? 98.527  76.386 13.551  1.00 23.54  ? 457  ILE A CG2 1 
ATOM   3486 C CD1 . ILE A 1 460 ? 99.862  74.879 15.879  1.00 23.81  ? 457  ILE A CD1 1 
ATOM   3487 N N   . PRO A 1 461 ? 96.923  79.479 15.457  1.00 27.67  ? 458  PRO A N   1 
ATOM   3488 C CA  . PRO A 1 461 ? 96.662  80.806 14.881  1.00 27.64  ? 458  PRO A CA  1 
ATOM   3489 C C   . PRO A 1 461 ? 97.737  81.846 15.160  1.00 33.44  ? 458  PRO A C   1 
ATOM   3490 O O   . PRO A 1 461 ? 97.807  82.838 14.419  1.00 33.32  ? 458  PRO A O   1 
ATOM   3491 C CB  . PRO A 1 461 ? 95.324  81.199 15.514  1.00 27.06  ? 458  PRO A CB  1 
ATOM   3492 C CG  . PRO A 1 461 ? 94.631  79.910 15.661  1.00 28.17  ? 458  PRO A CG  1 
ATOM   3493 C CD  . PRO A 1 461 ? 95.694  78.936 16.074  1.00 27.88  ? 458  PRO A CD  1 
ATOM   3494 N N   . LEU A 1 462 ? 98.569  81.668 16.192  1.00 32.05  ? 459  LEU A N   1 
ATOM   3495 C CA  . LEU A 1 462 ? 99.612  82.653 16.472  1.00 33.32  ? 459  LEU A CA  1 
ATOM   3496 C C   . LEU A 1 462 ? 100.785 82.556 15.504  1.00 36.89  ? 459  LEU A C   1 
ATOM   3497 O O   . LEU A 1 462 ? 101.567 83.510 15.409  1.00 33.43  ? 459  LEU A O   1 
ATOM   3498 C CB  . LEU A 1 462 ? 100.123 82.496 17.904  1.00 28.81  ? 459  LEU A CB  1 
ATOM   3499 C CG  . LEU A 1 462 ? 99.080  82.637 19.012  1.00 35.16  ? 459  LEU A CG  1 
ATOM   3500 C CD1 . LEU A 1 462 ? 99.712  82.447 20.387  1.00 37.07  ? 459  LEU A CD1 1 
ATOM   3501 C CD2 . LEU A 1 462 ? 98.426  83.986 18.909  1.00 37.29  ? 459  LEU A CD2 1 
ATOM   3502 N N   . ASP A 1 463 ? 100.931 81.419 14.800  1.00 34.31  ? 460  ASP A N   1 
ATOM   3503 C CA  . ASP A 1 463 ? 101.963 81.212 13.785  1.00 33.47  ? 460  ASP A CA  1 
ATOM   3504 C C   . ASP A 1 463 ? 101.877 82.318 12.748  1.00 35.21  ? 460  ASP A C   1 
ATOM   3505 O O   . ASP A 1 463 ? 100.890 82.403 12.005  1.00 35.15  ? 460  ASP A O   1 
ATOM   3506 C CB  . ASP A 1 463 ? 101.818 79.845 13.104  1.00 39.66  ? 460  ASP A CB  1 
ATOM   3507 C CG  . ASP A 1 463 ? 103.049 79.453 12.279  1.00 37.54  ? 460  ASP A CG  1 
ATOM   3508 O OD1 . ASP A 1 463 ? 103.730 80.350 11.733  1.00 38.57  ? 460  ASP A OD1 1 
ATOM   3509 O OD2 . ASP A 1 463 ? 103.328 78.235 12.178  1.00 45.58  ? 460  ASP A OD2 1 
ATOM   3510 N N   . PRO A 1 464 ? 102.887 83.188 12.674  1.00 37.37  ? 461  PRO A N   1 
ATOM   3511 C CA  . PRO A 1 464 ? 102.804 84.318 11.744  1.00 31.86  ? 461  PRO A CA  1 
ATOM   3512 C C   . PRO A 1 464 ? 102.844 83.896 10.293  1.00 36.71  ? 461  PRO A C   1 
ATOM   3513 O O   . PRO A 1 464 ? 102.388 84.657 9.435   1.00 37.83  ? 461  PRO A O   1 
ATOM   3514 C CB  . PRO A 1 464 ? 104.020 85.178 12.118  1.00 39.65  ? 461  PRO A CB  1 
ATOM   3515 C CG  . PRO A 1 464 ? 104.975 84.231 12.770  1.00 41.26  ? 461  PRO A CG  1 
ATOM   3516 C CD  . PRO A 1 464 ? 104.132 83.195 13.464  1.00 40.58  ? 461  PRO A CD  1 
ATOM   3517 N N   . SER A 1 465 ? 103.344 82.702 9.983   1.00 41.13  ? 462  SER A N   1 
ATOM   3518 C CA  . SER A 1 465 ? 103.286 82.256 8.597   1.00 42.18  ? 462  SER A CA  1 
ATOM   3519 C C   . SER A 1 465 ? 101.900 81.760 8.189   1.00 43.76  ? 462  SER A C   1 
ATOM   3520 O O   . SER A 1 465 ? 101.725 81.374 7.032   1.00 44.70  ? 462  SER A O   1 
ATOM   3521 C CB  . SER A 1 465 ? 104.332 81.164 8.339   1.00 37.55  ? 462  SER A CB  1 
ATOM   3522 O OG  . SER A 1 465 ? 103.908 79.907 8.835   1.00 42.90  ? 462  SER A OG  1 
ATOM   3523 N N   . ARG A 1 466 ? 100.912 81.773 9.080   1.00 35.36  ? 463  ARG A N   1 
ATOM   3524 C CA  . ARG A 1 466 ? 99.565  81.335 8.741   1.00 35.42  ? 463  ARG A CA  1 
ATOM   3525 C C   . ARG A 1 466 ? 98.623  82.528 8.629   1.00 37.48  ? 463  ARG A C   1 
ATOM   3526 O O   . ARG A 1 466 ? 98.939  83.638 9.068   1.00 44.42  ? 463  ARG A O   1 
ATOM   3527 C CB  . ARG A 1 466 ? 99.069  80.310 9.764   1.00 34.08  ? 463  ARG A CB  1 
ATOM   3528 C CG  . ARG A 1 466 ? 99.704  78.955 9.472   1.00 33.57  ? 463  ARG A CG  1 
ATOM   3529 C CD  . ARG A 1 466 ? 99.622  77.972 10.588  1.00 35.16  ? 463  ARG A CD  1 
ATOM   3530 N NE  . ARG A 1 466 ? 100.625 76.930 10.388  1.00 49.48  ? 463  ARG A NE  1 
ATOM   3531 C CZ  . ARG A 1 466 ? 100.393 75.759 9.800   1.00 51.34  ? 463  ARG A CZ  1 
ATOM   3532 N NH1 . ARG A 1 466 ? 99.174  75.451 9.373   1.00 43.92  ? 463  ARG A NH1 1 
ATOM   3533 N NH2 . ARG A 1 466 ? 101.386 74.890 9.650   1.00 50.38  ? 463  ARG A NH2 1 
ATOM   3534 N N   . ASN A 1 467 ? 97.468  82.306 7.999   1.00 37.34  ? 464  ASN A N   1 
ATOM   3535 C CA  . ASN A 1 467 ? 96.565  83.393 7.618   1.00 36.92  ? 464  ASN A CA  1 
ATOM   3536 C C   . ASN A 1 467 ? 95.277  83.390 8.443   1.00 32.60  ? 464  ASN A C   1 
ATOM   3537 O O   . ASN A 1 467 ? 94.180  83.551 7.908   1.00 34.12  ? 464  ASN A O   1 
ATOM   3538 C CB  . ASN A 1 467 ? 96.238  83.332 6.121   1.00 41.26  ? 464  ASN A CB  1 
ATOM   3539 C CG  . ASN A 1 467 ? 95.493  84.584 5.620   1.00 51.95  ? 464  ASN A CG  1 
ATOM   3540 O OD1 . ASN A 1 467 ? 95.624  85.663 6.201   1.00 51.70  ? 464  ASN A OD1 1 
ATOM   3541 N ND2 . ASN A 1 467 ? 94.692  84.433 4.557   1.00 48.66  ? 464  ASN A ND2 1 
ATOM   3542 N N   . TYR A 1 468 ? 95.382  83.205 9.756   1.00 36.05  ? 465  TYR A N   1 
ATOM   3543 C CA  . TYR A 1 468 ? 94.204  83.312 10.609  1.00 33.93  ? 465  TYR A CA  1 
ATOM   3544 C C   . TYR A 1 468 ? 93.846  84.776 10.868  1.00 35.04  ? 465  TYR A C   1 
ATOM   3545 O O   . TYR A 1 468 ? 94.684  85.674 10.745  1.00 35.47  ? 465  TYR A O   1 
ATOM   3546 C CB  . TYR A 1 468 ? 94.442  82.626 11.947  1.00 28.69  ? 465  TYR A CB  1 
ATOM   3547 C CG  . TYR A 1 468 ? 94.501  81.116 11.920  1.00 29.76  ? 465  TYR A CG  1 
ATOM   3548 C CD1 . TYR A 1 468 ? 95.704  80.453 11.704  1.00 26.88  ? 465  TYR A CD1 1 
ATOM   3549 C CD2 . TYR A 1 468 ? 93.359  80.350 12.158  1.00 29.14  ? 465  TYR A CD2 1 
ATOM   3550 C CE1 . TYR A 1 468 ? 95.775  79.068 11.717  1.00 28.58  ? 465  TYR A CE1 1 
ATOM   3551 C CE2 . TYR A 1 468 ? 93.412  78.951 12.164  1.00 27.76  ? 465  TYR A CE2 1 
ATOM   3552 C CZ  . TYR A 1 468 ? 94.629  78.318 11.942  1.00 27.36  ? 465  TYR A CZ  1 
ATOM   3553 O OH  . TYR A 1 468 ? 94.704  76.943 11.946  1.00 22.44  ? 465  TYR A OH  1 
ATOM   3554 N N   . THR A 1 469 ? 92.592  85.009 11.272  1.00 30.94  ? 466  THR A N   1 
ATOM   3555 C CA  . THR A 1 469 ? 92.145  86.366 11.569  1.00 32.38  ? 466  THR A CA  1 
ATOM   3556 C C   . THR A 1 469 ? 92.605  86.809 12.959  1.00 33.27  ? 466  THR A C   1 
ATOM   3557 O O   . THR A 1 469 ? 92.996  86.002 13.808  1.00 31.85  ? 466  THR A O   1 
ATOM   3558 C CB  . THR A 1 469 ? 90.615  86.495 11.501  1.00 34.69  ? 466  THR A CB  1 
ATOM   3559 O OG1 . THR A 1 469 ? 90.028  85.875 12.655  1.00 35.08  ? 466  THR A OG1 1 
ATOM   3560 C CG2 . THR A 1 469 ? 90.055  85.849 10.232  1.00 31.07  ? 466  THR A CG2 1 
ATOM   3561 N N   . ALA A 1 470 ? 92.520  88.125 13.184  1.00 36.19  ? 467  ALA A N   1 
ATOM   3562 C CA  . ALA A 1 470 ? 92.874  88.691 14.482  1.00 39.85  ? 467  ALA A CA  1 
ATOM   3563 C C   . ALA A 1 470 ? 92.010  88.111 15.597  1.00 32.02  ? 467  ALA A C   1 
ATOM   3564 O O   . ALA A 1 470 ? 92.517  87.792 16.680  1.00 34.39  ? 467  ALA A O   1 
ATOM   3565 C CB  . ALA A 1 470 ? 92.755  90.218 14.435  1.00 32.26  ? 467  ALA A CB  1 
ATOM   3566 N N   . GLU A 1 471 ? 90.709  87.927 15.342  1.00 34.33  ? 468  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 471 ? 89.833  87.381 16.378  1.00 35.70  ? 468  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 471 ? 90.162  85.932 16.707  1.00 30.81  ? 468  GLU A C   1 
ATOM   3569 O O   . GLU A 1 471 ? 90.022  85.522 17.865  1.00 30.38  ? 468  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 471 ? 88.365  87.480 15.966  1.00 38.70  ? 468  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 471 ? 87.924  88.841 15.512  1.00 45.06  ? 468  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 471 ? 88.059  89.020 14.006  1.00 62.41  ? 468  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 471 ? 87.004  89.183 13.352  1.00 70.81  ? 468  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 471 ? 89.205  89.009 13.480  1.00 52.56  ? 468  GLU A OE2 1 
ATOM   3575 N N   . GLU A 1 472 ? 90.577  85.140 15.707  1.00 34.55  ? 469  GLU A N   1 
ATOM   3576 C CA  . GLU A 1 472 ? 90.962  83.748 15.960  1.00 32.82  ? 469  GLU A CA  1 
ATOM   3577 C C   . GLU A 1 472 ? 92.225  83.649 16.821  1.00 31.00  ? 469  GLU A C   1 
ATOM   3578 O O   . GLU A 1 472 ? 92.394  82.675 17.561  1.00 29.20  ? 469  GLU A O   1 
ATOM   3579 C CB  . GLU A 1 472 ? 91.151  83.008 14.625  1.00 32.83  ? 469  GLU A CB  1 
ATOM   3580 C CG  . GLU A 1 472 ? 89.841  82.846 13.829  1.00 34.24  ? 469  GLU A CG  1 
ATOM   3581 C CD  . GLU A 1 472 ? 90.018  82.157 12.476  1.00 33.29  ? 469  GLU A CD  1 
ATOM   3582 O OE1 . GLU A 1 472 ? 90.835  82.622 11.651  1.00 30.53  ? 469  GLU A OE1 1 
ATOM   3583 O OE2 . GLU A 1 472 ? 89.329  81.140 12.241  1.00 37.25  ? 469  GLU A OE2 1 
ATOM   3584 N N   . LYS A 1 473 ? 93.123  84.637 16.740  1.00 28.02  ? 470  LYS A N   1 
ATOM   3585 C CA  . LYS A 1 473 ? 94.280  84.637 17.632  1.00 35.00  ? 470  LYS A CA  1 
ATOM   3586 C C   . LYS A 1 473 ? 93.851  84.872 19.075  1.00 32.97  ? 470  LYS A C   1 
ATOM   3587 O O   . LYS A 1 473 ? 94.269  84.144 19.987  1.00 37.20  ? 470  LYS A O   1 
ATOM   3588 C CB  . LYS A 1 473 ? 95.290  85.694 17.187  1.00 32.69  ? 470  LYS A CB  1 
ATOM   3589 C CG  . LYS A 1 473 ? 96.095  85.284 15.977  1.00 38.38  ? 470  LYS A CG  1 
ATOM   3590 C CD  . LYS A 1 473 ? 96.737  86.485 15.311  1.00 39.50  ? 470  LYS A CD  1 
ATOM   3591 C CE  . LYS A 1 473 ? 97.602  86.072 14.139  1.00 37.42  ? 470  LYS A CE  1 
ATOM   3592 N NZ  . LYS A 1 473 ? 97.883  87.239 13.250  1.00 46.76  ? 470  LYS A NZ  1 
ATOM   3593 N N   . ILE A 1 474 ? 93.004  85.882 19.297  1.00 34.34  ? 471  ILE A N   1 
ATOM   3594 C CA  . ILE A 1 474 ? 92.458  86.121 20.627  1.00 31.47  ? 471  ILE A CA  1 
ATOM   3595 C C   . ILE A 1 474 ? 91.730  84.882 21.122  1.00 30.77  ? 471  ILE A C   1 
ATOM   3596 O O   . ILE A 1 474 ? 91.921  84.438 22.260  1.00 31.71  ? 471  ILE A O   1 
ATOM   3597 C CB  . ILE A 1 474 ? 91.534  87.351 20.607  1.00 34.38  ? 471  ILE A CB  1 
ATOM   3598 C CG1 . ILE A 1 474 ? 92.337  88.592 20.233  1.00 38.10  ? 471  ILE A CG1 1 
ATOM   3599 C CG2 . ILE A 1 474 ? 90.874  87.544 21.962  1.00 33.90  ? 471  ILE A CG2 1 
ATOM   3600 C CD1 . ILE A 1 474 ? 91.480  89.753 19.807  1.00 40.99  ? 471  ILE A CD1 1 
ATOM   3601 N N   . PHE A 1 475 ? 90.886  84.303 20.264  1.00 34.34  ? 472  PHE A N   1 
ATOM   3602 C CA  . PHE A 1 475 ? 90.146  83.098 20.625  1.00 29.02  ? 472  PHE A CA  1 
ATOM   3603 C C   . PHE A 1 475 ? 91.096  81.980 21.031  1.00 27.92  ? 472  PHE A C   1 
ATOM   3604 O O   . PHE A 1 475 ? 90.916  81.346 22.079  1.00 27.04  ? 472  PHE A O   1 
ATOM   3605 C CB  . PHE A 1 475 ? 89.262  82.683 19.443  1.00 34.51  ? 472  PHE A CB  1 
ATOM   3606 C CG  . PHE A 1 475 ? 88.487  81.404 19.655  1.00 30.65  ? 472  PHE A CG  1 
ATOM   3607 C CD1 . PHE A 1 475 ? 87.762  81.195 20.806  1.00 27.35  ? 472  PHE A CD1 1 
ATOM   3608 C CD2 . PHE A 1 475 ? 88.469  80.428 18.671  1.00 29.32  ? 472  PHE A CD2 1 
ATOM   3609 C CE1 . PHE A 1 475 ? 87.047  80.039 20.986  1.00 29.99  ? 472  PHE A CE1 1 
ATOM   3610 C CE2 . PHE A 1 475 ? 87.760  79.272 18.840  1.00 29.16  ? 472  PHE A CE2 1 
ATOM   3611 C CZ  . PHE A 1 475 ? 87.039  79.075 20.005  1.00 33.85  ? 472  PHE A CZ  1 
ATOM   3612 N N   . ALA A 1 476 ? 92.139  81.745 20.223  1.00 25.65  ? 473  ALA A N   1 
ATOM   3613 C CA  . ALA A 1 476 ? 93.130  80.726 20.571  1.00 26.10  ? 473  ALA A CA  1 
ATOM   3614 C C   . ALA A 1 476 ? 93.742  80.982 21.946  1.00 26.49  ? 473  ALA A C   1 
ATOM   3615 O O   . ALA A 1 476 ? 93.919  80.050 22.742  1.00 27.39  ? 473  ALA A O   1 
ATOM   3616 C CB  . ALA A 1 476 ? 94.226  80.679 19.504  1.00 26.54  ? 473  ALA A CB  1 
ATOM   3617 N N   . GLN A 1 477 ? 94.097  82.236 22.236  1.00 27.02  ? 474  GLN A N   1 
ATOM   3618 C CA  . GLN A 1 477 ? 94.694  82.534 23.535  1.00 30.18  ? 474  GLN A CA  1 
ATOM   3619 C C   . GLN A 1 477 ? 93.710  82.274 24.664  1.00 31.45  ? 474  GLN A C   1 
ATOM   3620 O O   . GLN A 1 477 ? 94.093  81.761 25.723  1.00 29.88  ? 474  GLN A O   1 
ATOM   3621 C CB  . GLN A 1 477 ? 95.184  83.978 23.569  1.00 31.20  ? 474  GLN A CB  1 
ATOM   3622 C CG  . GLN A 1 477 ? 96.389  84.194 22.687  1.00 35.81  ? 474  GLN A CG  1 
ATOM   3623 C CD  . GLN A 1 477 ? 96.723  85.648 22.510  1.00 42.72  ? 474  GLN A CD  1 
ATOM   3624 O OE1 . GLN A 1 477 ? 95.854  86.468 22.199  1.00 39.02  ? 474  GLN A OE1 1 
ATOM   3625 N NE2 . GLN A 1 477 ? 97.992  85.981 22.695  1.00 44.49  ? 474  GLN A NE2 1 
ATOM   3626 N N   . ARG A 1 478 ? 92.435  82.607 24.454  1.00 31.08  ? 475  ARG A N   1 
ATOM   3627 C CA  . ARG A 1 478 ? 91.444  82.315 25.483  1.00 30.70  ? 475  ARG A CA  1 
ATOM   3628 C C   . ARG A 1 478 ? 91.378  80.821 25.754  1.00 30.07  ? 475  ARG A C   1 
ATOM   3629 O O   . ARG A 1 478 ? 91.366  80.397 26.918  1.00 32.04  ? 475  ARG A O   1 
ATOM   3630 C CB  . ARG A 1 478 ? 90.073  82.873 25.080  1.00 34.38  ? 475  ARG A CB  1 
ATOM   3631 C CG  . ARG A 1 478 ? 88.969  82.526 26.071  1.00 38.58  ? 475  ARG A CG  1 
ATOM   3632 C CD  . ARG A 1 478 ? 87.842  83.565 26.112  1.00 43.55  ? 475  ARG A CD  1 
ATOM   3633 N NE  . ARG A 1 478 ? 87.217  83.758 24.807  1.00 31.46  ? 475  ARG A NE  1 
ATOM   3634 C CZ  . ARG A 1 478 ? 86.190  83.041 24.359  1.00 35.55  ? 475  ARG A CZ  1 
ATOM   3635 N NH1 . ARG A 1 478 ? 85.661  82.079 25.116  1.00 31.59  ? 475  ARG A NH1 1 
ATOM   3636 N NH2 . ARG A 1 478 ? 85.700  83.287 23.149  1.00 28.87  ? 475  ARG A NH2 1 
ATOM   3637 N N   . LEU A 1 479 ? 91.402  79.999 24.691  1.00 28.41  ? 476  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 479 ? 91.322  78.547 24.876  1.00 29.10  ? 476  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 479 ? 92.561  77.984 25.572  1.00 24.66  ? 476  LEU A C   1 
ATOM   3640 O O   . LEU A 1 479 ? 92.444  77.080 26.410  1.00 24.77  ? 476  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 479 ? 91.110  77.846 23.526  1.00 28.03  ? 476  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 479 ? 89.831  78.210 22.779  1.00 27.24  ? 476  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 479 ? 89.851  77.642 21.411  1.00 28.07  ? 476  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 479 ? 88.625  77.702 23.549  1.00 29.60  ? 476  LEU A CD2 1 
ATOM   3645 N N   . MET A 1 480 ? 93.762  78.456 25.197  1.00 27.37  ? 477  MET A N   1 
ATOM   3646 C CA  . MET A 1 480 ? 94.980  77.977 25.860  1.00 29.40  ? 477  MET A CA  1 
ATOM   3647 C C   . MET A 1 480 ? 94.955  78.309 27.351  1.00 26.56  ? 477  MET A C   1 
ATOM   3648 O O   . MET A 1 480 ? 95.412  77.515 28.188  1.00 26.13  ? 477  MET A O   1 
ATOM   3649 C CB  . MET A 1 480 ? 96.224  78.585 25.197  1.00 31.00  ? 477  MET A CB  1 
ATOM   3650 C CG  . MET A 1 480 ? 96.459  78.159 23.748  1.00 28.88  ? 477  MET A CG  1 
ATOM   3651 S SD  . MET A 1 480 ? 98.079  78.650 23.102  1.00 30.24  ? 477  MET A SD  1 
ATOM   3652 C CE  . MET A 1 480 ? 97.865  80.406 22.850  1.00 22.97  ? 477  MET A CE  1 
ATOM   3653 N N   . ARG A 1 481 ? 94.404  79.478 27.700  1.00 30.66  ? 478  ARG A N   1 
ATOM   3654 C CA  . ARG A 1 481 ? 94.202  79.823 29.107  1.00 32.82  ? 478  ARG A CA  1 
ATOM   3655 C C   . ARG A 1 481 ? 93.326  78.796 29.817  1.00 33.45  ? 478  ARG A C   1 
ATOM   3656 O O   . ARG A 1 481 ? 93.669  78.322 30.914  1.00 30.00  ? 478  ARG A O   1 
ATOM   3657 C CB  . ARG A 1 481 ? 93.567  81.202 29.217  1.00 33.29  ? 478  ARG A CB  1 
ATOM   3658 C CG  . ARG A 1 481 ? 93.187  81.552 30.640  1.00 43.45  ? 478  ARG A CG  1 
ATOM   3659 C CD  . ARG A 1 481 ? 94.394  82.084 31.382  1.00 44.55  ? 478  ARG A CD  1 
ATOM   3660 N NE  . ARG A 1 481 ? 94.884  83.274 30.700  1.00 49.65  ? 478  ARG A NE  1 
ATOM   3661 C CZ  . ARG A 1 481 ? 96.090  83.792 30.858  1.00 46.31  ? 478  ARG A CZ  1 
ATOM   3662 N NH1 . ARG A 1 481 ? 96.954  83.226 31.693  1.00 49.03  ? 478  ARG A NH1 1 
ATOM   3663 N NH2 . ARG A 1 481 ? 96.428  84.873 30.167  1.00 50.48  ? 478  ARG A NH2 1 
ATOM   3664 N N   . TYR A 1 482 ? 92.171  78.463 29.219  1.00 27.27  ? 479  TYR A N   1 
ATOM   3665 C CA  . TYR A 1 482 ? 91.267  77.498 29.843  1.00 30.13  ? 479  TYR A CA  1 
ATOM   3666 C C   . TYR A 1 482 ? 91.989  76.191 30.098  1.00 25.53  ? 479  TYR A C   1 
ATOM   3667 O O   . TYR A 1 482 ? 91.936  75.638 31.202  1.00 28.81  ? 479  TYR A O   1 
ATOM   3668 C CB  . TYR A 1 482 ? 90.041  77.228 28.958  1.00 28.43  ? 479  TYR A CB  1 
ATOM   3669 C CG  . TYR A 1 482 ? 89.044  78.350 28.768  1.00 32.27  ? 479  TYR A CG  1 
ATOM   3670 C CD1 . TYR A 1 482 ? 88.570  79.103 29.846  1.00 29.73  ? 479  TYR A CD1 1 
ATOM   3671 C CD2 . TYR A 1 482 ? 88.542  78.632 27.502  1.00 29.86  ? 479  TYR A CD2 1 
ATOM   3672 C CE1 . TYR A 1 482 ? 87.647  80.128 29.648  1.00 28.30  ? 479  TYR A CE1 1 
ATOM   3673 C CE2 . TYR A 1 482 ? 87.612  79.636 27.298  1.00 34.88  ? 479  TYR A CE2 1 
ATOM   3674 C CZ  . TYR A 1 482 ? 87.168  80.384 28.374  1.00 35.93  ? 479  TYR A CZ  1 
ATOM   3675 O OH  . TYR A 1 482 ? 86.260  81.393 28.148  1.00 37.43  ? 479  TYR A OH  1 
ATOM   3676 N N   . TRP A 1 483 ? 92.658  75.670 29.070  1.00 24.47  ? 480  TRP A N   1 
ATOM   3677 C CA  . TRP A 1 483 ? 93.316  74.378 29.206  1.00 23.65  ? 480  TRP A CA  1 
ATOM   3678 C C   . TRP A 1 483 ? 94.413  74.431 30.273  1.00 24.08  ? 480  TRP A C   1 
ATOM   3679 O O   . TRP A 1 483 ? 94.530  73.521 31.097  1.00 21.42  ? 480  TRP A O   1 
ATOM   3680 C CB  . TRP A 1 483 ? 93.868  73.943 27.834  1.00 26.33  ? 480  TRP A CB  1 
ATOM   3681 C CG  . TRP A 1 483 ? 92.994  72.893 27.098  1.00 27.17  ? 480  TRP A CG  1 
ATOM   3682 C CD1 . TRP A 1 483 ? 93.340  71.608 26.794  1.00 23.30  ? 480  TRP A CD1 1 
ATOM   3683 C CD2 . TRP A 1 483 ? 91.638  73.061 26.621  1.00 24.78  ? 480  TRP A CD2 1 
ATOM   3684 N NE1 . TRP A 1 483 ? 92.297  70.971 26.146  1.00 26.10  ? 480  TRP A NE1 1 
ATOM   3685 C CE2 . TRP A 1 483 ? 91.246  71.842 26.028  1.00 24.85  ? 480  TRP A CE2 1 
ATOM   3686 C CE3 . TRP A 1 483 ? 90.724  74.125 26.643  1.00 24.51  ? 480  TRP A CE3 1 
ATOM   3687 C CZ2 . TRP A 1 483 ? 89.978  71.654 25.462  1.00 21.92  ? 480  TRP A CZ2 1 
ATOM   3688 C CZ3 . TRP A 1 483 ? 89.461  73.938 26.060  1.00 25.89  ? 480  TRP A CZ3 1 
ATOM   3689 C CH2 . TRP A 1 483 ? 89.104  72.706 25.490  1.00 21.57  ? 480  TRP A CH2 1 
ATOM   3690 N N   . ALA A 1 484 ? 95.225  75.496 30.273  1.00 24.66  ? 481  ALA A N   1 
ATOM   3691 C CA  . ALA A 1 484 ? 96.313  75.594 31.247  1.00 31.33  ? 481  ALA A CA  1 
ATOM   3692 C C   . ALA A 1 484 ? 95.759  75.810 32.660  1.00 29.08  ? 481  ALA A C   1 
ATOM   3693 O O   . ALA A 1 484 ? 96.185  75.145 33.614  1.00 27.11  ? 481  ALA A O   1 
ATOM   3694 C CB  . ALA A 1 484 ? 97.267  76.730 30.849  1.00 25.34  ? 481  ALA A CB  1 
ATOM   3695 N N   . ASN A 1 485 ? 94.787  76.725 32.801  1.00 29.34  ? 482  ASN A N   1 
ATOM   3696 C CA  . ASN A 1 485 ? 94.104  76.900 34.085  1.00 32.73  ? 482  ASN A CA  1 
ATOM   3697 C C   . ASN A 1 485 ? 93.644  75.566 34.628  1.00 32.03  ? 482  ASN A C   1 
ATOM   3698 O O   . ASN A 1 485 ? 93.896  75.237 35.790  1.00 32.65  ? 482  ASN A O   1 
ATOM   3699 C CB  . ASN A 1 485 ? 92.904  77.833 33.946  1.00 31.77  ? 482  ASN A CB  1 
ATOM   3700 C CG  . ASN A 1 485 ? 93.307  79.253 33.884  1.00 34.31  ? 482  ASN A CG  1 
ATOM   3701 O OD1 . ASN A 1 485 ? 94.479  79.556 34.069  1.00 36.45  ? 482  ASN A OD1 1 
ATOM   3702 N ND2 . ASN A 1 485 ? 92.353  80.151 33.621  1.00 37.73  ? 482  ASN A ND2 1 
ATOM   3703 N N   . PHE A 1 486 ? 92.985  74.769 33.777  1.00 31.55  ? 483  PHE A N   1 
ATOM   3704 C CA  . PHE A 1 486 ? 92.546  73.451 34.204  1.00 26.43  ? 483  PHE A CA  1 
ATOM   3705 C C   . PHE A 1 486 ? 93.731  72.566 34.577  1.00 29.88  ? 483  PHE A C   1 
ATOM   3706 O O   . PHE A 1 486 ? 93.633  71.735 35.487  1.00 29.40  ? 483  PHE A O   1 
ATOM   3707 C CB  . PHE A 1 486 ? 91.702  72.793 33.109  1.00 26.51  ? 483  PHE A CB  1 
ATOM   3708 C CG  . PHE A 1 486 ? 91.311  71.400 33.442  1.00 22.51  ? 483  PHE A CG  1 
ATOM   3709 C CD1 . PHE A 1 486 ? 90.254  71.155 34.315  1.00 25.54  ? 483  PHE A CD1 1 
ATOM   3710 C CD2 . PHE A 1 486 ? 92.035  70.327 32.952  1.00 20.80  ? 483  PHE A CD2 1 
ATOM   3711 C CE1 . PHE A 1 486 ? 89.910  69.860 34.668  1.00 25.63  ? 483  PHE A CE1 1 
ATOM   3712 C CE2 . PHE A 1 486 ? 91.693  69.018 33.295  1.00 25.56  ? 483  PHE A CE2 1 
ATOM   3713 C CZ  . PHE A 1 486 ? 90.622  68.785 34.164  1.00 24.09  ? 483  PHE A CZ  1 
ATOM   3714 N N   . ALA A 1 487 ? 94.857  72.701 33.870  1.00 30.67  ? 484  ALA A N   1 
ATOM   3715 C CA  . ALA A 1 487 ? 96.014  71.875 34.213  1.00 32.72  ? 484  ALA A CA  1 
ATOM   3716 C C   . ALA A 1 487 ? 96.615  72.296 35.554  1.00 29.68  ? 484  ALA A C   1 
ATOM   3717 O O   . ALA A 1 487 ? 96.986  71.445 36.372  1.00 30.22  ? 484  ALA A O   1 
ATOM   3718 C CB  . ALA A 1 487 ? 97.066  71.951 33.102  1.00 32.95  ? 484  ALA A CB  1 
ATOM   3719 N N   . ARG A 1 488 ? 96.720  73.605 35.789  1.00 26.37  ? 485  ARG A N   1 
ATOM   3720 C CA  . ARG A 1 488 ? 97.249  74.117 37.052  1.00 35.03  ? 485  ARG A CA  1 
ATOM   3721 C C   . ARG A 1 488 ? 96.310  73.805 38.223  1.00 39.51  ? 485  ARG A C   1 
ATOM   3722 O O   . ARG A 1 488 ? 96.697  73.129 39.183  1.00 34.26  ? 485  ARG A O   1 
ATOM   3723 C CB  . ARG A 1 488 ? 97.494  75.630 36.930  1.00 31.89  ? 485  ARG A CB  1 
ATOM   3724 C CG  . ARG A 1 488 ? 98.684  75.999 36.043  1.00 28.56  ? 485  ARG A CG  1 
ATOM   3725 C CD  . ARG A 1 488 ? 98.909  77.491 35.945  1.00 27.93  ? 485  ARG A CD  1 
ATOM   3726 N NE  . ARG A 1 488 ? 97.884  78.200 35.170  1.00 33.88  ? 485  ARG A NE  1 
ATOM   3727 C CZ  . ARG A 1 488 ? 98.030  78.627 33.916  1.00 36.24  ? 485  ARG A CZ  1 
ATOM   3728 N NH1 . ARG A 1 488 ? 99.170  78.420 33.258  1.00 32.29  ? 485  ARG A NH1 1 
ATOM   3729 N NH2 . ARG A 1 488 ? 97.034  79.269 33.311  1.00 29.79  ? 485  ARG A NH2 1 
ATOM   3730 N N   . THR A 1 489 ? 95.054  74.254 38.136  1.00 35.46  ? 486  THR A N   1 
ATOM   3731 C CA  . THR A 1 489 ? 94.145  74.290 39.278  1.00 40.08  ? 486  THR A CA  1 
ATOM   3732 C C   . THR A 1 489 ? 93.051  73.235 39.249  1.00 40.01  ? 486  THR A C   1 
ATOM   3733 O O   . THR A 1 489 ? 92.429  72.995 40.285  1.00 40.07  ? 486  THR A O   1 
ATOM   3734 C CB  . THR A 1 489 ? 93.474  75.664 39.367  1.00 41.33  ? 486  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 489 ? 92.467  75.761 38.350  1.00 39.83  ? 486  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 489 ? 94.505  76.777 39.160  1.00 34.95  ? 486  THR A CG2 1 
ATOM   3737 N N   . GLY A 1 490 ? 92.799  72.598 38.111  1.00 35.83  ? 487  GLY A N   1 
ATOM   3738 C CA  . GLY A 1 490 ? 91.680  71.693 37.996  1.00 25.66  ? 487  GLY A CA  1 
ATOM   3739 C C   . GLY A 1 490 ? 90.394  72.383 37.622  1.00 29.48  ? 487  GLY A C   1 
ATOM   3740 O O   . GLY A 1 490 ? 89.323  71.776 37.721  1.00 29.77  ? 487  GLY A O   1 
ATOM   3741 N N   . ASP A 1 491 ? 90.475  73.610 37.149  1.00 30.41  ? 488  ASP A N   1 
ATOM   3742 C CA  . ASP A 1 491 ? 89.333  74.481 36.985  1.00 33.19  ? 488  ASP A CA  1 
ATOM   3743 C C   . ASP A 1 491 ? 89.649  75.434 35.843  1.00 36.43  ? 488  ASP A C   1 
ATOM   3744 O O   . ASP A 1 491 ? 90.543  76.281 35.964  1.00 42.10  ? 488  ASP A O   1 
ATOM   3745 C CB  . ASP A 1 491 ? 89.062  75.225 38.300  1.00 38.35  ? 488  ASP A CB  1 
ATOM   3746 C CG  . ASP A 1 491 ? 87.766  76.037 38.285  1.00 40.54  ? 488  ASP A CG  1 
ATOM   3747 O OD1 . ASP A 1 491 ? 87.375  76.575 37.226  1.00 39.36  ? 488  ASP A OD1 1 
ATOM   3748 O OD2 . ASP A 1 491 ? 87.142  76.155 39.365  1.00 48.48  ? 488  ASP A OD2 1 
ATOM   3749 N N   . PRO A 1 492 ? 88.955  75.320 34.712  1.00 36.39  ? 489  PRO A N   1 
ATOM   3750 C CA  . PRO A 1 492 ? 89.266  76.200 33.570  1.00 35.27  ? 489  PRO A CA  1 
ATOM   3751 C C   . PRO A 1 492 ? 89.055  77.664 33.872  1.00 38.83  ? 489  PRO A C   1 
ATOM   3752 O O   . PRO A 1 492 ? 89.556  78.519 33.127  1.00 32.79  ? 489  PRO A O   1 
ATOM   3753 C CB  . PRO A 1 492 ? 88.302  75.716 32.475  1.00 37.02  ? 489  PRO A CB  1 
ATOM   3754 C CG  . PRO A 1 492 ? 87.174  75.031 33.239  1.00 35.16  ? 489  PRO A CG  1 
ATOM   3755 C CD  . PRO A 1 492 ? 87.848  74.391 34.427  1.00 32.48  ? 489  PRO A CD  1 
ATOM   3756 N N   . ASN A 1 493 ? 88.330  77.974 34.944  1.00 42.28  ? 490  ASN A N   1 
ATOM   3757 C CA  . ASN A 1 493 ? 87.953  79.348 35.246  1.00 44.27  ? 490  ASN A CA  1 
ATOM   3758 C C   . ASN A 1 493 ? 89.135  80.131 35.795  1.00 45.54  ? 490  ASN A C   1 
ATOM   3759 O O   . ASN A 1 493 ? 89.940  79.616 36.581  1.00 46.35  ? 490  ASN A O   1 
ATOM   3760 C CB  . ASN A 1 493 ? 86.801  79.365 36.249  1.00 43.88  ? 490  ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 493 ? 85.514  78.887 35.639  1.00 31.97  ? 490  ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 493 ? 84.961  79.554 34.775  1.00 38.56  ? 490  ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 493 ? 85.044  77.728 36.063  1.00 32.48  ? 490  ASN A ND2 1 
ATOM   3764 N N   . GLU A 1 494 ? 89.219  81.390 35.387  1.00 50.11  ? 491  GLU A N   1 
ATOM   3765 C CA  . GLU A 1 494 ? 90.346  82.233 35.753  1.00 69.46  ? 491  GLU A CA  1 
ATOM   3766 C C   . GLU A 1 494 ? 90.409  82.403 37.267  1.00 74.67  ? 491  GLU A C   1 
ATOM   3767 O O   . GLU A 1 494 ? 89.426  82.856 37.876  1.00 78.87  ? 491  GLU A O   1 
ATOM   3768 C CB  . GLU A 1 494 ? 90.242  83.579 35.049  1.00 71.69  ? 491  GLU A CB  1 
ATOM   3769 C CG  . GLU A 1 494 ? 90.936  83.606 33.691  1.00 66.78  ? 491  GLU A CG  1 
ATOM   3770 C CD  . GLU A 1 494 ? 90.348  84.658 32.763  1.00 79.09  ? 491  GLU A CD  1 
ATOM   3771 O OE1 . GLU A 1 494 ? 89.102  84.736 32.667  1.00 82.18  ? 491  GLU A OE1 1 
ATOM   3772 O OE2 . GLU A 1 494 ? 91.125  85.398 32.122  1.00 75.59  ? 491  GLU A OE2 1 
ATOM   3773 N N   . PRO A 1 495 ? 91.540  82.074 37.900  1.00 70.67  ? 492  PRO A N   1 
ATOM   3774 C CA  . PRO A 1 495 ? 91.574  81.902 39.364  1.00 77.05  ? 492  PRO A CA  1 
ATOM   3775 C C   . PRO A 1 495 ? 90.936  83.025 40.167  1.00 89.36  ? 492  PRO A C   1 
ATOM   3776 O O   . PRO A 1 495 ? 90.405  82.765 41.258  1.00 91.54  ? 492  PRO A O   1 
ATOM   3777 C CB  . PRO A 1 495 ? 93.077  81.792 39.646  1.00 73.22  ? 492  PRO A CB  1 
ATOM   3778 C CG  . PRO A 1 495 ? 93.629  81.179 38.400  1.00 67.33  ? 492  PRO A CG  1 
ATOM   3779 C CD  . PRO A 1 495 ? 92.833  81.755 37.270  1.00 64.02  ? 492  PRO A CD  1 
ATOM   3780 N N   . ARG A 1 496 ? 90.959  84.261 39.668  1.00 92.51  ? 493  ARG A N   1 
ATOM   3781 C CA  . ARG A 1 496 ? 90.368  85.373 40.403  1.00 95.93  ? 493  ARG A CA  1 
ATOM   3782 C C   . ARG A 1 496 ? 89.417  86.180 39.527  1.00 96.05  ? 493  ARG A C   1 
ATOM   3783 O O   . ARG A 1 496 ? 88.437  86.735 40.035  1.00 97.96  ? 493  ARG A O   1 
ATOM   3784 C CB  . ARG A 1 496 ? 91.461  86.283 40.977  1.00 94.16  ? 493  ARG A CB  1 
ATOM   3785 C CG  . ARG A 1 496 ? 92.310  85.641 42.068  1.00 94.56  ? 493  ARG A CG  1 
ATOM   3786 C CD  . ARG A 1 496 ? 93.732  86.182 42.039  1.00 101.21 ? 493  ARG A CD  1 
ATOM   3787 N NE  . ARG A 1 496 ? 94.613  85.477 42.967  1.00 105.88 ? 493  ARG A NE  1 
ATOM   3788 C CZ  . ARG A 1 496 ? 94.890  85.895 44.199  1.00 111.89 ? 493  ARG A CZ  1 
ATOM   3789 N NH1 . ARG A 1 496 ? 94.356  87.020 44.655  1.00 109.72 ? 493  ARG A NH1 1 
ATOM   3790 N NH2 . ARG A 1 496 ? 95.703  85.189 44.976  1.00 111.89 ? 493  ARG A NH2 1 
ATOM   3791 N N   . ASP A 1 497 ? 89.690  86.235 38.211  1.00 85.39  ? 494  ASP A N   1 
ATOM   3792 C CA  . ASP A 1 497 ? 88.989  87.116 37.279  1.00 91.21  ? 494  ASP A CA  1 
ATOM   3793 C C   . ASP A 1 497 ? 87.476  86.988 37.423  1.00 96.79  ? 494  ASP A C   1 
ATOM   3794 O O   . ASP A 1 497 ? 86.898  85.958 37.048  1.00 95.58  ? 494  ASP A O   1 
ATOM   3795 C CB  . ASP A 1 497 ? 89.408  86.818 35.835  1.00 85.55  ? 494  ASP A CB  1 
ATOM   3796 C CG  . ASP A 1 497 ? 88.926  87.878 34.844  1.00 90.23  ? 494  ASP A CG  1 
ATOM   3797 O OD1 . ASP A 1 497 ? 88.118  88.751 35.234  1.00 90.42  ? 494  ASP A OD1 1 
ATOM   3798 O OD2 . ASP A 1 497 ? 89.355  87.835 33.667  1.00 83.84  ? 494  ASP A OD2 1 
ATOM   3799 N N   . PRO A 1 498 ? 86.804  88.006 37.972  1.00 100.43 ? 495  PRO A N   1 
ATOM   3800 C CA  . PRO A 1 498 ? 85.339  87.992 38.025  1.00 96.21  ? 495  PRO A CA  1 
ATOM   3801 C C   . PRO A 1 498 ? 84.691  88.607 36.795  1.00 92.21  ? 495  PRO A C   1 
ATOM   3802 O O   . PRO A 1 498 ? 83.478  88.443 36.604  1.00 88.38  ? 495  PRO A O   1 
ATOM   3803 C CB  . PRO A 1 498 ? 85.049  88.830 39.278  1.00 90.75  ? 495  PRO A CB  1 
ATOM   3804 C CG  . PRO A 1 498 ? 86.154  89.859 39.271  1.00 92.27  ? 495  PRO A CG  1 
ATOM   3805 C CD  . PRO A 1 498 ? 87.362  89.220 38.602  1.00 93.81  ? 495  PRO A CD  1 
ATOM   3806 N N   . LYS A 1 499 ? 85.474  89.299 35.961  1.00 90.47  ? 496  LYS A N   1 
ATOM   3807 C CA  . LYS A 1 499 ? 84.934  89.905 34.747  1.00 96.51  ? 496  LYS A CA  1 
ATOM   3808 C C   . LYS A 1 499 ? 84.440  88.844 33.765  1.00 94.27  ? 496  LYS A C   1 
ATOM   3809 O O   . LYS A 1 499 ? 83.282  88.883 33.327  1.00 89.69  ? 496  LYS A O   1 
ATOM   3810 C CB  . LYS A 1 499 ? 85.995  90.788 34.083  1.00 93.13  ? 496  LYS A CB  1 
ATOM   3811 C CG  . LYS A 1 499 ? 86.602  91.855 34.976  1.00 95.16  ? 496  LYS A CG  1 
ATOM   3812 C CD  . LYS A 1 499 ? 87.604  92.692 34.195  1.00 97.34  ? 496  LYS A CD  1 
ATOM   3813 C CE  . LYS A 1 499 ? 88.100  93.875 35.009  1.00 95.44  ? 496  LYS A CE  1 
ATOM   3814 N NZ  . LYS A 1 499 ? 88.898  94.815 34.171  1.00 97.78  ? 496  LYS A NZ  1 
ATOM   3815 N N   . ALA A 1 500 ? 85.313  87.896 33.408  1.00 90.31  ? 497  ALA A N   1 
ATOM   3816 C CA  . ALA A 1 500 ? 85.005  86.920 32.381  1.00 77.90  ? 497  ALA A CA  1 
ATOM   3817 C C   . ALA A 1 500 ? 83.846  86.022 32.822  1.00 73.40  ? 497  ALA A C   1 
ATOM   3818 O O   . ALA A 1 500 ? 83.730  85.674 33.998  1.00 72.88  ? 497  ALA A O   1 
ATOM   3819 C CB  . ALA A 1 500 ? 86.230  86.062 32.072  1.00 70.58  ? 497  ALA A CB  1 
ATOM   3820 N N   . PRO A 1 501 ? 82.967  85.626 31.900  1.00 68.02  ? 498  PRO A N   1 
ATOM   3821 C CA  . PRO A 1 501 ? 81.840  84.752 32.276  1.00 64.43  ? 498  PRO A CA  1 
ATOM   3822 C C   . PRO A 1 501 ? 82.355  83.406 32.771  1.00 56.39  ? 498  PRO A C   1 
ATOM   3823 O O   . PRO A 1 501 ? 83.467  82.983 32.441  1.00 57.19  ? 498  PRO A O   1 
ATOM   3824 C CB  . PRO A 1 501 ? 81.033  84.620 30.969  1.00 60.85  ? 498  PRO A CB  1 
ATOM   3825 C CG  . PRO A 1 501 ? 81.693  85.572 29.978  1.00 61.41  ? 498  PRO A CG  1 
ATOM   3826 C CD  . PRO A 1 501 ? 83.091  85.779 30.421  1.00 59.13  ? 498  PRO A CD  1 
ATOM   3827 N N   . GLN A 1 502 ? 81.555  82.763 33.601  1.00 47.35  ? 499  GLN A N   1 
ATOM   3828 C CA  . GLN A 1 502 ? 82.013  81.588 34.304  1.00 43.52  ? 499  GLN A CA  1 
ATOM   3829 C C   . GLN A 1 502 ? 81.610  80.313 33.580  1.00 45.01  ? 499  GLN A C   1 
ATOM   3830 O O   . GLN A 1 502 ? 80.595  80.251 32.890  1.00 43.34  ? 499  GLN A O   1 
ATOM   3831 C CB  . GLN A 1 502 ? 81.490  81.549 35.749  1.00 45.56  ? 499  GLN A CB  1 
ATOM   3832 C CG  . GLN A 1 502 ? 82.236  82.497 36.698  1.00 55.28  ? 499  GLN A CG  1 
ATOM   3833 C CD  . GLN A 1 502 ? 83.732  82.221 36.810  1.00 50.54  ? 499  GLN A CD  1 
ATOM   3834 O OE1 . GLN A 1 502 ? 84.159  81.292 37.507  1.00 51.77  ? 499  GLN A OE1 1 
ATOM   3835 N NE2 . GLN A 1 502 ? 84.538  83.053 36.153  1.00 46.56  ? 499  GLN A NE2 1 
ATOM   3836 N N   . TRP A 1 503 ? 82.455  79.292 33.739  1.00 42.28  ? 500  TRP A N   1 
ATOM   3837 C CA  . TRP A 1 503 ? 82.240  77.957 33.218  1.00 37.48  ? 500  TRP A CA  1 
ATOM   3838 C C   . TRP A 1 503 ? 81.817  77.070 34.374  1.00 37.72  ? 500  TRP A C   1 
ATOM   3839 O O   . TRP A 1 503 ? 82.654  76.742 35.231  1.00 34.81  ? 500  TRP A O   1 
ATOM   3840 C CB  . TRP A 1 503 ? 83.527  77.441 32.579  1.00 37.59  ? 500  TRP A CB  1 
ATOM   3841 C CG  . TRP A 1 503 ? 83.445  76.138 31.830  1.00 34.83  ? 500  TRP A CG  1 
ATOM   3842 C CD1 . TRP A 1 503 ? 82.520  75.137 31.972  1.00 36.94  ? 500  TRP A CD1 1 
ATOM   3843 C CD2 . TRP A 1 503 ? 84.357  75.699 30.824  1.00 36.98  ? 500  TRP A CD2 1 
ATOM   3844 N NE1 . TRP A 1 503 ? 82.808  74.099 31.104  1.00 32.91  ? 500  TRP A NE1 1 
ATOM   3845 C CE2 . TRP A 1 503 ? 83.927  74.430 30.386  1.00 34.12  ? 500  TRP A CE2 1 
ATOM   3846 C CE3 . TRP A 1 503 ? 85.495  76.267 30.238  1.00 37.15  ? 500  TRP A CE3 1 
ATOM   3847 C CZ2 . TRP A 1 503 ? 84.600  73.720 29.399  1.00 33.68  ? 500  TRP A CZ2 1 
ATOM   3848 C CZ3 . TRP A 1 503 ? 86.160  75.566 29.266  1.00 33.71  ? 500  TRP A CZ3 1 
ATOM   3849 C CH2 . TRP A 1 503 ? 85.714  74.302 28.855  1.00 33.27  ? 500  TRP A CH2 1 
ATOM   3850 N N   . PRO A 1 504 ? 80.560  76.655 34.439  1.00 30.93  ? 501  PRO A N   1 
ATOM   3851 C CA  . PRO A 1 504 ? 80.089  75.873 35.573  1.00 31.59  ? 501  PRO A CA  1 
ATOM   3852 C C   . PRO A 1 504 ? 80.377  74.400 35.370  1.00 32.42  ? 501  PRO A C   1 
ATOM   3853 O O   . PRO A 1 504 ? 80.392  73.919 34.231  1.00 34.00  ? 501  PRO A O   1 
ATOM   3854 C CB  . PRO A 1 504 ? 78.577  76.144 35.571  1.00 33.43  ? 501  PRO A CB  1 
ATOM   3855 C CG  . PRO A 1 504 ? 78.268  76.311 34.110  1.00 30.12  ? 501  PRO A CG  1 
ATOM   3856 C CD  . PRO A 1 504 ? 79.471  76.999 33.505  1.00 35.70  ? 501  PRO A CD  1 
ATOM   3857 N N   . PRO A 1 505 ? 80.608  73.652 36.444  1.00 30.11  ? 502  PRO A N   1 
ATOM   3858 C CA  . PRO A 1 505 ? 80.840  72.212 36.295  1.00 30.41  ? 502  PRO A CA  1 
ATOM   3859 C C   . PRO A 1 505 ? 79.662  71.510 35.636  1.00 34.58  ? 502  PRO A C   1 
ATOM   3860 O O   . PRO A 1 505 ? 78.517  71.954 35.718  1.00 35.25  ? 502  PRO A O   1 
ATOM   3861 C CB  . PRO A 1 505 ? 81.031  71.726 37.733  1.00 25.89  ? 502  PRO A CB  1 
ATOM   3862 C CG  . PRO A 1 505 ? 81.520  72.920 38.464  1.00 32.86  ? 502  PRO A CG  1 
ATOM   3863 C CD  . PRO A 1 505 ? 80.937  74.136 37.792  1.00 29.82  ? 502  PRO A CD  1 
ATOM   3864 N N   . TYR A 1 506 ? 79.971  70.401 34.971  1.00 39.11  ? 503  TYR A N   1 
ATOM   3865 C CA  . TYR A 1 506 ? 78.964  69.511 34.423  1.00 33.06  ? 503  TYR A CA  1 
ATOM   3866 C C   . TYR A 1 506 ? 78.494  68.559 35.512  1.00 37.38  ? 503  TYR A C   1 
ATOM   3867 O O   . TYR A 1 506 ? 79.312  67.966 36.224  1.00 30.70  ? 503  TYR A O   1 
ATOM   3868 C CB  . TYR A 1 506 ? 79.542  68.729 33.244  1.00 31.14  ? 503  TYR A CB  1 
ATOM   3869 C CG  . TYR A 1 506 ? 78.589  67.750 32.579  1.00 26.69  ? 503  TYR A CG  1 
ATOM   3870 C CD1 . TYR A 1 506 ? 78.455  66.452 33.045  1.00 29.10  ? 503  TYR A CD1 1 
ATOM   3871 C CD2 . TYR A 1 506 ? 77.841  68.131 31.475  1.00 26.31  ? 503  TYR A CD2 1 
ATOM   3872 C CE1 . TYR A 1 506 ? 77.586  65.564 32.437  1.00 28.44  ? 503  TYR A CE1 1 
ATOM   3873 C CE2 . TYR A 1 506 ? 76.989  67.253 30.861  1.00 26.69  ? 503  TYR A CE2 1 
ATOM   3874 C CZ  . TYR A 1 506 ? 76.868  65.973 31.337  1.00 27.74  ? 503  TYR A CZ  1 
ATOM   3875 O OH  . TYR A 1 506 ? 76.001  65.109 30.711  1.00 32.84  ? 503  TYR A OH  1 
ATOM   3876 N N   . THR A 1 507 ? 77.172  68.397 35.622  1.00 32.85  ? 504  THR A N   1 
ATOM   3877 C CA  . THR A 1 507 ? 76.551  67.545 36.624  1.00 36.86  ? 504  THR A CA  1 
ATOM   3878 C C   . THR A 1 507 ? 75.551  66.617 35.950  1.00 35.62  ? 504  THR A C   1 
ATOM   3879 O O   . THR A 1 507 ? 74.898  66.993 34.972  1.00 34.23  ? 504  THR A O   1 
ATOM   3880 C CB  . THR A 1 507 ? 75.834  68.381 37.691  1.00 41.20  ? 504  THR A CB  1 
ATOM   3881 O OG1 . THR A 1 507 ? 74.976  69.329 37.036  1.00 36.94  ? 504  THR A OG1 1 
ATOM   3882 C CG2 . THR A 1 507 ? 76.852  69.138 38.553  1.00 37.44  ? 504  THR A CG2 1 
ATOM   3883 N N   . ALA A 1 508 ? 75.438  65.396 36.482  1.00 32.04  ? 505  ALA A N   1 
ATOM   3884 C CA  . ALA A 1 508 ? 74.506  64.431 35.912  1.00 35.99  ? 505  ALA A CA  1 
ATOM   3885 C C   . ALA A 1 508 ? 73.059  64.919 35.977  1.00 40.78  ? 505  ALA A C   1 
ATOM   3886 O O   . ALA A 1 508 ? 72.218  64.441 35.205  1.00 48.39  ? 505  ALA A O   1 
ATOM   3887 C CB  . ALA A 1 508 ? 74.654  63.080 36.617  1.00 34.03  ? 505  ALA A CB  1 
ATOM   3888 N N   . GLY A 1 509 ? 72.752  65.870 36.857  1.00 35.18  ? 506  GLY A N   1 
ATOM   3889 C CA  . GLY A 1 509 ? 71.429  66.452 36.896  1.00 34.65  ? 506  GLY A CA  1 
ATOM   3890 C C   . GLY A 1 509 ? 71.234  67.604 35.934  1.00 34.07  ? 506  GLY A C   1 
ATOM   3891 O O   . GLY A 1 509 ? 70.427  67.513 35.006  1.00 42.78  ? 506  GLY A O   1 
ATOM   3892 N N   . ALA A 1 510 ? 71.972  68.695 36.142  1.00 33.38  ? 507  ALA A N   1 
ATOM   3893 C CA  . ALA A 1 510 ? 71.775  69.900 35.340  1.00 34.64  ? 507  ALA A CA  1 
ATOM   3894 C C   . ALA A 1 510 ? 72.461  69.834 33.968  1.00 36.88  ? 507  ALA A C   1 
ATOM   3895 O O   . ALA A 1 510 ? 72.039  70.546 33.048  1.00 34.09  ? 507  ALA A O   1 
ATOM   3896 C CB  . ALA A 1 510 ? 72.266  71.117 36.124  1.00 31.97  ? 507  ALA A CB  1 
ATOM   3897 N N   . GLN A 1 511 ? 73.520  69.025 33.817  1.00 34.20  ? 508  GLN A N   1 
ATOM   3898 C CA  . GLN A 1 511 ? 74.148  68.748 32.510  1.00 31.59  ? 508  GLN A CA  1 
ATOM   3899 C C   . GLN A 1 511 ? 74.542  70.025 31.781  1.00 32.91  ? 508  GLN A C   1 
ATOM   3900 O O   . GLN A 1 511 ? 74.297  70.177 30.582  1.00 34.92  ? 508  GLN A O   1 
ATOM   3901 C CB  . GLN A 1 511 ? 73.227  67.898 31.630  1.00 30.50  ? 508  GLN A CB  1 
ATOM   3902 C CG  . GLN A 1 511 ? 73.077  66.477 32.130  1.00 34.15  ? 508  GLN A CG  1 
ATOM   3903 C CD  . GLN A 1 511 ? 71.820  65.783 31.607  1.00 43.30  ? 508  GLN A CD  1 
ATOM   3904 O OE1 . GLN A 1 511 ? 71.682  65.530 30.409  1.00 38.16  ? 508  GLN A OE1 1 
ATOM   3905 N NE2 . GLN A 1 511 ? 70.909  65.455 32.514  1.00 44.45  ? 508  GLN A NE2 1 
ATOM   3906 N N   . GLN A 1 512 ? 75.137  70.964 32.517  1.00 27.37  ? 509  GLN A N   1 
ATOM   3907 C CA  . GLN A 1 512 ? 75.513  72.248 31.943  1.00 29.70  ? 509  GLN A CA  1 
ATOM   3908 C C   . GLN A 1 512 ? 76.878  72.175 31.254  1.00 31.31  ? 509  GLN A C   1 
ATOM   3909 O O   . GLN A 1 512 ? 77.805  71.536 31.750  1.00 29.74  ? 509  GLN A O   1 
ATOM   3910 C CB  . GLN A 1 512 ? 75.574  73.321 33.024  1.00 34.81  ? 509  GLN A CB  1 
ATOM   3911 C CG  . GLN A 1 512 ? 74.320  73.582 33.807  1.00 36.82  ? 509  GLN A CG  1 
ATOM   3912 C CD  . GLN A 1 512 ? 74.550  74.676 34.828  1.00 30.52  ? 509  GLN A CD  1 
ATOM   3913 O OE1 . GLN A 1 512 ? 74.389  75.855 34.531  1.00 37.90  ? 509  GLN A OE1 1 
ATOM   3914 N NE2 . GLN A 1 512 ? 74.965  74.290 36.026  1.00 27.03  ? 509  GLN A NE2 1 
ATOM   3915 N N   . TYR A 1 513 ? 77.007  72.877 30.132  1.00 29.47  ? 510  TYR A N   1 
ATOM   3916 C CA  . TYR A 1 513 ? 78.240  72.892 29.358  1.00 31.46  ? 510  TYR A CA  1 
ATOM   3917 C C   . TYR A 1 513 ? 78.329  74.259 28.700  1.00 32.15  ? 510  TYR A C   1 
ATOM   3918 O O   . TYR A 1 513 ? 77.373  75.039 28.732  1.00 35.27  ? 510  TYR A O   1 
ATOM   3919 C CB  . TYR A 1 513 ? 78.270  71.742 28.333  1.00 30.22  ? 510  TYR A CB  1 
ATOM   3920 C CG  . TYR A 1 513 ? 77.245  71.899 27.236  1.00 30.02  ? 510  TYR A CG  1 
ATOM   3921 C CD1 . TYR A 1 513 ? 75.924  71.489 27.421  1.00 31.56  ? 510  TYR A CD1 1 
ATOM   3922 C CD2 . TYR A 1 513 ? 77.591  72.471 26.017  1.00 27.90  ? 510  TYR A CD2 1 
ATOM   3923 C CE1 . TYR A 1 513 ? 74.981  71.634 26.420  1.00 31.00  ? 510  TYR A CE1 1 
ATOM   3924 C CE2 . TYR A 1 513 ? 76.656  72.625 25.006  1.00 29.55  ? 510  TYR A CE2 1 
ATOM   3925 C CZ  . TYR A 1 513 ? 75.350  72.203 25.215  1.00 35.69  ? 510  TYR A CZ  1 
ATOM   3926 O OH  . TYR A 1 513 ? 74.419  72.360 24.218  1.00 31.28  ? 510  TYR A OH  1 
ATOM   3927 N N   . VAL A 1 514 ? 79.492  74.570 28.118  1.00 28.77  ? 511  VAL A N   1 
ATOM   3928 C CA  . VAL A 1 514 ? 79.672  75.870 27.489  1.00 21.66  ? 511  VAL A CA  1 
ATOM   3929 C C   . VAL A 1 514 ? 80.005  75.707 26.013  1.00 27.27  ? 511  VAL A C   1 
ATOM   3930 O O   . VAL A 1 514 ? 80.605  74.718 25.580  1.00 24.07  ? 511  VAL A O   1 
ATOM   3931 C CB  . VAL A 1 514 ? 80.750  76.709 28.213  1.00 37.56  ? 511  VAL A CB  1 
ATOM   3932 C CG1 . VAL A 1 514 ? 80.432  76.767 29.697  1.00 29.84  ? 511  VAL A CG1 1 
ATOM   3933 C CG2 . VAL A 1 514 ? 82.184  76.165 27.949  1.00 27.95  ? 511  VAL A CG2 1 
ATOM   3934 N N   . SER A 1 515 ? 79.579  76.691 25.232  1.00 27.24  ? 512  SER A N   1 
ATOM   3935 C CA  . SER A 1 515 ? 79.964  76.794 23.839  1.00 32.28  ? 512  SER A CA  1 
ATOM   3936 C C   . SER A 1 515 ? 81.266  77.578 23.750  1.00 33.81  ? 512  SER A C   1 
ATOM   3937 O O   . SER A 1 515 ? 81.393  78.661 24.336  1.00 31.44  ? 512  SER A O   1 
ATOM   3938 C CB  . SER A 1 515 ? 78.876  77.478 23.008  1.00 34.51  ? 512  SER A CB  1 
ATOM   3939 O OG  . SER A 1 515 ? 78.563  78.760 23.535  1.00 38.37  ? 512  SER A OG  1 
ATOM   3940 N N   . LEU A 1 516 ? 82.232  77.018 23.027  1.00 35.13  ? 513  LEU A N   1 
ATOM   3941 C CA  . LEU A 1 516 ? 83.494  77.689 22.738  1.00 29.35  ? 513  LEU A CA  1 
ATOM   3942 C C   . LEU A 1 516 ? 83.428  78.193 21.304  1.00 26.41  ? 513  LEU A C   1 
ATOM   3943 O O   . LEU A 1 516 ? 83.446  77.395 20.361  1.00 30.55  ? 513  LEU A O   1 
ATOM   3944 C CB  . LEU A 1 516 ? 84.668  76.734 22.944  1.00 24.55  ? 513  LEU A CB  1 
ATOM   3945 C CG  . LEU A 1 516 ? 84.824  76.169 24.358  1.00 24.81  ? 513  LEU A CG  1 
ATOM   3946 C CD1 . LEU A 1 516 ? 85.937  75.137 24.423  1.00 22.76  ? 513  LEU A CD1 1 
ATOM   3947 C CD2 . LEU A 1 516 ? 85.094  77.292 25.367  1.00 25.35  ? 513  LEU A CD2 1 
ATOM   3948 N N   . ASP A 1 517 ? 83.302  79.503 21.137  1.00 25.11  ? 514  ASP A N   1 
ATOM   3949 C CA  . ASP A 1 517 ? 83.454  80.113 19.818  1.00 28.95  ? 514  ASP A CA  1 
ATOM   3950 C C   . ASP A 1 517 ? 83.936  81.546 20.020  1.00 28.51  ? 514  ASP A C   1 
ATOM   3951 O O   . ASP A 1 517 ? 84.442  81.899 21.089  1.00 31.83  ? 514  ASP A O   1 
ATOM   3952 C CB  . ASP A 1 517 ? 82.157  80.011 18.990  1.00 34.20  ? 514  ASP A CB  1 
ATOM   3953 C CG  . ASP A 1 517 ? 80.934  80.563 19.714  1.00 44.91  ? 514  ASP A CG  1 
ATOM   3954 O OD1 . ASP A 1 517 ? 81.085  81.365 20.664  1.00 44.98  ? 514  ASP A OD1 1 
ATOM   3955 O OD2 . ASP A 1 517 ? 79.806  80.192 19.317  1.00 52.97  ? 514  ASP A OD2 1 
ATOM   3956 N N   . LEU A 1 518 ? 83.804  82.375 18.985  1.00 29.40  ? 515  LEU A N   1 
ATOM   3957 C CA  . LEU A 1 518 ? 84.332  83.730 19.087  1.00 30.92  ? 515  LEU A CA  1 
ATOM   3958 C C   . LEU A 1 518 ? 83.551  84.559 20.095  1.00 40.48  ? 515  LEU A C   1 
ATOM   3959 O O   . LEU A 1 518 ? 84.104  85.502 20.670  1.00 43.24  ? 515  LEU A O   1 
ATOM   3960 C CB  . LEU A 1 518 ? 84.324  84.416 17.725  1.00 29.74  ? 515  LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 518 ? 85.190  83.774 16.644  1.00 31.99  ? 515  LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 518 ? 85.254  84.667 15.433  1.00 32.77  ? 515  LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 518 ? 86.583  83.469 17.192  1.00 33.35  ? 515  LEU A CD2 1 
ATOM   3964 N N   . ARG A 1 519 ? 82.275  84.221 20.319  1.00 40.68  ? 516  ARG A N   1 
ATOM   3965 C CA  . ARG A 1 519 ? 81.447  84.903 21.295  1.00 35.87  ? 516  ARG A CA  1 
ATOM   3966 C C   . ARG A 1 519 ? 81.901  84.542 22.701  1.00 35.90  ? 516  ARG A C   1 
ATOM   3967 O O   . ARG A 1 519 ? 82.524  83.498 22.915  1.00 38.66  ? 516  ARG A O   1 
ATOM   3968 C CB  . ARG A 1 519 ? 79.978  84.514 21.125  1.00 40.47  ? 516  ARG A CB  1 
ATOM   3969 C CG  . ARG A 1 519 ? 79.371  84.836 19.770  1.00 40.97  ? 516  ARG A CG  1 
ATOM   3970 C CD  . ARG A 1 519 ? 77.891  84.423 19.687  1.00 52.88  ? 516  ARG A CD  1 
ATOM   3971 N NE  . ARG A 1 519 ? 77.674  82.983 19.871  1.00 58.15  ? 516  ARG A NE  1 
ATOM   3972 C CZ  . ARG A 1 519 ? 77.117  82.431 20.951  1.00 58.43  ? 516  ARG A CZ  1 
ATOM   3973 N NH1 . ARG A 1 519 ? 76.705  83.195 21.958  1.00 59.74  ? 516  ARG A NH1 1 
ATOM   3974 N NH2 . ARG A 1 519 ? 76.970  81.112 21.028  1.00 57.41  ? 516  ARG A NH2 1 
ATOM   3975 N N   . PRO A 1 520 ? 81.581  85.377 23.688  1.00 40.82  ? 517  PRO A N   1 
ATOM   3976 C CA  . PRO A 1 520 ? 81.842  84.989 25.079  1.00 32.07  ? 517  PRO A CA  1 
ATOM   3977 C C   . PRO A 1 520 ? 81.084  83.720 25.427  1.00 35.69  ? 517  PRO A C   1 
ATOM   3978 O O   . PRO A 1 520 ? 80.079  83.375 24.796  1.00 40.82  ? 517  PRO A O   1 
ATOM   3979 C CB  . PRO A 1 520 ? 81.338  86.187 25.891  1.00 41.32  ? 517  PRO A CB  1 
ATOM   3980 C CG  . PRO A 1 520 ? 81.360  87.351 24.909  1.00 40.07  ? 517  PRO A CG  1 
ATOM   3981 C CD  . PRO A 1 520 ? 81.049  86.747 23.570  1.00 36.87  ? 517  PRO A CD  1 
ATOM   3982 N N   . LEU A 1 521 ? 81.606  83.007 26.432  1.00 30.80  ? 518  LEU A N   1 
ATOM   3983 C CA  . LEU A 1 521 ? 80.998  81.767 26.896  1.00 35.81  ? 518  LEU A CA  1 
ATOM   3984 C C   . LEU A 1 521 ? 79.491  81.914 27.058  1.00 43.79  ? 518  LEU A C   1 
ATOM   3985 O O   . LEU A 1 521 ? 78.998  82.928 27.560  1.00 45.18  ? 518  LEU A O   1 
ATOM   3986 C CB  . LEU A 1 521 ? 81.587  81.336 28.239  1.00 32.16  ? 518  LEU A CB  1 
ATOM   3987 C CG  . LEU A 1 521 ? 82.977  80.733 28.377  1.00 35.13  ? 518  LEU A CG  1 
ATOM   3988 C CD1 . LEU A 1 521 ? 83.106  80.148 29.773  1.00 34.02  ? 518  LEU A CD1 1 
ATOM   3989 C CD2 . LEU A 1 521 ? 83.246  79.668 27.328  1.00 32.25  ? 518  LEU A CD2 1 
ATOM   3990 N N   . GLU A 1 522 ? 78.767  80.879 26.647  1.00 36.69  ? 519  GLU A N   1 
ATOM   3991 C CA  . GLU A 1 522 ? 77.332  80.782 26.856  1.00 42.04  ? 519  GLU A CA  1 
ATOM   3992 C C   . GLU A 1 522 ? 77.064  79.439 27.512  1.00 37.39  ? 519  GLU A C   1 
ATOM   3993 O O   . GLU A 1 522 ? 77.644  78.428 27.102  1.00 37.98  ? 519  GLU A O   1 
ATOM   3994 C CB  . GLU A 1 522 ? 76.591  80.920 25.525  1.00 39.77  ? 519  GLU A CB  1 
ATOM   3995 C CG  . GLU A 1 522 ? 75.114  80.654 25.588  1.00 53.31  ? 519  GLU A CG  1 
ATOM   3996 C CD  . GLU A 1 522 ? 74.483  80.680 24.205  1.00 59.39  ? 519  GLU A CD  1 
ATOM   3997 O OE1 . GLU A 1 522 ? 75.184  81.064 23.239  1.00 57.72  ? 519  GLU A OE1 1 
ATOM   3998 O OE2 . GLU A 1 522 ? 73.293  80.313 24.087  1.00 62.08  ? 519  GLU A OE2 1 
ATOM   3999 N N   . VAL A 1 523 ? 76.233  79.423 28.551  1.00 34.33  ? 520  VAL A N   1 
ATOM   4000 C CA  . VAL A 1 523 ? 75.942  78.180 29.260  1.00 33.17  ? 520  VAL A CA  1 
ATOM   4001 C C   . VAL A 1 523 ? 74.731  77.514 28.627  1.00 35.95  ? 520  VAL A C   1 
ATOM   4002 O O   . VAL A 1 523 ? 73.754  78.179 28.275  1.00 42.07  ? 520  VAL A O   1 
ATOM   4003 C CB  . VAL A 1 523 ? 75.710  78.431 30.758  1.00 30.87  ? 520  VAL A CB  1 
ATOM   4004 C CG1 . VAL A 1 523 ? 75.534  77.094 31.494  1.00 29.81  ? 520  VAL A CG1 1 
ATOM   4005 C CG2 . VAL A 1 523 ? 76.856  79.226 31.336  1.00 28.88  ? 520  VAL A CG2 1 
ATOM   4006 N N   . ARG A 1 524 ? 74.800  76.197 28.462  1.00 34.19  ? 521  ARG A N   1 
ATOM   4007 C CA  . ARG A 1 524 ? 73.709  75.425 27.895  1.00 34.86  ? 521  ARG A CA  1 
ATOM   4008 C C   . ARG A 1 524 ? 73.531  74.178 28.737  1.00 31.92  ? 521  ARG A C   1 
ATOM   4009 O O   . ARG A 1 524 ? 74.370  73.850 29.577  1.00 31.88  ? 521  ARG A O   1 
ATOM   4010 C CB  . ARG A 1 524 ? 73.965  75.064 26.428  1.00 32.49  ? 521  ARG A CB  1 
ATOM   4011 C CG  . ARG A 1 524 ? 74.139  76.274 25.565  1.00 34.86  ? 521  ARG A CG  1 
ATOM   4012 C CD  . ARG A 1 524 ? 74.138  75.940 24.088  1.00 38.46  ? 521  ARG A CD  1 
ATOM   4013 N NE  . ARG A 1 524 ? 74.508  77.129 23.334  1.00 43.27  ? 521  ARG A NE  1 
ATOM   4014 C CZ  . ARG A 1 524 ? 75.180  77.102 22.193  1.00 41.61  ? 521  ARG A CZ  1 
ATOM   4015 N NH1 . ARG A 1 524 ? 75.543  75.940 21.679  1.00 41.03  ? 521  ARG A NH1 1 
ATOM   4016 N NH2 . ARG A 1 524 ? 75.496  78.231 21.580  1.00 45.00  ? 521  ARG A NH2 1 
ATOM   4017 N N   . ARG A 1 525 ? 72.424  73.475 28.512  1.00 34.17  ? 522  ARG A N   1 
ATOM   4018 C CA  . ARG A 1 525 ? 72.084  72.314 29.320  1.00 33.71  ? 522  ARG A CA  1 
ATOM   4019 C C   . ARG A 1 525 ? 71.790  71.139 28.408  1.00 30.84  ? 522  ARG A C   1 
ATOM   4020 O O   . ARG A 1 525 ? 70.996  71.265 27.475  1.00 37.41  ? 522  ARG A O   1 
ATOM   4021 C CB  . ARG A 1 525 ? 70.872  72.595 30.221  1.00 39.16  ? 522  ARG A CB  1 
ATOM   4022 C CG  . ARG A 1 525 ? 71.058  73.727 31.225  1.00 43.12  ? 522  ARG A CG  1 
ATOM   4023 C CD  . ARG A 1 525 ? 69.857  73.804 32.160  1.00 49.69  ? 522  ARG A CD  1 
ATOM   4024 N NE  . ARG A 1 525 ? 69.306  72.468 32.400  1.00 52.14  ? 522  ARG A NE  1 
ATOM   4025 C CZ  . ARG A 1 525 ? 69.266  71.864 33.583  1.00 51.68  ? 522  ARG A CZ  1 
ATOM   4026 N NH1 . ARG A 1 525 ? 69.721  72.496 34.661  1.00 57.31  ? 522  ARG A NH1 1 
ATOM   4027 N NH2 . ARG A 1 525 ? 68.757  70.632 33.687  1.00 50.20  ? 522  ARG A NH2 1 
ATOM   4028 N N   . GLY A 1 526 ? 72.419  69.998 28.683  1.00 31.54  ? 523  GLY A N   1 
ATOM   4029 C CA  . GLY A 1 526 ? 72.100  68.785 27.958  1.00 29.04  ? 523  GLY A CA  1 
ATOM   4030 C C   . GLY A 1 526 ? 72.919  68.588 26.704  1.00 33.11  ? 523  GLY A C   1 
ATOM   4031 O O   . GLY A 1 526 ? 72.770  69.341 25.745  1.00 37.90  ? 523  GLY A O   1 
ATOM   4032 N N   . LEU A 1 527 ? 73.798  67.581 26.718  1.00 37.41  ? 524  LEU A N   1 
ATOM   4033 C CA  . LEU A 1 527 ? 74.608  67.196 25.560  1.00 33.68  ? 524  LEU A CA  1 
ATOM   4034 C C   . LEU A 1 527 ? 73.772  66.271 24.687  1.00 32.45  ? 524  LEU A C   1 
ATOM   4035 O O   . LEU A 1 527 ? 73.837  65.045 24.798  1.00 33.99  ? 524  LEU A O   1 
ATOM   4036 C CB  . LEU A 1 527 ? 75.879  66.484 25.998  1.00 30.37  ? 524  LEU A CB  1 
ATOM   4037 C CG  . LEU A 1 527 ? 77.058  67.265 26.567  1.00 36.25  ? 524  LEU A CG  1 
ATOM   4038 C CD1 . LEU A 1 527 ? 78.083  66.289 27.156  1.00 35.60  ? 524  LEU A CD1 1 
ATOM   4039 C CD2 . LEU A 1 527 ? 77.682  68.118 25.476  1.00 34.95  ? 524  LEU A CD2 1 
ATOM   4040 N N   . ARG A 1 528 ? 72.961  66.868 23.816  1.00 32.78  ? 525  ARG A N   1 
ATOM   4041 C CA  . ARG A 1 528 ? 72.059  66.102 22.952  1.00 31.45  ? 525  ARG A CA  1 
ATOM   4042 C C   . ARG A 1 528 ? 71.269  65.073 23.758  1.00 26.40  ? 525  ARG A C   1 
ATOM   4043 O O   . ARG A 1 528 ? 71.269  63.873 23.462  1.00 29.51  ? 525  ARG A O   1 
ATOM   4044 C CB  . ARG A 1 528 ? 72.836  65.439 21.819  1.00 29.28  ? 525  ARG A CB  1 
ATOM   4045 C CG  . ARG A 1 528 ? 73.605  66.446 20.998  1.00 30.95  ? 525  ARG A CG  1 
ATOM   4046 C CD  . ARG A 1 528 ? 73.740  65.991 19.567  1.00 33.73  ? 525  ARG A CD  1 
ATOM   4047 N NE  . ARG A 1 528 ? 74.499  66.963 18.788  1.00 41.32  ? 525  ARG A NE  1 
ATOM   4048 C CZ  . ARG A 1 528 ? 74.695  66.888 17.473  1.00 44.34  ? 525  ARG A CZ  1 
ATOM   4049 N NH1 . ARG A 1 528 ? 74.190  65.870 16.774  1.00 37.70  ? 525  ARG A NH1 1 
ATOM   4050 N NH2 . ARG A 1 528 ? 75.396  67.839 16.855  1.00 38.55  ? 525  ARG A NH2 1 
ATOM   4051 N N   . ALA A 1 529 ? 70.601  65.563 24.804  1.00 28.77  ? 526  ALA A N   1 
ATOM   4052 C CA  . ALA A 1 529 ? 70.030  64.682 25.821  1.00 32.42  ? 526  ALA A CA  1 
ATOM   4053 C C   . ALA A 1 529 ? 69.033  63.693 25.230  1.00 29.04  ? 526  ALA A C   1 
ATOM   4054 O O   . ALA A 1 529 ? 69.031  62.513 25.599  1.00 32.13  ? 526  ALA A O   1 
ATOM   4055 C CB  . ALA A 1 529 ? 69.368  65.519 26.922  1.00 34.03  ? 526  ALA A CB  1 
ATOM   4056 N N   . GLN A 1 530 ? 68.169  64.152 24.321  1.00 29.55  ? 527  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 530 ? 67.153  63.264 23.763  1.00 27.87  ? 527  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 530 ? 67.789  62.220 22.860  1.00 33.11  ? 527  GLN A C   1 
ATOM   4059 O O   . GLN A 1 530 ? 67.452  61.030 22.933  1.00 34.18  ? 527  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 530 ? 66.094  64.068 22.992  1.00 30.52  ? 527  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 530 ? 65.266  65.063 23.824  1.00 39.61  ? 527  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 530 ? 64.608  64.429 25.056  1.00 43.30  ? 527  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 530 ? 64.930  64.786 26.197  1.00 40.29  ? 527  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 530 ? 63.681  63.492 24.826  1.00 33.22  ? 527  GLN A NE2 1 
ATOM   4065 N N   . ALA A 1 531 ? 68.690  62.645 21.972  1.00 30.23  ? 528  ALA A N   1 
ATOM   4066 C CA  . ALA A 1 531 ? 69.333  61.666 21.100  1.00 29.03  ? 528  ALA A CA  1 
ATOM   4067 C C   . ALA A 1 531 ? 70.158  60.674 21.917  1.00 27.23  ? 528  ALA A C   1 
ATOM   4068 O O   . ALA A 1 531 ? 70.141  59.460 21.651  1.00 30.20  ? 528  ALA A O   1 
ATOM   4069 C CB  . ALA A 1 531 ? 70.193  62.376 20.048  1.00 31.14  ? 528  ALA A CB  1 
ATOM   4070 N N   . CYS A 1 532 ? 70.844  61.159 22.953  1.00 21.09  ? 529  CYS A N   1 
ATOM   4071 C CA  . CYS A 1 532 ? 71.718  60.265 23.690  1.00 25.57  ? 529  CYS A CA  1 
ATOM   4072 C C   . CYS A 1 532 ? 70.926  59.313 24.570  1.00 28.48  ? 529  CYS A C   1 
ATOM   4073 O O   . CYS A 1 532 ? 71.384  58.199 24.839  1.00 28.48  ? 529  CYS A O   1 
ATOM   4074 C CB  . CYS A 1 532 ? 72.738  61.092 24.473  1.00 32.81  ? 529  CYS A CB  1 
ATOM   4075 S SG  . CYS A 1 532 ? 73.947  61.852 23.315  1.00 33.70  ? 529  CYS A SG  1 
ATOM   4076 N N   . ALA A 1 533 ? 69.720  59.705 24.989  1.00 27.08  ? 530  ALA A N   1 
ATOM   4077 C CA  . ALA A 1 533 ? 68.832  58.751 25.652  1.00 30.82  ? 530  ALA A CA  1 
ATOM   4078 C C   . ALA A 1 533 ? 68.456  57.609 24.716  1.00 25.75  ? 530  ALA A C   1 
ATOM   4079 O O   . ALA A 1 533 ? 68.335  56.454 25.141  1.00 26.84  ? 530  ALA A O   1 
ATOM   4080 C CB  . ALA A 1 533 ? 67.573  59.466 26.162  1.00 30.56  ? 530  ALA A CB  1 
ATOM   4081 N N   . PHE A 1 534 ? 68.271  57.907 23.429  1.00 23.10  ? 531  PHE A N   1 
ATOM   4082 C CA  . PHE A 1 534 ? 68.013  56.836 22.477  1.00 23.08  ? 531  PHE A CA  1 
ATOM   4083 C C   . PHE A 1 534 ? 69.208  55.892 22.377  1.00 29.59  ? 531  PHE A C   1 
ATOM   4084 O O   . PHE A 1 534 ? 69.050  54.664 22.425  1.00 29.37  ? 531  PHE A O   1 
ATOM   4085 C CB  . PHE A 1 534 ? 67.672  57.414 21.108  1.00 26.61  ? 531  PHE A CB  1 
ATOM   4086 C CG  . PHE A 1 534 ? 67.731  56.395 20.005  1.00 32.86  ? 531  PHE A CG  1 
ATOM   4087 C CD1 . PHE A 1 534 ? 66.668  55.527 19.790  1.00 32.03  ? 531  PHE A CD1 1 
ATOM   4088 C CD2 . PHE A 1 534 ? 68.854  56.296 19.186  1.00 30.20  ? 531  PHE A CD2 1 
ATOM   4089 C CE1 . PHE A 1 534 ? 66.714  54.581 18.780  1.00 35.18  ? 531  PHE A CE1 1 
ATOM   4090 C CE2 . PHE A 1 534 ? 68.915  55.348 18.173  1.00 30.65  ? 531  PHE A CE2 1 
ATOM   4091 C CZ  . PHE A 1 534 ? 67.838  54.487 17.966  1.00 36.61  ? 531  PHE A CZ  1 
ATOM   4092 N N   . TRP A 1 535 ? 70.422  56.448 22.240  1.00 23.52  ? 532  TRP A N   1 
ATOM   4093 C CA  . TRP A 1 535 ? 71.595  55.582 22.069  1.00 28.45  ? 532  TRP A CA  1 
ATOM   4094 C C   . TRP A 1 535 ? 71.951  54.869 23.364  1.00 24.44  ? 532  TRP A C   1 
ATOM   4095 O O   . TRP A 1 535 ? 72.245  53.667 23.354  1.00 26.35  ? 532  TRP A O   1 
ATOM   4096 C CB  . TRP A 1 535 ? 72.804  56.380 21.561  1.00 21.05  ? 532  TRP A CB  1 
ATOM   4097 C CG  . TRP A 1 535 ? 72.665  56.826 20.150  1.00 18.44  ? 532  TRP A CG  1 
ATOM   4098 C CD1 . TRP A 1 535 ? 72.401  58.084 19.718  1.00 19.88  ? 532  TRP A CD1 1 
ATOM   4099 C CD2 . TRP A 1 535 ? 72.733  56.000 18.972  1.00 17.68  ? 532  TRP A CD2 1 
ATOM   4100 N NE1 . TRP A 1 535 ? 72.308  58.100 18.343  1.00 21.82  ? 532  TRP A NE1 1 
ATOM   4101 C CE2 . TRP A 1 535 ? 72.517  56.833 17.865  1.00 17.67  ? 532  TRP A CE2 1 
ATOM   4102 C CE3 . TRP A 1 535 ? 72.963  54.643 18.753  1.00 17.04  ? 532  TRP A CE3 1 
ATOM   4103 C CZ2 . TRP A 1 535 ? 72.526  56.354 16.556  1.00 18.97  ? 532  TRP A CZ2 1 
ATOM   4104 C CZ3 . TRP A 1 535 ? 72.985  54.171 17.459  1.00 19.85  ? 532  TRP A CZ3 1 
ATOM   4105 C CH2 . TRP A 1 535 ? 72.770  55.022 16.375  1.00 14.90  ? 532  TRP A CH2 1 
ATOM   4106 N N   . ASN A 1 536 ? 71.898  55.581 24.488  1.00 21.83  ? 533  ASN A N   1 
ATOM   4107 C CA  . ASN A 1 536 ? 72.402  55.040 25.748  1.00 25.16  ? 533  ASN A CA  1 
ATOM   4108 C C   . ASN A 1 536 ? 71.379  54.187 26.491  1.00 33.10  ? 533  ASN A C   1 
ATOM   4109 O O   . ASN A 1 536 ? 71.761  53.211 27.150  1.00 38.24  ? 533  ASN A O   1 
ATOM   4110 C CB  . ASN A 1 536 ? 72.898  56.187 26.635  1.00 22.52  ? 533  ASN A CB  1 
ATOM   4111 C CG  . ASN A 1 536 ? 74.142  56.869 26.050  1.00 28.51  ? 533  ASN A CG  1 
ATOM   4112 O OD1 . ASN A 1 536 ? 74.790  56.311 25.172  1.00 31.66  ? 533  ASN A OD1 1 
ATOM   4113 N ND2 . ASN A 1 536 ? 74.463  58.068 26.517  1.00 30.59  ? 533  ASN A ND2 1 
ATOM   4114 N N   . ARG A 1 537 ? 70.089  54.509 26.403  1.00 32.18  ? 534  ARG A N   1 
ATOM   4115 C CA  . ARG A 1 537 ? 69.090  53.814 27.206  1.00 33.21  ? 534  ARG A CA  1 
ATOM   4116 C C   . ARG A 1 537 ? 68.223  52.858 26.402  1.00 32.78  ? 534  ARG A C   1 
ATOM   4117 O O   . ARG A 1 537 ? 68.069  51.696 26.792  1.00 38.06  ? 534  ARG A O   1 
ATOM   4118 C CB  . ARG A 1 537 ? 68.208  54.832 27.929  1.00 32.59  ? 534  ARG A CB  1 
ATOM   4119 C CG  . ARG A 1 537 ? 68.959  55.730 28.886  1.00 31.88  ? 534  ARG A CG  1 
ATOM   4120 C CD  . ARG A 1 537 ? 68.070  56.904 29.272  1.00 35.79  ? 534  ARG A CD  1 
ATOM   4121 N NE  . ARG A 1 537 ? 68.753  57.890 30.101  1.00 39.03  ? 534  ARG A NE  1 
ATOM   4122 C CZ  . ARG A 1 537 ? 68.825  57.823 31.427  1.00 39.81  ? 534  ARG A CZ  1 
ATOM   4123 N NH1 . ARG A 1 537 ? 68.262  56.804 32.068  1.00 33.72  ? 534  ARG A NH1 1 
ATOM   4124 N NH2 . ARG A 1 537 ? 69.464  58.772 32.104  1.00 35.56  ? 534  ARG A NH2 1 
ATOM   4125 N N   . PHE A 1 538 ? 67.665  53.297 25.270  1.00 34.37  ? 535  PHE A N   1 
ATOM   4126 C CA  . PHE A 1 538 ? 66.700  52.454 24.566  1.00 34.37  ? 535  PHE A CA  1 
ATOM   4127 C C   . PHE A 1 538 ? 67.361  51.421 23.665  1.00 32.19  ? 535  PHE A C   1 
ATOM   4128 O O   . PHE A 1 538 ? 67.071  50.223 23.764  1.00 34.69  ? 535  PHE A O   1 
ATOM   4129 C CB  . PHE A 1 538 ? 65.744  53.292 23.721  1.00 33.54  ? 535  PHE A CB  1 
ATOM   4130 C CG  . PHE A 1 538 ? 64.737  52.446 22.970  1.00 35.46  ? 535  PHE A CG  1 
ATOM   4131 C CD1 . PHE A 1 538 ? 63.754  51.740 23.665  1.00 38.95  ? 535  PHE A CD1 1 
ATOM   4132 C CD2 . PHE A 1 538 ? 64.791  52.329 21.586  1.00 33.90  ? 535  PHE A CD2 1 
ATOM   4133 C CE1 . PHE A 1 538 ? 62.828  50.943 22.994  1.00 36.47  ? 535  PHE A CE1 1 
ATOM   4134 C CE2 . PHE A 1 538 ? 63.870  51.529 20.906  1.00 37.69  ? 535  PHE A CE2 1 
ATOM   4135 C CZ  . PHE A 1 538 ? 62.888  50.839 21.614  1.00 38.97  ? 535  PHE A CZ  1 
ATOM   4136 N N   . LEU A 1 539 ? 68.208  51.873 22.739  1.00 32.93  ? 536  LEU A N   1 
ATOM   4137 C CA  . LEU A 1 539 ? 68.747  50.965 21.727  1.00 32.84  ? 536  LEU A CA  1 
ATOM   4138 C C   . LEU A 1 539 ? 69.406  49.726 22.309  1.00 34.78  ? 536  LEU A C   1 
ATOM   4139 O O   . LEU A 1 539 ? 69.247  48.648 21.715  1.00 41.41  ? 536  LEU A O   1 
ATOM   4140 C CB  . LEU A 1 539 ? 69.730  51.708 20.816  1.00 36.80  ? 536  LEU A CB  1 
ATOM   4141 C CG  . LEU A 1 539 ? 70.172  50.854 19.636  1.00 43.86  ? 536  LEU A CG  1 
ATOM   4142 C CD1 . LEU A 1 539 ? 68.949  50.284 18.930  1.00 43.59  ? 536  LEU A CD1 1 
ATOM   4143 C CD2 . LEU A 1 539 ? 71.004  51.669 18.682  1.00 32.35  ? 536  LEU A CD2 1 
ATOM   4144 N N   . PRO A 1 540 ? 70.138  49.789 23.430  1.00 38.09  ? 537  PRO A N   1 
ATOM   4145 C CA  . PRO A 1 540 ? 70.599  48.538 24.059  1.00 38.80  ? 537  PRO A CA  1 
ATOM   4146 C C   . PRO A 1 540 ? 69.468  47.563 24.348  1.00 46.92  ? 537  PRO A C   1 
ATOM   4147 O O   . PRO A 1 540 ? 69.550  46.393 23.955  1.00 49.13  ? 537  PRO A O   1 
ATOM   4148 C CB  . PRO A 1 540 ? 71.277  49.032 25.344  1.00 40.89  ? 537  PRO A CB  1 
ATOM   4149 C CG  . PRO A 1 540 ? 71.750  50.400 25.019  1.00 38.79  ? 537  PRO A CG  1 
ATOM   4150 C CD  . PRO A 1 540 ? 70.733  50.978 24.075  1.00 36.75  ? 537  PRO A CD  1 
ATOM   4151 N N   . LYS A 1 541 ? 68.406  48.020 25.026  1.00 50.13  ? 538  LYS A N   1 
ATOM   4152 C CA  . LYS A 1 541 ? 67.252  47.159 25.286  1.00 51.23  ? 538  LYS A CA  1 
ATOM   4153 C C   . LYS A 1 541 ? 66.666  46.611 23.996  1.00 47.24  ? 538  LYS A C   1 
ATOM   4154 O O   . LYS A 1 541 ? 66.214  45.461 23.953  1.00 48.98  ? 538  LYS A O   1 
ATOM   4155 C CB  . LYS A 1 541 ? 66.194  47.934 26.078  1.00 43.82  ? 538  LYS A CB  1 
ATOM   4156 C CG  . LYS A 1 541 ? 66.667  48.277 27.482  1.00 53.79  ? 538  LYS A CG  1 
ATOM   4157 C CD  . LYS A 1 541 ? 65.758  49.248 28.214  1.00 52.14  ? 538  LYS A CD  1 
ATOM   4158 C CE  . LYS A 1 541 ? 66.318  49.534 29.617  1.00 63.35  ? 538  LYS A CE  1 
ATOM   4159 N NZ  . LYS A 1 541 ? 65.533  50.543 30.403  1.00 63.25  ? 538  LYS A NZ  1 
ATOM   4160 N N   . LEU A 1 542 ? 66.697  47.405 22.932  1.00 44.77  ? 539  LEU A N   1 
ATOM   4161 C CA  . LEU A 1 542 ? 66.221  46.932 21.643  1.00 49.37  ? 539  LEU A CA  1 
ATOM   4162 C C   . LEU A 1 542 ? 67.111  45.829 21.078  1.00 55.39  ? 539  LEU A C   1 
ATOM   4163 O O   . LEU A 1 542 ? 66.621  44.944 20.368  1.00 61.62  ? 539  LEU A O   1 
ATOM   4164 C CB  . LEU A 1 542 ? 66.133  48.106 20.674  1.00 45.06  ? 539  LEU A CB  1 
ATOM   4165 C CG  . LEU A 1 542 ? 65.446  47.793 19.361  1.00 43.65  ? 539  LEU A CG  1 
ATOM   4166 C CD1 . LEU A 1 542 ? 64.190  47.013 19.662  1.00 48.98  ? 539  LEU A CD1 1 
ATOM   4167 C CD2 . LEU A 1 542 ? 65.118  49.093 18.662  1.00 44.46  ? 539  LEU A CD2 1 
ATOM   4168 N N   . LEU A 1 543 ? 68.411  45.864 21.363  1.00 55.21  ? 540  LEU A N   1 
ATOM   4169 C CA  . LEU A 1 543 ? 69.289  44.791 20.907  1.00 57.61  ? 540  LEU A CA  1 
ATOM   4170 C C   . LEU A 1 543 ? 69.166  43.547 21.785  1.00 60.83  ? 540  LEU A C   1 
ATOM   4171 O O   . LEU A 1 543 ? 69.275  42.426 21.276  1.00 65.10  ? 540  LEU A O   1 
ATOM   4172 C CB  . LEU A 1 543 ? 70.742  45.277 20.867  1.00 54.99  ? 540  LEU A CB  1 
ATOM   4173 C CG  . LEU A 1 543 ? 70.970  46.608 20.135  1.00 53.92  ? 540  LEU A CG  1 
ATOM   4174 C CD1 . LEU A 1 543 ? 72.404  47.153 20.261  1.00 50.84  ? 540  LEU A CD1 1 
ATOM   4175 C CD2 . LEU A 1 543 ? 70.570  46.485 18.683  1.00 54.26  ? 540  LEU A CD2 1 
ATOM   4176 N N   . SER A 1 544 ? 68.924  43.725 23.091  1.00 60.09  ? 541  SER A N   1 
ATOM   4177 C CA  . SER A 1 544 ? 68.788  42.588 24.004  1.00 59.58  ? 541  SER A CA  1 
ATOM   4178 C C   . SER A 1 544 ? 67.649  41.668 23.572  1.00 67.80  ? 541  SER A C   1 
ATOM   4179 O O   . SER A 1 544 ? 67.826  40.448 23.463  1.00 72.53  ? 541  SER A O   1 
ATOM   4180 C CB  . SER A 1 544 ? 68.556  43.090 25.433  1.00 66.78  ? 541  SER A CB  1 
ATOM   4181 O OG  . SER A 1 544 ? 69.740  43.623 26.003  1.00 70.21  ? 541  SER A OG  1 
ATOM   4182 N N   . ALA A 1 545 ? 66.463  42.237 23.335  1.00 67.48  ? 542  ALA A N   1 
ATOM   4183 C CA  . ALA A 1 545 ? 65.348  41.520 22.711  1.00 70.51  ? 542  ALA A CA  1 
ATOM   4184 C C   . ALA A 1 545 ? 65.482  41.694 21.202  1.00 73.06  ? 542  ALA A C   1 
ATOM   4185 O O   . ALA A 1 545 ? 65.006  42.673 20.626  1.00 75.73  ? 542  ALA A O   1 
ATOM   4186 C CB  . ALA A 1 545 ? 64.016  42.043 23.233  1.00 68.65  ? 542  ALA A CB  1 
ATOM   4187 N N   . THR A 1 546 ? 66.131  40.724 20.555  1.00 79.95  ? 543  THR A N   1 
ATOM   4188 C CA  . THR A 1 546 ? 66.649  40.878 19.185  1.00 81.04  ? 543  THR A CA  1 
ATOM   4189 C C   . THR A 1 546 ? 65.627  41.367 18.149  1.00 85.35  ? 543  THR A C   1 
ATOM   4190 O O   . THR A 1 546 ? 64.416  41.348 18.374  1.00 84.13  ? 543  THR A O   1 
ATOM   4191 C CB  . THR A 1 546 ? 67.255  39.547 18.670  1.00 76.40  ? 543  THR A CB  1 
ATOM   4192 O OG1 . THR A 1 546 ? 68.354  39.162 19.505  1.00 72.02  ? 543  THR A OG1 1 
ATOM   4193 C CG2 . THR A 1 546 ? 67.746  39.699 17.234  1.00 79.38  ? 543  THR A CG2 1 
ATOM   4194 N N   . GLU B 1 7   ? 132.967 69.784 -28.260 1.00 89.73  ? 4    GLU B N   1 
ATOM   4195 C CA  . GLU B 1 7   ? 131.517 69.950 -28.226 1.00 92.50  ? 4    GLU B CA  1 
ATOM   4196 C C   . GLU B 1 7   ? 130.833 69.026 -29.236 1.00 91.09  ? 4    GLU B C   1 
ATOM   4197 O O   . GLU B 1 7   ? 131.019 69.186 -30.450 1.00 91.56  ? 4    GLU B O   1 
ATOM   4198 C CB  . GLU B 1 7   ? 131.143 71.416 -28.497 1.00 90.09  ? 4    GLU B CB  1 
ATOM   4199 C CG  . GLU B 1 7   ? 129.683 71.651 -28.914 1.00 93.37  ? 4    GLU B CG  1 
ATOM   4200 C CD  . GLU B 1 7   ? 128.665 71.318 -27.820 1.00 90.05  ? 4    GLU B CD  1 
ATOM   4201 O OE1 . GLU B 1 7   ? 129.061 71.190 -26.634 1.00 81.55  ? 4    GLU B OE1 1 
ATOM   4202 O OE2 . GLU B 1 7   ? 127.463 71.188 -28.159 1.00 78.50  ? 4    GLU B OE2 1 
ATOM   4203 N N   . ASP B 1 8   ? 130.043 68.066 -28.734 1.00 84.71  ? 5    ASP B N   1 
ATOM   4204 C CA  . ASP B 1 8   ? 129.360 67.100 -29.597 1.00 73.20  ? 5    ASP B CA  1 
ATOM   4205 C C   . ASP B 1 8   ? 128.248 67.797 -30.375 1.00 64.72  ? 5    ASP B C   1 
ATOM   4206 O O   . ASP B 1 8   ? 127.219 68.181 -29.804 1.00 52.87  ? 5    ASP B O   1 
ATOM   4207 C CB  . ASP B 1 8   ? 128.802 65.941 -28.777 1.00 64.06  ? 5    ASP B CB  1 
ATOM   4208 C CG  . ASP B 1 8   ? 128.294 64.785 -29.654 1.00 67.99  ? 5    ASP B CG  1 
ATOM   4209 O OD1 . ASP B 1 8   ? 128.053 64.994 -30.871 1.00 61.56  ? 5    ASP B OD1 1 
ATOM   4210 O OD2 . ASP B 1 8   ? 128.127 63.661 -29.116 1.00 62.75  ? 5    ASP B OD2 1 
ATOM   4211 N N   . ALA B 1 9   ? 128.451 67.945 -31.689 1.00 62.46  ? 6    ALA B N   1 
ATOM   4212 C CA  . ALA B 1 9   ? 127.450 68.580 -32.537 1.00 65.57  ? 6    ALA B CA  1 
ATOM   4213 C C   . ALA B 1 9   ? 126.240 67.688 -32.767 1.00 61.91  ? 6    ALA B C   1 
ATOM   4214 O O   . ALA B 1 9   ? 125.166 68.198 -33.119 1.00 54.42  ? 6    ALA B O   1 
ATOM   4215 C CB  . ALA B 1 9   ? 128.064 68.969 -33.883 1.00 63.95  ? 6    ALA B CB  1 
ATOM   4216 N N   . GLU B 1 10  ? 126.388 66.371 -32.577 1.00 52.34  ? 7    GLU B N   1 
ATOM   4217 C CA  . GLU B 1 10  ? 125.267 65.477 -32.808 1.00 50.73  ? 7    GLU B CA  1 
ATOM   4218 C C   . GLU B 1 10  ? 124.152 65.687 -31.794 1.00 46.19  ? 7    GLU B C   1 
ATOM   4219 O O   . GLU B 1 10  ? 123.012 65.291 -32.060 1.00 43.65  ? 7    GLU B O   1 
ATOM   4220 C CB  . GLU B 1 10  ? 125.749 64.029 -32.794 1.00 52.57  ? 7    GLU B CB  1 
ATOM   4221 C CG  . GLU B 1 10  ? 126.710 63.747 -33.926 1.00 46.87  ? 7    GLU B CG  1 
ATOM   4222 C CD  . GLU B 1 10  ? 126.402 62.479 -34.682 1.00 52.85  ? 7    GLU B CD  1 
ATOM   4223 O OE1 . GLU B 1 10  ? 126.530 62.498 -35.928 1.00 52.63  ? 7    GLU B OE1 1 
ATOM   4224 O OE2 . GLU B 1 10  ? 126.056 61.464 -34.039 1.00 54.58  ? 7    GLU B OE2 1 
ATOM   4225 N N   . LEU B 1 11  ? 124.446 66.315 -30.653 1.00 40.65  ? 8    LEU B N   1 
ATOM   4226 C CA  . LEU B 1 11  ? 123.418 66.657 -29.680 1.00 34.34  ? 8    LEU B CA  1 
ATOM   4227 C C   . LEU B 1 11  ? 122.685 67.949 -30.014 1.00 33.10  ? 8    LEU B C   1 
ATOM   4228 O O   . LEU B 1 11  ? 121.893 68.416 -29.194 1.00 33.58  ? 8    LEU B O   1 
ATOM   4229 C CB  . LEU B 1 11  ? 124.019 66.750 -28.278 1.00 27.27  ? 8    LEU B CB  1 
ATOM   4230 C CG  . LEU B 1 11  ? 124.775 65.526 -27.747 1.00 40.21  ? 8    LEU B CG  1 
ATOM   4231 C CD1 . LEU B 1 11  ? 125.045 65.700 -26.268 1.00 27.84  ? 8    LEU B CD1 1 
ATOM   4232 C CD2 . LEU B 1 11  ? 124.044 64.191 -28.002 1.00 37.52  ? 8    LEU B CD2 1 
ATOM   4233 N N   . LEU B 1 12  ? 122.919 68.542 -31.180 1.00 39.32  ? 9    LEU B N   1 
ATOM   4234 C CA  . LEU B 1 12  ? 122.215 69.748 -31.607 1.00 36.50  ? 9    LEU B CA  1 
ATOM   4235 C C   . LEU B 1 12  ? 121.479 69.445 -32.898 1.00 37.70  ? 9    LEU B C   1 
ATOM   4236 O O   . LEU B 1 12  ? 122.066 68.877 -33.824 1.00 40.76  ? 9    LEU B O   1 
ATOM   4237 C CB  . LEU B 1 12  ? 123.181 70.914 -31.823 1.00 42.97  ? 9    LEU B CB  1 
ATOM   4238 C CG  . LEU B 1 12  ? 123.907 71.456 -30.597 1.00 44.89  ? 9    LEU B CG  1 
ATOM   4239 C CD1 . LEU B 1 12  ? 125.035 72.375 -31.038 1.00 44.25  ? 9    LEU B CD1 1 
ATOM   4240 C CD2 . LEU B 1 12  ? 122.928 72.195 -29.676 1.00 34.62  ? 9    LEU B CD2 1 
ATOM   4241 N N   . VAL B 1 13  ? 120.204 69.819 -32.960 1.00 33.97  ? 10   VAL B N   1 
ATOM   4242 C CA  . VAL B 1 13  ? 119.345 69.421 -34.071 1.00 35.38  ? 10   VAL B CA  1 
ATOM   4243 C C   . VAL B 1 13  ? 118.304 70.504 -34.267 1.00 27.52  ? 10   VAL B C   1 
ATOM   4244 O O   . VAL B 1 13  ? 117.824 71.093 -33.297 1.00 32.93  ? 10   VAL B O   1 
ATOM   4245 C CB  . VAL B 1 13  ? 118.668 68.049 -33.804 1.00 39.43  ? 10   VAL B CB  1 
ATOM   4246 C CG1 . VAL B 1 13  ? 117.520 67.818 -34.746 1.00 29.38  ? 10   VAL B CG1 1 
ATOM   4247 C CG2 . VAL B 1 13  ? 119.661 66.906 -33.933 1.00 36.23  ? 10   VAL B CG2 1 
ATOM   4248 N N   . THR B 1 14  ? 117.937 70.760 -35.521 1.00 26.22  ? 11   THR B N   1 
ATOM   4249 C CA  . THR B 1 14  ? 116.861 71.691 -35.819 1.00 29.75  ? 11   THR B CA  1 
ATOM   4250 C C   . THR B 1 14  ? 115.672 70.925 -36.381 1.00 29.37  ? 11   THR B C   1 
ATOM   4251 O O   . THR B 1 14  ? 115.843 69.958 -37.129 1.00 31.47  ? 11   THR B O   1 
ATOM   4252 C CB  . THR B 1 14  ? 117.325 72.773 -36.808 1.00 36.16  ? 11   THR B CB  1 
ATOM   4253 O OG1 . THR B 1 14  ? 118.492 73.415 -36.275 1.00 40.41  ? 11   THR B OG1 1 
ATOM   4254 C CG2 . THR B 1 14  ? 116.241 73.819 -37.012 1.00 27.80  ? 11   THR B CG2 1 
ATOM   4255 N N   . VAL B 1 15  ? 114.474 71.346 -35.991 1.00 26.43  ? 12   VAL B N   1 
ATOM   4256 C CA  . VAL B 1 15  ? 113.219 70.806 -36.479 1.00 30.69  ? 12   VAL B CA  1 
ATOM   4257 C C   . VAL B 1 15  ? 112.357 71.988 -36.889 1.00 31.44  ? 12   VAL B C   1 
ATOM   4258 O O   . VAL B 1 15  ? 112.731 73.141 -36.693 1.00 41.36  ? 12   VAL B O   1 
ATOM   4259 C CB  . VAL B 1 15  ? 112.487 69.923 -35.431 1.00 36.12  ? 12   VAL B CB  1 
ATOM   4260 C CG1 . VAL B 1 15  ? 113.339 68.725 -35.007 1.00 25.35  ? 12   VAL B CG1 1 
ATOM   4261 C CG2 . VAL B 1 15  ? 112.063 70.743 -34.201 1.00 28.83  ? 12   VAL B CG2 1 
ATOM   4262 N N   . ARG B 1 16  ? 111.186 71.692 -37.443 1.00 29.60  ? 13   ARG B N   1 
ATOM   4263 C CA  . ARG B 1 16  ? 110.399 72.747 -38.064 1.00 34.48  ? 13   ARG B CA  1 
ATOM   4264 C C   . ARG B 1 16  ? 110.062 73.864 -37.093 1.00 33.67  ? 13   ARG B C   1 
ATOM   4265 O O   . ARG B 1 16  ? 109.931 75.017 -37.511 1.00 39.99  ? 13   ARG B O   1 
ATOM   4266 C CB  . ARG B 1 16  ? 109.121 72.175 -38.664 1.00 34.49  ? 13   ARG B CB  1 
ATOM   4267 C CG  . ARG B 1 16  ? 109.380 71.283 -39.841 1.00 42.90  ? 13   ARG B CG  1 
ATOM   4268 C CD  . ARG B 1 16  ? 108.202 71.319 -40.784 1.00 45.46  ? 13   ARG B CD  1 
ATOM   4269 N NE  . ARG B 1 16  ? 108.328 70.298 -41.816 1.00 52.16  ? 13   ARG B NE  1 
ATOM   4270 C CZ  . ARG B 1 16  ? 107.377 70.020 -42.699 1.00 53.02  ? 13   ARG B CZ  1 
ATOM   4271 N NH1 . ARG B 1 16  ? 106.229 70.701 -42.663 1.00 41.96  ? 13   ARG B NH1 1 
ATOM   4272 N NH2 . ARG B 1 16  ? 107.574 69.064 -43.607 1.00 46.97  ? 13   ARG B NH2 1 
ATOM   4273 N N   . GLY B 1 17  ? 109.917 73.556 -35.808 1.00 34.60  ? 14   GLY B N   1 
ATOM   4274 C CA  . GLY B 1 17  ? 109.534 74.580 -34.855 1.00 32.28  ? 14   GLY B CA  1 
ATOM   4275 C C   . GLY B 1 17  ? 110.676 75.399 -34.262 1.00 29.26  ? 14   GLY B C   1 
ATOM   4276 O O   . GLY B 1 17  ? 110.436 76.459 -33.678 1.00 31.74  ? 14   GLY B O   1 
ATOM   4277 N N   . GLY B 1 18  ? 111.907 74.933 -34.368 1.00 26.81  ? 15   GLY B N   1 
ATOM   4278 C CA  . GLY B 1 18  ? 113.006 75.585 -33.687 1.00 26.71  ? 15   GLY B CA  1 
ATOM   4279 C C   . GLY B 1 18  ? 114.123 74.602 -33.431 1.00 28.71  ? 15   GLY B C   1 
ATOM   4280 O O   . GLY B 1 18  ? 114.101 73.478 -33.922 1.00 28.32  ? 15   GLY B O   1 
ATOM   4281 N N   . ARG B 1 19  ? 115.094 75.052 -32.636 1.00 28.20  ? 16   ARG B N   1 
ATOM   4282 C CA  . ARG B 1 19  ? 116.279 74.282 -32.289 1.00 29.28  ? 16   ARG B CA  1 
ATOM   4283 C C   . ARG B 1 19  ? 116.140 73.591 -30.928 1.00 27.48  ? 16   ARG B C   1 
ATOM   4284 O O   . ARG B 1 19  ? 115.392 74.035 -30.055 1.00 27.41  ? 16   ARG B O   1 
ATOM   4285 C CB  . ARG B 1 19  ? 117.521 75.185 -32.296 1.00 37.13  ? 16   ARG B CB  1 
ATOM   4286 C CG  . ARG B 1 19  ? 118.086 75.404 -33.692 1.00 45.93  ? 16   ARG B CG  1 
ATOM   4287 C CD  . ARG B 1 19  ? 119.073 76.568 -33.760 1.00 47.08  ? 16   ARG B CD  1 
ATOM   4288 N NE  . ARG B 1 19  ? 118.452 77.838 -33.393 1.00 44.45  ? 16   ARG B NE  1 
ATOM   4289 C CZ  . ARG B 1 19  ? 118.961 78.679 -32.497 1.00 47.63  ? 16   ARG B CZ  1 
ATOM   4290 N NH1 . ARG B 1 19  ? 120.108 78.386 -31.889 1.00 41.93  ? 16   ARG B NH1 1 
ATOM   4291 N NH2 . ARG B 1 19  ? 118.332 79.819 -32.221 1.00 44.77  ? 16   ARG B NH2 1 
ATOM   4292 N N   . LEU B 1 20  ? 116.921 72.512 -30.767 1.00 22.46  ? 17   LEU B N   1 
ATOM   4293 C CA  . LEU B 1 20  ? 116.882 71.566 -29.658 1.00 33.91  ? 17   LEU B CA  1 
ATOM   4294 C C   . LEU B 1 20  ? 118.296 71.197 -29.268 1.00 28.57  ? 17   LEU B C   1 
ATOM   4295 O O   . LEU B 1 20  ? 119.164 71.062 -30.133 1.00 34.20  ? 17   LEU B O   1 
ATOM   4296 C CB  . LEU B 1 20  ? 116.198 70.221 -30.025 1.00 26.15  ? 17   LEU B CB  1 
ATOM   4297 C CG  . LEU B 1 20  ? 114.780 70.228 -30.552 1.00 28.27  ? 17   LEU B CG  1 
ATOM   4298 C CD1 . LEU B 1 20  ? 114.441 68.815 -31.034 1.00 26.67  ? 17   LEU B CD1 1 
ATOM   4299 C CD2 . LEU B 1 20  ? 113.839 70.710 -29.456 1.00 25.67  ? 17   LEU B CD2 1 
ATOM   4300 N N   . ARG B 1 21  ? 118.508 70.959 -27.975 1.00 26.03  ? 18   ARG B N   1 
ATOM   4301 C CA  . ARG B 1 21  ? 119.720 70.304 -27.497 1.00 27.87  ? 18   ARG B CA  1 
ATOM   4302 C C   . ARG B 1 21  ? 119.360 69.019 -26.768 1.00 28.88  ? 18   ARG B C   1 
ATOM   4303 O O   . ARG B 1 21  ? 118.573 69.038 -25.815 1.00 22.87  ? 18   ARG B O   1 
ATOM   4304 C CB  . ARG B 1 21  ? 120.545 71.189 -26.547 1.00 24.30  ? 18   ARG B CB  1 
ATOM   4305 C CG  . ARG B 1 21  ? 121.720 70.418 -25.923 1.00 31.40  ? 18   ARG B CG  1 
ATOM   4306 C CD  . ARG B 1 21  ? 122.436 71.236 -24.863 1.00 40.25  ? 18   ARG B CD  1 
ATOM   4307 N NE  . ARG B 1 21  ? 122.601 72.606 -25.336 1.00 40.96  ? 18   ARG B NE  1 
ATOM   4308 C CZ  . ARG B 1 21  ? 123.683 73.045 -25.965 1.00 44.41  ? 18   ARG B CZ  1 
ATOM   4309 N NH1 . ARG B 1 21  ? 124.708 72.221 -26.172 1.00 45.76  ? 18   ARG B NH1 1 
ATOM   4310 N NH2 . ARG B 1 21  ? 123.740 74.310 -26.370 1.00 50.87  ? 18   ARG B NH2 1 
ATOM   4311 N N   . GLY B 1 22  ? 119.995 67.926 -27.168 1.00 29.69  ? 19   GLY B N   1 
ATOM   4312 C CA  . GLY B 1 22  ? 119.771 66.634 -26.581 1.00 30.47  ? 19   GLY B CA  1 
ATOM   4313 C C   . GLY B 1 22  ? 120.877 66.232 -25.638 1.00 30.71  ? 19   GLY B C   1 
ATOM   4314 O O   . GLY B 1 22  ? 121.700 67.049 -25.211 1.00 36.46  ? 19   GLY B O   1 
ATOM   4315 N N   . ILE B 1 23  ? 120.911 64.941 -25.331 1.00 25.44  ? 20   ILE B N   1 
ATOM   4316 C CA  . ILE B 1 23  ? 121.816 64.404 -24.333 1.00 27.60  ? 20   ILE B CA  1 
ATOM   4317 C C   . ILE B 1 23  ? 122.351 63.077 -24.842 1.00 26.18  ? 20   ILE B C   1 
ATOM   4318 O O   . ILE B 1 23  ? 121.659 62.334 -25.541 1.00 30.96  ? 20   ILE B O   1 
ATOM   4319 C CB  . ILE B 1 23  ? 121.095 64.256 -22.963 1.00 28.72  ? 20   ILE B CB  1 
ATOM   4320 C CG1 . ILE B 1 23  ? 122.046 63.752 -21.883 1.00 30.97  ? 20   ILE B CG1 1 
ATOM   4321 C CG2 . ILE B 1 23  ? 119.868 63.343 -23.071 1.00 20.48  ? 20   ILE B CG2 1 
ATOM   4322 C CD1 . ILE B 1 23  ? 121.430 63.802 -20.460 1.00 27.94  ? 20   ILE B CD1 1 
ATOM   4323 N N   . ARG B 1 24  ? 123.591 62.776 -24.481 1.00 29.26  ? 21   ARG B N   1 
ATOM   4324 C CA  . ARG B 1 24  ? 124.204 61.507 -24.832 1.00 33.14  ? 21   ARG B CA  1 
ATOM   4325 C C   . ARG B 1 24  ? 123.976 60.503 -23.711 1.00 37.23  ? 21   ARG B C   1 
ATOM   4326 O O   . ARG B 1 24  ? 124.276 60.791 -22.546 1.00 31.86  ? 21   ARG B O   1 
ATOM   4327 C CB  . ARG B 1 24  ? 125.704 61.662 -25.087 1.00 31.52  ? 21   ARG B CB  1 
ATOM   4328 C CG  . ARG B 1 24  ? 126.474 60.362 -24.810 1.00 38.40  ? 21   ARG B CG  1 
ATOM   4329 C CD  . ARG B 1 24  ? 127.897 60.402 -25.332 1.00 47.58  ? 21   ARG B CD  1 
ATOM   4330 N NE  . ARG B 1 24  ? 127.922 60.703 -26.760 1.00 60.61  ? 21   ARG B NE  1 
ATOM   4331 C CZ  . ARG B 1 24  ? 129.019 60.674 -27.508 1.00 58.71  ? 21   ARG B CZ  1 
ATOM   4332 N NH1 . ARG B 1 24  ? 130.188 60.353 -26.964 1.00 57.28  ? 21   ARG B NH1 1 
ATOM   4333 N NH2 . ARG B 1 24  ? 128.944 60.963 -28.799 1.00 58.73  ? 21   ARG B NH2 1 
ATOM   4334 N N   . LEU B 1 25  ? 123.459 59.328 -24.067 1.00 30.45  ? 22   LEU B N   1 
ATOM   4335 C CA  . LEU B 1 25  ? 123.147 58.278 -23.108 1.00 32.10  ? 22   LEU B CA  1 
ATOM   4336 C C   . LEU B 1 25  ? 124.097 57.111 -23.314 1.00 26.09  ? 22   LEU B C   1 
ATOM   4337 O O   . LEU B 1 25  ? 124.372 56.719 -24.451 1.00 32.91  ? 22   LEU B O   1 
ATOM   4338 C CB  . LEU B 1 25  ? 121.685 57.813 -23.252 1.00 28.66  ? 22   LEU B CB  1 
ATOM   4339 C CG  . LEU B 1 25  ? 120.611 58.894 -23.112 1.00 28.18  ? 22   LEU B CG  1 
ATOM   4340 C CD1 . LEU B 1 25  ? 119.224 58.304 -23.252 1.00 31.84  ? 22   LEU B CD1 1 
ATOM   4341 C CD2 . LEU B 1 25  ? 120.744 59.619 -21.764 1.00 27.71  ? 22   LEU B CD2 1 
ATOM   4342 N N   . LYS B 1 26  ? 124.603 56.564 -22.222 1.00 26.10  ? 23   LYS B N   1 
ATOM   4343 C CA  . LYS B 1 26  ? 125.501 55.424 -22.289 1.00 35.12  ? 23   LYS B CA  1 
ATOM   4344 C C   . LYS B 1 26  ? 124.741 54.108 -22.200 1.00 41.73  ? 23   LYS B C   1 
ATOM   4345 O O   . LYS B 1 26  ? 123.701 54.002 -21.539 1.00 39.41  ? 23   LYS B O   1 
ATOM   4346 C CB  . LYS B 1 26  ? 126.545 55.478 -21.173 1.00 36.32  ? 23   LYS B CB  1 
ATOM   4347 C CG  . LYS B 1 26  ? 126.954 56.895 -20.818 1.00 47.33  ? 23   LYS B CG  1 
ATOM   4348 C CD  . LYS B 1 26  ? 128.121 56.939 -19.839 1.00 52.66  ? 23   LYS B CD  1 
ATOM   4349 C CE  . LYS B 1 26  ? 129.468 56.870 -20.572 1.00 56.53  ? 23   LYS B CE  1 
ATOM   4350 N NZ  . LYS B 1 26  ? 130.591 56.529 -19.647 1.00 61.09  ? 23   LYS B NZ  1 
ATOM   4351 N N   . THR B 1 27  ? 125.265 53.113 -22.901 1.00 38.10  ? 24   THR B N   1 
ATOM   4352 C CA  . THR B 1 27  ? 124.917 51.712 -22.758 1.00 35.85  ? 24   THR B CA  1 
ATOM   4353 C C   . THR B 1 27  ? 126.223 50.940 -22.788 1.00 40.35  ? 24   THR B C   1 
ATOM   4354 O O   . THR B 1 27  ? 127.240 51.452 -23.272 1.00 39.08  ? 24   THR B O   1 
ATOM   4355 C CB  . THR B 1 27  ? 124.005 51.194 -23.883 1.00 37.03  ? 24   THR B CB  1 
ATOM   4356 O OG1 . THR B 1 27  ? 124.821 50.747 -24.974 1.00 40.44  ? 24   THR B OG1 1 
ATOM   4357 C CG2 . THR B 1 27  ? 123.031 52.263 -24.367 1.00 31.43  ? 24   THR B CG2 1 
ATOM   4358 N N   . PRO B 1 28  ? 126.229 49.700 -22.299 1.00 42.61  ? 25   PRO B N   1 
ATOM   4359 C CA  . PRO B 1 28  ? 127.463 48.904 -22.368 1.00 42.58  ? 25   PRO B CA  1 
ATOM   4360 C C   . PRO B 1 28  ? 127.983 48.726 -23.781 1.00 45.47  ? 25   PRO B C   1 
ATOM   4361 O O   . PRO B 1 28  ? 129.166 48.410 -23.957 1.00 41.49  ? 25   PRO B O   1 
ATOM   4362 C CB  . PRO B 1 28  ? 127.051 47.561 -21.749 1.00 43.52  ? 25   PRO B CB  1 
ATOM   4363 C CG  . PRO B 1 28  ? 125.912 47.908 -20.846 1.00 42.80  ? 25   PRO B CG  1 
ATOM   4364 C CD  . PRO B 1 28  ? 125.166 49.002 -21.551 1.00 40.83  ? 25   PRO B CD  1 
ATOM   4365 N N   . GLY B 1 29  ? 127.146 48.933 -24.789 1.00 42.28  ? 26   GLY B N   1 
ATOM   4366 C CA  . GLY B 1 29  ? 127.587 48.768 -26.154 1.00 46.55  ? 26   GLY B CA  1 
ATOM   4367 C C   . GLY B 1 29  ? 128.004 50.063 -26.818 1.00 43.41  ? 26   GLY B C   1 
ATOM   4368 O O   . GLY B 1 29  ? 128.484 50.050 -27.952 1.00 48.50  ? 26   GLY B O   1 
ATOM   4369 N N   . GLY B 1 30  ? 127.809 51.191 -26.147 1.00 43.88  ? 27   GLY B N   1 
ATOM   4370 C CA  . GLY B 1 30  ? 128.175 52.461 -26.722 1.00 35.66  ? 27   GLY B CA  1 
ATOM   4371 C C   . GLY B 1 30  ? 127.073 53.492 -26.615 1.00 42.18  ? 27   GLY B C   1 
ATOM   4372 O O   . GLY B 1 30  ? 125.929 53.187 -26.263 1.00 40.09  ? 27   GLY B O   1 
ATOM   4373 N N   . PRO B 1 31  ? 127.404 54.740 -26.932 1.00 43.15  ? 28   PRO B N   1 
ATOM   4374 C CA  . PRO B 1 31  ? 126.470 55.844 -26.691 1.00 38.08  ? 28   PRO B CA  1 
ATOM   4375 C C   . PRO B 1 31  ? 125.306 55.860 -27.671 1.00 35.87  ? 28   PRO B C   1 
ATOM   4376 O O   . PRO B 1 31  ? 125.306 55.225 -28.725 1.00 39.91  ? 28   PRO B O   1 
ATOM   4377 C CB  . PRO B 1 31  ? 127.344 57.091 -26.862 1.00 39.91  ? 28   PRO B CB  1 
ATOM   4378 C CG  . PRO B 1 31  ? 128.420 56.645 -27.810 1.00 37.86  ? 28   PRO B CG  1 
ATOM   4379 C CD  . PRO B 1 31  ? 128.719 55.223 -27.389 1.00 36.59  ? 28   PRO B CD  1 
ATOM   4380 N N   . VAL B 1 32  ? 124.310 56.660 -27.292 1.00 28.48  ? 29   VAL B N   1 
ATOM   4381 C CA  . VAL B 1 32  ? 123.110 56.929 -28.062 1.00 27.35  ? 29   VAL B CA  1 
ATOM   4382 C C   . VAL B 1 32  ? 122.813 58.403 -27.845 1.00 25.56  ? 29   VAL B C   1 
ATOM   4383 O O   . VAL B 1 32  ? 123.144 58.960 -26.796 1.00 32.34  ? 29   VAL B O   1 
ATOM   4384 C CB  . VAL B 1 32  ? 121.932 56.022 -27.591 1.00 34.34  ? 29   VAL B CB  1 
ATOM   4385 C CG1 . VAL B 1 32  ? 120.586 56.626 -27.922 1.00 28.31  ? 29   VAL B CG1 1 
ATOM   4386 C CG2 . VAL B 1 32  ? 122.054 54.627 -28.187 1.00 26.23  ? 29   VAL B CG2 1 
ATOM   4387 N N   . SER B 1 33  ? 122.213 59.052 -28.835 1.00 24.52  ? 30   SER B N   1 
ATOM   4388 C CA  . SER B 1 33  ? 121.771 60.430 -28.680 1.00 24.94  ? 30   SER B CA  1 
ATOM   4389 C C   . SER B 1 33  ? 120.278 60.432 -28.401 1.00 31.89  ? 30   SER B C   1 
ATOM   4390 O O   . SER B 1 33  ? 119.518 59.730 -29.071 1.00 27.45  ? 30   SER B O   1 
ATOM   4391 C CB  . SER B 1 33  ? 122.070 61.270 -29.923 1.00 25.12  ? 30   SER B CB  1 
ATOM   4392 O OG  . SER B 1 33  ? 123.463 61.305 -30.169 1.00 35.69  ? 30   SER B OG  1 
ATOM   4393 N N   . ALA B 1 34  ? 119.862 61.215 -27.411 1.00 27.24  ? 31   ALA B N   1 
ATOM   4394 C CA  . ALA B 1 34  ? 118.469 61.261 -27.011 1.00 23.75  ? 31   ALA B CA  1 
ATOM   4395 C C   . ALA B 1 34  ? 117.998 62.700 -26.951 1.00 21.77  ? 31   ALA B C   1 
ATOM   4396 O O   . ALA B 1 34  ? 118.709 63.582 -26.456 1.00 30.38  ? 31   ALA B O   1 
ATOM   4397 C CB  . ALA B 1 34  ? 118.270 60.570 -25.659 1.00 17.95  ? 31   ALA B CB  1 
ATOM   4398 N N   . PHE B 1 35  ? 116.797 62.930 -27.444 1.00 25.14  ? 32   PHE B N   1 
ATOM   4399 C CA  . PHE B 1 35  ? 116.163 64.241 -27.411 1.00 20.44  ? 32   PHE B CA  1 
ATOM   4400 C C   . PHE B 1 35  ? 114.848 64.067 -26.662 1.00 27.60  ? 32   PHE B C   1 
ATOM   4401 O O   . PHE B 1 35  ? 113.845 63.623 -27.236 1.00 22.49  ? 32   PHE B O   1 
ATOM   4402 C CB  . PHE B 1 35  ? 115.978 64.779 -28.820 1.00 21.69  ? 32   PHE B CB  1 
ATOM   4403 C CG  . PHE B 1 35  ? 117.275 64.982 -29.540 1.00 30.55  ? 32   PHE B CG  1 
ATOM   4404 C CD1 . PHE B 1 35  ? 117.977 63.890 -30.052 1.00 24.72  ? 32   PHE B CD1 1 
ATOM   4405 C CD2 . PHE B 1 35  ? 117.829 66.259 -29.657 1.00 30.62  ? 32   PHE B CD2 1 
ATOM   4406 C CE1 . PHE B 1 35  ? 119.199 64.067 -30.692 1.00 34.39  ? 32   PHE B CE1 1 
ATOM   4407 C CE2 . PHE B 1 35  ? 119.044 66.449 -30.299 1.00 33.29  ? 32   PHE B CE2 1 
ATOM   4408 C CZ  . PHE B 1 35  ? 119.736 65.351 -30.816 1.00 36.48  ? 32   PHE B CZ  1 
ATOM   4409 N N   . LEU B 1 36  ? 114.867 64.404 -25.375 1.00 28.48  ? 33   LEU B N   1 
ATOM   4410 C CA  . LEU B 1 36  ? 113.787 64.099 -24.443 1.00 23.68  ? 33   LEU B CA  1 
ATOM   4411 C C   . LEU B 1 36  ? 113.015 65.364 -24.132 1.00 21.84  ? 33   LEU B C   1 
ATOM   4412 O O   . LEU B 1 36  ? 113.609 66.373 -23.750 1.00 25.98  ? 33   LEU B O   1 
ATOM   4413 C CB  . LEU B 1 36  ? 114.341 63.522 -23.146 1.00 17.56  ? 33   LEU B CB  1 
ATOM   4414 C CG  . LEU B 1 36  ? 115.322 62.376 -23.310 1.00 20.09  ? 33   LEU B CG  1 
ATOM   4415 C CD1 . LEU B 1 36  ? 115.831 61.944 -21.941 1.00 20.08  ? 33   LEU B CD1 1 
ATOM   4416 C CD2 . LEU B 1 36  ? 114.662 61.205 -24.065 1.00 21.51  ? 33   LEU B CD2 1 
ATOM   4417 N N   . GLY B 1 37  ? 111.699 65.301 -24.259 1.00 23.43  ? 34   GLY B N   1 
ATOM   4418 C CA  . GLY B 1 37  ? 110.861 66.420 -23.897 1.00 16.83  ? 34   GLY B CA  1 
ATOM   4419 C C   . GLY B 1 37  ? 110.602 67.409 -25.005 1.00 26.08  ? 34   GLY B C   1 
ATOM   4420 O O   . GLY B 1 37  ? 110.386 68.596 -24.725 1.00 25.72  ? 34   GLY B O   1 
ATOM   4421 N N   . ILE B 1 38  ? 110.592 66.967 -26.254 1.00 24.21  ? 35   ILE B N   1 
ATOM   4422 C CA  . ILE B 1 38  ? 110.287 67.898 -27.349 1.00 20.28  ? 35   ILE B CA  1 
ATOM   4423 C C   . ILE B 1 38  ? 108.816 68.278 -27.299 1.00 20.87  ? 35   ILE B C   1 
ATOM   4424 O O   . ILE B 1 38  ? 107.952 67.389 -27.279 1.00 24.84  ? 35   ILE B O   1 
ATOM   4425 C CB  . ILE B 1 38  ? 110.621 67.269 -28.694 1.00 19.78  ? 35   ILE B CB  1 
ATOM   4426 C CG1 . ILE B 1 38  ? 112.051 66.760 -28.716 1.00 16.89  ? 35   ILE B CG1 1 
ATOM   4427 C CG2 . ILE B 1 38  ? 110.319 68.255 -29.804 1.00 21.14  ? 35   ILE B CG2 1 
ATOM   4428 C CD1 . ILE B 1 38  ? 112.395 66.073 -30.014 1.00 21.84  ? 35   ILE B CD1 1 
ATOM   4429 N N   . PRO B 1 39  ? 108.475 69.559 -27.327 1.00 26.69  ? 36   PRO B N   1 
ATOM   4430 C CA  . PRO B 1 39  ? 107.057 69.932 -27.394 1.00 16.81  ? 36   PRO B CA  1 
ATOM   4431 C C   . PRO B 1 39  ? 106.491 69.695 -28.789 1.00 30.90  ? 36   PRO B C   1 
ATOM   4432 O O   . PRO B 1 39  ? 107.068 70.145 -29.785 1.00 26.59  ? 36   PRO B O   1 
ATOM   4433 C CB  . PRO B 1 39  ? 107.061 71.425 -27.037 1.00 23.66  ? 36   PRO B CB  1 
ATOM   4434 C CG  . PRO B 1 39  ? 108.421 71.896 -27.408 1.00 22.27  ? 36   PRO B CG  1 
ATOM   4435 C CD  . PRO B 1 39  ? 109.370 70.729 -27.199 1.00 20.77  ? 36   PRO B CD  1 
ATOM   4436 N N   . PHE B 1 40  ? 105.339 68.993 -28.860 1.00 19.90  ? 37   PHE B N   1 
ATOM   4437 C CA  . PHE B 1 40  ? 104.669 68.804 -30.137 1.00 20.50  ? 37   PHE B CA  1 
ATOM   4438 C C   . PHE B 1 40  ? 103.285 69.405 -30.175 1.00 20.50  ? 37   PHE B C   1 
ATOM   4439 O O   . PHE B 1 40  ? 102.700 69.493 -31.254 1.00 22.48  ? 37   PHE B O   1 
ATOM   4440 C CB  . PHE B 1 40  ? 104.615 67.317 -30.529 1.00 22.78  ? 37   PHE B CB  1 
ATOM   4441 C CG  . PHE B 1 40  ? 103.688 66.452 -29.673 1.00 22.65  ? 37   PHE B CG  1 
ATOM   4442 C CD1 . PHE B 1 40  ? 102.352 66.287 -30.014 1.00 19.27  ? 37   PHE B CD1 1 
ATOM   4443 C CD2 . PHE B 1 40  ? 104.178 65.767 -28.571 1.00 17.19  ? 37   PHE B CD2 1 
ATOM   4444 C CE1 . PHE B 1 40  ? 101.506 65.459 -29.258 1.00 28.07  ? 37   PHE B CE1 1 
ATOM   4445 C CE2 . PHE B 1 40  ? 103.348 64.934 -27.797 1.00 23.53  ? 37   PHE B CE2 1 
ATOM   4446 C CZ  . PHE B 1 40  ? 102.008 64.779 -28.139 1.00 25.96  ? 37   PHE B CZ  1 
ATOM   4447 N N   . ALA B 1 41  ? 102.775 69.895 -29.056 1.00 20.62  ? 38   ALA B N   1 
ATOM   4448 C CA  . ALA B 1 41  ? 101.478 70.538 -29.050 1.00 24.81  ? 38   ALA B CA  1 
ATOM   4449 C C   . ALA B 1 41  ? 101.549 71.777 -28.174 1.00 24.32  ? 38   ALA B C   1 
ATOM   4450 O O   . ALA B 1 41  ? 102.387 71.877 -27.279 1.00 25.25  ? 38   ALA B O   1 
ATOM   4451 C CB  . ALA B 1 41  ? 100.374 69.578 -28.544 1.00 19.58  ? 38   ALA B CB  1 
ATOM   4452 N N   . GLU B 1 42  ? 100.661 72.723 -28.443 1.00 23.36  ? 39   GLU B N   1 
ATOM   4453 C CA  . GLU B 1 42  ? 100.397 73.759 -27.457 1.00 31.91  ? 39   GLU B CA  1 
ATOM   4454 C C   . GLU B 1 42  ? 99.855  73.116 -26.183 1.00 35.17  ? 39   GLU B C   1 
ATOM   4455 O O   . GLU B 1 42  ? 99.010  72.216 -26.258 1.00 34.41  ? 39   GLU B O   1 
ATOM   4456 C CB  . GLU B 1 42  ? 99.384  74.785 -27.980 1.00 28.60  ? 39   GLU B CB  1 
ATOM   4457 C CG  . GLU B 1 42  ? 99.933  75.759 -29.041 1.00 42.06  ? 39   GLU B CG  1 
ATOM   4458 C CD  . GLU B 1 42  ? 101.174 76.547 -28.577 1.00 39.50  ? 39   GLU B CD  1 
ATOM   4459 O OE1 . GLU B 1 42  ? 101.108 77.236 -27.537 1.00 41.18  ? 39   GLU B OE1 1 
ATOM   4460 O OE2 . GLU B 1 42  ? 102.221 76.468 -29.256 1.00 39.35  ? 39   GLU B OE2 1 
ATOM   4461 N N   . PRO B 1 43  ? 100.284 73.573 -25.009 1.00 33.38  ? 40   PRO B N   1 
ATOM   4462 C CA  . PRO B 1 43  ? 99.795  72.991 -23.747 1.00 30.66  ? 40   PRO B CA  1 
ATOM   4463 C C   . PRO B 1 43  ? 98.278  73.004 -23.672 1.00 33.97  ? 40   PRO B C   1 
ATOM   4464 O O   . PRO B 1 43  ? 97.640  74.056 -23.818 1.00 31.20  ? 40   PRO B O   1 
ATOM   4465 C CB  . PRO B 1 43  ? 100.418 73.901 -22.677 1.00 29.16  ? 40   PRO B CB  1 
ATOM   4466 C CG  . PRO B 1 43  ? 101.685 74.396 -23.325 1.00 31.80  ? 40   PRO B CG  1 
ATOM   4467 C CD  . PRO B 1 43  ? 101.318 74.602 -24.786 1.00 28.50  ? 40   PRO B CD  1 
ATOM   4468 N N   . PRO B 1 44  ? 97.648  71.823 -23.457 1.00 32.32  ? 41   PRO B N   1 
ATOM   4469 C CA  . PRO B 1 44  ? 96.173  71.721 -23.482 1.00 27.74  ? 41   PRO B CA  1 
ATOM   4470 C C   . PRO B 1 44  ? 95.535  72.094 -22.148 1.00 32.42  ? 41   PRO B C   1 
ATOM   4471 O O   . PRO B 1 44  ? 94.895  71.288 -21.466 1.00 34.53  ? 41   PRO B O   1 
ATOM   4472 C CB  . PRO B 1 44  ? 95.957  70.249 -23.849 1.00 22.94  ? 41   PRO B CB  1 
ATOM   4473 C CG  . PRO B 1 44  ? 97.125  69.553 -23.234 1.00 28.10  ? 41   PRO B CG  1 
ATOM   4474 C CD  . PRO B 1 44  ? 98.300  70.505 -23.368 1.00 27.84  ? 41   PRO B CD  1 
ATOM   4475 N N   . MET B 1 45  ? 95.680  73.356 -21.761 1.00 31.87  ? 42   MET B N   1 
ATOM   4476 C CA  . MET B 1 45  ? 95.238  73.812 -20.456 1.00 31.82  ? 42   MET B CA  1 
ATOM   4477 C C   . MET B 1 45  ? 94.210  74.914 -20.607 1.00 29.83  ? 42   MET B C   1 
ATOM   4478 O O   . MET B 1 45  ? 94.044  75.490 -21.683 1.00 32.93  ? 42   MET B O   1 
ATOM   4479 C CB  . MET B 1 45  ? 96.409  74.335 -19.635 1.00 36.07  ? 42   MET B CB  1 
ATOM   4480 C CG  . MET B 1 45  ? 97.588  73.453 -19.697 1.00 28.87  ? 42   MET B CG  1 
ATOM   4481 S SD  . MET B 1 45  ? 98.823  74.187 -18.679 1.00 47.35  ? 42   MET B SD  1 
ATOM   4482 C CE  . MET B 1 45  ? 97.997  74.048 -17.093 1.00 40.66  ? 42   MET B CE  1 
ATOM   4483 N N   . GLY B 1 46  ? 93.554  75.225 -19.492 1.00 27.77  ? 43   GLY B N   1 
ATOM   4484 C CA  . GLY B 1 46  ? 92.569  76.278 -19.445 1.00 30.48  ? 43   GLY B CA  1 
ATOM   4485 C C   . GLY B 1 46  ? 91.408  76.022 -20.381 1.00 33.11  ? 43   GLY B C   1 
ATOM   4486 O O   . GLY B 1 46  ? 90.769  74.968 -20.337 1.00 32.92  ? 43   GLY B O   1 
ATOM   4487 N N   . PRO B 1 47  ? 91.109  76.991 -21.251 1.00 34.34  ? 44   PRO B N   1 
ATOM   4488 C CA  . PRO B 1 47  ? 90.060  76.773 -22.263 1.00 35.03  ? 44   PRO B CA  1 
ATOM   4489 C C   . PRO B 1 47  ? 90.337  75.599 -23.183 1.00 27.34  ? 44   PRO B C   1 
ATOM   4490 O O   . PRO B 1 47  ? 89.406  75.108 -23.829 1.00 33.41  ? 44   PRO B O   1 
ATOM   4491 C CB  . PRO B 1 47  ? 90.040  78.101 -23.045 1.00 31.31  ? 44   PRO B CB  1 
ATOM   4492 C CG  . PRO B 1 47  ? 91.379  78.725 -22.769 1.00 29.11  ? 44   PRO B CG  1 
ATOM   4493 C CD  . PRO B 1 47  ? 91.703  78.335 -21.355 1.00 33.35  ? 44   PRO B CD  1 
ATOM   4494 N N   . ARG B 1 48  ? 91.578  75.118 -23.259 1.00 35.21  ? 45   ARG B N   1 
ATOM   4495 C CA  . ARG B 1 48  ? 91.923  73.982 -24.114 1.00 33.72  ? 45   ARG B CA  1 
ATOM   4496 C C   . ARG B 1 48  ? 91.728  72.619 -23.456 1.00 33.25  ? 45   ARG B C   1 
ATOM   4497 O O   . ARG B 1 48  ? 91.916  71.597 -24.130 1.00 31.64  ? 45   ARG B O   1 
ATOM   4498 C CB  . ARG B 1 48  ? 93.375  74.093 -24.584 1.00 32.28  ? 45   ARG B CB  1 
ATOM   4499 C CG  . ARG B 1 48  ? 93.568  75.011 -25.784 1.00 40.65  ? 45   ARG B CG  1 
ATOM   4500 C CD  . ARG B 1 48  ? 95.032  75.010 -26.215 1.00 48.23  ? 45   ARG B CD  1 
ATOM   4501 N NE  . ARG B 1 48  ? 95.251  75.829 -27.406 1.00 62.53  ? 45   ARG B NE  1 
ATOM   4502 C CZ  . ARG B 1 48  ? 95.558  77.123 -27.377 1.00 67.44  ? 45   ARG B CZ  1 
ATOM   4503 N NH1 . ARG B 1 48  ? 95.684  77.755 -26.213 1.00 67.21  ? 45   ARG B NH1 1 
ATOM   4504 N NH2 . ARG B 1 48  ? 95.734  77.788 -28.513 1.00 70.21  ? 45   ARG B NH2 1 
ATOM   4505 N N   . ARG B 1 49  ? 91.397  72.562 -22.168 1.00 31.71  ? 46   ARG B N   1 
ATOM   4506 C CA  . ARG B 1 49  ? 91.092  71.277 -21.553 1.00 32.15  ? 46   ARG B CA  1 
ATOM   4507 C C   . ARG B 1 49  ? 89.924  70.625 -22.292 1.00 27.48  ? 46   ARG B C   1 
ATOM   4508 O O   . ARG B 1 49  ? 88.911  71.274 -22.555 1.00 23.96  ? 46   ARG B O   1 
ATOM   4509 C CB  . ARG B 1 49  ? 90.756  71.461 -20.069 1.00 25.57  ? 46   ARG B CB  1 
ATOM   4510 C CG  . ARG B 1 49  ? 90.444  70.155 -19.336 1.00 23.20  ? 46   ARG B CG  1 
ATOM   4511 C CD  . ARG B 1 49  ? 89.952  70.415 -17.913 1.00 24.07  ? 46   ARG B CD  1 
ATOM   4512 N NE  . ARG B 1 49  ? 91.050  70.712 -16.998 1.00 25.69  ? 46   ARG B NE  1 
ATOM   4513 C CZ  . ARG B 1 49  ? 90.875  71.043 -15.723 1.00 24.04  ? 46   ARG B CZ  1 
ATOM   4514 N NH1 . ARG B 1 49  ? 89.651  71.120 -15.218 1.00 24.15  ? 46   ARG B NH1 1 
ATOM   4515 N NH2 . ARG B 1 49  ? 91.918  71.306 -14.959 1.00 24.65  ? 46   ARG B NH2 1 
ATOM   4516 N N   . PHE B 1 50  ? 90.090  69.353 -22.655 1.00 23.69  ? 47   PHE B N   1 
ATOM   4517 C CA  . PHE B 1 50  ? 89.142  68.486 -23.385 1.00 28.47  ? 47   PHE B CA  1 
ATOM   4518 C C   . PHE B 1 50  ? 89.109  68.747 -24.890 1.00 27.64  ? 47   PHE B C   1 
ATOM   4519 O O   . PHE B 1 50  ? 88.319  68.108 -25.575 1.00 31.86  ? 47   PHE B O   1 
ATOM   4520 C CB  . PHE B 1 50  ? 87.692  68.570 -22.868 1.00 23.81  ? 47   PHE B CB  1 
ATOM   4521 C CG  . PHE B 1 50  ? 87.578  68.455 -21.383 1.00 21.72  ? 47   PHE B CG  1 
ATOM   4522 C CD1 . PHE B 1 50  ? 88.086  67.347 -20.724 1.00 20.59  ? 47   PHE B CD1 1 
ATOM   4523 C CD2 . PHE B 1 50  ? 86.973  69.453 -20.647 1.00 23.55  ? 47   PHE B CD2 1 
ATOM   4524 C CE1 . PHE B 1 50  ? 87.984  67.234 -19.353 1.00 24.02  ? 47   PHE B CE1 1 
ATOM   4525 C CE2 . PHE B 1 50  ? 86.868  69.350 -19.264 1.00 28.28  ? 47   PHE B CE2 1 
ATOM   4526 C CZ  . PHE B 1 50  ? 87.377  68.245 -18.620 1.00 22.59  ? 47   PHE B CZ  1 
ATOM   4527 N N   . LEU B 1 51  ? 89.929  69.647 -25.425 1.00 29.49  ? 48   LEU B N   1 
ATOM   4528 C CA  . LEU B 1 51  ? 89.872  69.970 -26.842 1.00 28.31  ? 48   LEU B CA  1 
ATOM   4529 C C   . LEU B 1 51  ? 90.950  69.225 -27.599 1.00 25.49  ? 48   LEU B C   1 
ATOM   4530 O O   . LEU B 1 51  ? 91.938  68.775 -27.004 1.00 25.04  ? 48   LEU B O   1 
ATOM   4531 C CB  . LEU B 1 51  ? 90.037  71.485 -27.058 1.00 31.42  ? 48   LEU B CB  1 
ATOM   4532 C CG  . LEU B 1 51  ? 88.921  72.385 -26.533 1.00 33.58  ? 48   LEU B CG  1 
ATOM   4533 C CD1 . LEU B 1 51  ? 89.147  73.820 -26.990 1.00 30.58  ? 48   LEU B CD1 1 
ATOM   4534 C CD2 . LEU B 1 51  ? 87.523  71.873 -26.944 1.00 35.05  ? 48   LEU B CD2 1 
ATOM   4535 N N   . PRO B 1 52  ? 90.788  69.051 -28.906 1.00 24.61  ? 49   PRO B N   1 
ATOM   4536 C CA  . PRO B 1 52  ? 91.843  68.445 -29.706 1.00 25.72  ? 49   PRO B CA  1 
ATOM   4537 C C   . PRO B 1 52  ? 93.135  69.240 -29.568 1.00 25.44  ? 49   PRO B C   1 
ATOM   4538 O O   . PRO B 1 52  ? 93.106  70.474 -29.395 1.00 24.03  ? 49   PRO B O   1 
ATOM   4539 C CB  . PRO B 1 52  ? 91.300  68.508 -31.136 1.00 24.54  ? 49   PRO B CB  1 
ATOM   4540 C CG  . PRO B 1 52  ? 89.834  68.545 -30.980 1.00 24.89  ? 49   PRO B CG  1 
ATOM   4541 C CD  . PRO B 1 52  ? 89.578  69.313 -29.718 1.00 27.28  ? 49   PRO B CD  1 
ATOM   4542 N N   . PRO B 1 53  ? 94.277  68.577 -29.640 1.00 18.68  ? 50   PRO B N   1 
ATOM   4543 C CA  . PRO B 1 53  ? 95.546  69.285 -29.489 1.00 22.70  ? 50   PRO B CA  1 
ATOM   4544 C C   . PRO B 1 53  ? 95.761  70.225 -30.659 1.00 34.93  ? 50   PRO B C   1 
ATOM   4545 O O   . PRO B 1 53  ? 95.198  70.053 -31.744 1.00 33.73  ? 50   PRO B O   1 
ATOM   4546 C CB  . PRO B 1 53  ? 96.585  68.164 -29.496 1.00 21.77  ? 50   PRO B CB  1 
ATOM   4547 C CG  . PRO B 1 53  ? 95.955  67.113 -30.381 1.00 22.60  ? 50   PRO B CG  1 
ATOM   4548 C CD  . PRO B 1 53  ? 94.469  67.185 -30.077 1.00 19.01  ? 50   PRO B CD  1 
ATOM   4549 N N   . GLU B 1 54  ? 96.584  71.239 -30.418 1.00 35.83  ? 51   GLU B N   1 
ATOM   4550 C CA  . GLU B 1 54  ? 96.982  72.162 -31.466 1.00 35.58  ? 51   GLU B CA  1 
ATOM   4551 C C   . GLU B 1 54  ? 98.483  72.095 -31.649 1.00 31.03  ? 51   GLU B C   1 
ATOM   4552 O O   . GLU B 1 54  ? 99.209  71.919 -30.664 1.00 31.17  ? 51   GLU B O   1 
ATOM   4553 C CB  . GLU B 1 54  ? 96.583  73.587 -31.126 1.00 37.55  ? 51   GLU B CB  1 
ATOM   4554 C CG  . GLU B 1 54  ? 95.118  73.728 -30.935 1.00 45.76  ? 51   GLU B CG  1 
ATOM   4555 C CD  . GLU B 1 54  ? 94.694  75.155 -31.050 1.00 66.81  ? 51   GLU B CD  1 
ATOM   4556 O OE1 . GLU B 1 54  ? 94.941  75.924 -30.084 1.00 55.80  ? 51   GLU B OE1 1 
ATOM   4557 O OE2 . GLU B 1 54  ? 94.148  75.507 -32.124 1.00 71.53  ? 51   GLU B OE2 1 
ATOM   4558 N N   . PRO B 1 55  ? 98.980  72.211 -32.880 1.00 31.27  ? 52   PRO B N   1 
ATOM   4559 C CA  . PRO B 1 55  ? 100.420 72.052 -33.093 1.00 29.89  ? 52   PRO B CA  1 
ATOM   4560 C C   . PRO B 1 55  ? 101.179 73.102 -32.301 1.00 25.98  ? 52   PRO B C   1 
ATOM   4561 O O   . PRO B 1 55  ? 100.697 74.216 -32.084 1.00 28.53  ? 52   PRO B O   1 
ATOM   4562 C CB  . PRO B 1 55  ? 100.594 72.251 -34.608 1.00 32.22  ? 52   PRO B CB  1 
ATOM   4563 C CG  . PRO B 1 55  ? 99.213  72.139 -35.193 1.00 33.32  ? 52   PRO B CG  1 
ATOM   4564 C CD  . PRO B 1 55  ? 98.280  72.622 -34.110 1.00 32.65  ? 52   PRO B CD  1 
ATOM   4565 N N   . LYS B 1 56  ? 102.360 72.713 -31.836 1.00 26.03  ? 53   LYS B N   1 
ATOM   4566 C CA  . LYS B 1 56  ? 103.220 73.607 -31.078 1.00 30.00  ? 53   LYS B CA  1 
ATOM   4567 C C   . LYS B 1 56  ? 103.766 74.707 -31.994 1.00 33.95  ? 53   LYS B C   1 
ATOM   4568 O O   . LYS B 1 56  ? 104.485 74.423 -32.960 1.00 32.53  ? 53   LYS B O   1 
ATOM   4569 C CB  . LYS B 1 56  ? 104.354 72.798 -30.461 1.00 26.29  ? 53   LYS B CB  1 
ATOM   4570 C CG  . LYS B 1 56  ? 105.484 73.622 -29.848 1.00 29.73  ? 53   LYS B CG  1 
ATOM   4571 C CD  . LYS B 1 56  ? 105.023 74.355 -28.583 1.00 28.55  ? 53   LYS B CD  1 
ATOM   4572 C CE  . LYS B 1 56  ? 106.216 74.993 -27.860 1.00 28.28  ? 53   LYS B CE  1 
ATOM   4573 N NZ  . LYS B 1 56  ? 105.750 75.581 -26.572 1.00 27.94  ? 53   LYS B NZ  1 
ATOM   4574 N N   . GLN B 1 57  ? 103.430 75.958 -31.689 1.00 38.39  ? 54   GLN B N   1 
ATOM   4575 C CA  . GLN B 1 57  ? 103.957 77.084 -32.449 1.00 35.97  ? 54   GLN B CA  1 
ATOM   4576 C C   . GLN B 1 57  ? 105.483 77.161 -32.332 1.00 30.54  ? 54   GLN B C   1 
ATOM   4577 O O   . GLN B 1 57  ? 106.056 76.813 -31.291 1.00 29.74  ? 54   GLN B O   1 
ATOM   4578 C CB  . GLN B 1 57  ? 103.310 78.384 -31.978 1.00 34.90  ? 54   GLN B CB  1 
ATOM   4579 C CG  . GLN B 1 57  ? 101.787 78.422 -32.134 1.00 41.48  ? 54   GLN B CG  1 
ATOM   4580 C CD  . GLN B 1 57  ? 101.298 78.216 -33.569 1.00 55.73  ? 54   GLN B CD  1 
ATOM   4581 O OE1 . GLN B 1 57  ? 101.657 77.246 -34.254 1.00 58.74  ? 54   GLN B OE1 1 
ATOM   4582 N NE2 . GLN B 1 57  ? 100.454 79.128 -34.032 1.00 66.94  ? 54   GLN B NE2 1 
ATOM   4583 N N   . PRO B 1 58  ? 106.174 77.578 -33.401 1.00 33.56  ? 55   PRO B N   1 
ATOM   4584 C CA  . PRO B 1 58  ? 107.644 77.586 -33.372 1.00 33.45  ? 55   PRO B CA  1 
ATOM   4585 C C   . PRO B 1 58  ? 108.178 78.525 -32.298 1.00 28.18  ? 55   PRO B C   1 
ATOM   4586 O O   . PRO B 1 58  ? 107.511 79.467 -31.856 1.00 24.70  ? 55   PRO B O   1 
ATOM   4587 C CB  . PRO B 1 58  ? 108.039 78.076 -34.776 1.00 37.55  ? 55   PRO B CB  1 
ATOM   4588 C CG  . PRO B 1 58  ? 106.801 78.020 -35.594 1.00 29.70  ? 55   PRO B CG  1 
ATOM   4589 C CD  . PRO B 1 58  ? 105.652 78.173 -34.643 1.00 29.37  ? 55   PRO B CD  1 
ATOM   4590 N N   . TRP B 1 59  ? 109.407 78.250 -31.883 1.00 26.92  ? 56   TRP B N   1 
ATOM   4591 C CA  . TRP B 1 59  ? 110.028 78.924 -30.757 1.00 34.62  ? 56   TRP B CA  1 
ATOM   4592 C C   . TRP B 1 59  ? 111.376 79.487 -31.186 1.00 39.54  ? 56   TRP B C   1 
ATOM   4593 O O   . TRP B 1 59  ? 112.003 79.005 -32.134 1.00 35.99  ? 56   TRP B O   1 
ATOM   4594 C CB  . TRP B 1 59  ? 110.230 77.961 -29.574 1.00 26.89  ? 56   TRP B CB  1 
ATOM   4595 C CG  . TRP B 1 59  ? 111.119 76.774 -29.900 1.00 30.60  ? 56   TRP B CG  1 
ATOM   4596 C CD1 . TRP B 1 59  ? 112.474 76.699 -29.774 1.00 29.96  ? 56   TRP B CD1 1 
ATOM   4597 C CD2 . TRP B 1 59  ? 110.696 75.499 -30.405 1.00 31.43  ? 56   TRP B CD2 1 
ATOM   4598 N NE1 . TRP B 1 59  ? 112.930 75.456 -30.169 1.00 28.25  ? 56   TRP B NE1 1 
ATOM   4599 C CE2 . TRP B 1 59  ? 111.853 74.699 -30.552 1.00 30.84  ? 56   TRP B CE2 1 
ATOM   4600 C CE3 . TRP B 1 59  ? 109.451 74.952 -30.733 1.00 29.93  ? 56   TRP B CE3 1 
ATOM   4601 C CZ2 . TRP B 1 59  ? 111.802 73.385 -31.023 1.00 24.97  ? 56   TRP B CZ2 1 
ATOM   4602 C CZ3 . TRP B 1 59  ? 109.403 73.647 -31.204 1.00 29.97  ? 56   TRP B CZ3 1 
ATOM   4603 C CH2 . TRP B 1 59  ? 110.573 72.881 -31.344 1.00 26.17  ? 56   TRP B CH2 1 
ATOM   4604 N N   . SER B 1 60  ? 111.833 80.508 -30.470 1.00 45.25  ? 57   SER B N   1 
ATOM   4605 C CA  . SER B 1 60  ? 113.193 80.970 -30.701 1.00 41.64  ? 57   SER B CA  1 
ATOM   4606 C C   . SER B 1 60  ? 114.144 80.297 -29.717 1.00 39.44  ? 57   SER B C   1 
ATOM   4607 O O   . SER B 1 60  ? 113.741 79.786 -28.670 1.00 45.28  ? 57   SER B O   1 
ATOM   4608 C CB  . SER B 1 60  ? 113.280 82.492 -30.589 1.00 42.09  ? 57   SER B CB  1 
ATOM   4609 O OG  . SER B 1 60  ? 112.681 82.954 -29.392 1.00 56.37  ? 57   SER B OG  1 
ATOM   4610 N N   . GLY B 1 61  ? 115.410 80.273 -30.078 1.00 33.98  ? 58   GLY B N   1 
ATOM   4611 C CA  . GLY B 1 61  ? 116.397 79.732 -29.179 1.00 40.59  ? 58   GLY B CA  1 
ATOM   4612 C C   . GLY B 1 61  ? 116.447 78.221 -29.222 1.00 39.66  ? 58   GLY B C   1 
ATOM   4613 O O   . GLY B 1 61  ? 115.884 77.556 -30.099 1.00 41.75  ? 58   GLY B O   1 
ATOM   4614 N N   . VAL B 1 62  ? 117.157 77.675 -28.250 1.00 33.50  ? 59   VAL B N   1 
ATOM   4615 C CA  . VAL B 1 62  ? 117.392 76.244 -28.147 1.00 36.15  ? 59   VAL B CA  1 
ATOM   4616 C C   . VAL B 1 62  ? 116.544 75.716 -26.999 1.00 40.34  ? 59   VAL B C   1 
ATOM   4617 O O   . VAL B 1 62  ? 116.776 76.063 -25.832 1.00 40.46  ? 59   VAL B O   1 
ATOM   4618 C CB  . VAL B 1 62  ? 118.873 75.934 -27.928 1.00 34.14  ? 59   VAL B CB  1 
ATOM   4619 C CG1 . VAL B 1 62  ? 119.107 74.427 -27.898 1.00 30.42  ? 59   VAL B CG1 1 
ATOM   4620 C CG2 . VAL B 1 62  ? 119.709 76.614 -28.999 1.00 34.28  ? 59   VAL B CG2 1 
ATOM   4621 N N   . VAL B 1 63  ? 115.550 74.886 -27.326 1.00 35.60  ? 60   VAL B N   1 
ATOM   4622 C CA  . VAL B 1 63  ? 114.791 74.182 -26.296 1.00 29.82  ? 60   VAL B CA  1 
ATOM   4623 C C   . VAL B 1 63  ? 115.666 73.082 -25.710 1.00 27.35  ? 60   VAL B C   1 
ATOM   4624 O O   . VAL B 1 63  ? 116.338 72.342 -26.440 1.00 29.27  ? 60   VAL B O   1 
ATOM   4625 C CB  . VAL B 1 63  ? 113.479 73.637 -26.880 1.00 34.05  ? 60   VAL B CB  1 
ATOM   4626 C CG1 . VAL B 1 63  ? 112.910 72.523 -26.014 1.00 30.08  ? 60   VAL B CG1 1 
ATOM   4627 C CG2 . VAL B 1 63  ? 112.460 74.764 -27.005 1.00 27.14  ? 60   VAL B CG2 1 
ATOM   4628 N N   . ASP B 1 64  ? 115.739 73.024 -24.382 1.00 28.12  ? 61   ASP B N   1 
ATOM   4629 C CA  . ASP B 1 64  ? 116.500 71.959 -23.743 1.00 34.24  ? 61   ASP B CA  1 
ATOM   4630 C C   . ASP B 1 64  ? 115.707 70.664 -23.862 1.00 32.47  ? 61   ASP B C   1 
ATOM   4631 O O   . ASP B 1 64  ? 114.530 70.614 -23.489 1.00 30.20  ? 61   ASP B O   1 
ATOM   4632 C CB  . ASP B 1 64  ? 116.786 72.283 -22.277 1.00 35.19  ? 61   ASP B CB  1 
ATOM   4633 C CG  . ASP B 1 64  ? 117.811 71.340 -21.658 1.00 41.79  ? 61   ASP B CG  1 
ATOM   4634 O OD1 . ASP B 1 64  ? 117.429 70.208 -21.278 1.00 37.51  ? 61   ASP B OD1 1 
ATOM   4635 O OD2 . ASP B 1 64  ? 119.004 71.729 -21.552 1.00 45.05  ? 61   ASP B OD2 1 
ATOM   4636 N N   . ALA B 1 65  ? 116.334 69.643 -24.434 1.00 30.39  ? 62   ALA B N   1 
ATOM   4637 C CA  . ALA B 1 65  ? 115.700 68.342 -24.581 1.00 26.36  ? 62   ALA B CA  1 
ATOM   4638 C C   . ALA B 1 65  ? 116.611 67.324 -23.934 1.00 22.17  ? 62   ALA B C   1 
ATOM   4639 O O   . ALA B 1 65  ? 116.908 66.285 -24.521 1.00 22.68  ? 62   ALA B O   1 
ATOM   4640 C CB  . ALA B 1 65  ? 115.452 67.990 -26.059 1.00 22.24  ? 62   ALA B CB  1 
ATOM   4641 N N   . THR B 1 66  ? 117.073 67.622 -22.723 1.00 24.77  ? 63   THR B N   1 
ATOM   4642 C CA  . THR B 1 66  ? 117.963 66.716 -22.020 1.00 26.20  ? 63   THR B CA  1 
ATOM   4643 C C   . THR B 1 66  ? 117.259 65.877 -20.959 1.00 22.84  ? 63   THR B C   1 
ATOM   4644 O O   . THR B 1 66  ? 117.892 64.983 -20.390 1.00 23.01  ? 63   THR B O   1 
ATOM   4645 C CB  . THR B 1 66  ? 119.117 67.497 -21.369 1.00 31.29  ? 63   THR B CB  1 
ATOM   4646 O OG1 . THR B 1 66  ? 118.590 68.398 -20.383 1.00 30.43  ? 63   THR B OG1 1 
ATOM   4647 C CG2 . THR B 1 66  ? 119.877 68.297 -22.429 1.00 20.87  ? 63   THR B CG2 1 
ATOM   4648 N N   . THR B 1 67  ? 115.980 66.135 -20.676 1.00 23.81  ? 64   THR B N   1 
ATOM   4649 C CA  . THR B 1 67  ? 115.276 65.357 -19.663 1.00 25.84  ? 64   THR B CA  1 
ATOM   4650 C C   . THR B 1 67  ? 113.802 65.227 -20.042 1.00 20.46  ? 64   THR B C   1 
ATOM   4651 O O   . THR B 1 67  ? 113.255 66.034 -20.804 1.00 20.40  ? 64   THR B O   1 
ATOM   4652 C CB  . THR B 1 67  ? 115.430 65.989 -18.265 1.00 32.24  ? 64   THR B CB  1 
ATOM   4653 O OG1 . THR B 1 67  ? 114.984 65.061 -17.258 1.00 40.26  ? 64   THR B OG1 1 
ATOM   4654 C CG2 . THR B 1 67  ? 114.608 67.263 -18.165 1.00 21.81  ? 64   THR B CG2 1 
ATOM   4655 N N   . PHE B 1 68  ? 113.156 64.195 -19.496 1.00 20.69  ? 65   PHE B N   1 
ATOM   4656 C CA  . PHE B 1 68  ? 111.733 63.988 -19.750 1.00 21.35  ? 65   PHE B CA  1 
ATOM   4657 C C   . PHE B 1 68  ? 110.911 65.137 -19.177 1.00 19.45  ? 65   PHE B C   1 
ATOM   4658 O O   . PHE B 1 68  ? 111.243 65.725 -18.144 1.00 22.14  ? 65   PHE B O   1 
ATOM   4659 C CB  . PHE B 1 68  ? 111.250 62.664 -19.139 1.00 20.46  ? 65   PHE B CB  1 
ATOM   4660 C CG  . PHE B 1 68  ? 111.794 61.444 -19.816 1.00 14.79  ? 65   PHE B CG  1 
ATOM   4661 C CD1 . PHE B 1 68  ? 111.354 61.080 -21.083 1.00 18.38  ? 65   PHE B CD1 1 
ATOM   4662 C CD2 . PHE B 1 68  ? 112.711 60.639 -19.176 1.00 20.78  ? 65   PHE B CD2 1 
ATOM   4663 C CE1 . PHE B 1 68  ? 111.857 59.944 -21.704 1.00 19.77  ? 65   PHE B CE1 1 
ATOM   4664 C CE2 . PHE B 1 68  ? 113.210 59.495 -19.788 1.00 22.90  ? 65   PHE B CE2 1 
ATOM   4665 C CZ  . PHE B 1 68  ? 112.779 59.150 -21.053 1.00 17.59  ? 65   PHE B CZ  1 
ATOM   4666 N N   . GLN B 1 69  ? 109.832 65.449 -19.854 1.00 21.12  ? 66   GLN B N   1 
ATOM   4667 C CA  . GLN B 1 69  ? 108.917 66.473 -19.390 1.00 22.01  ? 66   GLN B CA  1 
ATOM   4668 C C   . GLN B 1 69  ? 107.876 65.877 -18.440 1.00 23.09  ? 66   GLN B C   1 
ATOM   4669 O O   . GLN B 1 69  ? 107.953 64.713 -18.039 1.00 20.81  ? 66   GLN B O   1 
ATOM   4670 C CB  . GLN B 1 69  ? 108.265 67.156 -20.580 1.00 19.82  ? 66   GLN B CB  1 
ATOM   4671 C CG  . GLN B 1 69  ? 108.998 68.390 -21.020 1.00 30.68  ? 66   GLN B CG  1 
ATOM   4672 C CD  . GLN B 1 69  ? 108.793 69.560 -20.047 1.00 32.51  ? 66   GLN B CD  1 
ATOM   4673 O OE1 . GLN B 1 69  ? 107.983 69.486 -19.104 1.00 31.43  ? 66   GLN B OE1 1 
ATOM   4674 N NE2 . GLN B 1 69  ? 109.530 70.635 -20.270 1.00 28.61  ? 66   GLN B NE2 1 
ATOM   4675 N N   . SER B 1 70  ? 106.882 66.682 -18.085 1.00 22.23  ? 67   SER B N   1 
ATOM   4676 C CA  . SER B 1 70  ? 105.906 66.314 -17.072 1.00 22.16  ? 67   SER B CA  1 
ATOM   4677 C C   . SER B 1 70  ? 105.024 65.148 -17.536 1.00 28.34  ? 67   SER B C   1 
ATOM   4678 O O   . SER B 1 70  ? 104.790 64.953 -18.733 1.00 22.38  ? 67   SER B O   1 
ATOM   4679 C CB  . SER B 1 70  ? 105.032 67.525 -16.739 1.00 22.66  ? 67   SER B CB  1 
ATOM   4680 O OG  . SER B 1 70  ? 105.798 68.595 -16.185 1.00 28.20  ? 67   SER B OG  1 
ATOM   4681 N N   . VAL B 1 71  ? 104.514 64.383 -16.560 1.00 23.50  ? 68   VAL B N   1 
ATOM   4682 C CA  . VAL B 1 71  ? 103.538 63.318 -16.803 1.00 22.66  ? 68   VAL B CA  1 
ATOM   4683 C C   . VAL B 1 71  ? 102.144 63.923 -16.855 1.00 17.47  ? 68   VAL B C   1 
ATOM   4684 O O   . VAL B 1 71  ? 101.821 64.828 -16.076 1.00 21.71  ? 68   VAL B O   1 
ATOM   4685 C CB  . VAL B 1 71  ? 103.655 62.244 -15.700 1.00 20.99  ? 68   VAL B CB  1 
ATOM   4686 C CG1 . VAL B 1 71  ? 102.540 61.169 -15.806 1.00 19.97  ? 68   VAL B CG1 1 
ATOM   4687 C CG2 . VAL B 1 71  ? 105.022 61.622 -15.750 1.00 17.64  ? 68   VAL B CG2 1 
ATOM   4688 N N   . CYS B 1 72  ? 101.306 63.453 -17.783 1.00 17.66  ? 69   CYS B N   1 
ATOM   4689 C CA  . CYS B 1 72  ? 99.932  63.957 -17.839 1.00 16.25  ? 69   CYS B CA  1 
ATOM   4690 C C   . CYS B 1 72  ? 99.179  63.531 -16.577 1.00 17.79  ? 69   CYS B C   1 
ATOM   4691 O O   . CYS B 1 72  ? 99.387  62.426 -16.072 1.00 18.56  ? 69   CYS B O   1 
ATOM   4692 C CB  . CYS B 1 72  ? 99.207  63.428 -19.086 1.00 23.66  ? 69   CYS B CB  1 
ATOM   4693 S SG  . CYS B 1 72  ? 99.941  63.841 -20.720 1.00 25.62  ? 69   CYS B SG  1 
ATOM   4694 N N   . TYR B 1 73  ? 98.306  64.412 -16.077 1.00 18.01  ? 70   TYR B N   1 
ATOM   4695 C CA  . TYR B 1 73  ? 97.536  64.153 -14.859 1.00 18.70  ? 70   TYR B CA  1 
ATOM   4696 C C   . TYR B 1 73  ? 96.830  62.811 -14.907 1.00 23.74  ? 70   TYR B C   1 
ATOM   4697 O O   . TYR B 1 73  ? 96.227  62.442 -15.917 1.00 18.12  ? 70   TYR B O   1 
ATOM   4698 C CB  . TYR B 1 73  ? 96.476  65.228 -14.625 1.00 22.50  ? 70   TYR B CB  1 
ATOM   4699 C CG  . TYR B 1 73  ? 96.911  66.277 -13.630 1.00 28.06  ? 70   TYR B CG  1 
ATOM   4700 C CD1 . TYR B 1 73  ? 96.840  66.052 -12.253 1.00 22.96  ? 70   TYR B CD1 1 
ATOM   4701 C CD2 . TYR B 1 73  ? 97.415  67.491 -14.077 1.00 27.61  ? 70   TYR B CD2 1 
ATOM   4702 C CE1 . TYR B 1 73  ? 97.275  67.041 -11.341 1.00 21.76  ? 70   TYR B CE1 1 
ATOM   4703 C CE2 . TYR B 1 73  ? 97.827  68.464 -13.195 1.00 26.00  ? 70   TYR B CE2 1 
ATOM   4704 C CZ  . TYR B 1 73  ? 97.763  68.240 -11.844 1.00 25.44  ? 70   TYR B CZ  1 
ATOM   4705 O OH  . TYR B 1 73  ? 98.187  69.261 -11.023 1.00 35.14  ? 70   TYR B OH  1 
ATOM   4706 N N   . GLN B 1 74  ? 96.873  62.106 -13.785 1.00 21.65  ? 71   GLN B N   1 
ATOM   4707 C CA  . GLN B 1 74  ? 96.436  60.722 -13.789 1.00 20.90  ? 71   GLN B CA  1 
ATOM   4708 C C   . GLN B 1 74  ? 96.395  60.214 -12.363 1.00 21.70  ? 71   GLN B C   1 
ATOM   4709 O O   . GLN B 1 74  ? 97.130  60.689 -11.489 1.00 17.21  ? 71   GLN B O   1 
ATOM   4710 C CB  . GLN B 1 74  ? 97.358  59.837 -14.647 1.00 18.14  ? 71   GLN B CB  1 
ATOM   4711 C CG  . GLN B 1 74  ? 98.796  59.618 -14.141 1.00 16.08  ? 71   GLN B CG  1 
ATOM   4712 C CD  . GLN B 1 74  ? 99.656  58.962 -15.217 1.00 18.48  ? 71   GLN B CD  1 
ATOM   4713 O OE1 . GLN B 1 74  ? 100.227 57.876 -15.028 1.00 16.07  ? 71   GLN B OE1 1 
ATOM   4714 N NE2 . GLN B 1 74  ? 99.735  59.622 -16.372 1.00 17.02  ? 71   GLN B NE2 1 
ATOM   4715 N N   . TYR B 1 75  ? 95.507  59.255 -12.151 1.00 23.46  ? 72   TYR B N   1 
ATOM   4716 C CA  . TYR B 1 75  ? 95.500  58.477 -10.932 1.00 23.42  ? 72   TYR B CA  1 
ATOM   4717 C C   . TYR B 1 75  ? 96.872  57.862 -10.681 1.00 22.92  ? 72   TYR B C   1 
ATOM   4718 O O   . TYR B 1 75  ? 97.588  57.488 -11.619 1.00 27.08  ? 72   TYR B O   1 
ATOM   4719 C CB  . TYR B 1 75  ? 94.428  57.391 -11.047 1.00 22.17  ? 72   TYR B CB  1 
ATOM   4720 C CG  . TYR B 1 75  ? 94.351  56.485 -9.852  1.00 21.29  ? 72   TYR B CG  1 
ATOM   4721 C CD1 . TYR B 1 75  ? 93.624  56.846 -8.729  1.00 26.09  ? 72   TYR B CD1 1 
ATOM   4722 C CD2 . TYR B 1 75  ? 95.006  55.259 -9.847  1.00 25.90  ? 72   TYR B CD2 1 
ATOM   4723 C CE1 . TYR B 1 75  ? 93.561  56.009 -7.621  1.00 26.02  ? 72   TYR B CE1 1 
ATOM   4724 C CE2 . TYR B 1 75  ? 94.947  54.424 -8.756  1.00 32.07  ? 72   TYR B CE2 1 
ATOM   4725 C CZ  . TYR B 1 75  ? 94.211  54.800 -7.645  1.00 31.04  ? 72   TYR B CZ  1 
ATOM   4726 O OH  . TYR B 1 75  ? 94.153  53.964 -6.554  1.00 41.65  ? 72   TYR B OH  1 
ATOM   4727 N N   . VAL B 1 76  ? 97.235  57.767 -9.404  1.00 15.61  ? 73   VAL B N   1 
ATOM   4728 C CA  . VAL B 1 76  ? 98.486  57.158 -8.965  1.00 18.55  ? 73   VAL B CA  1 
ATOM   4729 C C   . VAL B 1 76  ? 98.143  55.942 -8.123  1.00 22.05  ? 73   VAL B C   1 
ATOM   4730 O O   . VAL B 1 76  ? 97.348  56.045 -7.185  1.00 24.02  ? 73   VAL B O   1 
ATOM   4731 C CB  . VAL B 1 76  ? 99.343  58.152 -8.160  1.00 21.00  ? 73   VAL B CB  1 
ATOM   4732 C CG1 . VAL B 1 76  ? 100.431 57.424 -7.381  1.00 20.12  ? 73   VAL B CG1 1 
ATOM   4733 C CG2 . VAL B 1 76  ? 99.937  59.187 -9.101  1.00 18.68  ? 73   VAL B CG2 1 
ATOM   4734 N N   . ASP B 1 77  ? 98.750  54.801 -8.444  1.00 24.50  ? 74   ASP B N   1 
ATOM   4735 C CA  . ASP B 1 77  ? 98.418  53.561 -7.751  1.00 25.97  ? 74   ASP B CA  1 
ATOM   4736 C C   . ASP B 1 77  ? 99.009  53.563 -6.351  1.00 26.43  ? 74   ASP B C   1 
ATOM   4737 O O   . ASP B 1 77  ? 100.226 53.703 -6.176  1.00 29.33  ? 74   ASP B O   1 
ATOM   4738 C CB  . ASP B 1 77  ? 98.923  52.346 -8.515  1.00 22.89  ? 74   ASP B CB  1 
ATOM   4739 C CG  . ASP B 1 77  ? 98.370  51.034 -7.945  1.00 33.98  ? 74   ASP B CG  1 
ATOM   4740 O OD1 . ASP B 1 77  ? 98.749  50.639 -6.812  1.00 34.30  ? 74   ASP B OD1 1 
ATOM   4741 O OD2 . ASP B 1 77  ? 97.541  50.408 -8.634  1.00 35.40  ? 74   ASP B OD2 1 
ATOM   4742 N N   . THR B 1 78  ? 98.149  53.371 -5.358  1.00 25.96  ? 75   THR B N   1 
ATOM   4743 C CA  . THR B 1 78  ? 98.576  53.306 -3.970  1.00 33.40  ? 75   THR B CA  1 
ATOM   4744 C C   . THR B 1 78  ? 98.205  51.980 -3.300  1.00 38.73  ? 75   THR B C   1 
ATOM   4745 O O   . THR B 1 78  ? 98.308  51.874 -2.072  1.00 50.27  ? 75   THR B O   1 
ATOM   4746 C CB  . THR B 1 78  ? 97.980  54.494 -3.203  1.00 38.76  ? 75   THR B CB  1 
ATOM   4747 O OG1 . THR B 1 78  ? 96.569  54.564 -3.461  1.00 36.71  ? 75   THR B OG1 1 
ATOM   4748 C CG2 . THR B 1 78  ? 98.640  55.796 -3.658  1.00 31.86  ? 75   THR B CG2 1 
ATOM   4749 N N   . LEU B 1 79  ? 97.802  50.960 -4.074  1.00 41.32  ? 76   LEU B N   1 
ATOM   4750 C CA  . LEU B 1 79  ? 97.405  49.677 -3.487  1.00 43.69  ? 76   LEU B CA  1 
ATOM   4751 C C   . LEU B 1 79  ? 98.547  49.037 -2.698  1.00 46.62  ? 76   LEU B C   1 
ATOM   4752 O O   . LEU B 1 79  ? 98.291  48.320 -1.725  1.00 49.85  ? 76   LEU B O   1 
ATOM   4753 C CB  . LEU B 1 79  ? 96.888  48.720 -4.577  1.00 43.03  ? 76   LEU B CB  1 
ATOM   4754 C CG  . LEU B 1 79  ? 95.904  47.602 -4.168  1.00 49.50  ? 76   LEU B CG  1 
ATOM   4755 C CD1 . LEU B 1 79  ? 94.486  48.176 -4.100  1.00 58.34  ? 76   LEU B CD1 1 
ATOM   4756 C CD2 . LEU B 1 79  ? 95.885  46.384 -5.116  1.00 42.92  ? 76   LEU B CD2 1 
ATOM   4757 N N   . TYR B 1 80  ? 99.804  49.315 -3.061  1.00 42.61  ? 77   TYR B N   1 
ATOM   4758 C CA  . TYR B 1 80  ? 100.960 48.730 -2.375  1.00 30.55  ? 77   TYR B CA  1 
ATOM   4759 C C   . TYR B 1 80  ? 102.119 49.704 -2.322  1.00 32.33  ? 77   TYR B C   1 
ATOM   4760 O O   . TYR B 1 80  ? 103.064 49.612 -3.118  1.00 32.42  ? 77   TYR B O   1 
ATOM   4761 C CB  . TYR B 1 80  ? 101.420 47.452 -3.062  1.00 29.53  ? 77   TYR B CB  1 
ATOM   4762 C CG  . TYR B 1 80  ? 100.372 46.394 -3.219  1.00 31.09  ? 77   TYR B CG  1 
ATOM   4763 C CD1 . TYR B 1 80  ? 99.905  45.682 -2.124  1.00 29.03  ? 77   TYR B CD1 1 
ATOM   4764 C CD2 . TYR B 1 80  ? 99.892  46.064 -4.469  1.00 32.10  ? 77   TYR B CD2 1 
ATOM   4765 C CE1 . TYR B 1 80  ? 98.977  44.690 -2.277  1.00 33.60  ? 77   TYR B CE1 1 
ATOM   4766 C CE2 . TYR B 1 80  ? 98.968  45.077 -4.636  1.00 33.32  ? 77   TYR B CE2 1 
ATOM   4767 C CZ  . TYR B 1 80  ? 98.500  44.391 -3.550  1.00 41.96  ? 77   TYR B CZ  1 
ATOM   4768 O OH  . TYR B 1 80  ? 97.561  43.396 -3.756  1.00 38.68  ? 77   TYR B OH  1 
ATOM   4769 N N   . PRO B 1 81  ? 102.120 50.613 -1.345  1.00 38.05  ? 78   PRO B N   1 
ATOM   4770 C CA  . PRO B 1 81  ? 103.199 51.609 -1.253  1.00 30.84  ? 78   PRO B CA  1 
ATOM   4771 C C   . PRO B 1 81  ? 104.574 50.964 -1.186  1.00 29.80  ? 78   PRO B C   1 
ATOM   4772 O O   . PRO B 1 81  ? 104.784 49.971 -0.491  1.00 35.97  ? 78   PRO B O   1 
ATOM   4773 C CB  . PRO B 1 81  ? 102.875 52.358 0.048   1.00 33.88  ? 78   PRO B CB  1 
ATOM   4774 C CG  . PRO B 1 81  ? 101.398 52.208 0.208   1.00 36.03  ? 78   PRO B CG  1 
ATOM   4775 C CD  . PRO B 1 81  ? 101.029 50.868 -0.384  1.00 36.43  ? 78   PRO B CD  1 
ATOM   4776 N N   . GLY B 1 82  ? 105.519 51.542 -1.917  1.00 28.93  ? 79   GLY B N   1 
ATOM   4777 C CA  . GLY B 1 82  ? 106.874 51.030 -1.954  1.00 29.22  ? 79   GLY B CA  1 
ATOM   4778 C C   . GLY B 1 82  ? 107.102 49.791 -2.801  1.00 30.25  ? 79   GLY B C   1 
ATOM   4779 O O   . GLY B 1 82  ? 108.260 49.395 -2.981  1.00 29.92  ? 79   GLY B O   1 
ATOM   4780 N N   . PHE B 1 83  ? 106.052 49.171 -3.340  1.00 28.08  ? 80   PHE B N   1 
ATOM   4781 C CA  . PHE B 1 83  ? 106.193 47.900 -4.051  1.00 25.90  ? 80   PHE B CA  1 
ATOM   4782 C C   . PHE B 1 83  ? 106.614 48.138 -5.500  1.00 21.14  ? 80   PHE B C   1 
ATOM   4783 O O   . PHE B 1 83  ? 105.954 48.879 -6.236  1.00 21.53  ? 80   PHE B O   1 
ATOM   4784 C CB  . PHE B 1 83  ? 104.872 47.125 -3.990  1.00 22.38  ? 80   PHE B CB  1 
ATOM   4785 C CG  . PHE B 1 83  ? 104.867 45.828 -4.759  1.00 18.77  ? 80   PHE B CG  1 
ATOM   4786 C CD1 . PHE B 1 83  ? 105.777 44.817 -4.468  1.00 22.77  ? 80   PHE B CD1 1 
ATOM   4787 C CD2 . PHE B 1 83  ? 103.910 45.602 -5.742  1.00 19.32  ? 80   PHE B CD2 1 
ATOM   4788 C CE1 . PHE B 1 83  ? 105.751 43.605 -5.171  1.00 21.66  ? 80   PHE B CE1 1 
ATOM   4789 C CE2 . PHE B 1 83  ? 103.869 44.396 -6.448  1.00 18.93  ? 80   PHE B CE2 1 
ATOM   4790 C CZ  . PHE B 1 83  ? 104.790 43.404 -6.167  1.00 18.63  ? 80   PHE B CZ  1 
ATOM   4791 N N   . GLU B 1 84  ? 107.704 47.491 -5.909  1.00 21.80  ? 81   GLU B N   1 
ATOM   4792 C CA  . GLU B 1 84  ? 108.237 47.714 -7.249  1.00 24.54  ? 81   GLU B CA  1 
ATOM   4793 C C   . GLU B 1 84  ? 107.224 47.335 -8.322  1.00 26.45  ? 81   GLU B C   1 
ATOM   4794 O O   . GLU B 1 84  ? 107.106 48.021 -9.346  1.00 23.12  ? 81   GLU B O   1 
ATOM   4795 C CB  . GLU B 1 84  ? 109.532 46.926 -7.427  1.00 23.75  ? 81   GLU B CB  1 
ATOM   4796 C CG  . GLU B 1 84  ? 109.985 46.817 -8.885  1.00 40.69  ? 81   GLU B CG  1 
ATOM   4797 C CD  . GLU B 1 84  ? 111.310 46.068 -9.045  1.00 46.15  ? 81   GLU B CD  1 
ATOM   4798 O OE1 . GLU B 1 84  ? 112.326 46.742 -9.330  1.00 61.90  ? 81   GLU B OE1 1 
ATOM   4799 O OE2 . GLU B 1 84  ? 111.337 44.816 -8.897  1.00 42.04  ? 81   GLU B OE2 1 
ATOM   4800 N N   . GLY B 1 85  ? 106.461 46.263 -8.085  1.00 24.44  ? 82   GLY B N   1 
ATOM   4801 C CA  . GLY B 1 85  ? 105.562 45.750 -9.105  1.00 22.55  ? 82   GLY B CA  1 
ATOM   4802 C C   . GLY B 1 85  ? 104.505 46.741 -9.531  1.00 19.95  ? 82   GLY B C   1 
ATOM   4803 O O   . GLY B 1 85  ? 104.067 46.726 -10.682 1.00 19.16  ? 82   GLY B O   1 
ATOM   4804 N N   . THR B 1 86  ? 104.090 47.629 -8.630  1.00 17.60  ? 83   THR B N   1 
ATOM   4805 C CA  . THR B 1 86  ? 103.160 48.683 -9.035  1.00 19.42  ? 83   THR B CA  1 
ATOM   4806 C C   . THR B 1 86  ? 103.833 50.032 -9.262  1.00 19.32  ? 83   THR B C   1 
ATOM   4807 O O   . THR B 1 86  ? 103.396 50.794 -10.136 1.00 16.37  ? 83   THR B O   1 
ATOM   4808 C CB  . THR B 1 86  ? 102.048 48.862 -7.988  1.00 21.81  ? 83   THR B CB  1 
ATOM   4809 O OG1 . THR B 1 86  ? 102.626 48.940 -6.680  1.00 21.13  ? 83   THR B OG1 1 
ATOM   4810 C CG2 . THR B 1 86  ? 101.071 47.702 -8.042  1.00 20.56  ? 83   THR B CG2 1 
ATOM   4811 N N   . GLU B 1 87  ? 104.858 50.361 -8.470  1.00 15.90  ? 84   GLU B N   1 
ATOM   4812 C CA  . GLU B 1 87  ? 105.468 51.683 -8.568  1.00 22.36  ? 84   GLU B CA  1 
ATOM   4813 C C   . GLU B 1 87  ? 106.138 51.887 -9.916  1.00 19.72  ? 84   GLU B C   1 
ATOM   4814 O O   . GLU B 1 87  ? 106.209 53.017 -10.389 1.00 20.85  ? 84   GLU B O   1 
ATOM   4815 C CB  . GLU B 1 87  ? 106.497 51.900 -7.455  1.00 24.81  ? 84   GLU B CB  1 
ATOM   4816 C CG  . GLU B 1 87  ? 105.956 51.812 -6.036  1.00 28.76  ? 84   GLU B CG  1 
ATOM   4817 C CD  . GLU B 1 87  ? 105.287 53.068 -5.568  1.00 39.00  ? 84   GLU B CD  1 
ATOM   4818 O OE1 . GLU B 1 87  ? 105.048 53.169 -4.334  1.00 36.36  ? 84   GLU B OE1 1 
ATOM   4819 O OE2 . GLU B 1 87  ? 105.007 53.952 -6.427  1.00 43.41  ? 84   GLU B OE2 1 
ATOM   4820 N N   . MET B 1 88  ? 106.604 50.809 -10.550 1.00 16.51  ? 85   MET B N   1 
ATOM   4821 C CA  . MET B 1 88  ? 107.234 50.916 -11.863 1.00 20.01  ? 85   MET B CA  1 
ATOM   4822 C C   . MET B 1 88  ? 106.315 51.514 -12.914 1.00 17.86  ? 85   MET B C   1 
ATOM   4823 O O   . MET B 1 88  ? 106.800 51.937 -13.966 1.00 18.36  ? 85   MET B O   1 
ATOM   4824 C CB  . MET B 1 88  ? 107.726 49.547 -12.339 1.00 21.12  ? 85   MET B CB  1 
ATOM   4825 C CG  . MET B 1 88  ? 106.610 48.521 -12.610 1.00 19.81  ? 85   MET B CG  1 
ATOM   4826 S SD  . MET B 1 88  ? 107.307 46.921 -13.096 1.00 21.24  ? 85   MET B SD  1 
ATOM   4827 C CE  . MET B 1 88  ? 107.566 47.234 -14.857 1.00 17.40  ? 85   MET B CE  1 
ATOM   4828 N N   . TRP B 1 89  ? 105.011 51.574 -12.664 1.00 18.01  ? 86   TRP B N   1 
ATOM   4829 C CA  . TRP B 1 89  ? 104.082 52.130 -13.634 1.00 15.74  ? 86   TRP B CA  1 
ATOM   4830 C C   . TRP B 1 89  ? 103.609 53.538 -13.268 1.00 20.48  ? 86   TRP B C   1 
ATOM   4831 O O   . TRP B 1 89  ? 102.993 54.213 -14.102 1.00 16.11  ? 86   TRP B O   1 
ATOM   4832 C CB  . TRP B 1 89  ? 102.857 51.200 -13.776 1.00 18.57  ? 86   TRP B CB  1 
ATOM   4833 C CG  . TRP B 1 89  ? 103.193 49.754 -14.044 1.00 23.01  ? 86   TRP B CG  1 
ATOM   4834 C CD1 . TRP B 1 89  ? 103.084 48.701 -13.162 1.00 21.49  ? 86   TRP B CD1 1 
ATOM   4835 C CD2 . TRP B 1 89  ? 103.699 49.196 -15.268 1.00 22.72  ? 86   TRP B CD2 1 
ATOM   4836 N NE1 . TRP B 1 89  ? 103.488 47.524 -13.770 1.00 17.71  ? 86   TRP B NE1 1 
ATOM   4837 C CE2 . TRP B 1 89  ? 103.859 47.800 -15.062 1.00 23.51  ? 86   TRP B CE2 1 
ATOM   4838 C CE3 . TRP B 1 89  ? 104.018 49.731 -16.523 1.00 23.86  ? 86   TRP B CE3 1 
ATOM   4839 C CZ2 . TRP B 1 89  ? 104.332 46.941 -16.067 1.00 22.14  ? 86   TRP B CZ2 1 
ATOM   4840 C CZ3 . TRP B 1 89  ? 104.487 48.867 -17.522 1.00 23.95  ? 86   TRP B CZ3 1 
ATOM   4841 C CH2 . TRP B 1 89  ? 104.634 47.486 -17.282 1.00 20.31  ? 86   TRP B CH2 1 
ATOM   4842 N N   . ASN B 1 90  ? 103.864 53.980 -12.044 1.00 19.96  ? 87   ASN B N   1 
ATOM   4843 C CA  . ASN B 1 90  ? 103.400 55.259 -11.532 1.00 19.41  ? 87   ASN B CA  1 
ATOM   4844 C C   . ASN B 1 90  ? 104.232 56.408 -12.111 1.00 17.56  ? 87   ASN B C   1 
ATOM   4845 O O   . ASN B 1 90  ? 105.363 56.201 -12.553 1.00 15.51  ? 87   ASN B O   1 
ATOM   4846 C CB  . ASN B 1 90  ? 103.487 55.253 -10.002 1.00 18.96  ? 87   ASN B CB  1 
ATOM   4847 C CG  . ASN B 1 90  ? 102.255 54.628 -9.346  1.00 21.08  ? 87   ASN B CG  1 
ATOM   4848 O OD1 . ASN B 1 90  ? 101.204 54.530 -9.969  1.00 21.49  ? 87   ASN B OD1 1 
ATOM   4849 N ND2 . ASN B 1 90  ? 102.371 54.254 -8.077  1.00 19.81  ? 87   ASN B ND2 1 
ATOM   4850 N N   . PRO B 1 91  ? 103.685 57.627 -12.116 1.00 19.80  ? 88   PRO B N   1 
ATOM   4851 C CA  . PRO B 1 91  ? 104.443 58.787 -12.611 1.00 22.12  ? 88   PRO B CA  1 
ATOM   4852 C C   . PRO B 1 91  ? 105.804 58.911 -11.942 1.00 20.61  ? 88   PRO B C   1 
ATOM   4853 O O   . PRO B 1 91  ? 105.955 58.685 -10.743 1.00 16.72  ? 88   PRO B O   1 
ATOM   4854 C CB  . PRO B 1 91  ? 103.543 59.975 -12.255 1.00 19.64  ? 88   PRO B CB  1 
ATOM   4855 C CG  . PRO B 1 91  ? 102.141 59.382 -12.248 1.00 22.68  ? 88   PRO B CG  1 
ATOM   4856 C CD  . PRO B 1 91  ? 102.318 57.993 -11.695 1.00 18.54  ? 88   PRO B CD  1 
ATOM   4857 N N   . ASN B 1 92  ? 106.811 59.243 -12.746 1.00 20.60  ? 89   ASN B N   1 
ATOM   4858 C CA  . ASN B 1 92  ? 108.158 59.472 -12.249 1.00 19.39  ? 89   ASN B CA  1 
ATOM   4859 C C   . ASN B 1 92  ? 108.648 60.874 -12.597 1.00 18.11  ? 89   ASN B C   1 
ATOM   4860 O O   . ASN B 1 92  ? 109.847 61.130 -12.525 1.00 25.53  ? 89   ASN B O   1 
ATOM   4861 C CB  . ASN B 1 92  ? 109.118 58.412 -12.790 1.00 20.74  ? 89   ASN B CB  1 
ATOM   4862 C CG  . ASN B 1 92  ? 109.248 58.457 -14.321 1.00 20.79  ? 89   ASN B CG  1 
ATOM   4863 O OD1 . ASN B 1 92  ? 108.408 59.035 -15.031 1.00 20.12  ? 89   ASN B OD1 1 
ATOM   4864 N ND2 . ASN B 1 92  ? 110.297 57.833 -14.828 1.00 22.90  ? 89   ASN B ND2 1 
ATOM   4865 N N   . ARG B 1 93  ? 107.746 61.752 -13.028 1.00 20.46  ? 90   ARG B N   1 
ATOM   4866 C CA  . ARG B 1 93  ? 107.931 63.192 -13.120 1.00 19.63  ? 90   ARG B CA  1 
ATOM   4867 C C   . ARG B 1 93  ? 106.666 63.829 -12.557 1.00 25.85  ? 90   ARG B C   1 
ATOM   4868 O O   . ARG B 1 93  ? 105.651 63.158 -12.368 1.00 25.56  ? 90   ARG B O   1 
ATOM   4869 C CB  . ARG B 1 93  ? 108.159 63.666 -14.564 1.00 20.09  ? 90   ARG B CB  1 
ATOM   4870 C CG  . ARG B 1 93  ? 109.365 63.037 -15.271 1.00 27.97  ? 90   ARG B CG  1 
ATOM   4871 C CD  . ARG B 1 93  ? 110.676 63.550 -14.679 1.00 28.38  ? 90   ARG B CD  1 
ATOM   4872 N NE  . ARG B 1 93  ? 111.887 63.079 -15.357 1.00 22.28  ? 90   ARG B NE  1 
ATOM   4873 C CZ  . ARG B 1 93  ? 112.494 61.928 -15.084 1.00 29.82  ? 90   ARG B CZ  1 
ATOM   4874 N NH1 . ARG B 1 93  ? 111.984 61.109 -14.177 1.00 27.20  ? 90   ARG B NH1 1 
ATOM   4875 N NH2 . ARG B 1 93  ? 113.608 61.581 -15.725 1.00 31.61  ? 90   ARG B NH2 1 
ATOM   4876 N N   . GLU B 1 94  ? 106.717 65.132 -12.302 1.00 27.29  ? 91   GLU B N   1 
ATOM   4877 C CA  . GLU B 1 94  ? 105.556 65.828 -11.769 1.00 26.11  ? 91   GLU B CA  1 
ATOM   4878 C C   . GLU B 1 94  ? 104.376 65.736 -12.733 1.00 24.84  ? 91   GLU B C   1 
ATOM   4879 O O   . GLU B 1 94  ? 104.545 65.683 -13.953 1.00 21.75  ? 91   GLU B O   1 
ATOM   4880 C CB  . GLU B 1 94  ? 105.896 67.302 -11.493 1.00 26.71  ? 91   GLU B CB  1 
ATOM   4881 C CG  . GLU B 1 94  ? 106.878 67.514 -10.327 1.00 48.15  ? 91   GLU B CG  1 
ATOM   4882 C CD  . GLU B 1 94  ? 106.220 67.406 -8.936  1.00 55.12  ? 91   GLU B CD  1 
ATOM   4883 O OE1 . GLU B 1 94  ? 106.335 66.348 -8.284  1.00 54.50  ? 91   GLU B OE1 1 
ATOM   4884 O OE2 . GLU B 1 94  ? 105.605 68.385 -8.476  1.00 70.92  ? 91   GLU B OE2 1 
ATOM   4885 N N   . LEU B 1 95  ? 103.167 65.758 -12.168 1.00 18.74  ? 92   LEU B N   1 
ATOM   4886 C CA  . LEU B 1 95  ? 101.952 65.804 -12.966 1.00 21.47  ? 92   LEU B CA  1 
ATOM   4887 C C   . LEU B 1 95  ? 101.711 67.214 -13.459 1.00 23.46  ? 92   LEU B C   1 
ATOM   4888 O O   . LEU B 1 95  ? 101.883 68.182 -12.716 1.00 26.62  ? 92   LEU B O   1 
ATOM   4889 C CB  . LEU B 1 95  ? 100.731 65.341 -12.155 1.00 21.11  ? 92   LEU B CB  1 
ATOM   4890 C CG  . LEU B 1 95  ? 100.794 63.928 -11.551 1.00 18.81  ? 92   LEU B CG  1 
ATOM   4891 C CD1 . LEU B 1 95  ? 99.467  63.545 -10.850 1.00 17.11  ? 92   LEU B CD1 1 
ATOM   4892 C CD2 . LEU B 1 95  ? 101.157 62.939 -12.625 1.00 22.03  ? 92   LEU B CD2 1 
ATOM   4893 N N   . SER B 1 96  ? 101.281 67.329 -14.708 1.00 20.91  ? 93   SER B N   1 
ATOM   4894 C CA  . SER B 1 96  ? 100.863 68.616 -15.240 1.00 22.02  ? 93   SER B CA  1 
ATOM   4895 C C   . SER B 1 96  ? 99.894  68.378 -16.385 1.00 19.84  ? 93   SER B C   1 
ATOM   4896 O O   . SER B 1 96  ? 99.989  67.371 -17.094 1.00 23.41  ? 93   SER B O   1 
ATOM   4897 C CB  . SER B 1 96  ? 102.066 69.447 -15.734 1.00 18.02  ? 93   SER B CB  1 
ATOM   4898 O OG  . SER B 1 96  ? 101.610 70.649 -16.313 1.00 19.62  ? 93   SER B OG  1 
ATOM   4899 N N   . GLU B 1 97  ? 98.969  69.315 -16.575 1.00 19.42  ? 94   GLU B N   1 
ATOM   4900 C CA  . GLU B 1 97  ? 98.233  69.318 -17.833 1.00 18.79  ? 94   GLU B CA  1 
ATOM   4901 C C   . GLU B 1 97  ? 99.114  69.749 -18.997 1.00 25.92  ? 94   GLU B C   1 
ATOM   4902 O O   . GLU B 1 97  ? 98.759  69.509 -20.158 1.00 22.05  ? 94   GLU B O   1 
ATOM   4903 C CB  . GLU B 1 97  ? 97.016  70.217 -17.733 1.00 22.39  ? 94   GLU B CB  1 
ATOM   4904 C CG  . GLU B 1 97  ? 95.948  69.671 -16.800 1.00 22.11  ? 94   GLU B CG  1 
ATOM   4905 C CD  . GLU B 1 97  ? 94.674  70.452 -16.887 1.00 26.26  ? 94   GLU B CD  1 
ATOM   4906 O OE1 . GLU B 1 97  ? 93.857  70.159 -17.794 1.00 26.79  ? 94   GLU B OE1 1 
ATOM   4907 O OE2 . GLU B 1 97  ? 94.495  71.377 -16.060 1.00 27.64  ? 94   GLU B OE2 1 
ATOM   4908 N N   . ASP B 1 98  ? 100.264 70.359 -18.710 1.00 22.48  ? 95   ASP B N   1 
ATOM   4909 C CA  . ASP B 1 98  ? 101.232 70.728 -19.736 1.00 20.73  ? 95   ASP B CA  1 
ATOM   4910 C C   . ASP B 1 98  ? 102.160 69.530 -19.919 1.00 22.18  ? 95   ASP B C   1 
ATOM   4911 O O   . ASP B 1 98  ? 103.254 69.443 -19.357 1.00 18.68  ? 95   ASP B O   1 
ATOM   4912 C CB  . ASP B 1 98  ? 101.964 72.008 -19.339 1.00 25.56  ? 95   ASP B CB  1 
ATOM   4913 C CG  . ASP B 1 98  ? 103.045 72.425 -20.347 1.00 33.65  ? 95   ASP B CG  1 
ATOM   4914 O OD1 . ASP B 1 98  ? 103.165 71.814 -21.433 1.00 26.64  ? 95   ASP B OD1 1 
ATOM   4915 O OD2 . ASP B 1 98  ? 103.761 73.410 -20.074 1.00 33.67  ? 95   ASP B OD2 1 
ATOM   4916 N N   . CYS B 1 99  ? 101.707 68.583 -20.748 1.00 18.64  ? 96   CYS B N   1 
ATOM   4917 C CA  . CYS B 1 99  ? 102.390 67.303 -20.836 1.00 20.62  ? 96   CYS B CA  1 
ATOM   4918 C C   . CYS B 1 99  ? 102.559 66.765 -22.248 1.00 16.33  ? 96   CYS B C   1 
ATOM   4919 O O   . CYS B 1 99  ? 103.077 65.660 -22.395 1.00 18.74  ? 96   CYS B O   1 
ATOM   4920 C CB  . CYS B 1 99  ? 101.632 66.241 -20.015 1.00 18.70  ? 96   CYS B CB  1 
ATOM   4921 S SG  . CYS B 1 99  ? 99.960  65.908 -20.660 1.00 22.22  ? 96   CYS B SG  1 
ATOM   4922 N N   . LEU B 1 100 ? 102.142 67.485 -23.284 1.00 18.18  ? 97   LEU B N   1 
ATOM   4923 C CA  . LEU B 1 100 ? 102.250 66.959 -24.646 1.00 20.18  ? 97   LEU B CA  1 
ATOM   4924 C C   . LEU B 1 100 ? 103.675 67.177 -25.158 1.00 17.86  ? 97   LEU B C   1 
ATOM   4925 O O   . LEU B 1 100 ? 103.984 68.124 -25.884 1.00 19.99  ? 97   LEU B O   1 
ATOM   4926 C CB  . LEU B 1 100 ? 101.181 67.585 -25.534 1.00 20.34  ? 97   LEU B CB  1 
ATOM   4927 C CG  . LEU B 1 100 ? 99.777  67.174 -25.034 1.00 22.62  ? 97   LEU B CG  1 
ATOM   4928 C CD1 . LEU B 1 100 ? 98.646  67.680 -25.929 1.00 19.77  ? 97   LEU B CD1 1 
ATOM   4929 C CD2 . LEU B 1 100 ? 99.672  65.653 -24.853 1.00 17.46  ? 97   LEU B CD2 1 
ATOM   4930 N N   . TYR B 1 101 ? 104.560 66.245 -24.785 1.00 19.38  ? 98   TYR B N   1 
ATOM   4931 C CA  . TYR B 1 101 ? 105.947 66.233 -25.232 1.00 19.70  ? 98   TYR B CA  1 
ATOM   4932 C C   . TYR B 1 101 ? 106.288 64.835 -25.730 1.00 25.56  ? 98   TYR B C   1 
ATOM   4933 O O   . TYR B 1 101 ? 105.679 63.848 -25.299 1.00 23.33  ? 98   TYR B O   1 
ATOM   4934 C CB  . TYR B 1 101 ? 106.933 66.643 -24.083 1.00 19.78  ? 98   TYR B CB  1 
ATOM   4935 C CG  . TYR B 1 101 ? 106.631 68.026 -23.535 1.00 23.68  ? 98   TYR B CG  1 
ATOM   4936 C CD1 . TYR B 1 101 ? 105.600 68.224 -22.623 1.00 22.15  ? 98   TYR B CD1 1 
ATOM   4937 C CD2 . TYR B 1 101 ? 107.361 69.148 -23.959 1.00 26.89  ? 98   TYR B CD2 1 
ATOM   4938 C CE1 . TYR B 1 101 ? 105.299 69.494 -22.137 1.00 23.89  ? 98   TYR B CE1 1 
ATOM   4939 C CE2 . TYR B 1 101 ? 107.075 70.421 -23.473 1.00 20.54  ? 98   TYR B CE2 1 
ATOM   4940 C CZ  . TYR B 1 101 ? 106.047 70.594 -22.571 1.00 23.89  ? 98   TYR B CZ  1 
ATOM   4941 O OH  . TYR B 1 101 ? 105.741 71.857 -22.114 1.00 22.12  ? 98   TYR B OH  1 
ATOM   4942 N N   . LEU B 1 102 ? 107.280 64.746 -26.624 1.00 17.58  ? 99   LEU B N   1 
ATOM   4943 C CA  . LEU B 1 102 ? 107.707 63.468 -27.173 1.00 19.45  ? 99   LEU B CA  1 
ATOM   4944 C C   . LEU B 1 102 ? 109.224 63.368 -27.112 1.00 23.49  ? 99   LEU B C   1 
ATOM   4945 O O   . LEU B 1 102 ? 109.923 64.357 -26.874 1.00 24.31  ? 99   LEU B O   1 
ATOM   4946 C CB  . LEU B 1 102 ? 107.195 63.264 -28.615 1.00 19.82  ? 99   LEU B CB  1 
ATOM   4947 C CG  . LEU B 1 102 ? 107.522 64.247 -29.754 1.00 20.99  ? 99   LEU B CG  1 
ATOM   4948 C CD1 . LEU B 1 102 ? 108.931 64.041 -30.323 1.00 17.93  ? 99   LEU B CD1 1 
ATOM   4949 C CD2 . LEU B 1 102 ? 106.462 64.193 -30.874 1.00 18.92  ? 99   LEU B CD2 1 
ATOM   4950 N N   . ASN B 1 103 ? 109.726 62.153 -27.331 1.00 17.83  ? 100  ASN B N   1 
ATOM   4951 C CA  . ASN B 1 103 ? 111.132 61.821 -27.162 1.00 16.43  ? 100  ASN B CA  1 
ATOM   4952 C C   . ASN B 1 103 ? 111.640 61.074 -28.387 1.00 21.02  ? 100  ASN B C   1 
ATOM   4953 O O   . ASN B 1 103 ? 110.888 60.344 -29.034 1.00 20.99  ? 100  ASN B O   1 
ATOM   4954 C CB  . ASN B 1 103 ? 111.324 60.975 -25.912 1.00 17.51  ? 100  ASN B CB  1 
ATOM   4955 C CG  . ASN B 1 103 ? 110.403 61.420 -24.779 1.00 29.69  ? 100  ASN B CG  1 
ATOM   4956 O OD1 . ASN B 1 103 ? 110.657 62.441 -24.133 1.00 19.00  ? 100  ASN B OD1 1 
ATOM   4957 N ND2 . ASN B 1 103 ? 109.293 60.682 -24.569 1.00 21.02  ? 100  ASN B ND2 1 
ATOM   4958 N N   . VAL B 1 104 ? 112.919 61.267 -28.707 1.00 21.66  ? 101  VAL B N   1 
ATOM   4959 C CA  . VAL B 1 104 ? 113.565 60.635 -29.860 1.00 17.91  ? 101  VAL B CA  1 
ATOM   4960 C C   . VAL B 1 104 ? 114.903 60.082 -29.411 1.00 19.76  ? 101  VAL B C   1 
ATOM   4961 O O   . VAL B 1 104 ? 115.723 60.812 -28.844 1.00 27.91  ? 101  VAL B O   1 
ATOM   4962 C CB  . VAL B 1 104 ? 113.759 61.610 -31.030 1.00 24.22  ? 101  VAL B CB  1 
ATOM   4963 C CG1 . VAL B 1 104 ? 114.431 60.907 -32.205 1.00 23.32  ? 101  VAL B CG1 1 
ATOM   4964 C CG2 . VAL B 1 104 ? 112.448 62.237 -31.451 1.00 17.70  ? 101  VAL B CG2 1 
ATOM   4965 N N   . TRP B 1 105 ? 115.116 58.794 -29.614 1.00 16.73  ? 102  TRP B N   1 
ATOM   4966 C CA  . TRP B 1 105 ? 116.428 58.207 -29.439 1.00 20.51  ? 102  TRP B CA  1 
ATOM   4967 C C   . TRP B 1 105 ? 116.971 57.871 -30.820 1.00 32.92  ? 102  TRP B C   1 
ATOM   4968 O O   . TRP B 1 105 ? 116.244 57.344 -31.668 1.00 29.23  ? 102  TRP B O   1 
ATOM   4969 C CB  . TRP B 1 105 ? 116.396 56.948 -28.580 1.00 22.68  ? 102  TRP B CB  1 
ATOM   4970 C CG  . TRP B 1 105 ? 115.969 57.101 -27.145 1.00 23.92  ? 102  TRP B CG  1 
ATOM   4971 C CD1 . TRP B 1 105 ? 116.772 57.072 -26.044 1.00 23.51  ? 102  TRP B CD1 1 
ATOM   4972 C CD2 . TRP B 1 105 ? 114.630 57.229 -26.660 1.00 20.89  ? 102  TRP B CD2 1 
ATOM   4973 N NE1 . TRP B 1 105 ? 116.016 57.191 -24.901 1.00 21.68  ? 102  TRP B NE1 1 
ATOM   4974 C CE2 . TRP B 1 105 ? 114.698 57.286 -25.252 1.00 23.10  ? 102  TRP B CE2 1 
ATOM   4975 C CE3 . TRP B 1 105 ? 113.380 57.316 -27.279 1.00 20.62  ? 102  TRP B CE3 1 
ATOM   4976 C CZ2 . TRP B 1 105 ? 113.566 57.429 -24.451 1.00 20.50  ? 102  TRP B CZ2 1 
ATOM   4977 C CZ3 . TRP B 1 105 ? 112.252 57.435 -26.478 1.00 21.74  ? 102  TRP B CZ3 1 
ATOM   4978 C CH2 . TRP B 1 105 ? 112.358 57.506 -25.086 1.00 21.69  ? 102  TRP B CH2 1 
ATOM   4979 N N   . THR B 1 106 ? 118.237 58.194 -31.055 1.00 30.02  ? 103  THR B N   1 
ATOM   4980 C CA  . THR B 1 106 ? 118.836 57.952 -32.356 1.00 25.95  ? 103  THR B CA  1 
ATOM   4981 C C   . THR B 1 106 ? 120.257 57.448 -32.158 1.00 27.68  ? 103  THR B C   1 
ATOM   4982 O O   . THR B 1 106 ? 120.903 57.788 -31.161 1.00 31.66  ? 103  THR B O   1 
ATOM   4983 C CB  . THR B 1 106 ? 118.820 59.219 -33.222 1.00 33.10  ? 103  THR B CB  1 
ATOM   4984 O OG1 . THR B 1 106 ? 119.112 58.862 -34.573 1.00 33.01  ? 103  THR B OG1 1 
ATOM   4985 C CG2 . THR B 1 106 ? 119.841 60.257 -32.705 1.00 30.20  ? 103  THR B CG2 1 
ATOM   4986 N N   . PRO B 1 107 ? 120.744 56.583 -33.042 1.00 29.68  ? 104  PRO B N   1 
ATOM   4987 C CA  . PRO B 1 107 ? 122.041 55.954 -32.789 1.00 32.30  ? 104  PRO B CA  1 
ATOM   4988 C C   . PRO B 1 107 ? 123.160 56.977 -32.875 1.00 35.59  ? 104  PRO B C   1 
ATOM   4989 O O   . PRO B 1 107 ? 123.007 58.080 -33.408 1.00 25.88  ? 104  PRO B O   1 
ATOM   4990 C CB  . PRO B 1 107 ? 122.164 54.897 -33.896 1.00 33.84  ? 104  PRO B CB  1 
ATOM   4991 C CG  . PRO B 1 107 ? 120.780 54.726 -34.433 1.00 33.98  ? 104  PRO B CG  1 
ATOM   4992 C CD  . PRO B 1 107 ? 120.133 56.078 -34.283 1.00 29.53  ? 104  PRO B CD  1 
ATOM   4993 N N   . TYR B 1 108 ? 124.290 56.610 -32.296 1.00 35.50  ? 105  TYR B N   1 
ATOM   4994 C CA  . TYR B 1 108 ? 125.463 57.430 -32.438 1.00 38.61  ? 105  TYR B CA  1 
ATOM   4995 C C   . TYR B 1 108 ? 126.547 56.568 -33.066 1.00 45.27  ? 105  TYR B C   1 
ATOM   4996 O O   . TYR B 1 108 ? 126.793 55.449 -32.607 1.00 40.06  ? 105  TYR B O   1 
ATOM   4997 C CB  . TYR B 1 108 ? 125.924 58.025 -31.105 1.00 42.75  ? 105  TYR B CB  1 
ATOM   4998 C CG  . TYR B 1 108 ? 127.231 58.775 -31.275 1.00 47.02  ? 105  TYR B CG  1 
ATOM   4999 C CD1 . TYR B 1 108 ? 128.445 58.121 -31.182 1.00 49.50  ? 105  TYR B CD1 1 
ATOM   5000 C CD2 . TYR B 1 108 ? 127.245 60.121 -31.620 1.00 43.53  ? 105  TYR B CD2 1 
ATOM   5001 C CE1 . TYR B 1 108 ? 129.648 58.798 -31.379 1.00 58.61  ? 105  TYR B CE1 1 
ATOM   5002 C CE2 . TYR B 1 108 ? 128.444 60.805 -31.826 1.00 55.23  ? 105  TYR B CE2 1 
ATOM   5003 C CZ  . TYR B 1 108 ? 129.649 60.133 -31.700 1.00 63.27  ? 105  TYR B CZ  1 
ATOM   5004 O OH  . TYR B 1 108 ? 130.862 60.773 -31.892 1.00 70.28  ? 105  TYR B OH  1 
ATOM   5005 N N   . PRO B 1 109 ? 127.190 57.078 -34.134 1.00 44.47  ? 106  PRO B N   1 
ATOM   5006 C CA  . PRO B 1 109 ? 126.884 58.360 -34.780 1.00 40.50  ? 106  PRO B CA  1 
ATOM   5007 C C   . PRO B 1 109 ? 125.527 58.358 -35.453 1.00 36.66  ? 106  PRO B C   1 
ATOM   5008 O O   . PRO B 1 109 ? 125.008 57.286 -35.781 1.00 38.76  ? 106  PRO B O   1 
ATOM   5009 C CB  . PRO B 1 109 ? 128.003 58.514 -35.826 1.00 45.18  ? 106  PRO B CB  1 
ATOM   5010 C CG  . PRO B 1 109 ? 128.471 57.128 -36.083 1.00 50.81  ? 106  PRO B CG  1 
ATOM   5011 C CD  . PRO B 1 109 ? 128.339 56.406 -34.765 1.00 49.50  ? 106  PRO B CD  1 
ATOM   5012 N N   . ARG B 1 110 ? 124.960 59.543 -35.623 1.00 26.83  ? 107  ARG B N   1 
ATOM   5013 C CA  . ARG B 1 110 ? 123.684 59.662 -36.295 1.00 33.55  ? 107  ARG B CA  1 
ATOM   5014 C C   . ARG B 1 110 ? 123.728 58.909 -37.621 1.00 40.71  ? 107  ARG B C   1 
ATOM   5015 O O   . ARG B 1 110 ? 124.767 58.902 -38.299 1.00 43.38  ? 107  ARG B O   1 
ATOM   5016 C CB  . ARG B 1 110 ? 123.337 61.135 -36.523 1.00 34.80  ? 107  ARG B CB  1 
ATOM   5017 C CG  . ARG B 1 110 ? 121.893 61.358 -36.929 1.00 37.86  ? 107  ARG B CG  1 
ATOM   5018 C CD  . ARG B 1 110 ? 121.576 62.820 -37.115 1.00 38.27  ? 107  ARG B CD  1 
ATOM   5019 N NE  . ARG B 1 110 ? 122.067 63.606 -35.989 1.00 46.79  ? 107  ARG B NE  1 
ATOM   5020 C CZ  . ARG B 1 110 ? 121.926 64.922 -35.873 1.00 43.37  ? 107  ARG B CZ  1 
ATOM   5021 N NH1 . ARG B 1 110 ? 121.296 65.615 -36.817 1.00 50.24  ? 107  ARG B NH1 1 
ATOM   5022 N NH2 . ARG B 1 110 ? 122.414 65.545 -34.810 1.00 48.53  ? 107  ARG B NH2 1 
ATOM   5023 N N   . PRO B 1 111 ? 122.655 58.225 -37.997 1.00 47.88  ? 108  PRO B N   1 
ATOM   5024 C CA  . PRO B 1 111 ? 122.647 57.530 -39.285 1.00 43.27  ? 108  PRO B CA  1 
ATOM   5025 C C   . PRO B 1 111 ? 122.686 58.521 -40.436 1.00 48.41  ? 108  PRO B C   1 
ATOM   5026 O O   . PRO B 1 111 ? 122.138 59.626 -40.361 1.00 41.97  ? 108  PRO B O   1 
ATOM   5027 C CB  . PRO B 1 111 ? 121.327 56.749 -39.262 1.00 42.78  ? 108  PRO B CB  1 
ATOM   5028 C CG  . PRO B 1 111 ? 120.970 56.641 -37.799 1.00 41.64  ? 108  PRO B CG  1 
ATOM   5029 C CD  . PRO B 1 111 ? 121.452 57.924 -37.198 1.00 41.63  ? 108  PRO B CD  1 
ATOM   5030 N N   . THR B 1 112 ? 123.358 58.105 -41.510 1.00 48.77  ? 109  THR B N   1 
ATOM   5031 C CA  . THR B 1 112 ? 123.548 58.921 -42.703 1.00 50.84  ? 109  THR B CA  1 
ATOM   5032 C C   . THR B 1 112 ? 122.508 58.641 -43.776 1.00 49.81  ? 109  THR B C   1 
ATOM   5033 O O   . THR B 1 112 ? 122.144 59.548 -44.534 1.00 51.56  ? 109  THR B O   1 
ATOM   5034 C CB  . THR B 1 112 ? 124.949 58.680 -43.279 1.00 47.46  ? 109  THR B CB  1 
ATOM   5035 O OG1 . THR B 1 112 ? 125.063 57.311 -43.698 1.00 55.45  ? 109  THR B OG1 1 
ATOM   5036 C CG2 . THR B 1 112 ? 126.000 58.948 -42.232 1.00 47.18  ? 109  THR B CG2 1 
ATOM   5037 N N   . SER B 1 113 ? 122.047 57.454 -43.847 1.00 47.93  ? 110  SER B N   1 
ATOM   5038 C CA  . SER B 1 113 ? 120.991 56.860 -44.643 1.00 52.99  ? 110  SER B CA  1 
ATOM   5039 C C   . SER B 1 113 ? 119.715 56.792 -43.813 1.00 52.30  ? 110  SER B C   1 
ATOM   5040 O O   . SER B 1 113 ? 119.776 56.482 -42.615 1.00 45.43  ? 110  SER B O   1 
ATOM   5041 C CB  . SER B 1 113 ? 121.391 55.451 -45.081 1.00 52.97  ? 110  SER B CB  1 
ATOM   5042 O OG  . SER B 1 113 ? 122.740 55.382 -45.360 1.00 61.75  ? 110  SER B OG  1 
ATOM   5043 N N   . PRO B 1 114 ? 118.551 57.085 -44.394 1.00 46.31  ? 111  PRO B N   1 
ATOM   5044 C CA  . PRO B 1 114 ? 117.308 57.017 -43.617 1.00 43.93  ? 111  PRO B CA  1 
ATOM   5045 C C   . PRO B 1 114 ? 117.118 55.647 -42.971 1.00 43.51  ? 111  PRO B C   1 
ATOM   5046 O O   . PRO B 1 114 ? 117.512 54.608 -43.508 1.00 41.82  ? 111  PRO B O   1 
ATOM   5047 C CB  . PRO B 1 114 ? 116.226 57.317 -44.657 1.00 46.58  ? 111  PRO B CB  1 
ATOM   5048 C CG  . PRO B 1 114 ? 116.939 58.163 -45.694 1.00 49.13  ? 111  PRO B CG  1 
ATOM   5049 C CD  . PRO B 1 114 ? 118.326 57.574 -45.765 1.00 42.49  ? 111  PRO B CD  1 
ATOM   5050 N N   . THR B 1 115 ? 116.536 55.662 -41.780 1.00 40.36  ? 112  THR B N   1 
ATOM   5051 C CA  . THR B 1 115 ? 116.480 54.475 -40.949 1.00 43.60  ? 112  THR B CA  1 
ATOM   5052 C C   . THR B 1 115 ? 115.045 54.218 -40.512 1.00 38.83  ? 112  THR B C   1 
ATOM   5053 O O   . THR B 1 115 ? 114.283 55.167 -40.274 1.00 33.85  ? 112  THR B O   1 
ATOM   5054 C CB  . THR B 1 115 ? 117.381 54.661 -39.730 1.00 41.98  ? 112  THR B CB  1 
ATOM   5055 O OG1 . THR B 1 115 ? 118.556 55.350 -40.152 1.00 45.30  ? 112  THR B OG1 1 
ATOM   5056 C CG2 . THR B 1 115 ? 117.783 53.331 -39.104 1.00 40.19  ? 112  THR B CG2 1 
ATOM   5057 N N   . PRO B 1 116 ? 114.642 52.953 -40.417 1.00 43.12  ? 113  PRO B N   1 
ATOM   5058 C CA  . PRO B 1 116 ? 113.299 52.640 -39.909 1.00 39.70  ? 113  PRO B CA  1 
ATOM   5059 C C   . PRO B 1 116 ? 113.071 53.192 -38.505 1.00 34.48  ? 113  PRO B C   1 
ATOM   5060 O O   . PRO B 1 116 ? 113.970 53.197 -37.657 1.00 31.37  ? 113  PRO B O   1 
ATOM   5061 C CB  . PRO B 1 116 ? 113.268 51.107 -39.925 1.00 39.65  ? 113  PRO B CB  1 
ATOM   5062 C CG  . PRO B 1 116 ? 114.715 50.695 -40.028 1.00 45.16  ? 113  PRO B CG  1 
ATOM   5063 C CD  . PRO B 1 116 ? 115.344 51.744 -40.872 1.00 44.07  ? 113  PRO B CD  1 
ATOM   5064 N N   . VAL B 1 117 ? 111.845 53.657 -38.280 1.00 31.92  ? 114  VAL B N   1 
ATOM   5065 C CA  . VAL B 1 117 ? 111.437 54.317 -37.048 1.00 32.06  ? 114  VAL B CA  1 
ATOM   5066 C C   . VAL B 1 117 ? 110.460 53.415 -36.303 1.00 27.58  ? 114  VAL B C   1 
ATOM   5067 O O   . VAL B 1 117 ? 109.452 52.983 -36.873 1.00 31.16  ? 114  VAL B O   1 
ATOM   5068 C CB  . VAL B 1 117 ? 110.789 55.680 -37.341 1.00 29.46  ? 114  VAL B CB  1 
ATOM   5069 C CG1 . VAL B 1 117 ? 110.444 56.391 -36.032 1.00 26.15  ? 114  VAL B CG1 1 
ATOM   5070 C CG2 . VAL B 1 117 ? 111.708 56.551 -38.217 1.00 32.24  ? 114  VAL B CG2 1 
ATOM   5071 N N   . LEU B 1 118 ? 110.746 53.152 -35.030 1.00 30.03  ? 115  LEU B N   1 
ATOM   5072 C CA  . LEU B 1 118 ? 109.795 52.545 -34.100 1.00 25.61  ? 115  LEU B CA  1 
ATOM   5073 C C   . LEU B 1 118 ? 109.166 53.641 -33.248 1.00 29.99  ? 115  LEU B C   1 
ATOM   5074 O O   . LEU B 1 118 ? 109.881 54.485 -32.696 1.00 27.53  ? 115  LEU B O   1 
ATOM   5075 C CB  . LEU B 1 118 ? 110.493 51.524 -33.204 1.00 23.01  ? 115  LEU B CB  1 
ATOM   5076 C CG  . LEU B 1 118 ? 110.808 50.171 -33.851 1.00 25.35  ? 115  LEU B CG  1 
ATOM   5077 C CD1 . LEU B 1 118 ? 111.948 49.471 -33.115 1.00 26.25  ? 115  LEU B CD1 1 
ATOM   5078 C CD2 . LEU B 1 118 ? 109.560 49.312 -33.841 1.00 32.72  ? 115  LEU B CD2 1 
ATOM   5079 N N   . VAL B 1 119 ? 107.837 53.634 -33.148 1.00 28.97  ? 116  VAL B N   1 
ATOM   5080 C CA  . VAL B 1 119 ? 107.094 54.615 -32.361 1.00 23.42  ? 116  VAL B CA  1 
ATOM   5081 C C   . VAL B 1 119 ? 106.329 53.868 -31.273 1.00 29.52  ? 116  VAL B C   1 
ATOM   5082 O O   . VAL B 1 119 ? 105.453 53.050 -31.582 1.00 25.57  ? 116  VAL B O   1 
ATOM   5083 C CB  . VAL B 1 119 ? 106.120 55.423 -33.223 1.00 25.17  ? 116  VAL B CB  1 
ATOM   5084 C CG1 . VAL B 1 119 ? 105.411 56.455 -32.362 1.00 13.57  ? 116  VAL B CG1 1 
ATOM   5085 C CG2 . VAL B 1 119 ? 106.822 56.042 -34.413 1.00 23.89  ? 116  VAL B CG2 1 
ATOM   5086 N N   . TRP B 1 120 ? 106.629 54.179 -30.009 1.00 20.37  ? 117  TRP B N   1 
ATOM   5087 C CA  . TRP B 1 120 ? 106.043 53.520 -28.847 1.00 19.48  ? 117  TRP B CA  1 
ATOM   5088 C C   . TRP B 1 120 ? 104.862 54.313 -28.307 1.00 23.22  ? 117  TRP B C   1 
ATOM   5089 O O   . TRP B 1 120 ? 104.977 55.518 -28.057 1.00 20.59  ? 117  TRP B O   1 
ATOM   5090 C CB  . TRP B 1 120 ? 107.093 53.331 -27.757 1.00 18.03  ? 117  TRP B CB  1 
ATOM   5091 C CG  . TRP B 1 120 ? 106.568 52.750 -26.484 1.00 23.58  ? 117  TRP B CG  1 
ATOM   5092 C CD1 . TRP B 1 120 ? 106.464 53.380 -25.271 1.00 21.91  ? 117  TRP B CD1 1 
ATOM   5093 C CD2 . TRP B 1 120 ? 106.090 51.413 -26.283 1.00 25.35  ? 117  TRP B CD2 1 
ATOM   5094 N NE1 . TRP B 1 120 ? 105.942 52.519 -24.335 1.00 24.07  ? 117  TRP B NE1 1 
ATOM   5095 C CE2 . TRP B 1 120 ? 105.698 51.309 -24.930 1.00 23.36  ? 117  TRP B CE2 1 
ATOM   5096 C CE3 . TRP B 1 120 ? 105.949 50.298 -27.116 1.00 25.61  ? 117  TRP B CE3 1 
ATOM   5097 C CZ2 . TRP B 1 120 ? 105.193 50.131 -24.390 1.00 22.29  ? 117  TRP B CZ2 1 
ATOM   5098 C CZ3 . TRP B 1 120 ? 105.445 49.127 -26.576 1.00 27.29  ? 117  TRP B CZ3 1 
ATOM   5099 C CH2 . TRP B 1 120 ? 105.075 49.051 -25.225 1.00 20.53  ? 117  TRP B CH2 1 
ATOM   5100 N N   . ILE B 1 121 ? 103.727 53.632 -28.143 1.00 17.08  ? 118  ILE B N   1 
ATOM   5101 C CA  . ILE B 1 121 ? 102.547 54.165 -27.468 1.00 17.94  ? 118  ILE B CA  1 
ATOM   5102 C C   . ILE B 1 121 ? 102.341 53.362 -26.194 1.00 23.91  ? 118  ILE B C   1 
ATOM   5103 O O   . ILE B 1 121 ? 102.072 52.151 -26.263 1.00 19.70  ? 118  ILE B O   1 
ATOM   5104 C CB  . ILE B 1 121 ? 101.303 54.102 -28.358 1.00 20.40  ? 118  ILE B CB  1 
ATOM   5105 C CG1 . ILE B 1 121 ? 101.614 54.712 -29.728 1.00 20.45  ? 118  ILE B CG1 1 
ATOM   5106 C CG2 . ILE B 1 121 ? 100.130 54.819 -27.692 1.00 14.98  ? 118  ILE B CG2 1 
ATOM   5107 C CD1 . ILE B 1 121 ? 100.388 54.761 -30.618 1.00 20.92  ? 118  ILE B CD1 1 
ATOM   5108 N N   . TYR B 1 122 ? 102.455 54.024 -25.029 1.00 18.23  ? 119  TYR B N   1 
ATOM   5109 C CA  . TYR B 1 122 ? 102.339 53.294 -23.764 1.00 18.02  ? 119  TYR B CA  1 
ATOM   5110 C C   . TYR B 1 122 ? 100.884 52.915 -23.464 1.00 14.77  ? 119  TYR B C   1 
ATOM   5111 O O   . TYR B 1 122 ? 99.927  53.554 -23.921 1.00 14.71  ? 119  TYR B O   1 
ATOM   5112 C CB  . TYR B 1 122 ? 102.918 54.101 -22.584 1.00 16.77  ? 119  TYR B CB  1 
ATOM   5113 C CG  . TYR B 1 122 ? 102.336 55.488 -22.398 1.00 15.18  ? 119  TYR B CG  1 
ATOM   5114 C CD1 . TYR B 1 122 ? 101.065 55.668 -21.876 1.00 14.00  ? 119  TYR B CD1 1 
ATOM   5115 C CD2 . TYR B 1 122 ? 103.076 56.630 -22.728 1.00 20.65  ? 119  TYR B CD2 1 
ATOM   5116 C CE1 . TYR B 1 122 ? 100.516 56.940 -21.709 1.00 17.17  ? 119  TYR B CE1 1 
ATOM   5117 C CE2 . TYR B 1 122 ? 102.535 57.937 -22.564 1.00 15.24  ? 119  TYR B CE2 1 
ATOM   5118 C CZ  . TYR B 1 122 ? 101.271 58.085 -22.055 1.00 17.85  ? 119  TYR B CZ  1 
ATOM   5119 O OH  . TYR B 1 122 ? 100.719 59.352 -21.893 1.00 18.27  ? 119  TYR B OH  1 
ATOM   5120 N N   . GLY B 1 123 ? 100.737 51.864 -22.658 1.00 14.84  ? 120  GLY B N   1 
ATOM   5121 C CA  . GLY B 1 123 ? 99.459  51.472 -22.106 1.00 18.70  ? 120  GLY B CA  1 
ATOM   5122 C C   . GLY B 1 123 ? 99.245  52.078 -20.731 1.00 27.30  ? 120  GLY B C   1 
ATOM   5123 O O   . GLY B 1 123 ? 99.950  53.006 -20.313 1.00 20.04  ? 120  GLY B O   1 
ATOM   5124 N N   . GLY B 1 124 ? 98.255  51.537 -20.018 1.00 19.82  ? 121  GLY B N   1 
ATOM   5125 C CA  . GLY B 1 124 ? 97.809  52.114 -18.756 1.00 17.85  ? 121  GLY B CA  1 
ATOM   5126 C C   . GLY B 1 124 ? 96.308  52.320 -18.729 1.00 19.96  ? 121  GLY B C   1 
ATOM   5127 O O   . GLY B 1 124 ? 95.794  53.250 -18.084 1.00 19.10  ? 121  GLY B O   1 
ATOM   5128 N N   . GLY B 1 125 ? 95.588  51.463 -19.463 1.00 19.88  ? 122  GLY B N   1 
ATOM   5129 C CA  . GLY B 1 125 ? 94.130  51.477 -19.431 1.00 15.54  ? 122  GLY B CA  1 
ATOM   5130 C C   . GLY B 1 125 ? 93.466  52.765 -19.872 1.00 16.18  ? 122  GLY B C   1 
ATOM   5131 O O   . GLY B 1 125 ? 92.298  52.988 -19.538 1.00 20.20  ? 122  GLY B O   1 
ATOM   5132 N N   . PHE B 1 126 ? 94.164  53.620 -20.622 1.00 15.83  ? 123  PHE B N   1 
ATOM   5133 C CA  . PHE B 1 126 ? 93.704  54.959 -21.019 1.00 14.48  ? 123  PHE B CA  1 
ATOM   5134 C C   . PHE B 1 126 ? 93.525  55.924 -19.835 1.00 17.66  ? 123  PHE B C   1 
ATOM   5135 O O   . PHE B 1 126 ? 93.012  57.026 -20.028 1.00 19.49  ? 123  PHE B O   1 
ATOM   5136 C CB  . PHE B 1 126 ? 92.403  54.918 -21.850 1.00 14.93  ? 123  PHE B CB  1 
ATOM   5137 C CG  . PHE B 1 126 ? 92.564  54.234 -23.191 1.00 20.38  ? 123  PHE B CG  1 
ATOM   5138 C CD1 . PHE B 1 126 ? 93.222  54.878 -24.241 1.00 17.64  ? 123  PHE B CD1 1 
ATOM   5139 C CD2 . PHE B 1 126 ? 92.070  52.942 -23.399 1.00 18.74  ? 123  PHE B CD2 1 
ATOM   5140 C CE1 . PHE B 1 126 ? 93.394  54.258 -25.475 1.00 22.04  ? 123  PHE B CE1 1 
ATOM   5141 C CE2 . PHE B 1 126 ? 92.232  52.301 -24.639 1.00 21.05  ? 123  PHE B CE2 1 
ATOM   5142 C CZ  . PHE B 1 126 ? 92.899  52.962 -25.684 1.00 23.25  ? 123  PHE B CZ  1 
ATOM   5143 N N   . TYR B 1 127 ? 93.934  55.550 -18.608 1.00 13.86  ? 124  TYR B N   1 
ATOM   5144 C CA  . TYR B 1 127 ? 93.814  56.431 -17.447 1.00 17.54  ? 124  TYR B CA  1 
ATOM   5145 C C   . TYR B 1 127 ? 95.160  56.762 -16.802 1.00 17.65  ? 124  TYR B C   1 
ATOM   5146 O O   . TYR B 1 127 ? 95.193  57.556 -15.860 1.00 21.91  ? 124  TYR B O   1 
ATOM   5147 C CB  . TYR B 1 127 ? 92.886  55.811 -16.378 1.00 19.53  ? 124  TYR B CB  1 
ATOM   5148 C CG  . TYR B 1 127 ? 93.535  54.651 -15.632 1.00 21.46  ? 124  TYR B CG  1 
ATOM   5149 C CD1 . TYR B 1 127 ? 94.338  54.879 -14.517 1.00 23.96  ? 124  TYR B CD1 1 
ATOM   5150 C CD2 . TYR B 1 127 ? 93.365  53.331 -16.059 1.00 21.77  ? 124  TYR B CD2 1 
ATOM   5151 C CE1 . TYR B 1 127 ? 94.968  53.840 -13.857 1.00 24.15  ? 124  TYR B CE1 1 
ATOM   5152 C CE2 . TYR B 1 127 ? 93.988  52.286 -15.396 1.00 22.83  ? 124  TYR B CE2 1 
ATOM   5153 C CZ  . TYR B 1 127 ? 94.788  52.553 -14.298 1.00 26.10  ? 124  TYR B CZ  1 
ATOM   5154 O OH  . TYR B 1 127 ? 95.412  51.541 -13.620 1.00 25.52  ? 124  TYR B OH  1 
ATOM   5155 N N   . SER B 1 128 ? 96.255  56.155 -17.258 1.00 17.61  ? 125  SER B N   1 
ATOM   5156 C CA  . SER B 1 128 ? 97.572  56.296 -16.662 1.00 16.34  ? 125  SER B CA  1 
ATOM   5157 C C   . SER B 1 128 ? 98.618  56.035 -17.737 1.00 20.40  ? 125  SER B C   1 
ATOM   5158 O O   . SER B 1 128 ? 98.298  55.642 -18.869 1.00 16.53  ? 125  SER B O   1 
ATOM   5159 C CB  . SER B 1 128 ? 97.765  55.317 -15.501 1.00 20.63  ? 125  SER B CB  1 
ATOM   5160 O OG  . SER B 1 128 ? 97.702  53.973 -15.973 1.00 16.98  ? 125  SER B OG  1 
ATOM   5161 N N   . GLY B 1 129 ? 99.881  56.204 -17.353 1.00 14.10  ? 126  GLY B N   1 
ATOM   5162 C CA  . GLY B 1 129 ? 101.000 55.943 -18.245 1.00 19.15  ? 126  GLY B CA  1 
ATOM   5163 C C   . GLY B 1 129 ? 101.831 57.185 -18.540 1.00 18.32  ? 126  GLY B C   1 
ATOM   5164 O O   . GLY B 1 129 ? 101.335 58.305 -18.407 1.00 18.53  ? 126  GLY B O   1 
ATOM   5165 N N   . ALA B 1 130 ? 103.077 56.996 -18.971 1.00 17.15  ? 127  ALA B N   1 
ATOM   5166 C CA  . ALA B 1 130 ? 103.987 58.095 -19.267 1.00 21.72  ? 127  ALA B CA  1 
ATOM   5167 C C   . ALA B 1 130 ? 105.107 57.568 -20.149 1.00 16.92  ? 127  ALA B C   1 
ATOM   5168 O O   . ALA B 1 130 ? 105.550 56.432 -19.968 1.00 16.74  ? 127  ALA B O   1 
ATOM   5169 C CB  . ALA B 1 130 ? 104.584 58.706 -17.982 1.00 17.39  ? 127  ALA B CB  1 
ATOM   5170 N N   . SER B 1 131 ? 105.595 58.403 -21.076 1.00 21.73  ? 128  SER B N   1 
ATOM   5171 C CA  . SER B 1 131 ? 106.724 57.953 -21.898 1.00 20.16  ? 128  SER B CA  1 
ATOM   5172 C C   . SER B 1 131 ? 108.037 57.929 -21.138 1.00 18.68  ? 128  SER B C   1 
ATOM   5173 O O   . SER B 1 131 ? 109.023 57.365 -21.641 1.00 19.67  ? 128  SER B O   1 
ATOM   5174 C CB  . SER B 1 131 ? 106.875 58.822 -23.152 1.00 23.21  ? 128  SER B CB  1 
ATOM   5175 O OG  . SER B 1 131 ? 107.017 60.188 -22.812 1.00 22.37  ? 128  SER B OG  1 
ATOM   5176 N N   . SER B 1 132 ? 108.070 58.472 -19.924 1.00 22.83  ? 129  SER B N   1 
ATOM   5177 C CA  . SER B 1 132 ? 109.310 58.609 -19.178 1.00 20.06  ? 129  SER B CA  1 
ATOM   5178 C C   . SER B 1 132 ? 109.602 57.427 -18.262 1.00 25.40  ? 129  SER B C   1 
ATOM   5179 O O   . SER B 1 132 ? 110.646 57.427 -17.594 1.00 24.05  ? 129  SER B O   1 
ATOM   5180 C CB  . SER B 1 132 ? 109.270 59.894 -18.347 1.00 23.03  ? 129  SER B CB  1 
ATOM   5181 O OG  . SER B 1 132 ? 108.110 59.980 -17.537 1.00 16.37  ? 129  SER B OG  1 
ATOM   5182 N N   . LEU B 1 133 ? 108.714 56.435 -18.189 1.00 20.68  ? 130  LEU B N   1 
ATOM   5183 C CA  . LEU B 1 133 ? 108.941 55.318 -17.277 1.00 20.11  ? 130  LEU B CA  1 
ATOM   5184 C C   . LEU B 1 133 ? 110.252 54.621 -17.611 1.00 19.37  ? 130  LEU B C   1 
ATOM   5185 O O   . LEU B 1 133 ? 110.607 54.464 -18.782 1.00 18.99  ? 130  LEU B O   1 
ATOM   5186 C CB  . LEU B 1 133 ? 107.779 54.317 -17.342 1.00 18.11  ? 130  LEU B CB  1 
ATOM   5187 C CG  . LEU B 1 133 ? 106.384 54.809 -16.939 1.00 20.36  ? 130  LEU B CG  1 
ATOM   5188 C CD1 . LEU B 1 133 ? 105.389 53.633 -16.923 1.00 18.99  ? 130  LEU B CD1 1 
ATOM   5189 C CD2 . LEU B 1 133 ? 106.408 55.543 -15.586 1.00 19.04  ? 130  LEU B CD2 1 
ATOM   5190 N N   . ASP B 1 134 ? 110.962 54.180 -16.567 1.00 19.84  ? 131  ASP B N   1 
ATOM   5191 C CA  . ASP B 1 134 ? 112.257 53.535 -16.766 1.00 27.64  ? 131  ASP B CA  1 
ATOM   5192 C C   . ASP B 1 134 ? 112.145 52.311 -17.659 1.00 28.21  ? 131  ASP B C   1 
ATOM   5193 O O   . ASP B 1 134 ? 113.111 51.948 -18.339 1.00 21.38  ? 131  ASP B O   1 
ATOM   5194 C CB  . ASP B 1 134 ? 112.872 53.127 -15.422 1.00 23.78  ? 131  ASP B CB  1 
ATOM   5195 C CG  . ASP B 1 134 ? 113.189 54.319 -14.534 1.00 29.15  ? 131  ASP B CG  1 
ATOM   5196 O OD1 . ASP B 1 134 ? 113.166 55.479 -15.013 1.00 25.70  ? 131  ASP B OD1 1 
ATOM   5197 O OD2 . ASP B 1 134 ? 113.447 54.092 -13.343 1.00 31.14  ? 131  ASP B OD2 1 
ATOM   5198 N N   . VAL B 1 135 ? 110.979 51.657 -17.667 1.00 25.06  ? 132  VAL B N   1 
ATOM   5199 C CA  . VAL B 1 135 ? 110.826 50.421 -18.428 1.00 24.71  ? 132  VAL B CA  1 
ATOM   5200 C C   . VAL B 1 135 ? 110.665 50.695 -19.916 1.00 23.33  ? 132  VAL B C   1 
ATOM   5201 O O   . VAL B 1 135 ? 110.803 49.773 -20.728 1.00 24.19  ? 132  VAL B O   1 
ATOM   5202 C CB  . VAL B 1 135 ? 109.673 49.609 -17.792 1.00 23.56  ? 132  VAL B CB  1 
ATOM   5203 C CG1 . VAL B 1 135 ? 108.286 50.202 -18.110 1.00 19.71  ? 132  VAL B CG1 1 
ATOM   5204 C CG2 . VAL B 1 135 ? 109.760 48.170 -18.185 1.00 21.46  ? 132  VAL B CG2 1 
ATOM   5205 N N   . TYR B 1 136 ? 110.434 51.948 -20.310 1.00 24.16  ? 133  TYR B N   1 
ATOM   5206 C CA  . TYR B 1 136 ? 110.349 52.329 -21.716 1.00 21.52  ? 133  TYR B CA  1 
ATOM   5207 C C   . TYR B 1 136 ? 111.616 53.033 -22.220 1.00 24.31  ? 133  TYR B C   1 
ATOM   5208 O O   . TYR B 1 136 ? 111.567 53.737 -23.235 1.00 26.21  ? 133  TYR B O   1 
ATOM   5209 C CB  . TYR B 1 136 ? 109.147 53.234 -21.933 1.00 18.76  ? 133  TYR B CB  1 
ATOM   5210 C CG  . TYR B 1 136 ? 107.818 52.707 -21.414 1.00 23.45  ? 133  TYR B CG  1 
ATOM   5211 C CD1 . TYR B 1 136 ? 107.550 51.333 -21.345 1.00 21.73  ? 133  TYR B CD1 1 
ATOM   5212 C CD2 . TYR B 1 136 ? 106.822 53.594 -21.020 1.00 20.80  ? 133  TYR B CD2 1 
ATOM   5213 C CE1 . TYR B 1 136 ? 106.325 50.871 -20.895 1.00 19.92  ? 133  TYR B CE1 1 
ATOM   5214 C CE2 . TYR B 1 136 ? 105.603 53.149 -20.565 1.00 22.05  ? 133  TYR B CE2 1 
ATOM   5215 C CZ  . TYR B 1 136 ? 105.358 51.783 -20.509 1.00 21.53  ? 133  TYR B CZ  1 
ATOM   5216 O OH  . TYR B 1 136 ? 104.143 51.349 -20.065 1.00 16.00  ? 133  TYR B OH  1 
ATOM   5217 N N   . ASP B 1 137 ? 112.730 52.886 -21.510 1.00 26.05  ? 134  ASP B N   1 
ATOM   5218 C CA  . ASP B 1 137 ? 114.004 53.518 -21.853 1.00 28.32  ? 134  ASP B CA  1 
ATOM   5219 C C   . ASP B 1 137 ? 114.503 53.019 -23.207 1.00 26.90  ? 134  ASP B C   1 
ATOM   5220 O O   . ASP B 1 137 ? 114.966 51.880 -23.323 1.00 25.33  ? 134  ASP B O   1 
ATOM   5221 C CB  . ASP B 1 137 ? 115.019 53.225 -20.730 1.00 28.19  ? 134  ASP B CB  1 
ATOM   5222 C CG  . ASP B 1 137 ? 116.368 53.945 -20.907 1.00 34.03  ? 134  ASP B CG  1 
ATOM   5223 O OD1 . ASP B 1 137 ? 116.591 54.625 -21.938 1.00 30.63  ? 134  ASP B OD1 1 
ATOM   5224 O OD2 . ASP B 1 137 ? 117.226 53.779 -20.002 1.00 30.78  ? 134  ASP B OD2 1 
ATOM   5225 N N   . GLY B 1 138 ? 114.434 53.862 -24.234 1.00 26.95  ? 135  GLY B N   1 
ATOM   5226 C CA  . GLY B 1 138 ? 114.803 53.426 -25.576 1.00 25.59  ? 135  GLY B CA  1 
ATOM   5227 C C   . GLY B 1 138 ? 116.297 53.243 -25.869 1.00 31.90  ? 135  GLY B C   1 
ATOM   5228 O O   . GLY B 1 138 ? 116.641 52.926 -27.014 1.00 27.45  ? 135  GLY B O   1 
ATOM   5229 N N   . ARG B 1 139 ? 117.194 53.388 -24.893 1.00 29.96  ? 136  ARG B N   1 
ATOM   5230 C CA  . ARG B 1 139 ? 118.614 53.445 -25.250 1.00 31.90  ? 136  ARG B CA  1 
ATOM   5231 C C   . ARG B 1 139 ? 119.125 52.098 -25.746 1.00 34.71  ? 136  ARG B C   1 
ATOM   5232 O O   . ARG B 1 139 ? 119.903 52.045 -26.705 1.00 37.73  ? 136  ARG B O   1 
ATOM   5233 C CB  . ARG B 1 139 ? 119.459 53.950 -24.073 1.00 21.68  ? 136  ARG B CB  1 
ATOM   5234 C CG  . ARG B 1 139 ? 119.784 52.956 -22.982 1.00 28.95  ? 136  ARG B CG  1 
ATOM   5235 C CD  . ARG B 1 139 ? 120.541 53.635 -21.824 1.00 29.09  ? 136  ARG B CD  1 
ATOM   5236 N NE  . ARG B 1 139 ? 119.750 54.709 -21.223 1.00 28.40  ? 136  ARG B NE  1 
ATOM   5237 C CZ  . ARG B 1 139 ? 120.218 55.613 -20.361 1.00 36.36  ? 136  ARG B CZ  1 
ATOM   5238 N NH1 . ARG B 1 139 ? 121.493 55.590 -19.992 1.00 29.49  ? 136  ARG B NH1 1 
ATOM   5239 N NH2 . ARG B 1 139 ? 119.408 56.552 -19.874 1.00 28.41  ? 136  ARG B NH2 1 
ATOM   5240 N N   . PHE B 1 140 ? 118.706 50.997 -25.122 1.00 30.62  ? 137  PHE B N   1 
ATOM   5241 C CA  . PHE B 1 140 ? 119.299 49.716 -25.482 1.00 32.21  ? 137  PHE B CA  1 
ATOM   5242 C C   . PHE B 1 140 ? 118.795 49.239 -26.838 1.00 30.64  ? 137  PHE B C   1 
ATOM   5243 O O   . PHE B 1 140 ? 119.561 48.664 -27.618 1.00 26.33  ? 137  PHE B O   1 
ATOM   5244 C CB  . PHE B 1 140 ? 119.033 48.690 -24.385 1.00 28.19  ? 137  PHE B CB  1 
ATOM   5245 C CG  . PHE B 1 140 ? 119.487 49.150 -23.030 1.00 33.70  ? 137  PHE B CG  1 
ATOM   5246 C CD1 . PHE B 1 140 ? 120.829 49.110 -22.684 1.00 29.95  ? 137  PHE B CD1 1 
ATOM   5247 C CD2 . PHE B 1 140 ? 118.583 49.660 -22.118 1.00 31.37  ? 137  PHE B CD2 1 
ATOM   5248 C CE1 . PHE B 1 140 ? 121.255 49.556 -21.441 1.00 37.54  ? 137  PHE B CE1 1 
ATOM   5249 C CE2 . PHE B 1 140 ? 119.005 50.112 -20.867 1.00 30.37  ? 137  PHE B CE2 1 
ATOM   5250 C CZ  . PHE B 1 140 ? 120.338 50.061 -20.530 1.00 33.96  ? 137  PHE B CZ  1 
ATOM   5251 N N   . LEU B 1 141 ? 117.524 49.497 -27.147 1.00 32.42  ? 138  LEU B N   1 
ATOM   5252 C CA  . LEU B 1 141 ? 116.981 49.109 -28.447 1.00 33.33  ? 138  LEU B CA  1 
ATOM   5253 C C   . LEU B 1 141 ? 117.658 49.871 -29.578 1.00 33.85  ? 138  LEU B C   1 
ATOM   5254 O O   . LEU B 1 141 ? 118.009 49.291 -30.613 1.00 31.04  ? 138  LEU B O   1 
ATOM   5255 C CB  . LEU B 1 141 ? 115.473 49.353 -28.473 1.00 28.63  ? 138  LEU B CB  1 
ATOM   5256 C CG  . LEU B 1 141 ? 114.639 48.875 -29.659 1.00 36.98  ? 138  LEU B CG  1 
ATOM   5257 C CD1 . LEU B 1 141 ? 114.604 47.362 -29.707 1.00 34.57  ? 138  LEU B CD1 1 
ATOM   5258 C CD2 . LEU B 1 141 ? 113.229 49.441 -29.544 1.00 36.15  ? 138  LEU B CD2 1 
ATOM   5259 N N   . VAL B 1 142 ? 117.830 51.179 -29.410 1.00 35.41  ? 139  VAL B N   1 
ATOM   5260 C CA  . VAL B 1 142 ? 118.460 51.980 -30.450 1.00 30.23  ? 139  VAL B CA  1 
ATOM   5261 C C   . VAL B 1 142 ? 119.936 51.613 -30.592 1.00 33.57  ? 139  VAL B C   1 
ATOM   5262 O O   . VAL B 1 142 ? 120.476 51.570 -31.700 1.00 32.49  ? 139  VAL B O   1 
ATOM   5263 C CB  . VAL B 1 142 ? 118.239 53.472 -30.154 1.00 32.15  ? 139  VAL B CB  1 
ATOM   5264 C CG1 . VAL B 1 142 ? 119.158 54.350 -31.010 1.00 29.55  ? 139  VAL B CG1 1 
ATOM   5265 C CG2 . VAL B 1 142 ? 116.785 53.819 -30.433 1.00 27.34  ? 139  VAL B CG2 1 
ATOM   5266 N N   . GLN B 1 143 ? 120.601 51.290 -29.490 1.00 33.79  ? 140  GLN B N   1 
ATOM   5267 C CA  . GLN B 1 143 ? 122.008 50.933 -29.608 1.00 35.94  ? 140  GLN B CA  1 
ATOM   5268 C C   . GLN B 1 143 ? 122.180 49.584 -30.287 1.00 43.04  ? 140  GLN B C   1 
ATOM   5269 O O   . GLN B 1 143 ? 123.101 49.407 -31.090 1.00 40.42  ? 140  GLN B O   1 
ATOM   5270 C CB  . GLN B 1 143 ? 122.677 50.912 -28.241 1.00 33.00  ? 140  GLN B CB  1 
ATOM   5271 C CG  . GLN B 1 143 ? 124.199 50.877 -28.319 1.00 39.41  ? 140  GLN B CG  1 
ATOM   5272 C CD  . GLN B 1 143 ? 124.756 49.491 -28.588 1.00 43.84  ? 140  GLN B CD  1 
ATOM   5273 O OE1 . GLN B 1 143 ? 124.077 48.478 -28.393 1.00 44.27  ? 140  GLN B OE1 1 
ATOM   5274 N NE2 . GLN B 1 143 ? 125.998 49.440 -29.052 1.00 43.86  ? 140  GLN B NE2 1 
ATOM   5275 N N   . ALA B 1 144 ? 121.326 48.613 -29.950 1.00 35.67  ? 141  ALA B N   1 
ATOM   5276 C CA  . ALA B 1 144 ? 121.536 47.239 -30.390 1.00 35.13  ? 141  ALA B CA  1 
ATOM   5277 C C   . ALA B 1 144 ? 121.126 47.029 -31.837 1.00 34.80  ? 141  ALA B C   1 
ATOM   5278 O O   . ALA B 1 144 ? 121.759 46.242 -32.550 1.00 37.86  ? 141  ALA B O   1 
ATOM   5279 C CB  . ALA B 1 144 ? 120.760 46.271 -29.496 1.00 32.27  ? 141  ALA B CB  1 
ATOM   5280 N N   . GLU B 1 145 ? 120.085 47.716 -32.281 1.00 31.35  ? 142  GLU B N   1 
ATOM   5281 C CA  . GLU B 1 145 ? 119.493 47.478 -33.583 1.00 34.59  ? 142  GLU B CA  1 
ATOM   5282 C C   . GLU B 1 145 ? 119.573 48.690 -34.491 1.00 38.49  ? 142  GLU B C   1 
ATOM   5283 O O   . GLU B 1 145 ? 119.132 48.611 -35.645 1.00 33.64  ? 142  GLU B O   1 
ATOM   5284 C CB  . GLU B 1 145 ? 118.036 47.039 -33.410 1.00 31.79  ? 142  GLU B CB  1 
ATOM   5285 C CG  . GLU B 1 145 ? 117.924 45.664 -32.760 1.00 35.65  ? 142  GLU B CG  1 
ATOM   5286 C CD  . GLU B 1 145 ? 118.595 44.586 -33.602 1.00 39.02  ? 142  GLU B CD  1 
ATOM   5287 O OE1 . GLU B 1 145 ? 118.375 44.596 -34.835 1.00 34.87  ? 142  GLU B OE1 1 
ATOM   5288 O OE2 . GLU B 1 145 ? 119.338 43.746 -33.042 1.00 33.93  ? 142  GLU B OE2 1 
ATOM   5289 N N   . ARG B 1 146 ? 120.110 49.806 -33.988 1.00 38.42  ? 143  ARG B N   1 
ATOM   5290 C CA  . ARG B 1 146 ? 120.389 51.017 -34.763 1.00 35.00  ? 143  ARG B CA  1 
ATOM   5291 C C   . ARG B 1 146 ? 119.181 51.451 -35.578 1.00 30.41  ? 143  ARG B C   1 
ATOM   5292 O O   . ARG B 1 146 ? 119.265 51.769 -36.762 1.00 40.75  ? 143  ARG B O   1 
ATOM   5293 C CB  . ARG B 1 146 ? 121.636 50.848 -35.633 1.00 35.19  ? 143  ARG B CB  1 
ATOM   5294 C CG  . ARG B 1 146 ? 122.913 50.841 -34.786 1.00 38.86  ? 143  ARG B CG  1 
ATOM   5295 C CD  . ARG B 1 146 ? 124.196 50.991 -35.616 1.00 36.81  ? 143  ARG B CD  1 
ATOM   5296 N NE  . ARG B 1 146 ? 124.366 52.339 -36.151 1.00 39.92  ? 143  ARG B NE  1 
ATOM   5297 C CZ  . ARG B 1 146 ? 125.003 53.321 -35.514 1.00 48.35  ? 143  ARG B CZ  1 
ATOM   5298 N NH1 . ARG B 1 146 ? 125.538 53.110 -34.310 1.00 37.50  ? 143  ARG B NH1 1 
ATOM   5299 N NH2 . ARG B 1 146 ? 125.103 54.520 -36.079 1.00 47.94  ? 143  ARG B NH2 1 
ATOM   5300 N N   . THR B 1 147 ? 118.036 51.419 -34.927 1.00 33.03  ? 144  THR B N   1 
ATOM   5301 C CA  A THR B 1 147 ? 116.838 52.072 -35.427 0.38 31.75  ? 144  THR B CA  1 
ATOM   5302 C CA  B THR B 1 147 ? 116.826 52.059 -35.411 0.62 31.77  ? 144  THR B CA  1 
ATOM   5303 C C   . THR B 1 147 ? 116.676 53.418 -34.727 1.00 26.02  ? 144  THR B C   1 
ATOM   5304 O O   . THR B 1 147 ? 117.422 53.761 -33.810 1.00 26.16  ? 144  THR B O   1 
ATOM   5305 C CB  A THR B 1 147 ? 115.605 51.192 -35.198 0.38 33.07  ? 144  THR B CB  1 
ATOM   5306 C CB  B THR B 1 147 ? 115.606 51.167 -35.137 0.62 33.11  ? 144  THR B CB  1 
ATOM   5307 O OG1 A THR B 1 147 ? 114.424 51.910 -35.575 0.38 29.11  ? 144  THR B OG1 1 
ATOM   5308 O OG1 B THR B 1 147 ? 115.280 51.210 -33.741 0.62 27.54  ? 144  THR B OG1 1 
ATOM   5309 C CG2 A THR B 1 147 ? 115.507 50.788 -33.730 0.38 29.01  ? 144  THR B CG2 1 
ATOM   5310 C CG2 B THR B 1 147 ? 115.910 49.721 -35.511 0.62 29.75  ? 144  THR B CG2 1 
ATOM   5311 N N   . VAL B 1 148 ? 115.703 54.193 -35.187 1.00 23.47  ? 145  VAL B N   1 
ATOM   5312 C CA  . VAL B 1 148 ? 115.276 55.409 -34.500 1.00 28.75  ? 145  VAL B CA  1 
ATOM   5313 C C   . VAL B 1 148 ? 114.019 55.079 -33.697 1.00 33.13  ? 145  VAL B C   1 
ATOM   5314 O O   . VAL B 1 148 ? 113.099 54.422 -34.213 1.00 29.47  ? 145  VAL B O   1 
ATOM   5315 C CB  . VAL B 1 148 ? 115.005 56.553 -35.492 1.00 29.09  ? 145  VAL B CB  1 
ATOM   5316 C CG1 . VAL B 1 148 ? 114.238 57.691 -34.797 1.00 30.66  ? 145  VAL B CG1 1 
ATOM   5317 C CG2 . VAL B 1 148 ? 116.305 57.072 -36.080 1.00 30.04  ? 145  VAL B CG2 1 
ATOM   5318 N N   . LEU B 1 149 ? 113.966 55.535 -32.442 1.00 26.17  ? 146  LEU B N   1 
ATOM   5319 C CA  . LEU B 1 149 ? 112.814 55.299 -31.573 1.00 23.92  ? 146  LEU B CA  1 
ATOM   5320 C C   . LEU B 1 149 ? 112.192 56.613 -31.136 1.00 26.99  ? 146  LEU B C   1 
ATOM   5321 O O   . LEU B 1 149 ? 112.892 57.509 -30.647 1.00 25.42  ? 146  LEU B O   1 
ATOM   5322 C CB  . LEU B 1 149 ? 113.202 54.460 -30.348 1.00 26.60  ? 146  LEU B CB  1 
ATOM   5323 C CG  . LEU B 1 149 ? 112.088 54.170 -29.319 1.00 30.23  ? 146  LEU B CG  1 
ATOM   5324 C CD1 . LEU B 1 149 ? 110.936 53.383 -29.899 1.00 23.88  ? 146  LEU B CD1 1 
ATOM   5325 C CD2 . LEU B 1 149 ? 112.684 53.395 -28.197 1.00 33.77  ? 146  LEU B CD2 1 
ATOM   5326 N N   . VAL B 1 150 ? 110.876 56.716 -31.314 1.00 23.71  ? 147  VAL B N   1 
ATOM   5327 C CA  . VAL B 1 150 ? 110.068 57.835 -30.845 1.00 21.63  ? 147  VAL B CA  1 
ATOM   5328 C C   . VAL B 1 150 ? 109.021 57.335 -29.850 1.00 29.22  ? 147  VAL B C   1 
ATOM   5329 O O   . VAL B 1 150 ? 108.416 56.275 -30.054 1.00 26.08  ? 147  VAL B O   1 
ATOM   5330 C CB  . VAL B 1 150 ? 109.367 58.539 -32.019 1.00 21.36  ? 147  VAL B CB  1 
ATOM   5331 C CG1 . VAL B 1 150 ? 108.704 59.832 -31.540 1.00 17.15  ? 147  VAL B CG1 1 
ATOM   5332 C CG2 . VAL B 1 150 ? 110.363 58.793 -33.155 1.00 22.38  ? 147  VAL B CG2 1 
ATOM   5333 N N   . SER B 1 151 ? 108.782 58.110 -28.791 1.00 21.06  ? 148  SER B N   1 
ATOM   5334 C CA  . SER B 1 151 ? 107.637 57.868 -27.918 1.00 25.48  ? 148  SER B CA  1 
ATOM   5335 C C   . SER B 1 151 ? 107.048 59.205 -27.523 1.00 23.60  ? 148  SER B C   1 
ATOM   5336 O O   . SER B 1 151 ? 107.771 60.190 -27.409 1.00 25.16  ? 148  SER B O   1 
ATOM   5337 C CB  . SER B 1 151 ? 108.010 57.058 -26.670 1.00 19.59  ? 148  SER B CB  1 
ATOM   5338 O OG  . SER B 1 151 ? 108.953 57.728 -25.842 1.00 18.21  ? 148  SER B OG  1 
ATOM   5339 N N   . MET B 1 152 ? 105.724 59.243 -27.338 1.00 21.00  ? 149  MET B N   1 
ATOM   5340 C CA  . MET B 1 152 ? 105.027 60.476 -26.987 1.00 18.97  ? 149  MET B CA  1 
ATOM   5341 C C   . MET B 1 152 ? 104.207 60.295 -25.710 1.00 26.81  ? 149  MET B C   1 
ATOM   5342 O O   . MET B 1 152 ? 103.812 59.177 -25.356 1.00 21.06  ? 149  MET B O   1 
ATOM   5343 C CB  . MET B 1 152 ? 104.113 60.951 -28.120 1.00 16.11  ? 149  MET B CB  1 
ATOM   5344 C CG  . MET B 1 152 ? 102.672 60.401 -28.151 1.00 20.79  ? 149  MET B CG  1 
ATOM   5345 S SD  . MET B 1 152 ? 102.626 58.613 -28.480 1.00 21.23  ? 149  MET B SD  1 
ATOM   5346 C CE  . MET B 1 152 ? 103.353 58.499 -30.133 1.00 27.87  ? 149  MET B CE  1 
ATOM   5347 N N   . ASN B 1 153 ? 103.988 61.400 -25.000 1.00 23.30  ? 150  ASN B N   1 
ATOM   5348 C CA  . ASN B 1 153 ? 102.922 61.449 -24.012 1.00 22.93  ? 150  ASN B CA  1 
ATOM   5349 C C   . ASN B 1 153 ? 101.619 61.799 -24.711 1.00 23.12  ? 150  ASN B C   1 
ATOM   5350 O O   . ASN B 1 153 ? 101.603 62.516 -25.715 1.00 18.68  ? 150  ASN B O   1 
ATOM   5351 C CB  . ASN B 1 153 ? 103.184 62.495 -22.927 1.00 13.51  ? 150  ASN B CB  1 
ATOM   5352 C CG  . ASN B 1 153 ? 104.121 62.017 -21.858 1.00 19.08  ? 150  ASN B CG  1 
ATOM   5353 O OD1 . ASN B 1 153 ? 104.708 60.939 -21.949 1.00 24.42  ? 150  ASN B OD1 1 
ATOM   5354 N ND2 . ASN B 1 153 ? 104.278 62.828 -20.819 1.00 21.11  ? 150  ASN B ND2 1 
ATOM   5355 N N   . TYR B 1 154 ? 100.520 61.281 -24.172 1.00 15.36  ? 151  TYR B N   1 
ATOM   5356 C CA  . TYR B 1 154 ? 99.196  61.633 -24.648 1.00 16.26  ? 151  TYR B CA  1 
ATOM   5357 C C   . TYR B 1 154 ? 98.293  61.712 -23.432 1.00 16.45  ? 151  TYR B C   1 
ATOM   5358 O O   . TYR B 1 154 ? 98.528  61.033 -22.427 1.00 16.96  ? 151  TYR B O   1 
ATOM   5359 C CB  . TYR B 1 154 ? 98.647  60.610 -25.690 1.00 15.90  ? 151  TYR B CB  1 
ATOM   5360 C CG  . TYR B 1 154 ? 98.489  59.187 -25.166 1.00 15.74  ? 151  TYR B CG  1 
ATOM   5361 C CD1 . TYR B 1 154 ? 99.550  58.281 -25.218 1.00 18.49  ? 151  TYR B CD1 1 
ATOM   5362 C CD2 . TYR B 1 154 ? 97.277  58.752 -24.615 1.00 20.49  ? 151  TYR B CD2 1 
ATOM   5363 C CE1 . TYR B 1 154 ? 99.421  56.984 -24.740 1.00 16.75  ? 151  TYR B CE1 1 
ATOM   5364 C CE2 . TYR B 1 154 ? 97.131  57.432 -24.132 1.00 17.49  ? 151  TYR B CE2 1 
ATOM   5365 C CZ  . TYR B 1 154 ? 98.202  56.561 -24.192 1.00 16.59  ? 151  TYR B CZ  1 
ATOM   5366 O OH  . TYR B 1 154 ? 98.073  55.273 -23.694 1.00 15.70  ? 151  TYR B OH  1 
ATOM   5367 N N   . ARG B 1 155 ? 97.257  62.532 -23.532 1.00 15.76  ? 152  ARG B N   1 
ATOM   5368 C CA  . ARG B 1 155 ? 96.374  62.743 -22.393 1.00 17.51  ? 152  ARG B CA  1 
ATOM   5369 C C   . ARG B 1 155 ? 95.601  61.470 -22.057 1.00 22.29  ? 152  ARG B C   1 
ATOM   5370 O O   . ARG B 1 155 ? 95.137  60.752 -22.950 1.00 20.66  ? 152  ARG B O   1 
ATOM   5371 C CB  . ARG B 1 155 ? 95.418  63.900 -22.691 1.00 19.74  ? 152  ARG B CB  1 
ATOM   5372 C CG  . ARG B 1 155 ? 96.007  65.302 -22.414 1.00 19.02  ? 152  ARG B CG  1 
ATOM   5373 C CD  . ARG B 1 155 ? 95.093  66.414 -22.956 1.00 16.62  ? 152  ARG B CD  1 
ATOM   5374 N NE  . ARG B 1 155 ? 95.143  66.451 -24.413 1.00 18.04  ? 152  ARG B NE  1 
ATOM   5375 C CZ  . ARG B 1 155 ? 94.306  67.141 -25.179 1.00 21.43  ? 152  ARG B CZ  1 
ATOM   5376 N NH1 . ARG B 1 155 ? 93.344  67.877 -24.634 1.00 19.73  ? 152  ARG B NH1 1 
ATOM   5377 N NH2 . ARG B 1 155 ? 94.437  67.090 -26.501 1.00 24.42  ? 152  ARG B NH2 1 
ATOM   5378 N N   . VAL B 1 156 ? 95.456  61.189 -20.758 1.00 19.25  ? 153  VAL B N   1 
ATOM   5379 C CA  . VAL B 1 156 ? 94.734  60.010 -20.281 1.00 16.15  ? 153  VAL B CA  1 
ATOM   5380 C C   . VAL B 1 156 ? 93.602  60.464 -19.364 1.00 21.56  ? 153  VAL B C   1 
ATOM   5381 O O   . VAL B 1 156 ? 93.472  61.645 -19.025 1.00 20.64  ? 153  VAL B O   1 
ATOM   5382 C CB  . VAL B 1 156 ? 95.654  59.002 -19.561 1.00 19.33  ? 153  VAL B CB  1 
ATOM   5383 C CG1 . VAL B 1 156 ? 96.624  58.366 -20.557 1.00 15.46  ? 153  VAL B CG1 1 
ATOM   5384 C CG2 . VAL B 1 156 ? 96.439  59.675 -18.387 1.00 15.83  ? 153  VAL B CG2 1 
ATOM   5385 N N   . GLY B 1 157 ? 92.767  59.498 -18.978 1.00 19.19  ? 154  GLY B N   1 
ATOM   5386 C CA  . GLY B 1 157 ? 91.670  59.764 -18.060 1.00 16.43  ? 154  GLY B CA  1 
ATOM   5387 C C   . GLY B 1 157 ? 90.694  60.751 -18.662 1.00 17.96  ? 154  GLY B C   1 
ATOM   5388 O O   . GLY B 1 157 ? 90.534  60.856 -19.878 1.00 18.68  ? 154  GLY B O   1 
ATOM   5389 N N   . ALA B 1 158 ? 90.040  61.510 -17.789 1.00 17.52  ? 155  ALA B N   1 
ATOM   5390 C CA  . ALA B 1 158 ? 89.064  62.479 -18.265 1.00 18.85  ? 155  ALA B CA  1 
ATOM   5391 C C   . ALA B 1 158 ? 89.683  63.498 -19.222 1.00 24.03  ? 155  ALA B C   1 
ATOM   5392 O O   . ALA B 1 158 ? 89.020  63.936 -20.174 1.00 20.43  ? 155  ALA B O   1 
ATOM   5393 C CB  . ALA B 1 158 ? 88.424  63.174 -17.078 1.00 17.60  ? 155  ALA B CB  1 
ATOM   5394 N N   . PHE B 1 159 ? 90.954  63.865 -19.007 1.00 20.30  ? 156  PHE B N   1 
ATOM   5395 C CA  . PHE B 1 159 ? 91.588  64.885 -19.839 1.00 19.56  ? 156  PHE B CA  1 
ATOM   5396 C C   . PHE B 1 159 ? 91.742  64.409 -21.275 1.00 20.93  ? 156  PHE B C   1 
ATOM   5397 O O   . PHE B 1 159 ? 91.621  65.214 -22.207 1.00 17.78  ? 156  PHE B O   1 
ATOM   5398 C CB  . PHE B 1 159 ? 92.942  65.273 -19.230 1.00 23.16  ? 156  PHE B CB  1 
ATOM   5399 C CG  . PHE B 1 159 ? 92.839  65.655 -17.768 1.00 23.38  ? 156  PHE B CG  1 
ATOM   5400 C CD1 . PHE B 1 159 ? 92.454  66.935 -17.402 1.00 19.88  ? 156  PHE B CD1 1 
ATOM   5401 C CD2 . PHE B 1 159 ? 93.048  64.711 -16.764 1.00 19.07  ? 156  PHE B CD2 1 
ATOM   5402 C CE1 . PHE B 1 159 ? 92.317  67.289 -16.052 1.00 24.83  ? 156  PHE B CE1 1 
ATOM   5403 C CE2 . PHE B 1 159 ? 92.902  65.052 -15.415 1.00 20.28  ? 156  PHE B CE2 1 
ATOM   5404 C CZ  . PHE B 1 159 ? 92.529  66.339 -15.064 1.00 20.83  ? 156  PHE B CZ  1 
ATOM   5405 N N   . GLY B 1 160 ? 91.984  63.113 -21.474 1.00 18.56  ? 157  GLY B N   1 
ATOM   5406 C CA  . GLY B 1 160 ? 92.105  62.559 -22.811 1.00 18.24  ? 157  GLY B CA  1 
ATOM   5407 C C   . GLY B 1 160 ? 90.818  62.018 -23.417 1.00 24.46  ? 157  GLY B C   1 
ATOM   5408 O O   . GLY B 1 160 ? 90.706  61.920 -24.644 1.00 24.49  ? 157  GLY B O   1 
ATOM   5409 N N   . PHE B 1 161 ? 89.827  61.652 -22.589 1.00 26.08  ? 158  PHE B N   1 
ATOM   5410 C CA  . PHE B 1 161 ? 88.745  60.818 -23.101 1.00 21.45  ? 158  PHE B CA  1 
ATOM   5411 C C   . PHE B 1 161 ? 87.368  61.101 -22.524 1.00 25.69  ? 158  PHE B C   1 
ATOM   5412 O O   . PHE B 1 161 ? 86.421  60.403 -22.895 1.00 26.11  ? 158  PHE B O   1 
ATOM   5413 C CB  . PHE B 1 161 ? 89.105  59.333 -22.895 1.00 17.79  ? 158  PHE B CB  1 
ATOM   5414 C CG  . PHE B 1 161 ? 90.309  58.926 -23.680 1.00 20.98  ? 158  PHE B CG  1 
ATOM   5415 C CD1 . PHE B 1 161 ? 90.201  58.693 -25.053 1.00 21.42  ? 158  PHE B CD1 1 
ATOM   5416 C CD2 . PHE B 1 161 ? 91.565  58.868 -23.083 1.00 16.83  ? 158  PHE B CD2 1 
ATOM   5417 C CE1 . PHE B 1 161 ? 91.321  58.363 -25.809 1.00 19.14  ? 158  PHE B CE1 1 
ATOM   5418 C CE2 . PHE B 1 161 ? 92.704  58.544 -23.839 1.00 13.40  ? 158  PHE B CE2 1 
ATOM   5419 C CZ  . PHE B 1 161 ? 92.577  58.295 -25.205 1.00 17.95  ? 158  PHE B CZ  1 
ATOM   5420 N N   . LEU B 1 162 ? 87.218  62.081 -21.634 1.00 22.88  ? 159  LEU B N   1 
ATOM   5421 C CA  . LEU B 1 162 ? 85.888  62.532 -21.278 1.00 23.53  ? 159  LEU B CA  1 
ATOM   5422 C C   . LEU B 1 162 ? 85.181  62.965 -22.547 1.00 28.45  ? 159  LEU B C   1 
ATOM   5423 O O   . LEU B 1 162 ? 85.759  63.669 -23.375 1.00 26.94  ? 159  LEU B O   1 
ATOM   5424 C CB  . LEU B 1 162 ? 85.952  63.688 -20.284 1.00 23.54  ? 159  LEU B CB  1 
ATOM   5425 C CG  . LEU B 1 162 ? 84.590  64.179 -19.781 1.00 25.19  ? 159  LEU B CG  1 
ATOM   5426 C CD1 . LEU B 1 162 ? 84.594  64.388 -18.265 1.00 22.85  ? 159  LEU B CD1 1 
ATOM   5427 C CD2 . LEU B 1 162 ? 84.160  65.453 -20.488 1.00 24.00  ? 159  LEU B CD2 1 
ATOM   5428 N N   . ALA B 1 163 ? 83.935  62.531 -22.716 1.00 29.41  ? 160  ALA B N   1 
ATOM   5429 C CA  . ALA B 1 163 ? 83.222  62.820 -23.952 1.00 28.17  ? 160  ALA B CA  1 
ATOM   5430 C C   . ALA B 1 163 ? 81.767  63.100 -23.646 1.00 36.13  ? 160  ALA B C   1 
ATOM   5431 O O   . ALA B 1 163 ? 81.108  62.317 -22.952 1.00 35.21  ? 160  ALA B O   1 
ATOM   5432 C CB  . ALA B 1 163 ? 83.339  61.663 -24.946 1.00 30.36  ? 160  ALA B CB  1 
ATOM   5433 N N   . LEU B 1 164 ? 81.296  64.251 -24.118 1.00 35.41  ? 161  LEU B N   1 
ATOM   5434 C CA  . LEU B 1 164 ? 79.877  64.551 -24.253 1.00 36.68  ? 161  LEU B CA  1 
ATOM   5435 C C   . LEU B 1 164 ? 79.596  64.489 -25.748 1.00 39.94  ? 161  LEU B C   1 
ATOM   5436 O O   . LEU B 1 164 ? 79.725  65.502 -26.450 1.00 39.28  ? 161  LEU B O   1 
ATOM   5437 C CB  . LEU B 1 164 ? 79.531  65.926 -23.678 1.00 37.53  ? 161  LEU B CB  1 
ATOM   5438 C CG  . LEU B 1 164 ? 79.752  66.068 -22.172 1.00 37.39  ? 161  LEU B CG  1 
ATOM   5439 C CD1 . LEU B 1 164 ? 79.460  67.482 -21.730 1.00 43.81  ? 161  LEU B CD1 1 
ATOM   5440 C CD2 . LEU B 1 164 ? 78.877  65.095 -21.419 1.00 31.82  ? 161  LEU B CD2 1 
ATOM   5441 N N   . PRO B 1 165 ? 79.251  63.319 -26.288 1.00 40.70  ? 162  PRO B N   1 
ATOM   5442 C CA  . PRO B 1 165 ? 79.193  63.163 -27.751 1.00 42.95  ? 162  PRO B CA  1 
ATOM   5443 C C   . PRO B 1 165 ? 78.268  64.177 -28.416 1.00 42.76  ? 162  PRO B C   1 
ATOM   5444 O O   . PRO B 1 165 ? 77.205  64.528 -27.895 1.00 36.20  ? 162  PRO B O   1 
ATOM   5445 C CB  . PRO B 1 165 ? 78.688  61.727 -27.931 1.00 40.57  ? 162  PRO B CB  1 
ATOM   5446 C CG  . PRO B 1 165 ? 79.204  61.011 -26.716 1.00 38.95  ? 162  PRO B CG  1 
ATOM   5447 C CD  . PRO B 1 165 ? 79.081  62.032 -25.588 1.00 38.31  ? 162  PRO B CD  1 
ATOM   5448 N N   . GLY B 1 166 ? 78.710  64.671 -29.572 1.00 51.09  ? 163  GLY B N   1 
ATOM   5449 C CA  . GLY B 1 166 ? 77.992  65.712 -30.276 1.00 45.48  ? 163  GLY B CA  1 
ATOM   5450 C C   . GLY B 1 166 ? 78.522  67.100 -29.986 1.00 52.69  ? 163  GLY B C   1 
ATOM   5451 O O   . GLY B 1 166 ? 78.565  67.952 -30.881 1.00 51.05  ? 163  GLY B O   1 
ATOM   5452 N N   . SER B 1 167 ? 78.940  67.335 -28.744 1.00 46.09  ? 164  SER B N   1 
ATOM   5453 C CA  . SER B 1 167 ? 79.359  68.667 -28.324 1.00 44.90  ? 164  SER B CA  1 
ATOM   5454 C C   . SER B 1 167 ? 80.675  69.072 -28.982 1.00 43.91  ? 164  SER B C   1 
ATOM   5455 O O   . SER B 1 167 ? 81.510  68.234 -29.330 1.00 41.37  ? 164  SER B O   1 
ATOM   5456 C CB  . SER B 1 167 ? 79.526  68.727 -26.805 1.00 41.11  ? 164  SER B CB  1 
ATOM   5457 O OG  . SER B 1 167 ? 80.850  68.331 -26.443 1.00 38.96  ? 164  SER B OG  1 
ATOM   5458 N N   . ARG B 1 168 ? 80.861  70.385 -29.121 1.00 44.03  ? 165  ARG B N   1 
ATOM   5459 C CA  . ARG B 1 168 ? 82.143  70.924 -29.560 1.00 49.35  ? 165  ARG B CA  1 
ATOM   5460 C C   . ARG B 1 168 ? 83.143  71.034 -28.416 1.00 40.21  ? 165  ARG B C   1 
ATOM   5461 O O   . ARG B 1 168 ? 84.357  71.010 -28.653 1.00 36.10  ? 165  ARG B O   1 
ATOM   5462 C CB  . ARG B 1 168 ? 81.946  72.309 -30.178 1.00 54.30  ? 165  ARG B CB  1 
ATOM   5463 C CG  . ARG B 1 168 ? 82.961  72.677 -31.242 1.00 62.54  ? 165  ARG B CG  1 
ATOM   5464 C CD  . ARG B 1 168 ? 82.622  71.998 -32.556 1.00 61.98  ? 165  ARG B CD  1 
ATOM   5465 N NE  . ARG B 1 168 ? 83.236  72.679 -33.693 1.00 75.18  ? 165  ARG B NE  1 
ATOM   5466 C CZ  . ARG B 1 168 ? 82.717  73.745 -34.302 1.00 81.91  ? 165  ARG B CZ  1 
ATOM   5467 N NH1 . ARG B 1 168 ? 81.569  74.272 -33.884 1.00 75.66  ? 165  ARG B NH1 1 
ATOM   5468 N NH2 . ARG B 1 168 ? 83.349  74.287 -35.334 1.00 86.58  ? 165  ARG B NH2 1 
ATOM   5469 N N   . GLU B 1 169 ? 82.650  71.161 -27.179 1.00 41.41  ? 166  GLU B N   1 
ATOM   5470 C CA  . GLU B 1 169 ? 83.513  71.503 -26.053 1.00 42.71  ? 166  GLU B CA  1 
ATOM   5471 C C   . GLU B 1 169 ? 84.231  70.289 -25.480 1.00 39.04  ? 166  GLU B C   1 
ATOM   5472 O O   . GLU B 1 169 ? 85.338  70.430 -24.939 1.00 38.96  ? 166  GLU B O   1 
ATOM   5473 C CB  . GLU B 1 169 ? 82.698  72.193 -24.960 1.00 42.46  ? 166  GLU B CB  1 
ATOM   5474 C CG  . GLU B 1 169 ? 82.038  73.500 -25.397 1.00 45.94  ? 166  GLU B CG  1 
ATOM   5475 C CD  . GLU B 1 169 ? 80.648  73.304 -26.010 1.00 59.99  ? 166  GLU B CD  1 
ATOM   5476 O OE1 . GLU B 1 169 ? 80.298  72.148 -26.372 1.00 54.66  ? 166  GLU B OE1 1 
ATOM   5477 O OE2 . GLU B 1 169 ? 79.905  74.315 -26.119 1.00 51.47  ? 166  GLU B OE2 1 
ATOM   5478 N N   . ALA B 1 170 ? 83.637  69.101 -25.589 1.00 35.20  ? 167  ALA B N   1 
ATOM   5479 C CA  . ALA B 1 170 ? 84.266  67.861 -25.128 1.00 36.84  ? 167  ALA B CA  1 
ATOM   5480 C C   . ALA B 1 170 ? 83.898  66.762 -26.103 1.00 34.70  ? 167  ALA B C   1 
ATOM   5481 O O   . ALA B 1 170 ? 83.044  65.914 -25.820 1.00 38.05  ? 167  ALA B O   1 
ATOM   5482 C CB  . ALA B 1 170 ? 83.839  67.515 -23.697 1.00 25.59  ? 167  ALA B CB  1 
ATOM   5483 N N   . PRO B 1 171 ? 84.528  66.747 -27.280 1.00 39.12  ? 168  PRO B N   1 
ATOM   5484 C CA  . PRO B 1 171 ? 84.123  65.798 -28.327 1.00 40.23  ? 168  PRO B CA  1 
ATOM   5485 C C   . PRO B 1 171 ? 84.504  64.364 -28.037 1.00 41.77  ? 168  PRO B C   1 
ATOM   5486 O O   . PRO B 1 171 ? 83.886  63.457 -28.608 1.00 46.27  ? 168  PRO B O   1 
ATOM   5487 C CB  . PRO B 1 171 ? 84.875  66.313 -29.558 1.00 39.01  ? 168  PRO B CB  1 
ATOM   5488 C CG  . PRO B 1 171 ? 86.137  66.864 -28.965 1.00 33.85  ? 168  PRO B CG  1 
ATOM   5489 C CD  . PRO B 1 171 ? 85.669  67.571 -27.713 1.00 35.43  ? 168  PRO B CD  1 
ATOM   5490 N N   . GLY B 1 172 ? 85.514  64.129 -27.207 1.00 35.75  ? 169  GLY B N   1 
ATOM   5491 C CA  . GLY B 1 172 ? 86.027  62.801 -26.965 1.00 30.14  ? 169  GLY B CA  1 
ATOM   5492 C C   . GLY B 1 172 ? 87.276  62.506 -27.784 1.00 28.76  ? 169  GLY B C   1 
ATOM   5493 O O   . GLY B 1 172 ? 87.628  63.216 -28.729 1.00 31.94  ? 169  GLY B O   1 
ATOM   5494 N N   . ASN B 1 173 ? 87.979  61.449 -27.378 1.00 23.10  ? 170  ASN B N   1 
ATOM   5495 C CA  . ASN B 1 173 ? 89.082  60.876 -28.142 1.00 23.37  ? 170  ASN B CA  1 
ATOM   5496 C C   . ASN B 1 173 ? 90.262  61.840 -28.316 1.00 23.97  ? 170  ASN B C   1 
ATOM   5497 O O   . ASN B 1 173 ? 91.144  61.600 -29.150 1.00 25.71  ? 170  ASN B O   1 
ATOM   5498 C CB  . ASN B 1 173 ? 88.584  60.386 -29.514 1.00 28.06  ? 170  ASN B CB  1 
ATOM   5499 C CG  . ASN B 1 173 ? 87.631  59.185 -29.403 1.00 31.99  ? 170  ASN B CG  1 
ATOM   5500 O OD1 . ASN B 1 173 ? 87.809  58.319 -28.547 1.00 26.46  ? 170  ASN B OD1 1 
ATOM   5501 N ND2 . ASN B 1 173 ? 86.629  59.133 -30.270 1.00 27.43  ? 170  ASN B ND2 1 
ATOM   5502 N N   . VAL B 1 174 ? 90.344  62.921 -27.536 1.00 23.01  ? 171  VAL B N   1 
ATOM   5503 C CA  . VAL B 1 174 ? 91.440  63.856 -27.788 1.00 23.87  ? 171  VAL B CA  1 
ATOM   5504 C C   . VAL B 1 174 ? 92.796  63.240 -27.457 1.00 23.07  ? 171  VAL B C   1 
ATOM   5505 O O   . VAL B 1 174 ? 93.802  63.617 -28.070 1.00 24.35  ? 171  VAL B O   1 
ATOM   5506 C CB  . VAL B 1 174 ? 91.191  65.201 -27.074 1.00 27.59  ? 171  VAL B CB  1 
ATOM   5507 C CG1 . VAL B 1 174 ? 89.896  65.813 -27.615 1.00 26.62  ? 171  VAL B CG1 1 
ATOM   5508 C CG2 . VAL B 1 174 ? 91.144  65.070 -25.545 1.00 23.36  ? 171  VAL B CG2 1 
ATOM   5509 N N   . GLY B 1 175 ? 92.849  62.231 -26.583 1.00 21.79  ? 172  GLY B N   1 
ATOM   5510 C CA  . GLY B 1 175 ? 94.106  61.535 -26.367 1.00 17.61  ? 172  GLY B CA  1 
ATOM   5511 C C   . GLY B 1 175 ? 94.578  60.776 -27.590 1.00 24.20  ? 172  GLY B C   1 
ATOM   5512 O O   . GLY B 1 175 ? 95.786  60.637 -27.819 1.00 18.20  ? 172  GLY B O   1 
ATOM   5513 N N   . LEU B 1 176 ? 93.646  60.241 -28.380 1.00 21.69  ? 173  LEU B N   1 
ATOM   5514 C CA  . LEU B 1 176 ? 94.059  59.585 -29.612 1.00 21.72  ? 173  LEU B CA  1 
ATOM   5515 C C   . LEU B 1 176 ? 94.556  60.615 -30.626 1.00 18.15  ? 173  LEU B C   1 
ATOM   5516 O O   . LEU B 1 176 ? 95.491  60.350 -31.392 1.00 21.68  ? 173  LEU B O   1 
ATOM   5517 C CB  . LEU B 1 176 ? 92.899  58.754 -30.179 1.00 30.24  ? 173  LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 176 ? 92.527  57.434 -29.476 1.00 27.06  ? 173  LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 176 ? 91.114  56.935 -29.856 1.00 20.08  ? 173  LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 176 ? 93.555  56.377 -29.822 1.00 24.36  ? 173  LEU B CD2 1 
ATOM   5521 N N   . LEU B 1 177 ? 93.943  61.796 -30.641 1.00 17.61  ? 174  LEU B N   1 
ATOM   5522 C CA  . LEU B 1 177 ? 94.434  62.872 -31.494 1.00 25.55  ? 174  LEU B CA  1 
ATOM   5523 C C   . LEU B 1 177 ? 95.825  63.342 -31.058 1.00 29.62  ? 174  LEU B C   1 
ATOM   5524 O O   . LEU B 1 177 ? 96.671  63.659 -31.906 1.00 25.77  ? 174  LEU B O   1 
ATOM   5525 C CB  . LEU B 1 177 ? 93.430  64.020 -31.500 1.00 24.02  ? 174  LEU B CB  1 
ATOM   5526 C CG  . LEU B 1 177 ? 92.086  63.649 -32.130 1.00 25.63  ? 174  LEU B CG  1 
ATOM   5527 C CD1 . LEU B 1 177 ? 91.103  64.807 -32.085 1.00 21.75  ? 174  LEU B CD1 1 
ATOM   5528 C CD2 . LEU B 1 177 ? 92.277  63.167 -33.573 1.00 19.60  ? 174  LEU B CD2 1 
ATOM   5529 N N   . ASP B 1 178 ? 96.098  63.359 -29.745 1.00 22.35  ? 175  ASP B N   1 
ATOM   5530 C CA  . ASP B 1 178 ? 97.450  63.671 -29.297 1.00 18.41  ? 175  ASP B CA  1 
ATOM   5531 C C   . ASP B 1 178 ? 98.441  62.741 -29.965 1.00 20.56  ? 175  ASP B C   1 
ATOM   5532 O O   . ASP B 1 178 ? 99.474  63.178 -30.488 1.00 24.27  ? 175  ASP B O   1 
ATOM   5533 C CB  . ASP B 1 178 ? 97.580  63.562 -27.763 1.00 17.11  ? 175  ASP B CB  1 
ATOM   5534 C CG  . ASP B 1 178 ? 96.749  64.609 -27.002 1.00 23.40  ? 175  ASP B CG  1 
ATOM   5535 O OD1 . ASP B 1 178 ? 96.248  65.595 -27.613 1.00 23.72  ? 175  ASP B OD1 1 
ATOM   5536 O OD2 . ASP B 1 178 ? 96.603  64.437 -25.764 1.00 21.68  ? 175  ASP B OD2 1 
ATOM   5537 N N   . GLN B 1 179 ? 98.142  61.437 -29.949 1.00 24.90  ? 176  GLN B N   1 
ATOM   5538 C CA  . GLN B 1 179 ? 99.027  60.460 -30.579 1.00 21.18  ? 176  GLN B CA  1 
ATOM   5539 C C   . GLN B 1 179 ? 99.165  60.727 -32.077 1.00 18.58  ? 176  GLN B C   1 
ATOM   5540 O O   . GLN B 1 179 ? 100.257 60.611 -32.637 1.00 19.82  ? 176  GLN B O   1 
ATOM   5541 C CB  . GLN B 1 179 ? 98.501  59.041 -30.339 1.00 21.38  ? 176  GLN B CB  1 
ATOM   5542 C CG  . GLN B 1 179 ? 98.373  58.599 -28.865 1.00 20.59  ? 176  GLN B CG  1 
ATOM   5543 C CD  . GLN B 1 179 ? 97.709  57.220 -28.738 1.00 27.49  ? 176  GLN B CD  1 
ATOM   5544 O OE1 . GLN B 1 179 ? 97.522  56.525 -29.741 1.00 21.14  ? 176  GLN B OE1 1 
ATOM   5545 N NE2 . GLN B 1 179 ? 97.347  56.825 -27.503 1.00 19.05  ? 176  GLN B NE2 1 
ATOM   5546 N N   . ARG B 1 180 ? 98.064  61.081 -32.736 1.00 19.90  ? 177  ARG B N   1 
ATOM   5547 C CA  . ARG B 1 180 ? 98.101  61.327 -34.170 1.00 27.28  ? 177  ARG B CA  1 
ATOM   5548 C C   . ARG B 1 180 ? 98.996  62.518 -34.476 1.00 25.68  ? 177  ARG B C   1 
ATOM   5549 O O   . ARG B 1 180 ? 99.911  62.423 -35.303 1.00 24.60  ? 177  ARG B O   1 
ATOM   5550 C CB  . ARG B 1 180 ? 96.683  61.561 -34.690 1.00 23.35  ? 177  ARG B CB  1 
ATOM   5551 C CG  . ARG B 1 180 ? 96.611  61.823 -36.187 1.00 29.86  ? 177  ARG B CG  1 
ATOM   5552 C CD  . ARG B 1 180 ? 95.206  62.195 -36.588 1.00 29.04  ? 177  ARG B CD  1 
ATOM   5553 N NE  . ARG B 1 180 ? 94.380  60.998 -36.713 1.00 30.06  ? 177  ARG B NE  1 
ATOM   5554 C CZ  . ARG B 1 180 ? 93.065  61.027 -36.860 1.00 29.37  ? 177  ARG B CZ  1 
ATOM   5555 N NH1 . ARG B 1 180 ? 92.435  62.195 -36.888 1.00 31.52  ? 177  ARG B NH1 1 
ATOM   5556 N NH2 . ARG B 1 180 ? 92.385  59.897 -36.975 1.00 28.69  ? 177  ARG B NH2 1 
ATOM   5557 N N   . LEU B 1 181 ? 98.772  63.629 -33.765 1.00 25.46  ? 178  LEU B N   1 
ATOM   5558 C CA  . LEU B 1 181 ? 99.614  64.818 -33.898 1.00 26.78  ? 178  LEU B CA  1 
ATOM   5559 C C   . LEU B 1 181 ? 101.085 64.461 -33.791 1.00 23.87  ? 178  LEU B C   1 
ATOM   5560 O O   . LEU B 1 181 ? 101.893 64.861 -34.637 1.00 27.03  ? 178  LEU B O   1 
ATOM   5561 C CB  . LEU B 1 181 ? 99.226  65.857 -32.850 1.00 18.36  ? 178  LEU B CB  1 
ATOM   5562 C CG  . LEU B 1 181 ? 100.015 67.156 -32.893 1.00 30.56  ? 178  LEU B CG  1 
ATOM   5563 C CD1 . LEU B 1 181 ? 99.744  67.863 -34.232 1.00 29.87  ? 178  LEU B CD1 1 
ATOM   5564 C CD2 . LEU B 1 181 ? 99.627  68.033 -31.723 1.00 23.91  ? 178  LEU B CD2 1 
ATOM   5565 N N   . ALA B 1 182 ? 101.438 63.634 -32.801 1.00 21.37  ? 179  ALA B N   1 
ATOM   5566 C CA  . ALA B 1 182 ? 102.814 63.155 -32.681 1.00 21.73  ? 179  ALA B CA  1 
ATOM   5567 C C   . ALA B 1 182 ? 103.260 62.355 -33.909 1.00 29.05  ? 179  ALA B C   1 
ATOM   5568 O O   . ALA B 1 182 ? 104.450 62.368 -34.269 1.00 23.41  ? 179  ALA B O   1 
ATOM   5569 C CB  . ALA B 1 182 ? 102.970 62.305 -31.416 1.00 13.94  ? 179  ALA B CB  1 
ATOM   5570 N N   . LEU B 1 183 ? 102.338 61.594 -34.525 1.00 26.43  ? 180  LEU B N   1 
ATOM   5571 C CA  . LEU B 1 183 ? 102.697 60.835 -35.724 1.00 29.38  ? 180  LEU B CA  1 
ATOM   5572 C C   . LEU B 1 183 ? 102.909 61.771 -36.910 1.00 24.62  ? 180  LEU B C   1 
ATOM   5573 O O   . LEU B 1 183 ? 103.841 61.585 -37.699 1.00 27.04  ? 180  LEU B O   1 
ATOM   5574 C CB  . LEU B 1 183 ? 101.615 59.789 -36.048 1.00 24.23  ? 180  LEU B CB  1 
ATOM   5575 C CG  . LEU B 1 183 ? 101.417 58.665 -35.014 1.00 27.82  ? 180  LEU B CG  1 
ATOM   5576 C CD1 . LEU B 1 183 ? 100.333 57.704 -35.448 1.00 27.35  ? 180  LEU B CD1 1 
ATOM   5577 C CD2 . LEU B 1 183 ? 102.726 57.914 -34.780 1.00 28.40  ? 180  LEU B CD2 1 
ATOM   5578 N N   . GLN B 1 184 ? 102.041 62.774 -37.051 1.00 18.83  ? 181  GLN B N   1 
ATOM   5579 C CA  . GLN B 1 184 ? 102.297 63.850 -37.999 1.00 25.02  ? 181  GLN B CA  1 
ATOM   5580 C C   . GLN B 1 184 ? 103.627 64.532 -37.719 1.00 33.47  ? 181  GLN B C   1 
ATOM   5581 O O   . GLN B 1 184 ? 104.368 64.858 -38.655 1.00 34.18  ? 181  GLN B O   1 
ATOM   5582 C CB  . GLN B 1 184 ? 101.155 64.851 -37.958 1.00 22.71  ? 181  GLN B CB  1 
ATOM   5583 C CG  . GLN B 1 184 ? 99.874  64.261 -38.468 1.00 31.14  ? 181  GLN B CG  1 
ATOM   5584 C CD  . GLN B 1 184 ? 98.675  65.071 -38.063 1.00 37.34  ? 181  GLN B CD  1 
ATOM   5585 O OE1 . GLN B 1 184 ? 98.760  65.912 -37.164 1.00 39.59  ? 181  GLN B OE1 1 
ATOM   5586 N NE2 . GLN B 1 184 ? 97.543  64.828 -38.717 1.00 31.56  ? 181  GLN B NE2 1 
ATOM   5587 N N   . TRP B 1 185 ? 103.968 64.729 -36.433 1.00 28.02  ? 182  TRP B N   1 
ATOM   5588 C CA  . TRP B 1 185 ? 105.271 65.302 -36.111 1.00 28.53  ? 182  TRP B CA  1 
ATOM   5589 C C   . TRP B 1 185 ? 106.401 64.410 -36.613 1.00 28.37  ? 182  TRP B C   1 
ATOM   5590 O O   . TRP B 1 185 ? 107.411 64.913 -37.119 1.00 29.24  ? 182  TRP B O   1 
ATOM   5591 C CB  . TRP B 1 185 ? 105.402 65.547 -34.600 1.00 26.22  ? 182  TRP B CB  1 
ATOM   5592 C CG  . TRP B 1 185 ? 106.631 66.348 -34.176 1.00 21.65  ? 182  TRP B CG  1 
ATOM   5593 C CD1 . TRP B 1 185 ? 106.686 67.704 -33.875 1.00 24.62  ? 182  TRP B CD1 1 
ATOM   5594 C CD2 . TRP B 1 185 ? 107.960 65.845 -33.961 1.00 19.46  ? 182  TRP B CD2 1 
ATOM   5595 N NE1 . TRP B 1 185 ? 107.976 68.055 -33.510 1.00 21.76  ? 182  TRP B NE1 1 
ATOM   5596 C CE2 . TRP B 1 185 ? 108.767 66.936 -33.550 1.00 19.10  ? 182  TRP B CE2 1 
ATOM   5597 C CE3 . TRP B 1 185 ? 108.544 64.582 -34.060 1.00 20.14  ? 182  TRP B CE3 1 
ATOM   5598 C CZ2 . TRP B 1 185 ? 110.116 66.791 -33.268 1.00 19.36  ? 182  TRP B CZ2 1 
ATOM   5599 C CZ3 . TRP B 1 185 ? 109.890 64.441 -33.770 1.00 19.35  ? 182  TRP B CZ3 1 
ATOM   5600 C CH2 . TRP B 1 185 ? 110.659 65.535 -33.371 1.00 16.13  ? 182  TRP B CH2 1 
ATOM   5601 N N   . VAL B 1 186 ? 106.264 63.084 -36.468 1.00 26.53  ? 183  VAL B N   1 
ATOM   5602 C CA  . VAL B 1 186 ? 107.320 62.179 -36.926 1.00 25.89  ? 183  VAL B CA  1 
ATOM   5603 C C   . VAL B 1 186 ? 107.481 62.271 -38.441 1.00 31.21  ? 183  VAL B C   1 
ATOM   5604 O O   . VAL B 1 186 ? 108.602 62.266 -38.967 1.00 27.42  ? 183  VAL B O   1 
ATOM   5605 C CB  . VAL B 1 186 ? 107.027 60.734 -36.483 1.00 32.15  ? 183  VAL B CB  1 
ATOM   5606 C CG1 . VAL B 1 186 ? 108.021 59.741 -37.142 1.00 25.38  ? 183  VAL B CG1 1 
ATOM   5607 C CG2 . VAL B 1 186 ? 107.096 60.625 -34.972 1.00 25.43  ? 183  VAL B CG2 1 
ATOM   5608 N N   . GLN B 1 187 ? 106.365 62.358 -39.162 1.00 28.07  ? 184  GLN B N   1 
ATOM   5609 C CA  . GLN B 1 187 ? 106.425 62.521 -40.611 1.00 35.74  ? 184  GLN B CA  1 
ATOM   5610 C C   . GLN B 1 187 ? 107.252 63.746 -40.998 1.00 34.59  ? 184  GLN B C   1 
ATOM   5611 O O   . GLN B 1 187 ? 108.106 63.676 -41.893 1.00 33.13  ? 184  GLN B O   1 
ATOM   5612 C CB  . GLN B 1 187 ? 105.004 62.617 -41.172 1.00 28.09  ? 184  GLN B CB  1 
ATOM   5613 C CG  . GLN B 1 187 ? 104.319 61.259 -41.314 1.00 30.13  ? 184  GLN B CG  1 
ATOM   5614 C CD  . GLN B 1 187 ? 105.167 60.273 -42.093 1.00 34.84  ? 184  GLN B CD  1 
ATOM   5615 O OE1 . GLN B 1 187 ? 105.506 60.514 -43.254 1.00 38.84  ? 184  GLN B OE1 1 
ATOM   5616 N NE2 . GLN B 1 187 ? 105.538 59.166 -41.454 1.00 35.60  ? 184  GLN B NE2 1 
ATOM   5617 N N   . GLU B 1 188 ? 107.049 64.862 -40.298 1.00 31.63  ? 185  GLU B N   1 
ATOM   5618 C CA  . GLU B 1 188 ? 107.667 66.125 -40.690 1.00 34.94  ? 185  GLU B CA  1 
ATOM   5619 C C   . GLU B 1 188 ? 109.078 66.320 -40.153 1.00 33.98  ? 185  GLU B C   1 
ATOM   5620 O O   . GLU B 1 188 ? 109.813 67.141 -40.704 1.00 38.40  ? 185  GLU B O   1 
ATOM   5621 C CB  . GLU B 1 188 ? 106.815 67.307 -40.235 1.00 31.27  ? 185  GLU B CB  1 
ATOM   5622 C CG  . GLU B 1 188 ? 105.416 67.314 -40.802 1.00 33.87  ? 185  GLU B CG  1 
ATOM   5623 C CD  . GLU B 1 188 ? 104.631 68.503 -40.310 1.00 42.95  ? 185  GLU B CD  1 
ATOM   5624 O OE1 . GLU B 1 188 ? 103.417 68.592 -40.608 1.00 46.07  ? 185  GLU B OE1 1 
ATOM   5625 O OE2 . GLU B 1 188 ? 105.241 69.346 -39.612 1.00 40.45  ? 185  GLU B OE2 1 
ATOM   5626 N N   . ASN B 1 189 ? 109.489 65.606 -39.106 1.00 27.85  ? 186  ASN B N   1 
ATOM   5627 C CA  . ASN B 1 189 ? 110.745 65.950 -38.458 1.00 26.12  ? 186  ASN B CA  1 
ATOM   5628 C C   . ASN B 1 189 ? 111.685 64.796 -38.239 1.00 26.13  ? 186  ASN B C   1 
ATOM   5629 O O   . ASN B 1 189 ? 112.851 65.042 -37.912 1.00 25.64  ? 186  ASN B O   1 
ATOM   5630 C CB  . ASN B 1 189 ? 110.492 66.617 -37.095 1.00 26.75  ? 186  ASN B CB  1 
ATOM   5631 C CG  . ASN B 1 189 ? 109.738 67.918 -37.228 1.00 28.87  ? 186  ASN B CG  1 
ATOM   5632 O OD1 . ASN B 1 189 ? 110.287 68.910 -37.706 1.00 35.44  ? 186  ASN B OD1 1 
ATOM   5633 N ND2 . ASN B 1 189 ? 108.485 67.931 -36.795 1.00 24.71  ? 186  ASN B ND2 1 
ATOM   5634 N N   . VAL B 1 190 ? 111.236 63.549 -38.375 1.00 22.51  ? 187  VAL B N   1 
ATOM   5635 C CA  . VAL B 1 190 ? 112.119 62.468 -37.956 1.00 24.45  ? 187  VAL B CA  1 
ATOM   5636 C C   . VAL B 1 190 ? 113.341 62.369 -38.858 1.00 24.85  ? 187  VAL B C   1 
ATOM   5637 O O   . VAL B 1 190 ? 114.387 61.863 -38.425 1.00 26.81  ? 187  VAL B O   1 
ATOM   5638 C CB  . VAL B 1 190 ? 111.343 61.130 -37.884 1.00 30.00  ? 187  VAL B CB  1 
ATOM   5639 C CG1 . VAL B 1 190 ? 111.280 60.435 -39.263 1.00 25.61  ? 187  VAL B CG1 1 
ATOM   5640 C CG2 . VAL B 1 190 ? 111.966 60.219 -36.840 1.00 23.78  ? 187  VAL B CG2 1 
ATOM   5641 N N   . ALA B 1 191 ? 113.244 62.843 -40.107 1.00 28.58  ? 188  ALA B N   1 
ATOM   5642 C CA  . ALA B 1 191 ? 114.415 62.840 -40.990 1.00 31.35  ? 188  ALA B CA  1 
ATOM   5643 C C   . ALA B 1 191 ? 115.573 63.635 -40.384 1.00 29.62  ? 188  ALA B C   1 
ATOM   5644 O O   . ALA B 1 191 ? 116.737 63.225 -40.477 1.00 28.59  ? 188  ALA B O   1 
ATOM   5645 C CB  . ALA B 1 191 ? 114.033 63.389 -42.366 1.00 28.13  ? 188  ALA B CB  1 
ATOM   5646 N N   . ALA B 1 192 ? 115.269 64.738 -39.690 1.00 32.62  ? 189  ALA B N   1 
ATOM   5647 C CA  . ALA B 1 192 ? 116.321 65.522 -39.044 1.00 28.76  ? 189  ALA B CA  1 
ATOM   5648 C C   . ALA B 1 192 ? 117.119 64.707 -38.034 1.00 35.09  ? 189  ALA B C   1 
ATOM   5649 O O   . ALA B 1 192 ? 118.232 65.108 -37.670 1.00 34.13  ? 189  ALA B O   1 
ATOM   5650 C CB  . ALA B 1 192 ? 115.714 66.750 -38.380 1.00 23.32  ? 189  ALA B CB  1 
ATOM   5651 N N   . PHE B 1 193 ? 116.605 63.554 -37.602 1.00 32.45  ? 190  PHE B N   1 
ATOM   5652 C CA  . PHE B 1 193 ? 117.349 62.675 -36.708 1.00 28.13  ? 190  PHE B CA  1 
ATOM   5653 C C   . PHE B 1 193 ? 117.966 61.487 -37.425 1.00 30.41  ? 190  PHE B C   1 
ATOM   5654 O O   . PHE B 1 193 ? 118.562 60.626 -36.764 1.00 30.85  ? 190  PHE B O   1 
ATOM   5655 C CB  . PHE B 1 193 ? 116.440 62.191 -35.569 1.00 27.58  ? 190  PHE B CB  1 
ATOM   5656 C CG  . PHE B 1 193 ? 115.873 63.305 -34.739 1.00 23.35  ? 190  PHE B CG  1 
ATOM   5657 C CD1 . PHE B 1 193 ? 114.719 63.958 -35.133 1.00 20.38  ? 190  PHE B CD1 1 
ATOM   5658 C CD2 . PHE B 1 193 ? 116.514 63.715 -33.570 1.00 25.19  ? 190  PHE B CD2 1 
ATOM   5659 C CE1 . PHE B 1 193 ? 114.202 65.005 -34.380 1.00 23.36  ? 190  PHE B CE1 1 
ATOM   5660 C CE2 . PHE B 1 193 ? 116.012 64.753 -32.821 1.00 25.22  ? 190  PHE B CE2 1 
ATOM   5661 C CZ  . PHE B 1 193 ? 114.855 65.406 -33.228 1.00 22.64  ? 190  PHE B CZ  1 
ATOM   5662 N N   . GLY B 1 194 ? 117.854 61.419 -38.753 1.00 34.93  ? 191  GLY B N   1 
ATOM   5663 C CA  . GLY B 1 194 ? 118.280 60.240 -39.489 1.00 30.66  ? 191  GLY B CA  1 
ATOM   5664 C C   . GLY B 1 194 ? 117.230 59.154 -39.619 1.00 40.71  ? 191  GLY B C   1 
ATOM   5665 O O   . GLY B 1 194 ? 117.581 58.006 -39.930 1.00 34.98  ? 191  GLY B O   1 
ATOM   5666 N N   . GLY B 1 195 ? 115.953 59.479 -39.400 1.00 36.87  ? 192  GLY B N   1 
ATOM   5667 C CA  . GLY B 1 195 ? 114.880 58.503 -39.418 1.00 35.54  ? 192  GLY B CA  1 
ATOM   5668 C C   . GLY B 1 195 ? 114.039 58.590 -40.680 1.00 39.71  ? 192  GLY B C   1 
ATOM   5669 O O   . GLY B 1 195 ? 113.822 59.667 -41.234 1.00 38.10  ? 192  GLY B O   1 
ATOM   5670 N N   . ASP B 1 196 ? 113.537 57.436 -41.112 1.00 35.16  ? 193  ASP B N   1 
ATOM   5671 C CA  . ASP B 1 196 ? 112.895 57.309 -42.411 1.00 30.53  ? 193  ASP B CA  1 
ATOM   5672 C C   . ASP B 1 196 ? 111.394 57.399 -42.252 1.00 35.79  ? 193  ASP B C   1 
ATOM   5673 O O   . ASP B 1 196 ? 110.756 56.404 -41.875 1.00 34.12  ? 193  ASP B O   1 
ATOM   5674 C CB  . ASP B 1 196 ? 113.284 55.977 -43.048 1.00 38.68  ? 193  ASP B CB  1 
ATOM   5675 C CG  . ASP B 1 196 ? 112.783 55.829 -44.475 1.00 37.29  ? 193  ASP B CG  1 
ATOM   5676 O OD1 . ASP B 1 196 ? 111.979 56.669 -44.953 1.00 30.19  ? 193  ASP B OD1 1 
ATOM   5677 O OD2 . ASP B 1 196 ? 113.204 54.836 -45.106 1.00 35.82  ? 193  ASP B OD2 1 
ATOM   5678 N N   . PRO B 1 197 ? 110.772 58.535 -42.568 1.00 30.88  ? 194  PRO B N   1 
ATOM   5679 C CA  . PRO B 1 197 ? 109.316 58.637 -42.430 1.00 26.51  ? 194  PRO B CA  1 
ATOM   5680 C C   . PRO B 1 197 ? 108.523 57.704 -43.348 1.00 32.95  ? 194  PRO B C   1 
ATOM   5681 O O   . PRO B 1 197 ? 107.303 57.604 -43.170 1.00 34.44  ? 194  PRO B O   1 
ATOM   5682 C CB  . PRO B 1 197 ? 109.038 60.109 -42.763 1.00 27.82  ? 194  PRO B CB  1 
ATOM   5683 C CG  . PRO B 1 197 ? 110.177 60.500 -43.664 1.00 25.58  ? 194  PRO B CG  1 
ATOM   5684 C CD  . PRO B 1 197 ? 111.368 59.751 -43.145 1.00 29.00  ? 194  PRO B CD  1 
ATOM   5685 N N   . THR B 1 198 ? 109.145 57.062 -44.343 1.00 38.45  ? 195  THR B N   1 
ATOM   5686 C CA  . THR B 1 198 ? 108.434 56.073 -45.159 1.00 38.74  ? 195  THR B CA  1 
ATOM   5687 C C   . THR B 1 198 ? 108.486 54.677 -44.544 1.00 39.13  ? 195  THR B C   1 
ATOM   5688 O O   . THR B 1 198 ? 107.935 53.735 -45.123 1.00 41.81  ? 195  THR B O   1 
ATOM   5689 C CB  . THR B 1 198 ? 108.984 56.007 -46.607 1.00 26.67  ? 195  THR B CB  1 
ATOM   5690 O OG1 . THR B 1 198 ? 110.311 55.452 -46.621 1.00 25.95  ? 195  THR B OG1 1 
ATOM   5691 C CG2 . THR B 1 198 ? 108.968 57.374 -47.292 1.00 25.12  ? 195  THR B CG2 1 
ATOM   5692 N N   . SER B 1 199 ? 109.130 54.527 -43.384 1.00 33.99  ? 196  SER B N   1 
ATOM   5693 C CA  . SER B 1 199 ? 109.227 53.252 -42.685 1.00 32.73  ? 196  SER B CA  1 
ATOM   5694 C C   . SER B 1 199 ? 108.981 53.495 -41.183 1.00 33.36  ? 196  SER B C   1 
ATOM   5695 O O   . SER B 1 199 ? 109.912 53.506 -40.370 1.00 36.87  ? 196  SER B O   1 
ATOM   5696 C CB  . SER B 1 199 ? 110.580 52.616 -42.943 1.00 27.82  ? 196  SER B CB  1 
ATOM   5697 O OG  . SER B 1 199 ? 110.605 51.269 -42.531 1.00 39.78  ? 196  SER B OG  1 
ATOM   5698 N N   . VAL B 1 200 ? 107.712 53.668 -40.813 1.00 33.49  ? 197  VAL B N   1 
ATOM   5699 C CA  . VAL B 1 200 ? 107.301 53.917 -39.429 1.00 31.71  ? 197  VAL B CA  1 
ATOM   5700 C C   . VAL B 1 200 ? 106.473 52.735 -38.923 1.00 30.88  ? 197  VAL B C   1 
ATOM   5701 O O   . VAL B 1 200 ? 105.387 52.453 -39.450 1.00 29.48  ? 197  VAL B O   1 
ATOM   5702 C CB  . VAL B 1 200 ? 106.510 55.228 -39.311 1.00 28.20  ? 197  VAL B CB  1 
ATOM   5703 C CG1 . VAL B 1 200 ? 106.049 55.438 -37.875 1.00 30.05  ? 197  VAL B CG1 1 
ATOM   5704 C CG2 . VAL B 1 200 ? 107.370 56.404 -39.773 1.00 25.68  ? 197  VAL B CG2 1 
ATOM   5705 N N   . THR B 1 201 ? 106.972 52.064 -37.881 1.00 27.47  ? 198  THR B N   1 
ATOM   5706 C CA  . THR B 1 201 ? 106.274 50.962 -37.221 1.00 26.14  ? 198  THR B CA  1 
ATOM   5707 C C   . THR B 1 201 ? 105.762 51.396 -35.839 1.00 27.35  ? 198  THR B C   1 
ATOM   5708 O O   . THR B 1 201 ? 106.556 51.657 -34.930 1.00 24.12  ? 198  THR B O   1 
ATOM   5709 C CB  . THR B 1 201 ? 107.211 49.763 -37.110 1.00 26.47  ? 198  THR B CB  1 
ATOM   5710 O OG1 . THR B 1 201 ? 107.622 49.360 -38.426 1.00 29.09  ? 198  THR B OG1 1 
ATOM   5711 C CG2 . THR B 1 201 ? 106.528 48.588 -36.414 1.00 22.86  ? 198  THR B CG2 1 
ATOM   5712 N N   . LEU B 1 202 ? 104.438 51.472 -35.677 1.00 25.90  ? 199  LEU B N   1 
ATOM   5713 C CA  . LEU B 1 202 ? 103.858 51.674 -34.352 1.00 26.59  ? 199  LEU B CA  1 
ATOM   5714 C C   . LEU B 1 202 ? 103.960 50.405 -33.525 1.00 30.72  ? 199  LEU B C   1 
ATOM   5715 O O   . LEU B 1 202 ? 103.590 49.329 -33.999 1.00 31.80  ? 199  LEU B O   1 
ATOM   5716 C CB  . LEU B 1 202 ? 102.394 52.050 -34.463 1.00 21.68  ? 199  LEU B CB  1 
ATOM   5717 C CG  . LEU B 1 202 ? 102.074 53.172 -35.409 1.00 28.99  ? 199  LEU B CG  1 
ATOM   5718 C CD1 . LEU B 1 202 ? 100.645 53.547 -35.168 1.00 23.67  ? 199  LEU B CD1 1 
ATOM   5719 C CD2 . LEU B 1 202 ? 103.014 54.321 -35.069 1.00 31.33  ? 199  LEU B CD2 1 
ATOM   5720 N N   . PHE B 1 203 ? 104.442 50.515 -32.284 1.00 26.44  ? 200  PHE B N   1 
ATOM   5721 C CA  . PHE B 1 203 ? 104.203 49.456 -31.313 1.00 23.56  ? 200  PHE B CA  1 
ATOM   5722 C C   . PHE B 1 203 ? 103.709 50.040 -29.997 1.00 26.68  ? 200  PHE B C   1 
ATOM   5723 O O   . PHE B 1 203 ? 103.941 51.212 -29.676 1.00 23.67  ? 200  PHE B O   1 
ATOM   5724 C CB  . PHE B 1 203 ? 105.423 48.521 -31.095 1.00 22.20  ? 200  PHE B CB  1 
ATOM   5725 C CG  . PHE B 1 203 ? 106.640 49.152 -30.484 1.00 25.67  ? 200  PHE B CG  1 
ATOM   5726 C CD1 . PHE B 1 203 ? 107.080 50.412 -30.857 1.00 25.82  ? 200  PHE B CD1 1 
ATOM   5727 C CD2 . PHE B 1 203 ? 107.391 48.431 -29.568 1.00 25.29  ? 200  PHE B CD2 1 
ATOM   5728 C CE1 . PHE B 1 203 ? 108.232 50.950 -30.306 1.00 26.15  ? 200  PHE B CE1 1 
ATOM   5729 C CE2 . PHE B 1 203 ? 108.542 48.976 -29.001 1.00 30.48  ? 200  PHE B CE2 1 
ATOM   5730 C CZ  . PHE B 1 203 ? 108.955 50.250 -29.377 1.00 21.22  ? 200  PHE B CZ  1 
ATOM   5731 N N   . GLY B 1 204 ? 102.985 49.204 -29.262 1.00 24.86  ? 201  GLY B N   1 
ATOM   5732 C CA  . GLY B 1 204 ? 102.246 49.626 -28.089 1.00 21.59  ? 201  GLY B CA  1 
ATOM   5733 C C   . GLY B 1 204 ? 101.794 48.412 -27.311 1.00 29.48  ? 201  GLY B C   1 
ATOM   5734 O O   . GLY B 1 204 ? 101.675 47.309 -27.857 1.00 22.83  ? 201  GLY B O   1 
ATOM   5735 N N   . GLU B 1 205 ? 101.564 48.619 -26.013 1.00 23.65  ? 202  GLU B N   1 
ATOM   5736 C CA  . GLU B 1 205 ? 101.167 47.526 -25.133 1.00 19.34  ? 202  GLU B CA  1 
ATOM   5737 C C   . GLU B 1 205 ? 99.898  47.912 -24.383 1.00 23.28  ? 202  GLU B C   1 
ATOM   5738 O O   . GLU B 1 205 ? 99.689  49.087 -24.041 1.00 20.38  ? 202  GLU B O   1 
ATOM   5739 C CB  . GLU B 1 205 ? 102.299 47.144 -24.168 1.00 19.27  ? 202  GLU B CB  1 
ATOM   5740 C CG  . GLU B 1 205 ? 102.091 45.844 -23.397 1.00 18.67  ? 202  GLU B CG  1 
ATOM   5741 C CD  . GLU B 1 205 ? 101.366 46.048 -22.066 1.00 27.20  ? 202  GLU B CD  1 
ATOM   5742 O OE1 . GLU B 1 205 ? 101.162 47.209 -21.656 1.00 25.40  ? 202  GLU B OE1 1 
ATOM   5743 O OE2 . GLU B 1 205 ? 100.993 45.043 -21.420 1.00 30.43  ? 202  GLU B OE2 1 
ATOM   5744 N N   . SER B 1 206 ? 99.026  46.919 -24.202 1.00 19.98  ? 203  SER B N   1 
ATOM   5745 C CA  . SER B 1 206 ? 97.748  47.064 -23.506 1.00 20.57  ? 203  SER B CA  1 
ATOM   5746 C C   . SER B 1 206 ? 96.946  48.200 -24.123 1.00 19.40  ? 203  SER B C   1 
ATOM   5747 O O   . SER B 1 206 ? 96.586  48.107 -25.294 1.00 20.17  ? 203  SER B O   1 
ATOM   5748 C CB  . SER B 1 206 ? 97.975  47.260 -22.005 1.00 24.30  ? 203  SER B CB  1 
ATOM   5749 O OG  . SER B 1 206 ? 96.796  46.979 -21.256 1.00 28.50  ? 203  SER B OG  1 
ATOM   5750 N N   . ALA B 1 207 ? 96.660  49.283 -23.391 1.00 18.52  ? 204  ALA B N   1 
ATOM   5751 C CA  . ALA B 1 207 ? 95.884  50.338 -24.049 1.00 19.13  ? 204  ALA B CA  1 
ATOM   5752 C C   . ALA B 1 207 ? 96.655  50.983 -25.199 1.00 18.49  ? 204  ALA B C   1 
ATOM   5753 O O   . ALA B 1 207 ? 96.039  51.565 -26.102 1.00 18.51  ? 204  ALA B O   1 
ATOM   5754 C CB  . ALA B 1 207 ? 95.439  51.415 -23.055 1.00 17.56  ? 204  ALA B CB  1 
ATOM   5755 N N   . GLY B 1 208 ? 97.984  50.871 -25.197 1.00 18.03  ? 205  GLY B N   1 
ATOM   5756 C CA  . GLY B 1 208 ? 98.745  51.342 -26.337 1.00 21.19  ? 205  GLY B CA  1 
ATOM   5757 C C   . GLY B 1 208 ? 98.568  50.458 -27.552 1.00 23.46  ? 205  GLY B C   1 
ATOM   5758 O O   . GLY B 1 208 ? 98.574  50.954 -28.682 1.00 26.18  ? 205  GLY B O   1 
ATOM   5759 N N   . ALA B 1 209 ? 98.415  49.140 -27.340 1.00 26.23  ? 206  ALA B N   1 
ATOM   5760 C CA  . ALA B 1 209 ? 98.055  48.239 -28.433 1.00 23.00  ? 206  ALA B CA  1 
ATOM   5761 C C   . ALA B 1 209 ? 96.667  48.563 -28.973 1.00 19.24  ? 206  ALA B C   1 
ATOM   5762 O O   . ALA B 1 209 ? 96.470  48.683 -30.185 1.00 22.09  ? 206  ALA B O   1 
ATOM   5763 C CB  . ALA B 1 209 ? 98.142  46.785 -27.962 1.00 21.69  ? 206  ALA B CB  1 
ATOM   5764 N N   . ALA B 1 210 ? 95.687  48.731 -28.087 1.00 24.31  ? 207  ALA B N   1 
ATOM   5765 C CA  . ALA B 1 210 ? 94.376  49.195 -28.530 1.00 21.28  ? 207  ALA B CA  1 
ATOM   5766 C C   . ALA B 1 210 ? 94.484  50.489 -29.340 1.00 28.09  ? 207  ALA B C   1 
ATOM   5767 O O   . ALA B 1 210 ? 93.767  50.670 -30.338 1.00 19.99  ? 207  ALA B O   1 
ATOM   5768 C CB  . ALA B 1 210 ? 93.462  49.385 -27.324 1.00 17.51  ? 207  ALA B CB  1 
ATOM   5769 N N   . SER B 1 211 ? 95.388  51.399 -28.928 1.00 24.16  ? 208  SER B N   1 
ATOM   5770 C CA  . SER B 1 211 ? 95.587  52.654 -29.658 1.00 25.50  ? 208  SER B CA  1 
ATOM   5771 C C   . SER B 1 211 ? 96.158  52.392 -31.049 1.00 17.90  ? 208  SER B C   1 
ATOM   5772 O O   . SER B 1 211 ? 95.660  52.934 -32.042 1.00 19.46  ? 208  SER B O   1 
ATOM   5773 C CB  . SER B 1 211 ? 96.521  53.603 -28.876 1.00 21.56  ? 208  SER B CB  1 
ATOM   5774 O OG  . SER B 1 211 ? 95.908  54.161 -27.702 1.00 16.97  ? 208  SER B OG  1 
ATOM   5775 N N   . VAL B 1 212 ? 97.239  51.608 -31.124 1.00 19.98  ? 209  VAL B N   1 
ATOM   5776 C CA  . VAL B 1 212 ? 97.806  51.213 -32.414 1.00 18.21  ? 209  VAL B CA  1 
ATOM   5777 C C   . VAL B 1 212 ? 96.705  50.679 -33.317 1.00 27.43  ? 209  VAL B C   1 
ATOM   5778 O O   . VAL B 1 212 ? 96.571  51.089 -34.475 1.00 29.86  ? 209  VAL B O   1 
ATOM   5779 C CB  . VAL B 1 212 ? 98.917  50.162 -32.218 1.00 25.51  ? 209  VAL B CB  1 
ATOM   5780 C CG1 . VAL B 1 212 ? 99.398  49.621 -33.565 1.00 26.15  ? 209  VAL B CG1 1 
ATOM   5781 C CG2 . VAL B 1 212 ? 100.078 50.721 -31.439 1.00 18.73  ? 209  VAL B CG2 1 
ATOM   5782 N N   . GLY B 1 213 ? 95.861  49.793 -32.771 1.00 24.93  ? 210  GLY B N   1 
ATOM   5783 C CA  . GLY B 1 213 ? 94.776  49.233 -33.559 1.00 25.34  ? 210  GLY B CA  1 
ATOM   5784 C C   . GLY B 1 213 ? 93.774  50.278 -33.999 1.00 26.33  ? 210  GLY B C   1 
ATOM   5785 O O   . GLY B 1 213 ? 93.311  50.266 -35.142 1.00 26.84  ? 210  GLY B O   1 
ATOM   5786 N N   . MET B 1 214 ? 93.423  51.200 -33.103 1.00 24.91  ? 211  MET B N   1 
ATOM   5787 C CA  . MET B 1 214 ? 92.529  52.278 -33.507 1.00 23.58  ? 211  MET B CA  1 
ATOM   5788 C C   . MET B 1 214 ? 93.129  53.131 -34.619 1.00 30.13  ? 211  MET B C   1 
ATOM   5789 O O   . MET B 1 214 ? 92.389  53.666 -35.449 1.00 28.38  ? 211  MET B O   1 
ATOM   5790 C CB  . MET B 1 214 ? 92.182  53.127 -32.305 1.00 27.51  ? 211  MET B CB  1 
ATOM   5791 C CG  . MET B 1 214 ? 91.549  52.261 -31.243 1.00 35.00  ? 211  MET B CG  1 
ATOM   5792 S SD  . MET B 1 214 ? 90.305  53.054 -30.287 1.00 45.60  ? 211  MET B SD  1 
ATOM   5793 C CE  . MET B 1 214 ? 90.237  51.985 -28.812 1.00 28.25  ? 211  MET B CE  1 
ATOM   5794 N N   . HIS B 1 215 ? 94.457  53.263 -34.665 1.00 25.87  ? 212  HIS B N   1 
ATOM   5795 C CA  . HIS B 1 215 ? 95.049  54.033 -35.756 1.00 30.09  ? 212  HIS B CA  1 
ATOM   5796 C C   . HIS B 1 215 ? 95.002  53.250 -37.069 1.00 28.28  ? 212  HIS B C   1 
ATOM   5797 O O   . HIS B 1 215 ? 94.866  53.852 -38.137 1.00 27.44  ? 212  HIS B O   1 
ATOM   5798 C CB  . HIS B 1 215 ? 96.484  54.444 -35.406 1.00 22.31  ? 212  HIS B CB  1 
ATOM   5799 C CG  . HIS B 1 215 ? 96.569  55.468 -34.312 1.00 29.42  ? 212  HIS B CG  1 
ATOM   5800 N ND1 . HIS B 1 215 ? 95.975  56.712 -34.405 1.00 29.84  ? 212  HIS B ND1 1 
ATOM   5801 C CD2 . HIS B 1 215 ? 97.159  55.423 -33.091 1.00 22.52  ? 212  HIS B CD2 1 
ATOM   5802 C CE1 . HIS B 1 215 ? 96.188  57.384 -33.288 1.00 27.73  ? 212  HIS B CE1 1 
ATOM   5803 N NE2 . HIS B 1 215 ? 96.904  56.624 -32.475 1.00 27.41  ? 212  HIS B NE2 1 
ATOM   5804 N N   . LEU B 1 216 ? 95.112  51.916 -37.006 1.00 28.93  ? 213  LEU B N   1 
ATOM   5805 C CA  . LEU B 1 216 ? 94.849  51.079 -38.177 1.00 29.02  ? 213  LEU B CA  1 
ATOM   5806 C C   . LEU B 1 216 ? 93.477  51.352 -38.763 1.00 27.09  ? 213  LEU B C   1 
ATOM   5807 O O   . LEU B 1 216 ? 93.316  51.394 -39.984 1.00 34.23  ? 213  LEU B O   1 
ATOM   5808 C CB  . LEU B 1 216 ? 94.949  49.605 -37.813 1.00 27.44  ? 213  LEU B CB  1 
ATOM   5809 C CG  . LEU B 1 216 ? 96.375  49.143 -37.663 1.00 29.71  ? 213  LEU B CG  1 
ATOM   5810 C CD1 . LEU B 1 216 ? 96.378  47.750 -37.103 1.00 28.44  ? 213  LEU B CD1 1 
ATOM   5811 C CD2 . LEU B 1 216 ? 97.064  49.216 -39.025 1.00 32.45  ? 213  LEU B CD2 1 
ATOM   5812 N N   . LEU B 1 217 ? 92.479  51.542 -37.911 1.00 27.54  ? 214  LEU B N   1 
ATOM   5813 C CA  . LEU B 1 217 ? 91.095  51.666 -38.343 1.00 31.52  ? 214  LEU B CA  1 
ATOM   5814 C C   . LEU B 1 217 ? 90.656  53.112 -38.561 1.00 33.47  ? 214  LEU B C   1 
ATOM   5815 O O   . LEU B 1 217 ? 89.480  53.349 -38.853 1.00 33.07  ? 214  LEU B O   1 
ATOM   5816 C CB  . LEU B 1 217 ? 90.179  50.981 -37.325 1.00 26.47  ? 214  LEU B CB  1 
ATOM   5817 C CG  . LEU B 1 217 ? 90.584  49.547 -36.953 1.00 33.76  ? 214  LEU B CG  1 
ATOM   5818 C CD1 . LEU B 1 217 ? 89.745  49.021 -35.767 1.00 25.00  ? 214  LEU B CD1 1 
ATOM   5819 C CD2 . LEU B 1 217 ? 90.480  48.605 -38.168 1.00 31.83  ? 214  LEU B CD2 1 
ATOM   5820 N N   . SER B 1 218 ? 91.562  54.086 -38.437 1.00 31.57  ? 215  SER B N   1 
ATOM   5821 C CA  . SER B 1 218 ? 91.196  55.486 -38.673 1.00 32.86  ? 215  SER B CA  1 
ATOM   5822 C C   . SER B 1 218 ? 91.932  56.003 -39.902 1.00 35.47  ? 215  SER B C   1 
ATOM   5823 O O   . SER B 1 218 ? 93.173  56.070 -39.887 1.00 35.10  ? 215  SER B O   1 
ATOM   5824 C CB  . SER B 1 218 ? 91.515  56.357 -37.454 1.00 33.74  ? 215  SER B CB  1 
ATOM   5825 O OG  . SER B 1 218 ? 90.785  57.576 -37.498 1.00 31.53  ? 215  SER B OG  1 
ATOM   5826 N N   . PRO B 1 219 ? 91.229  56.355 -40.979 1.00 35.84  ? 216  PRO B N   1 
ATOM   5827 C CA  . PRO B 1 219 ? 91.907  56.744 -42.232 1.00 37.26  ? 216  PRO B CA  1 
ATOM   5828 C C   . PRO B 1 219 ? 92.885  57.897 -42.045 1.00 29.86  ? 216  PRO B C   1 
ATOM   5829 O O   . PRO B 1 219 ? 94.011  57.813 -42.556 1.00 31.40  ? 216  PRO B O   1 
ATOM   5830 C CB  . PRO B 1 219 ? 90.741  57.123 -43.163 1.00 40.08  ? 216  PRO B CB  1 
ATOM   5831 C CG  . PRO B 1 219 ? 89.592  56.296 -42.657 1.00 40.62  ? 216  PRO B CG  1 
ATOM   5832 C CD  . PRO B 1 219 ? 89.766  56.245 -41.152 1.00 34.78  ? 216  PRO B CD  1 
ATOM   5833 N N   . PRO B 1 220 ? 92.545  58.972 -41.311 1.00 31.90  ? 217  PRO B N   1 
ATOM   5834 C CA  . PRO B 1 220 ? 93.559  60.041 -41.124 1.00 29.96  ? 217  PRO B CA  1 
ATOM   5835 C C   . PRO B 1 220 ? 94.872  59.567 -40.496 1.00 36.01  ? 217  PRO B C   1 
ATOM   5836 O O   . PRO B 1 220 ? 95.926  60.127 -40.813 1.00 33.85  ? 217  PRO B O   1 
ATOM   5837 C CB  . PRO B 1 220 ? 92.845  61.061 -40.231 1.00 26.22  ? 217  PRO B CB  1 
ATOM   5838 C CG  . PRO B 1 220 ? 91.396  60.846 -40.506 1.00 33.33  ? 217  PRO B CG  1 
ATOM   5839 C CD  . PRO B 1 220 ? 91.261  59.352 -40.690 1.00 31.73  ? 217  PRO B CD  1 
ATOM   5840 N N   . SER B 1 221 ? 94.856  58.541 -39.637 1.00 29.80  ? 218  SER B N   1 
ATOM   5841 C CA  . SER B 1 221 ? 96.085  58.065 -39.016 1.00 27.23  ? 218  SER B CA  1 
ATOM   5842 C C   . SER B 1 221 ? 96.792  57.031 -39.863 1.00 33.93  ? 218  SER B C   1 
ATOM   5843 O O   . SER B 1 221 ? 98.027  56.911 -39.791 1.00 29.30  ? 218  SER B O   1 
ATOM   5844 C CB  . SER B 1 221 ? 95.796  57.458 -37.623 1.00 25.26  ? 218  SER B CB  1 
ATOM   5845 O OG  . SER B 1 221 ? 94.913  58.284 -36.854 1.00 29.78  ? 218  SER B OG  1 
ATOM   5846 N N   . ARG B 1 222 ? 96.026  56.273 -40.655 1.00 36.24  ? 219  ARG B N   1 
ATOM   5847 C CA  . ARG B 1 222 ? 96.572  55.098 -41.324 1.00 38.46  ? 219  ARG B CA  1 
ATOM   5848 C C   . ARG B 1 222 ? 97.691  55.473 -42.291 1.00 37.59  ? 219  ARG B C   1 
ATOM   5849 O O   . ARG B 1 222 ? 98.642  54.697 -42.474 1.00 39.28  ? 219  ARG B O   1 
ATOM   5850 C CB  . ARG B 1 222 ? 95.438  54.336 -42.032 1.00 37.41  ? 219  ARG B CB  1 
ATOM   5851 C CG  . ARG B 1 222 ? 95.883  53.115 -42.814 1.00 39.45  ? 219  ARG B CG  1 
ATOM   5852 C CD  . ARG B 1 222 ? 96.608  52.089 -41.960 1.00 31.47  ? 219  ARG B CD  1 
ATOM   5853 N NE  . ARG B 1 222 ? 97.153  50.986 -42.754 1.00 38.55  ? 219  ARG B NE  1 
ATOM   5854 C CZ  . ARG B 1 222 ? 98.402  50.937 -43.220 1.00 45.91  ? 219  ARG B CZ  1 
ATOM   5855 N NH1 . ARG B 1 222 ? 99.257  51.930 -42.968 1.00 30.07  ? 219  ARG B NH1 1 
ATOM   5856 N NH2 . ARG B 1 222 ? 98.808  49.887 -43.931 1.00 44.07  ? 219  ARG B NH2 1 
ATOM   5857 N N   . GLY B 1 223 ? 97.629  56.673 -42.873 1.00 33.86  ? 220  GLY B N   1 
ATOM   5858 C CA  . GLY B 1 223 ? 98.705  57.130 -43.741 1.00 35.27  ? 220  GLY B CA  1 
ATOM   5859 C C   . GLY B 1 223 ? 99.993  57.541 -43.049 1.00 39.07  ? 220  GLY B C   1 
ATOM   5860 O O   . GLY B 1 223 ? 100.992 57.774 -43.736 1.00 37.70  ? 220  GLY B O   1 
ATOM   5861 N N   . LEU B 1 224 ? 100.024 57.602 -41.715 1.00 34.41  ? 221  LEU B N   1 
ATOM   5862 C CA  . LEU B 1 224 ? 101.218 58.075 -41.021 1.00 26.66  ? 221  LEU B CA  1 
ATOM   5863 C C   . LEU B 1 224 ? 102.168 56.958 -40.607 1.00 36.85  ? 221  LEU B C   1 
ATOM   5864 O O   . LEU B 1 224 ? 103.203 57.250 -39.995 1.00 32.93  ? 221  LEU B O   1 
ATOM   5865 C CB  . LEU B 1 224 ? 100.817 58.897 -39.802 1.00 22.64  ? 221  LEU B CB  1 
ATOM   5866 C CG  . LEU B 1 224 ? 99.866  60.039 -40.162 1.00 26.97  ? 221  LEU B CG  1 
ATOM   5867 C CD1 . LEU B 1 224 ? 99.151  60.599 -38.933 1.00 28.74  ? 221  LEU B CD1 1 
ATOM   5868 C CD2 . LEU B 1 224 ? 100.647 61.135 -40.916 1.00 23.62  ? 221  LEU B CD2 1 
ATOM   5869 N N   . PHE B 1 225 ? 101.866 55.698 -40.935 1.00 27.99  ? 222  PHE B N   1 
ATOM   5870 C CA  . PHE B 1 225 ? 102.728 54.586 -40.543 1.00 27.51  ? 222  PHE B CA  1 
ATOM   5871 C C   . PHE B 1 225 ? 102.479 53.418 -41.492 1.00 28.13  ? 222  PHE B C   1 
ATOM   5872 O O   . PHE B 1 225 ? 101.532 53.425 -42.277 1.00 29.09  ? 222  PHE B O   1 
ATOM   5873 C CB  . PHE B 1 225 ? 102.489 54.170 -39.082 1.00 26.12  ? 222  PHE B CB  1 
ATOM   5874 C CG  . PHE B 1 225 ? 101.101 53.654 -38.832 1.00 23.80  ? 222  PHE B CG  1 
ATOM   5875 C CD1 . PHE B 1 225 ? 100.031 54.522 -38.752 1.00 22.31  ? 222  PHE B CD1 1 
ATOM   5876 C CD2 . PHE B 1 225 ? 100.868 52.301 -38.703 1.00 28.43  ? 222  PHE B CD2 1 
ATOM   5877 C CE1 . PHE B 1 225 ? 98.757  54.057 -38.536 1.00 30.58  ? 222  PHE B CE1 1 
ATOM   5878 C CE2 . PHE B 1 225 ? 99.588  51.824 -38.491 1.00 29.01  ? 222  PHE B CE2 1 
ATOM   5879 C CZ  . PHE B 1 225 ? 98.532  52.705 -38.411 1.00 28.29  ? 222  PHE B CZ  1 
ATOM   5880 N N   . HIS B 1 226 ? 103.317 52.383 -41.365 1.00 31.80  ? 223  HIS B N   1 
ATOM   5881 C CA  . HIS B 1 226 ? 103.397 51.327 -42.371 1.00 35.94  ? 223  HIS B CA  1 
ATOM   5882 C C   . HIS B 1 226 ? 103.298 49.918 -41.798 1.00 34.53  ? 223  HIS B C   1 
ATOM   5883 O O   . HIS B 1 226 ? 102.865 48.998 -42.494 1.00 35.45  ? 223  HIS B O   1 
ATOM   5884 C CB  . HIS B 1 226 ? 104.697 51.523 -43.154 1.00 35.40  ? 223  HIS B CB  1 
ATOM   5885 C CG  . HIS B 1 226 ? 104.882 52.946 -43.577 1.00 45.69  ? 223  HIS B CG  1 
ATOM   5886 N ND1 . HIS B 1 226 ? 105.610 53.854 -42.834 1.00 42.33  ? 223  HIS B ND1 1 
ATOM   5887 C CD2 . HIS B 1 226 ? 104.323 53.650 -44.593 1.00 45.61  ? 223  HIS B CD2 1 
ATOM   5888 C CE1 . HIS B 1 226 ? 105.536 55.043 -43.409 1.00 45.86  ? 223  HIS B CE1 1 
ATOM   5889 N NE2 . HIS B 1 226 ? 104.766 54.946 -44.479 1.00 46.26  ? 223  HIS B NE2 1 
ATOM   5890 N N   . ARG B 1 227 ? 103.703 49.725 -40.549 1.00 24.88  ? 224  ARG B N   1 
ATOM   5891 C CA  . ARG B 1 227 ? 103.529 48.457 -39.863 1.00 27.00  ? 224  ARG B CA  1 
ATOM   5892 C C   . ARG B 1 227 ? 102.974 48.715 -38.467 1.00 33.63  ? 224  ARG B C   1 
ATOM   5893 O O   . ARG B 1 227 ? 102.926 49.861 -38.001 1.00 33.65  ? 224  ARG B O   1 
ATOM   5894 C CB  . ARG B 1 227 ? 104.851 47.692 -39.786 1.00 31.27  ? 224  ARG B CB  1 
ATOM   5895 C CG  . ARG B 1 227 ? 105.654 47.765 -41.062 1.00 32.87  ? 224  ARG B CG  1 
ATOM   5896 C CD  . ARG B 1 227 ? 106.744 46.758 -41.038 1.00 27.39  ? 224  ARG B CD  1 
ATOM   5897 N NE  . ARG B 1 227 ? 108.003 47.271 -41.569 1.00 45.65  ? 224  ARG B NE  1 
ATOM   5898 C CZ  . ARG B 1 227 ? 108.223 47.572 -42.850 1.00 48.24  ? 224  ARG B CZ  1 
ATOM   5899 N NH1 . ARG B 1 227 ? 107.257 47.438 -43.753 1.00 43.56  ? 224  ARG B NH1 1 
ATOM   5900 N NH2 . ARG B 1 227 ? 109.414 48.026 -43.230 1.00 43.00  ? 224  ARG B NH2 1 
ATOM   5901 N N   . ALA B 1 228 ? 102.574 47.633 -37.787 1.00 32.97  ? 225  ALA B N   1 
ATOM   5902 C CA  . ALA B 1 228 ? 101.914 47.731 -36.487 1.00 26.79  ? 225  ALA B CA  1 
ATOM   5903 C C   . ALA B 1 228 ? 102.273 46.530 -35.626 1.00 31.70  ? 225  ALA B C   1 
ATOM   5904 O O   . ALA B 1 228 ? 102.353 45.403 -36.121 1.00 27.50  ? 225  ALA B O   1 
ATOM   5905 C CB  . ALA B 1 228 ? 100.394 47.838 -36.638 1.00 19.67  ? 225  ALA B CB  1 
ATOM   5906 N N   . VAL B 1 229 ? 102.522 46.791 -34.340 1.00 30.26  ? 226  VAL B N   1 
ATOM   5907 C CA  . VAL B 1 229 ? 102.755 45.765 -33.330 1.00 22.94  ? 226  VAL B CA  1 
ATOM   5908 C C   . VAL B 1 229 ? 101.779 46.007 -32.191 1.00 30.74  ? 226  VAL B C   1 
ATOM   5909 O O   . VAL B 1 229 ? 101.744 47.109 -31.625 1.00 28.23  ? 226  VAL B O   1 
ATOM   5910 C CB  . VAL B 1 229 ? 104.193 45.773 -32.795 1.00 26.79  ? 226  VAL B CB  1 
ATOM   5911 C CG1 . VAL B 1 229 ? 104.396 44.612 -31.808 1.00 23.47  ? 226  VAL B CG1 1 
ATOM   5912 C CG2 . VAL B 1 229 ? 105.204 45.713 -33.937 1.00 23.42  ? 226  VAL B CG2 1 
ATOM   5913 N N   . LEU B 1 230 ? 100.996 44.983 -31.849 1.00 27.56  ? 227  LEU B N   1 
ATOM   5914 C CA  . LEU B 1 230 ? 99.969  45.074 -30.806 1.00 22.77  ? 227  LEU B CA  1 
ATOM   5915 C C   . LEU B 1 230 ? 100.283 44.045 -29.731 1.00 26.54  ? 227  LEU B C   1 
ATOM   5916 O O   . LEU B 1 230 ? 99.997  42.855 -29.905 1.00 27.95  ? 227  LEU B O   1 
ATOM   5917 C CB  . LEU B 1 230 ? 98.574  44.850 -31.371 1.00 22.12  ? 227  LEU B CB  1 
ATOM   5918 C CG  . LEU B 1 230 ? 98.022  45.883 -32.337 1.00 23.21  ? 227  LEU B CG  1 
ATOM   5919 C CD1 . LEU B 1 230 ? 98.563  45.647 -33.741 1.00 24.87  ? 227  LEU B CD1 1 
ATOM   5920 C CD2 . LEU B 1 230 ? 96.511  45.842 -32.312 1.00 19.64  ? 227  LEU B CD2 1 
ATOM   5921 N N   . GLN B 1 231 ? 100.866 44.501 -28.621 1.00 20.66  ? 228  GLN B N   1 
ATOM   5922 C CA  . GLN B 1 231 ? 101.287 43.629 -27.530 1.00 20.89  ? 228  GLN B CA  1 
ATOM   5923 C C   . GLN B 1 231 ? 100.198 43.643 -26.463 1.00 24.92  ? 228  GLN B C   1 
ATOM   5924 O O   . GLN B 1 231 ? 99.914  44.692 -25.864 1.00 22.26  ? 228  GLN B O   1 
ATOM   5925 C CB  . GLN B 1 231 ? 102.634 44.075 -26.962 1.00 21.94  ? 228  GLN B CB  1 
ATOM   5926 C CG  . GLN B 1 231 ? 103.703 44.339 -28.052 1.00 20.86  ? 228  GLN B CG  1 
ATOM   5927 C CD  . GLN B 1 231 ? 105.004 44.950 -27.494 1.00 26.83  ? 228  GLN B CD  1 
ATOM   5928 O OE1 . GLN B 1 231 ? 105.822 45.451 -28.255 1.00 27.11  ? 228  GLN B OE1 1 
ATOM   5929 N NE2 . GLN B 1 231 ? 105.190 44.910 -26.169 1.00 24.37  ? 228  GLN B NE2 1 
ATOM   5930 N N   . SER B 1 232 ? 99.564  42.484 -26.255 1.00 22.56  ? 229  SER B N   1 
ATOM   5931 C CA  . SER B 1 232 ? 98.586  42.292 -25.182 1.00 18.07  ? 229  SER B CA  1 
ATOM   5932 C C   . SER B 1 232 ? 97.475  43.337 -25.209 1.00 19.01  ? 229  SER B C   1 
ATOM   5933 O O   . SER B 1 232 ? 97.136  43.921 -24.181 1.00 19.51  ? 229  SER B O   1 
ATOM   5934 C CB  . SER B 1 232 ? 99.264  42.299 -23.815 1.00 18.00  ? 229  SER B CB  1 
ATOM   5935 O OG  . SER B 1 232 ? 100.265 41.309 -23.712 1.00 23.53  ? 229  SER B OG  1 
ATOM   5936 N N   . GLY B 1 233 ? 96.896  43.569 -26.381 1.00 18.77  ? 230  GLY B N   1 
ATOM   5937 C CA  . GLY B 1 233 ? 95.748  44.461 -26.441 1.00 18.30  ? 230  GLY B CA  1 
ATOM   5938 C C   . GLY B 1 233 ? 95.260  44.602 -27.862 1.00 16.24  ? 230  GLY B C   1 
ATOM   5939 O O   . GLY B 1 233 ? 95.962  44.274 -28.818 1.00 22.47  ? 230  GLY B O   1 
ATOM   5940 N N   . ALA B 1 234 ? 94.043  45.127 -27.991 1.00 20.77  ? 231  ALA B N   1 
ATOM   5941 C CA  . ALA B 1 234 ? 93.389  45.219 -29.290 1.00 24.23  ? 231  ALA B CA  1 
ATOM   5942 C C   . ALA B 1 234 ? 92.260  46.226 -29.185 1.00 19.66  ? 231  ALA B C   1 
ATOM   5943 O O   . ALA B 1 234 ? 91.680  46.376 -28.104 1.00 20.18  ? 231  ALA B O   1 
ATOM   5944 C CB  . ALA B 1 234 ? 92.847  43.848 -29.728 1.00 25.52  ? 231  ALA B CB  1 
ATOM   5945 N N   . PRO B 1 235 ? 91.912  46.922 -30.279 1.00 20.92  ? 232  PRO B N   1 
ATOM   5946 C CA  . PRO B 1 235 ? 90.841  47.935 -30.185 1.00 21.75  ? 232  PRO B CA  1 
ATOM   5947 C C   . PRO B 1 235 ? 89.470  47.341 -29.986 1.00 24.71  ? 232  PRO B C   1 
ATOM   5948 O O   . PRO B 1 235 ? 88.555  48.071 -29.569 1.00 22.71  ? 232  PRO B O   1 
ATOM   5949 C CB  . PRO B 1 235 ? 90.921  48.679 -31.527 1.00 21.36  ? 232  PRO B CB  1 
ATOM   5950 C CG  . PRO B 1 235 ? 91.528  47.692 -32.468 1.00 21.20  ? 232  PRO B CG  1 
ATOM   5951 C CD  . PRO B 1 235 ? 92.442  46.798 -31.652 1.00 23.28  ? 232  PRO B CD  1 
ATOM   5952 N N   . ASN B 1 236 ? 89.288  46.050 -30.277 1.00 27.67  ? 233  ASN B N   1 
ATOM   5953 C CA  . ASN B 1 236 ? 87.999  45.397 -30.066 1.00 31.70  ? 233  ASN B CA  1 
ATOM   5954 C C   . ASN B 1 236 ? 87.831  44.807 -28.658 1.00 28.86  ? 233  ASN B C   1 
ATOM   5955 O O   . ASN B 1 236 ? 86.779  44.224 -28.373 1.00 29.67  ? 233  ASN B O   1 
ATOM   5956 C CB  . ASN B 1 236 ? 87.769  44.301 -31.131 1.00 26.77  ? 233  ASN B CB  1 
ATOM   5957 C CG  . ASN B 1 236 ? 88.979  43.436 -31.344 1.00 26.34  ? 233  ASN B CG  1 
ATOM   5958 O OD1 . ASN B 1 236 ? 90.076  43.940 -31.565 1.00 34.59  ? 233  ASN B OD1 1 
ATOM   5959 N ND2 . ASN B 1 236 ? 88.799  42.128 -31.263 1.00 35.73  ? 233  ASN B ND2 1 
ATOM   5960 N N   . GLY B 1 237 ? 88.807  44.954 -27.761 1.00 29.84  ? 234  GLY B N   1 
ATOM   5961 C CA  . GLY B 1 237 ? 88.603  44.593 -26.360 1.00 32.09  ? 234  GLY B CA  1 
ATOM   5962 C C   . GLY B 1 237 ? 87.324  45.145 -25.722 1.00 35.34  ? 234  GLY B C   1 
ATOM   5963 O O   . GLY B 1 237 ? 86.913  46.277 -26.002 1.00 36.29  ? 234  GLY B O   1 
ATOM   5964 N N   . PRO B 1 238 ? 86.670  44.360 -24.849 1.00 28.01  ? 235  PRO B N   1 
ATOM   5965 C CA  . PRO B 1 238 ? 85.475  44.869 -24.141 1.00 27.61  ? 235  PRO B CA  1 
ATOM   5966 C C   . PRO B 1 238 ? 85.737  46.102 -23.277 1.00 26.09  ? 235  PRO B C   1 
ATOM   5967 O O   . PRO B 1 238 ? 84.771  46.749 -22.851 1.00 26.94  ? 235  PRO B O   1 
ATOM   5968 C CB  . PRO B 1 238 ? 85.054  43.685 -23.255 1.00 22.19  ? 235  PRO B CB  1 
ATOM   5969 C CG  . PRO B 1 238 ? 86.325  42.988 -22.968 1.00 25.58  ? 235  PRO B CG  1 
ATOM   5970 C CD  . PRO B 1 238 ? 87.135  43.090 -24.264 1.00 24.70  ? 235  PRO B CD  1 
ATOM   5971 N N   . TRP B 1 239 ? 87.000  46.413 -22.979 1.00 21.94  ? 236  TRP B N   1 
ATOM   5972 C CA  . TRP B 1 239 ? 87.386  47.560 -22.168 1.00 26.85  ? 236  TRP B CA  1 
ATOM   5973 C C   . TRP B 1 239 ? 87.876  48.746 -22.994 1.00 24.73  ? 236  TRP B C   1 
ATOM   5974 O O   . TRP B 1 239 ? 88.057  49.831 -22.438 1.00 26.82  ? 236  TRP B O   1 
ATOM   5975 C CB  . TRP B 1 239 ? 88.501  47.151 -21.198 1.00 21.96  ? 236  TRP B CB  1 
ATOM   5976 C CG  . TRP B 1 239 ? 89.633  46.492 -21.951 1.00 26.04  ? 236  TRP B CG  1 
ATOM   5977 C CD1 . TRP B 1 239 ? 89.761  45.158 -22.237 1.00 24.14  ? 236  TRP B CD1 1 
ATOM   5978 C CD2 . TRP B 1 239 ? 90.759  47.143 -22.562 1.00 21.97  ? 236  TRP B CD2 1 
ATOM   5979 N NE1 . TRP B 1 239 ? 90.907  44.937 -22.959 1.00 24.32  ? 236  TRP B NE1 1 
ATOM   5980 C CE2 . TRP B 1 239 ? 91.543  46.137 -23.166 1.00 23.53  ? 236  TRP B CE2 1 
ATOM   5981 C CE3 . TRP B 1 239 ? 91.208  48.478 -22.608 1.00 20.32  ? 236  TRP B CE3 1 
ATOM   5982 C CZ2 . TRP B 1 239 ? 92.741  46.421 -23.838 1.00 24.10  ? 236  TRP B CZ2 1 
ATOM   5983 C CZ3 . TRP B 1 239 ? 92.383  48.761 -23.277 1.00 17.95  ? 236  TRP B CZ3 1 
ATOM   5984 C CH2 . TRP B 1 239 ? 93.142  47.734 -23.888 1.00 25.99  ? 236  TRP B CH2 1 
ATOM   5985 N N   . ALA B 1 240 ? 88.105  48.567 -24.288 1.00 20.98  ? 237  ALA B N   1 
ATOM   5986 C CA  . ALA B 1 240 ? 88.879  49.523 -25.062 1.00 21.86  ? 237  ALA B CA  1 
ATOM   5987 C C   . ALA B 1 240 ? 88.035  50.654 -25.623 1.00 25.43  ? 237  ALA B C   1 
ATOM   5988 O O   . ALA B 1 240 ? 88.576  51.724 -25.931 1.00 23.83  ? 237  ALA B O   1 
ATOM   5989 C CB  . ALA B 1 240 ? 89.605  48.816 -26.207 1.00 18.45  ? 237  ALA B CB  1 
ATOM   5990 N N   . THR B 1 241 ? 86.731  50.462 -25.748 1.00 21.05  ? 238  THR B N   1 
ATOM   5991 C CA  . THR B 1 241 ? 85.868  51.484 -26.302 1.00 22.13  ? 238  THR B CA  1 
ATOM   5992 C C   . THR B 1 241 ? 84.619  51.530 -25.461 1.00 23.01  ? 238  THR B C   1 
ATOM   5993 O O   . THR B 1 241 ? 84.367  50.649 -24.642 1.00 23.89  ? 238  THR B O   1 
ATOM   5994 C CB  . THR B 1 241 ? 85.501  51.230 -27.772 1.00 25.05  ? 238  THR B CB  1 
ATOM   5995 O OG1 . THR B 1 241 ? 84.699  50.046 -27.883 1.00 30.69  ? 238  THR B OG1 1 
ATOM   5996 C CG2 . THR B 1 241 ? 86.740  51.042 -28.598 1.00 25.93  ? 238  THR B CG2 1 
ATOM   5997 N N   . VAL B 1 242 ? 83.830  52.571 -25.678 1.00 26.67  ? 239  VAL B N   1 
ATOM   5998 C CA  . VAL B 1 242 ? 82.628  52.788 -24.897 1.00 27.45  ? 239  VAL B CA  1 
ATOM   5999 C C   . VAL B 1 242 ? 81.640  53.525 -25.787 1.00 31.13  ? 239  VAL B C   1 
ATOM   6000 O O   . VAL B 1 242 ? 82.029  54.205 -26.739 1.00 30.28  ? 239  VAL B O   1 
ATOM   6001 C CB  . VAL B 1 242 ? 82.972  53.546 -23.595 1.00 31.04  ? 239  VAL B CB  1 
ATOM   6002 C CG1 . VAL B 1 242 ? 83.066  55.088 -23.829 1.00 25.51  ? 239  VAL B CG1 1 
ATOM   6003 C CG2 . VAL B 1 242 ? 82.031  53.161 -22.501 1.00 27.18  ? 239  VAL B CG2 1 
ATOM   6004 N N   . GLY B 1 243 ? 80.345  53.351 -25.504 1.00 36.19  ? 240  GLY B N   1 
ATOM   6005 C CA  . GLY B 1 243 ? 79.318  53.918 -26.355 1.00 31.73  ? 240  GLY B CA  1 
ATOM   6006 C C   . GLY B 1 243 ? 78.954  55.351 -25.987 1.00 35.45  ? 240  GLY B C   1 
ATOM   6007 O O   . GLY B 1 243 ? 79.203  55.799 -24.864 1.00 36.48  ? 240  GLY B O   1 
ATOM   6008 N N   . MET B 1 244 ? 78.350  56.053 -26.955 1.00 29.46  ? 241  MET B N   1 
ATOM   6009 C CA  . MET B 1 244 ? 77.998  57.460 -26.764 1.00 36.60  ? 241  MET B CA  1 
ATOM   6010 C C   . MET B 1 244 ? 77.151  57.663 -25.518 1.00 38.91  ? 241  MET B C   1 
ATOM   6011 O O   . MET B 1 244 ? 77.440  58.538 -24.694 1.00 37.84  ? 241  MET B O   1 
ATOM   6012 C CB  . MET B 1 244 ? 77.264  58.002 -27.991 1.00 33.40  ? 241  MET B CB  1 
ATOM   6013 C CG  . MET B 1 244 ? 78.112  57.985 -29.250 1.00 41.02  ? 241  MET B CG  1 
ATOM   6014 S SD  . MET B 1 244 ? 77.493  59.093 -30.538 1.00 53.79  ? 241  MET B SD  1 
ATOM   6015 C CE  . MET B 1 244 ? 75.777  58.571 -30.642 1.00 54.83  ? 241  MET B CE  1 
ATOM   6016 N N   . GLY B 1 245 ? 76.095  56.863 -25.365 1.00 35.73  ? 242  GLY B N   1 
ATOM   6017 C CA  . GLY B 1 245 ? 75.259  56.989 -24.185 1.00 30.68  ? 242  GLY B CA  1 
ATOM   6018 C C   . GLY B 1 245 ? 76.021  56.743 -22.898 1.00 34.46  ? 242  GLY B C   1 
ATOM   6019 O O   . GLY B 1 245 ? 75.833  57.454 -21.905 1.00 29.42  ? 242  GLY B O   1 
ATOM   6020 N N   . GLU B 1 246 ? 76.901  55.739 -22.892 1.00 35.77  ? 243  GLU B N   1 
ATOM   6021 C CA  . GLU B 1 246 ? 77.590  55.438 -21.642 1.00 34.15  ? 243  GLU B CA  1 
ATOM   6022 C C   . GLU B 1 246 ? 78.703  56.451 -21.366 1.00 29.91  ? 243  GLU B C   1 
ATOM   6023 O O   . GLU B 1 246 ? 78.924  56.825 -20.209 1.00 30.04  ? 243  GLU B O   1 
ATOM   6024 C CB  . GLU B 1 246 ? 78.110  53.997 -21.666 1.00 32.79  ? 243  GLU B CB  1 
ATOM   6025 C CG  . GLU B 1 246 ? 78.845  53.533 -20.405 1.00 31.01  ? 243  GLU B CG  1 
ATOM   6026 C CD  . GLU B 1 246 ? 78.019  53.617 -19.125 1.00 35.89  ? 243  GLU B CD  1 
ATOM   6027 O OE1 . GLU B 1 246 ? 76.799  53.894 -19.192 1.00 42.21  ? 243  GLU B OE1 1 
ATOM   6028 O OE2 . GLU B 1 246 ? 78.606  53.421 -18.033 1.00 34.90  ? 243  GLU B OE2 1 
ATOM   6029 N N   . ALA B 1 247 ? 79.371  56.937 -22.417 1.00 30.84  ? 244  ALA B N   1 
ATOM   6030 C CA  . ALA B 1 247 ? 80.351  58.011 -22.255 1.00 31.42  ? 244  ALA B CA  1 
ATOM   6031 C C   . ALA B 1 247 ? 79.707  59.281 -21.707 1.00 30.47  ? 244  ALA B C   1 
ATOM   6032 O O   . ALA B 1 247 ? 80.262  59.932 -20.812 1.00 29.62  ? 244  ALA B O   1 
ATOM   6033 C CB  . ALA B 1 247 ? 81.044  58.305 -23.587 1.00 24.24  ? 244  ALA B CB  1 
ATOM   6034 N N   . ARG B 1 248 ? 78.539  59.657 -22.233 1.00 31.03  ? 245  ARG B N   1 
ATOM   6035 C CA  . ARG B 1 248 ? 77.858  60.841 -21.717 1.00 28.37  ? 245  ARG B CA  1 
ATOM   6036 C C   . ARG B 1 248 ? 77.430  60.651 -20.264 1.00 33.13  ? 245  ARG B C   1 
ATOM   6037 O O   . ARG B 1 248 ? 77.514  61.588 -19.457 1.00 32.25  ? 245  ARG B O   1 
ATOM   6038 C CB  . ARG B 1 248 ? 76.661  61.180 -22.601 1.00 32.54  ? 245  ARG B CB  1 
ATOM   6039 C CG  . ARG B 1 248 ? 75.599  62.035 -21.916 1.00 29.93  ? 245  ARG B CG  1 
ATOM   6040 C CD  . ARG B 1 248 ? 74.574  62.540 -22.942 1.00 35.76  ? 245  ARG B CD  1 
ATOM   6041 N NE  . ARG B 1 248 ? 75.219  63.100 -24.130 1.00 42.82  ? 245  ARG B NE  1 
ATOM   6042 C CZ  . ARG B 1 248 ? 75.448  64.400 -24.311 1.00 46.96  ? 245  ARG B CZ  1 
ATOM   6043 N NH1 . ARG B 1 248 ? 75.073  65.268 -23.376 1.00 42.35  ? 245  ARG B NH1 1 
ATOM   6044 N NH2 . ARG B 1 248 ? 76.041  64.835 -25.425 1.00 39.67  ? 245  ARG B NH2 1 
ATOM   6045 N N   . ARG B 1 249 ? 76.972  59.449 -19.905 1.00 33.60  ? 246  ARG B N   1 
ATOM   6046 C CA  . ARG B 1 249 ? 76.589  59.200 -18.520 1.00 34.09  ? 246  ARG B CA  1 
ATOM   6047 C C   . ARG B 1 249 ? 77.794  59.316 -17.590 1.00 30.50  ? 246  ARG B C   1 
ATOM   6048 O O   . ARG B 1 249 ? 77.686  59.838 -16.477 1.00 32.12  ? 246  ARG B O   1 
ATOM   6049 C CB  . ARG B 1 249 ? 75.948  57.816 -18.387 1.00 33.00  ? 246  ARG B CB  1 
ATOM   6050 C CG  . ARG B 1 249 ? 75.354  57.577 -17.015 1.00 31.39  ? 246  ARG B CG  1 
ATOM   6051 C CD  . ARG B 1 249 ? 75.173  56.097 -16.662 1.00 43.62  ? 246  ARG B CD  1 
ATOM   6052 N NE  . ARG B 1 249 ? 76.437  55.364 -16.512 1.00 45.02  ? 246  ARG B NE  1 
ATOM   6053 C CZ  . ARG B 1 249 ? 77.258  55.462 -15.467 1.00 42.55  ? 246  ARG B CZ  1 
ATOM   6054 N NH1 . ARG B 1 249 ? 76.976  56.279 -14.452 1.00 43.52  ? 246  ARG B NH1 1 
ATOM   6055 N NH2 . ARG B 1 249 ? 78.375  54.746 -15.441 1.00 36.88  ? 246  ARG B NH2 1 
ATOM   6056 N N   . ARG B 1 250 ? 78.952  58.831 -18.029 1.00 32.55  ? 247  ARG B N   1 
ATOM   6057 C CA  . ARG B 1 250 ? 80.134  58.889 -17.182 1.00 30.22  ? 247  ARG B CA  1 
ATOM   6058 C C   . ARG B 1 250 ? 80.602  60.327 -17.007 1.00 28.29  ? 247  ARG B C   1 
ATOM   6059 O O   . ARG B 1 250 ? 80.870  60.766 -15.881 1.00 23.53  ? 247  ARG B O   1 
ATOM   6060 C CB  . ARG B 1 250 ? 81.234  58.001 -17.759 1.00 26.45  ? 247  ARG B CB  1 
ATOM   6061 C CG  . ARG B 1 250 ? 80.862  56.517 -17.740 1.00 22.81  ? 247  ARG B CG  1 
ATOM   6062 C CD  . ARG B 1 250 ? 81.962  55.625 -18.319 1.00 30.35  ? 247  ARG B CD  1 
ATOM   6063 N NE  . ARG B 1 250 ? 81.580  54.213 -18.319 1.00 28.35  ? 247  ARG B NE  1 
ATOM   6064 C CZ  . ARG B 1 250 ? 82.380  53.203 -18.664 1.00 35.91  ? 247  ARG B CZ  1 
ATOM   6065 N NH1 . ARG B 1 250 ? 83.645  53.424 -19.040 1.00 27.10  ? 247  ARG B NH1 1 
ATOM   6066 N NH2 . ARG B 1 250 ? 81.916  51.955 -18.640 1.00 30.63  ? 247  ARG B NH2 1 
ATOM   6067 N N   . ALA B 1 251 ? 80.661  61.087 -18.108 1.00 26.18  ? 248  ALA B N   1 
ATOM   6068 C CA  . ALA B 1 251 ? 81.022  62.500 -18.022 1.00 28.44  ? 248  ALA B CA  1 
ATOM   6069 C C   . ALA B 1 251 ? 80.054  63.262 -17.120 1.00 31.35  ? 248  ALA B C   1 
ATOM   6070 O O   . ALA B 1 251 ? 80.472  64.089 -16.291 1.00 27.08  ? 248  ALA B O   1 
ATOM   6071 C CB  . ALA B 1 251 ? 81.070  63.117 -19.426 1.00 24.15  ? 248  ALA B CB  1 
ATOM   6072 N N   . THR B 1 252 ? 78.760  62.973 -17.237 1.00 29.14  ? 249  THR B N   1 
ATOM   6073 C CA  . THR B 1 252 ? 77.783  63.689 -16.427 1.00 27.69  ? 249  THR B CA  1 
ATOM   6074 C C   . THR B 1 252 ? 77.907  63.320 -14.952 1.00 29.17  ? 249  THR B C   1 
ATOM   6075 O O   . THR B 1 252 ? 77.805  64.189 -14.079 1.00 28.56  ? 249  THR B O   1 
ATOM   6076 C CB  . THR B 1 252 ? 76.383  63.422 -16.968 1.00 33.12  ? 249  THR B CB  1 
ATOM   6077 O OG1 . THR B 1 252 ? 76.330  63.866 -18.328 1.00 34.16  ? 249  THR B OG1 1 
ATOM   6078 C CG2 . THR B 1 252 ? 75.331  64.167 -16.153 1.00 30.67  ? 249  THR B CG2 1 
ATOM   6079 N N   . GLN B 1 253 ? 78.178  62.055 -14.643 1.00 31.11  ? 250  GLN B N   1 
ATOM   6080 C CA  . GLN B 1 253 ? 78.373  61.723 -13.237 1.00 30.19  ? 250  GLN B CA  1 
ATOM   6081 C C   . GLN B 1 253 ? 79.657  62.345 -12.693 1.00 33.45  ? 250  GLN B C   1 
ATOM   6082 O O   . GLN B 1 253 ? 79.686  62.809 -11.546 1.00 29.93  ? 250  GLN B O   1 
ATOM   6083 C CB  . GLN B 1 253 ? 78.365  60.210 -13.025 1.00 28.76  ? 250  GLN B CB  1 
ATOM   6084 C CG  . GLN B 1 253 ? 78.611  59.794 -11.557 1.00 33.13  ? 250  GLN B CG  1 
ATOM   6085 C CD  . GLN B 1 253 ? 77.503  60.250 -10.592 1.00 51.37  ? 250  GLN B CD  1 
ATOM   6086 O OE1 . GLN B 1 253 ? 76.541  60.932 -10.984 1.00 53.00  ? 250  GLN B OE1 1 
ATOM   6087 N NE2 . GLN B 1 253 ? 77.658  59.905 -9.311  1.00 47.16  ? 250  GLN B NE2 1 
ATOM   6088 N N   . LEU B 1 254 ? 80.732  62.372 -13.492 1.00 29.20  ? 251  LEU B N   1 
ATOM   6089 C CA  . LEU B 1 254 ? 81.941  63.045 -13.027 1.00 30.52  ? 251  LEU B CA  1 
ATOM   6090 C C   . LEU B 1 254 ? 81.646  64.502 -12.692 1.00 28.11  ? 251  LEU B C   1 
ATOM   6091 O O   . LEU B 1 254 ? 82.034  65.000 -11.627 1.00 27.52  ? 251  LEU B O   1 
ATOM   6092 C CB  . LEU B 1 254 ? 83.055  62.944 -14.068 1.00 28.13  ? 251  LEU B CB  1 
ATOM   6093 C CG  . LEU B 1 254 ? 84.343  63.629 -13.590 1.00 28.44  ? 251  LEU B CG  1 
ATOM   6094 C CD1 . LEU B 1 254 ? 84.992  62.840 -12.449 1.00 24.65  ? 251  LEU B CD1 1 
ATOM   6095 C CD2 . LEU B 1 254 ? 85.316  63.817 -14.734 1.00 23.20  ? 251  LEU B CD2 1 
ATOM   6096 N N   . ALA B 1 255 ? 80.921  65.189 -13.579 1.00 25.30  ? 252  ALA B N   1 
ATOM   6097 C CA  . ALA B 1 255 ? 80.506  66.557 -13.301 1.00 29.76  ? 252  ALA B CA  1 
ATOM   6098 C C   . ALA B 1 255 ? 79.751  66.646 -11.977 1.00 27.87  ? 252  ALA B C   1 
ATOM   6099 O O   . ALA B 1 255 ? 80.054  67.496 -11.134 1.00 28.97  ? 252  ALA B O   1 
ATOM   6100 C CB  . ALA B 1 255 ? 79.657  67.092 -14.456 1.00 28.78  ? 252  ALA B CB  1 
ATOM   6101 N N   . HIS B 1 256 ? 78.783  65.756 -11.762 1.00 27.68  ? 253  HIS B N   1 
ATOM   6102 C CA  . HIS B 1 256 ? 78.013  65.804 -10.522 1.00 28.33  ? 253  HIS B CA  1 
ATOM   6103 C C   . HIS B 1 256 ? 78.917  65.659 -9.304  1.00 29.58  ? 253  HIS B C   1 
ATOM   6104 O O   . HIS B 1 256 ? 78.769  66.389 -8.317  1.00 30.68  ? 253  HIS B O   1 
ATOM   6105 C CB  . HIS B 1 256 ? 76.936  64.715 -10.522 1.00 30.96  ? 253  HIS B CB  1 
ATOM   6106 C CG  . HIS B 1 256 ? 76.295  64.504 -9.180  1.00 40.98  ? 253  HIS B CG  1 
ATOM   6107 N ND1 . HIS B 1 256 ? 75.342  65.358 -8.661  1.00 36.13  ? 253  HIS B ND1 1 
ATOM   6108 C CD2 . HIS B 1 256 ? 76.489  63.543 -8.241  1.00 36.45  ? 253  HIS B CD2 1 
ATOM   6109 C CE1 . HIS B 1 256 ? 74.970  64.925 -7.468  1.00 39.05  ? 253  HIS B CE1 1 
ATOM   6110 N NE2 . HIS B 1 256 ? 75.653  63.828 -7.189  1.00 37.92  ? 253  HIS B NE2 1 
ATOM   6111 N N   . LEU B 1 257 ? 79.876  64.740 -9.365  1.00 26.50  ? 254  LEU B N   1 
ATOM   6112 C CA  . LEU B 1 257 ? 80.709  64.454 -8.209  1.00 30.19  ? 254  LEU B CA  1 
ATOM   6113 C C   . LEU B 1 257 ? 81.611  65.623 -7.823  1.00 30.43  ? 254  LEU B C   1 
ATOM   6114 O O   . LEU B 1 257 ? 82.046  65.691 -6.665  1.00 28.97  ? 254  LEU B O   1 
ATOM   6115 C CB  . LEU B 1 257 ? 81.552  63.209 -8.482  1.00 26.80  ? 254  LEU B CB  1 
ATOM   6116 C CG  . LEU B 1 257 ? 80.840  61.869 -8.295  1.00 36.39  ? 254  LEU B CG  1 
ATOM   6117 C CD1 . LEU B 1 257 ? 81.712  60.745 -8.811  1.00 26.92  ? 254  LEU B CD1 1 
ATOM   6118 C CD2 . LEU B 1 257 ? 80.499  61.653 -6.817  1.00 26.38  ? 254  LEU B CD2 1 
ATOM   6119 N N   . VAL B 1 258 ? 81.908  66.533 -8.750  1.00 28.82  ? 255  VAL B N   1 
ATOM   6120 C CA  . VAL B 1 258 ? 82.741  67.688 -8.445  1.00 22.48  ? 255  VAL B CA  1 
ATOM   6121 C C   . VAL B 1 258 ? 81.905  68.969 -8.381  1.00 31.59  ? 255  VAL B C   1 
ATOM   6122 O O   . VAL B 1 258 ? 82.445  70.065 -8.464  1.00 31.77  ? 255  VAL B O   1 
ATOM   6123 C CB  . VAL B 1 258 ? 83.918  67.813 -9.431  1.00 30.57  ? 255  VAL B CB  1 
ATOM   6124 C CG1 . VAL B 1 258 ? 84.801  66.584 -9.342  1.00 27.58  ? 255  VAL B CG1 1 
ATOM   6125 C CG2 . VAL B 1 258 ? 83.448  68.022 -10.878 1.00 26.38  ? 255  VAL B CG2 1 
ATOM   6126 N N   . GLY B 1 259 ? 80.591  68.847 -8.198  1.00 29.27  ? 256  GLY B N   1 
ATOM   6127 C CA  . GLY B 1 259 ? 79.758  70.024 -8.018  1.00 33.91  ? 256  GLY B CA  1 
ATOM   6128 C C   . GLY B 1 259 ? 79.305  70.721 -9.283  1.00 39.62  ? 256  GLY B C   1 
ATOM   6129 O O   . GLY B 1 259 ? 78.867  71.873 -9.216  1.00 38.37  ? 256  GLY B O   1 
ATOM   6130 N N   . CYS B 1 260 ? 79.385  70.055 -10.432 1.00 36.31  ? 257  CYS B N   1 
ATOM   6131 C CA  . CYS B 1 260 ? 78.983  70.629 -11.712 1.00 39.96  ? 257  CYS B CA  1 
ATOM   6132 C C   . CYS B 1 260 ? 77.690  69.995 -12.242 1.00 46.05  ? 257  CYS B C   1 
ATOM   6133 O O   . CYS B 1 260 ? 77.581  68.769 -12.298 1.00 42.82  ? 257  CYS B O   1 
ATOM   6134 C CB  . CYS B 1 260 ? 80.108  70.448 -12.738 1.00 35.68  ? 257  CYS B CB  1 
ATOM   6135 S SG  . CYS B 1 260 ? 81.585  71.460 -12.431 1.00 44.67  ? 257  CYS B SG  1 
ATOM   6136 N N   . PRO B 1 261 ? 76.705  70.823 -12.643 1.00 54.67  ? 258  PRO B N   1 
ATOM   6137 C CA  . PRO B 1 261 ? 76.722  72.288 -12.572 1.00 59.53  ? 258  PRO B CA  1 
ATOM   6138 C C   . PRO B 1 261 ? 76.241  72.748 -11.199 1.00 57.45  ? 258  PRO B C   1 
ATOM   6139 O O   . PRO B 1 261 ? 75.550  71.978 -10.523 1.00 55.62  ? 258  PRO B O   1 
ATOM   6140 C CB  . PRO B 1 261 ? 75.743  72.696 -13.677 1.00 53.87  ? 258  PRO B CB  1 
ATOM   6141 C CG  . PRO B 1 261 ? 74.712  71.611 -13.639 1.00 57.52  ? 258  PRO B CG  1 
ATOM   6142 C CD  . PRO B 1 261 ? 75.440  70.332 -13.230 1.00 57.34  ? 258  PRO B CD  1 
ATOM   6143 N N   . PRO B 1 262 ? 76.609  73.960 -10.782 1.00 57.81  ? 259  PRO B N   1 
ATOM   6144 C CA  . PRO B 1 262 ? 76.187  74.434 -9.457  1.00 64.26  ? 259  PRO B CA  1 
ATOM   6145 C C   . PRO B 1 262 ? 74.670  74.411 -9.340  1.00 69.19  ? 259  PRO B C   1 
ATOM   6146 O O   . PRO B 1 262 ? 73.950  74.614 -10.321 1.00 69.65  ? 259  PRO B O   1 
ATOM   6147 C CB  . PRO B 1 262 ? 76.744  75.862 -9.390  1.00 56.58  ? 259  PRO B CB  1 
ATOM   6148 C CG  . PRO B 1 262 ? 77.872  75.876 -10.385 1.00 58.84  ? 259  PRO B CG  1 
ATOM   6149 C CD  . PRO B 1 262 ? 77.441  74.949 -11.490 1.00 58.81  ? 259  PRO B CD  1 
ATOM   6150 N N   . GLY B 1 263 ? 74.188  74.129 -8.128  1.00 68.98  ? 260  GLY B N   1 
ATOM   6151 C CA  . GLY B 1 263 ? 72.769  73.913 -7.892  1.00 71.18  ? 260  GLY B CA  1 
ATOM   6152 C C   . GLY B 1 263 ? 71.851  75.023 -8.370  1.00 74.74  ? 260  GLY B C   1 
ATOM   6153 O O   . GLY B 1 263 ? 71.982  76.175 -7.944  1.00 78.04  ? 260  GLY B O   1 
ATOM   6154 N N   . GLY B 1 264 ? 70.908  74.685 -9.251  1.00 75.80  ? 261  GLY B N   1 
ATOM   6155 C CA  . GLY B 1 264 ? 70.006  75.656 -9.836  1.00 73.96  ? 261  GLY B CA  1 
ATOM   6156 C C   . GLY B 1 264 ? 70.412  76.155 -11.206 1.00 77.77  ? 261  GLY B C   1 
ATOM   6157 O O   . GLY B 1 264 ? 69.705  76.996 -11.775 1.00 82.03  ? 261  GLY B O   1 
ATOM   6158 N N   . THR B 1 265 ? 71.521  75.663 -11.750 1.00 75.95  ? 262  THR B N   1 
ATOM   6159 C CA  . THR B 1 265 ? 72.051  76.075 -13.039 1.00 72.27  ? 262  THR B CA  1 
ATOM   6160 C C   . THR B 1 265 ? 71.745  75.011 -14.091 1.00 74.28  ? 262  THR B C   1 
ATOM   6161 O O   . THR B 1 265 ? 71.655  73.819 -13.783 1.00 76.68  ? 262  THR B O   1 
ATOM   6162 C CB  . THR B 1 265 ? 73.564  76.326 -12.919 1.00 69.74  ? 262  THR B CB  1 
ATOM   6163 O OG1 . THR B 1 265 ? 73.782  77.623 -12.352 1.00 71.16  ? 262  THR B OG1 1 
ATOM   6164 C CG2 . THR B 1 265 ? 74.302  76.221 -14.262 1.00 68.25  ? 262  THR B CG2 1 
ATOM   6165 N N   . GLY B 1 266 ? 71.545  75.457 -15.331 1.00 79.26  ? 263  GLY B N   1 
ATOM   6166 C CA  . GLY B 1 266 ? 71.301  74.521 -16.412 1.00 73.07  ? 263  GLY B CA  1 
ATOM   6167 C C   . GLY B 1 266 ? 72.471  73.577 -16.618 1.00 72.67  ? 263  GLY B C   1 
ATOM   6168 O O   . GLY B 1 266 ? 73.622  73.887 -16.290 1.00 64.51  ? 263  GLY B O   1 
ATOM   6169 N N   . GLY B 1 267 ? 72.164  72.402 -17.169 1.00 73.29  ? 264  GLY B N   1 
ATOM   6170 C CA  . GLY B 1 267 ? 73.177  71.393 -17.409 1.00 59.32  ? 264  GLY B CA  1 
ATOM   6171 C C   . GLY B 1 267 ? 73.329  70.969 -18.858 1.00 59.78  ? 264  GLY B C   1 
ATOM   6172 O O   . GLY B 1 267 ? 73.539  69.780 -19.125 1.00 58.27  ? 264  GLY B O   1 
ATOM   6173 N N   . ASN B 1 268 ? 73.231  71.911 -19.801 1.00 56.44  ? 265  ASN B N   1 
ATOM   6174 C CA  . ASN B 1 268 ? 73.566  71.588 -21.182 1.00 53.90  ? 265  ASN B CA  1 
ATOM   6175 C C   . ASN B 1 268 ? 75.082  71.425 -21.308 1.00 50.77  ? 265  ASN B C   1 
ATOM   6176 O O   . ASN B 1 268 ? 75.841  71.719 -20.380 1.00 51.07  ? 265  ASN B O   1 
ATOM   6177 C CB  . ASN B 1 268 ? 72.995  72.637 -22.155 1.00 53.45  ? 265  ASN B CB  1 
ATOM   6178 C CG  . ASN B 1 268 ? 73.713  73.998 -22.105 1.00 58.23  ? 265  ASN B CG  1 
ATOM   6179 O OD1 . ASN B 1 268 ? 74.941  74.077 -22.057 1.00 51.56  ? 265  ASN B OD1 1 
ATOM   6180 N ND2 . ASN B 1 268 ? 72.928  75.080 -22.157 1.00 54.36  ? 265  ASN B ND2 1 
ATOM   6181 N N   . ASP B 1 269 ? 75.526  70.946 -22.473 1.00 44.79  ? 266  ASP B N   1 
ATOM   6182 C CA  . ASP B 1 269 ? 76.921  70.534 -22.607 1.00 43.30  ? 266  ASP B CA  1 
ATOM   6183 C C   . ASP B 1 269 ? 77.879  71.706 -22.414 1.00 47.40  ? 266  ASP B C   1 
ATOM   6184 O O   . ASP B 1 269 ? 78.950  71.546 -21.809 1.00 43.00  ? 266  ASP B O   1 
ATOM   6185 C CB  . ASP B 1 269 ? 77.152  69.866 -23.966 1.00 45.08  ? 266  ASP B CB  1 
ATOM   6186 C CG  . ASP B 1 269 ? 76.516  68.479 -24.060 1.00 46.83  ? 266  ASP B CG  1 
ATOM   6187 O OD1 . ASP B 1 269 ? 76.034  67.967 -23.018 1.00 48.09  ? 266  ASP B OD1 1 
ATOM   6188 O OD2 . ASP B 1 269 ? 76.501  67.905 -25.175 1.00 45.94  ? 266  ASP B OD2 1 
ATOM   6189 N N   . THR B 1 270 ? 77.514  72.890 -22.918 1.00 46.28  ? 267  THR B N   1 
ATOM   6190 C CA  . THR B 1 270 ? 78.382  74.060 -22.781 1.00 51.02  ? 267  THR B CA  1 
ATOM   6191 C C   . THR B 1 270 ? 78.567  74.440 -21.314 1.00 44.78  ? 267  THR B C   1 
ATOM   6192 O O   . THR B 1 270 ? 79.690  74.692 -20.860 1.00 43.77  ? 267  THR B O   1 
ATOM   6193 C CB  . THR B 1 270 ? 77.812  75.241 -23.579 1.00 54.62  ? 267  THR B CB  1 
ATOM   6194 O OG1 . THR B 1 270 ? 77.892  74.956 -24.981 1.00 46.09  ? 267  THR B OG1 1 
ATOM   6195 C CG2 . THR B 1 270 ? 78.588  76.533 -23.292 1.00 40.16  ? 267  THR B CG2 1 
ATOM   6196 N N   . GLU B 1 271 ? 77.475  74.476 -20.553 1.00 42.89  ? 268  GLU B N   1 
ATOM   6197 C CA  . GLU B 1 271 ? 77.582  74.840 -19.146 1.00 46.44  ? 268  GLU B CA  1 
ATOM   6198 C C   . GLU B 1 271 ? 78.352  73.778 -18.367 1.00 43.88  ? 268  GLU B C   1 
ATOM   6199 O O   . GLU B 1 271 ? 79.153  74.101 -17.480 1.00 45.26  ? 268  GLU B O   1 
ATOM   6200 C CB  . GLU B 1 271 ? 76.183  75.059 -18.563 1.00 51.50  ? 268  GLU B CB  1 
ATOM   6201 C CG  . GLU B 1 271 ? 75.275  75.937 -19.450 1.00 58.84  ? 268  GLU B CG  1 
ATOM   6202 C CD  . GLU B 1 271 ? 73.838  76.073 -18.930 1.00 67.19  ? 268  GLU B CD  1 
ATOM   6203 O OE1 . GLU B 1 271 ? 73.559  77.025 -18.166 1.00 71.28  ? 268  GLU B OE1 1 
ATOM   6204 O OE2 . GLU B 1 271 ? 72.982  75.232 -19.294 1.00 66.47  ? 268  GLU B OE2 1 
ATOM   6205 N N   . LEU B 1 272 ? 78.149  72.507 -18.709 1.00 41.05  ? 269  LEU B N   1 
ATOM   6206 C CA  . LEU B 1 272 ? 78.812  71.426 -17.992 1.00 43.40  ? 269  LEU B CA  1 
ATOM   6207 C C   . LEU B 1 272 ? 80.319  71.468 -18.199 1.00 36.23  ? 269  LEU B C   1 
ATOM   6208 O O   . LEU B 1 272 ? 81.089  71.442 -17.233 1.00 35.43  ? 269  LEU B O   1 
ATOM   6209 C CB  . LEU B 1 272 ? 78.248  70.081 -18.446 1.00 42.19  ? 269  LEU B CB  1 
ATOM   6210 C CG  . LEU B 1 272 ? 78.103  69.035 -17.351 1.00 46.58  ? 269  LEU B CG  1 
ATOM   6211 C CD1 . LEU B 1 272 ? 77.251  69.586 -16.203 1.00 43.55  ? 269  LEU B CD1 1 
ATOM   6212 C CD2 . LEU B 1 272 ? 77.491  67.765 -17.926 1.00 45.72  ? 269  LEU B CD2 1 
ATOM   6213 N N   . VAL B 1 273 ? 80.764  71.522 -19.453 1.00 33.00  ? 270  VAL B N   1 
ATOM   6214 C CA  . VAL B 1 273 ? 82.200  71.552 -19.702 1.00 32.81  ? 270  VAL B CA  1 
ATOM   6215 C C   . VAL B 1 273 ? 82.819  72.818 -19.116 1.00 37.45  ? 270  VAL B C   1 
ATOM   6216 O O   . VAL B 1 273 ? 83.917  72.783 -18.546 1.00 32.14  ? 270  VAL B O   1 
ATOM   6217 C CB  . VAL B 1 273 ? 82.484  71.410 -21.205 1.00 34.84  ? 270  VAL B CB  1 
ATOM   6218 C CG1 . VAL B 1 273 ? 83.966  71.564 -21.484 1.00 33.22  ? 270  VAL B CG1 1 
ATOM   6219 C CG2 . VAL B 1 273 ? 81.996  70.054 -21.691 1.00 30.65  ? 270  VAL B CG2 1 
ATOM   6220 N N   . ALA B 1 274 ? 82.123  73.952 -19.226 1.00 35.70  ? 271  ALA B N   1 
ATOM   6221 C CA  . ALA B 1 274 ? 82.664  75.186 -18.672 1.00 34.81  ? 271  ALA B CA  1 
ATOM   6222 C C   . ALA B 1 274 ? 82.882  75.054 -17.172 1.00 37.32  ? 271  ALA B C   1 
ATOM   6223 O O   . ALA B 1 274 ? 83.921  75.470 -16.650 1.00 33.92  ? 271  ALA B O   1 
ATOM   6224 C CB  . ALA B 1 274 ? 81.741  76.362 -18.976 1.00 36.98  ? 271  ALA B CB  1 
ATOM   6225 N N   . CYS B 1 275 ? 81.923  74.453 -16.467 1.00 36.26  ? 272  CYS B N   1 
ATOM   6226 C CA  . CYS B 1 275 ? 82.116  74.205 -15.045 1.00 36.01  ? 272  CYS B CA  1 
ATOM   6227 C C   . CYS B 1 275 ? 83.262  73.225 -14.815 1.00 33.27  ? 272  CYS B C   1 
ATOM   6228 O O   . CYS B 1 275 ? 84.116  73.454 -13.949 1.00 33.28  ? 272  CYS B O   1 
ATOM   6229 C CB  . CYS B 1 275 ? 80.812  73.695 -14.420 1.00 38.07  ? 272  CYS B CB  1 
ATOM   6230 S SG  . CYS B 1 275 ? 80.898  73.397 -12.632 1.00 57.32  ? 272  CYS B SG  1 
ATOM   6231 N N   . LEU B 1 276 ? 83.312  72.143 -15.600 1.00 30.00  ? 273  LEU B N   1 
ATOM   6232 C CA  . LEU B 1 276 ? 84.429  71.205 -15.508 1.00 28.24  ? 273  LEU B CA  1 
ATOM   6233 C C   . LEU B 1 276 ? 85.767  71.901 -15.735 1.00 32.82  ? 273  LEU B C   1 
ATOM   6234 O O   . LEU B 1 276 ? 86.782  71.534 -15.125 1.00 28.32  ? 273  LEU B O   1 
ATOM   6235 C CB  . LEU B 1 276 ? 84.260  70.074 -16.521 1.00 32.43  ? 273  LEU B CB  1 
ATOM   6236 C CG  . LEU B 1 276 ? 83.358  68.873 -16.220 1.00 34.33  ? 273  LEU B CG  1 
ATOM   6237 C CD1 . LEU B 1 276 ? 83.419  67.875 -17.386 1.00 28.78  ? 273  LEU B CD1 1 
ATOM   6238 C CD2 . LEU B 1 276 ? 83.744  68.191 -14.902 1.00 27.32  ? 273  LEU B CD2 1 
ATOM   6239 N N   . ARG B 1 277 ? 85.801  72.895 -16.620 1.00 29.89  ? 274  ARG B N   1 
ATOM   6240 C CA  . ARG B 1 277 ? 87.081  73.523 -16.923 1.00 32.46  ? 274  ARG B CA  1 
ATOM   6241 C C   . ARG B 1 277 ? 87.591  74.406 -15.787 1.00 31.69  ? 274  ARG B C   1 
ATOM   6242 O O   . ARG B 1 277 ? 88.779  74.749 -15.783 1.00 33.97  ? 274  ARG B O   1 
ATOM   6243 C CB  . ARG B 1 277 ? 86.989  74.314 -18.235 1.00 29.84  ? 274  ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 277 ? 87.144  73.406 -19.456 1.00 31.73  ? 274  ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 277 ? 87.486  74.168 -20.722 1.00 31.72  ? 274  ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 277 ? 86.290  74.455 -21.493 1.00 44.81  ? 274  ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 277 ? 86.020  73.929 -22.687 1.00 48.18  ? 274  ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 277 ? 86.873  73.092 -23.282 1.00 38.08  ? 274  ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 277 ? 84.885  74.251 -23.294 1.00 48.66  ? 274  ARG B NH2 1 
ATOM   6250 N N   . THR B 1 278 ? 86.750  74.745 -14.817 1.00 26.70  ? 275  THR B N   1 
ATOM   6251 C CA  . THR B 1 278 ? 87.184  75.511 -13.656 1.00 30.79  ? 275  THR B CA  1 
ATOM   6252 C C   . THR B 1 278 ? 87.711  74.640 -12.524 1.00 28.83  ? 275  THR B C   1 
ATOM   6253 O O   . THR B 1 278 ? 88.230  75.179 -11.539 1.00 35.13  ? 275  THR B O   1 
ATOM   6254 C CB  . THR B 1 278 ? 86.032  76.365 -13.123 1.00 33.99  ? 275  THR B CB  1 
ATOM   6255 O OG1 . THR B 1 278 ? 85.123  75.541 -12.386 1.00 35.93  ? 275  THR B OG1 1 
ATOM   6256 C CG2 . THR B 1 278 ? 85.284  76.993 -14.277 1.00 33.86  ? 275  THR B CG2 1 
ATOM   6257 N N   . ARG B 1 279 ? 87.608  73.362 -12.633 1.00 29.35  ? 276  ARG B N   1 
ATOM   6258 C CA  . ARG B 1 279 ? 88.050  72.561 -11.494 1.00 28.20  ? 276  ARG B CA  1 
ATOM   6259 C C   . ARG B 1 279 ? 89.548  72.276 -11.573 1.00 27.45  ? 276  ARG B C   1 
ATOM   6260 O O   . ARG B 1 279 ? 90.097  72.094 -12.666 1.00 26.62  ? 276  ARG B O   1 
ATOM   6261 C CB  . ARG B 1 279 ? 87.282  71.248 -11.437 1.00 26.84  ? 276  ARG B CB  1 
ATOM   6262 C CG  . ARG B 1 279 ? 85.796  71.432 -11.257 1.00 32.03  ? 276  ARG B CG  1 
ATOM   6263 C CD  . ARG B 1 279 ? 85.530  72.056 -9.907  1.00 37.52  ? 276  ARG B CD  1 
ATOM   6264 N NE  . ARG B 1 279 ? 84.111  72.096 -9.580  1.00 34.44  ? 276  ARG B NE  1 
ATOM   6265 C CZ  . ARG B 1 279 ? 83.346  73.182 -9.662  1.00 48.32  ? 276  ARG B CZ  1 
ATOM   6266 N NH1 . ARG B 1 279 ? 83.858  74.339 -10.079 1.00 45.75  ? 276  ARG B NH1 1 
ATOM   6267 N NH2 . ARG B 1 279 ? 82.058  73.109 -9.329  1.00 50.91  ? 276  ARG B NH2 1 
ATOM   6268 N N   . PRO B 1 280 ? 90.228  72.256 -10.435 1.00 29.06  ? 277  PRO B N   1 
ATOM   6269 C CA  . PRO B 1 280 ? 91.619  71.778 -10.424 1.00 27.87  ? 277  PRO B CA  1 
ATOM   6270 C C   . PRO B 1 280 ? 91.700  70.362 -10.983 1.00 27.26  ? 277  PRO B C   1 
ATOM   6271 O O   . PRO B 1 280 ? 90.854  69.517 -10.689 1.00 26.29  ? 277  PRO B O   1 
ATOM   6272 C CB  . PRO B 1 280 ? 91.999  71.823 -8.936  1.00 20.68  ? 277  PRO B CB  1 
ATOM   6273 C CG  . PRO B 1 280 ? 91.085  72.876 -8.349  1.00 23.11  ? 277  PRO B CG  1 
ATOM   6274 C CD  . PRO B 1 280 ? 89.775  72.720 -9.114  1.00 25.03  ? 277  PRO B CD  1 
ATOM   6275 N N   . ALA B 1 281 ? 92.740  70.107 -11.782 1.00 24.47  ? 278  ALA B N   1 
ATOM   6276 C CA  . ALA B 1 281 ? 92.909  68.795 -12.414 1.00 28.27  ? 278  ALA B CA  1 
ATOM   6277 C C   . ALA B 1 281 ? 92.849  67.648 -11.403 1.00 27.09  ? 278  ALA B C   1 
ATOM   6278 O O   . ALA B 1 281 ? 92.200  66.621 -11.655 1.00 22.85  ? 278  ALA B O   1 
ATOM   6279 C CB  . ALA B 1 281 ? 94.236  68.748 -13.174 1.00 21.52  ? 278  ALA B CB  1 
ATOM   6280 N N   . GLN B 1 282 ? 93.532  67.799 -10.261 1.00 20.06  ? 279  GLN B N   1 
ATOM   6281 C CA  . GLN B 1 282 ? 93.546  66.737 -9.257  1.00 24.06  ? 279  GLN B CA  1 
ATOM   6282 C C   . GLN B 1 282 ? 92.147  66.416 -8.746  1.00 20.69  ? 279  GLN B C   1 
ATOM   6283 O O   . GLN B 1 282 ? 91.852  65.254 -8.436  1.00 19.98  ? 279  GLN B O   1 
ATOM   6284 C CB  . GLN B 1 282 ? 94.440  67.121 -8.073  1.00 26.02  ? 279  GLN B CB  1 
ATOM   6285 C CG  . GLN B 1 282 ? 94.625  65.981 -7.077  1.00 23.12  ? 279  GLN B CG  1 
ATOM   6286 C CD  . GLN B 1 282 ? 95.427  64.839 -7.680  1.00 27.87  ? 279  GLN B CD  1 
ATOM   6287 O OE1 . GLN B 1 282 ? 96.528  65.050 -8.181  1.00 22.10  ? 279  GLN B OE1 1 
ATOM   6288 N NE2 . GLN B 1 282 ? 94.872  63.628 -7.648  1.00 28.01  ? 279  GLN B NE2 1 
ATOM   6289 N N   . VAL B 1 283 ? 91.281  67.425 -8.640  1.00 19.05  ? 280  VAL B N   1 
ATOM   6290 C CA  . VAL B 1 283 ? 89.900  67.171 -8.232  1.00 22.19  ? 280  VAL B CA  1 
ATOM   6291 C C   . VAL B 1 283 ? 89.218  66.230 -9.216  1.00 26.31  ? 280  VAL B C   1 
ATOM   6292 O O   . VAL B 1 283 ? 88.520  65.290 -8.811  1.00 25.97  ? 280  VAL B O   1 
ATOM   6293 C CB  . VAL B 1 283 ? 89.136  68.498 -8.069  1.00 25.21  ? 280  VAL B CB  1 
ATOM   6294 C CG1 . VAL B 1 283 ? 87.663  68.251 -7.858  1.00 24.68  ? 280  VAL B CG1 1 
ATOM   6295 C CG2 . VAL B 1 283 ? 89.691  69.277 -6.883  1.00 14.06  ? 280  VAL B CG2 1 
ATOM   6296 N N   . LEU B 1 284 ? 89.436  66.432 -10.524 1.00 23.24  ? 281  LEU B N   1 
ATOM   6297 C CA  . LEU B 1 284 ? 88.884  65.488 -11.493 1.00 25.45  ? 281  LEU B CA  1 
ATOM   6298 C C   . LEU B 1 284 ? 89.471  64.096 -11.284 1.00 27.23  ? 281  LEU B C   1 
ATOM   6299 O O   . LEU B 1 284 ? 88.738  63.094 -11.259 1.00 26.05  ? 281  LEU B O   1 
ATOM   6300 C CB  . LEU B 1 284 ? 89.130  65.966 -12.926 1.00 21.54  ? 281  LEU B CB  1 
ATOM   6301 C CG  . LEU B 1 284 ? 88.447  67.267 -13.331 1.00 27.98  ? 281  LEU B CG  1 
ATOM   6302 C CD1 . LEU B 1 284 ? 88.433  67.408 -14.861 1.00 25.81  ? 281  LEU B CD1 1 
ATOM   6303 C CD2 . LEU B 1 284 ? 87.033  67.372 -12.760 1.00 23.26  ? 281  LEU B CD2 1 
ATOM   6304 N N   . VAL B 1 285 ? 90.797  64.015 -11.131 1.00 24.90  ? 282  VAL B N   1 
ATOM   6305 C CA  . VAL B 1 285 ? 91.446  62.723 -10.951 1.00 21.47  ? 282  VAL B CA  1 
ATOM   6306 C C   . VAL B 1 285 ? 90.838  61.978 -9.766  1.00 28.05  ? 282  VAL B C   1 
ATOM   6307 O O   . VAL B 1 285 ? 90.592  60.769 -9.838  1.00 25.42  ? 282  VAL B O   1 
ATOM   6308 C CB  . VAL B 1 285 ? 92.963  62.902 -10.775 1.00 23.26  ? 282  VAL B CB  1 
ATOM   6309 C CG1 . VAL B 1 285 ? 93.577  61.607 -10.248 1.00 21.14  ? 282  VAL B CG1 1 
ATOM   6310 C CG2 . VAL B 1 285 ? 93.640  63.340 -12.100 1.00 21.25  ? 282  VAL B CG2 1 
ATOM   6311 N N   . ASN B 1 286 ? 90.563  62.689 -8.669  1.00 23.53  ? 283  ASN B N   1 
ATOM   6312 C CA  . ASN B 1 286 ? 90.169  62.059 -7.408  1.00 23.00  ? 283  ASN B CA  1 
ATOM   6313 C C   . ASN B 1 286 ? 88.792  61.398 -7.462  1.00 26.66  ? 283  ASN B C   1 
ATOM   6314 O O   . ASN B 1 286 ? 88.435  60.674 -6.531  1.00 24.92  ? 283  ASN B O   1 
ATOM   6315 C CB  . ASN B 1 286 ? 90.167  63.086 -6.272  1.00 21.91  ? 283  ASN B CB  1 
ATOM   6316 C CG  . ASN B 1 286 ? 91.557  63.569 -5.900  1.00 23.33  ? 283  ASN B CG  1 
ATOM   6317 O OD1 . ASN B 1 286 ? 92.582  63.004 -6.320  1.00 24.15  ? 283  ASN B OD1 1 
ATOM   6318 N ND2 . ASN B 1 286 ? 91.600  64.629 -5.102  1.00 24.29  ? 283  ASN B ND2 1 
ATOM   6319 N N   . HIS B 1 287 ? 88.002  61.635 -8.504  1.00 26.02  ? 284  HIS B N   1 
ATOM   6320 C CA  . HIS B 1 287 ? 86.662  61.067 -8.589  1.00 32.08  ? 284  HIS B CA  1 
ATOM   6321 C C   . HIS B 1 287 ? 86.502  60.162 -9.794  1.00 29.64  ? 284  HIS B C   1 
ATOM   6322 O O   . HIS B 1 287 ? 85.381  59.729 -10.093 1.00 32.65  ? 284  HIS B O   1 
ATOM   6323 C CB  . HIS B 1 287 ? 85.613  62.181 -8.614  1.00 23.67  ? 284  HIS B CB  1 
ATOM   6324 C CG  . HIS B 1 287 ? 85.555  62.954 -7.338  1.00 25.13  ? 284  HIS B CG  1 
ATOM   6325 N ND1 . HIS B 1 287 ? 84.898  62.484 -6.225  1.00 25.29  ? 284  HIS B ND1 1 
ATOM   6326 C CD2 . HIS B 1 287 ? 86.096  64.143 -6.982  1.00 25.94  ? 284  HIS B CD2 1 
ATOM   6327 C CE1 . HIS B 1 287 ? 85.034  63.347 -5.235  1.00 28.56  ? 284  HIS B CE1 1 
ATOM   6328 N NE2 . HIS B 1 287 ? 85.755  64.366 -5.668  1.00 23.87  ? 284  HIS B NE2 1 
ATOM   6329 N N   . GLU B 1 288 ? 87.603  59.848 -10.472 1.00 28.66  ? 285  GLU B N   1 
ATOM   6330 C CA  . GLU B 1 288 ? 87.527  59.144 -11.746 1.00 35.47  ? 285  GLU B CA  1 
ATOM   6331 C C   . GLU B 1 288 ? 86.960  57.738 -11.588 1.00 31.41  ? 285  GLU B C   1 
ATOM   6332 O O   . GLU B 1 288 ? 86.100  57.317 -12.369 1.00 25.51  ? 285  GLU B O   1 
ATOM   6333 C CB  . GLU B 1 288 ? 88.910  59.087 -12.371 1.00 28.47  ? 285  GLU B CB  1 
ATOM   6334 C CG  . GLU B 1 288 ? 89.003  58.182 -13.565 1.00 30.76  ? 285  GLU B CG  1 
ATOM   6335 C CD  . GLU B 1 288 ? 90.434  58.110 -14.068 1.00 32.70  ? 285  GLU B CD  1 
ATOM   6336 O OE1 . GLU B 1 288 ? 91.218  57.292 -13.550 1.00 37.92  ? 285  GLU B OE1 1 
ATOM   6337 O OE2 . GLU B 1 288 ? 90.785  58.926 -14.931 1.00 33.52  ? 285  GLU B OE2 1 
ATOM   6338 N N   . TRP B 1 289 ? 87.454  56.978 -10.609 1.00 26.98  ? 286  TRP B N   1 
ATOM   6339 C CA  . TRP B 1 289 ? 87.010  55.593 -10.526 1.00 38.82  ? 286  TRP B CA  1 
ATOM   6340 C C   . TRP B 1 289 ? 85.545  55.490 -10.126 1.00 41.27  ? 286  TRP B C   1 
ATOM   6341 O O   . TRP B 1 289 ? 84.919  54.462 -10.385 1.00 40.28  ? 286  TRP B O   1 
ATOM   6342 C CB  . TRP B 1 289 ? 87.896  54.788 -9.566  1.00 33.79  ? 286  TRP B CB  1 
ATOM   6343 C CG  . TRP B 1 289 ? 89.306  54.584 -10.097 1.00 46.05  ? 286  TRP B CG  1 
ATOM   6344 C CD1 . TRP B 1 289 ? 90.435  55.278 -9.734  1.00 40.50  ? 286  TRP B CD1 1 
ATOM   6345 C CD2 . TRP B 1 289 ? 89.723  53.651 -11.115 1.00 47.19  ? 286  TRP B CD2 1 
ATOM   6346 N NE1 . TRP B 1 289 ? 91.519  54.827 -10.452 1.00 41.39  ? 286  TRP B NE1 1 
ATOM   6347 C CE2 . TRP B 1 289 ? 91.114  53.834 -11.306 1.00 45.56  ? 286  TRP B CE2 1 
ATOM   6348 C CE3 . TRP B 1 289 ? 89.059  52.684 -11.879 1.00 43.12  ? 286  TRP B CE3 1 
ATOM   6349 C CZ2 . TRP B 1 289 ? 91.852  53.074 -12.220 1.00 38.83  ? 286  TRP B CZ2 1 
ATOM   6350 C CZ3 . TRP B 1 289 ? 89.797  51.934 -12.796 1.00 32.95  ? 286  TRP B CZ3 1 
ATOM   6351 C CH2 . TRP B 1 289 ? 91.177  52.133 -12.952 1.00 41.05  ? 286  TRP B CH2 1 
ATOM   6352 N N   . HIS B 1 290 ? 84.973  56.549 -9.567  1.00 35.36  ? 287  HIS B N   1 
ATOM   6353 C CA  . HIS B 1 290 ? 83.617  56.510 -9.039  1.00 37.24  ? 287  HIS B CA  1 
ATOM   6354 C C   . HIS B 1 290 ? 82.544  56.602 -10.111 1.00 37.50  ? 287  HIS B C   1 
ATOM   6355 O O   . HIS B 1 290 ? 81.364  56.718 -9.758  1.00 46.40  ? 287  HIS B O   1 
ATOM   6356 C CB  . HIS B 1 290 ? 83.405  57.624 -8.020  1.00 36.74  ? 287  HIS B CB  1 
ATOM   6357 C CG  . HIS B 1 290 ? 84.305  57.518 -6.818  1.00 47.69  ? 287  HIS B CG  1 
ATOM   6358 N ND1 . HIS B 1 290 ? 84.948  58.625 -6.275  1.00 48.36  ? 287  HIS B ND1 1 
ATOM   6359 C CD2 . HIS B 1 290 ? 84.681  56.440 -6.077  1.00 55.17  ? 287  HIS B CD2 1 
ATOM   6360 C CE1 . HIS B 1 290 ? 85.672  58.226 -5.244  1.00 56.50  ? 287  HIS B CE1 1 
ATOM   6361 N NE2 . HIS B 1 290 ? 85.530  56.910 -5.109  1.00 60.37  ? 287  HIS B NE2 1 
ATOM   6362 N N   . VAL B 1 291 ? 82.873  56.543 -11.400 1.00 32.26  ? 288  VAL B N   1 
ATOM   6363 C CA  . VAL B 1 291 ? 81.828  56.599 -12.414 1.00 33.81  ? 288  VAL B CA  1 
ATOM   6364 C C   . VAL B 1 291 ? 81.634  55.278 -13.133 1.00 34.66  ? 288  VAL B C   1 
ATOM   6365 O O   . VAL B 1 291 ? 80.758  55.187 -14.007 1.00 31.81  ? 288  VAL B O   1 
ATOM   6366 C CB  . VAL B 1 291 ? 82.095  57.735 -13.413 1.00 32.88  ? 288  VAL B CB  1 
ATOM   6367 C CG1 . VAL B 1 291 ? 82.123  59.070 -12.678 1.00 32.27  ? 288  VAL B CG1 1 
ATOM   6368 C CG2 . VAL B 1 291 ? 83.383  57.499 -14.133 1.00 27.86  ? 288  VAL B CG2 1 
ATOM   6369 N N   . LEU B 1 292 ? 82.412  54.251 -12.798 1.00 33.56  ? 289  LEU B N   1 
ATOM   6370 C CA  . LEU B 1 292 ? 82.211  52.961 -13.429 1.00 34.67  ? 289  LEU B CA  1 
ATOM   6371 C C   . LEU B 1 292 ? 80.859  52.387 -13.001 1.00 38.89  ? 289  LEU B C   1 
ATOM   6372 O O   . LEU B 1 292 ? 80.494  52.466 -11.820 1.00 35.76  ? 289  LEU B O   1 
ATOM   6373 C CB  . LEU B 1 292 ? 83.342  52.003 -13.063 1.00 36.74  ? 289  LEU B CB  1 
ATOM   6374 C CG  . LEU B 1 292 ? 84.678  52.143 -13.802 1.00 31.01  ? 289  LEU B CG  1 
ATOM   6375 C CD1 . LEU B 1 292 ? 85.724  51.276 -13.117 1.00 28.56  ? 289  LEU B CD1 1 
ATOM   6376 C CD2 . LEU B 1 292 ? 84.559  51.773 -15.280 1.00 27.29  ? 289  LEU B CD2 1 
ATOM   6377 N N   . PRO B 1 293 ? 80.084  51.830 -13.941 1.00 39.24  ? 290  PRO B N   1 
ATOM   6378 C CA  . PRO B 1 293 ? 78.708  51.402 -13.608 1.00 45.08  ? 290  PRO B CA  1 
ATOM   6379 C C   . PRO B 1 293 ? 78.618  50.253 -12.608 1.00 46.59  ? 290  PRO B C   1 
ATOM   6380 O O   . PRO B 1 293 ? 77.574  50.121 -11.956 1.00 52.17  ? 290  PRO B O   1 
ATOM   6381 C CB  . PRO B 1 293 ? 78.117  50.999 -14.970 1.00 40.39  ? 290  PRO B CB  1 
ATOM   6382 C CG  . PRO B 1 293 ? 79.317  50.690 -15.842 1.00 43.19  ? 290  PRO B CG  1 
ATOM   6383 C CD  . PRO B 1 293 ? 80.406  51.634 -15.366 1.00 35.85  ? 290  PRO B CD  1 
ATOM   6384 N N   . GLN B 1 294 ? 79.664  49.444 -12.473 1.00 43.02  ? 291  GLN B N   1 
ATOM   6385 C CA  . GLN B 1 294 ? 79.607  48.318 -11.544 1.00 49.73  ? 291  GLN B CA  1 
ATOM   6386 C C   . GLN B 1 294 ? 80.977  47.784 -11.137 1.00 42.59  ? 291  GLN B C   1 
ATOM   6387 O O   . GLN B 1 294 ? 81.950  47.895 -11.883 1.00 45.56  ? 291  GLN B O   1 
ATOM   6388 C CB  . GLN B 1 294 ? 78.762  47.186 -12.134 1.00 50.84  ? 291  GLN B CB  1 
ATOM   6389 C CG  . GLN B 1 294 ? 79.427  46.450 -13.286 1.00 48.07  ? 291  GLN B CG  1 
ATOM   6390 C CD  . GLN B 1 294 ? 79.126  47.082 -14.631 1.00 56.58  ? 291  GLN B CD  1 
ATOM   6391 O OE1 . GLN B 1 294 ? 78.050  47.643 -14.840 1.00 57.21  ? 291  GLN B OE1 1 
ATOM   6392 N NE2 . GLN B 1 294 ? 80.078  46.993 -15.553 1.00 55.39  ? 291  GLN B NE2 1 
ATOM   6393 N N   . GLU B 1 295 ? 81.036  47.197 -9.945  1.00 39.36  ? 292  GLU B N   1 
ATOM   6394 C CA  . GLU B 1 295 ? 82.253  46.568 -9.446  1.00 39.26  ? 292  GLU B CA  1 
ATOM   6395 C C   . GLU B 1 295 ? 82.849  45.661 -10.520 1.00 42.18  ? 292  GLU B C   1 
ATOM   6396 O O   . GLU B 1 295 ? 82.146  44.837 -11.116 1.00 38.25  ? 292  GLU B O   1 
ATOM   6397 C CB  . GLU B 1 295 ? 81.901  45.787 -8.179  1.00 42.26  ? 292  GLU B CB  1 
ATOM   6398 C CG  . GLU B 1 295 ? 82.980  44.917 -7.565  1.00 51.54  ? 292  GLU B CG  1 
ATOM   6399 C CD  . GLU B 1 295 ? 82.400  44.056 -6.426  1.00 60.01  ? 292  GLU B CD  1 
ATOM   6400 O OE1 . GLU B 1 295 ? 83.161  43.419 -5.673  1.00 56.66  ? 292  GLU B OE1 1 
ATOM   6401 O OE2 . GLU B 1 295 ? 81.163  44.014 -6.286  1.00 60.20  ? 292  GLU B OE2 1 
ATOM   6402 N N   . SER B 1 296 ? 84.143  45.833 -10.792 1.00 38.43  ? 293  SER B N   1 
ATOM   6403 C CA  . SER B 1 296 ? 84.747  45.224 -11.968 1.00 35.87  ? 293  SER B CA  1 
ATOM   6404 C C   . SER B 1 296 ? 86.257  45.166 -11.797 1.00 32.71  ? 293  SER B C   1 
ATOM   6405 O O   . SER B 1 296 ? 86.836  45.823 -10.929 1.00 27.21  ? 293  SER B O   1 
ATOM   6406 C CB  . SER B 1 296 ? 84.399  46.010 -13.232 1.00 33.50  ? 293  SER B CB  1 
ATOM   6407 O OG  . SER B 1 296 ? 85.004  47.293 -13.166 1.00 37.65  ? 293  SER B OG  1 
ATOM   6408 N N   . VAL B 1 297 ? 86.886  44.350 -12.639 1.00 26.93  ? 294  VAL B N   1 
ATOM   6409 C CA  . VAL B 1 297 ? 88.302  44.488 -12.930 1.00 22.96  ? 294  VAL B CA  1 
ATOM   6410 C C   . VAL B 1 297 ? 88.427  44.675 -14.434 1.00 24.61  ? 294  VAL B C   1 
ATOM   6411 O O   . VAL B 1 297 ? 87.514  44.350 -15.201 1.00 23.35  ? 294  VAL B O   1 
ATOM   6412 C CB  . VAL B 1 297 ? 89.144  43.295 -12.441 1.00 23.57  ? 294  VAL B CB  1 
ATOM   6413 C CG1 . VAL B 1 297 ? 89.043  43.145 -10.927 1.00 25.32  ? 294  VAL B CG1 1 
ATOM   6414 C CG2 . VAL B 1 297 ? 88.740  42.009 -13.160 1.00 22.33  ? 294  VAL B CG2 1 
ATOM   6415 N N   . PHE B 1 298 ? 89.552  45.253 -14.851 1.00 25.07  ? 295  PHE B N   1 
ATOM   6416 C CA  . PHE B 1 298 ? 89.838  45.465 -16.273 1.00 22.93  ? 295  PHE B CA  1 
ATOM   6417 C C   . PHE B 1 298 ? 88.766  46.333 -16.936 1.00 23.73  ? 295  PHE B C   1 
ATOM   6418 O O   . PHE B 1 298 ? 88.390  46.109 -18.085 1.00 26.25  ? 295  PHE B O   1 
ATOM   6419 C CB  . PHE B 1 298 ? 89.990  44.123 -17.005 1.00 21.45  ? 295  PHE B CB  1 
ATOM   6420 C CG  . PHE B 1 298 ? 91.106  44.100 -18.027 1.00 24.28  ? 295  PHE B CG  1 
ATOM   6421 C CD1 . PHE B 1 298 ? 91.290  45.161 -18.916 1.00 23.13  ? 295  PHE B CD1 1 
ATOM   6422 C CD2 . PHE B 1 298 ? 91.984  43.022 -18.086 1.00 19.02  ? 295  PHE B CD2 1 
ATOM   6423 C CE1 . PHE B 1 298 ? 92.330  45.141 -19.847 1.00 20.43  ? 295  PHE B CE1 1 
ATOM   6424 C CE2 . PHE B 1 298 ? 93.004  42.984 -19.019 1.00 19.37  ? 295  PHE B CE2 1 
ATOM   6425 C CZ  . PHE B 1 298 ? 93.186  44.045 -19.897 1.00 18.09  ? 295  PHE B CZ  1 
ATOM   6426 N N   . ARG B 1 299 ? 88.251  47.331 -16.207 1.00 19.65  ? 296  ARG B N   1 
ATOM   6427 C CA  . ARG B 1 299 ? 87.342  48.320 -16.776 1.00 23.57  ? 296  ARG B CA  1 
ATOM   6428 C C   . ARG B 1 299 ? 87.794  49.712 -16.359 1.00 23.93  ? 296  ARG B C   1 
ATOM   6429 O O   . ARG B 1 299 ? 88.165  49.934 -15.203 1.00 20.35  ? 296  ARG B O   1 
ATOM   6430 C CB  . ARG B 1 299 ? 85.869  48.100 -16.328 1.00 20.84  ? 296  ARG B CB  1 
ATOM   6431 C CG  . ARG B 1 299 ? 85.226  46.815 -16.876 1.00 23.64  ? 296  ARG B CG  1 
ATOM   6432 C CD  . ARG B 1 299 ? 85.141  46.834 -18.404 1.00 25.65  ? 296  ARG B CD  1 
ATOM   6433 N NE  . ARG B 1 299 ? 84.420  45.672 -18.913 1.00 29.67  ? 296  ARG B NE  1 
ATOM   6434 C CZ  . ARG B 1 299 ? 84.992  44.526 -19.278 1.00 28.77  ? 296  ARG B CZ  1 
ATOM   6435 N NH1 . ARG B 1 299 ? 86.313  44.371 -19.209 1.00 19.04  ? 296  ARG B NH1 1 
ATOM   6436 N NH2 . ARG B 1 299 ? 84.238  43.532 -19.726 1.00 29.55  ? 296  ARG B NH2 1 
ATOM   6437 N N   . PHE B 1 300 ? 87.715  50.660 -17.284 1.00 22.48  ? 297  PHE B N   1 
ATOM   6438 C CA  . PHE B 1 300 ? 88.294  51.980 -17.076 1.00 23.55  ? 297  PHE B CA  1 
ATOM   6439 C C   . PHE B 1 300 ? 87.275  53.039 -17.479 1.00 23.32  ? 297  PHE B C   1 
ATOM   6440 O O   . PHE B 1 300 ? 86.540  52.856 -18.454 1.00 26.08  ? 297  PHE B O   1 
ATOM   6441 C CB  . PHE B 1 300 ? 89.604  52.112 -17.871 1.00 17.19  ? 297  PHE B CB  1 
ATOM   6442 C CG  . PHE B 1 300 ? 90.490  50.888 -17.790 1.00 17.06  ? 297  PHE B CG  1 
ATOM   6443 C CD1 . PHE B 1 300 ? 91.168  50.574 -16.629 1.00 21.91  ? 297  PHE B CD1 1 
ATOM   6444 C CD2 . PHE B 1 300 ? 90.642  50.050 -18.882 1.00 21.75  ? 297  PHE B CD2 1 
ATOM   6445 C CE1 . PHE B 1 300 ? 91.992  49.456 -16.555 1.00 21.34  ? 297  PHE B CE1 1 
ATOM   6446 C CE2 . PHE B 1 300 ? 91.459  48.916 -18.812 1.00 17.45  ? 297  PHE B CE2 1 
ATOM   6447 C CZ  . PHE B 1 300 ? 92.130  48.624 -17.652 1.00 21.84  ? 297  PHE B CZ  1 
ATOM   6448 N N   . SER B 1 301 ? 87.235  54.144 -16.722 1.00 17.96  ? 298  SER B N   1 
ATOM   6449 C CA  . SER B 1 301 ? 86.129  55.102 -16.817 1.00 20.35  ? 298  SER B CA  1 
ATOM   6450 C C   . SER B 1 301 ? 86.125  55.866 -18.138 1.00 23.79  ? 298  SER B C   1 
ATOM   6451 O O   . SER B 1 301 ? 85.065  56.057 -18.751 1.00 25.38  ? 298  SER B O   1 
ATOM   6452 C CB  . SER B 1 301 ? 86.195  56.103 -15.658 1.00 25.65  ? 298  SER B CB  1 
ATOM   6453 O OG  . SER B 1 301 ? 86.176  55.462 -14.404 1.00 27.49  ? 298  SER B OG  1 
ATOM   6454 N N   . PHE B 1 302 ? 87.280  56.376 -18.565 1.00 21.10  ? 299  PHE B N   1 
ATOM   6455 C CA  . PHE B 1 302 ? 87.320  57.262 -19.728 1.00 23.31  ? 299  PHE B CA  1 
ATOM   6456 C C   . PHE B 1 302 ? 88.208  56.638 -20.795 1.00 23.00  ? 299  PHE B C   1 
ATOM   6457 O O   . PHE B 1 302 ? 89.441  56.613 -20.661 1.00 19.83  ? 299  PHE B O   1 
ATOM   6458 C CB  . PHE B 1 302 ? 87.766  58.668 -19.320 1.00 20.45  ? 299  PHE B CB  1 
ATOM   6459 C CG  . PHE B 1 302 ? 86.769  59.348 -18.407 1.00 21.75  ? 299  PHE B CG  1 
ATOM   6460 C CD1 . PHE B 1 302 ? 85.555  59.786 -18.907 1.00 18.92  ? 299  PHE B CD1 1 
ATOM   6461 C CD2 . PHE B 1 302 ? 87.023  59.493 -17.037 1.00 23.31  ? 299  PHE B CD2 1 
ATOM   6462 C CE1 . PHE B 1 302 ? 84.619  60.366 -18.082 1.00 19.99  ? 299  PHE B CE1 1 
ATOM   6463 C CE2 . PHE B 1 302 ? 86.083  60.094 -16.196 1.00 23.42  ? 299  PHE B CE2 1 
ATOM   6464 C CZ  . PHE B 1 302 ? 84.885  60.528 -16.721 1.00 18.62  ? 299  PHE B CZ  1 
ATOM   6465 N N   . VAL B 1 303 ? 87.571  56.118 -21.842 1.00 19.75  ? 300  VAL B N   1 
ATOM   6466 C CA  . VAL B 1 303 ? 88.263  55.370 -22.888 1.00 20.02  ? 300  VAL B CA  1 
ATOM   6467 C C   . VAL B 1 303 ? 87.768  55.907 -24.226 1.00 19.38  ? 300  VAL B C   1 
ATOM   6468 O O   . VAL B 1 303 ? 86.830  56.724 -24.254 1.00 20.46  ? 300  VAL B O   1 
ATOM   6469 C CB  . VAL B 1 303 ? 88.030  53.850 -22.744 1.00 21.57  ? 300  VAL B CB  1 
ATOM   6470 C CG1 . VAL B 1 303 ? 88.464  53.339 -21.348 1.00 19.72  ? 300  VAL B CG1 1 
ATOM   6471 C CG2 . VAL B 1 303 ? 86.554  53.478 -23.059 1.00 21.72  ? 300  VAL B CG2 1 
ATOM   6472 N N   . PRO B 1 304 ? 88.352  55.496 -25.350 1.00 22.56  ? 301  PRO B N   1 
ATOM   6473 C CA  . PRO B 1 304 ? 87.822  55.922 -26.657 1.00 24.27  ? 301  PRO B CA  1 
ATOM   6474 C C   . PRO B 1 304 ? 86.320  55.666 -26.816 1.00 25.77  ? 301  PRO B C   1 
ATOM   6475 O O   . PRO B 1 304 ? 85.778  54.655 -26.362 1.00 24.22  ? 301  PRO B O   1 
ATOM   6476 C CB  . PRO B 1 304 ? 88.638  55.097 -27.643 1.00 22.40  ? 301  PRO B CB  1 
ATOM   6477 C CG  . PRO B 1 304 ? 89.952  54.906 -26.941 1.00 24.31  ? 301  PRO B CG  1 
ATOM   6478 C CD  . PRO B 1 304 ? 89.625  54.765 -25.477 1.00 20.84  ? 301  PRO B CD  1 
ATOM   6479 N N   . VAL B 1 305 ? 85.636  56.617 -27.435 1.00 21.73  ? 302  VAL B N   1 
ATOM   6480 C CA  . VAL B 1 305 ? 84.190  56.575 -27.604 1.00 27.95  ? 302  VAL B CA  1 
ATOM   6481 C C   . VAL B 1 305 ? 83.904  56.349 -29.082 1.00 36.53  ? 302  VAL B C   1 
ATOM   6482 O O   . VAL B 1 305 ? 84.591  56.906 -29.950 1.00 31.09  ? 302  VAL B O   1 
ATOM   6483 C CB  . VAL B 1 305 ? 83.520  57.868 -27.097 1.00 26.88  ? 302  VAL B CB  1 
ATOM   6484 C CG1 . VAL B 1 305 ? 83.973  59.075 -27.922 1.00 29.00  ? 302  VAL B CG1 1 
ATOM   6485 C CG2 . VAL B 1 305 ? 81.997  57.749 -27.119 1.00 32.52  ? 302  VAL B CG2 1 
ATOM   6486 N N   . VAL B 1 306 ? 82.916  55.501 -29.369 1.00 36.78  ? 303  VAL B N   1 
ATOM   6487 C CA  . VAL B 1 306 ? 82.540  55.178 -30.747 1.00 38.71  ? 303  VAL B CA  1 
ATOM   6488 C C   . VAL B 1 306 ? 81.454  56.171 -31.144 1.00 38.10  ? 303  VAL B C   1 
ATOM   6489 O O   . VAL B 1 306 ? 80.286  56.016 -30.781 1.00 43.38  ? 303  VAL B O   1 
ATOM   6490 C CB  . VAL B 1 306 ? 82.064  53.731 -30.892 1.00 39.55  ? 303  VAL B CB  1 
ATOM   6491 C CG1 . VAL B 1 306 ? 81.816  53.402 -32.358 1.00 34.53  ? 303  VAL B CG1 1 
ATOM   6492 C CG2 . VAL B 1 306 ? 83.085  52.765 -30.296 1.00 36.16  ? 303  VAL B CG2 1 
ATOM   6493 N N   . ASP B 1 307 ? 81.835  57.214 -31.871 1.00 37.02  ? 304  ASP B N   1 
ATOM   6494 C CA  . ASP B 1 307 ? 80.915  58.324 -32.074 1.00 44.63  ? 304  ASP B CA  1 
ATOM   6495 C C   . ASP B 1 307 ? 80.765  58.735 -33.526 1.00 43.54  ? 304  ASP B C   1 
ATOM   6496 O O   . ASP B 1 307 ? 80.075  59.725 -33.797 1.00 43.91  ? 304  ASP B O   1 
ATOM   6497 C CB  . ASP B 1 307 ? 81.354  59.543 -31.254 1.00 37.55  ? 304  ASP B CB  1 
ATOM   6498 C CG  . ASP B 1 307 ? 82.682  60.128 -31.733 1.00 44.94  ? 304  ASP B CG  1 
ATOM   6499 O OD1 . ASP B 1 307 ? 83.499  59.396 -32.350 1.00 42.05  ? 304  ASP B OD1 1 
ATOM   6500 O OD2 . ASP B 1 307 ? 82.908  61.335 -31.485 1.00 55.31  ? 304  ASP B OD2 1 
ATOM   6501 N N   . GLY B 1 308 ? 81.387  58.011 -34.462 1.00 40.39  ? 305  GLY B N   1 
ATOM   6502 C CA  . GLY B 1 308 ? 81.292  58.325 -35.868 1.00 46.61  ? 305  GLY B CA  1 
ATOM   6503 C C   . GLY B 1 308 ? 82.379  59.238 -36.390 1.00 52.09  ? 305  GLY B C   1 
ATOM   6504 O O   . GLY B 1 308 ? 82.480  59.416 -37.613 1.00 52.23  ? 305  GLY B O   1 
ATOM   6505 N N   . ASP B 1 309 ? 83.199  59.818 -35.510 1.00 46.08  ? 306  ASP B N   1 
ATOM   6506 C CA  . ASP B 1 309 ? 84.251  60.734 -35.933 1.00 42.01  ? 306  ASP B CA  1 
ATOM   6507 C C   . ASP B 1 309 ? 85.585  60.002 -36.055 1.00 45.35  ? 306  ASP B C   1 
ATOM   6508 O O   . ASP B 1 309 ? 85.921  59.517 -37.140 1.00 44.77  ? 306  ASP B O   1 
ATOM   6509 C CB  . ASP B 1 309 ? 84.348  61.904 -34.956 1.00 49.68  ? 306  ASP B CB  1 
ATOM   6510 C CG  . ASP B 1 309 ? 85.199  63.031 -35.483 1.00 52.13  ? 306  ASP B CG  1 
ATOM   6511 O OD1 . ASP B 1 309 ? 85.736  62.899 -36.605 1.00 59.18  ? 306  ASP B OD1 1 
ATOM   6512 O OD2 . ASP B 1 309 ? 85.331  64.046 -34.770 1.00 57.79  ? 306  ASP B OD2 1 
ATOM   6513 N N   . PHE B 1 310 ? 86.349  59.896 -34.957 1.00 40.92  ? 307  PHE B N   1 
ATOM   6514 C CA  . PHE B 1 310 ? 87.634  59.204 -35.035 1.00 35.69  ? 307  PHE B CA  1 
ATOM   6515 C C   . PHE B 1 310 ? 87.455  57.772 -35.523 1.00 32.20  ? 307  PHE B C   1 
ATOM   6516 O O   . PHE B 1 310 ? 88.282  57.258 -36.284 1.00 34.48  ? 307  PHE B O   1 
ATOM   6517 C CB  . PHE B 1 310 ? 88.343  59.207 -33.678 1.00 33.96  ? 307  PHE B CB  1 
ATOM   6518 C CG  . PHE B 1 310 ? 89.768  58.729 -33.747 1.00 30.96  ? 307  PHE B CG  1 
ATOM   6519 C CD1 . PHE B 1 310 ? 90.063  57.373 -33.770 1.00 28.61  ? 307  PHE B CD1 1 
ATOM   6520 C CD2 . PHE B 1 310 ? 90.815  59.632 -33.810 1.00 27.36  ? 307  PHE B CD2 1 
ATOM   6521 C CE1 . PHE B 1 310 ? 91.373  56.929 -33.848 1.00 26.03  ? 307  PHE B CE1 1 
ATOM   6522 C CE2 . PHE B 1 310 ? 92.129  59.190 -33.882 1.00 24.50  ? 307  PHE B CE2 1 
ATOM   6523 C CZ  . PHE B 1 310 ? 92.404  57.834 -33.906 1.00 24.34  ? 307  PHE B CZ  1 
ATOM   6524 N N   . LEU B 1 311 ? 86.405  57.102 -35.062 1.00 40.30  ? 308  LEU B N   1 
ATOM   6525 C CA  . LEU B 1 311 ? 86.029  55.778 -35.535 1.00 42.43  ? 308  LEU B CA  1 
ATOM   6526 C C   . LEU B 1 311 ? 84.652  55.905 -36.162 1.00 42.82  ? 308  LEU B C   1 
ATOM   6527 O O   . LEU B 1 311 ? 83.687  56.242 -35.468 1.00 40.96  ? 308  LEU B O   1 
ATOM   6528 C CB  . LEU B 1 311 ? 86.030  54.759 -34.394 1.00 40.01  ? 308  LEU B CB  1 
ATOM   6529 C CG  . LEU B 1 311 ? 87.440  54.346 -33.977 1.00 44.07  ? 308  LEU B CG  1 
ATOM   6530 C CD1 . LEU B 1 311 ? 87.400  53.153 -33.062 1.00 50.60  ? 308  LEU B CD1 1 
ATOM   6531 C CD2 . LEU B 1 311 ? 88.271  54.032 -35.221 1.00 41.15  ? 308  LEU B CD2 1 
ATOM   6532 N N   . SER B 1 312 ? 84.578  55.678 -37.481 1.00 45.70  ? 309  SER B N   1 
ATOM   6533 C CA  . SER B 1 312 ? 83.308  55.795 -38.197 1.00 47.73  ? 309  SER B CA  1 
ATOM   6534 C C   . SER B 1 312 ? 82.304  54.731 -37.758 1.00 46.26  ? 309  SER B C   1 
ATOM   6535 O O   . SER B 1 312 ? 81.089  54.948 -37.858 1.00 49.86  ? 309  SER B O   1 
ATOM   6536 C CB  . SER B 1 312 ? 83.552  55.723 -39.707 1.00 43.89  ? 309  SER B CB  1 
ATOM   6537 O OG  . SER B 1 312 ? 84.073  54.459 -40.091 1.00 46.89  ? 309  SER B OG  1 
ATOM   6538 N N   . ASP B 1 313 ? 82.784  53.590 -37.267 1.00 45.05  ? 310  ASP B N   1 
ATOM   6539 C CA  . ASP B 1 313 ? 81.929  52.560 -36.685 1.00 46.86  ? 310  ASP B CA  1 
ATOM   6540 C C   . ASP B 1 313 ? 82.712  51.893 -35.558 1.00 43.20  ? 310  ASP B C   1 
ATOM   6541 O O   . ASP B 1 313 ? 83.859  52.255 -35.282 1.00 39.71  ? 310  ASP B O   1 
ATOM   6542 C CB  . ASP B 1 313 ? 81.481  51.548 -37.750 1.00 44.27  ? 310  ASP B CB  1 
ATOM   6543 C CG  . ASP B 1 313 ? 80.120  50.911 -37.435 1.00 52.70  ? 310  ASP B CG  1 
ATOM   6544 O OD1 . ASP B 1 313 ? 79.743  50.827 -36.241 1.00 44.08  ? 310  ASP B OD1 1 
ATOM   6545 O OD2 . ASP B 1 313 ? 79.428  50.493 -38.394 1.00 59.06  ? 310  ASP B OD2 1 
ATOM   6546 N N   . THR B 1 314 ? 82.097  50.901 -34.914 1.00 40.32  ? 311  THR B N   1 
ATOM   6547 C CA  . THR B 1 314 ? 82.794  50.174 -33.865 1.00 34.99  ? 311  THR B CA  1 
ATOM   6548 C C   . THR B 1 314 ? 84.060  49.541 -34.424 1.00 32.45  ? 311  THR B C   1 
ATOM   6549 O O   . THR B 1 314 ? 84.140  49.251 -35.620 1.00 39.73  ? 311  THR B O   1 
ATOM   6550 C CB  . THR B 1 314 ? 81.920  49.076 -33.270 1.00 39.11  ? 311  THR B CB  1 
ATOM   6551 O OG1 . THR B 1 314 ? 81.702  48.068 -34.266 1.00 38.80  ? 311  THR B OG1 1 
ATOM   6552 C CG2 . THR B 1 314 ? 80.604  49.643 -32.809 1.00 34.59  ? 311  THR B CG2 1 
ATOM   6553 N N   . PRO B 1 315 ? 85.067  49.319 -33.582 1.00 28.74  ? 312  PRO B N   1 
ATOM   6554 C CA  . PRO B 1 315 ? 86.235  48.561 -34.049 1.00 35.67  ? 312  PRO B CA  1 
ATOM   6555 C C   . PRO B 1 315 ? 85.870  47.188 -34.597 1.00 33.87  ? 312  PRO B C   1 
ATOM   6556 O O   . PRO B 1 315 ? 86.532  46.706 -35.522 1.00 34.08  ? 312  PRO B O   1 
ATOM   6557 C CB  . PRO B 1 315 ? 87.113  48.449 -32.793 1.00 27.90  ? 312  PRO B CB  1 
ATOM   6558 C CG  . PRO B 1 315 ? 86.692  49.576 -31.924 1.00 30.45  ? 312  PRO B CG  1 
ATOM   6559 C CD  . PRO B 1 315 ? 85.241  49.840 -32.213 1.00 32.60  ? 312  PRO B CD  1 
ATOM   6560 N N   . GLU B 1 316 ? 84.847  46.535 -34.041 1.00 41.70  ? 313  GLU B N   1 
ATOM   6561 C CA  . GLU B 1 316 ? 84.446  45.226 -34.555 1.00 44.33  ? 313  GLU B CA  1 
ATOM   6562 C C   . GLU B 1 316 ? 83.942  45.339 -35.990 1.00 37.42  ? 313  GLU B C   1 
ATOM   6563 O O   . GLU B 1 316 ? 84.378  44.595 -36.873 1.00 35.20  ? 313  GLU B O   1 
ATOM   6564 C CB  . GLU B 1 316 ? 83.381  44.600 -33.653 1.00 36.44  ? 313  GLU B CB  1 
ATOM   6565 C CG  . GLU B 1 316 ? 83.167  43.110 -33.928 1.00 55.47  ? 313  GLU B CG  1 
ATOM   6566 C CD  . GLU B 1 316 ? 81.849  42.566 -33.387 1.00 60.97  ? 313  GLU B CD  1 
ATOM   6567 O OE1 . GLU B 1 316 ? 81.283  41.651 -34.025 1.00 73.24  ? 313  GLU B OE1 1 
ATOM   6568 O OE2 . GLU B 1 316 ? 81.381  43.041 -32.330 1.00 61.61  ? 313  GLU B OE2 1 
ATOM   6569 N N   . ALA B 1 317 ? 83.040  46.289 -36.244 1.00 37.96  ? 314  ALA B N   1 
ATOM   6570 C CA  . ALA B 1 317 ? 82.551  46.513 -37.601 1.00 39.19  ? 314  ALA B CA  1 
ATOM   6571 C C   . ALA B 1 317 ? 83.692  46.844 -38.557 1.00 41.26  ? 314  ALA B C   1 
ATOM   6572 O O   . ALA B 1 317 ? 83.795  46.262 -39.646 1.00 43.34  ? 314  ALA B O   1 
ATOM   6573 C CB  . ALA B 1 317 ? 81.511  47.632 -37.596 1.00 38.94  ? 314  ALA B CB  1 
ATOM   6574 N N   . LEU B 1 318 ? 84.569  47.777 -38.160 1.00 38.72  ? 315  LEU B N   1 
ATOM   6575 C CA  . LEU B 1 318 ? 85.651  48.215 -39.038 1.00 30.14  ? 315  LEU B CA  1 
ATOM   6576 C C   . LEU B 1 318 ? 86.684  47.124 -39.264 1.00 32.84  ? 315  LEU B C   1 
ATOM   6577 O O   . LEU B 1 318 ? 87.309  47.080 -40.333 1.00 36.84  ? 315  LEU B O   1 
ATOM   6578 C CB  . LEU B 1 318 ? 86.327  49.465 -38.465 1.00 34.32  ? 315  LEU B CB  1 
ATOM   6579 C CG  . LEU B 1 318 ? 85.437  50.694 -38.284 1.00 36.95  ? 315  LEU B CG  1 
ATOM   6580 C CD1 . LEU B 1 318 ? 86.203  51.774 -37.541 1.00 42.01  ? 315  LEU B CD1 1 
ATOM   6581 C CD2 . LEU B 1 318 ? 84.947  51.220 -39.616 1.00 32.05  ? 315  LEU B CD2 1 
ATOM   6582 N N   . ILE B 1 319 ? 86.904  46.254 -38.276 1.00 31.49  ? 316  ILE B N   1 
ATOM   6583 C CA  . ILE B 1 319 ? 87.843  45.150 -38.480 1.00 36.87  ? 316  ILE B CA  1 
ATOM   6584 C C   . ILE B 1 319 ? 87.267  44.146 -39.473 1.00 39.01  ? 316  ILE B C   1 
ATOM   6585 O O   . ILE B 1 319 ? 87.991  43.578 -40.299 1.00 40.45  ? 316  ILE B O   1 
ATOM   6586 C CB  . ILE B 1 319 ? 88.186  44.469 -37.141 1.00 34.35  ? 316  ILE B CB  1 
ATOM   6587 C CG1 . ILE B 1 319 ? 89.095  45.351 -36.284 1.00 33.25  ? 316  ILE B CG1 1 
ATOM   6588 C CG2 . ILE B 1 319 ? 88.830  43.081 -37.371 1.00 32.80  ? 316  ILE B CG2 1 
ATOM   6589 C CD1 . ILE B 1 319 ? 89.115  44.947 -34.822 1.00 28.44  ? 316  ILE B CD1 1 
ATOM   6590 N N   . ASN B 1 320 ? 85.956  43.908 -39.402 1.00 38.61  ? 317  ASN B N   1 
ATOM   6591 C CA  . ASN B 1 320 ? 85.348  42.883 -40.241 1.00 41.46  ? 317  ASN B CA  1 
ATOM   6592 C C   . ASN B 1 320 ? 85.331  43.322 -41.693 1.00 37.17  ? 317  ASN B C   1 
ATOM   6593 O O   . ASN B 1 320 ? 85.689  42.552 -42.587 1.00 43.55  ? 317  ASN B O   1 
ATOM   6594 C CB  . ASN B 1 320 ? 83.935  42.567 -39.746 1.00 35.45  ? 317  ASN B CB  1 
ATOM   6595 C CG  . ASN B 1 320 ? 83.940  41.805 -38.449 1.00 34.72  ? 317  ASN B CG  1 
ATOM   6596 O OD1 . ASN B 1 320 ? 84.929  41.158 -38.101 1.00 40.64  ? 317  ASN B OD1 1 
ATOM   6597 N ND2 . ASN B 1 320 ? 82.840  41.879 -37.715 1.00 39.04  ? 317  ASN B ND2 1 
ATOM   6598 N N   . ALA B 1 321 ? 84.950  44.573 -41.935 1.00 37.36  ? 318  ALA B N   1 
ATOM   6599 C CA  . ALA B 1 321 ? 84.840  45.129 -43.271 1.00 36.89  ? 318  ALA B CA  1 
ATOM   6600 C C   . ALA B 1 321 ? 86.179  45.561 -43.874 1.00 45.81  ? 318  ALA B C   1 
ATOM   6601 O O   . ALA B 1 321 ? 86.215  45.926 -45.052 1.00 47.98  ? 318  ALA B O   1 
ATOM   6602 C CB  . ALA B 1 321 ? 83.871  46.316 -43.235 1.00 32.86  ? 318  ALA B CB  1 
ATOM   6603 N N   . GLY B 1 322 ? 87.283  45.507 -43.130 1.00 43.76  ? 319  GLY B N   1 
ATOM   6604 C CA  . GLY B 1 322 ? 88.502  46.158 -43.578 1.00 37.88  ? 319  GLY B CA  1 
ATOM   6605 C C   . GLY B 1 322 ? 89.304  45.348 -44.586 1.00 42.53  ? 319  GLY B C   1 
ATOM   6606 O O   . GLY B 1 322 ? 89.311  44.116 -44.582 1.00 35.89  ? 319  GLY B O   1 
ATOM   6607 N N   . ASP B 1 323 ? 90.003  46.072 -45.460 1.00 36.75  ? 320  ASP B N   1 
ATOM   6608 C CA  . ASP B 1 323 ? 90.969  45.502 -46.388 1.00 39.56  ? 320  ASP B CA  1 
ATOM   6609 C C   . ASP B 1 323 ? 92.356  45.906 -45.921 1.00 38.42  ? 320  ASP B C   1 
ATOM   6610 O O   . ASP B 1 323 ? 92.677  47.098 -45.878 1.00 44.96  ? 320  ASP B O   1 
ATOM   6611 C CB  . ASP B 1 323 ? 90.697  45.973 -47.823 1.00 41.57  ? 320  ASP B CB  1 
ATOM   6612 C CG  . ASP B 1 323 ? 91.773  45.514 -48.825 1.00 45.76  ? 320  ASP B CG  1 
ATOM   6613 O OD1 . ASP B 1 323 ? 92.580  44.611 -48.529 1.00 51.58  ? 320  ASP B OD1 1 
ATOM   6614 O OD2 . ASP B 1 323 ? 91.776  46.008 -49.963 1.00 55.70  ? 320  ASP B OD2 1 
ATOM   6615 N N   . PHE B 1 324 ? 93.171  44.919 -45.562 1.00 35.69  ? 321  PHE B N   1 
ATOM   6616 C CA  . PHE B 1 324 ? 94.463  45.165 -44.945 1.00 34.89  ? 321  PHE B CA  1 
ATOM   6617 C C   . PHE B 1 324 ? 95.605  44.720 -45.832 1.00 42.41  ? 321  PHE B C   1 
ATOM   6618 O O   . PHE B 1 324 ? 96.702  44.442 -45.333 1.00 41.30  ? 321  PHE B O   1 
ATOM   6619 C CB  . PHE B 1 324 ? 94.520  44.487 -43.575 1.00 38.97  ? 321  PHE B CB  1 
ATOM   6620 C CG  . PHE B 1 324 ? 93.417  44.922 -42.662 1.00 34.24  ? 321  PHE B CG  1 
ATOM   6621 C CD1 . PHE B 1 324 ? 93.467  46.156 -42.034 1.00 34.72  ? 321  PHE B CD1 1 
ATOM   6622 C CD2 . PHE B 1 324 ? 92.304  44.121 -42.472 1.00 32.22  ? 321  PHE B CD2 1 
ATOM   6623 C CE1 . PHE B 1 324 ? 92.430  46.567 -41.207 1.00 34.43  ? 321  PHE B CE1 1 
ATOM   6624 C CE2 . PHE B 1 324 ? 91.276  44.520 -41.658 1.00 29.50  ? 321  PHE B CE2 1 
ATOM   6625 C CZ  . PHE B 1 324 ? 91.337  45.750 -41.016 1.00 36.97  ? 321  PHE B CZ  1 
ATOM   6626 N N   . HIS B 1 325 ? 95.366  44.649 -47.141 1.00 44.52  ? 322  HIS B N   1 
ATOM   6627 C CA  . HIS B 1 325 ? 96.446  44.393 -48.083 1.00 43.56  ? 322  HIS B CA  1 
ATOM   6628 C C   . HIS B 1 325 ? 97.522  45.462 -47.961 1.00 35.99  ? 322  HIS B C   1 
ATOM   6629 O O   . HIS B 1 325 ? 97.227  46.649 -47.803 1.00 40.21  ? 322  HIS B O   1 
ATOM   6630 C CB  . HIS B 1 325 ? 95.898  44.339 -49.511 1.00 43.54  ? 322  HIS B CB  1 
ATOM   6631 C CG  . HIS B 1 325 ? 95.098  43.104 -49.794 1.00 42.62  ? 322  HIS B CG  1 
ATOM   6632 N ND1 . HIS B 1 325 ? 93.721  43.071 -49.716 1.00 42.78  ? 322  HIS B ND1 1 
ATOM   6633 C CD2 . HIS B 1 325 ? 95.489  41.849 -50.119 1.00 40.65  ? 322  HIS B CD2 1 
ATOM   6634 C CE1 . HIS B 1 325 ? 93.297  41.853 -49.998 1.00 48.84  ? 322  HIS B CE1 1 
ATOM   6635 N NE2 . HIS B 1 325 ? 94.349  41.091 -50.243 1.00 50.80  ? 322  HIS B NE2 1 
ATOM   6636 N N   . GLY B 1 326 ? 98.779  45.028 -48.009 1.00 38.65  ? 323  GLY B N   1 
ATOM   6637 C CA  . GLY B 1 326 ? 99.905  45.921 -47.868 1.00 39.93  ? 323  GLY B CA  1 
ATOM   6638 C C   . GLY B 1 326 ? 100.372 46.140 -46.444 1.00 46.80  ? 323  GLY B C   1 
ATOM   6639 O O   . GLY B 1 326 ? 101.411 46.783 -46.243 1.00 42.19  ? 323  GLY B O   1 
ATOM   6640 N N   . LEU B 1 327 ? 99.647  45.620 -45.455 1.00 43.94  ? 324  LEU B N   1 
ATOM   6641 C CA  . LEU B 1 327 ? 99.959  45.816 -44.044 1.00 36.43  ? 324  LEU B CA  1 
ATOM   6642 C C   . LEU B 1 327 ? 100.660 44.585 -43.477 1.00 36.34  ? 324  LEU B C   1 
ATOM   6643 O O   . LEU B 1 327 ? 100.306 43.451 -43.809 1.00 37.63  ? 324  LEU B O   1 
ATOM   6644 C CB  . LEU B 1 327 ? 98.671  46.112 -43.272 1.00 36.41  ? 324  LEU B CB  1 
ATOM   6645 C CG  . LEU B 1 327 ? 98.707  46.075 -41.747 1.00 40.26  ? 324  LEU B CG  1 
ATOM   6646 C CD1 . LEU B 1 327 ? 99.729  47.075 -41.219 1.00 41.28  ? 324  LEU B CD1 1 
ATOM   6647 C CD2 . LEU B 1 327 ? 97.329  46.357 -41.183 1.00 35.03  ? 324  LEU B CD2 1 
ATOM   6648 N N   . GLN B 1 328 ? 101.679 44.808 -42.648 1.00 31.65  ? 325  GLN B N   1 
ATOM   6649 C CA  . GLN B 1 328 ? 102.246 43.755 -41.813 1.00 35.55  ? 325  GLN B CA  1 
ATOM   6650 C C   . GLN B 1 328 ? 101.976 44.068 -40.346 1.00 40.15  ? 325  GLN B C   1 
ATOM   6651 O O   . GLN B 1 328 ? 102.094 45.221 -39.908 1.00 30.34  ? 325  GLN B O   1 
ATOM   6652 C CB  . GLN B 1 328 ? 103.749 43.581 -42.030 1.00 34.06  ? 325  GLN B CB  1 
ATOM   6653 C CG  . GLN B 1 328 ? 104.145 43.293 -43.469 1.00 39.00  ? 325  GLN B CG  1 
ATOM   6654 C CD  . GLN B 1 328 ? 104.208 44.557 -44.292 1.00 41.74  ? 325  GLN B CD  1 
ATOM   6655 O OE1 . GLN B 1 328 ? 105.019 45.441 -44.013 1.00 44.28  ? 325  GLN B OE1 1 
ATOM   6656 N NE2 . GLN B 1 328 ? 103.333 44.669 -45.293 1.00 45.09  ? 325  GLN B NE2 1 
ATOM   6657 N N   . VAL B 1 329 ? 101.602 43.037 -39.590 1.00 34.05  ? 326  VAL B N   1 
ATOM   6658 C CA  . VAL B 1 329 ? 101.243 43.178 -38.186 1.00 27.00  ? 326  VAL B CA  1 
ATOM   6659 C C   . VAL B 1 329 ? 101.946 42.102 -37.381 1.00 30.47  ? 326  VAL B C   1 
ATOM   6660 O O   . VAL B 1 329 ? 102.009 40.941 -37.796 1.00 30.38  ? 326  VAL B O   1 
ATOM   6661 C CB  . VAL B 1 329 ? 99.723  43.091 -37.975 1.00 27.70  ? 326  VAL B CB  1 
ATOM   6662 C CG1 . VAL B 1 329 ? 99.387  43.407 -36.533 1.00 35.39  ? 326  VAL B CG1 1 
ATOM   6663 C CG2 . VAL B 1 329 ? 99.030  44.077 -38.852 1.00 32.28  ? 326  VAL B CG2 1 
ATOM   6664 N N   . LEU B 1 330 ? 102.483 42.491 -36.233 1.00 25.13  ? 327  LEU B N   1 
ATOM   6665 C CA  . LEU B 1 330 ? 102.984 41.566 -35.234 1.00 23.69  ? 327  LEU B CA  1 
ATOM   6666 C C   . LEU B 1 330 ? 102.078 41.705 -34.014 1.00 34.26  ? 327  LEU B C   1 
ATOM   6667 O O   . LEU B 1 330 ? 101.812 42.831 -33.572 1.00 29.66  ? 327  LEU B O   1 
ATOM   6668 C CB  . LEU B 1 330 ? 104.446 41.883 -34.902 1.00 22.80  ? 327  LEU B CB  1 
ATOM   6669 C CG  . LEU B 1 330 ? 105.175 41.098 -33.809 1.00 29.46  ? 327  LEU B CG  1 
ATOM   6670 C CD1 . LEU B 1 330 ? 105.121 39.629 -34.100 1.00 34.36  ? 327  LEU B CD1 1 
ATOM   6671 C CD2 . LEU B 1 330 ? 106.627 41.536 -33.710 1.00 29.00  ? 327  LEU B CD2 1 
ATOM   6672 N N   . VAL B 1 331 ? 101.538 40.582 -33.516 1.00 25.50  ? 328  VAL B N   1 
ATOM   6673 C CA  . VAL B 1 331 ? 100.623 40.601 -32.376 1.00 21.74  ? 328  VAL B CA  1 
ATOM   6674 C C   . VAL B 1 331 ? 101.019 39.497 -31.417 1.00 25.45  ? 328  VAL B C   1 
ATOM   6675 O O   . VAL B 1 331 ? 101.678 38.526 -31.791 1.00 27.28  ? 328  VAL B O   1 
ATOM   6676 C CB  . VAL B 1 331 ? 99.142  40.442 -32.766 1.00 27.18  ? 328  VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 331 ? 98.705  41.599 -33.609 1.00 22.95  ? 328  VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 331 ? 98.921  39.126 -33.514 1.00 29.24  ? 328  VAL B CG2 1 
ATOM   6679 N N   . GLY B 1 332 ? 100.616 39.652 -30.162 1.00 21.62  ? 329  GLY B N   1 
ATOM   6680 C CA  . GLY B 1 332 ? 101.011 38.658 -29.181 1.00 23.25  ? 329  GLY B CA  1 
ATOM   6681 C C   . GLY B 1 332 ? 100.425 38.937 -27.820 1.00 24.02  ? 329  GLY B C   1 
ATOM   6682 O O   . GLY B 1 332 ? 99.772  39.961 -27.584 1.00 20.10  ? 329  GLY B O   1 
ATOM   6683 N N   . VAL B 1 333 ? 100.667 37.989 -26.922 1.00 22.76  ? 330  VAL B N   1 
ATOM   6684 C CA  . VAL B 1 333 ? 100.128 38.016 -25.574 1.00 20.99  ? 330  VAL B CA  1 
ATOM   6685 C C   . VAL B 1 333 ? 101.185 37.408 -24.667 1.00 20.27  ? 330  VAL B C   1 
ATOM   6686 O O   . VAL B 1 333 ? 102.108 36.729 -25.125 1.00 22.66  ? 330  VAL B O   1 
ATOM   6687 C CB  . VAL B 1 333 ? 98.793  37.234 -25.476 1.00 24.15  ? 330  VAL B CB  1 
ATOM   6688 C CG1 . VAL B 1 333 ? 97.723  37.853 -26.387 1.00 19.47  ? 330  VAL B CG1 1 
ATOM   6689 C CG2 . VAL B 1 333 ? 99.031  35.788 -25.855 1.00 21.98  ? 330  VAL B CG2 1 
ATOM   6690 N N   . VAL B 1 334 ? 101.054 37.668 -23.361 1.00 19.48  ? 331  VAL B N   1 
ATOM   6691 C CA  . VAL B 1 334 ? 101.914 37.032 -22.367 1.00 22.20  ? 331  VAL B CA  1 
ATOM   6692 C C   . VAL B 1 334 ? 101.211 35.763 -21.893 1.00 17.00  ? 331  VAL B C   1 
ATOM   6693 O O   . VAL B 1 334 ? 100.015 35.581 -22.143 1.00 22.67  ? 331  VAL B O   1 
ATOM   6694 C CB  . VAL B 1 334 ? 102.213 37.972 -21.178 1.00 20.97  ? 331  VAL B CB  1 
ATOM   6695 C CG1 . VAL B 1 334 ? 102.904 39.251 -21.659 1.00 22.74  ? 331  VAL B CG1 1 
ATOM   6696 C CG2 . VAL B 1 334 ? 100.937 38.330 -20.472 1.00 17.27  ? 331  VAL B CG2 1 
ATOM   6697 N N   . LYS B 1 335 ? 101.922 34.910 -21.166 1.00 19.93  ? 332  LYS B N   1 
ATOM   6698 C CA  . LYS B 1 335 ? 101.341 33.629 -20.765 1.00 26.27  ? 332  LYS B CA  1 
ATOM   6699 C C   . LYS B 1 335 ? 100.163 33.787 -19.805 1.00 27.92  ? 332  LYS B C   1 
ATOM   6700 O O   . LYS B 1 335 ? 99.217  32.997 -19.867 1.00 28.24  ? 332  LYS B O   1 
ATOM   6701 C CB  . LYS B 1 335 ? 102.421 32.743 -20.150 1.00 31.14  ? 332  LYS B CB  1 
ATOM   6702 C CG  . LYS B 1 335 ? 102.036 31.261 -20.050 1.00 29.77  ? 332  LYS B CG  1 
ATOM   6703 C CD  . LYS B 1 335 ? 103.120 30.447 -19.355 1.00 29.95  ? 332  LYS B CD  1 
ATOM   6704 C CE  . LYS B 1 335 ? 102.555 29.132 -18.805 1.00 40.90  ? 332  LYS B CE  1 
ATOM   6705 N NZ  . LYS B 1 335 ? 101.433 29.365 -17.800 1.00 47.00  ? 332  LYS B NZ  1 
ATOM   6706 N N   . ASP B 1 336 ? 100.169 34.810 -18.934 1.00 26.22  ? 333  ASP B N   1 
ATOM   6707 C CA  . ASP B 1 336 ? 99.176  34.931 -17.856 1.00 20.86  ? 333  ASP B CA  1 
ATOM   6708 C C   . ASP B 1 336 ? 98.540  36.328 -17.862 1.00 24.20  ? 333  ASP B C   1 
ATOM   6709 O O   . ASP B 1 336 ? 98.692  37.104 -16.913 1.00 23.99  ? 333  ASP B O   1 
ATOM   6710 C CB  . ASP B 1 336 ? 99.810  34.623 -16.507 1.00 21.33  ? 333  ASP B CB  1 
ATOM   6711 C CG  . ASP B 1 336 ? 100.285 33.186 -16.410 1.00 31.41  ? 333  ASP B CG  1 
ATOM   6712 O OD1 . ASP B 1 336 ? 99.417  32.300 -16.210 1.00 34.83  ? 333  ASP B OD1 1 
ATOM   6713 O OD2 . ASP B 1 336 ? 101.509 32.937 -16.533 1.00 24.31  ? 333  ASP B OD2 1 
ATOM   6714 N N   . GLU B 1 337 ? 97.773  36.608 -18.914 1.00 20.14  ? 334  GLU B N   1 
ATOM   6715 C CA  . GLU B 1 337 ? 97.212  37.934 -19.125 1.00 24.00  ? 334  GLU B CA  1 
ATOM   6716 C C   . GLU B 1 337 ? 96.307  38.382 -17.985 1.00 27.35  ? 334  GLU B C   1 
ATOM   6717 O O   . GLU B 1 337 ? 96.138  39.595 -17.765 1.00 24.06  ? 334  GLU B O   1 
ATOM   6718 C CB  . GLU B 1 337 ? 96.428  37.964 -20.435 1.00 19.19  ? 334  GLU B CB  1 
ATOM   6719 C CG  . GLU B 1 337 ? 97.275  37.931 -21.689 1.00 24.57  ? 334  GLU B CG  1 
ATOM   6720 C CD  . GLU B 1 337 ? 97.996  39.262 -21.926 1.00 28.61  ? 334  GLU B CD  1 
ATOM   6721 O OE1 . GLU B 1 337 ? 98.865  39.339 -22.831 1.00 23.46  ? 334  GLU B OE1 1 
ATOM   6722 O OE2 . GLU B 1 337 ? 97.688  40.223 -21.186 1.00 24.64  ? 334  GLU B OE2 1 
ATOM   6723 N N   . GLY B 1 338 ? 95.699  37.446 -17.268 1.00 23.21  ? 335  GLY B N   1 
ATOM   6724 C CA  . GLY B 1 338 ? 94.632  37.851 -16.371 1.00 17.42  ? 335  GLY B CA  1 
ATOM   6725 C C   . GLY B 1 338 ? 95.071  38.041 -14.931 1.00 18.35  ? 335  GLY B C   1 
ATOM   6726 O O   . GLY B 1 338 ? 94.380  38.705 -14.160 1.00 21.73  ? 335  GLY B O   1 
ATOM   6727 N N   . SER B 1 339 ? 96.216  37.473 -14.554 1.00 16.09  ? 336  SER B N   1 
ATOM   6728 C CA  . SER B 1 339 ? 96.476  37.235 -13.135 1.00 22.34  ? 336  SER B CA  1 
ATOM   6729 C C   . SER B 1 339 ? 96.618  38.543 -12.371 1.00 25.65  ? 336  SER B C   1 
ATOM   6730 O O   . SER B 1 339 ? 96.100  38.688 -11.254 1.00 24.36  ? 336  SER B O   1 
ATOM   6731 C CB  . SER B 1 339 ? 97.723  36.366 -12.963 1.00 22.59  ? 336  SER B CB  1 
ATOM   6732 O OG  . SER B 1 339 ? 98.849  36.951 -13.594 1.00 22.87  ? 336  SER B OG  1 
ATOM   6733 N N   . TYR B 1 340 ? 97.289  39.511 -12.986 1.00 30.25  ? 337  TYR B N   1 
ATOM   6734 C CA  . TYR B 1 340 ? 97.566  40.795 -12.360 1.00 24.80  ? 337  TYR B CA  1 
ATOM   6735 C C   . TYR B 1 340 ? 96.281  41.520 -11.957 1.00 24.70  ? 337  TYR B C   1 
ATOM   6736 O O   . TYR B 1 340 ? 96.188  42.082 -10.857 1.00 24.56  ? 337  TYR B O   1 
ATOM   6737 C CB  . TYR B 1 340 ? 98.407  41.595 -13.357 1.00 33.36  ? 337  TYR B CB  1 
ATOM   6738 C CG  . TYR B 1 340 ? 98.310  43.092 -13.319 1.00 30.62  ? 337  TYR B CG  1 
ATOM   6739 C CD1 . TYR B 1 340 ? 98.715  43.811 -12.229 1.00 36.74  ? 337  TYR B CD1 1 
ATOM   6740 C CD2 . TYR B 1 340 ? 97.811  43.781 -14.394 1.00 38.16  ? 337  TYR B CD2 1 
ATOM   6741 C CE1 . TYR B 1 340 ? 98.628  45.192 -12.211 1.00 42.97  ? 337  TYR B CE1 1 
ATOM   6742 C CE2 . TYR B 1 340 ? 97.711  45.154 -14.384 1.00 41.81  ? 337  TYR B CE2 1 
ATOM   6743 C CZ  . TYR B 1 340 ? 98.120  45.856 -13.290 1.00 48.43  ? 337  TYR B CZ  1 
ATOM   6744 O OH  . TYR B 1 340 ? 98.040  47.233 -13.271 1.00 57.69  ? 337  TYR B OH  1 
ATOM   6745 N N   . PHE B 1 341 ? 95.259  41.476 -12.804 1.00 24.01  ? 338  PHE B N   1 
ATOM   6746 C CA  . PHE B 1 341 ? 94.011  42.161 -12.490 1.00 22.05  ? 338  PHE B CA  1 
ATOM   6747 C C   . PHE B 1 341 ? 93.220  41.530 -11.344 1.00 22.94  ? 338  PHE B C   1 
ATOM   6748 O O   . PHE B 1 341 ? 92.301  42.176 -10.836 1.00 22.53  ? 338  PHE B O   1 
ATOM   6749 C CB  . PHE B 1 341 ? 93.157  42.217 -13.744 1.00 22.23  ? 338  PHE B CB  1 
ATOM   6750 C CG  . PHE B 1 341 ? 93.844  42.895 -14.881 1.00 28.80  ? 338  PHE B CG  1 
ATOM   6751 C CD1 . PHE B 1 341 ? 93.719  44.260 -15.055 1.00 26.65  ? 338  PHE B CD1 1 
ATOM   6752 C CD2 . PHE B 1 341 ? 94.674  42.181 -15.738 1.00 25.30  ? 338  PHE B CD2 1 
ATOM   6753 C CE1 . PHE B 1 341 ? 94.377  44.907 -16.089 1.00 30.72  ? 338  PHE B CE1 1 
ATOM   6754 C CE2 . PHE B 1 341 ? 95.345  42.827 -16.771 1.00 26.55  ? 338  PHE B CE2 1 
ATOM   6755 C CZ  . PHE B 1 341 ? 95.185  44.192 -16.948 1.00 28.02  ? 338  PHE B CZ  1 
ATOM   6756 N N   . LEU B 1 342 ? 93.526  40.298 -10.918 1.00 24.07  ? 339  LEU B N   1 
ATOM   6757 C CA  . LEU B 1 342 ? 92.643  39.665 -9.935  1.00 22.41  ? 339  LEU B CA  1 
ATOM   6758 C C   . LEU B 1 342 ? 92.796  40.286 -8.549  1.00 26.69  ? 339  LEU B C   1 
ATOM   6759 O O   . LEU B 1 342 ? 91.831  40.308 -7.778  1.00 23.06  ? 339  LEU B O   1 
ATOM   6760 C CB  . LEU B 1 342 ? 92.886  38.151 -9.885  1.00 21.29  ? 339  LEU B CB  1 
ATOM   6761 C CG  . LEU B 1 342 ? 92.675  37.437 -11.224 1.00 25.36  ? 339  LEU B CG  1 
ATOM   6762 C CD1 . LEU B 1 342 ? 92.876  35.926 -11.122 1.00 23.05  ? 339  LEU B CD1 1 
ATOM   6763 C CD2 . LEU B 1 342 ? 91.283  37.776 -11.740 1.00 22.99  ? 339  LEU B CD2 1 
ATOM   6764 N N   . VAL B 1 343 ? 93.984  40.807 -8.213  1.00 25.09  ? 340  VAL B N   1 
ATOM   6765 C CA  . VAL B 1 343 ? 94.161  41.451 -6.908  1.00 23.67  ? 340  VAL B CA  1 
ATOM   6766 C C   . VAL B 1 343 ? 93.568  42.846 -6.845  1.00 25.73  ? 340  VAL B C   1 
ATOM   6767 O O   . VAL B 1 343 ? 93.650  43.496 -5.797  1.00 32.94  ? 340  VAL B O   1 
ATOM   6768 C CB  . VAL B 1 343 ? 95.640  41.551 -6.504  1.00 27.05  ? 340  VAL B CB  1 
ATOM   6769 C CG1 . VAL B 1 343 ? 96.209  40.156 -6.378  1.00 23.45  ? 340  VAL B CG1 1 
ATOM   6770 C CG2 . VAL B 1 343 ? 96.421  42.414 -7.520  1.00 28.26  ? 340  VAL B CG2 1 
ATOM   6771 N N   . TYR B 1 344 ? 92.966  43.327 -7.926  1.00 23.53  ? 341  TYR B N   1 
ATOM   6772 C CA  . TYR B 1 344 ? 92.270  44.601 -7.916  1.00 25.43  ? 341  TYR B CA  1 
ATOM   6773 C C   . TYR B 1 344 ? 90.764  44.442 -7.764  1.00 30.04  ? 341  TYR B C   1 
ATOM   6774 O O   . TYR B 1 344 ? 90.012  45.315 -8.203  1.00 33.67  ? 341  TYR B O   1 
ATOM   6775 C CB  . TYR B 1 344 ? 92.598  45.400 -9.181  1.00 27.86  ? 341  TYR B CB  1 
ATOM   6776 C CG  . TYR B 1 344 ? 93.960  46.011 -9.094  1.00 29.67  ? 341  TYR B CG  1 
ATOM   6777 C CD1 . TYR B 1 344 ? 94.141  47.274 -8.554  1.00 36.03  ? 341  TYR B CD1 1 
ATOM   6778 C CD2 . TYR B 1 344 ? 95.081  45.298 -9.495  1.00 33.46  ? 341  TYR B CD2 1 
ATOM   6779 C CE1 . TYR B 1 344 ? 95.415  47.837 -8.452  1.00 36.28  ? 341  TYR B CE1 1 
ATOM   6780 C CE2 . TYR B 1 344 ? 96.351  45.841 -9.391  1.00 40.99  ? 341  TYR B CE2 1 
ATOM   6781 C CZ  . TYR B 1 344 ? 96.510  47.112 -8.866  1.00 38.85  ? 341  TYR B CZ  1 
ATOM   6782 O OH  . TYR B 1 344 ? 97.772  47.636 -8.765  1.00 40.40  ? 341  TYR B OH  1 
ATOM   6783 N N   . GLY B 1 345 ? 90.294  43.357 -7.148  1.00 31.26  ? 342  GLY B N   1 
ATOM   6784 C CA  . GLY B 1 345 ? 88.856  43.273 -6.948  1.00 38.53  ? 342  GLY B CA  1 
ATOM   6785 C C   . GLY B 1 345 ? 88.213  41.900 -6.885  1.00 33.62  ? 342  GLY B C   1 
ATOM   6786 O O   . GLY B 1 345 ? 87.074  41.783 -6.428  1.00 35.84  ? 342  GLY B O   1 
ATOM   6787 N N   . ALA B 1 346 ? 88.901  40.870 -7.343  1.00 27.28  ? 343  ALA B N   1 
ATOM   6788 C CA  . ALA B 1 346 ? 88.347  39.529 -7.264  1.00 33.39  ? 343  ALA B CA  1 
ATOM   6789 C C   . ALA B 1 346 ? 88.403  39.051 -5.815  1.00 32.00  ? 343  ALA B C   1 
ATOM   6790 O O   . ALA B 1 346 ? 89.454  39.174 -5.167  1.00 27.09  ? 343  ALA B O   1 
ATOM   6791 C CB  . ALA B 1 346 ? 89.105  38.568 -8.191  1.00 23.16  ? 343  ALA B CB  1 
ATOM   6792 N N   . PRO B 1 347 ? 87.304  38.515 -5.272  1.00 30.68  ? 344  PRO B N   1 
ATOM   6793 C CA  . PRO B 1 347 ? 87.293  38.110 -3.853  1.00 30.37  ? 344  PRO B CA  1 
ATOM   6794 C C   . PRO B 1 347 ? 88.282  36.983 -3.585  1.00 26.96  ? 344  PRO B C   1 
ATOM   6795 O O   . PRO B 1 347 ? 88.467  36.083 -4.408  1.00 24.73  ? 344  PRO B O   1 
ATOM   6796 C CB  . PRO B 1 347 ? 85.845  37.654 -3.614  1.00 28.09  ? 344  PRO B CB  1 
ATOM   6797 C CG  . PRO B 1 347 ? 85.053  38.155 -4.783  1.00 34.14  ? 344  PRO B CG  1 
ATOM   6798 C CD  . PRO B 1 347 ? 86.012  38.281 -5.942  1.00 29.85  ? 344  PRO B CD  1 
ATOM   6799 N N   . GLY B 1 348 ? 88.932  37.053 -2.420  1.00 27.82  ? 345  GLY B N   1 
ATOM   6800 C CA  . GLY B 1 348 ? 89.904  36.063 -1.996  1.00 25.15  ? 345  GLY B CA  1 
ATOM   6801 C C   . GLY B 1 348 ? 91.311  36.223 -2.553  1.00 25.68  ? 345  GLY B C   1 
ATOM   6802 O O   . GLY B 1 348 ? 92.185  35.402 -2.233  1.00 22.33  ? 345  GLY B O   1 
ATOM   6803 N N   . PHE B 1 349 ? 91.575  37.223 -3.384  1.00 26.68  ? 346  PHE B N   1 
ATOM   6804 C CA  . PHE B 1 349 ? 92.902  37.362 -3.974  1.00 28.18  ? 346  PHE B CA  1 
ATOM   6805 C C   . PHE B 1 349 ? 93.741  38.346 -3.165  1.00 29.66  ? 346  PHE B C   1 
ATOM   6806 O O   . PHE B 1 349 ? 93.232  39.351 -2.670  1.00 26.98  ? 346  PHE B O   1 
ATOM   6807 C CB  . PHE B 1 349 ? 92.809  37.792 -5.443  1.00 22.64  ? 346  PHE B CB  1 
ATOM   6808 C CG  . PHE B 1 349 ? 92.502  36.637 -6.387  1.00 25.55  ? 346  PHE B CG  1 
ATOM   6809 C CD1 . PHE B 1 349 ? 91.192  36.263 -6.645  1.00 23.94  ? 346  PHE B CD1 1 
ATOM   6810 C CD2 . PHE B 1 349 ? 93.525  35.922 -6.991  1.00 23.26  ? 346  PHE B CD2 1 
ATOM   6811 C CE1 . PHE B 1 349 ? 90.912  35.215 -7.495  1.00 24.13  ? 346  PHE B CE1 1 
ATOM   6812 C CE2 . PHE B 1 349 ? 93.246  34.870 -7.849  1.00 24.22  ? 346  PHE B CE2 1 
ATOM   6813 C CZ  . PHE B 1 349 ? 91.943  34.514 -8.089  1.00 24.16  ? 346  PHE B CZ  1 
ATOM   6814 N N   . SER B 1 350 ? 95.023  38.018 -3.008  1.00 26.81  ? 347  SER B N   1 
ATOM   6815 C CA  . SER B 1 350 ? 95.995  38.843 -2.302  1.00 25.40  ? 347  SER B CA  1 
ATOM   6816 C C   . SER B 1 350 ? 97.332  38.605 -2.976  1.00 28.57  ? 347  SER B C   1 
ATOM   6817 O O   . SER B 1 350 ? 97.659  37.462 -3.302  1.00 24.47  ? 347  SER B O   1 
ATOM   6818 C CB  . SER B 1 350 ? 96.083  38.483 -0.808  1.00 22.62  ? 347  SER B CB  1 
ATOM   6819 O OG  . SER B 1 350 ? 97.222  39.063 -0.184  1.00 29.32  ? 347  SER B OG  1 
ATOM   6820 N N   . LYS B 1 351 ? 98.110  39.668 -3.189  1.00 26.79  ? 348  LYS B N   1 
ATOM   6821 C CA  . LYS B 1 351 ? 99.431  39.424 -3.770  1.00 22.55  ? 348  LYS B CA  1 
ATOM   6822 C C   . LYS B 1 351 ? 100.384 38.820 -2.752  1.00 22.54  ? 348  LYS B C   1 
ATOM   6823 O O   . LYS B 1 351 ? 101.412 38.254 -3.138  1.00 22.57  ? 348  LYS B O   1 
ATOM   6824 C CB  . LYS B 1 351 ? 100.027 40.706 -4.357  1.00 25.88  ? 348  LYS B CB  1 
ATOM   6825 C CG  . LYS B 1 351 ? 100.994 41.450 -3.433  1.00 22.56  ? 348  LYS B CG  1 
ATOM   6826 C CD  . LYS B 1 351 ? 101.723 42.574 -4.198  1.00 23.31  ? 348  LYS B CD  1 
ATOM   6827 C CE  . LYS B 1 351 ? 102.583 43.440 -3.265  1.00 20.72  ? 348  LYS B CE  1 
ATOM   6828 N NZ  . LYS B 1 351 ? 103.492 42.599 -2.462  1.00 16.45  ? 348  LYS B NZ  1 
ATOM   6829 N N   . ASP B 1 352 ? 100.053 38.900 -1.465  1.00 20.85  ? 349  ASP B N   1 
ATOM   6830 C CA  . ASP B 1 352 ? 100.945 38.438 -0.415  1.00 22.49  ? 349  ASP B CA  1 
ATOM   6831 C C   . ASP B 1 352 ? 100.557 37.074 0.156   1.00 26.05  ? 349  ASP B C   1 
ATOM   6832 O O   . ASP B 1 352 ? 101.114 36.664 1.179   1.00 26.54  ? 349  ASP B O   1 
ATOM   6833 C CB  . ASP B 1 352 ? 101.026 39.505 0.673   1.00 23.84  ? 349  ASP B CB  1 
ATOM   6834 C CG  . ASP B 1 352 ? 101.575 40.812 0.128   1.00 22.18  ? 349  ASP B CG  1 
ATOM   6835 O OD1 . ASP B 1 352 ? 102.655 40.768 -0.494  1.00 20.63  ? 349  ASP B OD1 1 
ATOM   6836 O OD2 . ASP B 1 352 ? 100.909 41.860 0.251   1.00 22.12  ? 349  ASP B OD2 1 
ATOM   6837 N N   . ASN B 1 353 ? 99.639  36.349 -0.486  1.00 24.33  ? 350  ASN B N   1 
ATOM   6838 C CA  . ASN B 1 353 ? 99.483  34.926 -0.180  1.00 29.00  ? 350  ASN B CA  1 
ATOM   6839 C C   . ASN B 1 353 ? 99.295  34.170 -1.494  1.00 29.45  ? 350  ASN B C   1 
ATOM   6840 O O   . ASN B 1 353 ? 99.535  34.705 -2.583  1.00 26.34  ? 350  ASN B O   1 
ATOM   6841 C CB  . ASN B 1 353 ? 98.363  34.658 0.843   1.00 20.34  ? 350  ASN B CB  1 
ATOM   6842 C CG  . ASN B 1 353 ? 96.980  35.026 0.347   1.00 25.81  ? 350  ASN B CG  1 
ATOM   6843 O OD1 . ASN B 1 353 ? 96.704  35.044 -0.852  1.00 27.51  ? 350  ASN B OD1 1 
ATOM   6844 N ND2 . ASN B 1 353 ? 96.086  35.320 1.289   1.00 27.81  ? 350  ASN B ND2 1 
ATOM   6845 N N   . GLU B 1 354 ? 98.894  32.898 -1.376  1.00 33.95  ? 351  GLU B N   1 
ATOM   6846 C CA  . GLU B 1 354 ? 98.791  31.997 -2.518  1.00 30.21  ? 351  GLU B CA  1 
ATOM   6847 C C   . GLU B 1 354 ? 97.488  32.160 -3.276  1.00 23.82  ? 351  GLU B C   1 
ATOM   6848 O O   . GLU B 1 354 ? 97.327  31.540 -4.332  1.00 27.87  ? 351  GLU B O   1 
ATOM   6849 C CB  . GLU B 1 354 ? 98.926  30.539 -2.066  1.00 29.30  ? 351  GLU B CB  1 
ATOM   6850 C CG  . GLU B 1 354 ? 100.306 30.148 -1.619  1.00 35.29  ? 351  GLU B CG  1 
ATOM   6851 C CD  . GLU B 1 354 ? 101.327 30.562 -2.637  1.00 44.77  ? 351  GLU B CD  1 
ATOM   6852 O OE1 . GLU B 1 354 ? 101.416 29.902 -3.699  1.00 53.38  ? 351  GLU B OE1 1 
ATOM   6853 O OE2 . GLU B 1 354 ? 102.014 31.574 -2.393  1.00 45.35  ? 351  GLU B OE2 1 
ATOM   6854 N N   . SER B 1 355 ? 96.555  32.944 -2.752  1.00 23.38  ? 352  SER B N   1 
ATOM   6855 C CA  . SER B 1 355 ? 95.283  33.215 -3.427  1.00 28.45  ? 352  SER B CA  1 
ATOM   6856 C C   . SER B 1 355 ? 94.533  31.927 -3.788  1.00 25.75  ? 352  SER B C   1 
ATOM   6857 O O   . SER B 1 355 ? 93.966  31.802 -4.878  1.00 20.78  ? 352  SER B O   1 
ATOM   6858 C CB  . SER B 1 355 ? 95.510  34.079 -4.671  1.00 26.78  ? 352  SER B CB  1 
ATOM   6859 O OG  . SER B 1 355 ? 95.679  35.438 -4.317  1.00 26.94  ? 352  SER B OG  1 
ATOM   6860 N N   . LEU B 1 356 ? 94.528  30.959 -2.872  1.00 28.12  ? 353  LEU B N   1 
ATOM   6861 C CA  . LEU B 1 356 ? 93.847  29.680 -3.098  1.00 30.01  ? 353  LEU B CA  1 
ATOM   6862 C C   . LEU B 1 356 ? 92.365  29.862 -2.793  1.00 25.34  ? 353  LEU B C   1 
ATOM   6863 O O   . LEU B 1 356 ? 91.905  29.635 -1.674  1.00 33.73  ? 353  LEU B O   1 
ATOM   6864 C CB  . LEU B 1 356 ? 94.464  28.587 -2.239  1.00 28.82  ? 353  LEU B CB  1 
ATOM   6865 C CG  . LEU B 1 356 ? 95.936  28.298 -2.519  1.00 29.44  ? 353  LEU B CG  1 
ATOM   6866 C CD1 . LEU B 1 356 ? 96.549  27.519 -1.360  1.00 30.90  ? 353  LEU B CD1 1 
ATOM   6867 C CD2 . LEU B 1 356 ? 96.113  27.556 -3.825  1.00 28.93  ? 353  LEU B CD2 1 
ATOM   6868 N N   . ILE B 1 357 ? 91.601  30.273 -3.805  1.00 21.27  ? 354  ILE B N   1 
ATOM   6869 C CA  . ILE B 1 357 ? 90.234  30.713 -3.566  1.00 25.25  ? 354  ILE B CA  1 
ATOM   6870 C C   . ILE B 1 357 ? 89.305  29.508 -3.460  1.00 28.63  ? 354  ILE B C   1 
ATOM   6871 O O   . ILE B 1 357 ? 89.601  28.409 -3.931  1.00 25.66  ? 354  ILE B O   1 
ATOM   6872 C CB  . ILE B 1 357 ? 89.755  31.690 -4.661  1.00 24.20  ? 354  ILE B CB  1 
ATOM   6873 C CG1 . ILE B 1 357 ? 89.942  31.063 -6.044  1.00 25.54  ? 354  ILE B CG1 1 
ATOM   6874 C CG2 . ILE B 1 357 ? 90.478  33.031 -4.533  1.00 28.01  ? 354  ILE B CG2 1 
ATOM   6875 C CD1 . ILE B 1 357 ? 89.279  31.823 -7.150  1.00 24.99  ? 354  ILE B CD1 1 
ATOM   6876 N N   . SER B 1 358 ? 88.173  29.730 -2.812  1.00 32.47  ? 355  SER B N   1 
ATOM   6877 C CA  . SER B 1 358 ? 87.113  28.746 -2.711  1.00 31.22  ? 355  SER B CA  1 
ATOM   6878 C C   . SER B 1 358 ? 86.205  28.837 -3.931  1.00 35.43  ? 355  SER B C   1 
ATOM   6879 O O   . SER B 1 358 ? 86.221  29.820 -4.681  1.00 31.68  ? 355  SER B O   1 
ATOM   6880 C CB  . SER B 1 358 ? 86.296  28.988 -1.458  1.00 24.65  ? 355  SER B CB  1 
ATOM   6881 O OG  . SER B 1 358 ? 85.499  30.129 -1.669  1.00 29.57  ? 355  SER B OG  1 
ATOM   6882 N N   . ARG B 1 359 ? 85.375  27.802 -4.099  1.00 35.90  ? 356  ARG B N   1 
ATOM   6883 C CA  . ARG B 1 359 ? 84.429  27.771 -5.208  1.00 30.15  ? 356  ARG B CA  1 
ATOM   6884 C C   . ARG B 1 359 ? 83.487  28.959 -5.164  1.00 27.33  ? 356  ARG B C   1 
ATOM   6885 O O   . ARG B 1 359 ? 83.174  29.547 -6.205  1.00 28.00  ? 356  ARG B O   1 
ATOM   6886 C CB  . ARG B 1 359 ? 83.641  26.459 -5.185  1.00 37.32  ? 356  ARG B CB  1 
ATOM   6887 C CG  . ARG B 1 359 ? 82.587  26.336 -6.274  1.00 35.24  ? 356  ARG B CG  1 
ATOM   6888 C CD  . ARG B 1 359 ? 83.193  25.809 -7.556  1.00 37.81  ? 356  ARG B CD  1 
ATOM   6889 N NE  . ARG B 1 359 ? 82.203  25.734 -8.624  1.00 38.76  ? 356  ARG B NE  1 
ATOM   6890 C CZ  . ARG B 1 359 ? 82.507  25.536 -9.899  1.00 32.64  ? 356  ARG B CZ  1 
ATOM   6891 N NH1 . ARG B 1 359 ? 83.774  25.390 -10.257 1.00 33.27  ? 356  ARG B NH1 1 
ATOM   6892 N NH2 . ARG B 1 359 ? 81.546  25.487 -10.812 1.00 33.42  ? 356  ARG B NH2 1 
ATOM   6893 N N   . ALA B 1 360 ? 83.010  29.319 -3.969  1.00 28.22  ? 357  ALA B N   1 
ATOM   6894 C CA  . ALA B 1 360 ? 82.150  30.497 -3.846  1.00 31.30  ? 357  ALA B CA  1 
ATOM   6895 C C   . ALA B 1 360 ? 82.875  31.754 -4.315  1.00 30.50  ? 357  ALA B C   1 
ATOM   6896 O O   . ALA B 1 360 ? 82.294  32.595 -5.010  1.00 33.01  ? 357  ALA B O   1 
ATOM   6897 C CB  . ALA B 1 360 ? 81.682  30.666 -2.395  1.00 20.92  ? 357  ALA B CB  1 
ATOM   6898 N N   . GLU B 1 361 ? 84.147  31.901 -3.928  1.00 30.81  ? 358  GLU B N   1 
ATOM   6899 C CA  . GLU B 1 361 ? 84.931  33.049 -4.372  1.00 32.89  ? 358  GLU B CA  1 
ATOM   6900 C C   . GLU B 1 361 ? 85.098  33.042 -5.884  1.00 28.10  ? 358  GLU B C   1 
ATOM   6901 O O   . GLU B 1 361 ? 84.911  34.072 -6.539  1.00 26.05  ? 358  GLU B O   1 
ATOM   6902 C CB  . GLU B 1 361 ? 86.285  33.066 -3.650  1.00 26.92  ? 358  GLU B CB  1 
ATOM   6903 C CG  . GLU B 1 361 ? 86.137  33.615 -2.236  1.00 24.73  ? 358  GLU B CG  1 
ATOM   6904 C CD  . GLU B 1 361 ? 87.316  33.324 -1.341  1.00 31.77  ? 358  GLU B CD  1 
ATOM   6905 O OE1 . GLU B 1 361 ? 88.118  32.427 -1.668  1.00 34.40  ? 358  GLU B OE1 1 
ATOM   6906 O OE2 . GLU B 1 361 ? 87.444  34.001 -0.301  1.00 39.80  ? 358  GLU B OE2 1 
ATOM   6907 N N   . PHE B 1 362 ? 85.392  31.877 -6.460  1.00 28.70  ? 359  PHE B N   1 
ATOM   6908 C CA  . PHE B 1 362 ? 85.480  31.775 -7.911  1.00 29.10  ? 359  PHE B CA  1 
ATOM   6909 C C   . PHE B 1 362 ? 84.196  32.247 -8.576  1.00 29.63  ? 359  PHE B C   1 
ATOM   6910 O O   . PHE B 1 362 ? 84.229  33.020 -9.544  1.00 28.68  ? 359  PHE B O   1 
ATOM   6911 C CB  . PHE B 1 362 ? 85.799  30.343 -8.325  1.00 28.04  ? 359  PHE B CB  1 
ATOM   6912 C CG  . PHE B 1 362 ? 85.765  30.126 -9.809  1.00 28.19  ? 359  PHE B CG  1 
ATOM   6913 C CD1 . PHE B 1 362 ? 86.845  30.491 -10.602 1.00 27.27  ? 359  PHE B CD1 1 
ATOM   6914 C CD2 . PHE B 1 362 ? 84.652  29.546 -10.415 1.00 30.82  ? 359  PHE B CD2 1 
ATOM   6915 C CE1 . PHE B 1 362 ? 86.821  30.294 -11.968 1.00 29.30  ? 359  PHE B CE1 1 
ATOM   6916 C CE2 . PHE B 1 362 ? 84.620  29.342 -11.796 1.00 28.65  ? 359  PHE B CE2 1 
ATOM   6917 C CZ  . PHE B 1 362 ? 85.702  29.719 -12.568 1.00 27.73  ? 359  PHE B CZ  1 
ATOM   6918 N N   . LEU B 1 363 ? 83.048  31.807 -8.060  1.00 33.80  ? 360  LEU B N   1 
ATOM   6919 C CA  . LEU B 1 363 ? 81.780  32.154 -8.698  1.00 34.42  ? 360  LEU B CA  1 
ATOM   6920 C C   . LEU B 1 363 ? 81.467  33.644 -8.551  1.00 31.89  ? 360  LEU B C   1 
ATOM   6921 O O   . LEU B 1 363 ? 80.941  34.272 -9.481  1.00 31.02  ? 360  LEU B O   1 
ATOM   6922 C CB  . LEU B 1 363 ? 80.656  31.285 -8.123  1.00 35.18  ? 360  LEU B CB  1 
ATOM   6923 C CG  . LEU B 1 363 ? 80.737  29.791 -8.469  1.00 31.17  ? 360  LEU B CG  1 
ATOM   6924 C CD1 . LEU B 1 363 ? 79.877  28.976 -7.536  1.00 34.14  ? 360  LEU B CD1 1 
ATOM   6925 C CD2 . LEU B 1 363 ? 80.294  29.580 -9.892  1.00 33.70  ? 360  LEU B CD2 1 
ATOM   6926 N N   . ALA B 1 364 ? 81.786  34.230 -7.397  1.00 27.68  ? 361  ALA B N   1 
ATOM   6927 C CA  . ALA B 1 364 ? 81.667  35.678 -7.274  1.00 34.01  ? 361  ALA B CA  1 
ATOM   6928 C C   . ALA B 1 364 ? 82.668  36.385 -8.185  1.00 28.47  ? 361  ALA B C   1 
ATOM   6929 O O   . ALA B 1 364 ? 82.340  37.397 -8.814  1.00 29.57  ? 361  ALA B O   1 
ATOM   6930 C CB  . ALA B 1 364 ? 81.862  36.102 -5.814  1.00 28.16  ? 361  ALA B CB  1 
ATOM   6931 N N   . GLY B 1 365 ? 83.888  35.860 -8.276  1.00 28.52  ? 362  GLY B N   1 
ATOM   6932 C CA  . GLY B 1 365 ? 84.888  36.478 -9.136  1.00 26.11  ? 362  GLY B CA  1 
ATOM   6933 C C   . GLY B 1 365 ? 84.463  36.554 -10.590 1.00 26.71  ? 362  GLY B C   1 
ATOM   6934 O O   . GLY B 1 365 ? 84.750  37.536 -11.276 1.00 26.42  ? 362  GLY B O   1 
ATOM   6935 N N   . VAL B 1 366 ? 83.745  35.533 -11.078 1.00 23.10  ? 363  VAL B N   1 
ATOM   6936 C CA  . VAL B 1 366 ? 83.316  35.557 -12.472 1.00 22.94  ? 363  VAL B CA  1 
ATOM   6937 C C   . VAL B 1 366 ? 82.447  36.781 -12.747 1.00 25.61  ? 363  VAL B C   1 
ATOM   6938 O O   . VAL B 1 366 ? 82.528  37.380 -13.824 1.00 27.84  ? 363  VAL B O   1 
ATOM   6939 C CB  . VAL B 1 366 ? 82.602  34.242 -12.843 1.00 28.81  ? 363  VAL B CB  1 
ATOM   6940 C CG1 . VAL B 1 366 ? 81.950  34.336 -14.232 1.00 19.65  ? 363  VAL B CG1 1 
ATOM   6941 C CG2 . VAL B 1 366 ? 83.591  33.103 -12.810 1.00 22.79  ? 363  VAL B CG2 1 
ATOM   6942 N N   . ARG B 1 367 ? 81.615  37.184 -11.781 1.00 22.57  ? 364  ARG B N   1 
ATOM   6943 C CA  . ARG B 1 367 ? 80.776  38.366 -11.992 1.00 28.75  ? 364  ARG B CA  1 
ATOM   6944 C C   . ARG B 1 367 ? 81.586  39.661 -11.942 1.00 30.25  ? 364  ARG B C   1 
ATOM   6945 O O   . ARG B 1 367 ? 81.198  40.650 -12.572 1.00 28.59  ? 364  ARG B O   1 
ATOM   6946 C CB  . ARG B 1 367 ? 79.645  38.438 -10.959 1.00 30.03  ? 364  ARG B CB  1 
ATOM   6947 C CG  . ARG B 1 367 ? 78.831  37.161 -10.795 1.00 30.14  ? 364  ARG B CG  1 
ATOM   6948 C CD  . ARG B 1 367 ? 78.381  36.565 -12.126 1.00 35.97  ? 364  ARG B CD  1 
ATOM   6949 N NE  . ARG B 1 367 ? 77.340  37.328 -12.824 1.00 44.14  ? 364  ARG B NE  1 
ATOM   6950 C CZ  . ARG B 1 367 ? 76.029  37.114 -12.694 1.00 46.61  ? 364  ARG B CZ  1 
ATOM   6951 N NH1 . ARG B 1 367 ? 75.584  36.168 -11.875 1.00 46.46  ? 364  ARG B NH1 1 
ATOM   6952 N NH2 . ARG B 1 367 ? 75.158  37.849 -13.380 1.00 43.47  ? 364  ARG B NH2 1 
ATOM   6953 N N   . VAL B 1 368 ? 82.682  39.689 -11.178 1.00 27.35  ? 365  VAL B N   1 
ATOM   6954 C CA  . VAL B 1 368 ? 83.557  40.857 -11.190 1.00 32.05  ? 365  VAL B CA  1 
ATOM   6955 C C   . VAL B 1 368 ? 84.403  40.887 -12.462 1.00 28.62  ? 365  VAL B C   1 
ATOM   6956 O O   . VAL B 1 368 ? 84.565  41.943 -13.081 1.00 30.47  ? 365  VAL B O   1 
ATOM   6957 C CB  . VAL B 1 368 ? 84.415  40.871 -9.912  1.00 30.04  ? 365  VAL B CB  1 
ATOM   6958 C CG1 . VAL B 1 368 ? 85.574  41.869 -10.011 1.00 26.10  ? 365  VAL B CG1 1 
ATOM   6959 C CG2 . VAL B 1 368 ? 83.525  41.167 -8.709  1.00 33.43  ? 365  VAL B CG2 1 
ATOM   6960 N N   . GLY B 1 369 ? 84.923  39.727 -12.894 1.00 26.69  ? 366  GLY B N   1 
ATOM   6961 C CA  . GLY B 1 369 ? 85.718  39.652 -14.114 1.00 24.63  ? 366  GLY B CA  1 
ATOM   6962 C C   . GLY B 1 369 ? 84.927  39.730 -15.407 1.00 29.56  ? 366  GLY B C   1 
ATOM   6963 O O   . GLY B 1 369 ? 85.490  40.083 -16.451 1.00 32.81  ? 366  GLY B O   1 
ATOM   6964 N N   . VAL B 1 370 ? 83.643  39.392 -15.380 1.00 26.29  ? 367  VAL B N   1 
ATOM   6965 C CA  . VAL B 1 370 ? 82.800  39.549 -16.560 1.00 28.75  ? 367  VAL B CA  1 
ATOM   6966 C C   . VAL B 1 370 ? 81.593  40.384 -16.158 1.00 32.70  ? 367  VAL B C   1 
ATOM   6967 O O   . VAL B 1 370 ? 80.484  39.849 -16.021 1.00 35.01  ? 367  VAL B O   1 
ATOM   6968 C CB  . VAL B 1 370 ? 82.389  38.193 -17.152 1.00 30.15  ? 367  VAL B CB  1 
ATOM   6969 C CG1 . VAL B 1 370 ? 81.739  38.381 -18.522 1.00 25.94  ? 367  VAL B CG1 1 
ATOM   6970 C CG2 . VAL B 1 370 ? 83.603  37.299 -17.264 1.00 25.16  ? 367  VAL B CG2 1 
ATOM   6971 N N   . PRO B 1 371 ? 81.759  41.690 -15.971 1.00 32.53  ? 368  PRO B N   1 
ATOM   6972 C CA  . PRO B 1 371 ? 80.663  42.510 -15.444 1.00 33.23  ? 368  PRO B CA  1 
ATOM   6973 C C   . PRO B 1 371 ? 79.596  42.743 -16.497 1.00 30.17  ? 368  PRO B C   1 
ATOM   6974 O O   . PRO B 1 371 ? 79.829  42.598 -17.698 1.00 38.04  ? 368  PRO B O   1 
ATOM   6975 C CB  . PRO B 1 371 ? 81.364  43.820 -15.062 1.00 35.48  ? 368  PRO B CB  1 
ATOM   6976 C CG  . PRO B 1 371 ? 82.492  43.919 -16.057 1.00 34.77  ? 368  PRO B CG  1 
ATOM   6977 C CD  . PRO B 1 371 ? 82.950  42.497 -16.312 1.00 31.41  ? 368  PRO B CD  1 
ATOM   6978 N N   . GLN B 1 372 ? 78.404  43.101 -16.029 1.00 36.75  ? 369  GLN B N   1 
ATOM   6979 C CA  . GLN B 1 372 ? 77.308  43.485 -16.937 1.00 47.77  ? 369  GLN B CA  1 
ATOM   6980 C C   . GLN B 1 372 ? 76.883  42.357 -17.872 1.00 45.92  ? 369  GLN B C   1 
ATOM   6981 O O   . GLN B 1 372 ? 76.643  42.593 -19.054 1.00 44.66  ? 369  GLN B O   1 
ATOM   6982 C CB  . GLN B 1 372 ? 77.668  44.689 -17.816 1.00 52.93  ? 369  GLN B CB  1 
ATOM   6983 C CG  . GLN B 1 372 ? 77.892  45.969 -17.128 1.00 61.20  ? 369  GLN B CG  1 
ATOM   6984 C CD  . GLN B 1 372 ? 77.326  47.175 -17.858 1.00 64.10  ? 369  GLN B CD  1 
ATOM   6985 O OE1 . GLN B 1 372 ? 77.476  47.332 -19.069 1.00 62.11  ? 369  GLN B OE1 1 
ATOM   6986 N NE2 . GLN B 1 372 ? 76.666  48.055 -17.097 1.00 61.03  ? 369  GLN B NE2 1 
ATOM   6987 N N   . VAL B 1 373 ? 76.824  41.122 -17.385 1.00 47.30  ? 370  VAL B N   1 
ATOM   6988 C CA  . VAL B 1 373 ? 76.246  40.053 -18.191 1.00 45.43  ? 370  VAL B CA  1 
ATOM   6989 C C   . VAL B 1 373 ? 75.202  39.311 -17.371 1.00 43.30  ? 370  VAL B C   1 
ATOM   6990 O O   . VAL B 1 373 ? 75.262  39.267 -16.137 1.00 41.62  ? 370  VAL B O   1 
ATOM   6991 C CB  . VAL B 1 373 ? 77.292  39.064 -18.764 1.00 41.31  ? 370  VAL B CB  1 
ATOM   6992 C CG1 . VAL B 1 373 ? 78.229  39.779 -19.720 1.00 40.03  ? 370  VAL B CG1 1 
ATOM   6993 C CG2 . VAL B 1 373 ? 78.043  38.323 -17.650 1.00 33.14  ? 370  VAL B CG2 1 
ATOM   6994 N N   . SER B 1 374 ? 74.236  38.729 -18.082 1.00 42.15  ? 371  SER B N   1 
ATOM   6995 C CA  . SER B 1 374 ? 73.136  38.000 -17.471 1.00 40.32  ? 371  SER B CA  1 
ATOM   6996 C C   . SER B 1 374 ? 73.646  36.823 -16.645 1.00 40.55  ? 371  SER B C   1 
ATOM   6997 O O   . SER B 1 374 ? 74.791  36.372 -16.784 1.00 38.84  ? 371  SER B O   1 
ATOM   6998 C CB  . SER B 1 374 ? 72.181  37.490 -18.549 1.00 36.38  ? 371  SER B CB  1 
ATOM   6999 O OG  . SER B 1 374 ? 72.831  36.550 -19.400 1.00 42.39  ? 371  SER B OG  1 
ATOM   7000 N N   . ASP B 1 375 ? 72.760  36.313 -15.785 1.00 37.78  ? 372  ASP B N   1 
ATOM   7001 C CA  . ASP B 1 375 ? 73.097  35.149 -14.976 1.00 37.88  ? 372  ASP B CA  1 
ATOM   7002 C C   . ASP B 1 375 ? 73.335  33.921 -15.848 1.00 40.58  ? 372  ASP B C   1 
ATOM   7003 O O   . ASP B 1 375 ? 74.225  33.109 -15.559 1.00 39.61  ? 372  ASP B O   1 
ATOM   7004 C CB  . ASP B 1 375 ? 71.987  34.882 -13.959 1.00 52.56  ? 372  ASP B CB  1 
ATOM   7005 C CG  . ASP B 1 375 ? 71.844  36.007 -12.932 1.00 56.71  ? 372  ASP B CG  1 
ATOM   7006 O OD1 . ASP B 1 375 ? 72.858  36.671 -12.604 1.00 54.18  ? 372  ASP B OD1 1 
ATOM   7007 O OD2 . ASP B 1 375 ? 70.707  36.228 -12.460 1.00 60.12  ? 372  ASP B OD2 1 
ATOM   7008 N N   . LEU B 1 376 ? 72.553  33.770 -16.925 1.00 33.82  ? 373  LEU B N   1 
ATOM   7009 C CA  . LEU B 1 376 ? 72.767  32.649 -17.831 1.00 33.08  ? 373  LEU B CA  1 
ATOM   7010 C C   . LEU B 1 376 ? 74.140  32.727 -18.492 1.00 36.50  ? 373  LEU B C   1 
ATOM   7011 O O   . LEU B 1 376 ? 74.814  31.702 -18.660 1.00 34.22  ? 373  LEU B O   1 
ATOM   7012 C CB  . LEU B 1 376 ? 71.662  32.608 -18.888 1.00 40.89  ? 373  LEU B CB  1 
ATOM   7013 C CG  . LEU B 1 376 ? 71.811  31.488 -19.922 1.00 40.02  ? 373  LEU B CG  1 
ATOM   7014 C CD1 . LEU B 1 376 ? 71.613  30.135 -19.256 1.00 39.23  ? 373  LEU B CD1 1 
ATOM   7015 C CD2 . LEU B 1 376 ? 70.862  31.674 -21.100 1.00 40.94  ? 373  LEU B CD2 1 
ATOM   7016 N N   . ALA B 1 377 ? 74.575  33.937 -18.872 1.00 37.02  ? 374  ALA B N   1 
ATOM   7017 C CA  . ALA B 1 377 ? 75.909  34.104 -19.449 1.00 30.47  ? 374  ALA B CA  1 
ATOM   7018 C C   . ALA B 1 377 ? 76.995  33.719 -18.447 1.00 24.01  ? 374  ALA B C   1 
ATOM   7019 O O   . ALA B 1 377 ? 77.944  32.999 -18.781 1.00 28.14  ? 374  ALA B O   1 
ATOM   7020 C CB  . ALA B 1 377 ? 76.091  35.543 -19.928 1.00 38.03  ? 374  ALA B CB  1 
ATOM   7021 N N   . ALA B 1 378 ? 76.860  34.174 -17.202 1.00 29.93  ? 375  ALA B N   1 
ATOM   7022 C CA  . ALA B 1 378 ? 77.823  33.801 -16.169 1.00 29.76  ? 375  ALA B CA  1 
ATOM   7023 C C   . ALA B 1 378 ? 77.881  32.290 -15.977 1.00 35.03  ? 375  ALA B C   1 
ATOM   7024 O O   . ALA B 1 378 ? 78.972  31.717 -15.832 1.00 33.13  ? 375  ALA B O   1 
ATOM   7025 C CB  . ALA B 1 378 ? 77.469  34.493 -14.856 1.00 32.14  ? 375  ALA B CB  1 
ATOM   7026 N N   . GLU B 1 379 ? 76.710  31.627 -15.961 1.00 35.59  ? 376  GLU B N   1 
ATOM   7027 C CA  . GLU B 1 379 ? 76.677  30.169 -15.875 1.00 34.83  ? 376  GLU B CA  1 
ATOM   7028 C C   . GLU B 1 379 ? 77.437  29.538 -17.028 1.00 31.49  ? 376  GLU B C   1 
ATOM   7029 O O   . GLU B 1 379 ? 78.183  28.569 -16.837 1.00 36.46  ? 376  GLU B O   1 
ATOM   7030 C CB  . GLU B 1 379 ? 75.229  29.660 -15.871 1.00 39.98  ? 376  GLU B CB  1 
ATOM   7031 C CG  . GLU B 1 379 ? 74.420  29.998 -14.627 1.00 47.21  ? 376  GLU B CG  1 
ATOM   7032 C CD  . GLU B 1 379 ? 74.705  29.070 -13.450 1.00 59.29  ? 376  GLU B CD  1 
ATOM   7033 O OE1 . GLU B 1 379 ? 75.779  28.419 -13.414 1.00 61.21  ? 376  GLU B OE1 1 
ATOM   7034 O OE2 . GLU B 1 379 ? 73.839  28.989 -12.552 1.00 69.01  ? 376  GLU B OE2 1 
ATOM   7035 N N   . ALA B 1 380 ? 77.247  30.061 -18.239 1.00 29.09  ? 377  ALA B N   1 
ATOM   7036 C CA  . ALA B 1 380 ? 78.006  29.558 -19.377 1.00 28.54  ? 377  ALA B CA  1 
ATOM   7037 C C   . ALA B 1 380 ? 79.501  29.764 -19.174 1.00 28.50  ? 377  ALA B C   1 
ATOM   7038 O O   . ALA B 1 380 ? 80.301  28.882 -19.507 1.00 29.98  ? 377  ALA B O   1 
ATOM   7039 C CB  . ALA B 1 380 ? 77.527  30.222 -20.670 1.00 28.43  ? 377  ALA B CB  1 
ATOM   7040 N N   . VAL B 1 381 ? 79.907  30.906 -18.601 1.00 29.80  ? 378  VAL B N   1 
ATOM   7041 C CA  . VAL B 1 381 ? 81.332  31.104 -18.321 1.00 23.17  ? 378  VAL B CA  1 
ATOM   7042 C C   . VAL B 1 381 ? 81.812  30.061 -17.315 1.00 23.65  ? 378  VAL B C   1 
ATOM   7043 O O   . VAL B 1 381 ? 82.830  29.389 -17.527 1.00 24.28  ? 378  VAL B O   1 
ATOM   7044 C CB  . VAL B 1 381 ? 81.615  32.548 -17.836 1.00 22.42  ? 378  VAL B CB  1 
ATOM   7045 C CG1 . VAL B 1 381 ? 83.081  32.687 -17.383 1.00 19.91  ? 378  VAL B CG1 1 
ATOM   7046 C CG2 . VAL B 1 381 ? 81.348  33.557 -18.940 1.00 20.51  ? 378  VAL B CG2 1 
ATOM   7047 N N   . VAL B 1 382 ? 81.068  29.884 -16.219 1.00 26.76  ? 379  VAL B N   1 
ATOM   7048 C CA  . VAL B 1 382 ? 81.449  28.890 -15.208 1.00 27.44  ? 379  VAL B CA  1 
ATOM   7049 C C   . VAL B 1 382 ? 81.553  27.496 -15.822 1.00 34.44  ? 379  VAL B C   1 
ATOM   7050 O O   . VAL B 1 382 ? 82.461  26.716 -15.494 1.00 33.49  ? 379  VAL B O   1 
ATOM   7051 C CB  . VAL B 1 382 ? 80.445  28.910 -14.046 1.00 33.97  ? 379  VAL B CB  1 
ATOM   7052 C CG1 . VAL B 1 382 ? 80.747  27.778 -13.089 1.00 36.31  ? 379  VAL B CG1 1 
ATOM   7053 C CG2 . VAL B 1 382 ? 80.478  30.273 -13.338 1.00 31.22  ? 379  VAL B CG2 1 
ATOM   7054 N N   . LEU B 1 383 ? 80.620  27.157 -16.721 1.00 33.47  ? 380  LEU B N   1 
ATOM   7055 C CA  . LEU B 1 383 ? 80.650  25.845 -17.361 1.00 34.96  ? 380  LEU B CA  1 
ATOM   7056 C C   . LEU B 1 383 ? 81.948  25.635 -18.116 1.00 35.21  ? 380  LEU B C   1 
ATOM   7057 O O   . LEU B 1 383 ? 82.610  24.599 -17.964 1.00 35.35  ? 380  LEU B O   1 
ATOM   7058 C CB  . LEU B 1 383 ? 79.475  25.681 -18.329 1.00 36.62  ? 380  LEU B CB  1 
ATOM   7059 C CG  . LEU B 1 383 ? 79.686  24.638 -19.458 1.00 43.39  ? 380  LEU B CG  1 
ATOM   7060 C CD1 . LEU B 1 383 ? 79.536  23.144 -18.987 1.00 38.67  ? 380  LEU B CD1 1 
ATOM   7061 C CD2 . LEU B 1 383 ? 78.873  24.957 -20.717 1.00 41.19  ? 380  LEU B CD2 1 
ATOM   7062 N N   A HIS B 1 384 ? 82.314  26.597 -18.970 0.51 30.52  ? 381  HIS B N   1 
ATOM   7063 N N   B HIS B 1 384 ? 82.316  26.606 -18.953 0.49 30.49  ? 381  HIS B N   1 
ATOM   7064 C CA  A HIS B 1 384 ? 83.510  26.415 -19.789 0.51 30.39  ? 381  HIS B CA  1 
ATOM   7065 C CA  B HIS B 1 384 ? 83.494  26.436 -19.791 0.49 30.32  ? 381  HIS B CA  1 
ATOM   7066 C C   A HIS B 1 384 ? 84.778  26.391 -18.944 0.51 30.72  ? 381  HIS B C   1 
ATOM   7067 C C   B HIS B 1 384 ? 84.783  26.442 -18.976 0.49 30.72  ? 381  HIS B C   1 
ATOM   7068 O O   A HIS B 1 384 ? 85.753  25.721 -19.312 0.51 31.22  ? 381  HIS B O   1 
ATOM   7069 O O   B HIS B 1 384 ? 85.778  25.834 -19.394 0.49 31.24  ? 381  HIS B O   1 
ATOM   7070 C CB  A HIS B 1 384 ? 83.610  27.518 -20.856 0.51 30.62  ? 381  HIS B CB  1 
ATOM   7071 C CB  B HIS B 1 384 ? 83.532  27.527 -20.869 0.49 30.62  ? 381  HIS B CB  1 
ATOM   7072 C CG  A HIS B 1 384 ? 84.811  27.399 -21.749 0.51 29.24  ? 381  HIS B CG  1 
ATOM   7073 C CG  B HIS B 1 384 ? 83.221  27.025 -22.243 0.49 32.19  ? 381  HIS B CG  1 
ATOM   7074 N ND1 A HIS B 1 384 ? 86.094  27.674 -21.318 0.51 32.41  ? 381  HIS B ND1 1 
ATOM   7075 N ND1 B HIS B 1 384 ? 81.978  26.539 -22.597 0.49 32.22  ? 381  HIS B ND1 1 
ATOM   7076 C CD2 A HIS B 1 384 ? 84.923  27.038 -23.049 0.51 28.50  ? 381  HIS B CD2 1 
ATOM   7077 C CD2 B HIS B 1 384 ? 84.000  26.909 -23.345 0.49 30.25  ? 381  HIS B CD2 1 
ATOM   7078 C CE1 A HIS B 1 384 ? 86.943  27.480 -22.311 0.51 28.13  ? 381  HIS B CE1 1 
ATOM   7079 C CE1 B HIS B 1 384 ? 82.005  26.156 -23.861 0.49 30.81  ? 381  HIS B CE1 1 
ATOM   7080 N NE2 A HIS B 1 384 ? 86.257  27.096 -23.374 0.51 32.82  ? 381  HIS B NE2 1 
ATOM   7081 N NE2 B HIS B 1 384 ? 83.218  26.372 -24.339 0.49 31.92  ? 381  HIS B NE2 1 
ATOM   7082 N N   . TYR B 1 385 ? 84.790  27.096 -17.812 1.00 28.39  ? 382  TYR B N   1 
ATOM   7083 C CA  . TYR B 1 385 ? 86.027  27.293 -17.059 1.00 29.48  ? 382  TYR B CA  1 
ATOM   7084 C C   . TYR B 1 385 ? 86.165  26.416 -15.825 1.00 35.16  ? 382  TYR B C   1 
ATOM   7085 O O   . TYR B 1 385 ? 87.235  26.420 -15.203 1.00 38.01  ? 382  TYR B O   1 
ATOM   7086 C CB  . TYR B 1 385 ? 86.194  28.785 -16.694 1.00 25.30  ? 382  TYR B CB  1 
ATOM   7087 C CG  . TYR B 1 385 ? 86.667  29.542 -17.911 1.00 24.76  ? 382  TYR B CG  1 
ATOM   7088 C CD1 . TYR B 1 385 ? 88.018  29.582 -18.242 1.00 28.83  ? 382  TYR B CD1 1 
ATOM   7089 C CD2 . TYR B 1 385 ? 85.763  30.131 -18.783 1.00 21.58  ? 382  TYR B CD2 1 
ATOM   7090 C CE1 . TYR B 1 385 ? 88.468  30.234 -19.398 1.00 22.42  ? 382  TYR B CE1 1 
ATOM   7091 C CE2 . TYR B 1 385 ? 86.198  30.778 -19.936 1.00 27.93  ? 382  TYR B CE2 1 
ATOM   7092 C CZ  . TYR B 1 385 ? 87.556  30.830 -20.230 1.00 24.67  ? 382  TYR B CZ  1 
ATOM   7093 O OH  . TYR B 1 385 ? 87.994  31.466 -21.370 1.00 27.37  ? 382  TYR B OH  1 
ATOM   7094 N N   . THR B 1 386 ? 85.150  25.635 -15.471 1.00 33.25  ? 383  THR B N   1 
ATOM   7095 C CA  . THR B 1 386 ? 85.298  24.674 -14.388 1.00 30.55  ? 383  THR B CA  1 
ATOM   7096 C C   . THR B 1 386 ? 85.904  23.390 -14.936 1.00 33.12  ? 383  THR B C   1 
ATOM   7097 O O   . THR B 1 386 ? 85.499  22.921 -16.000 1.00 33.44  ? 383  THR B O   1 
ATOM   7098 C CB  . THR B 1 386 ? 83.953  24.378 -13.731 1.00 28.89  ? 383  THR B CB  1 
ATOM   7099 O OG1 . THR B 1 386 ? 83.412  25.575 -13.150 1.00 31.46  ? 383  THR B OG1 1 
ATOM   7100 C CG2 . THR B 1 386 ? 84.117  23.284 -12.657 1.00 32.16  ? 383  THR B CG2 1 
ATOM   7101 N N   . ASP B 1 387 ? 86.896  22.840 -14.231 1.00 33.11  ? 384  ASP B N   1 
ATOM   7102 C CA  . ASP B 1 387 ? 87.291  21.450 -14.447 1.00 34.01  ? 384  ASP B CA  1 
ATOM   7103 C C   . ASP B 1 387 ? 86.339  20.587 -13.631 1.00 35.69  ? 384  ASP B C   1 
ATOM   7104 O O   . ASP B 1 387 ? 86.383  20.595 -12.396 1.00 31.63  ? 384  ASP B O   1 
ATOM   7105 C CB  . ASP B 1 387 ? 88.742  21.212 -14.044 1.00 39.79  ? 384  ASP B CB  1 
ATOM   7106 C CG  . ASP B 1 387 ? 89.182  19.737 -14.203 1.00 44.59  ? 384  ASP B CG  1 
ATOM   7107 O OD1 . ASP B 1 387 ? 88.324  18.828 -14.310 1.00 46.91  ? 384  ASP B OD1 1 
ATOM   7108 O OD2 . ASP B 1 387 ? 90.404  19.481 -14.210 1.00 44.46  ? 384  ASP B OD2 1 
ATOM   7109 N N   . TRP B 1 388 ? 85.484  19.831 -14.311 1.00 39.93  ? 385  TRP B N   1 
ATOM   7110 C CA  . TRP B 1 388 ? 84.410  19.131 -13.612 1.00 38.88  ? 385  TRP B CA  1 
ATOM   7111 C C   . TRP B 1 388 ? 84.880  17.881 -12.885 1.00 32.73  ? 385  TRP B C   1 
ATOM   7112 O O   . TRP B 1 388 ? 84.125  17.330 -12.080 1.00 39.23  ? 385  TRP B O   1 
ATOM   7113 C CB  . TRP B 1 388 ? 83.294  18.828 -14.603 1.00 34.38  ? 385  TRP B CB  1 
ATOM   7114 C CG  . TRP B 1 388 ? 82.642  20.095 -14.946 1.00 30.63  ? 385  TRP B CG  1 
ATOM   7115 C CD1 . TRP B 1 388 ? 82.799  20.828 -16.088 1.00 33.48  ? 385  TRP B CD1 1 
ATOM   7116 C CD2 . TRP B 1 388 ? 81.784  20.851 -14.093 1.00 29.37  ? 385  TRP B CD2 1 
ATOM   7117 N NE1 . TRP B 1 388 ? 82.044  21.982 -16.015 1.00 29.33  ? 385  TRP B NE1 1 
ATOM   7118 C CE2 . TRP B 1 388 ? 81.425  22.021 -14.789 1.00 31.47  ? 385  TRP B CE2 1 
ATOM   7119 C CE3 . TRP B 1 388 ? 81.286  20.652 -12.804 1.00 31.68  ? 385  TRP B CE3 1 
ATOM   7120 C CZ2 . TRP B 1 388 ? 80.581  22.979 -14.241 1.00 32.08  ? 385  TRP B CZ2 1 
ATOM   7121 C CZ3 . TRP B 1 388 ? 80.444  21.600 -12.264 1.00 25.72  ? 385  TRP B CZ3 1 
ATOM   7122 C CH2 . TRP B 1 388 ? 80.098  22.747 -12.977 1.00 32.65  ? 385  TRP B CH2 1 
ATOM   7123 N N   . LEU B 1 389 ? 86.119  17.464 -13.108 1.00 32.71  ? 386  LEU B N   1 
ATOM   7124 C CA  . LEU B 1 389 ? 86.758  16.452 -12.285 1.00 34.84  ? 386  LEU B CA  1 
ATOM   7125 C C   . LEU B 1 389 ? 87.359  17.023 -11.003 1.00 40.03  ? 386  LEU B C   1 
ATOM   7126 O O   . LEU B 1 389 ? 87.562  16.273 -10.043 1.00 42.69  ? 386  LEU B O   1 
ATOM   7127 C CB  . LEU B 1 389 ? 87.847  15.770 -13.108 1.00 38.00  ? 386  LEU B CB  1 
ATOM   7128 C CG  . LEU B 1 389 ? 88.249  14.333 -12.811 1.00 44.84  ? 386  LEU B CG  1 
ATOM   7129 C CD1 . LEU B 1 389 ? 87.026  13.474 -12.530 1.00 41.63  ? 386  LEU B CD1 1 
ATOM   7130 C CD2 . LEU B 1 389 ? 89.000  13.814 -14.027 1.00 45.04  ? 386  LEU B CD2 1 
ATOM   7131 N N   . HIS B 1 390 ? 87.683  18.321 -10.971 1.00 38.70  ? 387  HIS B N   1 
ATOM   7132 C CA  . HIS B 1 390 ? 88.245  18.964 -9.777  1.00 39.60  ? 387  HIS B CA  1 
ATOM   7133 C C   . HIS B 1 390 ? 87.570  20.312 -9.575  1.00 37.25  ? 387  HIS B C   1 
ATOM   7134 O O   . HIS B 1 390 ? 88.222  21.357 -9.581  1.00 34.80  ? 387  HIS B O   1 
ATOM   7135 C CB  . HIS B 1 390 ? 89.760  19.131 -9.903  1.00 37.19  ? 387  HIS B CB  1 
ATOM   7136 C CG  . HIS B 1 390 ? 90.467  17.895 -10.353 1.00 37.87  ? 387  HIS B CG  1 
ATOM   7137 N ND1 . HIS B 1 390 ? 90.753  16.848 -9.502  1.00 41.84  ? 387  HIS B ND1 1 
ATOM   7138 C CD2 . HIS B 1 390 ? 90.929  17.528 -11.572 1.00 37.50  ? 387  HIS B CD2 1 
ATOM   7139 C CE1 . HIS B 1 390 ? 91.367  15.892 -10.176 1.00 38.11  ? 387  HIS B CE1 1 
ATOM   7140 N NE2 . HIS B 1 390 ? 91.492  16.282 -11.433 1.00 46.97  ? 387  HIS B NE2 1 
ATOM   7141 N N   . PRO B 1 391 ? 86.247  20.324 -9.390  1.00 41.99  ? 388  PRO B N   1 
ATOM   7142 C CA  . PRO B 1 391 ? 85.508  21.593 -9.469  1.00 32.60  ? 388  PRO B CA  1 
ATOM   7143 C C   . PRO B 1 391 ? 85.762  22.533 -8.310  1.00 36.18  ? 388  PRO B C   1 
ATOM   7144 O O   . PRO B 1 391 ? 85.332  23.692 -8.371  1.00 36.19  ? 388  PRO B O   1 
ATOM   7145 C CB  . PRO B 1 391 ? 84.043  21.140 -9.496  1.00 37.44  ? 388  PRO B CB  1 
ATOM   7146 C CG  . PRO B 1 391 ? 84.053  19.832 -8.762  1.00 37.60  ? 388  PRO B CG  1 
ATOM   7147 C CD  . PRO B 1 391 ? 85.362  19.179 -9.109  1.00 35.04  ? 388  PRO B CD  1 
ATOM   7148 N N   . GLU B 1 392 ? 86.423  22.082 -7.251  1.00 36.64  ? 389  GLU B N   1 
ATOM   7149 C CA  . GLU B 1 392 ? 86.614  22.926 -6.080  1.00 40.46  ? 389  GLU B CA  1 
ATOM   7150 C C   . GLU B 1 392 ? 88.077  23.035 -5.676  1.00 31.56  ? 389  GLU B C   1 
ATOM   7151 O O   . GLU B 1 392 ? 88.363  23.585 -4.608  1.00 38.92  ? 389  GLU B O   1 
ATOM   7152 C CB  . GLU B 1 392 ? 85.790  22.406 -4.893  1.00 39.99  ? 389  GLU B CB  1 
ATOM   7153 C CG  . GLU B 1 392 ? 84.359  22.093 -5.245  1.00 42.45  ? 389  GLU B CG  1 
ATOM   7154 C CD  . GLU B 1 392 ? 83.389  22.651 -4.244  1.00 47.90  ? 389  GLU B CD  1 
ATOM   7155 O OE1 . GLU B 1 392 ? 82.191  22.777 -4.583  1.00 56.48  ? 389  GLU B OE1 1 
ATOM   7156 O OE2 . GLU B 1 392 ? 83.827  22.980 -3.123  1.00 56.29  ? 389  GLU B OE2 1 
ATOM   7157 N N   . ASP B 1 393 ? 88.994  22.509 -6.480  1.00 29.56  ? 390  ASP B N   1 
ATOM   7158 C CA  . ASP B 1 393 ? 90.421  22.596 -6.202  1.00 34.76  ? 390  ASP B CA  1 
ATOM   7159 C C   . ASP B 1 393 ? 90.872  24.047 -6.301  1.00 32.30  ? 390  ASP B C   1 
ATOM   7160 O O   . ASP B 1 393 ? 90.819  24.623 -7.398  1.00 27.49  ? 390  ASP B O   1 
ATOM   7161 C CB  . ASP B 1 393 ? 91.212  21.738 -7.175  1.00 33.64  ? 390  ASP B CB  1 
ATOM   7162 C CG  . ASP B 1 393 ? 92.694  21.838 -6.941  1.00 41.12  ? 390  ASP B CG  1 
ATOM   7163 O OD1 . ASP B 1 393 ? 93.087  21.995 -5.767  1.00 45.56  ? 390  ASP B OD1 1 
ATOM   7164 O OD2 . ASP B 1 393 ? 93.467  21.774 -7.920  1.00 44.85  ? 390  ASP B OD2 1 
ATOM   7165 N N   . PRO B 1 394 ? 91.315  24.668 -5.202  1.00 35.74  ? 391  PRO B N   1 
ATOM   7166 C CA  . PRO B 1 394 ? 91.565  26.125 -5.220  1.00 33.59  ? 391  PRO B CA  1 
ATOM   7167 C C   . PRO B 1 394 ? 92.595  26.575 -6.248  1.00 25.48  ? 391  PRO B C   1 
ATOM   7168 O O   . PRO B 1 394 ? 92.368  27.583 -6.920  1.00 26.70  ? 391  PRO B O   1 
ATOM   7169 C CB  . PRO B 1 394 ? 92.019  26.411 -3.778  1.00 31.89  ? 391  PRO B CB  1 
ATOM   7170 C CG  . PRO B 1 394 ? 91.373  25.284 -2.958  1.00 34.90  ? 391  PRO B CG  1 
ATOM   7171 C CD  . PRO B 1 394 ? 91.457  24.083 -3.855  1.00 31.27  ? 391  PRO B CD  1 
ATOM   7172 N N   . ALA B 1 395 ? 93.700  25.844 -6.412  1.00 27.17  ? 392  ALA B N   1 
ATOM   7173 C CA  . ALA B 1 395 ? 94.706  26.239 -7.389  1.00 30.70  ? 392  ALA B CA  1 
ATOM   7174 C C   . ALA B 1 395 ? 94.139  26.231 -8.804  1.00 35.87  ? 392  ALA B C   1 
ATOM   7175 O O   . ALA B 1 395 ? 94.480  27.095 -9.624  1.00 30.33  ? 392  ALA B O   1 
ATOM   7176 C CB  . ALA B 1 395 ? 95.929  25.320 -7.294  1.00 28.32  ? 392  ALA B CB  1 
ATOM   7177 N N   . ARG B 1 396 ? 93.280  25.257 -9.121  1.00 34.39  ? 393  ARG B N   1 
ATOM   7178 C CA  . ARG B 1 396 ? 92.686  25.250 -10.450 1.00 32.66  ? 393  ARG B CA  1 
ATOM   7179 C C   . ARG B 1 396 ? 91.685  26.381 -10.595 1.00 28.62  ? 393  ARG B C   1 
ATOM   7180 O O   . ARG B 1 396 ? 91.564  26.961 -11.676 1.00 31.56  ? 393  ARG B O   1 
ATOM   7181 C CB  . ARG B 1 396 ? 92.023  23.903 -10.750 1.00 32.93  ? 393  ARG B CB  1 
ATOM   7182 C CG  . ARG B 1 396 ? 92.994  22.793 -11.168 1.00 39.30  ? 393  ARG B CG  1 
ATOM   7183 C CD  . ARG B 1 396 ? 92.258  21.474 -11.436 1.00 41.72  ? 393  ARG B CD  1 
ATOM   7184 N NE  . ARG B 1 396 ? 93.152  20.405 -11.877 1.00 37.33  ? 393  ARG B NE  1 
ATOM   7185 C CZ  . ARG B 1 396 ? 93.634  19.462 -11.070 1.00 43.09  ? 393  ARG B CZ  1 
ATOM   7186 N NH1 . ARG B 1 396 ? 93.305  19.462 -9.787  1.00 39.76  ? 393  ARG B NH1 1 
ATOM   7187 N NH2 . ARG B 1 396 ? 94.439  18.517 -11.539 1.00 37.58  ? 393  ARG B NH2 1 
ATOM   7188 N N   . LEU B 1 397 ? 90.968  26.712 -9.523  1.00 29.45  ? 394  LEU B N   1 
ATOM   7189 C CA  . LEU B 1 397 ? 90.015  27.812 -9.596  1.00 25.35  ? 394  LEU B CA  1 
ATOM   7190 C C   . LEU B 1 397 ? 90.733  29.145 -9.781  1.00 27.68  ? 394  LEU B C   1 
ATOM   7191 O O   . LEU B 1 397 ? 90.268  30.015 -10.535 1.00 22.22  ? 394  LEU B O   1 
ATOM   7192 C CB  . LEU B 1 397 ? 89.153  27.829 -8.338  1.00 26.99  ? 394  LEU B CB  1 
ATOM   7193 C CG  . LEU B 1 397 ? 88.233  26.621 -8.142  1.00 32.09  ? 394  LEU B CG  1 
ATOM   7194 C CD1 . LEU B 1 397 ? 87.465  26.739 -6.832  1.00 28.11  ? 394  LEU B CD1 1 
ATOM   7195 C CD2 . LEU B 1 397 ? 87.275  26.510 -9.303  1.00 21.47  ? 394  LEU B CD2 1 
ATOM   7196 N N   . ARG B 1 398 ? 91.877  29.311 -9.106  1.00 28.43  ? 395  ARG B N   1 
ATOM   7197 C CA  . ARG B 1 398 ? 92.678  30.521 -9.257  1.00 25.97  ? 395  ARG B CA  1 
ATOM   7198 C C   . ARG B 1 398 ? 93.161  30.666 -10.694 1.00 28.74  ? 395  ARG B C   1 
ATOM   7199 O O   . ARG B 1 398 ? 92.966  31.710 -11.324 1.00 27.37  ? 395  ARG B O   1 
ATOM   7200 C CB  . ARG B 1 398 ? 93.852  30.482 -8.272  1.00 26.59  ? 395  ARG B CB  1 
ATOM   7201 C CG  . ARG B 1 398 ? 94.825  31.666 -8.325  1.00 24.97  ? 395  ARG B CG  1 
ATOM   7202 C CD  . ARG B 1 398 ? 96.102  31.336 -7.566  1.00 20.95  ? 395  ARG B CD  1 
ATOM   7203 N NE  . ARG B 1 398 ? 96.844  30.221 -8.178  1.00 28.05  ? 395  ARG B NE  1 
ATOM   7204 C CZ  . ARG B 1 398 ? 97.699  29.439 -7.513  1.00 26.15  ? 395  ARG B CZ  1 
ATOM   7205 N NH1 . ARG B 1 398 ? 97.907  29.632 -6.218  1.00 24.45  ? 395  ARG B NH1 1 
ATOM   7206 N NH2 . ARG B 1 398 ? 98.343  28.458 -8.128  1.00 23.05  ? 395  ARG B NH2 1 
ATOM   7207 N N   . GLU B 1 399 ? 93.771  29.608 -11.246 1.00 28.70  ? 396  GLU B N   1 
ATOM   7208 C CA  . GLU B 1 399 ? 94.196  29.649 -12.644 1.00 26.37  ? 396  GLU B CA  1 
ATOM   7209 C C   . GLU B 1 399 ? 93.015  29.860 -13.589 1.00 27.69  ? 396  GLU B C   1 
ATOM   7210 O O   . GLU B 1 399 ? 93.148  30.532 -14.620 1.00 24.54  ? 396  GLU B O   1 
ATOM   7211 C CB  . GLU B 1 399 ? 94.957  28.366 -12.996 1.00 26.88  ? 396  GLU B CB  1 
ATOM   7212 C CG  . GLU B 1 399 ? 96.486  28.437 -12.798 1.00 37.80  ? 396  GLU B CG  1 
ATOM   7213 C CD  . GLU B 1 399 ? 96.947  28.796 -11.383 1.00 43.28  ? 396  GLU B CD  1 
ATOM   7214 O OE1 . GLU B 1 399 ? 97.275  27.852 -10.624 1.00 41.00  ? 396  GLU B OE1 1 
ATOM   7215 O OE2 . GLU B 1 399 ? 97.006  30.014 -11.035 1.00 40.22  ? 396  GLU B OE2 1 
ATOM   7216 N N   . ALA B 1 400 ? 91.846  29.316 -13.245 1.00 29.37  ? 397  ALA B N   1 
ATOM   7217 C CA  . ALA B 1 400 ? 90.684  29.433 -14.118 1.00 27.84  ? 397  ALA B CA  1 
ATOM   7218 C C   . ALA B 1 400 ? 90.152  30.861 -14.156 1.00 25.54  ? 397  ALA B C   1 
ATOM   7219 O O   . ALA B 1 400 ? 89.811  31.373 -15.232 1.00 27.41  ? 397  ALA B O   1 
ATOM   7220 C CB  . ALA B 1 400 ? 89.585  28.460 -13.667 1.00 26.99  ? 397  ALA B CB  1 
ATOM   7221 N N   . LEU B 1 401 ? 90.046  31.522 -13.000 1.00 23.95  ? 398  LEU B N   1 
ATOM   7222 C CA  . LEU B 1 401 ? 89.587  32.909 -13.044 1.00 29.15  ? 398  LEU B CA  1 
ATOM   7223 C C   . LEU B 1 401 ? 90.604  33.792 -13.768 1.00 19.41  ? 398  LEU B C   1 
ATOM   7224 O O   . LEU B 1 401 ? 90.229  34.686 -14.532 1.00 22.40  ? 398  LEU B O   1 
ATOM   7225 C CB  . LEU B 1 401 ? 89.304  33.433 -11.637 1.00 24.19  ? 398  LEU B CB  1 
ATOM   7226 C CG  . LEU B 1 401 ? 88.588  34.789 -11.618 1.00 23.81  ? 398  LEU B CG  1 
ATOM   7227 C CD1 . LEU B 1 401 ? 87.230  34.723 -12.345 1.00 25.40  ? 398  LEU B CD1 1 
ATOM   7228 C CD2 . LEU B 1 401 ? 88.420  35.304 -10.190 1.00 22.27  ? 398  LEU B CD2 1 
ATOM   7229 N N   . SER B 1 402 ? 91.891  33.521 -13.583 1.00 20.14  ? 399  SER B N   1 
ATOM   7230 C CA  . SER B 1 402 ? 92.896  34.213 -14.378 1.00 23.86  ? 399  SER B CA  1 
ATOM   7231 C C   . SER B 1 402 ? 92.642  34.025 -15.871 1.00 26.51  ? 399  SER B C   1 
ATOM   7232 O O   . SER B 1 402 ? 92.782  34.976 -16.649 1.00 24.85  ? 399  SER B O   1 
ATOM   7233 C CB  . SER B 1 402 ? 94.289  33.722 -13.991 1.00 22.23  ? 399  SER B CB  1 
ATOM   7234 O OG  . SER B 1 402 ? 95.258  34.286 -14.850 1.00 26.83  ? 399  SER B OG  1 
ATOM   7235 N N   . ASP B 1 403 ? 92.251  32.810 -16.292 1.00 21.68  ? 400  ASP B N   1 
ATOM   7236 C CA  . ASP B 1 403 ? 91.987  32.576 -17.714 1.00 21.05  ? 400  ASP B CA  1 
ATOM   7237 C C   . ASP B 1 403 ? 90.732  33.305 -18.156 1.00 22.03  ? 400  ASP B C   1 
ATOM   7238 O O   . ASP B 1 403 ? 90.675  33.823 -19.279 1.00 21.29  ? 400  ASP B O   1 
ATOM   7239 C CB  . ASP B 1 403 ? 91.854  31.077 -18.029 1.00 28.05  ? 400  ASP B CB  1 
ATOM   7240 C CG  . ASP B 1 403 ? 93.183  30.316 -17.928 1.00 33.04  ? 400  ASP B CG  1 
ATOM   7241 O OD1 . ASP B 1 403 ? 94.257  30.896 -18.214 1.00 35.25  ? 400  ASP B OD1 1 
ATOM   7242 O OD2 . ASP B 1 403 ? 93.148  29.118 -17.561 1.00 35.38  ? 400  ASP B OD2 1 
ATOM   7243 N N   . VAL B 1 404 ? 89.712  33.359 -17.291 1.00 20.59  ? 401  VAL B N   1 
ATOM   7244 C CA  . VAL B 1 404 ? 88.486  34.082 -17.644 1.00 21.13  ? 401  VAL B CA  1 
ATOM   7245 C C   . VAL B 1 404 ? 88.808  35.534 -17.977 1.00 22.65  ? 401  VAL B C   1 
ATOM   7246 O O   . VAL B 1 404 ? 88.378  36.064 -19.010 1.00 20.71  ? 401  VAL B O   1 
ATOM   7247 C CB  . VAL B 1 404 ? 87.447  34.003 -16.509 1.00 20.73  ? 401  VAL B CB  1 
ATOM   7248 C CG1 . VAL B 1 404 ? 86.292  34.946 -16.805 1.00 15.16  ? 401  VAL B CG1 1 
ATOM   7249 C CG2 . VAL B 1 404 ? 86.931  32.572 -16.317 1.00 22.14  ? 401  VAL B CG2 1 
ATOM   7250 N N   . VAL B 1 405 ? 89.549  36.206 -17.086 1.00 20.40  ? 402  VAL B N   1 
ATOM   7251 C CA  . VAL B 1 405 ? 89.802  37.633 -17.262 1.00 23.43  ? 402  VAL B CA  1 
ATOM   7252 C C   . VAL B 1 405 ? 90.717  37.861 -18.459 1.00 16.99  ? 402  VAL B C   1 
ATOM   7253 O O   . VAL B 1 405 ? 90.447  38.717 -19.309 1.00 19.34  ? 402  VAL B O   1 
ATOM   7254 C CB  . VAL B 1 405 ? 90.373  38.236 -15.957 1.00 24.05  ? 402  VAL B CB  1 
ATOM   7255 C CG1 . VAL B 1 405 ? 90.980  39.647 -16.204 1.00 20.36  ? 402  VAL B CG1 1 
ATOM   7256 C CG2 . VAL B 1 405 ? 89.262  38.270 -14.857 1.00 19.22  ? 402  VAL B CG2 1 
ATOM   7257 N N   . GLY B 1 406 ? 91.754  37.038 -18.589 1.00 17.39  ? 403  GLY B N   1 
ATOM   7258 C CA  . GLY B 1 406 ? 92.699  37.215 -19.681 1.00 19.80  ? 403  GLY B CA  1 
ATOM   7259 C C   . GLY B 1 406 ? 92.106  36.908 -21.044 1.00 26.10  ? 403  GLY B C   1 
ATOM   7260 O O   . GLY B 1 406 ? 92.333  37.650 -22.013 1.00 22.86  ? 403  GLY B O   1 
ATOM   7261 N N   . ASP B 1 407 ? 91.344  35.808 -21.146 1.00 24.59  ? 404  ASP B N   1 
ATOM   7262 C CA  . ASP B 1 407 ? 90.753  35.434 -22.434 1.00 22.33  ? 404  ASP B CA  1 
ATOM   7263 C C   . ASP B 1 407 ? 89.713  36.452 -22.860 1.00 20.75  ? 404  ASP B C   1 
ATOM   7264 O O   . ASP B 1 407 ? 89.692  36.889 -24.012 1.00 24.23  ? 404  ASP B O   1 
ATOM   7265 C CB  . ASP B 1 407 ? 90.121  34.040 -22.357 1.00 21.95  ? 404  ASP B CB  1 
ATOM   7266 C CG  . ASP B 1 407 ? 91.132  32.956 -22.072 1.00 29.18  ? 404  ASP B CG  1 
ATOM   7267 O OD1 . ASP B 1 407 ? 92.344  33.183 -22.292 1.00 28.49  ? 404  ASP B OD1 1 
ATOM   7268 O OD2 . ASP B 1 407 ? 90.717  31.868 -21.628 1.00 31.61  ? 404  ASP B OD2 1 
ATOM   7269 N N   . HIS B 1 408 ? 88.839  36.836 -21.928 1.00 20.53  ? 405  HIS B N   1 
ATOM   7270 C CA  . HIS B 1 408 ? 87.782  37.797 -22.222 1.00 21.84  ? 405  HIS B CA  1 
ATOM   7271 C C   . HIS B 1 408 ? 88.361  39.156 -22.628 1.00 25.61  ? 405  HIS B C   1 
ATOM   7272 O O   . HIS B 1 408 ? 87.873  39.800 -23.572 1.00 22.34  ? 405  HIS B O   1 
ATOM   7273 C CB  . HIS B 1 408 ? 86.878  37.901 -20.986 1.00 23.90  ? 405  HIS B CB  1 
ATOM   7274 C CG  . HIS B 1 408 ? 85.859  38.997 -21.033 1.00 22.41  ? 405  HIS B CG  1 
ATOM   7275 N ND1 . HIS B 1 408 ? 84.944  39.135 -22.056 1.00 25.36  ? 405  HIS B ND1 1 
ATOM   7276 C CD2 . HIS B 1 408 ? 85.595  39.995 -20.157 1.00 23.84  ? 405  HIS B CD2 1 
ATOM   7277 C CE1 . HIS B 1 408 ? 84.161  40.172 -21.810 1.00 20.07  ? 405  HIS B CE1 1 
ATOM   7278 N NE2 . HIS B 1 408 ? 84.530  40.707 -20.660 1.00 26.75  ? 405  HIS B NE2 1 
ATOM   7279 N N   . ASN B 1 409 ? 89.422  39.600 -21.952 1.00 26.33  ? 406  ASN B N   1 
ATOM   7280 C CA  . ASN B 1 409 ? 89.892  40.966 -22.164 1.00 25.74  ? 406  ASN B CA  1 
ATOM   7281 C C   . ASN B 1 409 ? 91.021  41.085 -23.175 1.00 18.79  ? 406  ASN B C   1 
ATOM   7282 O O   . ASN B 1 409 ? 91.104  42.113 -23.859 1.00 21.02  ? 406  ASN B O   1 
ATOM   7283 C CB  . ASN B 1 409 ? 90.333  41.594 -20.837 1.00 20.84  ? 406  ASN B CB  1 
ATOM   7284 C CG  . ASN B 1 409 ? 89.163  41.900 -19.932 1.00 20.77  ? 406  ASN B CG  1 
ATOM   7285 O OD1 . ASN B 1 409 ? 88.286  42.716 -20.257 1.00 21.61  ? 406  ASN B OD1 1 
ATOM   7286 N ND2 . ASN B 1 409 ? 89.134  41.239 -18.785 1.00 19.91  ? 406  ASN B ND2 1 
ATOM   7287 N N   . VAL B 1 410 ? 91.878  40.074 -23.311 1.00 22.88  ? 407  VAL B N   1 
ATOM   7288 C CA  . VAL B 1 410 ? 93.082  40.218 -24.130 1.00 20.19  ? 407  VAL B CA  1 
ATOM   7289 C C   . VAL B 1 410 ? 93.205  39.132 -25.197 1.00 25.76  ? 407  VAL B C   1 
ATOM   7290 O O   . VAL B 1 410 ? 93.314  39.448 -26.385 1.00 23.22  ? 407  VAL B O   1 
ATOM   7291 C CB  . VAL B 1 410 ? 94.361  40.224 -23.265 1.00 20.43  ? 407  VAL B CB  1 
ATOM   7292 C CG1 . VAL B 1 410 ? 95.570  40.600 -24.134 1.00 18.91  ? 407  VAL B CG1 1 
ATOM   7293 C CG2 . VAL B 1 410 ? 94.234  41.168 -22.068 1.00 17.18  ? 407  VAL B CG2 1 
ATOM   7294 N N   . VAL B 1 411 ? 93.249  37.850 -24.789 1.00 20.46  ? 408  VAL B N   1 
ATOM   7295 C CA  . VAL B 1 411 ? 93.642  36.800 -25.736 1.00 22.55  ? 408  VAL B CA  1 
ATOM   7296 C C   . VAL B 1 411 ? 92.608  36.660 -26.848 1.00 23.76  ? 408  VAL B C   1 
ATOM   7297 O O   . VAL B 1 411 ? 92.953  36.590 -28.032 1.00 29.39  ? 408  VAL B O   1 
ATOM   7298 C CB  . VAL B 1 411 ? 93.878  35.457 -25.017 1.00 29.72  ? 408  VAL B CB  1 
ATOM   7299 C CG1 . VAL B 1 411 ? 94.423  34.407 -25.995 1.00 29.82  ? 408  VAL B CG1 1 
ATOM   7300 C CG2 . VAL B 1 411 ? 94.827  35.616 -23.856 1.00 24.23  ? 408  VAL B CG2 1 
ATOM   7301 N N   . CYS B 1 412 ? 91.336  36.667 -26.506 1.00 24.27  ? 409  CYS B N   1 
ATOM   7302 C CA  . CYS B 1 412 ? 90.351  36.423 -27.550 1.00 28.46  ? 409  CYS B CA  1 
ATOM   7303 C C   . CYS B 1 412 ? 90.078  37.659 -28.410 1.00 27.55  ? 409  CYS B C   1 
ATOM   7304 O O   . CYS B 1 412 ? 89.912  37.513 -29.625 1.00 26.36  ? 409  CYS B O   1 
ATOM   7305 C CB  . CYS B 1 412 ? 89.068  35.860 -26.926 1.00 24.77  ? 409  CYS B CB  1 
ATOM   7306 S SG  . CYS B 1 412 ? 89.399  34.259 -26.121 1.00 30.46  ? 409  CYS B SG  1 
ATOM   7307 N N   . PRO B 1 413 ? 90.032  38.883 -27.864 1.00 26.90  ? 410  PRO B N   1 
ATOM   7308 C CA  . PRO B 1 413 ? 90.037  40.051 -28.779 1.00 28.45  ? 410  PRO B CA  1 
ATOM   7309 C C   . PRO B 1 413 ? 91.242  40.065 -29.720 1.00 23.16  ? 410  PRO B C   1 
ATOM   7310 O O   . PRO B 1 413 ? 91.108  40.408 -30.900 1.00 25.32  ? 410  PRO B O   1 
ATOM   7311 C CB  . PRO B 1 413 ? 90.026  41.258 -27.822 1.00 26.43  ? 410  PRO B CB  1 
ATOM   7312 C CG  . PRO B 1 413 ? 89.386  40.712 -26.521 1.00 24.23  ? 410  PRO B CG  1 
ATOM   7313 C CD  . PRO B 1 413 ? 89.857  39.273 -26.446 1.00 23.58  ? 410  PRO B CD  1 
ATOM   7314 N N   . VAL B 1 414 ? 92.415  39.656 -29.242 1.00 23.62  ? 411  VAL B N   1 
ATOM   7315 C CA  . VAL B 1 414 ? 93.599  39.640 -30.095 1.00 25.70  ? 411  VAL B CA  1 
ATOM   7316 C C   . VAL B 1 414 ? 93.508  38.525 -31.147 1.00 28.44  ? 411  VAL B C   1 
ATOM   7317 O O   . VAL B 1 414 ? 93.835  38.739 -32.322 1.00 25.93  ? 411  VAL B O   1 
ATOM   7318 C CB  . VAL B 1 414 ? 94.865  39.518 -29.228 1.00 22.70  ? 411  VAL B CB  1 
ATOM   7319 C CG1 . VAL B 1 414 ? 96.094  39.134 -30.078 1.00 21.07  ? 411  VAL B CG1 1 
ATOM   7320 C CG2 . VAL B 1 414 ? 95.112  40.831 -28.472 1.00 24.71  ? 411  VAL B CG2 1 
ATOM   7321 N N   . ALA B 1 415 ? 93.106  37.308 -30.745 1.00 25.34  ? 412  ALA B N   1 
ATOM   7322 C CA  . ALA B 1 415 ? 92.985  36.226 -31.729 1.00 25.44  ? 412  ALA B CA  1 
ATOM   7323 C C   . ALA B 1 415 ? 91.957  36.592 -32.789 1.00 22.88  ? 412  ALA B C   1 
ATOM   7324 O O   . ALA B 1 415 ? 92.178  36.392 -33.988 1.00 27.47  ? 412  ALA B O   1 
ATOM   7325 C CB  . ALA B 1 415 ? 92.613  34.899 -31.046 1.00 20.43  ? 412  ALA B CB  1 
ATOM   7326 N N   . GLN B 1 416 ? 90.844  37.172 -32.361 1.00 21.68  ? 413  GLN B N   1 
ATOM   7327 C CA  . GLN B 1 416 ? 89.835  37.653 -33.287 1.00 23.90  ? 413  GLN B CA  1 
ATOM   7328 C C   . GLN B 1 416 ? 90.443  38.594 -34.324 1.00 33.79  ? 413  GLN B C   1 
ATOM   7329 O O   . GLN B 1 416 ? 90.350  38.356 -35.537 1.00 29.17  ? 413  GLN B O   1 
ATOM   7330 C CB  . GLN B 1 416 ? 88.746  38.357 -32.486 1.00 27.90  ? 413  GLN B CB  1 
ATOM   7331 C CG  . GLN B 1 416 ? 87.714  39.030 -33.330 1.00 34.05  ? 413  GLN B CG  1 
ATOM   7332 C CD  . GLN B 1 416 ? 86.594  38.114 -33.669 1.00 45.93  ? 413  GLN B CD  1 
ATOM   7333 O OE1 . GLN B 1 416 ? 85.638  37.982 -32.897 1.00 60.28  ? 413  GLN B OE1 1 
ATOM   7334 N NE2 . GLN B 1 416 ? 86.699  37.443 -34.817 1.00 49.02  ? 413  GLN B NE2 1 
ATOM   7335 N N   . LEU B 1 417 ? 91.069  39.680 -33.847 1.00 28.26  ? 414  LEU B N   1 
ATOM   7336 C CA  . LEU B 1 417 ? 91.691  40.657 -34.738 1.00 29.28  ? 414  LEU B CA  1 
ATOM   7337 C C   . LEU B 1 417 ? 92.714  39.989 -35.658 1.00 24.49  ? 414  LEU B C   1 
ATOM   7338 O O   . LEU B 1 417 ? 92.719  40.222 -36.871 1.00 26.82  ? 414  LEU B O   1 
ATOM   7339 C CB  . LEU B 1 417 ? 92.345  41.778 -33.910 1.00 23.19  ? 414  LEU B CB  1 
ATOM   7340 C CG  . LEU B 1 417 ? 93.155  42.888 -34.600 1.00 28.98  ? 414  LEU B CG  1 
ATOM   7341 C CD1 . LEU B 1 417 ? 92.264  43.673 -35.513 1.00 26.36  ? 414  LEU B CD1 1 
ATOM   7342 C CD2 . LEU B 1 417 ? 93.796  43.844 -33.594 1.00 27.18  ? 414  LEU B CD2 1 
ATOM   7343 N N   . ALA B 1 418 ? 93.569  39.131 -35.096 1.00 22.83  ? 415  ALA B N   1 
ATOM   7344 C CA  . ALA B 1 418 ? 94.649  38.537 -35.879 1.00 23.89  ? 415  ALA B CA  1 
ATOM   7345 C C   . ALA B 1 418 ? 94.112  37.738 -37.068 1.00 35.73  ? 415  ALA B C   1 
ATOM   7346 O O   . ALA B 1 418 ? 94.670  37.802 -38.173 1.00 30.68  ? 415  ALA B O   1 
ATOM   7347 C CB  . ALA B 1 418 ? 95.511  37.645 -34.989 1.00 20.14  ? 415  ALA B CB  1 
ATOM   7348 N N   . GLY B 1 419 ? 93.037  36.971 -36.862 1.00 31.83  ? 416  GLY B N   1 
ATOM   7349 C CA  . GLY B 1 419 ? 92.498  36.172 -37.956 1.00 31.54  ? 416  GLY B CA  1 
ATOM   7350 C C   . GLY B 1 419 ? 91.803  37.008 -39.013 1.00 29.72  ? 416  GLY B C   1 
ATOM   7351 O O   . GLY B 1 419 ? 91.992  36.788 -40.212 1.00 32.32  ? 416  GLY B O   1 
ATOM   7352 N N   . ARG B 1 420 ? 90.982  37.972 -38.588 1.00 29.28  ? 417  ARG B N   1 
ATOM   7353 C CA  . ARG B 1 420 ? 90.352  38.874 -39.548 1.00 29.95  ? 417  ARG B CA  1 
ATOM   7354 C C   . ARG B 1 420 ? 91.388  39.649 -40.358 1.00 37.45  ? 417  ARG B C   1 
ATOM   7355 O O   . ARG B 1 420 ? 91.215  39.851 -41.568 1.00 39.99  ? 417  ARG B O   1 
ATOM   7356 C CB  . ARG B 1 420 ? 89.411  39.835 -38.827 1.00 27.01  ? 417  ARG B CB  1 
ATOM   7357 C CG  . ARG B 1 420 ? 88.156  39.173 -38.309 1.00 36.72  ? 417  ARG B CG  1 
ATOM   7358 C CD  . ARG B 1 420 ? 87.478  38.374 -39.418 1.00 42.61  ? 417  ARG B CD  1 
ATOM   7359 N NE  . ARG B 1 420 ? 86.023  38.477 -39.357 1.00 47.02  ? 417  ARG B NE  1 
ATOM   7360 C CZ  . ARG B 1 420 ? 85.255  38.998 -40.311 1.00 43.32  ? 417  ARG B CZ  1 
ATOM   7361 N NH1 . ARG B 1 420 ? 85.786  39.461 -41.434 1.00 41.48  ? 417  ARG B NH1 1 
ATOM   7362 N NH2 . ARG B 1 420 ? 83.938  39.037 -40.146 1.00 47.11  ? 417  ARG B NH2 1 
ATOM   7363 N N   . LEU B 1 421 ? 92.475  40.092 -39.720 1.00 34.16  ? 418  LEU B N   1 
ATOM   7364 C CA  . LEU B 1 421 ? 93.523  40.788 -40.469 1.00 37.63  ? 418  LEU B CA  1 
ATOM   7365 C C   . LEU B 1 421 ? 94.171  39.857 -41.484 1.00 34.40  ? 418  LEU B C   1 
ATOM   7366 O O   . LEU B 1 421 ? 94.329  40.210 -42.658 1.00 31.75  ? 418  LEU B O   1 
ATOM   7367 C CB  . LEU B 1 421 ? 94.592  41.349 -39.524 1.00 36.72  ? 418  LEU B CB  1 
ATOM   7368 C CG  . LEU B 1 421 ? 94.333  42.576 -38.636 1.00 33.24  ? 418  LEU B CG  1 
ATOM   7369 C CD1 . LEU B 1 421 ? 95.493  42.745 -37.677 1.00 30.92  ? 418  LEU B CD1 1 
ATOM   7370 C CD2 . LEU B 1 421 ? 94.158  43.823 -39.444 1.00 26.09  ? 418  LEU B CD2 1 
ATOM   7371 N N   . ALA B 1 422 ? 94.580  38.669 -41.038 1.00 31.03  ? 419  ALA B N   1 
ATOM   7372 C CA  . ALA B 1 422 ? 95.259  37.733 -41.928 1.00 32.88  ? 419  ALA B CA  1 
ATOM   7373 C C   . ALA B 1 422 ? 94.352  37.311 -43.077 1.00 38.42  ? 419  ALA B C   1 
ATOM   7374 O O   . ALA B 1 422 ? 94.792  37.224 -44.229 1.00 38.27  ? 419  ALA B O   1 
ATOM   7375 C CB  . ALA B 1 422 ? 95.734  36.509 -41.143 1.00 31.68  ? 419  ALA B CB  1 
ATOM   7376 N N   . ALA B 1 423 ? 93.072  37.079 -42.790 1.00 36.12  ? 420  ALA B N   1 
ATOM   7377 C CA  . ALA B 1 423 ? 92.152  36.640 -43.830 1.00 38.64  ? 420  ALA B CA  1 
ATOM   7378 C C   . ALA B 1 423 ? 91.815  37.754 -44.800 1.00 41.31  ? 420  ALA B C   1 
ATOM   7379 O O   . ALA B 1 423 ? 91.386  37.476 -45.924 1.00 44.73  ? 420  ALA B O   1 
ATOM   7380 C CB  . ALA B 1 423 ? 90.863  36.093 -43.213 1.00 33.11  ? 420  ALA B CB  1 
ATOM   7381 N N   . GLN B 1 424 ? 91.998  39.011 -44.408 1.00 40.40  ? 421  GLN B N   1 
ATOM   7382 C CA  . GLN B 1 424 ? 91.572  40.107 -45.263 1.00 31.41  ? 421  GLN B CA  1 
ATOM   7383 C C   . GLN B 1 424 ? 92.739  40.908 -45.825 1.00 30.26  ? 421  GLN B C   1 
ATOM   7384 O O   . GLN B 1 424 ? 92.559  42.064 -46.206 1.00 32.25  ? 421  GLN B O   1 
ATOM   7385 C CB  . GLN B 1 424 ? 90.583  40.995 -44.515 1.00 34.62  ? 421  GLN B CB  1 
ATOM   7386 C CG  . GLN B 1 424 ? 89.308  40.232 -44.198 1.00 31.84  ? 421  GLN B CG  1 
ATOM   7387 C CD  . GLN B 1 424 ? 88.498  40.836 -43.069 1.00 39.69  ? 421  GLN B CD  1 
ATOM   7388 O OE1 . GLN B 1 424 ? 87.773  40.125 -42.371 1.00 42.17  ? 421  GLN B OE1 1 
ATOM   7389 N NE2 . GLN B 1 424 ? 88.603  42.146 -42.889 1.00 37.05  ? 421  GLN B NE2 1 
ATOM   7390 N N   . GLY B 1 425 ? 93.923  40.315 -45.911 1.00 31.05  ? 422  GLY B N   1 
ATOM   7391 C CA  . GLY B 1 425 ? 94.972  40.949 -46.688 1.00 36.16  ? 422  GLY B CA  1 
ATOM   7392 C C   . GLY B 1 425 ? 96.304  41.166 -46.004 1.00 40.12  ? 422  GLY B C   1 
ATOM   7393 O O   . GLY B 1 425 ? 97.327  41.327 -46.679 1.00 35.66  ? 422  GLY B O   1 
ATOM   7394 N N   . ALA B 1 426 ? 96.312  41.190 -44.675 1.00 34.83  ? 423  ALA B N   1 
ATOM   7395 C CA  . ALA B 1 426 ? 97.516  41.529 -43.931 1.00 34.43  ? 423  ALA B CA  1 
ATOM   7396 C C   . ALA B 1 426 ? 98.395  40.306 -43.745 1.00 30.87  ? 423  ALA B C   1 
ATOM   7397 O O   . ALA B 1 426 ? 97.910  39.178 -43.650 1.00 36.71  ? 423  ALA B O   1 
ATOM   7398 C CB  . ALA B 1 426 ? 97.160  42.122 -42.564 1.00 32.28  ? 423  ALA B CB  1 
ATOM   7399 N N   . ARG B 1 427 ? 99.698  40.537 -43.705 1.00 26.11  ? 424  ARG B N   1 
ATOM   7400 C CA  . ARG B 1 427 ? 100.648 39.539 -43.241 1.00 26.41  ? 424  ARG B CA  1 
ATOM   7401 C C   . ARG B 1 427 ? 100.798 39.676 -41.721 1.00 37.62  ? 424  ARG B C   1 
ATOM   7402 O O   . ARG B 1 427 ? 101.176 40.747 -41.225 1.00 31.73  ? 424  ARG B O   1 
ATOM   7403 C CB  . ARG B 1 427 ? 101.977 39.728 -43.961 1.00 29.21  ? 424  ARG B CB  1 
ATOM   7404 C CG  . ARG B 1 427 ? 103.176 39.146 -43.243 1.00 40.82  ? 424  ARG B CG  1 
ATOM   7405 C CD  . ARG B 1 427 ? 103.212 37.643 -43.347 1.00 43.76  ? 424  ARG B CD  1 
ATOM   7406 N NE  . ARG B 1 427 ? 103.005 37.222 -44.723 1.00 50.76  ? 424  ARG B NE  1 
ATOM   7407 C CZ  . ARG B 1 427 ? 103.938 37.283 -45.666 1.00 60.92  ? 424  ARG B CZ  1 
ATOM   7408 N NH1 . ARG B 1 427 ? 105.151 37.744 -45.374 1.00 55.48  ? 424  ARG B NH1 1 
ATOM   7409 N NH2 . ARG B 1 427 ? 103.651 36.886 -46.902 1.00 65.55  ? 424  ARG B NH2 1 
ATOM   7410 N N   . VAL B 1 428 ? 100.500 38.603 -40.981 1.00 31.31  ? 425  VAL B N   1 
ATOM   7411 C CA  . VAL B 1 428 ? 100.380 38.653 -39.527 1.00 31.13  ? 425  VAL B CA  1 
ATOM   7412 C C   . VAL B 1 428 ? 101.367 37.678 -38.912 1.00 34.88  ? 425  VAL B C   1 
ATOM   7413 O O   . VAL B 1 428 ? 101.527 36.556 -39.405 1.00 34.70  ? 425  VAL B O   1 
ATOM   7414 C CB  . VAL B 1 428 ? 98.943  38.323 -39.070 1.00 28.11  ? 425  VAL B CB  1 
ATOM   7415 C CG1 . VAL B 1 428 ? 98.829  38.363 -37.537 1.00 28.77  ? 425  VAL B CG1 1 
ATOM   7416 C CG2 . VAL B 1 428 ? 97.954  39.263 -39.718 1.00 26.38  ? 425  VAL B CG2 1 
ATOM   7417 N N   . TYR B 1 429 ? 102.036 38.108 -37.840 1.00 27.12  ? 426  TYR B N   1 
ATOM   7418 C CA  . TYR B 1 429 ? 102.871 37.242 -37.015 1.00 28.06  ? 426  TYR B CA  1 
ATOM   7419 C C   . TYR B 1 429 ? 102.393 37.310 -35.571 1.00 30.32  ? 426  TYR B C   1 
ATOM   7420 O O   . TYR B 1 429 ? 101.981 38.370 -35.093 1.00 33.20  ? 426  TYR B O   1 
ATOM   7421 C CB  . TYR B 1 429 ? 104.348 37.635 -37.086 1.00 29.88  ? 426  TYR B CB  1 
ATOM   7422 C CG  . TYR B 1 429 ? 104.943 37.486 -38.457 1.00 32.21  ? 426  TYR B CG  1 
ATOM   7423 C CD1 . TYR B 1 429 ? 104.787 38.490 -39.413 1.00 31.38  ? 426  TYR B CD1 1 
ATOM   7424 C CD2 . TYR B 1 429 ? 105.661 36.344 -38.807 1.00 33.46  ? 426  TYR B CD2 1 
ATOM   7425 C CE1 . TYR B 1 429 ? 105.323 38.365 -40.679 1.00 34.20  ? 426  TYR B CE1 1 
ATOM   7426 C CE2 . TYR B 1 429 ? 106.207 36.202 -40.084 1.00 33.81  ? 426  TYR B CE2 1 
ATOM   7427 C CZ  . TYR B 1 429 ? 106.032 37.222 -41.016 1.00 38.02  ? 426  TYR B CZ  1 
ATOM   7428 O OH  . TYR B 1 429 ? 106.561 37.113 -42.285 1.00 39.76  ? 426  TYR B OH  1 
ATOM   7429 N N   . ALA B 1 430 ? 102.450 36.181 -34.871 1.00 28.72  ? 427  ALA B N   1 
ATOM   7430 C CA  . ALA B 1 430 ? 101.835 36.083 -33.562 1.00 22.17  ? 427  ALA B CA  1 
ATOM   7431 C C   . ALA B 1 430 ? 102.776 35.349 -32.633 1.00 24.79  ? 427  ALA B C   1 
ATOM   7432 O O   . ALA B 1 430 ? 103.551 34.492 -33.065 1.00 26.11  ? 427  ALA B O   1 
ATOM   7433 C CB  . ALA B 1 430 ? 100.471 35.381 -33.625 1.00 29.46  ? 427  ALA B CB  1 
ATOM   7434 N N   . TYR B 1 431 ? 102.722 35.719 -31.353 1.00 21.41  ? 428  TYR B N   1 
ATOM   7435 C CA  . TYR B 1 431 ? 103.592 35.137 -30.345 1.00 22.13  ? 428  TYR B CA  1 
ATOM   7436 C C   . TYR B 1 431 ? 102.816 34.987 -29.045 1.00 21.08  ? 428  TYR B C   1 
ATOM   7437 O O   . TYR B 1 431 ? 101.821 35.667 -28.808 1.00 24.05  ? 428  TYR B O   1 
ATOM   7438 C CB  . TYR B 1 431 ? 104.855 35.997 -30.088 1.00 25.28  ? 428  TYR B CB  1 
ATOM   7439 C CG  . TYR B 1 431 ? 104.538 37.345 -29.461 1.00 21.96  ? 428  TYR B CG  1 
ATOM   7440 C CD1 . TYR B 1 431 ? 104.387 37.478 -28.075 1.00 23.37  ? 428  TYR B CD1 1 
ATOM   7441 C CD2 . TYR B 1 431 ? 104.369 38.478 -30.253 1.00 25.16  ? 428  TYR B CD2 1 
ATOM   7442 C CE1 . TYR B 1 431 ? 104.079 38.703 -27.499 1.00 24.36  ? 428  TYR B CE1 1 
ATOM   7443 C CE2 . TYR B 1 431 ? 104.073 39.722 -29.685 1.00 27.26  ? 428  TYR B CE2 1 
ATOM   7444 C CZ  . TYR B 1 431 ? 103.925 39.823 -28.308 1.00 23.89  ? 428  TYR B CZ  1 
ATOM   7445 O OH  . TYR B 1 431 ? 103.592 41.030 -27.747 1.00 23.24  ? 428  TYR B OH  1 
ATOM   7446 N N   . VAL B 1 432 ? 103.304 34.103 -28.192 1.00 24.77  ? 429  VAL B N   1 
ATOM   7447 C CA  . VAL B 1 432 ? 102.934 34.080 -26.786 1.00 24.22  ? 429  VAL B CA  1 
ATOM   7448 C C   . VAL B 1 432 ? 104.226 34.148 -25.998 1.00 27.92  ? 429  VAL B C   1 
ATOM   7449 O O   . VAL B 1 432 ? 105.148 33.360 -26.249 1.00 24.78  ? 429  VAL B O   1 
ATOM   7450 C CB  . VAL B 1 432 ? 102.129 32.826 -26.394 1.00 26.92  ? 429  VAL B CB  1 
ATOM   7451 C CG1 . VAL B 1 432 ? 101.982 32.757 -24.873 1.00 28.86  ? 429  VAL B CG1 1 
ATOM   7452 C CG2 . VAL B 1 432 ? 100.760 32.858 -27.051 1.00 33.86  ? 429  VAL B CG2 1 
ATOM   7453 N N   . PHE B 1 433 ? 104.299 35.104 -25.067 1.00 25.33  ? 430  PHE B N   1 
ATOM   7454 C CA  . PHE B 1 433 ? 105.518 35.375 -24.320 1.00 21.79  ? 430  PHE B CA  1 
ATOM   7455 C C   . PHE B 1 433 ? 105.455 34.602 -23.002 1.00 24.99  ? 430  PHE B C   1 
ATOM   7456 O O   . PHE B 1 433 ? 104.533 34.802 -22.202 1.00 22.82  ? 430  PHE B O   1 
ATOM   7457 C CB  . PHE B 1 433 ? 105.666 36.889 -24.099 1.00 24.51  ? 430  PHE B CB  1 
ATOM   7458 C CG  . PHE B 1 433 ? 106.971 37.285 -23.472 1.00 23.17  ? 430  PHE B CG  1 
ATOM   7459 C CD1 . PHE B 1 433 ? 107.133 37.251 -22.091 1.00 20.61  ? 430  PHE B CD1 1 
ATOM   7460 C CD2 . PHE B 1 433 ? 108.042 37.681 -24.260 1.00 23.23  ? 430  PHE B CD2 1 
ATOM   7461 C CE1 . PHE B 1 433 ? 108.348 37.606 -21.511 1.00 31.74  ? 430  PHE B CE1 1 
ATOM   7462 C CE2 . PHE B 1 433 ? 109.259 38.042 -23.681 1.00 23.67  ? 430  PHE B CE2 1 
ATOM   7463 C CZ  . PHE B 1 433 ? 109.420 37.995 -22.314 1.00 21.21  ? 430  PHE B CZ  1 
ATOM   7464 N N   . GLU B 1 434 ? 106.431 33.718 -22.775 1.00 23.92  ? 431  GLU B N   1 
ATOM   7465 C CA  . GLU B 1 434 ? 106.340 32.718 -21.717 1.00 25.87  ? 431  GLU B CA  1 
ATOM   7466 C C   . GLU B 1 434 ? 107.481 32.767 -20.719 1.00 28.80  ? 431  GLU B C   1 
ATOM   7467 O O   . GLU B 1 434 ? 107.572 31.872 -19.875 1.00 31.29  ? 431  GLU B O   1 
ATOM   7468 C CB  . GLU B 1 434 ? 106.297 31.310 -22.310 1.00 27.77  ? 431  GLU B CB  1 
ATOM   7469 C CG  . GLU B 1 434 ? 105.267 31.111 -23.373 1.00 33.85  ? 431  GLU B CG  1 
ATOM   7470 C CD  . GLU B 1 434 ? 104.861 29.646 -23.494 1.00 41.99  ? 431  GLU B CD  1 
ATOM   7471 O OE1 . GLU B 1 434 ? 105.743 28.758 -23.436 1.00 40.99  ? 431  GLU B OE1 1 
ATOM   7472 O OE2 . GLU B 1 434 ? 103.653 29.391 -23.617 1.00 41.29  ? 431  GLU B OE2 1 
ATOM   7473 N N   . HIS B 1 435 ? 108.374 33.743 -20.801 1.00 27.29  ? 432  HIS B N   1 
ATOM   7474 C CA  . HIS B 1 435 ? 109.466 33.834 -19.844 1.00 26.49  ? 432  HIS B CA  1 
ATOM   7475 C C   . HIS B 1 435 ? 109.075 34.785 -18.721 1.00 28.66  ? 432  HIS B C   1 
ATOM   7476 O O   . HIS B 1 435 ? 108.642 35.914 -18.981 1.00 26.90  ? 432  HIS B O   1 
ATOM   7477 C CB  . HIS B 1 435 ? 110.757 34.319 -20.494 1.00 28.76  ? 432  HIS B CB  1 
ATOM   7478 C CG  . HIS B 1 435 ? 111.851 34.560 -19.507 1.00 25.66  ? 432  HIS B CG  1 
ATOM   7479 N ND1 . HIS B 1 435 ? 112.445 33.539 -18.800 1.00 26.93  ? 432  HIS B ND1 1 
ATOM   7480 C CD2 . HIS B 1 435 ? 112.442 35.701 -19.089 1.00 27.67  ? 432  HIS B CD2 1 
ATOM   7481 C CE1 . HIS B 1 435 ? 113.358 34.040 -17.988 1.00 27.79  ? 432  HIS B CE1 1 
ATOM   7482 N NE2 . HIS B 1 435 ? 113.379 35.349 -18.147 1.00 28.52  ? 432  HIS B NE2 1 
ATOM   7483 N N   . ARG B 1 436 ? 109.213 34.315 -17.484 1.00 28.46  ? 433  ARG B N   1 
ATOM   7484 C CA  . ARG B 1 436 ? 108.995 35.120 -16.294 1.00 25.71  ? 433  ARG B CA  1 
ATOM   7485 C C   . ARG B 1 436 ? 110.340 35.667 -15.835 1.00 26.18  ? 433  ARG B C   1 
ATOM   7486 O O   . ARG B 1 436 ? 111.237 34.891 -15.493 1.00 24.14  ? 433  ARG B O   1 
ATOM   7487 C CB  . ARG B 1 436 ? 108.350 34.283 -15.190 1.00 25.24  ? 433  ARG B CB  1 
ATOM   7488 C CG  . ARG B 1 436 ? 108.299 34.983 -13.835 1.00 26.63  ? 433  ARG B CG  1 
ATOM   7489 C CD  . ARG B 1 436 ? 107.628 34.104 -12.780 1.00 24.21  ? 433  ARG B CD  1 
ATOM   7490 N NE  . ARG B 1 436 ? 107.833 34.635 -11.441 1.00 24.20  ? 433  ARG B NE  1 
ATOM   7491 C CZ  . ARG B 1 436 ? 106.900 35.274 -10.751 1.00 28.21  ? 433  ARG B CZ  1 
ATOM   7492 N NH1 . ARG B 1 436 ? 105.679 35.443 -11.275 1.00 23.75  ? 433  ARG B NH1 1 
ATOM   7493 N NH2 . ARG B 1 436 ? 107.188 35.730 -9.535  1.00 28.32  ? 433  ARG B NH2 1 
ATOM   7494 N N   . ALA B 1 437 ? 110.479 36.996 -15.832 1.00 27.36  ? 434  ALA B N   1 
ATOM   7495 C CA  . ALA B 1 437 ? 111.723 37.627 -15.396 1.00 27.64  ? 434  ALA B CA  1 
ATOM   7496 C C   . ALA B 1 437 ? 112.213 37.021 -14.092 1.00 26.58  ? 434  ALA B C   1 
ATOM   7497 O O   . ALA B 1 437 ? 111.429 36.766 -13.175 1.00 29.56  ? 434  ALA B O   1 
ATOM   7498 C CB  . ALA B 1 437 ? 111.530 39.136 -15.219 1.00 23.17  ? 434  ALA B CB  1 
ATOM   7499 N N   . SER B 1 438 ? 113.522 36.776 -14.021 1.00 22.25  ? 435  SER B N   1 
ATOM   7500 C CA  . SER B 1 438 ? 114.118 36.322 -12.772 1.00 24.75  ? 435  SER B CA  1 
ATOM   7501 C C   . SER B 1 438 ? 113.944 37.338 -11.655 1.00 28.84  ? 435  SER B C   1 
ATOM   7502 O O   . SER B 1 438 ? 114.044 36.973 -10.480 1.00 33.91  ? 435  SER B O   1 
ATOM   7503 C CB  . SER B 1 438 ? 115.611 36.047 -12.959 1.00 26.53  ? 435  SER B CB  1 
ATOM   7504 O OG  . SER B 1 438 ? 116.285 37.263 -13.272 1.00 28.45  ? 435  SER B OG  1 
ATOM   7505 N N   . THR B 1 439 ? 113.711 38.602 -11.992 1.00 25.48  ? 436  THR B N   1 
ATOM   7506 C CA  . THR B 1 439 ? 113.621 39.669 -11.010 1.00 27.96  ? 436  THR B CA  1 
ATOM   7507 C C   . THR B 1 439 ? 112.187 40.050 -10.678 1.00 25.47  ? 436  THR B C   1 
ATOM   7508 O O   . THR B 1 439 ? 111.985 40.994 -9.911  1.00 27.26  ? 436  THR B O   1 
ATOM   7509 C CB  . THR B 1 439 ? 114.376 40.912 -11.508 1.00 31.82  ? 436  THR B CB  1 
ATOM   7510 O OG1 . THR B 1 439 ? 113.986 41.201 -12.862 1.00 27.21  ? 436  THR B OG1 1 
ATOM   7511 C CG2 . THR B 1 439 ? 115.882 40.684 -11.447 1.00 32.16  ? 436  THR B CG2 1 
ATOM   7512 N N   . LEU B 1 440 ? 111.190 39.341 -11.216 1.00 23.36  ? 437  LEU B N   1 
ATOM   7513 C CA  . LEU B 1 440 ? 109.802 39.776 -11.065 1.00 27.69  ? 437  LEU B CA  1 
ATOM   7514 C C   . LEU B 1 440 ? 109.391 39.795 -9.590  1.00 27.20  ? 437  LEU B C   1 
ATOM   7515 O O   . LEU B 1 440 ? 109.668 38.857 -8.838  1.00 24.32  ? 437  LEU B O   1 
ATOM   7516 C CB  . LEU B 1 440 ? 108.883 38.875 -11.890 1.00 27.38  ? 437  LEU B CB  1 
ATOM   7517 C CG  . LEU B 1 440 ? 107.502 39.372 -12.330 1.00 29.19  ? 437  LEU B CG  1 
ATOM   7518 C CD1 . LEU B 1 440 ? 107.454 40.853 -12.533 1.00 30.37  ? 437  LEU B CD1 1 
ATOM   7519 C CD2 . LEU B 1 440 ? 107.174 38.698 -13.636 1.00 35.01  ? 437  LEU B CD2 1 
ATOM   7520 N N   . SER B 1 441 ? 108.756 40.891 -9.166  1.00 22.37  ? 438  SER B N   1 
ATOM   7521 C CA  . SER B 1 441 ? 108.417 41.059 -7.758  1.00 24.49  ? 438  SER B CA  1 
ATOM   7522 C C   . SER B 1 441 ? 106.985 40.648 -7.412  1.00 22.25  ? 438  SER B C   1 
ATOM   7523 O O   . SER B 1 441 ? 106.685 40.479 -6.229  1.00 20.74  ? 438  SER B O   1 
ATOM   7524 C CB  . SER B 1 441 ? 108.642 42.517 -7.334  1.00 23.57  ? 438  SER B CB  1 
ATOM   7525 O OG  . SER B 1 441 ? 107.839 43.388 -8.110  1.00 24.09  ? 438  SER B OG  1 
ATOM   7526 N N   . TRP B 1 442 ? 106.099 40.503 -8.397  1.00 22.99  ? 439  TRP B N   1 
ATOM   7527 C CA  . TRP B 1 442 ? 104.801 39.889 -8.162  1.00 21.52  ? 439  TRP B CA  1 
ATOM   7528 C C   . TRP B 1 442 ? 104.983 38.428 -7.738  1.00 20.12  ? 439  TRP B C   1 
ATOM   7529 O O   . TRP B 1 442 ? 106.024 37.826 -8.015  1.00 23.79  ? 439  TRP B O   1 
ATOM   7530 C CB  . TRP B 1 442 ? 103.965 39.968 -9.426  1.00 18.29  ? 439  TRP B CB  1 
ATOM   7531 C CG  . TRP B 1 442 ? 103.569 41.344 -9.786  1.00 22.03  ? 439  TRP B CG  1 
ATOM   7532 C CD1 . TRP B 1 442 ? 104.134 42.137 -10.749 1.00 21.43  ? 439  TRP B CD1 1 
ATOM   7533 C CD2 . TRP B 1 442 ? 102.503 42.109 -9.205  1.00 20.65  ? 439  TRP B CD2 1 
ATOM   7534 N NE1 . TRP B 1 442 ? 103.482 43.349 -10.804 1.00 18.36  ? 439  TRP B NE1 1 
ATOM   7535 C CE2 . TRP B 1 442 ? 102.472 43.355 -9.876  1.00 20.38  ? 439  TRP B CE2 1 
ATOM   7536 C CE3 . TRP B 1 442 ? 101.569 41.862 -8.182  1.00 20.01  ? 439  TRP B CE3 1 
ATOM   7537 C CZ2 . TRP B 1 442 ? 101.553 44.357 -9.552  1.00 19.90  ? 439  TRP B CZ2 1 
ATOM   7538 C CZ3 . TRP B 1 442 ? 100.656 42.853 -7.863  1.00 19.44  ? 439  TRP B CZ3 1 
ATOM   7539 C CH2 . TRP B 1 442 ? 100.655 44.090 -8.547  1.00 22.59  ? 439  TRP B CH2 1 
ATOM   7540 N N   . PRO B 1 443 ? 103.991 37.831 -7.066  1.00 25.23  ? 440  PRO B N   1 
ATOM   7541 C CA  . PRO B 1 443 ? 104.152 36.444 -6.597  1.00 26.44  ? 440  PRO B CA  1 
ATOM   7542 C C   . PRO B 1 443 ? 104.209 35.435 -7.743  1.00 24.49  ? 440  PRO B C   1 
ATOM   7543 O O   . PRO B 1 443 ? 103.732 35.664 -8.861  1.00 23.26  ? 440  PRO B O   1 
ATOM   7544 C CB  . PRO B 1 443 ? 102.912 36.217 -5.725  1.00 23.20  ? 440  PRO B CB  1 
ATOM   7545 C CG  . PRO B 1 443 ? 101.894 37.103 -6.321  1.00 22.86  ? 440  PRO B CG  1 
ATOM   7546 C CD  . PRO B 1 443 ? 102.660 38.358 -6.715  1.00 19.87  ? 440  PRO B CD  1 
ATOM   7547 N N   . LEU B 1 444 ? 104.806 34.287 -7.429  1.00 24.72  ? 441  LEU B N   1 
ATOM   7548 C CA  . LEU B 1 444 ? 104.995 33.235 -8.421  1.00 25.11  ? 441  LEU B CA  1 
ATOM   7549 C C   . LEU B 1 444 ? 103.667 32.787 -9.033  1.00 27.30  ? 441  LEU B C   1 
ATOM   7550 O O   . LEU B 1 444 ? 103.597 32.521 -10.238 1.00 29.85  ? 441  LEU B O   1 
ATOM   7551 C CB  . LEU B 1 444 ? 105.734 32.057 -7.782  1.00 27.65  ? 441  LEU B CB  1 
ATOM   7552 C CG  . LEU B 1 444 ? 106.108 30.870 -8.669  1.00 37.52  ? 441  LEU B CG  1 
ATOM   7553 C CD1 . LEU B 1 444 ? 107.187 31.264 -9.676  1.00 34.94  ? 441  LEU B CD1 1 
ATOM   7554 C CD2 . LEU B 1 444 ? 106.567 29.696 -7.814  1.00 43.04  ? 441  LEU B CD2 1 
ATOM   7555 N N   . TRP B 1 445 ? 102.592 32.739 -8.244  1.00 24.34  ? 442  TRP B N   1 
ATOM   7556 C CA  . TRP B 1 445 ? 101.341 32.227 -8.803  1.00 30.27  ? 442  TRP B CA  1 
ATOM   7557 C C   . TRP B 1 445 ? 100.810 33.080 -9.949  1.00 30.34  ? 442  TRP B C   1 
ATOM   7558 O O   . TRP B 1 445 ? 100.020 32.577 -10.752 1.00 30.77  ? 442  TRP B O   1 
ATOM   7559 C CB  . TRP B 1 445 ? 100.256 32.073 -7.731  1.00 20.54  ? 442  TRP B CB  1 
ATOM   7560 C CG  . TRP B 1 445 ? 99.691  33.341 -7.103  1.00 25.16  ? 442  TRP B CG  1 
ATOM   7561 C CD1 . TRP B 1 445 ? 99.984  33.836 -5.852  1.00 24.47  ? 442  TRP B CD1 1 
ATOM   7562 C CD2 . TRP B 1 445 ? 98.698  34.229 -7.657  1.00 22.15  ? 442  TRP B CD2 1 
ATOM   7563 N NE1 . TRP B 1 445 ? 99.240  34.980 -5.602  1.00 20.88  ? 442  TRP B NE1 1 
ATOM   7564 C CE2 . TRP B 1 445 ? 98.450  35.243 -6.691  1.00 18.32  ? 442  TRP B CE2 1 
ATOM   7565 C CE3 . TRP B 1 445 ? 97.994  34.265 -8.865  1.00 22.25  ? 442  TRP B CE3 1 
ATOM   7566 C CZ2 . TRP B 1 445 ? 97.544  36.280 -6.908  1.00 20.68  ? 442  TRP B CZ2 1 
ATOM   7567 C CZ3 . TRP B 1 445 ? 97.082  35.304 -9.078  1.00 21.26  ? 442  TRP B CZ3 1 
ATOM   7568 C CH2 . TRP B 1 445 ? 96.871  36.296 -8.105  1.00 23.19  ? 442  TRP B CH2 1 
ATOM   7569 N N   . MET B 1 446 ? 101.224 34.345 -10.064 1.00 27.98  ? 443  MET B N   1 
ATOM   7570 C CA  . MET B 1 446 ? 100.753 35.157 -11.182 1.00 22.50  ? 443  MET B CA  1 
ATOM   7571 C C   . MET B 1 446 ? 101.448 34.824 -12.497 1.00 22.20  ? 443  MET B C   1 
ATOM   7572 O O   . MET B 1 446 ? 100.997 35.292 -13.552 1.00 25.10  ? 443  MET B O   1 
ATOM   7573 C CB  . MET B 1 446 ? 100.933 36.644 -10.879 1.00 21.48  ? 443  MET B CB  1 
ATOM   7574 C CG  . MET B 1 446 ? 99.982  37.212 -9.840  1.00 22.79  ? 443  MET B CG  1 
ATOM   7575 S SD  . MET B 1 446 ? 100.244 39.001 -9.675  1.00 26.99  ? 443  MET B SD  1 
ATOM   7576 C CE  . MET B 1 446 ? 99.056  39.396 -8.408  1.00 25.51  ? 443  MET B CE  1 
ATOM   7577 N N   . GLY B 1 447 ? 102.528 34.052 -12.469 1.00 22.88  ? 444  GLY B N   1 
ATOM   7578 C CA  . GLY B 1 447 ? 103.119 33.594 -13.718 1.00 27.10  ? 444  GLY B CA  1 
ATOM   7579 C C   . GLY B 1 447 ? 103.826 34.718 -14.460 1.00 24.06  ? 444  GLY B C   1 
ATOM   7580 O O   . GLY B 1 447 ? 104.720 35.379 -13.922 1.00 22.30  ? 444  GLY B O   1 
ATOM   7581 N N   . VAL B 1 448 ? 103.461 34.897 -15.727 1.00 18.97  ? 445  VAL B N   1 
ATOM   7582 C CA  . VAL B 1 448 ? 103.997 35.950 -16.581 1.00 20.80  ? 445  VAL B CA  1 
ATOM   7583 C C   . VAL B 1 448 ? 102.892 36.984 -16.745 1.00 20.97  ? 445  VAL B C   1 
ATOM   7584 O O   . VAL B 1 448 ? 102.073 36.859 -17.664 1.00 21.37  ? 445  VAL B O   1 
ATOM   7585 C CB  . VAL B 1 448 ? 104.453 35.416 -17.952 1.00 25.27  ? 445  VAL B CB  1 
ATOM   7586 C CG1 . VAL B 1 448 ? 105.107 36.538 -18.771 1.00 21.92  ? 445  VAL B CG1 1 
ATOM   7587 C CG2 . VAL B 1 448 ? 105.402 34.217 -17.822 1.00 19.25  ? 445  VAL B CG2 1 
ATOM   7588 N N   . PRO B 1 449 ? 102.805 38.000 -15.892 1.00 21.65  ? 446  PRO B N   1 
ATOM   7589 C CA  . PRO B 1 449 ? 101.623 38.870 -15.908 1.00 17.42  ? 446  PRO B CA  1 
ATOM   7590 C C   . PRO B 1 449 ? 101.645 39.841 -17.079 1.00 18.05  ? 446  PRO B C   1 
ATOM   7591 O O   . PRO B 1 449 ? 102.659 40.034 -17.761 1.00 18.15  ? 446  PRO B O   1 
ATOM   7592 C CB  . PRO B 1 449 ? 101.692 39.623 -14.566 1.00 18.34  ? 446  PRO B CB  1 
ATOM   7593 C CG  . PRO B 1 449 ? 102.825 38.973 -13.782 1.00 21.67  ? 446  PRO B CG  1 
ATOM   7594 C CD  . PRO B 1 449 ? 103.734 38.341 -14.799 1.00 21.70  ? 446  PRO B CD  1 
ATOM   7595 N N   . HIS B 1 450 ? 100.471 40.415 -17.313 1.00 17.23  ? 447  HIS B N   1 
ATOM   7596 C CA  . HIS B 1 450 ? 100.256 41.510 -18.247 1.00 18.61  ? 447  HIS B CA  1 
ATOM   7597 C C   . HIS B 1 450 ? 101.326 42.574 -18.050 1.00 25.91  ? 447  HIS B C   1 
ATOM   7598 O O   . HIS B 1 450 ? 101.475 43.107 -16.952 1.00 18.21  ? 447  HIS B O   1 
ATOM   7599 C CB  . HIS B 1 450 ? 98.871  42.086 -17.967 1.00 20.26  ? 447  HIS B CB  1 
ATOM   7600 C CG  . HIS B 1 450 ? 98.369  43.077 -18.973 1.00 20.58  ? 447  HIS B CG  1 
ATOM   7601 N ND1 . HIS B 1 450 ? 98.054  42.736 -20.271 1.00 18.69  ? 447  HIS B ND1 1 
ATOM   7602 C CD2 . HIS B 1 450 ? 98.034  44.383 -18.839 1.00 23.65  ? 447  HIS B CD2 1 
ATOM   7603 C CE1 . HIS B 1 450 ? 97.578  43.794 -20.904 1.00 19.40  ? 447  HIS B CE1 1 
ATOM   7604 N NE2 . HIS B 1 450 ? 97.548  44.806 -20.055 1.00 22.59  ? 447  HIS B NE2 1 
ATOM   7605 N N   . GLY B 1 451 ? 102.095 42.852 -19.103 1.00 25.18  ? 448  GLY B N   1 
ATOM   7606 C CA  . GLY B 1 451 ? 103.060 43.933 -19.079 1.00 25.04  ? 448  GLY B CA  1 
ATOM   7607 C C   . GLY B 1 451 ? 104.498 43.507 -18.885 1.00 25.03  ? 448  GLY B C   1 
ATOM   7608 O O   . GLY B 1 451 ? 105.404 44.347 -19.021 1.00 23.38  ? 448  GLY B O   1 
ATOM   7609 N N   . TYR B 1 452 ? 104.751 42.237 -18.582 1.00 18.26  ? 449  TYR B N   1 
ATOM   7610 C CA  . TYR B 1 452 ? 106.088 41.845 -18.180 1.00 17.06  ? 449  TYR B CA  1 
ATOM   7611 C C   . TYR B 1 452 ? 106.893 41.208 -19.309 1.00 17.17  ? 449  TYR B C   1 
ATOM   7612 O O   . TYR B 1 452 ? 107.933 40.591 -19.055 1.00 19.32  ? 449  TYR B O   1 
ATOM   7613 C CB  . TYR B 1 452 ? 106.007 40.984 -16.928 1.00 19.95  ? 449  TYR B CB  1 
ATOM   7614 C CG  . TYR B 1 452 ? 105.691 41.935 -15.812 1.00 24.45  ? 449  TYR B CG  1 
ATOM   7615 C CD1 . TYR B 1 452 ? 106.706 42.688 -15.215 1.00 25.28  ? 449  TYR B CD1 1 
ATOM   7616 C CD2 . TYR B 1 452 ? 104.372 42.190 -15.442 1.00 20.51  ? 449  TYR B CD2 1 
ATOM   7617 C CE1 . TYR B 1 452 ? 106.422 43.622 -14.226 1.00 22.86  ? 449  TYR B CE1 1 
ATOM   7618 C CE2 . TYR B 1 452 ? 104.075 43.119 -14.463 1.00 23.82  ? 449  TYR B CE2 1 
ATOM   7619 C CZ  . TYR B 1 452 ? 105.106 43.836 -13.861 1.00 26.07  ? 449  TYR B CZ  1 
ATOM   7620 O OH  . TYR B 1 452 ? 104.812 44.750 -12.879 1.00 21.45  ? 449  TYR B OH  1 
ATOM   7621 N N   . GLU B 1 453 ? 106.489 41.437 -20.549 1.00 18.19  ? 450  GLU B N   1 
ATOM   7622 C CA  . GLU B 1 453 ? 107.410 41.284 -21.668 1.00 25.80  ? 450  GLU B CA  1 
ATOM   7623 C C   . GLU B 1 453 ? 108.099 42.595 -22.037 1.00 25.60  ? 450  GLU B C   1 
ATOM   7624 O O   . GLU B 1 453 ? 109.192 42.567 -22.626 1.00 23.29  ? 450  GLU B O   1 
ATOM   7625 C CB  . GLU B 1 453 ? 106.671 40.733 -22.894 1.00 15.81  ? 450  GLU B CB  1 
ATOM   7626 C CG  . GLU B 1 453 ? 105.990 41.749 -23.772 1.00 18.40  ? 450  GLU B CG  1 
ATOM   7627 C CD  . GLU B 1 453 ? 104.781 42.445 -23.137 1.00 25.49  ? 450  GLU B CD  1 
ATOM   7628 O OE1 . GLU B 1 453 ? 104.550 42.315 -21.909 1.00 26.79  ? 450  GLU B OE1 1 
ATOM   7629 O OE2 . GLU B 1 453 ? 104.053 43.153 -23.879 1.00 21.57  ? 450  GLU B OE2 1 
ATOM   7630 N N   . ILE B 1 454 ? 107.496 43.734 -21.676 1.00 23.60  ? 451  ILE B N   1 
ATOM   7631 C CA  . ILE B 1 454 ? 107.995 45.033 -22.126 1.00 28.15  ? 451  ILE B CA  1 
ATOM   7632 C C   . ILE B 1 454 ? 109.474 45.194 -21.795 1.00 22.50  ? 451  ILE B C   1 
ATOM   7633 O O   . ILE B 1 454 ? 110.277 45.563 -22.653 1.00 25.06  ? 451  ILE B O   1 
ATOM   7634 C CB  . ILE B 1 454 ? 107.168 46.166 -21.511 1.00 24.52  ? 451  ILE B CB  1 
ATOM   7635 C CG1 . ILE B 1 454 ? 105.721 46.066 -21.976 1.00 24.33  ? 451  ILE B CG1 1 
ATOM   7636 C CG2 . ILE B 1 454 ? 107.761 47.492 -21.901 1.00 21.91  ? 451  ILE B CG2 1 
ATOM   7637 C CD1 . ILE B 1 454 ? 104.830 47.130 -21.366 1.00 21.22  ? 451  ILE B CD1 1 
ATOM   7638 N N   . GLU B 1 455 ? 109.858 44.896 -20.551 1.00 21.16  ? 452  GLU B N   1 
ATOM   7639 C CA  . GLU B 1 455 ? 111.241 45.114 -20.138 1.00 27.06  ? 452  GLU B CA  1 
ATOM   7640 C C   . GLU B 1 455 ? 112.221 44.325 -20.996 1.00 29.25  ? 452  GLU B C   1 
ATOM   7641 O O   . GLU B 1 455 ? 113.388 44.727 -21.123 1.00 26.59  ? 452  GLU B O   1 
ATOM   7642 C CB  . GLU B 1 455 ? 111.426 44.768 -18.651 1.00 21.19  ? 452  GLU B CB  1 
ATOM   7643 C CG  . GLU B 1 455 ? 111.175 43.326 -18.260 1.00 22.75  ? 452  GLU B CG  1 
ATOM   7644 C CD  . GLU B 1 455 ? 110.867 43.180 -16.774 1.00 27.71  ? 452  GLU B CD  1 
ATOM   7645 O OE1 . GLU B 1 455 ? 111.733 42.681 -16.012 1.00 24.18  ? 452  GLU B OE1 1 
ATOM   7646 O OE2 . GLU B 1 455 ? 109.754 43.577 -16.363 1.00 21.93  ? 452  GLU B OE2 1 
ATOM   7647 N N   . PHE B 1 456 ? 111.769 43.226 -21.603 1.00 26.14  ? 453  PHE B N   1 
ATOM   7648 C CA  . PHE B 1 456 ? 112.644 42.468 -22.480 1.00 23.78  ? 453  PHE B CA  1 
ATOM   7649 C C   . PHE B 1 456 ? 112.664 43.051 -23.888 1.00 22.54  ? 453  PHE B C   1 
ATOM   7650 O O   . PHE B 1 456 ? 113.717 43.048 -24.528 1.00 27.55  ? 453  PHE B O   1 
ATOM   7651 C CB  . PHE B 1 456 ? 112.230 40.991 -22.474 1.00 21.87  ? 453  PHE B CB  1 
ATOM   7652 C CG  . PHE B 1 456 ? 112.532 40.302 -21.170 1.00 26.23  ? 453  PHE B CG  1 
ATOM   7653 C CD1 . PHE B 1 456 ? 113.769 39.731 -20.950 1.00 22.23  ? 453  PHE B CD1 1 
ATOM   7654 C CD2 . PHE B 1 456 ? 111.596 40.272 -20.147 1.00 25.19  ? 453  PHE B CD2 1 
ATOM   7655 C CE1 . PHE B 1 456 ? 114.062 39.127 -19.757 1.00 24.79  ? 453  PHE B CE1 1 
ATOM   7656 C CE2 . PHE B 1 456 ? 111.896 39.664 -18.933 1.00 24.17  ? 453  PHE B CE2 1 
ATOM   7657 C CZ  . PHE B 1 456 ? 113.124 39.094 -18.745 1.00 26.72  ? 453  PHE B CZ  1 
ATOM   7658 N N   . ILE B 1 457 ? 111.538 43.596 -24.362 1.00 21.64  ? 454  ILE B N   1 
ATOM   7659 C CA  . ILE B 1 457 ? 111.504 44.220 -25.684 1.00 22.18  ? 454  ILE B CA  1 
ATOM   7660 C C   . ILE B 1 457 ? 112.421 45.438 -25.727 1.00 29.64  ? 454  ILE B C   1 
ATOM   7661 O O   . ILE B 1 457 ? 113.080 45.696 -26.742 1.00 28.13  ? 454  ILE B O   1 
ATOM   7662 C CB  . ILE B 1 457 ? 110.063 44.603 -26.081 1.00 22.48  ? 454  ILE B CB  1 
ATOM   7663 C CG1 . ILE B 1 457 ? 109.110 43.397 -26.064 1.00 26.73  ? 454  ILE B CG1 1 
ATOM   7664 C CG2 . ILE B 1 457 ? 110.042 45.250 -27.447 1.00 20.36  ? 454  ILE B CG2 1 
ATOM   7665 C CD1 . ILE B 1 457 ? 109.614 42.186 -26.809 1.00 29.57  ? 454  ILE B CD1 1 
ATOM   7666 N N   . PHE B 1 458 ? 112.456 46.226 -24.646 1.00 26.78  ? 455  PHE B N   1 
ATOM   7667 C CA  . PHE B 1 458 ? 113.296 47.419 -24.591 1.00 23.83  ? 455  PHE B CA  1 
ATOM   7668 C C   . PHE B 1 458 ? 114.714 47.112 -24.109 1.00 26.14  ? 455  PHE B C   1 
ATOM   7669 O O   . PHE B 1 458 ? 115.498 48.035 -23.879 1.00 33.57  ? 455  PHE B O   1 
ATOM   7670 C CB  . PHE B 1 458 ? 112.644 48.488 -23.704 1.00 22.47  ? 455  PHE B CB  1 
ATOM   7671 C CG  . PHE B 1 458 ? 111.503 49.227 -24.362 1.00 26.54  ? 455  PHE B CG  1 
ATOM   7672 C CD1 . PHE B 1 458 ? 110.218 48.714 -24.338 1.00 21.22  ? 455  PHE B CD1 1 
ATOM   7673 C CD2 . PHE B 1 458 ? 111.712 50.441 -24.987 1.00 25.48  ? 455  PHE B CD2 1 
ATOM   7674 C CE1 . PHE B 1 458 ? 109.169 49.385 -24.939 1.00 24.77  ? 455  PHE B CE1 1 
ATOM   7675 C CE2 . PHE B 1 458 ? 110.664 51.122 -25.591 1.00 26.36  ? 455  PHE B CE2 1 
ATOM   7676 C CZ  . PHE B 1 458 ? 109.386 50.598 -25.564 1.00 26.40  ? 455  PHE B CZ  1 
ATOM   7677 N N   . GLY B 1 459 ? 115.065 45.844 -23.940 1.00 26.41  ? 456  GLY B N   1 
ATOM   7678 C CA  . GLY B 1 459 ? 116.441 45.516 -23.626 1.00 23.04  ? 456  GLY B CA  1 
ATOM   7679 C C   . GLY B 1 459 ? 116.910 45.894 -22.240 1.00 29.95  ? 456  GLY B C   1 
ATOM   7680 O O   . GLY B 1 459 ? 118.122 45.900 -21.988 1.00 30.23  ? 456  GLY B O   1 
ATOM   7681 N N   . ILE B 1 460 ? 115.988 46.172 -21.320 1.00 27.84  ? 457  ILE B N   1 
ATOM   7682 C CA  . ILE B 1 460 ? 116.325 46.531 -19.942 1.00 20.88  ? 457  ILE B CA  1 
ATOM   7683 C C   . ILE B 1 460 ? 117.293 45.542 -19.295 1.00 27.18  ? 457  ILE B C   1 
ATOM   7684 O O   . ILE B 1 460 ? 118.124 45.970 -18.484 1.00 31.80  ? 457  ILE B O   1 
ATOM   7685 C CB  . ILE B 1 460 ? 115.055 46.675 -19.085 1.00 26.56  ? 457  ILE B CB  1 
ATOM   7686 C CG1 . ILE B 1 460 ? 114.116 47.712 -19.701 1.00 24.04  ? 457  ILE B CG1 1 
ATOM   7687 C CG2 . ILE B 1 460 ? 115.402 47.043 -17.633 1.00 21.92  ? 457  ILE B CG2 1 
ATOM   7688 C CD1 . ILE B 1 460 ? 114.773 49.029 -19.991 1.00 28.61  ? 457  ILE B CD1 1 
ATOM   7689 N N   . PRO B 1 461 ? 117.251 44.216 -19.584 1.00 28.70  ? 458  PRO B N   1 
ATOM   7690 C CA  . PRO B 1 461 ? 118.266 43.342 -18.983 1.00 26.42  ? 458  PRO B CA  1 
ATOM   7691 C C   . PRO B 1 461 ? 119.711 43.756 -19.235 1.00 31.32  ? 458  PRO B C   1 
ATOM   7692 O O   . PRO B 1 461 ? 120.599 43.377 -18.464 1.00 31.60  ? 458  PRO B O   1 
ATOM   7693 C CB  . PRO B 1 461 ? 117.959 41.981 -19.607 1.00 29.04  ? 458  PRO B CB  1 
ATOM   7694 C CG  . PRO B 1 461 ? 116.473 42.005 -19.744 1.00 27.77  ? 458  PRO B CG  1 
ATOM   7695 C CD  . PRO B 1 461 ? 116.169 43.417 -20.197 1.00 25.60  ? 458  PRO B CD  1 
ATOM   7696 N N   . LEU B 1 462 ? 119.967 44.545 -20.277 1.00 31.35  ? 459  LEU B N   1 
ATOM   7697 C CA  . LEU B 1 462 ? 121.342 44.952 -20.553 1.00 35.23  ? 459  LEU B CA  1 
ATOM   7698 C C   . LEU B 1 462 ? 121.842 46.039 -19.608 1.00 37.66  ? 459  LEU B C   1 
ATOM   7699 O O   . LEU B 1 462 ? 123.054 46.287 -19.561 1.00 36.62  ? 459  LEU B O   1 
ATOM   7700 C CB  . LEU B 1 462 ? 121.466 45.429 -21.996 1.00 33.33  ? 459  LEU B CB  1 
ATOM   7701 C CG  . LEU B 1 462 ? 121.100 44.372 -23.035 1.00 35.79  ? 459  LEU B CG  1 
ATOM   7702 C CD1 . LEU B 1 462 ? 120.928 45.034 -24.384 1.00 40.64  ? 459  LEU B CD1 1 
ATOM   7703 C CD2 . LEU B 1 462 ? 122.174 43.325 -23.099 1.00 38.61  ? 459  LEU B CD2 1 
ATOM   7704 N N   . ASP B 1 463 ? 120.942 46.697 -18.874 1.00 36.02  ? 460  ASP B N   1 
ATOM   7705 C CA  . ASP B 1 463 ? 121.305 47.711 -17.889 1.00 30.79  ? 460  ASP B CA  1 
ATOM   7706 C C   . ASP B 1 463 ? 122.282 47.124 -16.878 1.00 37.54  ? 460  ASP B C   1 
ATOM   7707 O O   . ASP B 1 463 ? 121.912 46.210 -16.122 1.00 36.58  ? 460  ASP B O   1 
ATOM   7708 C CB  . ASP B 1 463 ? 120.063 48.241 -17.172 1.00 36.12  ? 460  ASP B CB  1 
ATOM   7709 C CG  . ASP B 1 463 ? 120.313 49.558 -16.430 1.00 37.91  ? 460  ASP B CG  1 
ATOM   7710 O OD1 . ASP B 1 463 ? 121.386 49.713 -15.816 1.00 36.00  ? 460  ASP B OD1 1 
ATOM   7711 O OD2 . ASP B 1 463 ? 119.420 50.436 -16.460 1.00 45.45  ? 460  ASP B OD2 1 
ATOM   7712 N N   . PRO B 1 464 ? 123.522 47.618 -16.825 1.00 42.35  ? 461  PRO B N   1 
ATOM   7713 C CA  . PRO B 1 464 ? 124.499 47.047 -15.889 1.00 35.25  ? 461  PRO B CA  1 
ATOM   7714 C C   . PRO B 1 464 ? 124.102 47.218 -14.439 1.00 41.75  ? 461  PRO B C   1 
ATOM   7715 O O   . PRO B 1 464 ? 124.611 46.487 -13.582 1.00 39.26  ? 461  PRO B O   1 
ATOM   7716 C CB  . PRO B 1 464 ? 125.792 47.819 -16.200 1.00 37.90  ? 461  PRO B CB  1 
ATOM   7717 C CG  . PRO B 1 464 ? 125.509 48.648 -17.424 1.00 41.87  ? 461  PRO B CG  1 
ATOM   7718 C CD  . PRO B 1 464 ? 124.029 48.817 -17.515 1.00 40.78  ? 461  PRO B CD  1 
ATOM   7719 N N   . SER B 1 465 ? 123.215 48.160 -14.124 1.00 37.70  ? 462  SER B N   1 
ATOM   7720 C CA  . SER B 1 465 ? 122.819 48.319 -12.732 1.00 43.82  ? 462  SER B CA  1 
ATOM   7721 C C   . SER B 1 465 ? 121.751 47.322 -12.289 1.00 44.05  ? 462  SER B C   1 
ATOM   7722 O O   . SER B 1 465 ? 121.412 47.306 -11.104 1.00 42.62  ? 462  SER B O   1 
ATOM   7723 C CB  . SER B 1 465 ? 122.328 49.746 -12.478 1.00 36.85  ? 462  SER B CB  1 
ATOM   7724 O OG  . SER B 1 465 ? 121.003 49.915 -12.955 1.00 44.12  ? 462  SER B OG  1 
ATOM   7725 N N   . ARG B 1 466 ? 121.232 46.483 -13.181 1.00 38.67  ? 463  ARG B N   1 
ATOM   7726 C CA  . ARG B 1 466 ? 120.195 45.522 -12.822 1.00 40.43  ? 463  ARG B CA  1 
ATOM   7727 C C   . ARG B 1 466 ? 120.779 44.133 -12.617 1.00 38.35  ? 463  ARG B C   1 
ATOM   7728 O O   . ARG B 1 466 ? 121.918 43.846 -12.993 1.00 46.51  ? 463  ARG B O   1 
ATOM   7729 C CB  . ARG B 1 466 ? 119.121 45.480 -13.902 1.00 39.16  ? 463  ARG B CB  1 
ATOM   7730 C CG  . ARG B 1 466 ? 118.710 46.878 -14.285 1.00 35.56  ? 463  ARG B CG  1 
ATOM   7731 C CD  . ARG B 1 466 ? 117.271 47.131 -14.035 1.00 37.06  ? 463  ARG B CD  1 
ATOM   7732 N NE  . ARG B 1 466 ? 116.867 48.474 -14.433 1.00 48.69  ? 463  ARG B NE  1 
ATOM   7733 C CZ  . ARG B 1 466 ? 115.724 49.047 -14.073 1.00 50.79  ? 463  ARG B CZ  1 
ATOM   7734 N NH1 . ARG B 1 466 ? 114.806 48.407 -13.339 1.00 50.21  ? 463  ARG B NH1 1 
ATOM   7735 N NH2 . ARG B 1 466 ? 115.478 50.292 -14.478 1.00 52.31  ? 463  ARG B NH2 1 
ATOM   7736 N N   . ASN B 1 467 ? 119.955 43.246 -12.060 1.00 37.88  ? 464  ASN B N   1 
ATOM   7737 C CA  . ASN B 1 467 ? 120.402 41.913 -11.672 1.00 39.16  ? 464  ASN B CA  1 
ATOM   7738 C C   . ASN B 1 467 ? 119.743 40.815 -12.506 1.00 32.78  ? 464  ASN B C   1 
ATOM   7739 O O   . ASN B 1 467 ? 119.357 39.773 -11.983 1.00 37.95  ? 464  ASN B O   1 
ATOM   7740 C CB  . ASN B 1 467 ? 120.151 41.671 -10.180 1.00 43.15  ? 464  ASN B CB  1 
ATOM   7741 C CG  . ASN B 1 467 ? 120.940 40.471 -9.640  1.00 48.26  ? 464  ASN B CG  1 
ATOM   7742 O OD1 . ASN B 1 467 ? 121.966 40.104 -10.204 1.00 48.34  ? 464  ASN B OD1 1 
ATOM   7743 N ND2 . ASN B 1 467 ? 120.457 39.856 -8.557  1.00 50.37  ? 464  ASN B ND2 1 
ATOM   7744 N N   . TYR B 1 468 ? 119.615 41.018 -13.813 1.00 29.90  ? 465  TYR B N   1 
ATOM   7745 C CA  . TYR B 1 468 ? 119.136 39.939 -14.667 1.00 32.93  ? 465  TYR B CA  1 
ATOM   7746 C C   . TYR B 1 468 ? 120.227 38.895 -14.900 1.00 35.79  ? 465  TYR B C   1 
ATOM   7747 O O   . TYR B 1 468 ? 121.420 39.156 -14.723 1.00 32.83  ? 465  TYR B O   1 
ATOM   7748 C CB  . TYR B 1 468 ? 118.692 40.470 -16.021 1.00 29.71  ? 465  TYR B CB  1 
ATOM   7749 C CG  . TYR B 1 468 ? 117.439 41.303 -16.018 1.00 30.44  ? 465  TYR B CG  1 
ATOM   7750 C CD1 . TYR B 1 468 ? 117.487 42.665 -15.748 1.00 29.56  ? 465  TYR B CD1 1 
ATOM   7751 C CD2 . TYR B 1 468 ? 116.209 40.737 -16.315 1.00 28.25  ? 465  TYR B CD2 1 
ATOM   7752 C CE1 . TYR B 1 468 ? 116.343 43.435 -15.770 1.00 26.26  ? 465  TYR B CE1 1 
ATOM   7753 C CE2 . TYR B 1 468 ? 115.055 41.498 -16.334 1.00 25.52  ? 465  TYR B CE2 1 
ATOM   7754 C CZ  . TYR B 1 468 ? 115.129 42.850 -16.068 1.00 29.95  ? 465  TYR B CZ  1 
ATOM   7755 O OH  . TYR B 1 468 ? 113.981 43.616 -16.091 1.00 24.32  ? 465  TYR B OH  1 
ATOM   7756 N N   . THR B 1 469 ? 119.808 37.714 -15.358 1.00 33.95  ? 466  THR B N   1 
ATOM   7757 C CA  . THR B 1 469 ? 120.763 36.654 -15.662 1.00 32.56  ? 466  THR B CA  1 
ATOM   7758 C C   . THR B 1 469 ? 121.384 36.848 -17.048 1.00 32.17  ? 466  THR B C   1 
ATOM   7759 O O   . THR B 1 469 ? 120.869 37.580 -17.902 1.00 30.67  ? 466  THR B O   1 
ATOM   7760 C CB  . THR B 1 469 ? 120.100 35.270 -15.594 1.00 30.91  ? 466  THR B CB  1 
ATOM   7761 O OG1 . THR B 1 469 ? 119.345 35.029 -16.791 1.00 35.07  ? 466  THR B OG1 1 
ATOM   7762 C CG2 . THR B 1 469 ? 119.161 35.176 -14.383 1.00 29.92  ? 466  THR B CG2 1 
ATOM   7763 N N   . ALA B 1 470 ? 122.510 36.158 -17.262 1.00 36.40  ? 467  ALA B N   1 
ATOM   7764 C CA  . ALA B 1 470 ? 123.188 36.203 -18.554 1.00 37.36  ? 467  ALA B CA  1 
ATOM   7765 C C   . ALA B 1 470 ? 122.295 35.679 -19.670 1.00 33.42  ? 467  ALA B C   1 
ATOM   7766 O O   . ALA B 1 470 ? 122.293 36.225 -20.779 1.00 35.10  ? 467  ALA B O   1 
ATOM   7767 C CB  . ALA B 1 470 ? 124.490 35.399 -18.486 1.00 37.35  ? 467  ALA B CB  1 
ATOM   7768 N N   . GLU B 1 471 ? 121.513 34.630 -19.389 1.00 32.42  ? 468  GLU B N   1 
ATOM   7769 C CA  . GLU B 1 471 ? 120.598 34.089 -20.391 1.00 32.40  ? 468  GLU B CA  1 
ATOM   7770 C C   . GLU B 1 471 ? 119.509 35.090 -20.751 1.00 30.36  ? 468  GLU B C   1 
ATOM   7771 O O   . GLU B 1 471 ? 119.082 35.163 -21.912 1.00 29.67  ? 468  GLU B O   1 
ATOM   7772 C CB  . GLU B 1 471 ? 119.977 32.785 -19.884 1.00 39.30  ? 468  GLU B CB  1 
ATOM   7773 C CG  . GLU B 1 471 ? 120.963 31.635 -19.716 1.00 50.23  ? 468  GLU B CG  1 
ATOM   7774 C CD  . GLU B 1 471 ? 121.973 31.847 -18.579 1.00 61.83  ? 468  GLU B CD  1 
ATOM   7775 O OE1 . GLU B 1 471 ? 123.128 31.368 -18.717 1.00 65.85  ? 468  GLU B OE1 1 
ATOM   7776 O OE2 . GLU B 1 471 ? 121.619 32.490 -17.554 1.00 54.20  ? 468  GLU B OE2 1 
ATOM   7777 N N   . GLU B 1 472 ? 119.033 35.867 -19.764 1.00 33.42  ? 469  GLU B N   1 
ATOM   7778 C CA  . GLU B 1 472 ? 118.016 36.882 -20.046 1.00 34.46  ? 469  GLU B CA  1 
ATOM   7779 C C   . GLU B 1 472 ? 118.571 38.015 -20.906 1.00 28.83  ? 469  GLU B C   1 
ATOM   7780 O O   . GLU B 1 472 ? 117.824 38.632 -21.669 1.00 26.82  ? 469  GLU B O   1 
ATOM   7781 C CB  . GLU B 1 472 ? 117.426 37.423 -18.732 1.00 34.01  ? 469  GLU B CB  1 
ATOM   7782 C CG  . GLU B 1 472 ? 116.516 36.407 -18.006 1.00 34.15  ? 469  GLU B CG  1 
ATOM   7783 C CD  . GLU B 1 472 ? 115.990 36.914 -16.653 1.00 35.69  ? 469  GLU B CD  1 
ATOM   7784 O OE1 . GLU B 1 472 ? 116.811 37.330 -15.809 1.00 28.86  ? 469  GLU B OE1 1 
ATOM   7785 O OE2 . GLU B 1 472 ? 114.751 36.908 -16.446 1.00 32.33  ? 469  GLU B OE2 1 
ATOM   7786 N N   . LYS B 1 473 ? 119.873 38.304 -20.810 1.00 31.76  ? 470  LYS B N   1 
ATOM   7787 C CA  . LYS B 1 473 ? 120.447 39.310 -21.699 1.00 32.21  ? 470  LYS B CA  1 
ATOM   7788 C C   . LYS B 1 473 ? 120.447 38.820 -23.143 1.00 30.63  ? 470  LYS B C   1 
ATOM   7789 O O   . LYS B 1 473 ? 120.031 39.545 -24.060 1.00 35.40  ? 470  LYS B O   1 
ATOM   7790 C CB  . LYS B 1 473 ? 121.855 39.679 -21.237 1.00 31.04  ? 470  LYS B CB  1 
ATOM   7791 C CG  . LYS B 1 473 ? 121.867 40.533 -19.970 1.00 38.80  ? 470  LYS B CG  1 
ATOM   7792 C CD  . LYS B 1 473 ? 123.288 40.804 -19.484 1.00 39.78  ? 470  LYS B CD  1 
ATOM   7793 C CE  . LYS B 1 473 ? 123.296 41.608 -18.190 1.00 38.61  ? 470  LYS B CE  1 
ATOM   7794 N NZ  . LYS B 1 473 ? 124.658 41.630 -17.583 1.00 57.00  ? 470  LYS B NZ  1 
ATOM   7795 N N   . ILE B 1 474 ? 120.889 37.578 -23.359 1.00 35.16  ? 471  ILE B N   1 
ATOM   7796 C CA  . ILE B 1 474 ? 120.839 36.979 -24.692 1.00 29.72  ? 471  ILE B CA  1 
ATOM   7797 C C   . ILE B 1 474 ? 119.408 36.956 -25.202 1.00 29.95  ? 471  ILE B C   1 
ATOM   7798 O O   . ILE B 1 474 ? 119.127 37.339 -26.345 1.00 32.73  ? 471  ILE B O   1 
ATOM   7799 C CB  . ILE B 1 474 ? 121.447 35.567 -24.659 1.00 31.72  ? 471  ILE B CB  1 
ATOM   7800 C CG1 . ILE B 1 474 ? 122.942 35.642 -24.366 1.00 38.49  ? 471  ILE B CG1 1 
ATOM   7801 C CG2 . ILE B 1 474 ? 121.201 34.849 -25.967 1.00 36.76  ? 471  ILE B CG2 1 
ATOM   7802 C CD1 . ILE B 1 474 ? 123.539 34.301 -24.069 1.00 36.31  ? 471  ILE B CD1 1 
ATOM   7803 N N   . PHE B 1 475 ? 118.478 36.519 -24.345 1.00 33.78  ? 472  PHE B N   1 
ATOM   7804 C CA  . PHE B 1 475 ? 117.057 36.509 -24.692 1.00 28.71  ? 472  PHE B CA  1 
ATOM   7805 C C   . PHE B 1 475 ? 116.582 37.888 -25.138 1.00 25.49  ? 472  PHE B C   1 
ATOM   7806 O O   . PHE B 1 475 ? 115.933 38.028 -26.179 1.00 26.66  ? 472  PHE B O   1 
ATOM   7807 C CB  . PHE B 1 475 ? 116.259 36.022 -23.483 1.00 32.82  ? 472  PHE B CB  1 
ATOM   7808 C CG  . PHE B 1 475 ? 114.766 35.969 -23.696 1.00 31.04  ? 472  PHE B CG  1 
ATOM   7809 C CD1 . PHE B 1 475 ? 114.229 35.412 -24.839 1.00 29.48  ? 472  PHE B CD1 1 
ATOM   7810 C CD2 . PHE B 1 475 ? 113.904 36.435 -22.716 1.00 30.75  ? 472  PHE B CD2 1 
ATOM   7811 C CE1 . PHE B 1 475 ? 112.864 35.342 -25.016 1.00 31.93  ? 472  PHE B CE1 1 
ATOM   7812 C CE2 . PHE B 1 475 ? 112.541 36.372 -22.881 1.00 27.73  ? 472  PHE B CE2 1 
ATOM   7813 C CZ  . PHE B 1 475 ? 112.011 35.813 -24.035 1.00 29.92  ? 472  PHE B CZ  1 
ATOM   7814 N N   . ALA B 1 476 ? 116.896 38.924 -24.351 1.00 27.23  ? 473  ALA B N   1 
ATOM   7815 C CA  . ALA B 1 476 ? 116.484 40.285 -24.707 1.00 28.39  ? 473  ALA B CA  1 
ATOM   7816 C C   . ALA B 1 476 ? 117.032 40.707 -26.071 1.00 26.83  ? 473  ALA B C   1 
ATOM   7817 O O   . ALA B 1 476 ? 116.321 41.329 -26.873 1.00 28.51  ? 473  ALA B O   1 
ATOM   7818 C CB  . ALA B 1 476 ? 116.942 41.265 -23.623 1.00 24.97  ? 473  ALA B CB  1 
ATOM   7819 N N   . GLN B 1 477 ? 118.302 40.397 -26.342 1.00 28.91  ? 474  GLN B N   1 
ATOM   7820 C CA  . GLN B 1 477 ? 118.874 40.708 -27.650 1.00 31.26  ? 474  GLN B CA  1 
ATOM   7821 C C   . GLN B 1 477 ? 118.121 39.992 -28.766 1.00 33.05  ? 474  GLN B C   1 
ATOM   7822 O O   . GLN B 1 477 ? 117.845 40.592 -29.814 1.00 30.29  ? 474  GLN B O   1 
ATOM   7823 C CB  . GLN B 1 477 ? 120.363 40.348 -27.663 1.00 32.19  ? 474  GLN B CB  1 
ATOM   7824 C CG  . GLN B 1 477 ? 121.205 41.318 -26.836 1.00 30.00  ? 474  GLN B CG  1 
ATOM   7825 C CD  . GLN B 1 477 ? 122.565 40.770 -26.451 1.00 41.74  ? 474  GLN B CD  1 
ATOM   7826 O OE1 . GLN B 1 477 ? 122.701 39.613 -26.046 1.00 42.68  ? 474  GLN B OE1 1 
ATOM   7827 N NE2 . GLN B 1 477 ? 123.584 41.611 -26.565 1.00 45.43  ? 474  GLN B NE2 1 
ATOM   7828 N N   . ARG B 1 478 ? 117.753 38.716 -28.548 1.00 30.71  ? 475  ARG B N   1 
ATOM   7829 C CA  . ARG B 1 478 ? 116.944 37.993 -29.534 1.00 33.09  ? 475  ARG B CA  1 
ATOM   7830 C C   . ARG B 1 478 ? 115.666 38.748 -29.849 1.00 32.17  ? 475  ARG B C   1 
ATOM   7831 O O   . ARG B 1 478 ? 115.306 38.921 -31.019 1.00 31.49  ? 475  ARG B O   1 
ATOM   7832 C CB  . ARG B 1 478 ? 116.583 36.587 -29.037 1.00 34.32  ? 475  ARG B CB  1 
ATOM   7833 C CG  . ARG B 1 478 ? 117.620 35.507 -29.261 1.00 38.62  ? 475  ARG B CG  1 
ATOM   7834 C CD  . ARG B 1 478 ? 117.105 34.161 -28.721 1.00 39.44  ? 475  ARG B CD  1 
ATOM   7835 N NE  . ARG B 1 478 ? 115.795 33.855 -29.282 1.00 35.74  ? 475  ARG B NE  1 
ATOM   7836 C CZ  . ARG B 1 478 ? 114.841 33.185 -28.644 1.00 34.82  ? 475  ARG B CZ  1 
ATOM   7837 N NH1 . ARG B 1 478 ? 115.045 32.745 -27.405 1.00 29.70  ? 475  ARG B NH1 1 
ATOM   7838 N NH2 . ARG B 1 478 ? 113.675 32.974 -29.246 1.00 34.79  ? 475  ARG B NH2 1 
ATOM   7839 N N   . LEU B 1 479 ? 114.953 39.185 -28.806 1.00 28.26  ? 476  LEU B N   1 
ATOM   7840 C CA  . LEU B 1 479 ? 113.670 39.850 -29.014 1.00 29.00  ? 476  LEU B CA  1 
ATOM   7841 C C   . LEU B 1 479 ? 113.834 41.200 -29.703 1.00 24.74  ? 476  LEU B C   1 
ATOM   7842 O O   . LEU B 1 479 ? 113.017 41.560 -30.558 1.00 29.35  ? 476  LEU B O   1 
ATOM   7843 C CB  . LEU B 1 479 ? 112.940 40.020 -27.674 1.00 30.93  ? 476  LEU B CB  1 
ATOM   7844 C CG  . LEU B 1 479 ? 112.639 38.720 -26.938 1.00 29.05  ? 476  LEU B CG  1 
ATOM   7845 C CD1 . LEU B 1 479 ? 112.030 38.997 -25.584 1.00 30.58  ? 476  LEU B CD1 1 
ATOM   7846 C CD2 . LEU B 1 479 ? 111.714 37.885 -27.779 1.00 32.40  ? 476  LEU B CD2 1 
ATOM   7847 N N   . MET B 1 480 ? 114.853 41.984 -29.323 1.00 28.48  ? 477  MET B N   1 
ATOM   7848 C CA  . MET B 1 480 ? 115.050 43.277 -29.981 1.00 32.61  ? 477  MET B CA  1 
ATOM   7849 C C   . MET B 1 480 ? 115.332 43.091 -31.469 1.00 26.04  ? 477  MET B C   1 
ATOM   7850 O O   . MET B 1 480 ? 114.830 43.854 -32.308 1.00 24.58  ? 477  MET B O   1 
ATOM   7851 C CB  . MET B 1 480 ? 116.188 44.048 -29.310 1.00 31.17  ? 477  MET B CB  1 
ATOM   7852 C CG  . MET B 1 480 ? 115.906 44.464 -27.859 1.00 34.77  ? 477  MET B CG  1 
ATOM   7853 S SD  . MET B 1 480 ? 117.113 45.664 -27.242 1.00 28.45  ? 477  MET B SD  1 
ATOM   7854 C CE  . MET B 1 480 ? 118.526 44.590 -26.987 1.00 21.94  ? 477  MET B CE  1 
ATOM   7855 N N   . ARG B 1 481 ? 116.123 42.066 -31.810 1.00 30.34  ? 478  ARG B N   1 
ATOM   7856 C CA  . ARG B 1 481 ? 116.342 41.710 -33.212 1.00 34.16  ? 478  ARG B CA  1 
ATOM   7857 C C   . ARG B 1 481 ? 115.021 41.403 -33.921 1.00 32.89  ? 478  ARG B C   1 
ATOM   7858 O O   . ARG B 1 481 ? 114.763 41.925 -35.015 1.00 34.24  ? 478  ARG B O   1 
ATOM   7859 C CB  . ARG B 1 481 ? 117.311 40.525 -33.291 1.00 35.94  ? 478  ARG B CB  1 
ATOM   7860 C CG  . ARG B 1 481 ? 117.676 40.012 -34.713 1.00 39.80  ? 478  ARG B CG  1 
ATOM   7861 C CD  . ARG B 1 481 ? 118.390 41.042 -35.620 1.00 44.89  ? 478  ARG B CD  1 
ATOM   7862 N NE  . ARG B 1 481 ? 119.559 41.646 -34.982 1.00 43.89  ? 478  ARG B NE  1 
ATOM   7863 C CZ  . ARG B 1 481 ? 120.782 41.121 -34.956 1.00 47.13  ? 478  ARG B CZ  1 
ATOM   7864 N NH1 . ARG B 1 481 ? 121.043 39.963 -35.552 1.00 48.71  ? 478  ARG B NH1 1 
ATOM   7865 N NH2 . ARG B 1 481 ? 121.751 41.768 -34.320 1.00 45.44  ? 478  ARG B NH2 1 
ATOM   7866 N N   . TYR B 1 482 ? 114.158 40.571 -33.303 1.00 32.12  ? 479  TYR B N   1 
ATOM   7867 C CA  . TYR B 1 482 ? 112.852 40.271 -33.898 1.00 28.47  ? 479  TYR B CA  1 
ATOM   7868 C C   . TYR B 1 482 ? 112.081 41.549 -34.182 1.00 28.28  ? 479  TYR B C   1 
ATOM   7869 O O   . TYR B 1 482 ? 111.580 41.757 -35.293 1.00 26.54  ? 479  TYR B O   1 
ATOM   7870 C CB  . TYR B 1 482 ? 112.002 39.382 -32.978 1.00 31.02  ? 479  TYR B CB  1 
ATOM   7871 C CG  . TYR B 1 482 ? 112.443 37.948 -32.813 1.00 34.42  ? 479  TYR B CG  1 
ATOM   7872 C CD1 . TYR B 1 482 ? 112.814 37.164 -33.910 1.00 32.68  ? 479  TYR B CD1 1 
ATOM   7873 C CD2 . TYR B 1 482 ? 112.473 37.366 -31.551 1.00 32.05  ? 479  TYR B CD2 1 
ATOM   7874 C CE1 . TYR B 1 482 ? 113.219 35.847 -33.742 1.00 29.24  ? 479  TYR B CE1 1 
ATOM   7875 C CE2 . TYR B 1 482 ? 112.863 36.053 -31.375 1.00 37.15  ? 479  TYR B CE2 1 
ATOM   7876 C CZ  . TYR B 1 482 ? 113.240 35.300 -32.470 1.00 36.78  ? 479  TYR B CZ  1 
ATOM   7877 O OH  . TYR B 1 482 ? 113.636 34.006 -32.255 1.00 37.62  ? 479  TYR B OH  1 
ATOM   7878 N N   . TRP B 1 483 ? 111.949 42.407 -33.163 1.00 26.95  ? 480  TRP B N   1 
ATOM   7879 C CA  . TRP B 1 483 ? 111.165 43.628 -33.322 1.00 23.43  ? 480  TRP B CA  1 
ATOM   7880 C C   . TRP B 1 483 ? 111.779 44.545 -34.381 1.00 23.78  ? 480  TRP B C   1 
ATOM   7881 O O   . TRP B 1 483 ? 111.060 45.124 -35.197 1.00 24.60  ? 480  TRP B O   1 
ATOM   7882 C CB  . TRP B 1 483 ? 111.036 44.340 -31.964 1.00 24.35  ? 480  TRP B CB  1 
ATOM   7883 C CG  . TRP B 1 483 ? 109.678 44.127 -31.254 1.00 29.68  ? 480  TRP B CG  1 
ATOM   7884 C CD1 . TRP B 1 483 ? 108.750 45.083 -30.962 1.00 25.81  ? 480  TRP B CD1 1 
ATOM   7885 C CD2 . TRP B 1 483 ? 109.121 42.879 -30.783 1.00 23.20  ? 480  TRP B CD2 1 
ATOM   7886 N NE1 . TRP B 1 483 ? 107.667 44.521 -30.320 1.00 24.53  ? 480  TRP B NE1 1 
ATOM   7887 C CE2 . TRP B 1 483 ? 107.872 43.172 -30.199 1.00 27.19  ? 480  TRP B CE2 1 
ATOM   7888 C CE3 . TRP B 1 483 ? 109.565 41.546 -30.798 1.00 26.33  ? 480  TRP B CE3 1 
ATOM   7889 C CZ2 . TRP B 1 483 ? 107.050 42.180 -29.650 1.00 21.64  ? 480  TRP B CZ2 1 
ATOM   7890 C CZ3 . TRP B 1 483 ? 108.756 40.565 -30.234 1.00 26.57  ? 480  TRP B CZ3 1 
ATOM   7891 C CH2 . TRP B 1 483 ? 107.516 40.889 -29.668 1.00 23.00  ? 480  TRP B CH2 1 
ATOM   7892 N N   . ALA B 1 484 ? 113.109 44.685 -34.391 1.00 23.74  ? 481  ALA B N   1 
ATOM   7893 C CA  . ALA B 1 484 ? 113.728 45.557 -35.386 1.00 32.60  ? 481  ALA B CA  1 
ATOM   7894 C C   . ALA B 1 484 ? 113.646 44.950 -36.790 1.00 27.15  ? 481  ALA B C   1 
ATOM   7895 O O   . ALA B 1 484 ? 113.376 45.664 -37.763 1.00 28.86  ? 481  ALA B O   1 
ATOM   7896 C CB  . ALA B 1 484 ? 115.179 45.851 -34.995 1.00 29.56  ? 481  ALA B CB  1 
ATOM   7897 N N   . ASN B 1 485 ? 113.856 43.634 -36.917 1.00 34.43  ? 482  ASN B N   1 
ATOM   7898 C CA  . ASN B 1 485 ? 113.650 42.984 -38.217 1.00 32.69  ? 482  ASN B CA  1 
ATOM   7899 C C   . ASN B 1 485 ? 112.265 43.281 -38.752 1.00 32.91  ? 482  ASN B C   1 
ATOM   7900 O O   . ASN B 1 485 ? 112.100 43.641 -39.924 1.00 33.12  ? 482  ASN B O   1 
ATOM   7901 C CB  . ASN B 1 485 ? 113.844 41.475 -38.108 1.00 33.30  ? 482  ASN B CB  1 
ATOM   7902 C CG  . ASN B 1 485 ? 115.274 41.104 -38.040 1.00 34.69  ? 482  ASN B CG  1 
ATOM   7903 O OD1 . ASN B 1 485 ? 116.130 41.958 -38.260 1.00 35.63  ? 482  ASN B OD1 1 
ATOM   7904 N ND2 . ASN B 1 485 ? 115.567 39.839 -37.726 1.00 35.44  ? 482  ASN B ND2 1 
ATOM   7905 N N   . PHE B 1 486 ? 111.253 43.160 -37.889 1.00 27.69  ? 483  PHE B N   1 
ATOM   7906 C CA  . PHE B 1 486 ? 109.899 43.465 -38.312 1.00 25.07  ? 483  PHE B CA  1 
ATOM   7907 C C   . PHE B 1 486 ? 109.750 44.937 -38.704 1.00 30.20  ? 483  PHE B C   1 
ATOM   7908 O O   . PHE B 1 486 ? 108.980 45.273 -39.613 1.00 27.50  ? 483  PHE B O   1 
ATOM   7909 C CB  . PHE B 1 486 ? 108.919 43.094 -37.198 1.00 26.41  ? 483  PHE B CB  1 
ATOM   7910 C CG  . PHE B 1 486 ? 107.513 43.404 -37.544 1.00 23.59  ? 483  PHE B CG  1 
ATOM   7911 C CD1 . PHE B 1 486 ? 106.812 42.579 -38.416 1.00 23.61  ? 483  PHE B CD1 1 
ATOM   7912 C CD2 . PHE B 1 486 ? 106.899 44.538 -37.052 1.00 18.72  ? 483  PHE B CD2 1 
ATOM   7913 C CE1 . PHE B 1 486 ? 105.513 42.872 -38.772 1.00 25.07  ? 483  PHE B CE1 1 
ATOM   7914 C CE2 . PHE B 1 486 ? 105.596 44.838 -37.397 1.00 28.57  ? 483  PHE B CE2 1 
ATOM   7915 C CZ  . PHE B 1 486 ? 104.896 44.001 -38.271 1.00 27.07  ? 483  PHE B CZ  1 
ATOM   7916 N N   . ALA B 1 487 ? 110.430 45.844 -37.998 1.00 29.67  ? 484  ALA B N   1 
ATOM   7917 C CA  . ALA B 1 487 ? 110.293 47.252 -38.360 1.00 32.82  ? 484  ALA B CA  1 
ATOM   7918 C C   . ALA B 1 487 ? 110.984 47.535 -39.688 1.00 26.16  ? 484  ALA B C   1 
ATOM   7919 O O   . ALA B 1 487 ? 110.468 48.294 -40.513 1.00 26.30  ? 484  ALA B O   1 
ATOM   7920 C CB  . ALA B 1 487 ? 110.856 48.150 -37.256 1.00 30.30  ? 484  ALA B CB  1 
ATOM   7921 N N   . ARG B 1 488 ? 112.142 46.917 -39.913 1.00 22.33  ? 485  ARG B N   1 
ATOM   7922 C CA  . ARG B 1 488 ? 112.863 47.112 -41.171 1.00 30.42  ? 485  ARG B CA  1 
ATOM   7923 C C   . ARG B 1 488 ? 112.113 46.489 -42.350 1.00 36.98  ? 485  ARG B C   1 
ATOM   7924 O O   . ARG B 1 488 ? 111.803 47.174 -43.332 1.00 33.39  ? 485  ARG B O   1 
ATOM   7925 C CB  . ARG B 1 488 ? 114.277 46.524 -41.063 1.00 31.09  ? 485  ARG B CB  1 
ATOM   7926 C CG  . ARG B 1 488 ? 115.217 47.371 -40.217 1.00 29.07  ? 485  ARG B CG  1 
ATOM   7927 C CD  . ARG B 1 488 ? 116.608 46.812 -40.105 1.00 30.45  ? 485  ARG B CD  1 
ATOM   7928 N NE  . ARG B 1 488 ? 116.680 45.594 -39.301 1.00 35.71  ? 485  ARG B NE  1 
ATOM   7929 C CZ  . ARG B 1 488 ? 117.133 45.523 -38.051 1.00 35.28  ? 485  ARG B CZ  1 
ATOM   7930 N NH1 . ARG B 1 488 ? 117.569 46.613 -37.415 1.00 36.07  ? 485  ARG B NH1 1 
ATOM   7931 N NH2 . ARG B 1 488 ? 117.156 44.350 -37.435 1.00 30.21  ? 485  ARG B NH2 1 
ATOM   7932 N N   . THR B 1 489 ? 111.779 45.196 -42.251 1.00 35.15  ? 486  THR B N   1 
ATOM   7933 C CA  . THR B 1 489 ? 111.376 44.404 -43.404 1.00 39.19  ? 486  THR B CA  1 
ATOM   7934 C C   . THR B 1 489 ? 109.938 43.913 -43.382 1.00 38.41  ? 486  THR B C   1 
ATOM   7935 O O   . THR B 1 489 ? 109.488 43.363 -44.389 1.00 42.39  ? 486  THR B O   1 
ATOM   7936 C CB  . THR B 1 489 ? 112.294 43.182 -43.554 1.00 38.23  ? 486  THR B CB  1 
ATOM   7937 O OG1 . THR B 1 489 ? 112.080 42.278 -42.459 1.00 37.28  ? 486  THR B OG1 1 
ATOM   7938 C CG2 . THR B 1 489 ? 113.758 43.613 -43.586 1.00 34.19  ? 486  THR B CG2 1 
ATOM   7939 N N   . GLY B 1 490 ? 109.198 44.102 -42.294 1.00 36.58  ? 487  GLY B N   1 
ATOM   7940 C CA  . GLY B 1 490 ? 107.874 43.529 -42.201 1.00 30.23  ? 487  GLY B CA  1 
ATOM   7941 C C   . GLY B 1 490 ? 107.859 42.077 -41.779 1.00 31.69  ? 487  GLY B C   1 
ATOM   7942 O O   . GLY B 1 490 ? 106.800 41.438 -41.824 1.00 33.02  ? 487  GLY B O   1 
ATOM   7943 N N   . ASP B 1 491 ? 108.983 41.555 -41.331 1.00 29.82  ? 488  ASP B N   1 
ATOM   7944 C CA  . ASP B 1 491 ? 109.164 40.131 -41.122 1.00 33.31  ? 488  ASP B CA  1 
ATOM   7945 C C   . ASP B 1 491 ? 110.175 39.946 -40.001 1.00 33.62  ? 488  ASP B C   1 
ATOM   7946 O O   . ASP B 1 491 ? 111.328 40.375 -40.132 1.00 38.74  ? 488  ASP B O   1 
ATOM   7947 C CB  . ASP B 1 491 ? 109.624 39.497 -42.442 1.00 38.18  ? 488  ASP B CB  1 
ATOM   7948 C CG  . ASP B 1 491 ? 109.830 37.994 -42.359 1.00 42.43  ? 488  ASP B CG  1 
ATOM   7949 O OD1 . ASP B 1 491 ? 110.102 37.454 -41.262 1.00 40.61  ? 488  ASP B OD1 1 
ATOM   7950 O OD2 . ASP B 1 491 ? 109.747 37.351 -43.436 1.00 46.51  ? 488  ASP B OD2 1 
ATOM   7951 N N   . PRO B 1 492 ? 109.792 39.322 -38.885 1.00 37.58  ? 489  PRO B N   1 
ATOM   7952 C CA  . PRO B 1 492 ? 110.731 39.208 -37.753 1.00 33.24  ? 489  PRO B CA  1 
ATOM   7953 C C   . PRO B 1 492 ? 111.869 38.247 -38.002 1.00 38.95  ? 489  PRO B C   1 
ATOM   7954 O O   . PRO B 1 492 ? 112.868 38.295 -37.265 1.00 36.90  ? 489  PRO B O   1 
ATOM   7955 C CB  . PRO B 1 492 ? 109.839 38.725 -36.598 1.00 33.89  ? 489  PRO B CB  1 
ATOM   7956 C CG  . PRO B 1 492 ? 108.667 38.064 -37.271 1.00 37.38  ? 489  PRO B CG  1 
ATOM   7957 C CD  . PRO B 1 492 ? 108.452 38.794 -38.567 1.00 33.19  ? 489  PRO B CD  1 
ATOM   7958 N N   . ASN B 1 493 ? 111.748 37.374 -39.003 1.00 44.08  ? 490  ASN B N   1 
ATOM   7959 C CA  . ASN B 1 493 ? 112.775 36.376 -39.282 1.00 40.28  ? 490  ASN B CA  1 
ATOM   7960 C C   . ASN B 1 493 ? 114.024 37.026 -39.842 1.00 46.93  ? 490  ASN B C   1 
ATOM   7961 O O   . ASN B 1 493 ? 113.949 37.971 -40.636 1.00 45.61  ? 490  ASN B O   1 
ATOM   7962 C CB  . ASN B 1 493 ? 112.273 35.348 -40.292 1.00 46.05  ? 490  ASN B CB  1 
ATOM   7963 C CG  . ASN B 1 493 ? 111.161 34.505 -39.756 1.00 36.45  ? 490  ASN B CG  1 
ATOM   7964 O OD1 . ASN B 1 493 ? 111.392 33.574 -38.992 1.00 43.02  ? 490  ASN B OD1 1 
ATOM   7965 N ND2 . ASN B 1 493 ? 109.943 34.810 -40.165 1.00 33.38  ? 490  ASN B ND2 1 
ATOM   7966 N N   . GLU B 1 494 ? 115.171 36.473 -39.462 1.00 49.42  ? 491  GLU B N   1 
ATOM   7967 C CA  . GLU B 1 494 ? 116.462 36.998 -39.891 1.00 68.98  ? 491  GLU B CA  1 
ATOM   7968 C C   . GLU B 1 494 ? 116.660 36.794 -41.386 1.00 77.97  ? 491  GLU B C   1 
ATOM   7969 O O   . GLU B 1 494 ? 116.678 35.644 -41.849 1.00 79.43  ? 491  GLU B O   1 
ATOM   7970 C CB  . GLU B 1 494 ? 117.585 36.319 -39.125 1.00 73.62  ? 491  GLU B CB  1 
ATOM   7971 C CG  . GLU B 1 494 ? 117.448 36.448 -37.636 1.00 67.34  ? 491  GLU B CG  1 
ATOM   7972 C CD  . GLU B 1 494 ? 118.639 37.132 -37.038 1.00 70.44  ? 491  GLU B CD  1 
ATOM   7973 O OE1 . GLU B 1 494 ? 118.875 38.305 -37.415 1.00 63.78  ? 491  GLU B OE1 1 
ATOM   7974 O OE2 . GLU B 1 494 ? 119.338 36.496 -36.213 1.00 70.15  ? 491  GLU B OE2 1 
ATOM   7975 N N   . PRO B 1 495 ? 116.838 37.862 -42.169 1.00 76.55  ? 492  PRO B N   1 
ATOM   7976 C CA  . PRO B 1 495 ? 117.092 37.687 -43.606 1.00 82.90  ? 492  PRO B CA  1 
ATOM   7977 C C   . PRO B 1 495 ? 118.360 36.898 -43.910 1.00 93.76  ? 492  PRO B C   1 
ATOM   7978 O O   . PRO B 1 495 ? 118.602 36.569 -45.081 1.00 95.74  ? 492  PRO B O   1 
ATOM   7979 C CB  . PRO B 1 495 ? 117.198 39.130 -44.117 1.00 79.38  ? 492  PRO B CB  1 
ATOM   7980 C CG  . PRO B 1 495 ? 117.613 39.918 -42.915 1.00 75.48  ? 492  PRO B CG  1 
ATOM   7981 C CD  . PRO B 1 495 ? 116.913 39.276 -41.761 1.00 64.86  ? 492  PRO B CD  1 
ATOM   7982 N N   . ARG B 1 496 ? 119.164 36.572 -42.896 1.00 97.15  ? 493  ARG B N   1 
ATOM   7983 C CA  . ARG B 1 496 ? 120.470 35.968 -43.093 1.00 102.50 ? 493  ARG B CA  1 
ATOM   7984 C C   . ARG B 1 496 ? 120.652 34.636 -42.382 1.00 105.03 ? 493  ARG B C   1 
ATOM   7985 O O   . ARG B 1 496 ? 121.670 33.971 -42.613 1.00 111.53 ? 493  ARG B O   1 
ATOM   7986 C CB  . ARG B 1 496 ? 121.573 36.933 -42.625 1.00 107.53 ? 493  ARG B CB  1 
ATOM   7987 C CG  . ARG B 1 496 ? 121.487 38.315 -43.257 1.00 109.22 ? 493  ARG B CG  1 
ATOM   7988 C CD  . ARG B 1 496 ? 122.548 39.262 -42.716 1.00 117.32 ? 493  ARG B CD  1 
ATOM   7989 N NE  . ARG B 1 496 ? 122.510 40.553 -43.402 1.00 124.09 ? 493  ARG B NE  1 
ATOM   7990 C CZ  . ARG B 1 496 ? 123.348 41.558 -43.164 1.00 126.00 ? 493  ARG B CZ  1 
ATOM   7991 N NH1 . ARG B 1 496 ? 124.301 41.433 -42.249 1.00 123.25 ? 493  ARG B NH1 1 
ATOM   7992 N NH2 . ARG B 1 496 ? 123.233 42.693 -43.842 1.00 127.94 ? 493  ARG B NH2 1 
ATOM   7993 N N   . ASP B 1 497 ? 119.717 34.222 -41.527 1.00 97.13  ? 494  ASP B N   1 
ATOM   7994 C CA  . ASP B 1 497 ? 119.867 32.993 -40.750 1.00 101.21 ? 494  ASP B CA  1 
ATOM   7995 C C   . ASP B 1 497 ? 118.787 32.004 -41.164 1.00 102.60 ? 494  ASP B C   1 
ATOM   7996 O O   . ASP B 1 497 ? 117.702 31.970 -40.561 1.00 99.52  ? 494  ASP B O   1 
ATOM   7997 C CB  . ASP B 1 497 ? 119.806 33.276 -39.249 1.00 99.20  ? 494  ASP B CB  1 
ATOM   7998 C CG  . ASP B 1 497 ? 120.844 32.488 -38.463 1.00 102.03 ? 494  ASP B CG  1 
ATOM   7999 O OD1 . ASP B 1 497 ? 121.083 31.305 -38.800 1.00 98.67  ? 494  ASP B OD1 1 
ATOM   8000 O OD2 . ASP B 1 497 ? 121.421 33.053 -37.507 1.00 97.73  ? 494  ASP B OD2 1 
ATOM   8001 N N   . PRO B 1 498 ? 119.031 31.187 -42.195 1.00 107.65 ? 495  PRO B N   1 
ATOM   8002 C CA  . PRO B 1 498 ? 118.142 30.042 -42.446 1.00 103.55 ? 495  PRO B CA  1 
ATOM   8003 C C   . PRO B 1 498 ? 118.329 28.925 -41.434 1.00 101.19 ? 495  PRO B C   1 
ATOM   8004 O O   . PRO B 1 498 ? 117.510 27.996 -41.399 1.00 99.15  ? 495  PRO B O   1 
ATOM   8005 C CB  . PRO B 1 498 ? 118.540 29.592 -43.856 1.00 101.43 ? 495  PRO B CB  1 
ATOM   8006 C CG  . PRO B 1 498 ? 119.985 29.964 -43.951 1.00 105.67 ? 495  PRO B CG  1 
ATOM   8007 C CD  . PRO B 1 498 ? 120.146 31.243 -43.157 1.00 104.37 ? 495  PRO B CD  1 
ATOM   8008 N N   . LYS B 1 499 ? 119.381 29.001 -40.610 1.00 98.91  ? 496  LYS B N   1 
ATOM   8009 C CA  . LYS B 1 499 ? 119.603 28.007 -39.565 1.00 98.17  ? 496  LYS B CA  1 
ATOM   8010 C C   . LYS B 1 499 ? 118.628 28.194 -38.407 1.00 97.10  ? 496  LYS B C   1 
ATOM   8011 O O   . LYS B 1 499 ? 117.924 27.252 -38.019 1.00 93.77  ? 496  LYS B O   1 
ATOM   8012 C CB  . LYS B 1 499 ? 121.042 28.093 -39.060 1.00 101.61 ? 496  LYS B CB  1 
ATOM   8013 C CG  . LYS B 1 499 ? 122.073 28.323 -40.144 1.00 103.40 ? 496  LYS B CG  1 
ATOM   8014 C CD  . LYS B 1 499 ? 123.466 28.361 -39.547 1.00 100.68 ? 496  LYS B CD  1 
ATOM   8015 C CE  . LYS B 1 499 ? 124.525 28.363 -40.631 1.00 99.88  ? 496  LYS B CE  1 
ATOM   8016 N NZ  . LYS B 1 499 ? 125.891 28.508 -40.056 1.00 100.52 ? 496  LYS B NZ  1 
ATOM   8017 N N   . ALA B 1 500 ? 118.592 29.398 -37.832 1.00 98.62  ? 497  ALA B N   1 
ATOM   8018 C CA  . ALA B 1 500 ? 117.691 29.695 -36.725 1.00 84.76  ? 497  ALA B CA  1 
ATOM   8019 C C   . ALA B 1 500 ? 116.259 29.300 -37.090 1.00 76.71  ? 497  ALA B C   1 
ATOM   8020 O O   . ALA B 1 500 ? 115.831 29.488 -38.236 1.00 74.59  ? 497  ALA B O   1 
ATOM   8021 C CB  . ALA B 1 500 ? 117.751 31.180 -36.366 1.00 79.98  ? 497  ALA B CB  1 
ATOM   8022 N N   . PRO B 1 501 ? 115.499 28.736 -36.157 1.00 72.47  ? 498  PRO B N   1 
ATOM   8023 C CA  . PRO B 1 501 ? 114.149 28.260 -36.486 1.00 64.12  ? 498  PRO B CA  1 
ATOM   8024 C C   . PRO B 1 501 ? 113.277 29.440 -36.884 1.00 53.42  ? 498  PRO B C   1 
ATOM   8025 O O   . PRO B 1 501 ? 113.445 30.557 -36.387 1.00 56.61  ? 498  PRO B O   1 
ATOM   8026 C CB  . PRO B 1 501 ? 113.660 27.602 -35.193 1.00 62.05  ? 498  PRO B CB  1 
ATOM   8027 C CG  . PRO B 1 501 ? 114.635 28.030 -34.107 1.00 61.46  ? 498  PRO B CG  1 
ATOM   8028 C CD  . PRO B 1 501 ? 115.867 28.569 -34.729 1.00 59.60  ? 498  PRO B CD  1 
ATOM   8029 N N   . GLN B 1 502 ? 112.355 29.199 -37.805 1.00 48.62  ? 499  GLN B N   1 
ATOM   8030 C CA  . GLN B 1 502 ? 111.627 30.282 -38.425 1.00 44.50  ? 499  GLN B CA  1 
ATOM   8031 C C   . GLN B 1 502 ? 110.345 30.591 -37.666 1.00 45.78  ? 499  GLN B C   1 
ATOM   8032 O O   . GLN B 1 502 ? 109.802 29.767 -36.934 1.00 43.83  ? 499  GLN B O   1 
ATOM   8033 C CB  . GLN B 1 502 ? 111.292 29.955 -39.884 1.00 47.92  ? 499  GLN B CB  1 
ATOM   8034 C CG  . GLN B 1 502 ? 112.501 29.851 -40.813 1.00 55.50  ? 499  GLN B CG  1 
ATOM   8035 C CD  . GLN B 1 502 ? 113.382 31.094 -40.799 1.00 55.53  ? 499  GLN B CD  1 
ATOM   8036 O OE1 . GLN B 1 502 ? 114.460 31.099 -40.194 1.00 60.01  ? 499  GLN B OE1 1 
ATOM   8037 N NE2 . GLN B 1 502 ? 112.936 32.149 -41.486 1.00 42.22  ? 499  GLN B NE2 1 
ATOM   8038 N N   . TRP B 1 503 ? 109.858 31.811 -37.876 1.00 42.38  ? 500  TRP B N   1 
ATOM   8039 C CA  . TRP B 1 503 ? 108.602 32.297 -37.327 1.00 38.94  ? 500  TRP B CA  1 
ATOM   8040 C C   . TRP B 1 503 ? 107.601 32.368 -38.468 1.00 40.01  ? 500  TRP B C   1 
ATOM   8041 O O   . TRP B 1 503 ? 107.657 33.304 -39.287 1.00 34.39  ? 500  TRP B O   1 
ATOM   8042 C CB  . TRP B 1 503 ? 108.823 33.671 -36.700 1.00 39.04  ? 500  TRP B CB  1 
ATOM   8043 C CG  . TRP B 1 503 ? 107.689 34.262 -35.939 1.00 38.95  ? 500  TRP B CG  1 
ATOM   8044 C CD1 . TRP B 1 503 ? 106.351 34.038 -36.108 1.00 40.60  ? 500  TRP B CD1 1 
ATOM   8045 C CD2 . TRP B 1 503 ? 107.809 35.220 -34.890 1.00 38.90  ? 500  TRP B CD2 1 
ATOM   8046 N NE1 . TRP B 1 503 ? 105.631 34.796 -35.212 1.00 34.25  ? 500  TRP B NE1 1 
ATOM   8047 C CE2 . TRP B 1 503 ? 106.509 35.533 -34.457 1.00 37.58  ? 500  TRP B CE2 1 
ATOM   8048 C CE3 . TRP B 1 503 ? 108.902 35.846 -34.272 1.00 38.20  ? 500  TRP B CE3 1 
ATOM   8049 C CZ2 . TRP B 1 503 ? 106.270 36.440 -33.433 1.00 34.39  ? 500  TRP B CZ2 1 
ATOM   8050 C CZ3 . TRP B 1 503 ? 108.667 36.742 -33.260 1.00 33.14  ? 500  TRP B CZ3 1 
ATOM   8051 C CH2 . TRP B 1 503 ? 107.361 37.032 -32.848 1.00 36.23  ? 500  TRP B CH2 1 
ATOM   8052 N N   . PRO B 1 504 ? 106.689 31.404 -38.575 1.00 30.62  ? 501  PRO B N   1 
ATOM   8053 C CA  . PRO B 1 504 ? 105.760 31.368 -39.705 1.00 35.93  ? 501  PRO B CA  1 
ATOM   8054 C C   . PRO B 1 504 ? 104.663 32.398 -39.536 1.00 34.84  ? 501  PRO B C   1 
ATOM   8055 O O   . PRO B 1 504 ? 104.296 32.742 -38.405 1.00 36.35  ? 501  PRO B O   1 
ATOM   8056 C CB  . PRO B 1 504 ? 105.189 29.941 -39.647 1.00 35.84  ? 501  PRO B CB  1 
ATOM   8057 C CG  . PRO B 1 504 ? 105.318 29.555 -38.210 1.00 32.80  ? 501  PRO B CG  1 
ATOM   8058 C CD  . PRO B 1 504 ? 106.596 30.198 -37.732 1.00 37.65  ? 501  PRO B CD  1 
ATOM   8059 N N   . PRO B 1 505 ? 104.124 32.923 -40.630 1.00 32.15  ? 502  PRO B N   1 
ATOM   8060 C CA  . PRO B 1 505 ? 102.983 33.835 -40.519 1.00 32.61  ? 502  PRO B CA  1 
ATOM   8061 C C   . PRO B 1 505 ? 101.798 33.169 -39.841 1.00 35.75  ? 502  PRO B C   1 
ATOM   8062 O O   . PRO B 1 505 ? 101.668 31.945 -39.799 1.00 38.00  ? 502  PRO B O   1 
ATOM   8063 C CB  . PRO B 1 505 ? 102.661 34.191 -41.975 1.00 30.30  ? 502  PRO B CB  1 
ATOM   8064 C CG  . PRO B 1 505 ? 103.970 34.054 -42.675 1.00 34.08  ? 502  PRO B CG  1 
ATOM   8065 C CD  . PRO B 1 505 ? 104.731 32.949 -41.972 1.00 37.33  ? 502  PRO B CD  1 
ATOM   8066 N N   . TYR B 1 506 ? 100.942 34.010 -39.276 1.00 38.44  ? 503  TYR B N   1 
ATOM   8067 C CA  . TYR B 1 506 ? 99.692  33.584 -38.681 1.00 31.42  ? 503  TYR B CA  1 
ATOM   8068 C C   . TYR B 1 506 ? 98.616  33.695 -39.748 1.00 35.49  ? 503  TYR B C   1 
ATOM   8069 O O   . TYR B 1 506 ? 98.525  34.717 -40.435 1.00 32.71  ? 503  TYR B O   1 
ATOM   8070 C CB  . TYR B 1 506 ? 99.351  34.452 -37.465 1.00 29.84  ? 503  TYR B CB  1 
ATOM   8071 C CG  . TYR B 1 506 ? 98.030  34.135 -36.783 1.00 25.98  ? 503  TYR B CG  1 
ATOM   8072 C CD1 . TYR B 1 506 ? 96.837  34.670 -37.249 1.00 30.37  ? 503  TYR B CD1 1 
ATOM   8073 C CD2 . TYR B 1 506 ? 97.986  33.307 -35.665 1.00 23.77  ? 503  TYR B CD2 1 
ATOM   8074 C CE1 . TYR B 1 506 ? 95.634  34.377 -36.626 1.00 28.15  ? 503  TYR B CE1 1 
ATOM   8075 C CE2 . TYR B 1 506 ? 96.802  33.017 -35.036 1.00 23.85  ? 503  TYR B CE2 1 
ATOM   8076 C CZ  . TYR B 1 506 ? 95.631  33.552 -35.515 1.00 26.97  ? 503  TYR B CZ  1 
ATOM   8077 O OH  . TYR B 1 506 ? 94.443  33.253 -34.880 1.00 32.70  ? 503  TYR B OH  1 
ATOM   8078 N N   . THR B 1 507 ? 97.806  32.642 -39.882 1.00 34.37  ? 504  THR B N   1 
ATOM   8079 C CA  . THR B 1 507 ? 96.743  32.564 -40.874 1.00 34.65  ? 504  THR B CA  1 
ATOM   8080 C C   . THR B 1 507 ? 95.447  32.182 -40.184 1.00 35.48  ? 504  THR B C   1 
ATOM   8081 O O   . THR B 1 507 ? 95.461  31.458 -39.183 1.00 38.79  ? 504  THR B O   1 
ATOM   8082 C CB  . THR B 1 507 ? 97.060  31.529 -41.947 1.00 37.12  ? 504  THR B CB  1 
ATOM   8083 O OG1 . THR B 1 507 ? 97.433  30.293 -41.310 1.00 38.21  ? 504  THR B OG1 1 
ATOM   8084 C CG2 . THR B 1 507 ? 98.213  32.007 -42.820 1.00 40.94  ? 504  THR B CG2 1 
ATOM   8085 N N   . ALA B 1 508 ? 94.322  32.663 -40.727 1.00 31.95  ? 505  ALA B N   1 
ATOM   8086 C CA  . ALA B 1 508 ? 93.033  32.330 -40.128 1.00 35.88  ? 505  ALA B CA  1 
ATOM   8087 C C   . ALA B 1 508 ? 92.787  30.821 -40.079 1.00 42.89  ? 505  ALA B C   1 
ATOM   8088 O O   . ALA B 1 508 ? 92.028  30.358 -39.216 1.00 45.74  ? 505  ALA B O   1 
ATOM   8089 C CB  . ALA B 1 508 ? 91.906  33.033 -40.885 1.00 35.53  ? 505  ALA B CB  1 
ATOM   8090 N N   . GLY B 1 509 ? 93.431  30.047 -40.956 1.00 38.83  ? 506  GLY B N   1 
ATOM   8091 C CA  . GLY B 1 509 ? 93.313  28.602 -40.953 1.00 33.37  ? 506  GLY B CA  1 
ATOM   8092 C C   . GLY B 1 509 ? 94.276  27.855 -40.050 1.00 36.92  ? 506  GLY B C   1 
ATOM   8093 O O   . GLY B 1 509 ? 93.850  27.192 -39.100 1.00 47.31  ? 506  GLY B O   1 
ATOM   8094 N N   . ALA B 1 510 ? 95.579  27.942 -40.325 1.00 30.27  ? 507  ALA B N   1 
ATOM   8095 C CA  . ALA B 1 510 ? 96.540  27.184 -39.531 1.00 32.97  ? 507  ALA B CA  1 
ATOM   8096 C C   . ALA B 1 510 ? 96.767  27.794 -38.144 1.00 34.11  ? 507  ALA B C   1 
ATOM   8097 O O   . ALA B 1 510 ? 97.196  27.084 -37.226 1.00 35.96  ? 507  ALA B O   1 
ATOM   8098 C CB  . ALA B 1 510 ? 97.864  27.075 -40.292 1.00 31.80  ? 507  ALA B CB  1 
ATOM   8099 N N   . GLN B 1 511 ? 96.532  29.102 -37.981 1.00 35.52  ? 508  GLN B N   1 
ATOM   8100 C CA  . GLN B 1 511 ? 96.598  29.780 -36.671 1.00 33.28  ? 508  GLN B CA  1 
ATOM   8101 C C   . GLN B 1 511 ? 97.927  29.539 -35.953 1.00 27.93  ? 508  GLN B C   1 
ATOM   8102 O O   . GLN B 1 511 ? 97.968  29.278 -34.749 1.00 32.67  ? 508  GLN B O   1 
ATOM   8103 C CB  . GLN B 1 511 ? 95.414  29.360 -35.791 1.00 28.67  ? 508  GLN B CB  1 
ATOM   8104 C CG  . GLN B 1 511 ? 94.095  29.893 -36.348 1.00 35.94  ? 508  GLN B CG  1 
ATOM   8105 C CD  . GLN B 1 511 ? 92.871  29.324 -35.670 1.00 41.34  ? 508  GLN B CD  1 
ATOM   8106 O OE1 . GLN B 1 511 ? 92.669  29.500 -34.469 1.00 42.90  ? 508  GLN B OE1 1 
ATOM   8107 N NE2 . GLN B 1 511 ? 92.033  28.645 -36.445 1.00 45.98  ? 508  GLN B NE2 1 
ATOM   8108 N N   . GLN B 1 512 ? 99.032  29.613 -36.692 1.00 26.61  ? 509  GLN B N   1 
ATOM   8109 C CA  . GLN B 1 512 ? 100.322 29.317 -36.095 1.00 26.63  ? 509  GLN B CA  1 
ATOM   8110 C C   . GLN B 1 512 ? 100.896 30.557 -35.404 1.00 32.34  ? 509  GLN B C   1 
ATOM   8111 O O   . GLN B 1 512 ? 100.633 31.693 -35.806 1.00 31.01  ? 509  GLN B O   1 
ATOM   8112 C CB  . GLN B 1 512 ? 101.310 28.830 -37.146 1.00 35.02  ? 509  GLN B CB  1 
ATOM   8113 C CG  . GLN B 1 512 ? 100.930 27.571 -37.894 1.00 36.32  ? 509  GLN B CG  1 
ATOM   8114 C CD  . GLN B 1 512 ? 101.921 27.292 -39.007 1.00 34.44  ? 509  GLN B CD  1 
ATOM   8115 O OE1 . GLN B 1 512 ? 102.892 26.566 -38.814 1.00 36.79  ? 509  GLN B OE1 1 
ATOM   8116 N NE2 . GLN B 1 512 ? 101.704 27.910 -40.164 1.00 35.79  ? 509  GLN B NE2 1 
ATOM   8117 N N   . TYR B 1 513 ? 101.684 30.317 -34.358 1.00 28.97  ? 510  TYR B N   1 
ATOM   8118 C CA  . TYR B 1 513 ? 102.267 31.361 -33.526 1.00 31.79  ? 510  TYR B CA  1 
ATOM   8119 C C   . TYR B 1 513 ? 103.477 30.743 -32.849 1.00 28.18  ? 510  TYR B C   1 
ATOM   8120 O O   . TYR B 1 513 ? 103.630 29.519 -32.836 1.00 31.35  ? 510  TYR B O   1 
ATOM   8121 C CB  . TYR B 1 513 ? 101.249 31.906 -32.501 1.00 28.82  ? 510  TYR B CB  1 
ATOM   8122 C CG  . TYR B 1 513 ? 100.920 30.938 -31.374 1.00 29.56  ? 510  TYR B CG  1 
ATOM   8123 C CD1 . TYR B 1 513 ? 99.887  30.013 -31.495 1.00 31.83  ? 510  TYR B CD1 1 
ATOM   8124 C CD2 . TYR B 1 513 ? 101.652 30.945 -30.189 1.00 28.91  ? 510  TYR B CD2 1 
ATOM   8125 C CE1 . TYR B 1 513 ? 99.595  29.128 -30.470 1.00 32.04  ? 510  TYR B CE1 1 
ATOM   8126 C CE2 . TYR B 1 513 ? 101.370 30.064 -29.157 1.00 29.31  ? 510  TYR B CE2 1 
ATOM   8127 C CZ  . TYR B 1 513 ? 100.339 29.162 -29.302 1.00 36.56  ? 510  TYR B CZ  1 
ATOM   8128 O OH  . TYR B 1 513 ? 100.066 28.289 -28.277 1.00 35.58  ? 510  TYR B OH  1 
ATOM   8129 N N   . VAL B 1 514 ? 104.359 31.586 -32.309 1.00 28.11  ? 511  VAL B N   1 
ATOM   8130 C CA  . VAL B 1 514 ? 105.554 31.060 -31.653 1.00 24.33  ? 511  VAL B CA  1 
ATOM   8131 C C   . VAL B 1 514 ? 105.556 31.436 -30.176 1.00 26.46  ? 511  VAL B C   1 
ATOM   8132 O O   . VAL B 1 514 ? 104.945 32.423 -29.750 1.00 23.83  ? 511  VAL B O   1 
ATOM   8133 C CB  . VAL B 1 514 ? 106.867 31.522 -32.332 1.00 34.23  ? 511  VAL B CB  1 
ATOM   8134 C CG1 . VAL B 1 514 ? 106.860 31.127 -33.809 1.00 31.36  ? 511  VAL B CG1 1 
ATOM   8135 C CG2 . VAL B 1 514 ? 107.110 33.037 -32.153 1.00 29.62  ? 511  VAL B CG2 1 
ATOM   8136 N N   . SER B 1 515 ? 106.222 30.600 -29.385 1.00 24.61  ? 512  SER B N   1 
ATOM   8137 C CA  . SER B 1 515 ? 106.475 30.888 -27.987 1.00 30.37  ? 512  SER B CA  1 
ATOM   8138 C C   . SER B 1 515 ? 107.811 31.612 -27.864 1.00 33.20  ? 512  SER B C   1 
ATOM   8139 O O   . SER B 1 515 ? 108.820 31.174 -28.428 1.00 29.70  ? 512  SER B O   1 
ATOM   8140 C CB  . SER B 1 515 ? 106.496 29.602 -27.159 1.00 34.57  ? 512  SER B CB  1 
ATOM   8141 O OG  . SER B 1 515 ? 107.500 28.716 -27.629 1.00 38.35  ? 512  SER B OG  1 
ATOM   8142 N N   . LEU B 1 516 ? 107.814 32.714 -27.127 1.00 32.18  ? 513  LEU B N   1 
ATOM   8143 C CA  . LEU B 1 516 ? 109.033 33.467 -26.848 1.00 27.27  ? 513  LEU B CA  1 
ATOM   8144 C C   . LEU B 1 516 ? 109.451 33.163 -25.417 1.00 27.00  ? 513  LEU B C   1 
ATOM   8145 O O   . LEU B 1 516 ? 108.759 33.553 -24.467 1.00 26.80  ? 513  LEU B O   1 
ATOM   8146 C CB  . LEU B 1 516 ? 108.799 34.963 -27.062 1.00 22.48  ? 513  LEU B CB  1 
ATOM   8147 C CG  . LEU B 1 516 ? 108.327 35.400 -28.460 1.00 26.35  ? 513  LEU B CG  1 
ATOM   8148 C CD1 . LEU B 1 516 ? 107.951 36.875 -28.489 1.00 21.58  ? 513  LEU B CD1 1 
ATOM   8149 C CD2 . LEU B 1 516 ? 109.395 35.095 -29.532 1.00 24.07  ? 513  LEU B CD2 1 
ATOM   8150 N N   . ASP B 1 517 ? 110.552 32.437 -25.259 1.00 28.55  ? 514  ASP B N   1 
ATOM   8151 C CA  . ASP B 1 517 ? 111.169 32.242 -23.946 1.00 27.07  ? 514  ASP B CA  1 
ATOM   8152 C C   . ASP B 1 517 ? 112.653 31.956 -24.159 1.00 29.27  ? 514  ASP B C   1 
ATOM   8153 O O   . ASP B 1 517 ? 113.202 32.232 -25.232 1.00 32.99  ? 514  ASP B O   1 
ATOM   8154 C CB  . ASP B 1 517 ? 110.445 31.147 -23.137 1.00 34.41  ? 514  ASP B CB  1 
ATOM   8155 C CG  . ASP B 1 517 ? 110.226 29.860 -23.928 1.00 42.05  ? 514  ASP B CG  1 
ATOM   8156 O OD1 . ASP B 1 517 ? 111.188 29.335 -24.526 1.00 47.05  ? 514  ASP B OD1 1 
ATOM   8157 O OD2 . ASP B 1 517 ? 109.081 29.358 -23.943 1.00 53.08  ? 514  ASP B OD2 1 
ATOM   8158 N N   . LEU B 1 518 ? 113.311 31.417 -23.128 1.00 29.23  ? 515  LEU B N   1 
ATOM   8159 C CA  . LEU B 1 518 ? 114.750 31.177 -23.198 1.00 28.70  ? 515  LEU B CA  1 
ATOM   8160 C C   . LEU B 1 518 ? 115.112 30.055 -24.165 1.00 39.66  ? 515  LEU B C   1 
ATOM   8161 O O   . LEU B 1 518 ? 116.268 29.979 -24.596 1.00 42.52  ? 515  LEU B O   1 
ATOM   8162 C CB  . LEU B 1 518 ? 115.310 30.846 -21.812 1.00 27.94  ? 515  LEU B CB  1 
ATOM   8163 C CG  . LEU B 1 518 ? 115.168 31.921 -20.736 1.00 32.75  ? 515  LEU B CG  1 
ATOM   8164 C CD1 . LEU B 1 518 ? 116.013 31.565 -19.533 1.00 27.61  ? 515  LEU B CD1 1 
ATOM   8165 C CD2 . LEU B 1 518 ? 115.521 33.325 -21.286 1.00 29.37  ? 515  LEU B CD2 1 
ATOM   8166 N N   . ARG B 1 519 ? 114.164 29.180 -24.496 1.00 38.42  ? 516  ARG B N   1 
ATOM   8167 C CA  . ARG B 1 519 ? 114.386 28.116 -25.459 1.00 34.61  ? 516  ARG B CA  1 
ATOM   8168 C C   . ARG B 1 519 ? 114.212 28.647 -26.876 1.00 37.71  ? 516  ARG B C   1 
ATOM   8169 O O   . ARG B 1 519 ? 113.590 29.695 -27.087 1.00 41.68  ? 516  ARG B O   1 
ATOM   8170 C CB  . ARG B 1 519 ? 113.411 26.973 -25.195 1.00 34.48  ? 516  ARG B CB  1 
ATOM   8171 C CG  . ARG B 1 519 ? 113.391 26.520 -23.740 1.00 42.49  ? 516  ARG B CG  1 
ATOM   8172 C CD  . ARG B 1 519 ? 112.434 25.350 -23.504 1.00 49.51  ? 516  ARG B CD  1 
ATOM   8173 N NE  . ARG B 1 519 ? 111.430 25.227 -24.566 1.00 59.52  ? 516  ARG B NE  1 
ATOM   8174 C CZ  . ARG B 1 519 ? 110.269 25.879 -24.599 1.00 60.42  ? 516  ARG B CZ  1 
ATOM   8175 N NH1 . ARG B 1 519 ? 109.941 26.711 -23.618 1.00 60.37  ? 516  ARG B NH1 1 
ATOM   8176 N NH2 . ARG B 1 519 ? 109.431 25.697 -25.614 1.00 55.75  ? 516  ARG B NH2 1 
ATOM   8177 N N   . PRO B 1 520 ? 114.761 27.955 -27.873 1.00 38.14  ? 517  PRO B N   1 
ATOM   8178 C CA  . PRO B 1 520 ? 114.539 28.379 -29.263 1.00 26.75  ? 517  PRO B CA  1 
ATOM   8179 C C   . PRO B 1 520 ? 113.058 28.394 -29.600 1.00 33.80  ? 517  PRO B C   1 
ATOM   8180 O O   . PRO B 1 520 ? 112.248 27.714 -28.963 1.00 39.36  ? 517  PRO B O   1 
ATOM   8181 C CB  . PRO B 1 520 ? 115.288 27.323 -30.084 1.00 41.52  ? 517  PRO B CB  1 
ATOM   8182 C CG  . PRO B 1 520 ? 116.339 26.772 -29.132 1.00 37.41  ? 517  PRO B CG  1 
ATOM   8183 C CD  . PRO B 1 520 ? 115.714 26.835 -27.762 1.00 35.57  ? 517  PRO B CD  1 
ATOM   8184 N N   . LEU B 1 521 ? 112.710 29.193 -30.612 1.00 28.62  ? 518  LEU B N   1 
ATOM   8185 C CA  . LEU B 1 521 ? 111.325 29.306 -31.053 1.00 32.58  ? 518  LEU B CA  1 
ATOM   8186 C C   . LEU B 1 521 ? 110.680 27.932 -31.197 1.00 40.20  ? 518  LEU B C   1 
ATOM   8187 O O   . LEU B 1 521 ? 111.308 26.974 -31.654 1.00 40.32  ? 518  LEU B O   1 
ATOM   8188 C CB  . LEU B 1 521 ? 111.232 30.032 -32.396 1.00 30.03  ? 518  LEU B CB  1 
ATOM   8189 C CG  . LEU B 1 521 ? 111.465 31.528 -32.562 1.00 35.85  ? 518  LEU B CG  1 
ATOM   8190 C CD1 . LEU B 1 521 ? 110.892 31.978 -33.897 1.00 36.80  ? 518  LEU B CD1 1 
ATOM   8191 C CD2 . LEU B 1 521 ? 110.860 32.343 -31.430 1.00 34.06  ? 518  LEU B CD2 1 
ATOM   8192 N N   . GLU B 1 522 ? 109.416 27.847 -30.801 1.00 37.26  ? 519  GLU B N   1 
ATOM   8193 C CA  . GLU B 1 522 ? 108.617 26.640 -30.944 1.00 40.70  ? 519  GLU B CA  1 
ATOM   8194 C C   . GLU B 1 522 ? 107.319 27.045 -31.616 1.00 34.37  ? 519  GLU B C   1 
ATOM   8195 O O   . GLU B 1 522 ? 106.713 28.044 -31.225 1.00 38.16  ? 519  GLU B O   1 
ATOM   8196 C CB  . GLU B 1 522 ? 108.364 25.997 -29.578 1.00 42.46  ? 519  GLU B CB  1 
ATOM   8197 C CG  . GLU B 1 522 ? 107.599 24.690 -29.603 1.00 51.26  ? 519  GLU B CG  1 
ATOM   8198 C CD  . GLU B 1 522 ? 107.167 24.262 -28.203 1.00 59.14  ? 519  GLU B CD  1 
ATOM   8199 O OE1 . GLU B 1 522 ? 105.956 24.351 -27.900 1.00 62.54  ? 519  GLU B OE1 1 
ATOM   8200 O OE2 . GLU B 1 522 ? 108.042 23.864 -27.396 1.00 61.70  ? 519  GLU B OE2 1 
ATOM   8201 N N   . VAL B 1 523 ? 106.910 26.309 -32.643 1.00 38.26  ? 520  VAL B N   1 
ATOM   8202 C CA  . VAL B 1 523 ? 105.702 26.655 -33.390 1.00 36.52  ? 520  VAL B CA  1 
ATOM   8203 C C   . VAL B 1 523 ? 104.512 25.912 -32.799 1.00 35.17  ? 520  VAL B C   1 
ATOM   8204 O O   . VAL B 1 523 ? 104.551 24.690 -32.624 1.00 40.96  ? 520  VAL B O   1 
ATOM   8205 C CB  . VAL B 1 523 ? 105.852 26.334 -34.886 1.00 34.89  ? 520  VAL B CB  1 
ATOM   8206 C CG1 . VAL B 1 523 ? 104.526 26.594 -35.588 1.00 29.82  ? 520  VAL B CG1 1 
ATOM   8207 C CG2 . VAL B 1 523 ? 106.984 27.151 -35.515 1.00 28.31  ? 520  VAL B CG2 1 
ATOM   8208 N N   . ARG B 1 524 ? 103.451 26.649 -32.502 1.00 34.99  ? 521  ARG B N   1 
ATOM   8209 C CA  . ARG B 1 524 ? 102.219 26.096 -31.974 1.00 34.16  ? 521  ARG B CA  1 
ATOM   8210 C C   . ARG B 1 524 ? 101.081 26.580 -32.848 1.00 30.89  ? 521  ARG B C   1 
ATOM   8211 O O   . ARG B 1 524 ? 101.255 27.458 -33.693 1.00 32.12  ? 521  ARG B O   1 
ATOM   8212 C CB  . ARG B 1 524 ? 102.001 26.501 -30.513 1.00 33.72  ? 521  ARG B CB  1 
ATOM   8213 C CG  . ARG B 1 524 ? 103.064 25.952 -29.599 1.00 37.77  ? 521  ARG B CG  1 
ATOM   8214 C CD  . ARG B 1 524 ? 102.867 26.402 -28.180 1.00 41.16  ? 521  ARG B CD  1 
ATOM   8215 N NE  . ARG B 1 524 ? 104.075 26.164 -27.401 1.00 40.62  ? 521  ARG B NE  1 
ATOM   8216 C CZ  . ARG B 1 524 ? 104.320 26.745 -26.237 1.00 39.92  ? 521  ARG B CZ  1 
ATOM   8217 N NH1 . ARG B 1 524 ? 103.440 27.596 -25.732 1.00 40.76  ? 521  ARG B NH1 1 
ATOM   8218 N NH2 . ARG B 1 524 ? 105.442 26.489 -25.590 1.00 42.90  ? 521  ARG B NH2 1 
ATOM   8219 N N   . ARG B 1 525 ? 99.904  26.013 -32.639 1.00 31.64  ? 522  ARG B N   1 
ATOM   8220 C CA  A ARG B 1 525 ? 98.755  26.329 -33.467 0.51 34.08  ? 522  ARG B CA  1 
ATOM   8221 C CA  B ARG B 1 525 ? 98.740  26.297 -33.468 0.49 34.09  ? 522  ARG B CA  1 
ATOM   8222 C C   . ARG B 1 525 ? 97.564  26.645 -32.575 1.00 30.98  ? 522  ARG B C   1 
ATOM   8223 O O   . ARG B 1 525 ? 97.308  25.942 -31.599 1.00 34.84  ? 522  ARG B O   1 
ATOM   8224 C CB  A ARG B 1 525 ? 98.474  25.170 -34.441 0.51 35.13  ? 522  ARG B CB  1 
ATOM   8225 C CB  B ARG B 1 525 ? 98.378  25.096 -34.352 0.49 35.11  ? 522  ARG B CB  1 
ATOM   8226 C CG  A ARG B 1 525 ? 99.417  25.196 -35.668 0.51 36.50  ? 522  ARG B CG  1 
ATOM   8227 C CG  B ARG B 1 525 ? 99.449  24.703 -35.350 0.49 36.51  ? 522  ARG B CG  1 
ATOM   8228 C CD  A ARG B 1 525 ? 99.899  23.815 -36.149 0.51 38.18  ? 522  ARG B CD  1 
ATOM   8229 C CD  B ARG B 1 525 ? 98.859  23.868 -36.478 0.49 37.37  ? 522  ARG B CD  1 
ATOM   8230 N NE  A ARG B 1 525 ? 101.164 23.381 -35.542 0.51 37.69  ? 522  ARG B NE  1 
ATOM   8231 N NE  B ARG B 1 525 ? 97.427  24.105 -36.612 0.49 34.03  ? 522  ARG B NE  1 
ATOM   8232 C CZ  A ARG B 1 525 ? 102.363 23.475 -36.119 0.51 36.10  ? 522  ARG B CZ  1 
ATOM   8233 C CZ  B ARG B 1 525 ? 96.724  23.868 -37.709 0.49 35.54  ? 522  ARG B CZ  1 
ATOM   8234 N NH1 A ARG B 1 525 ? 102.497 23.999 -37.333 0.51 28.39  ? 522  ARG B NH1 1 
ATOM   8235 N NH1 B ARG B 1 525 ? 97.324  23.392 -38.792 0.49 42.60  ? 522  ARG B NH1 1 
ATOM   8236 N NH2 A ARG B 1 525 ? 103.441 23.036 -35.476 0.51 37.60  ? 522  ARG B NH2 1 
ATOM   8237 N NH2 B ARG B 1 525 ? 95.423  24.121 -37.727 0.49 36.68  ? 522  ARG B NH2 1 
ATOM   8238 N N   . GLY B 1 526 ? 96.853  27.726 -32.904 1.00 31.24  ? 523  GLY B N   1 
ATOM   8239 C CA  . GLY B 1 526 ? 95.664  28.118 -32.169 1.00 29.45  ? 523  GLY B CA  1 
ATOM   8240 C C   . GLY B 1 526 ? 95.905  28.936 -30.911 1.00 36.23  ? 523  GLY B C   1 
ATOM   8241 O O   . GLY B 1 526 ? 96.514  28.447 -29.959 1.00 38.13  ? 523  GLY B O   1 
ATOM   8242 N N   . LEU B 1 527 ? 95.434  30.188 -30.903 1.00 36.09  ? 524  LEU B N   1 
ATOM   8243 C CA  . LEU B 1 527 ? 95.521  31.062 -29.731 1.00 37.08  ? 524  LEU B CA  1 
ATOM   8244 C C   . LEU B 1 527 ? 94.304  30.806 -28.856 1.00 33.52  ? 524  LEU B C   1 
ATOM   8245 O O   . LEU B 1 527 ? 93.290  31.502 -28.934 1.00 33.57  ? 524  LEU B O   1 
ATOM   8246 C CB  . LEU B 1 527 ? 95.579  32.527 -30.145 1.00 36.87  ? 524  LEU B CB  1 
ATOM   8247 C CG  . LEU B 1 527 ? 96.925  33.120 -30.515 1.00 37.20  ? 524  LEU B CG  1 
ATOM   8248 C CD1 . LEU B 1 527 ? 96.701  34.572 -30.893 1.00 41.61  ? 524  LEU B CD1 1 
ATOM   8249 C CD2 . LEU B 1 527 ? 97.870  32.995 -29.345 1.00 34.83  ? 524  LEU B CD2 1 
ATOM   8250 N N   . ARG B 1 528 ? 94.409  29.777 -28.020 1.00 37.38  ? 525  ARG B N   1 
ATOM   8251 C CA  . ARG B 1 528 ? 93.302  29.338 -27.172 1.00 34.41  ? 525  ARG B CA  1 
ATOM   8252 C C   . ARG B 1 528 ? 92.007  29.222 -27.975 1.00 27.41  ? 525  ARG B C   1 
ATOM   8253 O O   . ARG B 1 528 ? 90.975  29.809 -27.642 1.00 30.27  ? 525  ARG B O   1 
ATOM   8254 C CB  . ARG B 1 528 ? 93.143  30.284 -25.986 1.00 32.78  ? 525  ARG B CB  1 
ATOM   8255 C CG  . ARG B 1 528 ? 94.425  30.444 -25.199 1.00 28.79  ? 525  ARG B CG  1 
ATOM   8256 C CD  . ARG B 1 528 ? 94.134  30.876 -23.774 1.00 36.20  ? 525  ARG B CD  1 
ATOM   8257 N NE  . ARG B 1 528 ? 95.377  31.134 -23.049 1.00 43.62  ? 525  ARG B NE  1 
ATOM   8258 C CZ  . ARG B 1 528 ? 95.463  31.257 -21.727 1.00 46.31  ? 525  ARG B CZ  1 
ATOM   8259 N NH1 . ARG B 1 528 ? 94.369  31.150 -20.971 1.00 37.06  ? 525  ARG B NH1 1 
ATOM   8260 N NH2 . ARG B 1 528 ? 96.646  31.477 -21.161 1.00 40.65  ? 525  ARG B NH2 1 
ATOM   8261 N N   . ALA B 1 529 ? 92.082  28.434 -29.052 1.00 30.17  ? 526  ALA B N   1 
ATOM   8262 C CA  . ALA B 1 529 ? 91.003  28.393 -30.038 1.00 33.74  ? 526  ALA B CA  1 
ATOM   8263 C C   . ALA B 1 529 ? 89.675  27.953 -29.427 1.00 29.58  ? 526  ALA B C   1 
ATOM   8264 O O   . ALA B 1 529 ? 88.619  28.481 -29.794 1.00 31.02  ? 526  ALA B O   1 
ATOM   8265 C CB  . ALA B 1 529 ? 91.382  27.466 -31.195 1.00 36.00  ? 526  ALA B CB  1 
ATOM   8266 N N   . GLN B 1 530 ? 89.694  26.977 -28.515 1.00 32.14  ? 527  GLN B N   1 
ATOM   8267 C CA  . GLN B 1 530 ? 88.429  26.505 -27.959 1.00 29.16  ? 527  GLN B CA  1 
ATOM   8268 C C   . GLN B 1 530 ? 87.801  27.573 -27.077 1.00 32.27  ? 527  GLN B C   1 
ATOM   8269 O O   . GLN B 1 530 ? 86.603  27.857 -27.189 1.00 31.80  ? 527  GLN B O   1 
ATOM   8270 C CB  . GLN B 1 530 ? 88.632  25.203 -27.177 1.00 32.40  ? 527  GLN B CB  1 
ATOM   8271 C CG  . GLN B 1 530 ? 88.997  23.969 -28.022 1.00 37.42  ? 527  GLN B CG  1 
ATOM   8272 C CD  . GLN B 1 530 ? 88.068  23.734 -29.214 1.00 40.92  ? 527  GLN B CD  1 
ATOM   8273 O OE1 . GLN B 1 530 ? 88.471  23.897 -30.374 1.00 36.43  ? 527  GLN B OE1 1 
ATOM   8274 N NE2 . GLN B 1 530 ? 86.824  23.341 -28.934 1.00 35.40  ? 527  GLN B NE2 1 
ATOM   8275 N N   . ALA B 1 531 ? 88.592  28.170 -26.181 1.00 30.31  ? 528  ALA B N   1 
ATOM   8276 C CA  . ALA B 1 531 ? 88.053  29.210 -25.305 1.00 29.03  ? 528  ALA B CA  1 
ATOM   8277 C C   . ALA B 1 531 ? 87.613  30.430 -26.102 1.00 26.69  ? 528  ALA B C   1 
ATOM   8278 O O   . ALA B 1 531 ? 86.575  31.039 -25.805 1.00 32.41  ? 528  ALA B O   1 
ATOM   8279 C CB  . ALA B 1 531 ? 89.091  29.604 -24.257 1.00 27.02  ? 528  ALA B CB  1 
ATOM   8280 N N   . CYS B 1 532 ? 88.362  30.785 -27.143 1.00 24.16  ? 529  CYS B N   1 
ATOM   8281 C CA  . CYS B 1 532 ? 87.996  31.986 -27.867 1.00 24.37  ? 529  CYS B CA  1 
ATOM   8282 C C   . CYS B 1 532 ? 86.784  31.759 -28.745 1.00 29.41  ? 529  CYS B C   1 
ATOM   8283 O O   . CYS B 1 532 ? 86.060  32.719 -29.042 1.00 27.95  ? 529  CYS B O   1 
ATOM   8284 C CB  . CYS B 1 532 ? 89.202  32.495 -28.657 1.00 34.30  ? 529  CYS B CB  1 
ATOM   8285 S SG  . CYS B 1 532 ? 90.473  33.197 -27.516 1.00 30.78  ? 529  CYS B SG  1 
ATOM   8286 N N   . ALA B 1 533 ? 86.511  30.508 -29.124 1.00 29.78  ? 530  ALA B N   1 
ATOM   8287 C CA  . ALA B 1 533 ? 85.258  30.234 -29.820 1.00 30.95  ? 530  ALA B CA  1 
ATOM   8288 C C   . ALA B 1 533 ? 84.078  30.495 -28.904 1.00 22.60  ? 530  ALA B C   1 
ATOM   8289 O O   . ALA B 1 533 ? 83.037  30.995 -29.348 1.00 26.83  ? 530  ALA B O   1 
ATOM   8290 C CB  . ALA B 1 533 ? 85.232  28.795 -30.351 1.00 30.84  ? 530  ALA B CB  1 
ATOM   8291 N N   . PHE B 1 534 ? 84.234  30.213 -27.606 1.00 23.20  ? 531  PHE B N   1 
ATOM   8292 C CA  . PHE B 1 534 ? 83.166  30.558 -26.676 1.00 24.61  ? 531  PHE B CA  1 
ATOM   8293 C C   . PHE B 1 534 ? 82.980  32.071 -26.584 1.00 28.07  ? 531  PHE B C   1 
ATOM   8294 O O   . PHE B 1 534 ? 81.854  32.573 -26.694 1.00 27.53  ? 531  PHE B O   1 
ATOM   8295 C CB  . PHE B 1 534 ? 83.443  29.967 -25.301 1.00 23.72  ? 531  PHE B CB  1 
ATOM   8296 C CG  . PHE B 1 534 ? 82.612  30.577 -24.223 1.00 30.06  ? 531  PHE B CG  1 
ATOM   8297 C CD1 . PHE B 1 534 ? 81.285  30.198 -24.057 1.00 32.99  ? 531  PHE B CD1 1 
ATOM   8298 C CD2 . PHE B 1 534 ? 83.147  31.538 -23.370 1.00 28.09  ? 531  PHE B CD2 1 
ATOM   8299 C CE1 . PHE B 1 534 ? 80.506  30.759 -23.057 1.00 34.75  ? 531  PHE B CE1 1 
ATOM   8300 C CE2 . PHE B 1 534 ? 82.373  32.106 -22.369 1.00 32.59  ? 531  PHE B CE2 1 
ATOM   8301 C CZ  . PHE B 1 534 ? 81.052  31.714 -22.207 1.00 38.04  ? 531  PHE B CZ  1 
ATOM   8302 N N   . TRP B 1 535 ? 84.074  32.820 -26.377 1.00 27.23  ? 532  TRP B N   1 
ATOM   8303 C CA  . TRP B 1 535 ? 83.948  34.274 -26.236 1.00 26.51  ? 532  TRP B CA  1 
ATOM   8304 C C   . TRP B 1 535 ? 83.487  34.906 -27.540 1.00 20.72  ? 532  TRP B C   1 
ATOM   8305 O O   . TRP B 1 535 ? 82.552  35.715 -27.552 1.00 26.00  ? 532  TRP B O   1 
ATOM   8306 C CB  . TRP B 1 535 ? 85.277  34.896 -25.773 1.00 22.23  ? 532  TRP B CB  1 
ATOM   8307 C CG  . TRP B 1 535 ? 85.595  34.544 -24.365 1.00 20.28  ? 532  TRP B CG  1 
ATOM   8308 C CD1 . TRP B 1 535 ? 86.531  33.652 -23.934 1.00 18.77  ? 532  TRP B CD1 1 
ATOM   8309 C CD2 . TRP B 1 535 ? 84.916  35.019 -23.189 1.00 16.45  ? 532  TRP B CD2 1 
ATOM   8310 N NE1 . TRP B 1 535 ? 86.488  33.556 -22.561 1.00 20.42  ? 532  TRP B NE1 1 
ATOM   8311 C CE2 . TRP B 1 535 ? 85.510  34.391 -22.084 1.00 17.12  ? 532  TRP B CE2 1 
ATOM   8312 C CE3 . TRP B 1 535 ? 83.881  35.932 -22.970 1.00 19.28  ? 532  TRP B CE3 1 
ATOM   8313 C CZ2 . TRP B 1 535 ? 85.106  34.650 -20.768 1.00 21.79  ? 532  TRP B CZ2 1 
ATOM   8314 C CZ3 . TRP B 1 535 ? 83.481  36.190 -21.666 1.00 18.93  ? 532  TRP B CZ3 1 
ATOM   8315 C CH2 . TRP B 1 535 ? 84.085  35.547 -20.585 1.00 14.97  ? 532  TRP B CH2 1 
ATOM   8316 N N   . ASN B 1 536 ? 84.084  34.495 -28.654 1.00 23.26  ? 533  ASN B N   1 
ATOM   8317 C CA  . ASN B 1 536 ? 83.886  35.178 -29.928 1.00 26.07  ? 533  ASN B CA  1 
ATOM   8318 C C   . ASN B 1 536 ? 82.698  34.665 -30.723 1.00 34.04  ? 533  ASN B C   1 
ATOM   8319 O O   . ASN B 1 536 ? 82.108  35.436 -31.489 1.00 36.86  ? 533  ASN B O   1 
ATOM   8320 C CB  . ASN B 1 536 ? 85.162  35.080 -30.772 1.00 27.97  ? 533  ASN B CB  1 
ATOM   8321 C CG  . ASN B 1 536 ? 86.323  35.823 -30.130 1.00 28.00  ? 533  ASN B CG  1 
ATOM   8322 O OD1 . ASN B 1 536 ? 86.098  36.678 -29.288 1.00 29.25  ? 533  ASN B OD1 1 
ATOM   8323 N ND2 . ASN B 1 536 ? 87.557  35.498 -30.513 1.00 29.54  ? 533  ASN B ND2 1 
ATOM   8324 N N   . ARG B 1 537 ? 82.318  33.395 -30.574 1.00 29.42  ? 534  ARG B N   1 
ATOM   8325 C CA  . ARG B 1 537 ? 81.217  32.853 -31.359 1.00 33.12  ? 534  ARG B CA  1 
ATOM   8326 C C   . ARG B 1 537 ? 79.965  32.609 -30.536 1.00 37.39  ? 534  ARG B C   1 
ATOM   8327 O O   . ARG B 1 537 ? 78.886  33.073 -30.909 1.00 36.05  ? 534  ARG B O   1 
ATOM   8328 C CB  . ARG B 1 537 ? 81.640  31.551 -32.049 1.00 35.10  ? 534  ARG B CB  1 
ATOM   8329 C CG  . ARG B 1 537 ? 82.731  31.728 -33.087 1.00 31.30  ? 534  ARG B CG  1 
ATOM   8330 C CD  . ARG B 1 537 ? 83.306  30.374 -33.455 1.00 37.25  ? 534  ARG B CD  1 
ATOM   8331 N NE  . ARG B 1 537 ? 84.491  30.470 -34.301 1.00 39.79  ? 534  ARG B NE  1 
ATOM   8332 C CZ  . ARG B 1 537 ? 84.445  30.638 -35.618 1.00 37.45  ? 534  ARG B CZ  1 
ATOM   8333 N NH1 . ARG B 1 537 ? 83.268  30.754 -36.225 1.00 31.87  ? 534  ARG B NH1 1 
ATOM   8334 N NH2 . ARG B 1 537 ? 85.571  30.707 -36.318 1.00 39.83  ? 534  ARG B NH2 1 
ATOM   8335 N N   . PHE B 1 538 ? 80.072  31.895 -29.415 1.00 32.88  ? 535  PHE B N   1 
ATOM   8336 C CA  . PHE B 1 538 ? 78.846  31.504 -28.738 1.00 35.13  ? 535  PHE B CA  1 
ATOM   8337 C C   . PHE B 1 538 ? 78.291  32.615 -27.856 1.00 35.54  ? 535  PHE B C   1 
ATOM   8338 O O   . PHE B 1 538 ? 77.108  32.960 -27.961 1.00 35.96  ? 535  PHE B O   1 
ATOM   8339 C CB  . PHE B 1 538 ? 79.046  30.244 -27.900 1.00 33.98  ? 535  PHE B CB  1 
ATOM   8340 C CG  . PHE B 1 538 ? 77.799  29.844 -27.147 1.00 36.61  ? 535  PHE B CG  1 
ATOM   8341 C CD1 . PHE B 1 538 ? 76.648  29.466 -27.841 1.00 37.49  ? 535  PHE B CD1 1 
ATOM   8342 C CD2 . PHE B 1 538 ? 77.755  29.889 -25.760 1.00 30.01  ? 535  PHE B CD2 1 
ATOM   8343 C CE1 . PHE B 1 538 ? 75.486  29.103 -27.164 1.00 35.85  ? 535  PHE B CE1 1 
ATOM   8344 C CE2 . PHE B 1 538 ? 76.593  29.532 -25.071 1.00 37.24  ? 535  PHE B CE2 1 
ATOM   8345 C CZ  . PHE B 1 538 ? 75.460  29.141 -25.777 1.00 36.33  ? 535  PHE B CZ  1 
ATOM   8346 N N   . LEU B 1 539 ? 79.107  33.151 -26.952 1.00 35.62  ? 536  LEU B N   1 
ATOM   8347 C CA  . LEU B 1 539 ? 78.582  34.074 -25.945 1.00 34.59  ? 536  LEU B CA  1 
ATOM   8348 C C   . LEU B 1 539 ? 77.784  35.238 -26.521 1.00 36.60  ? 536  LEU B C   1 
ATOM   8349 O O   . LEU B 1 539 ? 76.774  35.612 -25.903 1.00 43.45  ? 536  LEU B O   1 
ATOM   8350 C CB  . LEU B 1 539 ? 79.727  34.600 -25.073 1.00 34.24  ? 536  LEU B CB  1 
ATOM   8351 C CG  . LEU B 1 539 ? 79.225  35.288 -23.811 1.00 38.68  ? 536  LEU B CG  1 
ATOM   8352 C CD1 . LEU B 1 539 ? 78.396  34.321 -22.988 1.00 40.16  ? 536  LEU B CD1 1 
ATOM   8353 C CD2 . LEU B 1 539 ? 80.388  35.787 -23.011 1.00 30.71  ? 536  LEU B CD2 1 
ATOM   8354 N N   . PRO B 1 540 ? 78.156  35.847 -27.659 1.00 34.85  ? 537  PRO B N   1 
ATOM   8355 C CA  . PRO B 1 540 ? 77.287  36.900 -28.228 1.00 40.15  ? 537  PRO B CA  1 
ATOM   8356 C C   . PRO B 1 540 ? 75.884  36.420 -28.570 1.00 48.24  ? 537  PRO B C   1 
ATOM   8357 O O   . PRO B 1 540 ? 74.904  37.072 -28.187 1.00 53.42  ? 537  PRO B O   1 
ATOM   8358 C CB  . PRO B 1 540 ? 78.058  37.344 -29.482 1.00 36.27  ? 537  PRO B CB  1 
ATOM   8359 C CG  . PRO B 1 540 ? 79.468  37.009 -29.204 1.00 35.02  ? 537  PRO B CG  1 
ATOM   8360 C CD  . PRO B 1 540 ? 79.436  35.751 -28.387 1.00 34.96  ? 537  PRO B CD  1 
ATOM   8361 N N   . LYS B 1 541 ? 75.761  35.307 -29.306 1.00 52.88  ? 538  LYS B N   1 
ATOM   8362 C CA  . LYS B 1 541 ? 74.447  34.721 -29.586 1.00 52.01  ? 538  LYS B CA  1 
ATOM   8363 C C   . LYS B 1 541 ? 73.649  34.542 -28.308 1.00 51.26  ? 538  LYS B C   1 
ATOM   8364 O O   . LYS B 1 541 ? 72.435  34.781 -28.275 1.00 50.43  ? 538  LYS B O   1 
ATOM   8365 C CB  . LYS B 1 541 ? 74.604  33.367 -30.283 1.00 48.04  ? 538  LYS B CB  1 
ATOM   8366 C CG  . LYS B 1 541 ? 75.345  33.407 -31.614 1.00 52.17  ? 538  LYS B CG  1 
ATOM   8367 C CD  . LYS B 1 541 ? 75.643  31.995 -32.112 1.00 53.43  ? 538  LYS B CD  1 
ATOM   8368 C CE  . LYS B 1 541 ? 76.581  32.008 -33.315 1.00 62.53  ? 538  LYS B CE  1 
ATOM   8369 N NZ  . LYS B 1 541 ? 75.992  32.694 -34.505 1.00 63.27  ? 538  LYS B NZ  1 
ATOM   8370 N N   . LEU B 1 542 ? 74.329  34.136 -27.238 1.00 49.51  ? 539  LEU B N   1 
ATOM   8371 C CA  . LEU B 1 542 ? 73.666  33.934 -25.959 1.00 50.11  ? 539  LEU B CA  1 
ATOM   8372 C C   . LEU B 1 542 ? 73.047  35.228 -25.437 1.00 55.91  ? 539  LEU B C   1 
ATOM   8373 O O   . LEU B 1 542 ? 71.974  35.206 -24.825 1.00 57.86  ? 539  LEU B O   1 
ATOM   8374 C CB  . LEU B 1 542 ? 74.667  33.361 -24.961 1.00 45.16  ? 539  LEU B CB  1 
ATOM   8375 C CG  . LEU B 1 542 ? 74.037  32.810 -23.699 1.00 47.24  ? 539  LEU B CG  1 
ATOM   8376 C CD1 . LEU B 1 542 ? 72.891  31.922 -24.128 1.00 47.11  ? 539  LEU B CD1 1 
ATOM   8377 C CD2 . LEU B 1 542 ? 75.078  32.033 -22.907 1.00 39.53  ? 539  LEU B CD2 1 
ATOM   8378 N N   . LEU B 1 543 ? 73.702  36.368 -25.679 1.00 57.98  ? 540  LEU B N   1 
ATOM   8379 C CA  . LEU B 1 543 ? 73.149  37.643 -25.228 1.00 58.69  ? 540  LEU B CA  1 
ATOM   8380 C C   . LEU B 1 543 ? 71.958  38.080 -26.083 1.00 58.19  ? 540  LEU B C   1 
ATOM   8381 O O   . LEU B 1 543 ? 71.002  38.663 -25.560 1.00 60.25  ? 540  LEU B O   1 
ATOM   8382 C CB  . LEU B 1 543 ? 74.237  38.715 -25.233 1.00 55.90  ? 540  LEU B CB  1 
ATOM   8383 C CG  . LEU B 1 543 ? 75.529  38.323 -24.511 1.00 53.66  ? 540  LEU B CG  1 
ATOM   8384 C CD1 . LEU B 1 543 ? 76.571  39.431 -24.585 1.00 52.56  ? 540  LEU B CD1 1 
ATOM   8385 C CD2 . LEU B 1 543 ? 75.248  37.959 -23.070 1.00 52.73  ? 540  LEU B CD2 1 
ATOM   8386 N N   . SER B 1 544 ? 71.994  37.802 -27.394 1.00 63.21  ? 541  SER B N   1 
ATOM   8387 C CA  . SER B 1 544 ? 70.910  38.211 -28.293 1.00 59.79  ? 541  SER B CA  1 
ATOM   8388 C C   . SER B 1 544 ? 69.579  37.593 -27.886 1.00 63.45  ? 541  SER B C   1 
ATOM   8389 O O   . SER B 1 544 ? 68.553  38.283 -27.822 1.00 69.41  ? 541  SER B O   1 
ATOM   8390 C CB  . SER B 1 544 ? 71.239  37.831 -29.738 1.00 60.75  ? 541  SER B CB  1 
ATOM   8391 O OG  . SER B 1 544 ? 72.084  38.786 -30.346 1.00 70.32  ? 541  SER B OG  1 
ATOM   8392 N N   . ALA B 1 545 ? 69.567  36.282 -27.632 1.00 64.04  ? 542  ALA B N   1 
ATOM   8393 C CA  . ALA B 1 545 ? 68.398  35.615 -27.076 1.00 65.84  ? 542  ALA B CA  1 
ATOM   8394 C C   . ALA B 1 545 ? 68.259  35.829 -25.555 1.00 68.52  ? 542  ALA B C   1 
ATOM   8395 O O   . ALA B 1 545 ? 67.543  35.060 -24.903 1.00 70.33  ? 542  ALA B O   1 
ATOM   8396 C CB  . ALA B 1 545 ? 68.443  34.120 -27.410 1.00 57.99  ? 542  ALA B CB  1 
ATOM   8397 N N   . THR B 1 546 ? 68.904  36.869 -25.016 1.00 73.50  ? 543  THR B N   1 
ATOM   8398 C CA  . THR B 1 546 ? 68.980  37.186 -23.576 1.00 74.38  ? 543  THR B CA  1 
ATOM   8399 C C   . THR B 1 546 ? 68.969  35.944 -22.692 1.00 69.64  ? 543  THR B C   1 
ATOM   8400 O O   . THR B 1 546 ? 69.989  35.269 -22.558 1.00 65.39  ? 543  THR B O   1 
ATOM   8401 C CB  . THR B 1 546 ? 67.834  38.141 -23.118 1.00 77.44  ? 543  THR B CB  1 
ATOM   8402 O OG1 . THR B 1 546 ? 67.950  39.406 -23.787 1.00 72.93  ? 543  THR B OG1 1 
ATOM   8403 C CG2 . THR B 1 546 ? 67.906  38.377 -21.608 1.00 70.29  ? 543  THR B CG2 1 
HETATM 8404 C CAI A LND C 2 .   ? 91.076  53.839 4.391   0.57 42.97  ? 601  LND A CAI 1 
HETATM 8405 C CAI B LND C 2 .   ? 88.723  52.663 5.140   0.43 46.63  ? 601  LND A CAI 1 
HETATM 8406 C CAF A LND C 2 .   ? 91.486  53.043 3.354   0.57 45.05  ? 601  LND A CAF 1 
HETATM 8407 C CAF B LND C 2 .   ? 89.273  52.067 4.037   0.43 47.51  ? 601  LND A CAF 1 
HETATM 8408 C CAQ A LND C 2 .   ? 90.669  52.033 2.859   0.57 47.09  ? 601  LND A CAQ 1 
HETATM 8409 C CAQ B LND C 2 .   ? 90.438  52.591 3.488   0.43 45.52  ? 601  LND A CAQ 1 
HETATM 8410 C CAP A LND C 2 .   ? 91.181  51.190 1.719   0.57 51.52  ? 601  LND A CAP 1 
HETATM 8411 C CAP B LND C 2 .   ? 91.030  51.928 2.280   0.43 47.91  ? 601  LND A CAP 1 
HETATM 8412 O OAB A LND C 2 .   ? 90.658  51.264 0.603   0.57 55.71  ? 601  LND A OAB 1 
HETATM 8413 O OAB B LND C 2 .   ? 91.797  50.975 2.412   0.43 50.36  ? 601  LND A OAB 1 
HETATM 8414 N NAA A LND C 2 .   ? 92.218  50.395 2.002   0.57 50.76  ? 601  LND A NAA 1 
HETATM 8415 N NAA B LND C 2 .   ? 90.673  52.435 1.103   0.43 48.86  ? 601  LND A NAA 1 
HETATM 8416 C CAG A LND C 2 .   ? 89.423  51.843 3.448   0.57 48.57  ? 601  LND A CAG 1 
HETATM 8417 C CAG B LND C 2 .   ? 91.012  53.710 4.079   0.43 43.41  ? 601  LND A CAG 1 
HETATM 8418 C CAJ A LND C 2 .   ? 89.060  52.665 4.488   0.57 48.61  ? 601  LND A CAJ 1 
HETATM 8419 C CAJ B LND C 2 .   ? 90.419  54.266 5.182   0.43 41.54  ? 601  LND A CAJ 1 
HETATM 8420 N NAT A LND C 2 .   ? 89.876  53.640 4.935   0.57 43.57  ? 601  LND A NAT 1 
HETATM 8421 N NAT B LND C 2 .   ? 89.296  53.741 5.691   0.43 44.09  ? 601  LND A NAT 1 
HETATM 8422 C CAM A LND C 2 .   ? 89.436  54.494 6.056   0.57 42.28  ? 601  LND A CAM 1 
HETATM 8423 C CAM B LND C 2 .   ? 88.679  54.365 6.884   0.43 39.56  ? 601  LND A CAM 1 
HETATM 8424 C CAK A LND C 2 .   ? 90.004  55.907 6.026   0.57 40.70  ? 601  LND A CAK 1 
HETATM 8425 C CAK B LND C 2 .   ? 88.710  55.882 6.801   0.43 38.89  ? 601  LND A CAK 1 
HETATM 8426 C CAL A LND C 2 .   ? 89.980  56.622 7.389   0.57 37.79  ? 601  LND A CAL 1 
HETATM 8427 C CAL B LND C 2 .   ? 89.921  56.468 7.530   0.43 37.75  ? 601  LND A CAL 1 
HETATM 8428 N NAS A LND C 2 .   ? 88.719  56.657 8.157   0.57 37.13  ? 601  LND A NAS 1 
HETATM 8429 N NAS B LND C 2 .   ? 89.545  57.338 8.640   0.43 38.77  ? 601  LND A NAS 1 
HETATM 8430 C CAH A LND C 2 .   ? 87.510  56.054 7.871   0.57 40.70  ? 601  LND A CAH 1 
HETATM 8431 C CAH B LND C 2 .   ? 90.285  58.417 9.046   0.43 36.06  ? 601  LND A CAH 1 
HETATM 8432 C CAE A LND C 2 .   ? 86.641  56.367 8.881   0.57 38.56  ? 601  LND A CAE 1 
HETATM 8433 C CAE B LND C 2 .   ? 89.610  58.969 10.103  0.43 38.05  ? 601  LND A CAE 1 
HETATM 8434 N NAO A LND C 2 .   ? 87.286  57.165 9.792   0.57 39.27  ? 601  LND A NAO 1 
HETATM 8435 N NAO B LND C 2 .   ? 88.470  58.253 10.356  0.43 39.34  ? 601  LND A NAO 1 
HETATM 8436 C CAR A LND C 2 .   ? 88.532  57.335 9.348   0.57 38.05  ? 601  LND A CAR 1 
HETATM 8437 C CAR B LND C 2 .   ? 88.450  57.271 9.460   0.43 37.89  ? 601  LND A CAR 1 
HETATM 8438 C CAD A LND C 2 .   ? 89.562  58.119 10.038  0.57 38.00  ? 601  LND A CAD 1 
HETATM 8439 C CAD B LND C 2 .   ? 87.432  56.247 9.329   0.43 38.22  ? 601  LND A CAD 1 
HETATM 8440 N NAN A LND C 2 .   ? 89.424  58.439 11.282  0.57 38.04  ? 601  LND A NAN 1 
HETATM 8441 N NAN B LND C 2 .   ? 86.412  56.426 8.576   0.43 37.97  ? 601  LND A NAN 1 
HETATM 8442 O OAC A LND C 2 .   ? 90.438  59.187 11.876  0.57 33.56  ? 601  LND A OAC 1 
HETATM 8443 O OAC B LND C 2 .   ? 85.504  55.374 8.531   0.43 31.60  ? 601  LND A OAC 1 
HETATM 8444 N N   . NO3 D 3 .   ? 76.495  72.632 8.715   0.76 41.92  ? 602  NO3 A N   1 
HETATM 8445 O O1  . NO3 D 3 .   ? 76.381  71.646 9.505   0.76 37.08  ? 602  NO3 A O1  1 
HETATM 8446 O O2  . NO3 D 3 .   ? 77.055  73.691 9.126   0.76 36.32  ? 602  NO3 A O2  1 
HETATM 8447 O O3  . NO3 D 3 .   ? 76.051  72.564 7.522   0.76 44.70  ? 602  NO3 A O3  1 
HETATM 8448 N N   . NO3 E 3 .   ? 111.739 37.971 13.881  0.58 41.41  ? 603  NO3 A N   1 
HETATM 8449 O O1  . NO3 E 3 .   ? 111.492 37.376 14.978  0.58 38.16  ? 603  NO3 A O1  1 
HETATM 8450 O O2  . NO3 E 3 .   ? 112.106 39.188 13.894  0.58 33.79  ? 603  NO3 A O2  1 
HETATM 8451 O O3  . NO3 E 3 .   ? 111.621 37.345 12.779  0.58 36.10  ? 603  NO3 A O3  1 
HETATM 8452 C C1  . GOL F 4 .   ? 91.431  63.576 14.303  1.00 32.41  ? 604  GOL A C1  1 
HETATM 8453 O O1  . GOL F 4 .   ? 92.269  62.700 15.043  1.00 36.69  ? 604  GOL A O1  1 
HETATM 8454 C C2  . GOL F 4 .   ? 91.594  63.344 12.798  1.00 40.19  ? 604  GOL A C2  1 
HETATM 8455 O O2  . GOL F 4 .   ? 90.305  63.389 12.203  1.00 45.84  ? 604  GOL A O2  1 
HETATM 8456 C C3  . GOL F 4 .   ? 92.324  62.020 12.512  1.00 32.46  ? 604  GOL A C3  1 
HETATM 8457 O O3  . GOL F 4 .   ? 92.277  61.658 11.135  1.00 41.18  ? 604  GOL A O3  1 
HETATM 8458 C C1  . GOL G 4 .   ? 92.873  72.265 7.625   1.00 26.88  ? 605  GOL A C1  1 
HETATM 8459 O O1  . GOL G 4 .   ? 92.523  72.862 6.391   1.00 28.28  ? 605  GOL A O1  1 
HETATM 8460 C C2  . GOL G 4 .   ? 93.248  73.316 8.663   1.00 25.23  ? 605  GOL A C2  1 
HETATM 8461 O O2  . GOL G 4 .   ? 93.337  72.707 9.936   1.00 22.61  ? 605  GOL A O2  1 
HETATM 8462 C C3  . GOL G 4 .   ? 92.168  74.378 8.689   1.00 32.99  ? 605  GOL A C3  1 
HETATM 8463 O O3  . GOL G 4 .   ? 92.694  75.626 9.051   1.00 33.09  ? 605  GOL A O3  1 
HETATM 8464 C CAI A LND H 2 .   ? 92.854  51.202 -7.800  0.54 52.31  ? 601  LND B CAI 1 
HETATM 8465 C CAI B LND H 2 .   ? 91.293  50.836 -9.773  0.46 47.59  ? 601  LND B CAI 1 
HETATM 8466 C CAF A LND H 2 .   ? 91.938  51.490 -6.823  0.54 53.23  ? 601  LND B CAF 1 
HETATM 8467 C CAF B LND H 2 .   ? 90.385  51.160 -8.799  0.46 51.04  ? 601  LND B CAF 1 
HETATM 8468 C CAQ A LND H 2 .   ? 90.619  51.747 -7.178  0.54 53.81  ? 601  LND B CAQ 1 
HETATM 8469 C CAQ B LND H 2 .   ? 90.840  51.530 -7.539  0.46 52.67  ? 601  LND B CAQ 1 
HETATM 8470 C CAP A LND H 2 .   ? 89.627  52.061 -6.098  0.54 60.19  ? 601  LND B CAP 1 
HETATM 8471 C CAP B LND H 2 .   ? 89.835  51.882 -6.482  0.46 58.77  ? 601  LND B CAP 1 
HETATM 8472 O OAB A LND H 2 .   ? 89.946  52.789 -5.159  0.54 60.36  ? 601  LND B OAB 1 
HETATM 8473 O OAB B LND H 2 .   ? 88.655  51.564 -6.622  0.46 60.06  ? 601  LND B OAB 1 
HETATM 8474 N NAA A LND H 2 .   ? 88.424  51.511 -6.233  0.54 60.11  ? 601  LND B NAA 1 
HETATM 8475 N NAA B LND H 2 .   ? 90.306  52.539 -5.426  0.46 58.66  ? 601  LND B NAA 1 
HETATM 8476 C CAG A LND H 2 .   ? 90.267  51.704 -8.522  0.54 51.35  ? 601  LND B CAG 1 
HETATM 8477 C CAG B LND H 2 .   ? 92.209  51.561 -7.303  0.46 52.85  ? 601  LND B CAG 1 
HETATM 8478 C CAJ A LND H 2 .   ? 91.223  51.411 -9.458  0.54 48.26  ? 601  LND B CAJ 1 
HETATM 8479 C CAJ B LND H 2 .   ? 93.072  51.227 -8.313  0.46 50.85  ? 601  LND B CAJ 1 
HETATM 8480 N NAT A LND H 2 .   ? 92.488  51.167 -9.089  0.54 49.14  ? 601  LND B NAT 1 
HETATM 8481 N NAT B LND H 2 .   ? 92.608  50.874 -9.520  0.46 48.34  ? 601  LND B NAT 1 
HETATM 8482 C CAM A LND H 2 .   ? 93.498  50.853 -10.124 0.54 46.08  ? 601  LND B CAM 1 
HETATM 8483 C CAM B LND H 2 .   ? 93.566  50.519 -10.590 0.46 45.27  ? 601  LND B CAM 1 
HETATM 8484 C CAK A LND H 2 .   ? 92.940  49.920 -11.186 0.54 43.25  ? 601  LND B CAK 1 
HETATM 8485 C CAK B LND H 2 .   ? 93.103  49.302 -11.375 0.46 41.52  ? 601  LND B CAK 1 
HETATM 8486 C CAL A LND H 2 .   ? 94.023  49.019 -11.781 0.54 41.17  ? 601  LND B CAL 1 
HETATM 8487 C CAL B LND H 2 .   ? 94.258  48.346 -11.680 0.46 41.96  ? 601  LND B CAL 1 
HETATM 8488 N NAS A LND H 2 .   ? 93.496  48.080 -12.767 0.54 40.93  ? 601  LND B NAS 1 
HETATM 8489 N NAS B LND H 2 .   ? 94.615  48.327 -13.095 0.46 41.65  ? 601  LND B NAS 1 
HETATM 8490 C CAH A LND H 2 .   ? 92.360  47.337 -12.580 0.54 42.25  ? 601  LND B CAH 1 
HETATM 8491 C CAH B LND H 2 .   ? 95.820  48.760 -13.583 0.46 40.53  ? 601  LND B CAH 1 
HETATM 8492 C CAE A LND H 2 .   ? 92.202  46.589 -13.717 0.54 39.51  ? 601  LND B CAE 1 
HETATM 8493 C CAE B LND H 2 .   ? 95.769  48.582 -14.940 0.46 41.21  ? 601  LND B CAE 1 
HETATM 8494 N NAO A LND H 2 .   ? 93.215  46.855 -14.600 0.54 43.05  ? 601  LND B NAO 1 
HETATM 8495 N NAO B LND H 2 .   ? 94.559  48.050 -15.300 0.46 43.48  ? 601  LND B NAO 1 
HETATM 8496 C CAR A LND H 2 .   ? 93.987  47.760 -14.005 0.54 40.91  ? 601  LND B CAR 1 
HETATM 8497 C CAR B LND H 2 .   ? 93.876  47.904 -14.168 0.46 41.08  ? 601  LND B CAR 1 
HETATM 8498 C CAD A LND H 2 .   ? 95.191  48.355 -14.551 0.54 42.22  ? 601  LND B CAD 1 
HETATM 8499 C CAD B LND H 2 .   ? 92.533  47.374 -14.036 0.46 41.65  ? 601  LND B CAD 1 
HETATM 8500 N NAN A LND H 2 .   ? 95.661  47.973 -15.679 0.54 41.38  ? 601  LND B NAN 1 
HETATM 8501 N NAN B LND H 2 .   ? 92.182  46.724 -12.991 0.46 39.01  ? 601  LND B NAN 1 
HETATM 8502 O OAC A LND H 2 .   ? 96.819  48.616 -16.099 0.54 38.39  ? 601  LND B OAC 1 
HETATM 8503 O OAC B LND H 2 .   ? 90.870  46.266 -12.978 0.46 30.25  ? 601  LND B OAC 1 
HETATM 8504 C C1  . GOL I 4 .   ? 99.962  49.192 -16.742 1.00 33.05  ? 602  GOL B C1  1 
HETATM 8505 O O1  . GOL I 4 .   ? 99.417  49.213 -15.426 1.00 41.85  ? 602  GOL B O1  1 
HETATM 8506 C C2  . GOL I 4 .   ? 100.580 47.827 -17.072 1.00 39.34  ? 602  GOL B C2  1 
HETATM 8507 O O2  . GOL I 4 .   ? 99.932  46.814 -16.326 1.00 45.08  ? 602  GOL B O2  1 
HETATM 8508 C C3  . GOL I 4 .   ? 100.430 47.500 -18.558 1.00 29.70  ? 602  GOL B C3  1 
HETATM 8509 O O3  . GOL I 4 .   ? 100.545 48.681 -19.337 1.00 36.22  ? 602  GOL B O3  1 
HETATM 8510 C C1  . GOL J 4 .   ? 108.909 44.169 -11.685 1.00 28.43  ? 603  GOL B C1  1 
HETATM 8511 O O1  . GOL J 4 .   ? 109.292 43.837 -10.371 1.00 28.06  ? 603  GOL B O1  1 
HETATM 8512 C C2  . GOL J 4 .   ? 110.118 44.172 -12.616 1.00 31.20  ? 603  GOL B C2  1 
HETATM 8513 O O2  . GOL J 4 .   ? 109.741 44.293 -13.970 1.00 28.72  ? 603  GOL B O2  1 
HETATM 8514 C C3  . GOL J 4 .   ? 111.077 43.015 -12.318 1.00 34.98  ? 603  GOL B C3  1 
HETATM 8515 O O3  . GOL J 4 .   ? 111.333 42.223 -13.457 1.00 28.18  ? 603  GOL B O3  1 
HETATM 8516 O O   . HOH K 5 .   ? 75.949  69.935 17.523  1.00 43.18  ? 701  HOH A O   1 
HETATM 8517 O O   . HOH K 5 .   ? 75.201  63.016 31.230  1.00 30.67  ? 702  HOH A O   1 
HETATM 8518 O O   . HOH K 5 .   ? 93.533  66.491 -3.955  1.00 25.89  ? 703  HOH A O   1 
HETATM 8519 O O   . HOH K 5 .   ? 94.364  74.918 1.535   1.00 43.67  ? 704  HOH A O   1 
HETATM 8520 O O   . HOH K 5 .   ? 69.914  66.517 12.031  1.00 42.80  ? 705  HOH A O   1 
HETATM 8521 O O   . HOH K 5 .   ? 125.093 58.430 22.361  1.00 42.22  ? 706  HOH A O   1 
HETATM 8522 O O   . HOH K 5 .   ? 84.717  62.197 -2.292  1.00 41.55  ? 707  HOH A O   1 
HETATM 8523 O O   . HOH K 5 .   ? 99.155  82.613 32.257  1.00 46.92  ? 708  HOH A O   1 
HETATM 8524 O O   . HOH K 5 .   ? 113.210 57.662 33.049  1.00 36.96  ? 709  HOH A O   1 
HETATM 8525 O O   . HOH K 5 .   ? 94.146  49.273 12.856  1.00 21.70  ? 710  HOH A O   1 
HETATM 8526 O O   . HOH K 5 .   ? 81.085  52.097 1.406   1.00 51.96  ? 711  HOH A O   1 
HETATM 8527 O O   . HOH K 5 .   ? 91.150  48.396 34.578  1.00 36.32  ? 712  HOH A O   1 
HETATM 8528 O O   . HOH K 5 .   ? 66.578  72.226 3.661   1.00 46.48  ? 713  HOH A O   1 
HETATM 8529 O O   . HOH K 5 .   ? 90.786  58.911 16.004  1.00 31.61  ? 714  HOH A O   1 
HETATM 8530 O O   . HOH K 5 .   ? 91.845  61.061 7.189   1.00 41.69  ? 715  HOH A O   1 
HETATM 8531 O O   . HOH K 5 .   ? 90.017  60.020 -4.512  1.00 40.86  ? 716  HOH A O   1 
HETATM 8532 O O   . HOH K 5 .   ? 98.338  31.107 5.394   1.00 47.13  ? 717  HOH A O   1 
HETATM 8533 O O   . HOH K 5 .   ? 90.542  60.308 14.048  1.00 38.08  ? 718  HOH A O   1 
HETATM 8534 O O   . HOH K 5 .   ? 69.529  43.519 6.880   1.00 56.00  ? 719  HOH A O   1 
HETATM 8535 O O   . HOH K 5 .   ? 65.487  67.103 26.811  1.00 37.06  ? 720  HOH A O   1 
HETATM 8536 O O   . HOH K 5 .   ? 86.068  78.366 39.552  1.00 50.07  ? 721  HOH A O   1 
HETATM 8537 O O   . HOH K 5 .   ? 68.511  52.755 0.475   1.00 32.42  ? 722  HOH A O   1 
HETATM 8538 O O   . HOH K 5 .   ? 70.889  44.609 16.331  1.00 46.74  ? 723  HOH A O   1 
HETATM 8539 O O   . HOH K 5 .   ? 97.765  51.755 10.162  1.00 14.40  ? 724  HOH A O   1 
HETATM 8540 O O   . HOH K 5 .   ? 87.933  34.526 17.304  1.00 41.77  ? 725  HOH A O   1 
HETATM 8541 O O   . HOH K 5 .   ? 74.255  51.258 36.746  1.00 51.32  ? 726  HOH A O   1 
HETATM 8542 O O   . HOH K 5 .   ? 63.712  57.823 18.887  1.00 43.16  ? 727  HOH A O   1 
HETATM 8543 O O   . HOH K 5 .   ? 87.869  66.833 17.608  1.00 19.73  ? 728  HOH A O   1 
HETATM 8544 O O   . HOH K 5 .   ? 123.225 67.821 30.448  1.00 36.13  ? 729  HOH A O   1 
HETATM 8545 O O   . HOH K 5 .   ? 124.854 60.053 28.024  1.00 33.22  ? 730  HOH A O   1 
HETATM 8546 O O   . HOH K 5 .   ? 83.087  81.186 23.709  1.00 30.76  ? 731  HOH A O   1 
HETATM 8547 O O   . HOH K 5 .   ? 115.044 47.797 28.830  1.00 37.38  ? 732  HOH A O   1 
HETATM 8548 O O   . HOH K 5 .   ? 94.169  61.884 1.206   1.00 23.42  ? 733  HOH A O   1 
HETATM 8549 O O   . HOH K 5 .   ? 105.845 69.573 12.802  1.00 23.69  ? 734  HOH A O   1 
HETATM 8550 O O   . HOH K 5 .   ? 112.012 54.668 29.532  1.00 30.72  ? 735  HOH A O   1 
HETATM 8551 O O   . HOH K 5 .   ? 86.135  70.833 -4.517  1.00 25.80  ? 736  HOH A O   1 
HETATM 8552 O O   . HOH K 5 .   ? 123.760 73.252 21.552  1.00 53.80  ? 737  HOH A O   1 
HETATM 8553 O O   . HOH K 5 .   ? 93.572  57.909 7.421   1.00 31.37  ? 738  HOH A O   1 
HETATM 8554 O O   . HOH K 5 .   ? 98.850  72.098 40.018  1.00 46.81  ? 739  HOH A O   1 
HETATM 8555 O O   . HOH K 5 .   ? 101.213 65.719 8.010   1.00 20.94  ? 740  HOH A O   1 
HETATM 8556 O O   . HOH K 5 .   ? 91.051  47.996 0.724   1.00 51.40  ? 741  HOH A O   1 
HETATM 8557 O O   . HOH K 5 .   ? 58.680  59.955 2.141   1.00 53.96  ? 742  HOH A O   1 
HETATM 8558 O O   . HOH K 5 .   ? 84.676  50.642 23.941  1.00 29.52  ? 743  HOH A O   1 
HETATM 8559 O O   . HOH K 5 .   ? 103.114 66.675 19.871  1.00 25.72  ? 744  HOH A O   1 
HETATM 8560 O O   . HOH K 5 .   ? 107.219 36.073 21.673  1.00 44.81  ? 745  HOH A O   1 
HETATM 8561 O O   . HOH K 5 .   ? 97.135  62.241 15.024  1.00 16.99  ? 746  HOH A O   1 
HETATM 8562 O O   . HOH K 5 .   ? 79.563  81.080 23.074  1.00 42.84  ? 747  HOH A O   1 
HETATM 8563 O O   . HOH K 5 .   ? 62.999  53.086 6.952   1.00 51.32  ? 748  HOH A O   1 
HETATM 8564 O O   . HOH K 5 .   ? 91.689  83.523 7.265   1.00 33.23  ? 749  HOH A O   1 
HETATM 8565 O O   . HOH K 5 .   ? 77.689  49.155 15.507  1.00 37.01  ? 750  HOH A O   1 
HETATM 8566 O O   . HOH K 5 .   ? 76.870  68.163 10.547  1.00 30.77  ? 751  HOH A O   1 
HETATM 8567 O O   . HOH K 5 .   ? 128.277 73.858 19.738  1.00 42.94  ? 752  HOH A O   1 
HETATM 8568 O O   . HOH K 5 .   ? 109.232 41.485 13.271  1.00 26.67  ? 753  HOH A O   1 
HETATM 8569 O O   . HOH K 5 .   ? 107.604 72.097 18.057  1.00 31.75  ? 754  HOH A O   1 
HETATM 8570 O O   . HOH K 5 .   ? 81.054  68.363 38.083  1.00 28.86  ? 755  HOH A O   1 
HETATM 8571 O O   . HOH K 5 .   ? 109.090 80.257 26.994  1.00 32.24  ? 756  HOH A O   1 
HETATM 8572 O O   . HOH K 5 .   ? 79.580  72.310 -4.644  1.00 34.73  ? 757  HOH A O   1 
HETATM 8573 O O   . HOH K 5 .   ? 78.315  73.726 12.010  1.00 39.74  ? 758  HOH A O   1 
HETATM 8574 O O   . HOH K 5 .   ? 100.506 60.461 10.965  1.00 17.06  ? 759  HOH A O   1 
HETATM 8575 O O   . HOH K 5 .   ? 75.748  71.200 35.427  1.00 36.36  ? 760  HOH A O   1 
HETATM 8576 O O   . HOH K 5 .   ? 67.791  70.327 0.493   1.00 41.98  ? 761  HOH A O   1 
HETATM 8577 O O   . HOH K 5 .   ? 95.793  29.874 13.202  1.00 59.97  ? 762  HOH A O   1 
HETATM 8578 O O   . HOH K 5 .   ? 105.631 76.603 14.128  1.00 36.94  ? 763  HOH A O   1 
HETATM 8579 O O   . HOH K 5 .   ? 94.307  53.191 0.265   1.00 42.22  ? 764  HOH A O   1 
HETATM 8580 O O   . HOH K 5 .   ? 100.903 86.022 15.692  1.00 38.84  ? 765  HOH A O   1 
HETATM 8581 O O   . HOH K 5 .   ? 113.300 54.476 21.168  1.00 22.09  ? 766  HOH A O   1 
HETATM 8582 O O   . HOH K 5 .   ? 96.911  82.042 26.475  1.00 36.72  ? 767  HOH A O   1 
HETATM 8583 O O   . HOH K 5 .   ? 96.794  62.197 0.173   1.00 34.88  ? 768  HOH A O   1 
HETATM 8584 O O   . HOH K 5 .   ? 96.638  75.424 10.060  1.00 32.70  ? 769  HOH A O   1 
HETATM 8585 O O   . HOH K 5 .   ? 93.576  43.747 35.230  1.00 47.10  ? 770  HOH A O   1 
HETATM 8586 O O   . HOH K 5 .   ? 98.475  58.257 8.422   1.00 22.15  ? 771  HOH A O   1 
HETATM 8587 O O   . HOH K 5 .   ? 106.935 47.184 16.056  1.00 20.37  ? 772  HOH A O   1 
HETATM 8588 O O   . HOH K 5 .   ? 74.606  58.094 2.687   1.00 24.62  ? 773  HOH A O   1 
HETATM 8589 O O   . HOH K 5 .   ? 129.686 65.463 25.625  1.00 38.82  ? 774  HOH A O   1 
HETATM 8590 O O   . HOH K 5 .   ? 67.073  54.493 31.542  1.00 38.64  ? 775  HOH A O   1 
HETATM 8591 O O   . HOH K 5 .   ? 87.679  36.053 9.287   1.00 46.45  ? 776  HOH A O   1 
HETATM 8592 O O   . HOH K 5 .   ? 110.497 83.292 26.228  1.00 37.30  ? 777  HOH A O   1 
HETATM 8593 O O   . HOH K 5 .   ? 68.726  67.201 9.828   1.00 35.20  ? 778  HOH A O   1 
HETATM 8594 O O   . HOH K 5 .   ? 97.547  60.410 40.723  1.00 40.79  ? 779  HOH A O   1 
HETATM 8595 O O   . HOH K 5 .   ? 89.411  66.519 -4.575  1.00 22.71  ? 780  HOH A O   1 
HETATM 8596 O O   . HOH K 5 .   ? 74.611  73.240 21.715  1.00 45.38  ? 781  HOH A O   1 
HETATM 8597 O O   . HOH K 5 .   ? 95.921  32.475 9.264   1.00 37.76  ? 782  HOH A O   1 
HETATM 8598 O O   . HOH K 5 .   ? 79.877  54.845 12.520  1.00 23.70  ? 783  HOH A O   1 
HETATM 8599 O O   . HOH K 5 .   ? 78.703  75.469 8.013   1.00 47.94  ? 784  HOH A O   1 
HETATM 8600 O O   . HOH K 5 .   ? 101.316 74.926 21.262  1.00 23.12  ? 785  HOH A O   1 
HETATM 8601 O O   . HOH K 5 .   ? 74.646  73.003 0.500   1.00 48.83  ? 786  HOH A O   1 
HETATM 8602 O O   . HOH K 5 .   ? 128.304 60.108 28.926  1.00 46.22  ? 787  HOH A O   1 
HETATM 8603 O O   . HOH K 5 .   ? 108.723 35.136 17.091  1.00 44.75  ? 788  HOH A O   1 
HETATM 8604 O O   . HOH K 5 .   ? 108.389 37.381 4.945   1.00 36.66  ? 789  HOH A O   1 
HETATM 8605 O O   . HOH K 5 .   ? 101.318 72.625 8.181   1.00 39.97  ? 790  HOH A O   1 
HETATM 8606 O O   . HOH K 5 .   ? 71.263  64.679 17.491  1.00 29.77  ? 791  HOH A O   1 
HETATM 8607 O O   . HOH K 5 .   ? 112.034 53.222 19.154  1.00 19.31  ? 792  HOH A O   1 
HETATM 8608 O O   . HOH K 5 .   ? 103.543 72.886 39.917  1.00 41.03  ? 793  HOH A O   1 
HETATM 8609 O O   . HOH K 5 .   ? 96.081  89.181 12.829  1.00 47.64  ? 794  HOH A O   1 
HETATM 8610 O O   . HOH K 5 .   ? 109.843 70.169 39.254  1.00 41.82  ? 795  HOH A O   1 
HETATM 8611 O O   . HOH K 5 .   ? 110.415 64.379 37.340  1.00 31.90  ? 796  HOH A O   1 
HETATM 8612 O O   . HOH K 5 .   ? 87.509  74.837 13.517  1.00 25.18  ? 797  HOH A O   1 
HETATM 8613 O O   . HOH K 5 .   ? 110.380 44.054 12.826  1.00 29.01  ? 798  HOH A O   1 
HETATM 8614 O O   . HOH K 5 .   ? 126.302 61.173 30.333  1.00 47.51  ? 799  HOH A O   1 
HETATM 8615 O O   . HOH K 5 .   ? 76.184  56.815 38.739  1.00 43.63  ? 800  HOH A O   1 
HETATM 8616 O O   . HOH K 5 .   ? 83.387  65.475 11.500  1.00 22.95  ? 801  HOH A O   1 
HETATM 8617 O O   . HOH K 5 .   ? 108.440 45.028 28.936  1.00 42.89  ? 802  HOH A O   1 
HETATM 8618 O O   . HOH K 5 .   ? 94.884  60.113 10.980  1.00 24.03  ? 803  HOH A O   1 
HETATM 8619 O O   . HOH K 5 .   ? 114.402 76.601 28.703  1.00 32.82  ? 804  HOH A O   1 
HETATM 8620 O O   . HOH K 5 .   ? 100.403 42.696 21.291  1.00 28.80  ? 805  HOH A O   1 
HETATM 8621 O O   . HOH K 5 .   ? 87.013  50.025 15.734  1.00 18.24  ? 806  HOH A O   1 
HETATM 8622 O O   . HOH K 5 .   ? 73.587  47.822 10.300  1.00 33.25  ? 807  HOH A O   1 
HETATM 8623 O O   . HOH K 5 .   ? 92.913  71.288 14.039  1.00 23.83  ? 808  HOH A O   1 
HETATM 8624 O O   . HOH K 5 .   ? 86.735  68.565 21.036  1.00 19.90  ? 809  HOH A O   1 
HETATM 8625 O O   . HOH K 5 .   ? 75.914  61.612 42.769  1.00 41.32  ? 810  HOH A O   1 
HETATM 8626 O O   . HOH K 5 .   ? 98.928  50.524 2.722   1.00 26.32  ? 811  HOH A O   1 
HETATM 8627 O O   . HOH K 5 .   ? 87.346  85.526 12.447  1.00 39.89  ? 812  HOH A O   1 
HETATM 8628 O O   . HOH K 5 .   ? 102.166 44.375 0.335   1.00 20.57  ? 813  HOH A O   1 
HETATM 8629 O O   . HOH K 5 .   ? 116.139 79.199 34.232  1.00 44.15  ? 814  HOH A O   1 
HETATM 8630 O O   . HOH K 5 .   ? 104.229 68.559 16.599  1.00 24.24  ? 815  HOH A O   1 
HETATM 8631 O O   . HOH K 5 .   ? 107.037 61.391 14.394  1.00 25.40  ? 816  HOH A O   1 
HETATM 8632 O O   . HOH K 5 .   ? 77.505  84.805 24.001  1.00 44.76  ? 817  HOH A O   1 
HETATM 8633 O O   . HOH K 5 .   ? 103.409 61.059 34.405  1.00 26.92  ? 818  HOH A O   1 
HETATM 8634 O O   . HOH K 5 .   ? 87.539  44.513 37.552  1.00 49.56  ? 819  HOH A O   1 
HETATM 8635 O O   . HOH K 5 .   ? 80.914  51.079 26.053  1.00 43.17  ? 820  HOH A O   1 
HETATM 8636 O O   . HOH K 5 .   ? 100.914 62.146 21.476  1.00 21.09  ? 821  HOH A O   1 
HETATM 8637 O O   . HOH K 5 .   ? 93.133  50.918 14.444  1.00 22.62  ? 822  HOH A O   1 
HETATM 8638 O O   . HOH K 5 .   ? 61.859  55.524 5.896   1.00 42.94  ? 823  HOH A O   1 
HETATM 8639 O O   . HOH K 5 .   ? 104.925 46.085 17.639  1.00 18.51  ? 824  HOH A O   1 
HETATM 8640 O O   . HOH K 5 .   ? 109.957 62.665 18.221  1.00 21.36  ? 825  HOH A O   1 
HETATM 8641 O O   . HOH K 5 .   ? 104.560 77.127 9.993   1.00 50.30  ? 826  HOH A O   1 
HETATM 8642 O O   . HOH K 5 .   ? 98.517  47.799 10.827  1.00 23.53  ? 827  HOH A O   1 
HETATM 8643 O O   . HOH K 5 .   ? 92.721  44.542 18.449  1.00 22.47  ? 828  HOH A O   1 
HETATM 8644 O O   . HOH K 5 .   ? 110.863 47.701 23.436  1.00 29.55  ? 829  HOH A O   1 
HETATM 8645 O O   . HOH K 5 .   ? 95.667  38.923 25.910  1.00 51.48  ? 830  HOH A O   1 
HETATM 8646 O O   . HOH K 5 .   ? 80.586  72.294 32.023  1.00 26.33  ? 831  HOH A O   1 
HETATM 8647 O O   . HOH K 5 .   ? 121.943 61.890 18.414  1.00 37.04  ? 832  HOH A O   1 
HETATM 8648 O O   . HOH K 5 .   ? 93.938  57.565 -4.236  1.00 38.10  ? 833  HOH A O   1 
HETATM 8649 O O   . HOH K 5 .   ? 101.992 53.301 4.697   1.00 18.57  ? 834  HOH A O   1 
HETATM 8650 O O   . HOH K 5 .   ? 71.732  71.955 24.666  1.00 33.45  ? 835  HOH A O   1 
HETATM 8651 O O   . HOH K 5 .   ? 102.719 51.525 14.256  1.00 22.58  ? 836  HOH A O   1 
HETATM 8652 O O   . HOH K 5 .   ? 105.500 72.447 7.643   1.00 45.73  ? 837  HOH A O   1 
HETATM 8653 O O   . HOH K 5 .   ? 108.312 84.597 26.447  1.00 45.66  ? 838  HOH A O   1 
HETATM 8654 O O   . HOH K 5 .   ? 73.922  65.364 28.811  1.00 32.40  ? 839  HOH A O   1 
HETATM 8655 O O   . HOH K 5 .   ? 117.365 53.554 17.915  1.00 30.21  ? 840  HOH A O   1 
HETATM 8656 O O   . HOH K 5 .   ? 89.293  55.676 40.111  1.00 43.69  ? 841  HOH A O   1 
HETATM 8657 O O   . HOH K 5 .   ? 110.861 47.227 10.139  1.00 29.92  ? 842  HOH A O   1 
HETATM 8658 O O   . HOH K 5 .   ? 106.543 59.406 5.656   1.00 28.55  ? 843  HOH A O   1 
HETATM 8659 O O   . HOH K 5 .   ? 82.192  74.858 0.761   1.00 30.84  ? 844  HOH A O   1 
HETATM 8660 O O   . HOH K 5 .   ? 87.104  77.989 4.811   1.00 34.64  ? 845  HOH A O   1 
HETATM 8661 O O   . HOH K 5 .   ? 73.383  63.692 27.164  1.00 35.71  ? 846  HOH A O   1 
HETATM 8662 O O   . HOH K 5 .   ? 86.765  85.171 21.342  1.00 41.50  ? 847  HOH A O   1 
HETATM 8663 O O   . HOH K 5 .   ? 98.933  44.083 27.172  1.00 38.12  ? 848  HOH A O   1 
HETATM 8664 O O   . HOH K 5 .   ? 72.116  69.334 22.886  1.00 46.40  ? 849  HOH A O   1 
HETATM 8665 O O   . HOH K 5 .   ? 86.743  81.721 5.633   1.00 47.66  ? 850  HOH A O   1 
HETATM 8666 O O   . HOH K 5 .   ? 71.866  68.637 14.476  1.00 47.04  ? 851  HOH A O   1 
HETATM 8667 O O   . HOH K 5 .   ? 107.036 82.080 27.961  1.00 45.79  ? 852  HOH A O   1 
HETATM 8668 O O   . HOH K 5 .   ? 85.775  78.487 6.904   1.00 32.46  ? 853  HOH A O   1 
HETATM 8669 O O   . HOH K 5 .   ? 98.839  69.643 35.217  1.00 27.36  ? 854  HOH A O   1 
HETATM 8670 O O   . HOH K 5 .   ? 77.130  55.841 23.748  1.00 28.37  ? 855  HOH A O   1 
HETATM 8671 O O   . HOH K 5 .   ? 82.553  81.450 14.844  1.00 34.17  ? 856  HOH A O   1 
HETATM 8672 O O   . HOH K 5 .   ? 84.448  47.865 17.902  1.00 34.02  ? 857  HOH A O   1 
HETATM 8673 O O   . HOH K 5 .   ? 76.523  65.020 39.020  1.00 44.27  ? 858  HOH A O   1 
HETATM 8674 O O   . HOH K 5 .   ? 104.060 70.839 43.819  1.00 45.39  ? 859  HOH A O   1 
HETATM 8675 O O   . HOH K 5 .   ? 60.569  65.904 2.311   1.00 34.79  ? 860  HOH A O   1 
HETATM 8676 O O   . HOH K 5 .   ? 80.152  66.210 40.157  1.00 36.33  ? 861  HOH A O   1 
HETATM 8677 O O   . HOH K 5 .   ? 97.864  83.134 11.645  1.00 33.74  ? 862  HOH A O   1 
HETATM 8678 O O   . HOH K 5 .   ? 69.769  70.887 7.123   1.00 41.56  ? 863  HOH A O   1 
HETATM 8679 O O   . HOH K 5 .   ? 94.484  63.897 17.728  1.00 22.75  ? 864  HOH A O   1 
HETATM 8680 O O   . HOH K 5 .   ? 115.267 74.454 29.075  1.00 34.15  ? 865  HOH A O   1 
HETATM 8681 O O   . HOH K 5 .   ? 85.449  83.350 29.968  1.00 44.75  ? 866  HOH A O   1 
HETATM 8682 O O   . HOH K 5 .   ? 77.965  62.760 -4.679  1.00 40.18  ? 867  HOH A O   1 
HETATM 8683 O O   . HOH K 5 .   ? 74.267  50.227 3.298   1.00 32.65  ? 868  HOH A O   1 
HETATM 8684 O O   . HOH K 5 .   ? 69.202  57.460 -4.778  1.00 38.29  ? 869  HOH A O   1 
HETATM 8685 O O   . HOH K 5 .   ? 103.602 57.650 15.284  1.00 15.71  ? 870  HOH A O   1 
HETATM 8686 O O   . HOH K 5 .   ? 78.247  66.828 16.769  1.00 28.07  ? 871  HOH A O   1 
HETATM 8687 O O   . HOH K 5 .   ? 123.341 68.074 27.736  1.00 36.87  ? 872  HOH A O   1 
HETATM 8688 O O   . HOH K 5 .   ? 116.161 61.245 38.131  1.00 47.33  ? 873  HOH A O   1 
HETATM 8689 O O   . HOH K 5 .   ? 83.946  43.142 19.685  1.00 36.98  ? 874  HOH A O   1 
HETATM 8690 O O   . HOH K 5 .   ? 64.573  61.403 -1.713  1.00 40.32  ? 875  HOH A O   1 
HETATM 8691 O O   . HOH K 5 .   ? 94.540  61.627 6.747   1.00 24.10  ? 876  HOH A O   1 
HETATM 8692 O O   . HOH K 5 .   ? 96.845  79.649 7.299   1.00 35.29  ? 877  HOH A O   1 
HETATM 8693 O O   . HOH K 5 .   ? 120.406 58.231 36.110  1.00 48.50  ? 878  HOH A O   1 
HETATM 8694 O O   . HOH K 5 .   ? 113.908 55.737 13.673  1.00 31.79  ? 879  HOH A O   1 
HETATM 8695 O O   . HOH K 5 .   ? 86.404  51.298 37.977  1.00 43.31  ? 880  HOH A O   1 
HETATM 8696 O O   . HOH K 5 .   ? 95.754  43.862 28.064  1.00 38.07  ? 881  HOH A O   1 
HETATM 8697 O O   . HOH K 5 .   ? 77.452  72.535 38.268  1.00 40.30  ? 882  HOH A O   1 
HETATM 8698 O O   . HOH K 5 .   ? 79.325  53.764 -0.686  1.00 45.46  ? 883  HOH A O   1 
HETATM 8699 O O   . HOH K 5 .   ? 87.968  86.510 19.536  1.00 34.90  ? 884  HOH A O   1 
HETATM 8700 O O   . HOH K 5 .   ? 74.776  76.300 18.221  1.00 41.91  ? 885  HOH A O   1 
HETATM 8701 O O   . HOH K 5 .   ? 91.591  52.875 37.693  1.00 45.48  ? 886  HOH A O   1 
HETATM 8702 O O   . HOH K 5 .   ? 110.023 34.928 13.439  1.00 36.80  ? 887  HOH A O   1 
HETATM 8703 O O   . HOH K 5 .   ? 116.169 63.776 17.245  1.00 32.85  ? 888  HOH A O   1 
HETATM 8704 O O   . HOH K 5 .   ? 89.942  35.063 10.655  1.00 31.13  ? 889  HOH A O   1 
HETATM 8705 O O   . HOH K 5 .   ? 102.379 85.506 24.175  1.00 50.68  ? 890  HOH A O   1 
HETATM 8706 O O   . HOH K 5 .   ? 95.174  79.005 36.759  1.00 45.34  ? 891  HOH A O   1 
HETATM 8707 O O   . HOH K 5 .   ? 84.727  39.400 20.471  1.00 39.43  ? 892  HOH A O   1 
HETATM 8708 O O   . HOH K 5 .   ? 102.591 61.007 4.465   1.00 25.49  ? 893  HOH A O   1 
HETATM 8709 O O   . HOH K 5 .   ? 83.356  47.158 10.175  1.00 43.13  ? 894  HOH A O   1 
HETATM 8710 O O   . HOH K 5 .   ? 82.164  72.017 -5.262  1.00 44.64  ? 895  HOH A O   1 
HETATM 8711 O O   . HOH K 5 .   ? 84.201  46.782 25.415  1.00 41.44  ? 896  HOH A O   1 
HETATM 8712 O O   . HOH K 5 .   ? 70.287  61.542 27.957  1.00 36.71  ? 897  HOH A O   1 
HETATM 8713 O O   . HOH K 5 .   ? 112.061 80.847 35.189  1.00 49.88  ? 898  HOH A O   1 
HETATM 8714 O O   . HOH K 5 .   ? 94.931  45.286 21.308  1.00 21.19  ? 899  HOH A O   1 
HETATM 8715 O O   . HOH K 5 .   ? 120.925 52.567 24.849  1.00 38.95  ? 900  HOH A O   1 
HETATM 8716 O O   . HOH K 5 .   ? 83.783  84.395 27.644  1.00 48.35  ? 901  HOH A O   1 
HETATM 8717 O O   . HOH K 5 .   ? 115.104 57.673 28.251  1.00 26.95  ? 902  HOH A O   1 
HETATM 8718 O O   . HOH K 5 .   ? 112.008 78.508 15.448  1.00 30.42  ? 903  HOH A O   1 
HETATM 8719 O O   . HOH K 5 .   ? 68.480  49.342 5.768   1.00 42.81  ? 904  HOH A O   1 
HETATM 8720 O O   . HOH K 5 .   ? 80.795  78.023 13.138  1.00 37.29  ? 905  HOH A O   1 
HETATM 8721 O O   . HOH K 5 .   ? 93.784  41.674 16.691  1.00 24.84  ? 906  HOH A O   1 
HETATM 8722 O O   . HOH K 5 .   ? 92.024  50.530 10.421  1.00 28.56  ? 907  HOH A O   1 
HETATM 8723 O O   . HOH K 5 .   ? 124.174 57.197 30.720  1.00 29.14  ? 908  HOH A O   1 
HETATM 8724 O O   . HOH K 5 .   ? 90.344  56.841 38.423  1.00 43.03  ? 909  HOH A O   1 
HETATM 8725 O O   . HOH K 5 .   ? 87.352  53.034 41.628  1.00 48.24  ? 910  HOH A O   1 
HETATM 8726 O O   . HOH K 5 .   ? 75.582  71.567 13.180  1.00 38.91  ? 911  HOH A O   1 
HETATM 8727 O O   . HOH K 5 .   ? 97.485  32.390 3.589   1.00 34.89  ? 912  HOH A O   1 
HETATM 8728 O O   . HOH K 5 .   ? 118.904 64.427 35.759  1.00 40.33  ? 913  HOH A O   1 
HETATM 8729 O O   . HOH K 5 .   ? 105.743 68.844 8.707   1.00 38.61  ? 914  HOH A O   1 
HETATM 8730 O O   . HOH K 5 .   ? 68.265  51.515 6.871   1.00 29.76  ? 915  HOH A O   1 
HETATM 8731 O O   . HOH K 5 .   ? 95.657  56.754 16.996  1.00 17.63  ? 916  HOH A O   1 
HETATM 8732 O O   . HOH K 5 .   ? 106.954 81.021 15.297  1.00 46.25  ? 917  HOH A O   1 
HETATM 8733 O O   . HOH K 5 .   ? 101.792 77.255 34.019  1.00 42.73  ? 918  HOH A O   1 
HETATM 8734 O O   . HOH K 5 .   ? 79.545  73.132 1.200   1.00 30.18  ? 919  HOH A O   1 
HETATM 8735 O O   . HOH K 5 .   ? 60.471  70.796 11.089  1.00 42.79  ? 920  HOH A O   1 
HETATM 8736 O O   . HOH K 5 .   ? 76.503  55.107 21.243  1.00 23.80  ? 921  HOH A O   1 
HETATM 8737 O O   . HOH K 5 .   ? 81.874  90.486 31.385  1.00 64.21  ? 922  HOH A O   1 
HETATM 8738 O O   . HOH K 5 .   ? 64.908  69.375 10.201  1.00 43.34  ? 923  HOH A O   1 
HETATM 8739 O O   . HOH K 5 .   ? 107.411 68.947 42.401  1.00 41.54  ? 924  HOH A O   1 
HETATM 8740 O O   . HOH K 5 .   ? 91.957  89.767 10.872  1.00 37.74  ? 925  HOH A O   1 
HETATM 8741 O O   . HOH K 5 .   ? 86.345  74.983 1.895   1.00 33.24  ? 926  HOH A O   1 
HETATM 8742 O O   . HOH K 5 .   ? 99.876  50.329 11.235  1.00 19.95  ? 927  HOH A O   1 
HETATM 8743 O O   . HOH K 5 .   ? 74.042  59.830 -6.393  1.00 44.26  ? 928  HOH A O   1 
HETATM 8744 O O   . HOH K 5 .   ? 108.265 66.499 6.168   1.00 40.58  ? 929  HOH A O   1 
HETATM 8745 O O   . HOH K 5 .   ? 73.673  51.834 21.606  1.00 41.30  ? 930  HOH A O   1 
HETATM 8746 O O   . HOH K 5 .   ? 80.085  47.410 36.631  1.00 42.46  ? 931  HOH A O   1 
HETATM 8747 O O   . HOH K 5 .   ? 75.062  81.984 29.298  1.00 37.46  ? 932  HOH A O   1 
HETATM 8748 O O   . HOH K 5 .   ? 87.261  70.587 0.022   1.00 29.02  ? 933  HOH A O   1 
HETATM 8749 O O   . HOH K 5 .   ? 85.513  52.166 8.792   1.00 32.24  ? 934  HOH A O   1 
HETATM 8750 O O   . HOH K 5 .   ? 81.539  58.227 0.585   1.00 28.96  ? 935  HOH A O   1 
HETATM 8751 O O   . HOH K 5 .   ? 106.327 33.331 18.281  1.00 51.54  ? 936  HOH A O   1 
HETATM 8752 O O   . HOH K 5 .   ? 111.795 68.904 14.025  1.00 36.03  ? 937  HOH A O   1 
HETATM 8753 O O   . HOH K 5 .   ? 106.039 32.202 4.503   1.00 57.44  ? 938  HOH A O   1 
HETATM 8754 O O   . HOH K 5 .   ? 108.722 45.804 22.460  1.00 31.39  ? 939  HOH A O   1 
HETATM 8755 O O   . HOH K 5 .   ? 91.275  81.849 5.140   1.00 41.82  ? 940  HOH A O   1 
HETATM 8756 O O   . HOH K 5 .   ? 92.733  33.239 0.126   1.00 37.16  ? 941  HOH A O   1 
HETATM 8757 O O   . HOH K 5 .   ? 83.434  60.230 -1.098  1.00 35.36  ? 942  HOH A O   1 
HETATM 8758 O O   . HOH K 5 .   ? 89.572  73.474 -0.289  1.00 41.26  ? 943  HOH A O   1 
HETATM 8759 O O   . HOH K 5 .   ? 70.679  59.308 28.409  1.00 34.66  ? 944  HOH A O   1 
HETATM 8760 O O   . HOH K 5 .   ? 83.892  58.151 21.862  1.00 30.63  ? 945  HOH A O   1 
HETATM 8761 O O   . HOH K 5 .   ? 105.556 50.879 13.894  1.00 25.60  ? 946  HOH A O   1 
HETATM 8762 O O   . HOH K 5 .   ? 62.169  73.074 3.780   1.00 51.98  ? 947  HOH A O   1 
HETATM 8763 O O   . HOH K 5 .   ? 59.101  72.956 9.351   1.00 55.82  ? 948  HOH A O   1 
HETATM 8764 O O   . HOH K 5 .   ? 72.225  77.118 32.994  1.00 42.02  ? 949  HOH A O   1 
HETATM 8765 O O   . HOH K 5 .   ? 79.635  44.637 4.443   1.00 52.34  ? 950  HOH A O   1 
HETATM 8766 O O   . HOH K 5 .   ? 112.737 53.199 8.258   1.00 42.00  ? 951  HOH A O   1 
HETATM 8767 O O   . HOH K 5 .   ? 104.406 50.060 29.907  1.00 36.37  ? 952  HOH A O   1 
HETATM 8768 O O   . HOH K 5 .   ? 114.902 55.486 29.477  1.00 31.87  ? 953  HOH A O   1 
HETATM 8769 O O   . HOH K 5 .   ? 78.225  67.969 19.174  1.00 27.80  ? 954  HOH A O   1 
HETATM 8770 O O   . HOH K 5 .   ? 83.952  75.970 38.771  1.00 41.73  ? 955  HOH A O   1 
HETATM 8771 O O   . HOH K 5 .   ? 118.214 69.620 34.620  1.00 39.23  ? 956  HOH A O   1 
HETATM 8772 O O   . HOH K 5 .   ? 95.617  49.044 3.904   1.00 41.69  ? 957  HOH A O   1 
HETATM 8773 O O   . HOH K 5 .   ? 120.396 73.513 19.198  1.00 42.55  ? 958  HOH A O   1 
HETATM 8774 O O   . HOH K 5 .   ? 64.312  63.960 7.356   1.00 39.45  ? 959  HOH A O   1 
HETATM 8775 O O   . HOH K 5 .   ? 121.040 55.013 21.908  1.00 37.73  ? 960  HOH A O   1 
HETATM 8776 O O   . HOH K 5 .   ? 97.626  45.399 9.604   1.00 32.70  ? 961  HOH A O   1 
HETATM 8777 O O   . HOH K 5 .   ? 93.709  47.332 3.444   1.00 42.88  ? 962  HOH A O   1 
HETATM 8778 O O   . HOH K 5 .   ? 80.397  47.665 14.979  1.00 40.80  ? 963  HOH A O   1 
HETATM 8779 O O   . HOH K 5 .   ? 75.743  68.763 14.048  1.00 45.48  ? 964  HOH A O   1 
HETATM 8780 O O   . HOH K 5 .   ? 75.613  59.383 32.202  1.00 37.65  ? 965  HOH A O   1 
HETATM 8781 O O   . HOH K 5 .   ? 108.493 56.580 4.986   1.00 30.97  ? 966  HOH A O   1 
HETATM 8782 O O   . HOH K 5 .   ? 74.897  66.304 -4.165  1.00 33.52  ? 967  HOH A O   1 
HETATM 8783 O O   . HOH K 5 .   ? 112.386 61.132 8.569   1.00 31.90  ? 968  HOH A O   1 
HETATM 8784 O O   . HOH K 5 .   ? 109.845 79.780 37.196  1.00 50.72  ? 969  HOH A O   1 
HETATM 8785 O O   . HOH K 5 .   ? 116.026 54.173 20.618  1.00 24.84  ? 970  HOH A O   1 
HETATM 8786 O O   . HOH K 5 .   ? 66.182  64.272 8.745   1.00 39.59  ? 971  HOH A O   1 
HETATM 8787 O O   . HOH K 5 .   ? 109.917 53.808 5.522   1.00 41.03  ? 972  HOH A O   1 
HETATM 8788 O O   . HOH K 5 .   ? 101.906 67.996 9.630   1.00 22.95  ? 973  HOH A O   1 
HETATM 8789 O O   . HOH K 5 .   ? 76.947  68.189 8.069   1.00 33.38  ? 974  HOH A O   1 
HETATM 8790 O O   . HOH K 5 .   ? 108.519 70.051 11.806  1.00 41.66  ? 975  HOH A O   1 
HETATM 8791 O O   . HOH K 5 .   ? 77.448  65.461 13.676  1.00 27.32  ? 976  HOH A O   1 
HETATM 8792 O O   . HOH K 5 .   ? 99.573  69.158 10.722  1.00 23.77  ? 977  HOH A O   1 
HETATM 8793 O O   . HOH K 5 .   ? 90.183  82.308 28.892  1.00 42.31  ? 978  HOH A O   1 
HETATM 8794 O O   . HOH K 5 .   ? 68.863  65.595 21.466  1.00 33.06  ? 979  HOH A O   1 
HETATM 8795 O O   . HOH K 5 .   ? 108.368 47.660 5.300   1.00 26.46  ? 980  HOH A O   1 
HETATM 8796 O O   . HOH K 5 .   ? 111.561 49.800 10.515  1.00 25.69  ? 981  HOH A O   1 
HETATM 8797 O O   . HOH K 5 .   ? 70.012  68.540 24.852  1.00 38.69  ? 982  HOH A O   1 
HETATM 8798 O O   . HOH K 5 .   ? 76.250  68.984 -5.319  1.00 34.33  ? 983  HOH A O   1 
HETATM 8799 O O   . HOH K 5 .   ? 108.470 72.273 15.550  1.00 44.42  ? 984  HOH A O   1 
HETATM 8800 O O   . HOH K 5 .   ? 60.898  54.259 11.379  1.00 44.35  ? 985  HOH A O   1 
HETATM 8801 O O   . HOH K 5 .   ? 117.047 60.698 18.697  1.00 39.91  ? 986  HOH A O   1 
HETATM 8802 O O   . HOH K 5 .   ? 63.885  41.918 8.983   1.00 44.77  ? 987  HOH A O   1 
HETATM 8803 O O   . HOH K 5 .   ? 86.311  82.048 32.887  1.00 45.38  ? 988  HOH A O   1 
HETATM 8804 O O   . HOH K 5 .   ? 120.286 68.938 33.431  1.00 31.06  ? 989  HOH A O   1 
HETATM 8805 O O   . HOH K 5 .   ? 78.187  57.252 -3.945  1.00 41.13  ? 990  HOH A O   1 
HETATM 8806 O O   . HOH K 5 .   ? 106.701 49.724 15.940  1.00 23.63  ? 991  HOH A O   1 
HETATM 8807 O O   . HOH K 5 .   ? 115.850 58.984 30.565  1.00 29.74  ? 992  HOH A O   1 
HETATM 8808 O O   . HOH K 5 .   ? 76.929  64.710 16.166  1.00 31.94  ? 993  HOH A O   1 
HETATM 8809 O O   . HOH K 5 .   ? 94.283  71.799 -0.206  1.00 29.80  ? 994  HOH A O   1 
HETATM 8810 O O   . HOH K 5 .   ? 76.992  47.451 7.180   1.00 38.81  ? 995  HOH A O   1 
HETATM 8811 O O   . HOH K 5 .   ? 75.976  52.801 20.618  1.00 31.71  ? 996  HOH A O   1 
HETATM 8812 O O   . HOH K 5 .   ? 86.868  65.436 42.935  1.00 37.65  ? 997  HOH A O   1 
HETATM 8813 O O   . HOH K 5 .   ? 98.593  69.612 1.188   1.00 42.36  ? 998  HOH A O   1 
HETATM 8814 O O   . HOH K 5 .   ? 95.548  77.370 8.297   1.00 38.66  ? 999  HOH A O   1 
HETATM 8815 O O   . HOH K 5 .   ? 75.950  69.427 19.840  1.00 41.57  ? 1000 HOH A O   1 
HETATM 8816 O O   . HOH K 5 .   ? 92.267  86.245 24.689  1.00 42.69  ? 1001 HOH A O   1 
HETATM 8817 O O   . HOH K 5 .   ? 91.048  68.693 -3.544  1.00 27.95  ? 1002 HOH A O   1 
HETATM 8818 O O   . HOH K 5 .   ? 84.149  37.115 16.114  1.00 34.04  ? 1003 HOH A O   1 
HETATM 8819 O O   . HOH K 5 .   ? 72.852  69.065 39.221  1.00 41.38  ? 1004 HOH A O   1 
HETATM 8820 O O   . HOH K 5 .   ? 111.158 83.902 19.716  1.00 35.19  ? 1005 HOH A O   1 
HETATM 8821 O O   . HOH K 5 .   ? 67.902  41.808 11.166  1.00 45.72  ? 1006 HOH A O   1 
HETATM 8822 O O   . HOH K 5 .   ? 122.963 57.925 32.916  1.00 38.40  ? 1007 HOH A O   1 
HETATM 8823 O O   . HOH K 5 .   ? 83.027  43.629 14.891  1.00 40.16  ? 1008 HOH A O   1 
HETATM 8824 O O   . HOH K 5 .   ? 116.498 50.741 14.050  1.00 46.10  ? 1009 HOH A O   1 
HETATM 8825 O O   . HOH K 5 .   ? 63.394  69.546 -0.598  1.00 47.93  ? 1010 HOH A O   1 
HETATM 8826 O O   . HOH K 5 .   ? 96.358  72.915 9.300   1.00 30.60  ? 1011 HOH A O   1 
HETATM 8827 O O   . HOH K 5 .   ? 115.890 62.893 35.600  1.00 34.73  ? 1012 HOH A O   1 
HETATM 8828 O O   . HOH K 5 .   ? 103.412 83.336 20.701  1.00 38.14  ? 1013 HOH A O   1 
HETATM 8829 O O   . HOH K 5 .   ? 96.765  61.548 12.411  1.00 19.29  ? 1014 HOH A O   1 
HETATM 8830 O O   . HOH K 5 .   ? 97.629  67.783 40.778  1.00 48.74  ? 1015 HOH A O   1 
HETATM 8831 O O   . HOH K 5 .   ? 91.601  43.282 16.468  1.00 26.92  ? 1016 HOH A O   1 
HETATM 8832 O O   . HOH K 5 .   ? 103.807 83.985 29.288  1.00 49.66  ? 1017 HOH A O   1 
HETATM 8833 O O   . HOH K 5 .   ? 95.970  59.842 8.190   1.00 18.53  ? 1018 HOH A O   1 
HETATM 8834 O O   . HOH K 5 .   ? 82.265  79.805 12.704  1.00 33.76  ? 1019 HOH A O   1 
HETATM 8835 O O   . HOH K 5 .   ? 99.621  53.136 3.198   1.00 20.13  ? 1020 HOH A O   1 
HETATM 8836 O O   . HOH K 5 .   ? 109.599 61.824 40.838  1.00 48.04  ? 1021 HOH A O   1 
HETATM 8837 O O   . HOH K 5 .   ? 85.831  47.784 15.618  1.00 26.55  ? 1022 HOH A O   1 
HETATM 8838 O O   . HOH K 5 .   ? 118.103 56.412 17.996  1.00 39.98  ? 1023 HOH A O   1 
HETATM 8839 O O   . HOH K 5 .   ? 85.373  71.522 -1.211  1.00 35.46  ? 1024 HOH A O   1 
HETATM 8840 O O   . HOH K 5 .   ? 71.414  67.006 17.755  1.00 43.16  ? 1025 HOH A O   1 
HETATM 8841 O O   . HOH K 5 .   ? 82.571  49.479 26.720  1.00 36.74  ? 1026 HOH A O   1 
HETATM 8842 O O   . HOH K 5 .   ? 99.082  54.535 1.084   1.00 27.86  ? 1027 HOH A O   1 
HETATM 8843 O O   . HOH K 5 .   ? 70.666  75.503 34.870  1.00 52.56  ? 1028 HOH A O   1 
HETATM 8844 O O   . HOH K 5 .   ? 113.148 71.059 14.426  1.00 44.44  ? 1029 HOH A O   1 
HETATM 8845 O O   . HOH K 5 .   ? 84.680  37.408 22.844  1.00 47.73  ? 1030 HOH A O   1 
HETATM 8846 O O   . HOH K 5 .   ? 65.171  58.633 -2.475  1.00 35.87  ? 1031 HOH A O   1 
HETATM 8847 O O   . HOH K 5 .   ? 103.753 65.274 5.305   1.00 39.80  ? 1032 HOH A O   1 
HETATM 8848 O O   . HOH K 5 .   ? 66.433  65.103 12.470  1.00 46.40  ? 1033 HOH A O   1 
HETATM 8849 O O   . HOH K 5 .   ? 119.025 56.575 21.038  1.00 42.78  ? 1034 HOH A O   1 
HETATM 8850 O O   . HOH K 5 .   ? 119.053 75.956 19.038  1.00 39.91  ? 1035 HOH A O   1 
HETATM 8851 O O   . HOH K 5 .   ? 119.433 61.786 17.175  1.00 45.96  ? 1036 HOH A O   1 
HETATM 8852 O O   . HOH K 5 .   ? 72.872  73.764 2.854   1.00 52.29  ? 1037 HOH A O   1 
HETATM 8853 O O   . HOH K 5 .   ? 73.301  66.830 39.868  1.00 46.65  ? 1038 HOH A O   1 
HETATM 8854 O O   . HOH K 5 .   ? 111.788 50.797 8.111   1.00 39.85  ? 1039 HOH A O   1 
HETATM 8855 O O   . HOH K 5 .   ? 73.405  60.612 28.189  1.00 42.82  ? 1040 HOH A O   1 
HETATM 8856 O O   . HOH K 5 .   ? 68.756  64.822 13.483  1.00 44.81  ? 1041 HOH A O   1 
HETATM 8857 O O   . HOH K 5 .   ? 78.510  54.097 25.649  1.00 42.80  ? 1042 HOH A O   1 
HETATM 8858 O O   . HOH K 5 .   ? 95.091  41.033 35.355  1.00 51.74  ? 1043 HOH A O   1 
HETATM 8859 O O   . HOH K 5 .   ? 110.211 46.301 7.762   1.00 34.79  ? 1044 HOH A O   1 
HETATM 8860 O O   . HOH K 5 .   ? 89.662  79.159 3.377   1.00 38.46  ? 1045 HOH A O   1 
HETATM 8861 O O   . HOH K 5 .   ? 95.031  89.715 17.483  1.00 45.35  ? 1046 HOH A O   1 
HETATM 8862 O O   . HOH K 5 .   ? 115.648 67.389 38.097  1.00 45.98  ? 1047 HOH A O   1 
HETATM 8863 O O   . HOH K 5 .   ? 85.068  77.387 3.226   1.00 42.78  ? 1048 HOH A O   1 
HETATM 8864 O O   . HOH K 5 .   ? 100.813 63.009 2.456   1.00 40.66  ? 1049 HOH A O   1 
HETATM 8865 O O   . HOH K 5 .   ? 59.303  53.486 8.453   1.00 57.27  ? 1050 HOH A O   1 
HETATM 8866 O O   . HOH K 5 .   ? 89.027  51.446 37.399  1.00 43.87  ? 1051 HOH A O   1 
HETATM 8867 O O   . HOH K 5 .   ? 106.256 78.806 13.738  1.00 44.09  ? 1052 HOH A O   1 
HETATM 8868 O O   . HOH K 5 .   ? 115.143 44.893 19.276  1.00 44.88  ? 1053 HOH A O   1 
HETATM 8869 O O   . HOH K 5 .   ? 117.123 51.764 31.835  1.00 48.68  ? 1054 HOH A O   1 
HETATM 8870 O O   . HOH K 5 .   ? 77.887  83.117 30.765  1.00 45.78  ? 1055 HOH A O   1 
HETATM 8871 O O   . HOH K 5 .   ? 96.624  88.403 19.494  1.00 49.42  ? 1056 HOH A O   1 
HETATM 8872 O O   . HOH K 5 .   ? 118.565 67.343 35.816  1.00 51.63  ? 1057 HOH A O   1 
HETATM 8873 O O   . HOH K 5 .   ? 104.113 38.106 2.383   1.00 42.40  ? 1058 HOH A O   1 
HETATM 8874 O O   . HOH K 5 .   ? 95.699  46.026 -0.950  1.00 46.73  ? 1059 HOH A O   1 
HETATM 8875 O O   . HOH K 5 .   ? 106.168 86.418 27.934  1.00 57.23  ? 1060 HOH A O   1 
HETATM 8876 O O   . HOH K 5 .   ? 99.947  68.897 5.468   1.00 36.93  ? 1061 HOH A O   1 
HETATM 8877 O O   . HOH K 5 .   ? 114.546 50.653 11.330  1.00 41.21  ? 1062 HOH A O   1 
HETATM 8878 O O   . HOH K 5 .   ? 91.110  34.347 8.557   1.00 27.50  ? 1063 HOH A O   1 
HETATM 8879 O O   . HOH K 5 .   ? 97.147  74.715 42.222  1.00 41.39  ? 1064 HOH A O   1 
HETATM 8880 O O   . HOH K 5 .   ? 92.072  58.878 -5.035  1.00 38.76  ? 1065 HOH A O   1 
HETATM 8881 O O   . HOH K 5 .   ? 113.367 60.659 11.360  1.00 43.93  ? 1066 HOH A O   1 
HETATM 8882 O O   . HOH K 5 .   ? 98.273  84.194 25.670  1.00 35.54  ? 1067 HOH A O   1 
HETATM 8883 O O   . HOH K 5 .   ? 74.423  60.788 30.750  1.00 46.83  ? 1068 HOH A O   1 
HETATM 8884 O O   . HOH K 5 .   ? 69.057  65.837 -4.481  1.00 50.19  ? 1069 HOH A O   1 
HETATM 8885 O O   . HOH K 5 .   ? 72.266  74.888 20.947  1.00 51.97  ? 1070 HOH A O   1 
HETATM 8886 O O   . HOH K 5 .   ? 69.540  49.350 28.971  1.00 54.90  ? 1071 HOH A O   1 
HETATM 8887 O O   . HOH K 5 .   ? 115.641 56.523 31.783  1.00 36.90  ? 1072 HOH A O   1 
HETATM 8888 O O   . HOH K 5 .   ? 97.101  28.179 20.456  1.00 51.57  ? 1073 HOH A O   1 
HETATM 8889 O O   . HOH K 5 .   ? 111.036 55.445 32.164  1.00 42.37  ? 1074 HOH A O   1 
HETATM 8890 O O   . HOH K 5 .   ? 105.944 71.178 15.294  1.00 38.28  ? 1075 HOH A O   1 
HETATM 8891 O O   . HOH K 5 .   ? 72.445  77.526 19.811  1.00 50.34  ? 1076 HOH A O   1 
HETATM 8892 O O   . HOH K 5 .   ? 111.731 74.639 14.066  1.00 44.77  ? 1077 HOH A O   1 
HETATM 8893 O O   . HOH K 5 .   ? 63.935  55.326 0.429   1.00 45.11  ? 1078 HOH A O   1 
HETATM 8894 O O   . HOH K 5 .   ? 110.974 42.129 9.303   1.00 35.18  ? 1079 HOH A O   1 
HETATM 8895 O O   . HOH K 5 .   ? 78.937  43.387 17.695  1.00 56.54  ? 1080 HOH A O   1 
HETATM 8896 O O   . HOH K 5 .   ? 99.057  28.897 1.553   1.00 45.78  ? 1081 HOH A O   1 
HETATM 8897 O O   . HOH K 5 .   ? 118.201 57.285 38.330  1.00 56.20  ? 1082 HOH A O   1 
HETATM 8898 O O   . HOH K 5 .   ? 116.462 72.381 35.970  1.00 50.68  ? 1083 HOH A O   1 
HETATM 8899 O O   . HOH K 5 .   ? 110.561 53.364 33.456  1.00 41.19  ? 1084 HOH A O   1 
HETATM 8900 O O   . HOH K 5 .   ? 93.769  85.153 27.122  1.00 43.99  ? 1085 HOH A O   1 
HETATM 8901 O O   . HOH K 5 .   ? 82.593  46.910 21.520  1.00 41.19  ? 1086 HOH A O   1 
HETATM 8902 O O   . HOH K 5 .   ? 117.230 54.134 32.326  1.00 42.64  ? 1087 HOH A O   1 
HETATM 8903 O O   . HOH K 5 .   ? 78.331  59.947 -4.720  1.00 40.90  ? 1088 HOH A O   1 
HETATM 8904 O O   . HOH K 5 .   ? 88.236  33.984 21.648  1.00 45.48  ? 1089 HOH A O   1 
HETATM 8905 O O   . HOH K 5 .   ? 60.697  68.708 1.930   1.00 50.44  ? 1090 HOH A O   1 
HETATM 8906 O O   . HOH K 5 .   ? 104.977 47.487 29.472  1.00 35.88  ? 1091 HOH A O   1 
HETATM 8907 O O   . HOH K 5 .   ? 59.231  57.449 3.756   1.00 53.03  ? 1092 HOH A O   1 
HETATM 8908 O O   . HOH K 5 .   ? 93.957  30.880 23.842  1.00 54.18  ? 1093 HOH A O   1 
HETATM 8909 O O   . HOH K 5 .   ? 107.320 62.426 5.132   1.00 39.92  ? 1094 HOH A O   1 
HETATM 8910 O O   . HOH K 5 .   ? 105.979 75.081 12.224  1.00 47.01  ? 1095 HOH A O   1 
HETATM 8911 O O   . HOH K 5 .   ? 101.987 82.885 32.006  1.00 53.14  ? 1096 HOH A O   1 
HETATM 8912 O O   . HOH K 5 .   ? 93.855  68.985 -4.211  1.00 36.12  ? 1097 HOH A O   1 
HETATM 8913 O O   . HOH K 5 .   ? 79.734  75.633 10.986  1.00 41.75  ? 1098 HOH A O   1 
HETATM 8914 O O   . HOH K 5 .   ? 89.829  48.647 38.029  1.00 41.76  ? 1099 HOH A O   1 
HETATM 8915 O O   . HOH K 5 .   ? 89.479  33.208 15.074  1.00 39.81  ? 1100 HOH A O   1 
HETATM 8916 O O   . HOH K 5 .   ? 112.497 53.415 4.799   1.00 46.10  ? 1101 HOH A O   1 
HETATM 8917 O O   . HOH K 5 .   ? 91.485  85.533 28.304  1.00 52.87  ? 1102 HOH A O   1 
HETATM 8918 O O   . HOH K 5 .   ? 110.000 32.249 11.705  1.00 40.67  ? 1103 HOH A O   1 
HETATM 8919 O O   . HOH K 5 .   ? 102.024 65.414 3.781   1.00 33.11  ? 1104 HOH A O   1 
HETATM 8920 O O   . HOH K 5 .   ? 90.353  71.633 -2.958  1.00 42.17  ? 1105 HOH A O   1 
HETATM 8921 O O   . HOH K 5 .   ? 104.133 59.202 4.379   1.00 38.26  ? 1106 HOH A O   1 
HETATM 8922 O O   . HOH K 5 .   ? 103.789 54.788 3.104   1.00 27.73  ? 1107 HOH A O   1 
HETATM 8923 O O   . HOH K 5 .   ? 88.211  53.421 39.428  1.00 45.33  ? 1108 HOH A O   1 
HETATM 8924 O O   . HOH K 5 .   ? 110.298 63.012 5.816   1.00 38.61  ? 1109 HOH A O   1 
HETATM 8925 O O   . HOH K 5 .   ? 66.340  66.483 10.172  1.00 41.57  ? 1110 HOH A O   1 
HETATM 8926 O O   . HOH K 5 .   ? 100.128 70.451 7.345   1.00 44.76  ? 1111 HOH A O   1 
HETATM 8927 O O   . HOH K 5 .   ? 111.642 42.150 6.976   1.00 37.19  ? 1112 HOH A O   1 
HETATM 8928 O O   . HOH K 5 .   ? 74.473  49.293 35.333  1.00 47.54  ? 1113 HOH A O   1 
HETATM 8929 O O   . HOH K 5 .   ? 111.156 63.902 40.434  1.00 45.41  ? 1114 HOH A O   1 
HETATM 8930 O O   . HOH K 5 .   ? 63.455  56.307 -1.980  1.00 43.51  ? 1115 HOH A O   1 
HETATM 8931 O O   . HOH K 5 .   ? 76.613  49.204 17.761  1.00 45.59  ? 1116 HOH A O   1 
HETATM 8932 O O   . HOH K 5 .   ? 98.639  72.294 6.862   1.00 50.58  ? 1117 HOH A O   1 
HETATM 8933 O O   . HOH K 5 .   ? 101.022 61.142 1.056   1.00 44.71  ? 1118 HOH A O   1 
HETATM 8934 O O   . HOH K 5 .   ? 62.975  43.150 11.110  1.00 47.89  ? 1119 HOH A O   1 
HETATM 8935 O O   . HOH K 5 .   ? 117.094 69.387 37.298  1.00 48.62  ? 1120 HOH A O   1 
HETATM 8936 O O   . HOH K 5 .   ? 83.391  44.850 17.586  1.00 40.69  ? 1121 HOH A O   1 
HETATM 8937 O O   . HOH K 5 .   ? 65.621  57.337 35.184  1.00 55.50  ? 1122 HOH A O   1 
HETATM 8938 O O   . HOH K 5 .   ? 125.156 61.923 32.509  1.00 46.89  ? 1123 HOH A O   1 
HETATM 8939 O O   . HOH K 5 .   ? 109.840 68.396 41.208  1.00 45.18  ? 1124 HOH A O   1 
HETATM 8940 O O   . HOH K 5 .   ? 98.568  71.244 9.684   1.00 27.97  ? 1125 HOH A O   1 
HETATM 8941 O O   . HOH K 5 .   ? 118.208 58.163 19.523  1.00 35.96  ? 1126 HOH A O   1 
HETATM 8942 O O   . HOH K 5 .   ? 99.995  26.411 -0.205  1.00 51.13  ? 1127 HOH A O   1 
HETATM 8943 O O   . HOH K 5 .   ? 94.689  75.425 42.934  1.00 51.71  ? 1128 HOH A O   1 
HETATM 8944 O O   . HOH K 5 .   ? 84.273  80.381 7.254   1.00 47.62  ? 1129 HOH A O   1 
HETATM 8945 O O   . HOH K 5 .   ? 74.875  68.771 41.270  1.00 45.20  ? 1130 HOH A O   1 
HETATM 8946 O O   . HOH K 5 .   ? 112.725 42.921 11.055  1.00 49.59  ? 1131 HOH A O   1 
HETATM 8947 O O   . HOH K 5 .   ? 83.663  44.675 24.334  1.00 46.38  ? 1132 HOH A O   1 
HETATM 8948 O O   . HOH K 5 .   ? 83.343  88.141 15.376  1.00 52.07  ? 1133 HOH A O   1 
HETATM 8949 O O   . HOH K 5 .   ? 112.468 85.697 26.387  1.00 52.67  ? 1134 HOH A O   1 
HETATM 8950 O O   . HOH K 5 .   ? 93.808  91.755 17.883  1.00 51.26  ? 1135 HOH A O   1 
HETATM 8951 O O   . HOH K 5 .   ? 86.103  83.696 10.852  1.00 43.56  ? 1136 HOH A O   1 
HETATM 8952 O O   . HOH K 5 .   ? 112.966 45.562 10.191  1.00 47.34  ? 1137 HOH A O   1 
HETATM 8953 O O   . HOH K 5 .   ? 68.216  72.648 6.014   1.00 45.80  ? 1138 HOH A O   1 
HETATM 8954 O O   . HOH K 5 .   ? 68.862  69.919 9.418   1.00 37.52  ? 1139 HOH A O   1 
HETATM 8955 O O   . HOH K 5 .   ? 108.863 32.546 18.497  1.00 46.16  ? 1140 HOH A O   1 
HETATM 8956 O O   . HOH K 5 .   ? 93.010  53.224 40.311  1.00 46.03  ? 1141 HOH A O   1 
HETATM 8957 O O   . HOH K 5 .   ? 100.675 55.981 0.055   1.00 36.72  ? 1142 HOH A O   1 
HETATM 8958 O O   . HOH K 5 .   ? 70.056  51.317 -1.550  1.00 41.74  ? 1143 HOH A O   1 
HETATM 8959 O O   . HOH K 5 .   ? 90.756  30.865 15.421  1.00 49.56  ? 1144 HOH A O   1 
HETATM 8960 O O   . HOH K 5 .   ? 89.416  32.627 12.625  1.00 40.34  ? 1145 HOH A O   1 
HETATM 8961 O O   . HOH K 5 .   ? 108.831 30.477 17.005  1.00 48.50  ? 1146 HOH A O   1 
HETATM 8962 O O   . HOH K 5 .   ? 120.080 78.111 20.260  1.00 47.09  ? 1147 HOH A O   1 
HETATM 8963 O O   . HOH K 5 .   ? 110.809 71.264 14.389  1.00 43.54  ? 1148 HOH A O   1 
HETATM 8964 O O   . HOH K 5 .   ? 110.573 58.294 3.903   1.00 45.53  ? 1149 HOH A O   1 
HETATM 8965 O O   . HOH K 5 .   ? 95.988  66.341 42.335  1.00 47.37  ? 1150 HOH A O   1 
HETATM 8966 O O   . HOH K 5 .   ? 101.120 74.196 40.357  1.00 39.37  ? 1151 HOH A O   1 
HETATM 8967 O O   . HOH K 5 .   ? 95.438  30.132 10.883  1.00 48.97  ? 1152 HOH A O   1 
HETATM 8968 O O   . HOH K 5 .   ? 76.756  77.614 6.518   1.00 51.25  ? 1153 HOH A O   1 
HETATM 8969 O O   . HOH K 5 .   ? 106.215 55.508 3.265   1.00 44.28  ? 1154 HOH A O   1 
HETATM 8970 O O   . HOH K 5 .   ? 91.836  73.155 -1.044  1.00 42.77  ? 1155 HOH A O   1 
HETATM 8971 O O   . HOH K 5 .   ? 95.385  30.331 26.137  1.00 49.27  ? 1156 HOH A O   1 
HETATM 8972 O O   . HOH K 5 .   ? 69.067  68.552 -4.234  1.00 53.38  ? 1157 HOH A O   1 
HETATM 8973 O O   . HOH K 5 .   ? 109.505 68.772 5.243   1.00 52.09  ? 1158 HOH A O   1 
HETATM 8974 O O   . HOH K 5 .   ? 101.597 58.948 0.330   1.00 43.88  ? 1159 HOH A O   1 
HETATM 8975 O O   . HOH K 5 .   ? 92.439  51.312 41.969  1.00 43.99  ? 1160 HOH A O   1 
HETATM 8976 O O   . HOH K 5 .   ? 110.735 66.206 41.720  1.00 43.95  ? 1161 HOH A O   1 
HETATM 8977 O O   . HOH K 5 .   ? 102.804 56.049 1.102   1.00 33.74  ? 1162 HOH A O   1 
HETATM 8978 O O   . HOH K 5 .   ? 90.731  49.217 41.528  1.00 43.07  ? 1163 HOH A O   1 
HETATM 8979 O O   . HOH L 5 .   ? 113.214 78.976 -26.582 1.00 44.83  ? 701  HOH B O   1 
HETATM 8980 O O   . HOH L 5 .   ? 122.842 61.669 -45.112 1.00 50.45  ? 702  HOH B O   1 
HETATM 8981 O O   . HOH L 5 .   ? 114.658 59.534 -15.977 1.00 35.79  ? 703  HOH B O   1 
HETATM 8982 O O   . HOH L 5 .   ? 96.355  42.311 -2.062  1.00 36.34  ? 704  HOH B O   1 
HETATM 8983 O O   . HOH L 5 .   ? 91.740  27.452 -16.689 1.00 42.54  ? 705  HOH B O   1 
HETATM 8984 O O   . HOH L 5 .   ? 90.684  23.234 -30.811 1.00 44.10  ? 706  HOH B O   1 
HETATM 8985 O O   . HOH L 5 .   ? 84.903  57.632 -33.027 1.00 42.18  ? 707  HOH B O   1 
HETATM 8986 O O   . HOH L 5 .   ? 104.175 77.269 -27.134 1.00 46.09  ? 708  HOH B O   1 
HETATM 8987 O O   . HOH L 5 .   ? 99.287  78.213 -26.328 1.00 44.21  ? 709  HOH B O   1 
HETATM 8988 O O   . HOH L 5 .   ? 97.286  48.520 -18.459 1.00 39.91  ? 710  HOH B O   1 
HETATM 8989 O O   . HOH L 5 .   ? 114.527 34.811 -9.503  1.00 45.73  ? 711  HOH B O   1 
HETATM 8990 O O   . HOH L 5 .   ? 74.094  39.143 -20.464 1.00 47.49  ? 712  HOH B O   1 
HETATM 8991 O O   . HOH L 5 .   ? 83.330  60.199 -5.390  1.00 41.55  ? 713  HOH B O   1 
HETATM 8992 O O   . HOH L 5 .   ? 92.128  33.709 -35.440 1.00 33.22  ? 714  HOH B O   1 
HETATM 8993 O O   . HOH L 5 .   ? 110.792 35.217 -43.923 1.00 46.57  ? 715  HOH B O   1 
HETATM 8994 O O   . HOH L 5 .   ? 93.742  58.891 -14.414 1.00 16.54  ? 716  HOH B O   1 
HETATM 8995 O O   . HOH L 5 .   ? 85.552  43.691 -6.129  1.00 51.20  ? 717  HOH B O   1 
HETATM 8996 O O   . HOH L 5 .   ? 103.708 70.940 -25.435 1.00 24.07  ? 718  HOH B O   1 
HETATM 8997 O O   . HOH L 5 .   ? 122.334 43.424 -32.602 1.00 49.21  ? 719  HOH B O   1 
HETATM 8998 O O   . HOH L 5 .   ? 80.912  31.082 -35.600 1.00 36.82  ? 720  HOH B O   1 
HETATM 8999 O O   . HOH L 5 .   ? 96.990  48.133 0.356   1.00 39.73  ? 721  HOH B O   1 
HETATM 9000 O O   . HOH L 5 .   ? 97.319  32.430 -14.917 1.00 30.79  ? 722  HOH B O   1 
HETATM 9001 O O   . HOH L 5 .   ? 114.846 74.589 -22.688 1.00 31.04  ? 723  HOH B O   1 
HETATM 9002 O O   . HOH L 5 .   ? 90.633  61.394 -14.991 1.00 19.36  ? 724  HOH B O   1 
HETATM 9003 O O   . HOH L 5 .   ? 97.142  36.452 -44.308 1.00 34.39  ? 725  HOH B O   1 
HETATM 9004 O O   . HOH L 5 .   ? 98.791  30.873 -22.247 1.00 43.18  ? 726  HOH B O   1 
HETATM 9005 O O   . HOH L 5 .   ? 114.684 78.022 -32.226 1.00 38.25  ? 727  HOH B O   1 
HETATM 9006 O O   . HOH L 5 .   ? 96.508  49.355 -20.581 1.00 34.69  ? 728  HOH B O   1 
HETATM 9007 O O   . HOH L 5 .   ? 113.164 56.980 -16.997 1.00 23.12  ? 729  HOH B O   1 
HETATM 9008 O O   . HOH L 5 .   ? 111.839 31.293 -27.842 1.00 30.14  ? 730  HOH B O   1 
HETATM 9009 O O   . HOH L 5 .   ? 102.659 53.143 -19.181 1.00 15.34  ? 731  HOH B O   1 
HETATM 9010 O O   . HOH L 5 .   ? 116.230 57.075 -22.202 1.00 32.50  ? 732  HOH B O   1 
HETATM 9011 O O   . HOH L 5 .   ? 78.409  52.139 -34.590 1.00 53.22  ? 733  HOH B O   1 
HETATM 9012 O O   . HOH L 5 .   ? 79.095  25.678 -10.358 1.00 39.14  ? 734  HOH B O   1 
HETATM 9013 O O   . HOH L 5 .   ? 104.654 47.479 -0.280  1.00 26.93  ? 735  HOH B O   1 
HETATM 9014 O O   . HOH L 5 .   ? 100.221 27.997 -4.816  1.00 39.75  ? 736  HOH B O   1 
HETATM 9015 O O   . HOH L 5 .   ? 106.472 69.354 -37.316 1.00 36.30  ? 737  HOH B O   1 
HETATM 9016 O O   . HOH L 5 .   ? 98.910  75.803 -32.899 1.00 40.03  ? 738  HOH B O   1 
HETATM 9017 O O   . HOH L 5 .   ? 87.361  76.079 -24.949 1.00 46.17  ? 739  HOH B O   1 
HETATM 9018 O O   . HOH L 5 .   ? 75.415  58.183 -13.880 1.00 44.88  ? 740  HOH B O   1 
HETATM 9019 O O   . HOH L 5 .   ? 72.540  38.661 -11.078 1.00 52.66  ? 741  HOH B O   1 
HETATM 9020 O O   . HOH L 5 .   ? 79.801  32.867 -4.673  1.00 35.27  ? 742  HOH B O   1 
HETATM 9021 O O   . HOH L 5 .   ? 104.687 56.464 -6.359  1.00 40.69  ? 743  HOH B O   1 
HETATM 9022 O O   . HOH L 5 .   ? 101.269 45.200 -14.888 1.00 40.73  ? 744  HOH B O   1 
HETATM 9023 O O   . HOH L 5 .   ? 96.887  59.421 -43.060 1.00 42.77  ? 745  HOH B O   1 
HETATM 9024 O O   . HOH L 5 .   ? 118.867 52.990 -18.219 1.00 39.67  ? 746  HOH B O   1 
HETATM 9025 O O   . HOH L 5 .   ? 99.077  48.612 -11.395 1.00 40.28  ? 747  HOH B O   1 
HETATM 9026 O O   . HOH L 5 .   ? 102.894 30.831 -16.127 1.00 31.45  ? 748  HOH B O   1 
HETATM 9027 O O   . HOH L 5 .   ? 96.807  72.141 -27.547 1.00 29.50  ? 749  HOH B O   1 
HETATM 9028 O O   . HOH L 5 .   ? 110.011 28.374 -27.297 1.00 36.59  ? 750  HOH B O   1 
HETATM 9029 O O   . HOH L 5 .   ? 81.581  38.355 -40.877 1.00 53.47  ? 751  HOH B O   1 
HETATM 9030 O O   . HOH L 5 .   ? 111.100 63.419 -41.393 1.00 33.78  ? 752  HOH B O   1 
HETATM 9031 O O   . HOH L 5 .   ? 117.956 37.612 -11.342 1.00 31.18  ? 753  HOH B O   1 
HETATM 9032 O O   . HOH L 5 .   ? 86.120  47.920 -28.240 1.00 29.35  ? 754  HOH B O   1 
HETATM 9033 O O   . HOH L 5 .   ? 119.414 42.893 -30.605 1.00 38.39  ? 755  HOH B O   1 
HETATM 9034 O O   . HOH L 5 .   ? 73.846  59.025 -21.395 1.00 42.77  ? 756  HOH B O   1 
HETATM 9035 O O   . HOH L 5 .   ? 115.614 50.326 -25.284 1.00 26.45  ? 757  HOH B O   1 
HETATM 9036 O O   . HOH L 5 .   ? 93.744  31.293 -32.949 1.00 31.73  ? 758  HOH B O   1 
HETATM 9037 O O   . HOH L 5 .   ? 75.174  61.947 -12.937 1.00 37.50  ? 759  HOH B O   1 
HETATM 9038 O O   . HOH L 5 .   ? 81.362  42.372 -19.776 1.00 38.63  ? 760  HOH B O   1 
HETATM 9039 O O   . HOH L 5 .   ? 87.304  41.894 -16.845 1.00 24.18  ? 761  HOH B O   1 
HETATM 9040 O O   . HOH L 5 .   ? 109.418 55.999 -23.956 1.00 27.33  ? 762  HOH B O   1 
HETATM 9041 O O   . HOH L 5 .   ? 78.319  39.684 -14.587 1.00 38.85  ? 763  HOH B O   1 
HETATM 9042 O O   . HOH L 5 .   ? 96.991  52.052 -11.615 1.00 33.43  ? 764  HOH B O   1 
HETATM 9043 O O   . HOH L 5 .   ? 96.304  72.404 -14.483 1.00 29.50  ? 765  HOH B O   1 
HETATM 9044 O O   . HOH L 5 .   ? 84.498  76.345 -21.297 1.00 48.28  ? 766  HOH B O   1 
HETATM 9045 O O   . HOH L 5 .   ? 99.634  56.177 -12.578 1.00 24.50  ? 767  HOH B O   1 
HETATM 9046 O O   . HOH L 5 .   ? 125.213 46.122 -28.383 1.00 46.94  ? 768  HOH B O   1 
HETATM 9047 O O   . HOH L 5 .   ? 101.863 42.604 -21.789 1.00 20.72  ? 769  HOH B O   1 
HETATM 9048 O O   . HOH L 5 .   ? 92.037  31.604 -31.229 1.00 33.32  ? 770  HOH B O   1 
HETATM 9049 O O   . HOH L 5 .   ? 87.417  54.961 -38.759 1.00 33.98  ? 771  HOH B O   1 
HETATM 9050 O O   . HOH L 5 .   ? 123.346 52.177 -19.686 1.00 43.13  ? 772  HOH B O   1 
HETATM 9051 O O   . HOH L 5 .   ? 99.809  36.081 -42.274 1.00 34.70  ? 773  HOH B O   1 
HETATM 9052 O O   . HOH L 5 .   ? 100.386 28.207 -25.671 1.00 47.43  ? 774  HOH B O   1 
HETATM 9053 O O   . HOH L 5 .   ? 85.082  74.891 -25.835 1.00 43.93  ? 775  HOH B O   1 
HETATM 9054 O O   . HOH L 5 .   ? 100.902 50.613 -5.300  1.00 26.59  ? 776  HOH B O   1 
HETATM 9055 O O   . HOH L 5 .   ? 123.478 60.864 -32.765 1.00 30.37  ? 777  HOH B O   1 
HETATM 9056 O O   . HOH L 5 .   ? 107.462 54.660 -12.133 1.00 21.42  ? 778  HOH B O   1 
HETATM 9057 O O   . HOH L 5 .   ? 102.004 70.402 -23.337 1.00 19.75  ? 779  HOH B O   1 
HETATM 9058 O O   . HOH L 5 .   ? 70.521  75.490 -20.228 1.00 61.79  ? 780  HOH B O   1 
HETATM 9059 O O   . HOH L 5 .   ? 121.849 47.819 -26.595 1.00 38.49  ? 781  HOH B O   1 
HETATM 9060 O O   . HOH L 5 .   ? 93.446  38.711 -50.965 1.00 50.75  ? 782  HOH B O   1 
HETATM 9061 O O   . HOH L 5 .   ? 102.684 56.921 -15.264 1.00 19.75  ? 783  HOH B O   1 
HETATM 9062 O O   . HOH L 5 .   ? 115.443 55.104 -11.920 1.00 49.83  ? 784  HOH B O   1 
HETATM 9063 O O   . HOH L 5 .   ? 106.670 61.921 -18.645 1.00 22.30  ? 785  HOH B O   1 
HETATM 9064 O O   . HOH L 5 .   ? 94.770  23.733 -4.664  1.00 44.72  ? 786  HOH B O   1 
HETATM 9065 O O   . HOH L 5 .   ? 90.663  55.184 -18.780 1.00 21.23  ? 787  HOH B O   1 
HETATM 9066 O O   . HOH L 5 .   ? 96.015  63.159 -18.474 1.00 23.93  ? 788  HOH B O   1 
HETATM 9067 O O   . HOH L 5 .   ? 96.262  66.357 -36.350 1.00 46.18  ? 789  HOH B O   1 
HETATM 9068 O O   . HOH L 5 .   ? 101.002 29.376 -23.333 1.00 44.62  ? 790  HOH B O   1 
HETATM 9069 O O   . HOH L 5 .   ? 93.397  73.599 -17.044 1.00 26.26  ? 791  HOH B O   1 
HETATM 9070 O O   . HOH L 5 .   ? 94.349  68.967 -20.268 1.00 25.50  ? 792  HOH B O   1 
HETATM 9071 O O   . HOH L 5 .   ? 84.307  46.312 -26.602 1.00 45.19  ? 793  HOH B O   1 
HETATM 9072 O O   . HOH L 5 .   ? 103.650 69.584 -33.753 1.00 30.80  ? 794  HOH B O   1 
HETATM 9073 O O   . HOH L 5 .   ? 78.633  73.001 -6.801  1.00 51.46  ? 795  HOH B O   1 
HETATM 9074 O O   . HOH L 5 .   ? 82.882  60.468 -20.910 1.00 27.87  ? 796  HOH B O   1 
HETATM 9075 O O   . HOH L 5 .   ? 87.535  35.602 -6.873  1.00 23.38  ? 797  HOH B O   1 
HETATM 9076 O O   . HOH L 5 .   ? 102.802 72.560 -14.860 1.00 38.37  ? 798  HOH B O   1 
HETATM 9077 O O   . HOH L 5 .   ? 91.918  29.471 -21.634 1.00 29.12  ? 799  HOH B O   1 
HETATM 9078 O O   . HOH L 5 .   ? 104.193 56.349 -25.631 1.00 18.82  ? 800  HOH B O   1 
HETATM 9079 O O   . HOH L 5 .   ? 117.577 33.018 -16.622 1.00 39.42  ? 801  HOH B O   1 
HETATM 9080 O O   . HOH L 5 .   ? 82.442  48.480 -14.455 1.00 41.91  ? 802  HOH B O   1 
HETATM 9081 O O   . HOH L 5 .   ? 87.156  65.696 -25.393 1.00 30.93  ? 803  HOH B O   1 
HETATM 9082 O O   . HOH L 5 .   ? 114.953 53.186 -43.900 1.00 42.05  ? 804  HOH B O   1 
HETATM 9083 O O   . HOH L 5 .   ? 88.713  29.972 -32.039 1.00 34.85  ? 805  HOH B O   1 
HETATM 9084 O O   . HOH L 5 .   ? 127.189 54.012 -30.227 1.00 41.62  ? 806  HOH B O   1 
HETATM 9085 O O   . HOH L 5 .   ? 104.642 39.104 0.254   1.00 28.27  ? 807  HOH B O   1 
HETATM 9086 O O   . HOH L 5 .   ? 90.708  73.929 -17.484 1.00 26.30  ? 808  HOH B O   1 
HETATM 9087 O O   . HOH L 5 .   ? 109.961 50.722 -39.436 1.00 26.08  ? 809  HOH B O   1 
HETATM 9088 O O   . HOH L 5 .   ? 109.221 63.934 -22.387 1.00 24.10  ? 810  HOH B O   1 
HETATM 9089 O O   . HOH L 5 .   ? 82.696  49.527 -29.632 1.00 37.62  ? 811  HOH B O   1 
HETATM 9090 O O   . HOH L 5 .   ? 88.217  57.392 -8.032  1.00 41.88  ? 812  HOH B O   1 
HETATM 9091 O O   . HOH L 5 .   ? 92.343  67.815 -21.855 1.00 23.97  ? 813  HOH B O   1 
HETATM 9092 O O   . HOH L 5 .   ? 95.792  77.355 -23.518 1.00 45.22  ? 814  HOH B O   1 
HETATM 9093 O O   . HOH L 5 .   ? 98.257  39.543 -15.774 1.00 25.20  ? 815  HOH B O   1 
HETATM 9094 O O   . HOH L 5 .   ? 111.165 36.577 -8.946  1.00 29.65  ? 816  HOH B O   1 
HETATM 9095 O O   . HOH L 5 .   ? 107.428 70.768 -32.419 1.00 25.86  ? 817  HOH B O   1 
HETATM 9096 O O   . HOH L 5 .   ? 107.757 34.778 -43.043 1.00 39.44  ? 818  HOH B O   1 
HETATM 9097 O O   . HOH L 5 .   ? 73.399  67.701 -17.357 1.00 52.10  ? 819  HOH B O   1 
HETATM 9098 O O   . HOH L 5 .   ? 102.791 40.843 -25.139 1.00 23.00  ? 820  HOH B O   1 
HETATM 9099 O O   . HOH L 5 .   ? 113.642 51.504 -12.474 1.00 44.33  ? 821  HOH B O   1 
HETATM 9100 O O   . HOH L 5 .   ? 84.868  58.939 -39.602 1.00 39.19  ? 822  HOH B O   1 
HETATM 9101 O O   . HOH L 5 .   ? 120.966 43.086 -15.764 1.00 34.03  ? 823  HOH B O   1 
HETATM 9102 O O   . HOH L 5 .   ? 96.208  21.844 -7.920  1.00 42.27  ? 824  HOH B O   1 
HETATM 9103 O O   . HOH L 5 .   ? 85.000  58.041 -22.691 1.00 22.67  ? 825  HOH B O   1 
HETATM 9104 O O   . HOH L 5 .   ? 121.500 79.699 -29.921 1.00 33.50  ? 826  HOH B O   1 
HETATM 9105 O O   . HOH L 5 .   ? 92.576  25.909 -14.004 1.00 32.65  ? 827  HOH B O   1 
HETATM 9106 O O   . HOH L 5 .   ? 104.866 62.591 -9.796  1.00 29.12  ? 828  HOH B O   1 
HETATM 9107 O O   . HOH L 5 .   ? 91.107  34.954 -46.984 1.00 43.20  ? 829  HOH B O   1 
HETATM 9108 O O   . HOH L 5 .   ? 126.808 60.740 -38.146 1.00 46.43  ? 830  HOH B O   1 
HETATM 9109 O O   . HOH L 5 .   ? 124.035 54.170 -31.049 1.00 35.17  ? 831  HOH B O   1 
HETATM 9110 O O   . HOH L 5 .   ? 81.453  63.584 -29.889 1.00 45.93  ? 832  HOH B O   1 
HETATM 9111 O O   . HOH L 5 .   ? 104.123 58.520 -8.685  1.00 23.72  ? 833  HOH B O   1 
HETATM 9112 O O   . HOH L 5 .   ? 76.847  68.326 -7.891  1.00 36.15  ? 834  HOH B O   1 
HETATM 9113 O O   . HOH L 5 .   ? 111.928 78.780 -34.886 1.00 35.26  ? 835  HOH B O   1 
HETATM 9114 O O   . HOH L 5 .   ? 101.892 53.197 -16.424 1.00 16.82  ? 836  HOH B O   1 
HETATM 9115 O O   . HOH L 5 .   ? 80.158  42.932 -11.354 1.00 36.66  ? 837  HOH B O   1 
HETATM 9116 O O   . HOH L 5 .   ? 91.775  72.734 -30.268 1.00 41.91  ? 838  HOH B O   1 
HETATM 9117 O O   . HOH L 5 .   ? 106.206 78.405 -29.026 1.00 37.80  ? 839  HOH B O   1 
HETATM 9118 O O   . HOH L 5 .   ? 124.802 47.820 -32.599 1.00 42.95  ? 840  HOH B O   1 
HETATM 9119 O O   . HOH L 5 .   ? 108.573 38.324 -17.585 1.00 27.37  ? 841  HOH B O   1 
HETATM 9120 O O   . HOH L 5 .   ? 111.688 56.115 -20.738 1.00 24.73  ? 842  HOH B O   1 
HETATM 9121 O O   . HOH L 5 .   ? 102.932 33.686 -36.175 1.00 28.03  ? 843  HOH B O   1 
HETATM 9122 O O   . HOH L 5 .   ? 95.932  62.896 -40.564 1.00 38.77  ? 844  HOH B O   1 
HETATM 9123 O O   . HOH L 5 .   ? 127.323 51.527 -30.329 1.00 42.47  ? 845  HOH B O   1 
HETATM 9124 O O   . HOH L 5 .   ? 121.943 62.736 -33.347 1.00 32.90  ? 846  HOH B O   1 
HETATM 9125 O O   . HOH L 5 .   ? 84.714  31.395 0.686   1.00 39.09  ? 847  HOH B O   1 
HETATM 9126 O O   . HOH L 5 .   ? 105.837 33.826 -4.881  1.00 31.24  ? 848  HOH B O   1 
HETATM 9127 O O   . HOH L 5 .   ? 98.199  26.078 -28.960 1.00 36.89  ? 849  HOH B O   1 
HETATM 9128 O O   . HOH L 5 .   ? 79.477  51.195 -23.961 1.00 36.93  ? 850  HOH B O   1 
HETATM 9129 O O   . HOH L 5 .   ? 125.078 44.409 -19.982 1.00 41.07  ? 851  HOH B O   1 
HETATM 9130 O O   . HOH L 5 .   ? 99.628  30.049 -39.574 1.00 33.19  ? 852  HOH B O   1 
HETATM 9131 O O   . HOH L 5 .   ? 108.041 44.830 -18.223 1.00 24.72  ? 853  HOH B O   1 
HETATM 9132 O O   . HOH L 5 .   ? 98.190  33.666 -23.056 1.00 31.79  ? 854  HOH B O   1 
HETATM 9133 O O   . HOH L 5 .   ? 121.237 43.928 -36.025 1.00 44.63  ? 855  HOH B O   1 
HETATM 9134 O O   . HOH L 5 .   ? 86.630  75.388 -9.250  1.00 39.86  ? 856  HOH B O   1 
HETATM 9135 O O   . HOH L 5 .   ? 86.668  59.578 -25.561 1.00 21.60  ? 857  HOH B O   1 
HETATM 9136 O O   . HOH L 5 .   ? 104.961 58.898 -38.559 1.00 29.41  ? 858  HOH B O   1 
HETATM 9137 O O   . HOH L 5 .   ? 80.656  39.214 -7.497  1.00 31.80  ? 859  HOH B O   1 
HETATM 9138 O O   . HOH L 5 .   ? 120.663 72.581 -34.703 1.00 41.24  ? 860  HOH B O   1 
HETATM 9139 O O   . HOH L 5 .   ? 96.921  34.332 -20.781 1.00 30.33  ? 861  HOH B O   1 
HETATM 9140 O O   . HOH L 5 .   ? 113.820 45.925 -14.217 1.00 35.54  ? 862  HOH B O   1 
HETATM 9141 O O   . HOH L 5 .   ? 112.465 56.909 -12.696 1.00 38.71  ? 863  HOH B O   1 
HETATM 9142 O O   . HOH L 5 .   ? 108.986 66.698 -12.862 1.00 32.03  ? 864  HOH B O   1 
HETATM 9143 O O   . HOH L 5 .   ? 106.520 58.610 -45.678 1.00 48.80  ? 865  HOH B O   1 
HETATM 9144 O O   . HOH L 5 .   ? 97.097  61.690 -8.859  1.00 18.00  ? 866  HOH B O   1 
HETATM 9145 O O   . HOH L 5 .   ? 87.583  23.528 -11.589 1.00 34.58  ? 867  HOH B O   1 
HETATM 9146 O O   . HOH L 5 .   ? 119.512 67.375 -38.744 1.00 42.45  ? 868  HOH B O   1 
HETATM 9147 O O   . HOH L 5 .   ? 86.787  50.255 -19.912 1.00 21.80  ? 869  HOH B O   1 
HETATM 9148 O O   . HOH L 5 .   ? 120.511 72.788 -31.906 1.00 34.49  ? 870  HOH B O   1 
HETATM 9149 O O   . HOH L 5 .   ? 118.454 75.391 -23.671 1.00 32.34  ? 871  HOH B O   1 
HETATM 9150 O O   . HOH L 5 .   ? 96.671  52.665 0.083   1.00 35.09  ? 872  HOH B O   1 
HETATM 9151 O O   . HOH L 5 .   ? 102.128 52.998 -4.214  1.00 38.64  ? 873  HOH B O   1 
HETATM 9152 O O   . HOH L 5 .   ? 109.482 51.728 -14.822 1.00 21.05  ? 874  HOH B O   1 
HETATM 9153 O O   . HOH L 5 .   ? 90.505  32.743 -0.194  1.00 44.72  ? 875  HOH B O   1 
HETATM 9154 O O   . HOH L 5 .   ? 85.519  77.630 -17.518 1.00 35.72  ? 876  HOH B O   1 
HETATM 9155 O O   . HOH L 5 .   ? 93.249  60.335 -6.958  1.00 24.82  ? 877  HOH B O   1 
HETATM 9156 O O   . HOH L 5 .   ? 87.549  63.830 -31.485 1.00 38.11  ? 878  HOH B O   1 
HETATM 9157 O O   . HOH L 5 .   ? 88.099  49.108 -42.134 1.00 40.21  ? 879  HOH B O   1 
HETATM 9158 O O   . HOH L 5 .   ? 87.347  37.418 -43.067 1.00 48.91  ? 880  HOH B O   1 
HETATM 9159 O O   . HOH L 5 .   ? 100.699 51.222 -10.869 1.00 24.01  ? 881  HOH B O   1 
HETATM 9160 O O   . HOH L 5 .   ? 123.774 53.675 -38.572 1.00 51.31  ? 882  HOH B O   1 
HETATM 9161 O O   . HOH L 5 .   ? 97.802  31.420 -24.477 1.00 37.03  ? 883  HOH B O   1 
HETATM 9162 O O   . HOH L 5 .   ? 117.106 58.141 -19.445 1.00 40.35  ? 884  HOH B O   1 
HETATM 9163 O O   . HOH L 5 .   ? 87.903  48.064 -13.082 1.00 31.07  ? 885  HOH B O   1 
HETATM 9164 O O   . HOH L 5 .   ? 118.595 54.065 -46.079 1.00 49.91  ? 886  HOH B O   1 
HETATM 9165 O O   . HOH L 5 .   ? 110.770 35.187 -10.904 1.00 33.46  ? 887  HOH B O   1 
HETATM 9166 O O   . HOH L 5 .   ? 87.339  19.523 -6.414  1.00 36.20  ? 888  HOH B O   1 
HETATM 9167 O O   . HOH L 5 .   ? 86.975  38.991 -27.883 1.00 32.09  ? 889  HOH B O   1 
HETATM 9168 O O   . HOH L 5 .   ? 85.662  61.239 -32.193 1.00 43.98  ? 890  HOH B O   1 
HETATM 9169 O O   . HOH L 5 .   ? 91.002  41.491 -4.591  1.00 30.93  ? 891  HOH B O   1 
HETATM 9170 O O   . HOH L 5 .   ? 102.588 49.826 -21.936 1.00 20.66  ? 892  HOH B O   1 
HETATM 9171 O O   . HOH L 5 .   ? 99.581  52.094 -14.948 1.00 28.14  ? 893  HOH B O   1 
HETATM 9172 O O   . HOH L 5 .   ? 114.954 32.349 -34.161 1.00 41.86  ? 894  HOH B O   1 
HETATM 9173 O O   . HOH L 5 .   ? 78.859  33.392 -11.215 1.00 31.60  ? 895  HOH B O   1 
HETATM 9174 O O   . HOH L 5 .   ? 85.999  38.723 -25.431 1.00 26.05  ? 896  HOH B O   1 
HETATM 9175 O O   . HOH L 5 .   ? 96.268  27.941 -26.875 1.00 45.44  ? 897  HOH B O   1 
HETATM 9176 O O   . HOH L 5 .   ? 113.226 68.846 -21.284 1.00 27.96  ? 898  HOH B O   1 
HETATM 9177 O O   . HOH L 5 .   ? 104.535 30.367 -11.860 1.00 40.98  ? 899  HOH B O   1 
HETATM 9178 O O   . HOH L 5 .   ? 96.360  25.330 -11.607 1.00 39.93  ? 900  HOH B O   1 
HETATM 9179 O O   . HOH L 5 .   ? 105.478 70.919 -17.818 1.00 33.72  ? 901  HOH B O   1 
HETATM 9180 O O   . HOH L 5 .   ? 105.142 73.439 -24.778 1.00 26.92  ? 902  HOH B O   1 
HETATM 9181 O O   . HOH L 5 .   ? 76.247  53.498 -24.546 1.00 44.27  ? 903  HOH B O   1 
HETATM 9182 O O   . HOH L 5 .   ? 74.228  54.346 -20.376 1.00 35.46  ? 904  HOH B O   1 
HETATM 9183 O O   . HOH L 5 .   ? 78.145  54.548 -29.565 1.00 41.80  ? 905  HOH B O   1 
HETATM 9184 O O   . HOH L 5 .   ? 124.906 51.443 -31.997 1.00 43.67  ? 906  HOH B O   1 
HETATM 9185 O O   . HOH L 5 .   ? 69.698  71.235 -18.065 1.00 56.62  ? 907  HOH B O   1 
HETATM 9186 O O   . HOH L 5 .   ? 92.276  43.645 -25.987 1.00 33.24  ? 908  HOH B O   1 
HETATM 9187 O O   . HOH L 5 .   ? 88.175  61.785 -13.754 1.00 39.47  ? 909  HOH B O   1 
HETATM 9188 O O   . HOH L 5 .   ? 105.107 74.829 -22.179 1.00 27.96  ? 910  HOH B O   1 
HETATM 9189 O O   . HOH L 5 .   ? 96.850  54.500 -21.210 1.00 17.72  ? 911  HOH B O   1 
HETATM 9190 O O   . HOH L 5 .   ? 97.388  32.611 -12.209 1.00 36.34  ? 912  HOH B O   1 
HETATM 9191 O O   . HOH L 5 .   ? 117.276 43.996 -11.331 1.00 35.57  ? 913  HOH B O   1 
HETATM 9192 O O   . HOH L 5 .   ? 91.720  53.004 -41.755 1.00 39.95  ? 914  HOH B O   1 
HETATM 9193 O O   . HOH L 5 .   ? 82.061  45.871 -22.446 1.00 44.83  ? 915  HOH B O   1 
HETATM 9194 O O   . HOH L 5 .   ? 83.753  49.335 -22.103 1.00 34.70  ? 916  HOH B O   1 
HETATM 9195 O O   . HOH L 5 .   ? 81.602  46.090 -19.334 1.00 39.78  ? 917  HOH B O   1 
HETATM 9196 O O   . HOH L 5 .   ? 94.177  26.451 -29.109 1.00 42.74  ? 918  HOH B O   1 
HETATM 9197 O O   . HOH L 5 .   ? 104.755 44.519 -0.714  1.00 25.31  ? 919  HOH B O   1 
HETATM 9198 O O   . HOH L 5 .   ? 70.005  35.030 -17.451 1.00 49.47  ? 920  HOH B O   1 
HETATM 9199 O O   . HOH L 5 .   ? 111.834 30.750 -19.263 1.00 35.98  ? 921  HOH B O   1 
HETATM 9200 O O   . HOH L 5 .   ? 108.219 40.463 -3.775  1.00 43.78  ? 922  HOH B O   1 
HETATM 9201 O O   . HOH L 5 .   ? 116.526 51.105 -17.052 1.00 45.49  ? 923  HOH B O   1 
HETATM 9202 O O   . HOH L 5 .   ? 83.716  39.284 -24.676 1.00 37.84  ? 924  HOH B O   1 
HETATM 9203 O O   . HOH L 5 .   ? 103.950 33.729 -2.612  1.00 45.32  ? 925  HOH B O   1 
HETATM 9204 O O   . HOH L 5 .   ? 120.739 36.836 -28.711 1.00 42.03  ? 926  HOH B O   1 
HETATM 9205 O O   . HOH L 5 .   ? 101.846 60.948 -19.507 1.00 18.37  ? 927  HOH B O   1 
HETATM 9206 O O   . HOH L 5 .   ? 104.491 40.332 -4.321  1.00 27.86  ? 928  HOH B O   1 
HETATM 9207 O O   . HOH L 5 .   ? 87.268  34.527 -33.243 1.00 46.27  ? 929  HOH B O   1 
HETATM 9208 O O   . HOH L 5 .   ? 123.354 60.878 -19.783 1.00 45.21  ? 930  HOH B O   1 
HETATM 9209 O O   . HOH L 5 .   ? 92.992  49.584 -44.386 1.00 46.81  ? 931  HOH B O   1 
HETATM 9210 O O   . HOH L 5 .   ? 111.167 60.526 -9.994  1.00 47.66  ? 932  HOH B O   1 
HETATM 9211 O O   . HOH L 5 .   ? 79.593  24.581 -8.010  1.00 50.24  ? 933  HOH B O   1 
HETATM 9212 O O   . HOH L 5 .   ? 81.113  45.739 -40.676 1.00 40.22  ? 934  HOH B O   1 
HETATM 9213 O O   . HOH L 5 .   ? 68.773  34.258 -13.426 1.00 55.07  ? 935  HOH B O   1 
HETATM 9214 O O   . HOH L 5 .   ? 93.892  71.314 -26.702 1.00 26.64  ? 936  HOH B O   1 
HETATM 9215 O O   . HOH L 5 .   ? 109.267 45.785 -4.103  1.00 33.33  ? 937  HOH B O   1 
HETATM 9216 O O   . HOH L 5 .   ? 89.745  56.962 -17.082 1.00 24.17  ? 938  HOH B O   1 
HETATM 9217 O O   . HOH L 5 .   ? 108.518 68.076 -15.209 1.00 38.21  ? 939  HOH B O   1 
HETATM 9218 O O   . HOH L 5 .   ? 112.319 68.961 -39.828 1.00 33.87  ? 940  HOH B O   1 
HETATM 9219 O O   . HOH L 5 .   ? 103.083 32.412 -5.362  1.00 35.34  ? 941  HOH B O   1 
HETATM 9220 O O   . HOH L 5 .   ? 108.007 37.154 -5.946  1.00 36.75  ? 942  HOH B O   1 
HETATM 9221 O O   . HOH L 5 .   ? 105.366 71.695 -33.632 1.00 30.16  ? 943  HOH B O   1 
HETATM 9222 O O   . HOH L 5 .   ? 103.038 65.800 -9.226  1.00 30.58  ? 944  HOH B O   1 
HETATM 9223 O O   . HOH L 5 .   ? 118.876 32.757 -23.598 1.00 35.37  ? 945  HOH B O   1 
HETATM 9224 O O   . HOH L 5 .   ? 100.098 24.179 -39.398 1.00 50.14  ? 946  HOH B O   1 
HETATM 9225 O O   . HOH L 5 .   ? 91.512  17.040 -15.435 1.00 53.41  ? 947  HOH B O   1 
HETATM 9226 O O   . HOH L 5 .   ? 102.388 35.449 -2.375  1.00 38.49  ? 948  HOH B O   1 
HETATM 9227 O O   . HOH L 5 .   ? 128.034 54.241 -23.849 1.00 33.92  ? 949  HOH B O   1 
HETATM 9228 O O   . HOH L 5 .   ? 93.742  42.405 -3.050  1.00 37.96  ? 950  HOH B O   1 
HETATM 9229 O O   . HOH L 5 .   ? 116.476 36.925 -32.866 1.00 41.57  ? 951  HOH B O   1 
HETATM 9230 O O   . HOH L 5 .   ? 132.454 61.393 -28.562 1.00 56.37  ? 952  HOH B O   1 
HETATM 9231 O O   . HOH L 5 .   ? 95.564  34.353 -17.795 1.00 24.02  ? 953  HOH B O   1 
HETATM 9232 O O   . HOH L 5 .   ? 118.123 49.361 -38.375 1.00 43.31  ? 954  HOH B O   1 
HETATM 9233 O O   . HOH L 5 .   ? 89.069  35.856 -36.498 1.00 34.79  ? 955  HOH B O   1 
HETATM 9234 O O   . HOH L 5 .   ? 94.860  31.791 -0.041  1.00 26.85  ? 956  HOH B O   1 
HETATM 9235 O O   . HOH L 5 .   ? 101.284 54.307 -45.103 1.00 49.30  ? 957  HOH B O   1 
HETATM 9236 O O   . HOH L 5 .   ? 92.511  21.576 -14.531 1.00 46.51  ? 958  HOH B O   1 
HETATM 9237 O O   . HOH L 5 .   ? 111.036 70.992 -22.807 1.00 35.91  ? 959  HOH B O   1 
HETATM 9238 O O   . HOH L 5 .   ? 86.345  25.204 -3.018  1.00 43.28  ? 960  HOH B O   1 
HETATM 9239 O O   . HOH L 5 .   ? 113.566 58.480 -46.710 1.00 46.31  ? 961  HOH B O   1 
HETATM 9240 O O   . HOH L 5 .   ? 116.960 52.867 -14.732 1.00 47.06  ? 962  HOH B O   1 
HETATM 9241 O O   . HOH L 5 .   ? 75.210  60.351 -14.887 1.00 35.47  ? 963  HOH B O   1 
HETATM 9242 O O   . HOH L 5 .   ? 91.781  20.320 -3.664  1.00 43.96  ? 964  HOH B O   1 
HETATM 9243 O O   . HOH L 5 .   ? 95.908  59.615 -7.465  1.00 20.59  ? 965  HOH B O   1 
HETATM 9244 O O   . HOH L 5 .   ? 86.866  31.444 -32.767 1.00 30.49  ? 966  HOH B O   1 
HETATM 9245 O O   . HOH L 5 .   ? 96.532  67.512 -20.187 1.00 22.66  ? 967  HOH B O   1 
HETATM 9246 O O   . HOH L 5 .   ? 88.755  25.544 -23.924 1.00 49.20  ? 968  HOH B O   1 
HETATM 9247 O O   . HOH L 5 .   ? 91.935  25.257 -27.510 1.00 43.32  ? 969  HOH B O   1 
HETATM 9248 O O   . HOH L 5 .   ? 107.936 50.736 -45.119 1.00 51.63  ? 970  HOH B O   1 
HETATM 9249 O O   . HOH L 5 .   ? 116.513 37.894 -9.048  1.00 36.36  ? 971  HOH B O   1 
HETATM 9250 O O   . HOH L 5 .   ? 95.462  70.003 -9.599  1.00 26.33  ? 972  HOH B O   1 
HETATM 9251 O O   . HOH L 5 .   ? 117.376 32.632 -25.482 1.00 37.91  ? 973  HOH B O   1 
HETATM 9252 O O   . HOH L 5 .   ? 84.803  71.226 -6.783  1.00 42.02  ? 974  HOH B O   1 
HETATM 9253 O O   . HOH L 5 .   ? 123.907 47.876 -24.885 1.00 42.94  ? 975  HOH B O   1 
HETATM 9254 O O   . HOH L 5 .   ? 74.679  32.971 -12.582 1.00 44.49  ? 976  HOH B O   1 
HETATM 9255 O O   . HOH L 5 .   ? 120.998 47.998 -37.936 1.00 48.98  ? 977  HOH B O   1 
HETATM 9256 O O   . HOH L 5 .   ? 98.848  71.690 -14.701 1.00 26.42  ? 978  HOH B O   1 
HETATM 9257 O O   . HOH L 5 .   ? 86.419  46.589 -8.028  1.00 46.43  ? 979  HOH B O   1 
HETATM 9258 O O   . HOH L 5 .   ? 126.261 56.386 -39.088 1.00 48.80  ? 980  HOH B O   1 
HETATM 9259 O O   . HOH L 5 .   ? 84.197  50.355 -19.849 1.00 25.04  ? 981  HOH B O   1 
HETATM 9260 O O   . HOH L 5 .   ? 96.578  58.424 -5.459  1.00 29.22  ? 982  HOH B O   1 
HETATM 9261 O O   . HOH L 5 .   ? 96.627  28.607 -43.712 1.00 46.57  ? 983  HOH B O   1 
HETATM 9262 O O   . HOH L 5 .   ? 100.341 26.440 -7.021  1.00 47.14  ? 984  HOH B O   1 
HETATM 9263 O O   . HOH L 5 .   ? 86.269  40.977 -29.994 1.00 43.59  ? 985  HOH B O   1 
HETATM 9264 O O   . HOH L 5 .   ? 123.727 57.889 -19.611 1.00 33.47  ? 986  HOH B O   1 
HETATM 9265 O O   . HOH L 5 .   ? 107.703 63.877 -44.916 1.00 46.55  ? 987  HOH B O   1 
HETATM 9266 O O   . HOH L 5 .   ? 114.878 44.107 -12.544 1.00 34.65  ? 988  HOH B O   1 
HETATM 9267 O O   . HOH L 5 .   ? 81.036  75.916 -8.662  1.00 48.51  ? 989  HOH B O   1 
HETATM 9268 O O   . HOH L 5 .   ? 96.254  30.034 -16.055 1.00 35.00  ? 990  HOH B O   1 
HETATM 9269 O O   . HOH L 5 .   ? 103.400 26.615 -22.334 1.00 46.13  ? 991  HOH B O   1 
HETATM 9270 O O   . HOH L 5 .   ? 95.853  27.998 -18.488 1.00 42.45  ? 992  HOH B O   1 
HETATM 9271 O O   . HOH L 5 .   ? 82.056  76.709 -10.847 1.00 56.08  ? 993  HOH B O   1 
HETATM 9272 O O   . HOH L 5 .   ? 109.881 31.329 -17.179 1.00 38.01  ? 994  HOH B O   1 
HETATM 9273 O O   . HOH L 5 .   ? 122.584 62.671 -40.387 1.00 49.74  ? 995  HOH B O   1 
HETATM 9274 O O   . HOH L 5 .   ? 109.753 54.273 -13.738 1.00 19.54  ? 996  HOH B O   1 
HETATM 9275 O O   . HOH L 5 .   ? 88.240  39.433 -0.591  1.00 37.53  ? 997  HOH B O   1 
HETATM 9276 O O   . HOH L 5 .   ? 124.699 39.512 -23.692 1.00 45.71  ? 998  HOH B O   1 
HETATM 9277 O O   . HOH L 5 .   ? 124.819 37.626 -21.884 1.00 43.10  ? 999  HOH B O   1 
HETATM 9278 O O   . HOH L 5 .   ? 97.409  31.347 0.851   1.00 33.57  ? 1000 HOH B O   1 
HETATM 9279 O O   . HOH L 5 .   ? 75.586  66.671 -13.393 1.00 42.44  ? 1001 HOH B O   1 
HETATM 9280 O O   . HOH L 5 .   ? 89.510  54.411 -14.635 1.00 32.38  ? 1002 HOH B O   1 
HETATM 9281 O O   . HOH L 5 .   ? 108.980 70.845 -34.624 1.00 30.91  ? 1003 HOH B O   1 
HETATM 9282 O O   . HOH L 5 .   ? 123.604 34.665 -14.770 1.00 33.46  ? 1004 HOH B O   1 
HETATM 9283 O O   . HOH L 5 .   ? 99.761  53.259 -12.406 1.00 19.24  ? 1005 HOH B O   1 
HETATM 9284 O O   . HOH L 5 .   ? 78.404  46.225 -8.606  1.00 50.70  ? 1006 HOH B O   1 
HETATM 9285 O O   . HOH L 5 .   ? 94.711  56.415 -45.246 1.00 47.12  ? 1007 HOH B O   1 
HETATM 9286 O O   . HOH L 5 .   ? 108.456 74.707 -25.300 1.00 37.70  ? 1008 HOH B O   1 
HETATM 9287 O O   . HOH L 5 .   ? 101.906 30.253 -42.404 1.00 42.98  ? 1009 HOH B O   1 
HETATM 9288 O O   . HOH L 5 .   ? 126.770 74.767 -26.943 1.00 54.54  ? 1010 HOH B O   1 
HETATM 9289 O O   . HOH L 5 .   ? 102.399 71.262 -12.594 1.00 37.09  ? 1011 HOH B O   1 
HETATM 9290 O O   . HOH L 5 .   ? 83.307  57.670 -20.770 1.00 26.67  ? 1012 HOH B O   1 
HETATM 9291 O O   . HOH L 5 .   ? 125.148 65.179 -23.205 1.00 34.97  ? 1013 HOH B O   1 
HETATM 9292 O O   . HOH L 5 .   ? 108.183 72.935 -18.610 1.00 48.08  ? 1014 HOH B O   1 
HETATM 9293 O O   . HOH L 5 .   ? 89.066  51.604 -41.434 1.00 44.23  ? 1015 HOH B O   1 
HETATM 9294 O O   . HOH L 5 .   ? 94.440  34.404 -20.285 1.00 31.82  ? 1016 HOH B O   1 
HETATM 9295 O O   . HOH L 5 .   ? 88.925  25.003 -12.951 1.00 35.81  ? 1017 HOH B O   1 
HETATM 9296 O O   . HOH L 5 .   ? 103.910 57.492 -46.135 1.00 47.12  ? 1018 HOH B O   1 
HETATM 9297 O O   . HOH L 5 .   ? 93.315  61.323 -15.385 1.00 20.49  ? 1019 HOH B O   1 
HETATM 9298 O O   . HOH L 5 .   ? 100.057 71.452 -12.335 1.00 36.19  ? 1020 HOH B O   1 
HETATM 9299 O O   . HOH L 5 .   ? 108.333 77.340 -26.032 1.00 39.50  ? 1021 HOH B O   1 
HETATM 9300 O O   . HOH L 5 .   ? 77.479  25.668 -15.750 1.00 37.75  ? 1022 HOH B O   1 
HETATM 9301 O O   . HOH L 5 .   ? 81.792  37.982 -25.458 1.00 38.82  ? 1023 HOH B O   1 
HETATM 9302 O O   . HOH L 5 .   ? 111.313 47.029 -13.543 1.00 30.51  ? 1024 HOH B O   1 
HETATM 9303 O O   . HOH L 5 .   ? 74.894  54.509 -27.150 1.00 49.24  ? 1025 HOH B O   1 
HETATM 9304 O O   . HOH L 5 .   ? 94.592  30.176 -43.930 1.00 40.37  ? 1026 HOH B O   1 
HETATM 9305 O O   . HOH L 5 .   ? 104.612 48.544 -45.172 1.00 48.65  ? 1027 HOH B O   1 
HETATM 9306 O O   . HOH L 5 .   ? 83.355  45.615 -46.457 1.00 46.68  ? 1028 HOH B O   1 
HETATM 9307 O O   . HOH L 5 .   ? 83.397  27.060 -1.687  1.00 41.64  ? 1029 HOH B O   1 
HETATM 9308 O O   . HOH L 5 .   ? 76.774  60.808 -6.361  1.00 40.28  ? 1030 HOH B O   1 
HETATM 9309 O O   . HOH L 5 .   ? 86.771  54.618 -41.836 1.00 46.99  ? 1031 HOH B O   1 
HETATM 9310 O O   . HOH L 5 .   ? 121.249 52.451 -18.177 1.00 44.20  ? 1032 HOH B O   1 
HETATM 9311 O O   . HOH L 5 .   ? 96.649  66.140 -18.228 1.00 25.02  ? 1033 HOH B O   1 
HETATM 9312 O O   . HOH L 5 .   ? 91.196  38.885 -0.219  1.00 38.98  ? 1034 HOH B O   1 
HETATM 9313 O O   . HOH L 5 .   ? 108.708 23.688 -33.183 1.00 37.11  ? 1035 HOH B O   1 
HETATM 9314 O O   . HOH L 5 .   ? 80.886  56.181 -6.613  1.00 51.27  ? 1036 HOH B O   1 
HETATM 9315 O O   . HOH L 5 .   ? 118.194 76.567 -36.991 1.00 50.30  ? 1037 HOH B O   1 
HETATM 9316 O O   . HOH L 5 .   ? 106.073 73.825 -17.832 1.00 46.10  ? 1038 HOH B O   1 
HETATM 9317 O O   . HOH L 5 .   ? 104.661 38.251 -2.975  1.00 34.78  ? 1039 HOH B O   1 
HETATM 9318 O O   . HOH L 5 .   ? 102.298 32.964 0.555   1.00 40.35  ? 1040 HOH B O   1 
HETATM 9319 O O   . HOH L 5 .   ? 113.012 72.652 -21.427 1.00 45.90  ? 1041 HOH B O   1 
HETATM 9320 O O   . HOH L 5 .   ? 94.796  72.637 -12.085 1.00 37.56  ? 1042 HOH B O   1 
HETATM 9321 O O   . HOH L 5 .   ? 110.770 53.713 -11.473 1.00 45.56  ? 1043 HOH B O   1 
HETATM 9322 O O   . HOH L 5 .   ? 89.493  24.657 -16.817 1.00 46.35  ? 1044 HOH B O   1 
HETATM 9323 O O   . HOH L 5 .   ? 120.295 69.579 -37.487 1.00 38.28  ? 1045 HOH B O   1 
HETATM 9324 O O   . HOH L 5 .   ? 104.068 55.273 -1.990  1.00 46.12  ? 1046 HOH B O   1 
HETATM 9325 O O   . HOH L 5 .   ? 69.965  38.046 -15.460 1.00 51.44  ? 1047 HOH B O   1 
HETATM 9326 O O   . HOH L 5 .   ? 119.539 36.625 -32.915 1.00 49.39  ? 1048 HOH B O   1 
HETATM 9327 O O   . HOH L 5 .   ? 93.091  38.096 -48.691 1.00 48.84  ? 1049 HOH B O   1 
HETATM 9328 O O   . HOH L 5 .   ? 109.826 47.561 -46.483 1.00 45.24  ? 1050 HOH B O   1 
HETATM 9329 O O   . HOH L 5 .   ? 112.176 44.233 -5.746  1.00 42.26  ? 1051 HOH B O   1 
HETATM 9330 O O   . HOH L 5 .   ? 112.390 77.122 -36.807 1.00 38.79  ? 1052 HOH B O   1 
HETATM 9331 O O   . HOH L 5 .   ? 113.077 66.740 -41.180 1.00 38.28  ? 1053 HOH B O   1 
HETATM 9332 O O   . HOH L 5 .   ? 81.716  40.603 -42.082 1.00 47.02  ? 1054 HOH B O   1 
HETATM 9333 O O   . HOH L 5 .   ? 93.942  65.195 -36.998 1.00 38.73  ? 1055 HOH B O   1 
HETATM 9334 O O   . HOH L 5 .   ? 99.663  28.421 -42.986 1.00 43.79  ? 1056 HOH B O   1 
HETATM 9335 O O   . HOH L 5 .   ? 91.495  26.611 -25.433 1.00 37.38  ? 1057 HOH B O   1 
HETATM 9336 O O   . HOH L 5 .   ? 117.822 68.910 -39.667 1.00 46.25  ? 1058 HOH B O   1 
HETATM 9337 O O   . HOH L 5 .   ? 121.141 64.631 -40.079 1.00 47.56  ? 1059 HOH B O   1 
HETATM 9338 O O   . HOH L 5 .   ? 100.656 25.702 -25.146 1.00 52.17  ? 1060 HOH B O   1 
HETATM 9339 O O   . HOH L 5 .   ? 99.952  30.262 -13.515 1.00 40.15  ? 1061 HOH B O   1 
HETATM 9340 O O   . HOH L 5 .   ? 125.240 62.495 -39.111 1.00 48.24  ? 1062 HOH B O   1 
HETATM 9341 O O   . HOH L 5 .   ? 85.097  74.373 -28.623 1.00 44.89  ? 1063 HOH B O   1 
HETATM 9342 O O   . HOH L 5 .   ? 76.891  31.261 -11.724 1.00 52.45  ? 1064 HOH B O   1 
HETATM 9343 O O   . HOH L 5 .   ? 101.799 69.183 -37.548 1.00 39.54  ? 1065 HOH B O   1 
HETATM 9344 O O   . HOH L 5 .   ? 95.733  48.683 -45.144 1.00 47.73  ? 1066 HOH B O   1 
HETATM 9345 O O   . HOH L 5 .   ? 87.339  60.193 -3.211  1.00 44.47  ? 1067 HOH B O   1 
HETATM 9346 O O   . HOH L 5 .   ? 92.145  74.928 -13.149 1.00 39.81  ? 1068 HOH B O   1 
HETATM 9347 O O   . HOH L 5 .   ? 75.696  47.114 -11.942 1.00 57.38  ? 1069 HOH B O   1 
HETATM 9348 O O   . HOH L 5 .   ? 116.300 54.172 -16.587 1.00 45.57  ? 1070 HOH B O   1 
HETATM 9349 O O   . HOH L 5 .   ? 102.301 75.479 -17.566 1.00 52.06  ? 1071 HOH B O   1 
HETATM 9350 O O   . HOH L 5 .   ? 78.104  42.432 -12.490 1.00 44.09  ? 1072 HOH B O   1 
HETATM 9351 O O   . HOH L 5 .   ? 111.071 45.610 -46.672 1.00 50.17  ? 1073 HOH B O   1 
HETATM 9352 O O   . HOH L 5 .   ? 113.640 46.874 -46.389 1.00 47.41  ? 1074 HOH B O   1 
HETATM 9353 O O   . HOH L 5 .   ? 100.848 74.043 -15.420 1.00 43.14  ? 1075 HOH B O   1 
HETATM 9354 O O   . HOH L 5 .   ? 88.196  78.054 -17.098 1.00 45.18  ? 1076 HOH B O   1 
HETATM 9355 O O   . HOH L 5 .   ? 103.899 28.345 -42.991 1.00 47.62  ? 1077 HOH B O   1 
HETATM 9356 O O   . HOH L 5 .   ? 106.782 71.765 -35.885 1.00 38.51  ? 1078 HOH B O   1 
HETATM 9357 O O   . HOH L 5 .   ? 122.609 45.016 -27.286 1.00 44.13  ? 1079 HOH B O   1 
HETATM 9358 O O   . HOH L 5 .   ? 82.320  47.829 -25.670 1.00 37.50  ? 1080 HOH B O   1 
HETATM 9359 O O   . HOH L 5 .   ? 103.561 23.874 -23.836 1.00 53.61  ? 1081 HOH B O   1 
HETATM 9360 O O   . HOH L 5 .   ? 78.221  34.999 -6.968  1.00 49.13  ? 1082 HOH B O   1 
HETATM 9361 O O   . HOH L 5 .   ? 74.248  53.191 -23.050 1.00 49.28  ? 1083 HOH B O   1 
HETATM 9362 O O   . HOH L 5 .   ? 82.182  39.890 -5.240  1.00 46.15  ? 1084 HOH B O   1 
HETATM 9363 O O   . HOH L 5 .   ? 121.973 46.322 -36.318 1.00 49.23  ? 1085 HOH B O   1 
HETATM 9364 O O   . HOH L 5 .   ? 109.830 52.612 -9.668  1.00 39.27  ? 1086 HOH B O   1 
HETATM 9365 O O   . HOH L 5 .   ? 108.166 45.915 -47.018 1.00 54.07  ? 1087 HOH B O   1 
HETATM 9366 O O   . HOH L 5 .   ? 120.688 38.710 -31.295 1.00 45.57  ? 1088 HOH B O   1 
HETATM 9367 O O   . HOH L 5 .   ? 103.736 68.467 -36.317 1.00 37.44  ? 1089 HOH B O   1 
HETATM 9368 O O   . HOH L 5 .   ? 114.374 86.301 -29.322 1.00 46.66  ? 1090 HOH B O   1 
HETATM 9369 O O   . HOH L 5 .   ? 109.782 64.559 -10.211 1.00 40.19  ? 1091 HOH B O   1 
HETATM 9370 O O   . HOH L 5 .   ? 107.776 61.527 -9.096  1.00 40.66  ? 1092 HOH B O   1 
HETATM 9371 O O   . HOH L 5 .   ? 122.106 42.876 -29.837 1.00 38.24  ? 1093 HOH B O   1 
HETATM 9372 O O   . HOH L 5 .   ? 113.921 56.238 -19.467 1.00 37.11  ? 1094 HOH B O   1 
HETATM 9373 O O   . HOH L 5 .   ? 87.308  66.753 -32.921 1.00 44.12  ? 1095 HOH B O   1 
HETATM 9374 O O   . HOH L 5 .   ? 125.777 35.436 -22.165 1.00 49.37  ? 1096 HOH B O   1 
HETATM 9375 O O   . HOH L 5 .   ? 96.860  22.663 -5.334  1.00 48.88  ? 1097 HOH B O   1 
HETATM 9376 O O   . HOH L 5 .   ? 81.087  41.830 -22.060 1.00 44.22  ? 1098 HOH B O   1 
HETATM 9377 O O   . HOH L 5 .   ? 79.330  28.031 -4.157  1.00 42.98  ? 1099 HOH B O   1 
HETATM 9378 O O   . HOH L 5 .   ? 80.690  49.492 -25.996 1.00 46.17  ? 1100 HOH B O   1 
HETATM 9379 O O   . HOH L 5 .   ? 73.367  60.778 -19.194 1.00 40.25  ? 1101 HOH B O   1 
HETATM 9380 O O   . HOH L 5 .   ? 90.265  49.727 -44.041 1.00 48.25  ? 1102 HOH B O   1 
HETATM 9381 O O   . HOH L 5 .   ? 124.986 45.733 -23.998 1.00 45.42  ? 1103 HOH B O   1 
HETATM 9382 O O   . HOH L 5 .   ? 99.324  62.397 -7.314  1.00 30.43  ? 1104 HOH B O   1 
HETATM 9383 O O   . HOH L 5 .   ? 68.854  33.155 -15.619 1.00 51.63  ? 1105 HOH B O   1 
HETATM 9384 O O   . HOH L 5 .   ? 90.631  24.192 -14.390 1.00 39.24  ? 1106 HOH B O   1 
HETATM 9385 O O   . HOH L 5 .   ? 111.096 49.759 -13.812 1.00 30.90  ? 1107 HOH B O   1 
HETATM 9386 O O   . HOH L 5 .   ? 86.395  30.536 2.199   1.00 51.83  ? 1108 HOH B O   1 
HETATM 9387 O O   . HOH L 5 .   ? 120.536 54.873 -48.683 1.00 52.86  ? 1109 HOH B O   1 
HETATM 9388 O O   . HOH L 5 .   ? 114.971 79.097 -35.027 1.00 47.51  ? 1110 HOH B O   1 
HETATM 9389 O O   . HOH L 5 .   ? 102.136 29.855 -12.916 1.00 47.36  ? 1111 HOH B O   1 
HETATM 9390 O O   . HOH L 5 .   ? 70.175  67.780 -18.007 1.00 61.67  ? 1112 HOH B O   1 
HETATM 9391 O O   . HOH L 5 .   ? 115.480 33.090 -15.112 1.00 42.45  ? 1113 HOH B O   1 
HETATM 9392 O O   . HOH L 5 .   ? 108.221 49.667 1.743   1.00 42.11  ? 1114 HOH B O   1 
HETATM 9393 O O   . HOH L 5 .   ? 109.289 73.321 -23.590 1.00 36.29  ? 1115 HOH B O   1 
HETATM 9394 O O   . HOH L 5 .   ? 103.078 60.904 -8.804  1.00 34.44  ? 1116 HOH B O   1 
HETATM 9395 O O   . HOH L 5 .   ? 106.962 46.463 0.042   1.00 40.99  ? 1117 HOH B O   1 
HETATM 9396 O O   . HOH L 5 .   ? 93.247  76.247 -15.450 1.00 49.61  ? 1118 HOH B O   1 
HETATM 9397 O O   . HOH L 5 .   ? 79.846  34.904 -2.525  1.00 47.58  ? 1119 HOH B O   1 
HETATM 9398 O O   . HOH L 5 .   ? 126.041 44.975 -26.113 1.00 51.11  ? 1120 HOH B O   1 
HETATM 9399 O O   . HOH L 5 .   ? 105.352 31.170 -15.285 1.00 32.87  ? 1121 HOH B O   1 
HETATM 9400 O O   . HOH L 5 .   ? 73.874  64.651 -12.578 1.00 51.71  ? 1122 HOH B O   1 
HETATM 9401 O O   . HOH L 5 .   ? 101.745 55.006 -2.421  1.00 40.18  ? 1123 HOH B O   1 
HETATM 9402 O O   . HOH L 5 .   ? 80.687  77.025 -13.334 1.00 53.23  ? 1124 HOH B O   1 
HETATM 9403 O O   . HOH L 5 .   ? 101.135 64.539 -41.430 1.00 41.57  ? 1125 HOH B O   1 
HETATM 9404 O O   . HOH L 5 .   ? 112.589 75.454 -22.793 1.00 38.80  ? 1126 HOH B O   1 
HETATM 9405 O O   . HOH L 5 .   ? 115.727 77.495 -36.689 1.00 42.84  ? 1127 HOH B O   1 
HETATM 9406 O O   . HOH L 5 .   ? 103.018 57.239 -4.477  1.00 40.44  ? 1128 HOH B O   1 
HETATM 9407 O O   . HOH L 5 .   ? 116.831 64.672 -44.548 1.00 46.43  ? 1129 HOH B O   1 
HETATM 9408 O O   . HOH L 5 .   ? 87.124  36.771 -45.668 1.00 57.20  ? 1130 HOH B O   1 
HETATM 9409 O O   . HOH L 5 .   ? 130.642 61.236 -36.451 1.00 61.28  ? 1131 HOH B O   1 
HETATM 9410 O O   . HOH L 5 .   ? 79.967  50.639 -28.883 1.00 44.89  ? 1132 HOH B O   1 
HETATM 9411 O O   . HOH L 5 .   ? 78.449  37.407 -6.745  1.00 40.95  ? 1133 HOH B O   1 
HETATM 9412 O O   . HOH L 5 .   ? 108.810 42.547 -2.964  1.00 43.49  ? 1134 HOH B O   1 
HETATM 9413 O O   . HOH L 5 .   ? 98.607  59.160 -4.322  1.00 32.31  ? 1135 HOH B O   1 
HETATM 9414 O O   . HOH L 5 .   ? 94.949  24.872 -13.648 1.00 34.94  ? 1136 HOH B O   1 
HETATM 9415 O O   . HOH L 5 .   ? 82.737  36.110 -2.301  1.00 38.41  ? 1137 HOH B O   1 
HETATM 9416 O O   . HOH L 5 .   ? 97.068  22.804 -10.465 1.00 46.61  ? 1138 HOH B O   1 
HETATM 9417 O O   . HOH L 5 .   ? 129.191 59.653 -39.164 1.00 47.25  ? 1139 HOH B O   1 
HETATM 9418 O O   . HOH L 5 .   ? 73.997  67.706 -14.941 1.00 47.44  ? 1140 HOH B O   1 
HETATM 9419 O O   . HOH L 5 .   ? 117.253 60.371 -18.540 1.00 45.47  ? 1141 HOH B O   1 
HETATM 9420 O O   . HOH L 5 .   ? 114.861 50.398 -44.503 1.00 37.26  ? 1142 HOH B O   1 
HETATM 9421 O O   . HOH L 5 .   ? 78.348  30.463 -3.932  1.00 33.93  ? 1143 HOH B O   1 
HETATM 9422 O O   . HOH L 5 .   ? 86.935  74.526 -30.200 1.00 53.60  ? 1144 HOH B O   1 
HETATM 9423 O O   . HOH L 5 .   ? 106.546 39.843 1.874   1.00 42.69  ? 1145 HOH B O   1 
HETATM 9424 O O   . HOH L 5 .   ? 117.517 48.999 -42.366 1.00 51.06  ? 1146 HOH B O   1 
HETATM 9425 O O   . HOH L 5 .   ? 73.054  61.025 -16.576 1.00 39.83  ? 1147 HOH B O   1 
HETATM 9426 O O   . HOH L 5 .   ? 87.388  52.722 -43.115 1.00 42.49  ? 1148 HOH B O   1 
HETATM 9427 O O   . HOH L 5 .   ? 85.295  68.371 -32.548 1.00 46.36  ? 1149 HOH B O   1 
HETATM 9428 O O   . HOH L 5 .   ? 91.312  69.469 -34.628 1.00 40.48  ? 1150 HOH B O   1 
HETATM 9429 O O   . HOH L 5 .   ? 113.519 44.359 -47.074 1.00 53.69  ? 1151 HOH B O   1 
HETATM 9430 O O   . HOH L 5 .   ? 105.713 27.809 -10.732 1.00 53.36  ? 1152 HOH B O   1 
HETATM 9431 O O   . HOH L 5 .   ? 89.394  67.447 -34.858 1.00 43.83  ? 1153 HOH B O   1 
HETATM 9432 O O   . HOH L 5 .   ? 88.952  70.709 -33.895 1.00 44.36  ? 1154 HOH B O   1 
HETATM 9433 O O   . HOH L 5 .   ? 114.802 65.470 -45.324 1.00 46.13  ? 1155 HOH B O   1 
HETATM 9434 O O   . HOH L 5 .   ? 82.123  38.374 -2.923  1.00 48.11  ? 1156 HOH B O   1 
HETATM 9435 O O   . HOH L 5 .   ? 99.950  60.968 -5.454  1.00 37.65  ? 1157 HOH B O   1 
HETATM 9436 O O   . HOH L 5 .   ? 79.478  37.720 -3.347  1.00 54.45  ? 1158 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   LEU 3   0   ?   ?   ?   A . n 
A 1 4   GLU 4   1   ?   ?   ?   A . n 
A 1 5   GLY 5   2   ?   ?   ?   A . n 
A 1 6   ARG 6   3   ?   ?   ?   A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   ALA 9   6   6   ALA ALA A . n 
A 1 10  GLU 10  7   7   GLU GLU A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  LEU 12  9   9   LEU LEU A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  THR 14  11  11  THR THR A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ARG 16  13  13  ARG ARG A . n 
A 1 17  GLY 17  14  14  GLY GLY A . n 
A 1 18  GLY 18  15  15  GLY GLY A . n 
A 1 19  ARG 19  16  16  ARG ARG A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  GLY 22  19  19  GLY GLY A . n 
A 1 23  ILE 23  20  20  ILE ILE A . n 
A 1 24  ARG 24  21  21  ARG ARG A . n 
A 1 25  LEU 25  22  22  LEU LEU A . n 
A 1 26  LYS 26  23  23  LYS LYS A . n 
A 1 27  THR 27  24  24  THR THR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  GLY 29  26  26  GLY GLY A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  PRO 31  28  28  PRO PRO A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  SER 33  30  30  SER SER A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  GLY 37  34  34  GLY GLY A . n 
A 1 38  ILE 38  35  35  ILE ILE A . n 
A 1 39  PRO 39  36  36  PRO PRO A . n 
A 1 40  PHE 40  37  37  PHE PHE A . n 
A 1 41  ALA 41  38  38  ALA ALA A . n 
A 1 42  GLU 42  39  39  GLU GLU A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  PRO 44  41  41  PRO PRO A . n 
A 1 45  MET 45  42  42  MET MET A . n 
A 1 46  GLY 46  43  43  GLY GLY A . n 
A 1 47  PRO 47  44  44  PRO PRO A . n 
A 1 48  ARG 48  45  45  ARG ARG A . n 
A 1 49  ARG 49  46  46  ARG ARG A . n 
A 1 50  PHE 50  47  47  PHE PHE A . n 
A 1 51  LEU 51  48  48  LEU LEU A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLU 54  51  51  GLU GLU A . n 
A 1 55  PRO 55  52  52  PRO PRO A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  GLN 57  54  54  GLN GLN A . n 
A 1 58  PRO 58  55  55  PRO PRO A . n 
A 1 59  TRP 59  56  56  TRP TRP A . n 
A 1 60  SER 60  57  57  SER SER A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  VAL 63  60  60  VAL VAL A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  ALA 65  62  62  ALA ALA A . n 
A 1 66  THR 66  63  63  THR THR A . n 
A 1 67  THR 67  64  64  THR THR A . n 
A 1 68  PHE 68  65  65  PHE PHE A . n 
A 1 69  GLN 69  66  66  GLN GLN A . n 
A 1 70  SER 70  67  67  SER SER A . n 
A 1 71  VAL 71  68  68  VAL VAL A . n 
A 1 72  CYS 72  69  69  CYS CYS A . n 
A 1 73  TYR 73  70  70  TYR TYR A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  TYR 75  72  72  TYR TYR A . n 
A 1 76  VAL 76  73  73  VAL VAL A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  PRO 81  78  78  PRO PRO A . n 
A 1 82  GLY 82  79  79  GLY GLY A . n 
A 1 83  PHE 83  80  80  PHE PHE A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  GLY 85  82  82  GLY GLY A . n 
A 1 86  THR 86  83  83  THR THR A . n 
A 1 87  GLU 87  84  84  GLU GLU A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  TRP 89  86  86  TRP TRP A . n 
A 1 90  ASN 90  87  87  ASN ASN A . n 
A 1 91  PRO 91  88  88  PRO PRO A . n 
A 1 92  ASN 92  89  89  ASN ASN A . n 
A 1 93  ARG 93  90  90  ARG ARG A . n 
A 1 94  GLU 94  91  91  GLU GLU A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  SER 96  93  93  SER SER A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ASP 98  95  95  ASP ASP A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 LEU 100 97  97  LEU LEU A . n 
A 1 101 TYR 101 98  98  TYR TYR A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ASN 103 100 100 ASN ASN A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 TRP 105 102 102 TRP TRP A . n 
A 1 106 THR 106 103 103 THR THR A . n 
A 1 107 PRO 107 104 104 PRO PRO A . n 
A 1 108 TYR 108 105 105 TYR TYR A . n 
A 1 109 PRO 109 106 106 PRO PRO A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 PRO 111 108 108 PRO PRO A . n 
A 1 112 THR 112 109 109 THR THR A . n 
A 1 113 SER 113 110 110 SER SER A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 THR 115 112 112 THR THR A . n 
A 1 116 PRO 116 113 113 PRO PRO A . n 
A 1 117 VAL 117 114 114 VAL VAL A . n 
A 1 118 LEU 118 115 115 LEU LEU A . n 
A 1 119 VAL 119 116 116 VAL VAL A . n 
A 1 120 TRP 120 117 117 TRP TRP A . n 
A 1 121 ILE 121 118 118 ILE ILE A . n 
A 1 122 TYR 122 119 119 TYR TYR A . n 
A 1 123 GLY 123 120 120 GLY GLY A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 GLY 125 122 122 GLY GLY A . n 
A 1 126 PHE 126 123 123 PHE PHE A . n 
A 1 127 TYR 127 124 124 TYR TYR A . n 
A 1 128 SER 128 125 125 SER SER A . n 
A 1 129 GLY 129 126 126 GLY GLY A . n 
A 1 130 ALA 130 127 127 ALA ALA A . n 
A 1 131 SER 131 128 128 SER SER A . n 
A 1 132 SER 132 129 129 SER SER A . n 
A 1 133 LEU 133 130 130 LEU LEU A . n 
A 1 134 ASP 134 131 131 ASP ASP A . n 
A 1 135 VAL 135 132 132 VAL VAL A . n 
A 1 136 TYR 136 133 133 TYR TYR A . n 
A 1 137 ASP 137 134 134 ASP ASP A . n 
A 1 138 GLY 138 135 135 GLY GLY A . n 
A 1 139 ARG 139 136 136 ARG ARG A . n 
A 1 140 PHE 140 137 137 PHE PHE A . n 
A 1 141 LEU 141 138 138 LEU LEU A . n 
A 1 142 VAL 142 139 139 VAL VAL A . n 
A 1 143 GLN 143 140 140 GLN GLN A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 GLU 145 142 142 GLU GLU A . n 
A 1 146 ARG 146 143 143 ARG ARG A . n 
A 1 147 THR 147 144 144 THR THR A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 LEU 149 146 146 LEU LEU A . n 
A 1 150 VAL 150 147 147 VAL VAL A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 ASN 153 150 150 ASN ASN A . n 
A 1 154 TYR 154 151 151 TYR TYR A . n 
A 1 155 ARG 155 152 152 ARG ARG A . n 
A 1 156 VAL 156 153 153 VAL VAL A . n 
A 1 157 GLY 157 154 154 GLY GLY A . n 
A 1 158 ALA 158 155 155 ALA ALA A . n 
A 1 159 PHE 159 156 156 PHE PHE A . n 
A 1 160 GLY 160 157 157 GLY GLY A . n 
A 1 161 PHE 161 158 158 PHE PHE A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 LEU 164 161 161 LEU LEU A . n 
A 1 165 PRO 165 162 162 PRO PRO A . n 
A 1 166 GLY 166 163 163 GLY GLY A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ARG 168 165 165 ARG ARG A . n 
A 1 169 GLU 169 166 166 GLU GLU A . n 
A 1 170 ALA 170 167 167 ALA ALA A . n 
A 1 171 PRO 171 168 168 PRO PRO A . n 
A 1 172 GLY 172 169 169 GLY GLY A . n 
A 1 173 ASN 173 170 170 ASN ASN A . n 
A 1 174 VAL 174 171 171 VAL VAL A . n 
A 1 175 GLY 175 172 172 GLY GLY A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 LEU 177 174 174 LEU LEU A . n 
A 1 178 ASP 178 175 175 ASP ASP A . n 
A 1 179 GLN 179 176 176 GLN GLN A . n 
A 1 180 ARG 180 177 177 ARG ARG A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 ALA 182 179 179 ALA ALA A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 GLN 184 181 181 GLN GLN A . n 
A 1 185 TRP 185 182 182 TRP TRP A . n 
A 1 186 VAL 186 183 183 VAL VAL A . n 
A 1 187 GLN 187 184 184 GLN GLN A . n 
A 1 188 GLU 188 185 185 GLU GLU A . n 
A 1 189 ASN 189 186 186 ASN ASN A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 GLY 194 191 191 GLY GLY A . n 
A 1 195 GLY 195 192 192 GLY GLY A . n 
A 1 196 ASP 196 193 193 ASP ASP A . n 
A 1 197 PRO 197 194 194 PRO PRO A . n 
A 1 198 THR 198 195 195 THR THR A . n 
A 1 199 SER 199 196 196 SER SER A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 THR 201 198 198 THR THR A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 PHE 203 200 200 PHE PHE A . n 
A 1 204 GLY 204 201 201 GLY GLY A . n 
A 1 205 GLU 205 202 202 GLU GLU A . n 
A 1 206 SER 206 203 203 SER SER A . n 
A 1 207 ALA 207 204 204 ALA ALA A . n 
A 1 208 GLY 208 205 205 GLY GLY A . n 
A 1 209 ALA 209 206 206 ALA ALA A . n 
A 1 210 ALA 210 207 207 ALA ALA A . n 
A 1 211 SER 211 208 208 SER SER A . n 
A 1 212 VAL 212 209 209 VAL VAL A . n 
A 1 213 GLY 213 210 210 GLY GLY A . n 
A 1 214 MET 214 211 211 MET MET A . n 
A 1 215 HIS 215 212 212 HIS HIS A . n 
A 1 216 LEU 216 213 213 LEU LEU A . n 
A 1 217 LEU 217 214 214 LEU LEU A . n 
A 1 218 SER 218 215 215 SER SER A . n 
A 1 219 PRO 219 216 216 PRO PRO A . n 
A 1 220 PRO 220 217 217 PRO PRO A . n 
A 1 221 SER 221 218 218 SER SER A . n 
A 1 222 ARG 222 219 219 ARG ARG A . n 
A 1 223 GLY 223 220 220 GLY GLY A . n 
A 1 224 LEU 224 221 221 LEU LEU A . n 
A 1 225 PHE 225 222 222 PHE PHE A . n 
A 1 226 HIS 226 223 223 HIS HIS A . n 
A 1 227 ARG 227 224 224 ARG ARG A . n 
A 1 228 ALA 228 225 225 ALA ALA A . n 
A 1 229 VAL 229 226 226 VAL VAL A . n 
A 1 230 LEU 230 227 227 LEU LEU A . n 
A 1 231 GLN 231 228 228 GLN GLN A . n 
A 1 232 SER 232 229 229 SER SER A . n 
A 1 233 GLY 233 230 230 GLY GLY A . n 
A 1 234 ALA 234 231 231 ALA ALA A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 GLY 237 234 234 GLY GLY A . n 
A 1 238 PRO 238 235 235 PRO PRO A . n 
A 1 239 TRP 239 236 236 TRP TRP A . n 
A 1 240 ALA 240 237 237 ALA ALA A . n 
A 1 241 THR 241 238 238 THR THR A . n 
A 1 242 VAL 242 239 239 VAL VAL A . n 
A 1 243 GLY 243 240 240 GLY GLY A . n 
A 1 244 MET 244 241 241 MET MET A . n 
A 1 245 GLY 245 242 242 GLY GLY A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 ALA 247 244 244 ALA ALA A . n 
A 1 248 ARG 248 245 245 ARG ARG A . n 
A 1 249 ARG 249 246 246 ARG ARG A . n 
A 1 250 ARG 250 247 247 ARG ARG A . n 
A 1 251 ALA 251 248 248 ALA ALA A . n 
A 1 252 THR 252 249 249 THR THR A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 HIS 256 253 253 HIS HIS A . n 
A 1 257 LEU 257 254 254 LEU LEU A . n 
A 1 258 VAL 258 255 255 VAL VAL A . n 
A 1 259 GLY 259 256 256 GLY GLY A . n 
A 1 260 CYS 260 257 257 CYS CYS A . n 
A 1 261 PRO 261 258 258 PRO PRO A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 GLY 264 261 261 GLY GLY A . n 
A 1 265 THR 265 262 262 THR THR A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 GLY 267 264 264 GLY GLY A . n 
A 1 268 ASN 268 265 265 ASN ASN A . n 
A 1 269 ASP 269 266 266 ASP ASP A . n 
A 1 270 THR 270 267 267 THR THR A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 VAL 273 270 270 VAL VAL A . n 
A 1 274 ALA 274 271 271 ALA ALA A . n 
A 1 275 CYS 275 272 272 CYS CYS A . n 
A 1 276 LEU 276 273 273 LEU LEU A . n 
A 1 277 ARG 277 274 274 ARG ARG A . n 
A 1 278 THR 278 275 275 THR THR A . n 
A 1 279 ARG 279 276 276 ARG ARG A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 ALA 281 278 278 ALA ALA A . n 
A 1 282 GLN 282 279 279 GLN GLN A . n 
A 1 283 VAL 283 280 280 VAL VAL A . n 
A 1 284 LEU 284 281 281 LEU LEU A . n 
A 1 285 VAL 285 282 282 VAL VAL A . n 
A 1 286 ASN 286 283 283 ASN ASN A . n 
A 1 287 HIS 287 284 284 HIS HIS A . n 
A 1 288 GLU 288 285 285 GLU GLU A . n 
A 1 289 TRP 289 286 286 TRP TRP A . n 
A 1 290 HIS 290 287 287 HIS HIS A . n 
A 1 291 VAL 291 288 288 VAL VAL A . n 
A 1 292 LEU 292 289 289 LEU LEU A . n 
A 1 293 PRO 293 290 290 PRO PRO A . n 
A 1 294 GLN 294 291 291 GLN GLN A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 VAL 297 294 294 VAL VAL A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 ARG 299 296 296 ARG ARG A . n 
A 1 300 PHE 300 297 297 PHE PHE A . n 
A 1 301 SER 301 298 298 SER SER A . n 
A 1 302 PHE 302 299 299 PHE PHE A . n 
A 1 303 VAL 303 300 300 VAL VAL A . n 
A 1 304 PRO 304 301 301 PRO PRO A . n 
A 1 305 VAL 305 302 302 VAL VAL A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 ASP 307 304 304 ASP ASP A . n 
A 1 308 GLY 308 305 305 GLY GLY A . n 
A 1 309 ASP 309 306 306 ASP ASP A . n 
A 1 310 PHE 310 307 307 PHE PHE A . n 
A 1 311 LEU 311 308 308 LEU LEU A . n 
A 1 312 SER 312 309 309 SER SER A . n 
A 1 313 ASP 313 310 310 ASP ASP A . n 
A 1 314 THR 314 311 311 THR THR A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 GLU 316 313 313 GLU GLU A . n 
A 1 317 ALA 317 314 314 ALA ALA A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 ILE 319 316 316 ILE ILE A . n 
A 1 320 ASN 320 317 317 ASN ASN A . n 
A 1 321 ALA 321 318 318 ALA ALA A . n 
A 1 322 GLY 322 319 319 GLY GLY A . n 
A 1 323 ASP 323 320 320 ASP ASP A . n 
A 1 324 PHE 324 321 321 PHE PHE A . n 
A 1 325 HIS 325 322 322 HIS HIS A . n 
A 1 326 GLY 326 323 323 GLY GLY A . n 
A 1 327 LEU 327 324 324 LEU LEU A . n 
A 1 328 GLN 328 325 325 GLN GLN A . n 
A 1 329 VAL 329 326 326 VAL VAL A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 VAL 331 328 328 VAL VAL A . n 
A 1 332 GLY 332 329 329 GLY GLY A . n 
A 1 333 VAL 333 330 330 VAL VAL A . n 
A 1 334 VAL 334 331 331 VAL VAL A . n 
A 1 335 LYS 335 332 332 LYS LYS A . n 
A 1 336 ASP 336 333 333 ASP ASP A . n 
A 1 337 GLU 337 334 334 GLU GLU A . n 
A 1 338 GLY 338 335 335 GLY GLY A . n 
A 1 339 SER 339 336 336 SER SER A . n 
A 1 340 TYR 340 337 337 TYR TYR A . n 
A 1 341 PHE 341 338 338 PHE PHE A . n 
A 1 342 LEU 342 339 339 LEU LEU A . n 
A 1 343 VAL 343 340 340 VAL VAL A . n 
A 1 344 TYR 344 341 341 TYR TYR A . n 
A 1 345 GLY 345 342 342 GLY GLY A . n 
A 1 346 ALA 346 343 343 ALA ALA A . n 
A 1 347 PRO 347 344 344 PRO PRO A . n 
A 1 348 GLY 348 345 345 GLY GLY A . n 
A 1 349 PHE 349 346 346 PHE PHE A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 LYS 351 348 348 LYS LYS A . n 
A 1 352 ASP 352 349 349 ASP ASP A . n 
A 1 353 ASN 353 350 350 ASN ASN A . n 
A 1 354 GLU 354 351 351 GLU GLU A . n 
A 1 355 SER 355 352 352 SER SER A . n 
A 1 356 LEU 356 353 353 LEU LEU A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 SER 358 355 355 SER SER A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ALA 360 357 357 ALA ALA A . n 
A 1 361 GLU 361 358 358 GLU GLU A . n 
A 1 362 PHE 362 359 359 PHE PHE A . n 
A 1 363 LEU 363 360 360 LEU LEU A . n 
A 1 364 ALA 364 361 361 ALA ALA A . n 
A 1 365 GLY 365 362 362 GLY GLY A . n 
A 1 366 VAL 366 363 363 VAL VAL A . n 
A 1 367 ARG 367 364 364 ARG ARG A . n 
A 1 368 VAL 368 365 365 VAL VAL A . n 
A 1 369 GLY 369 366 366 GLY GLY A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 PRO 371 368 368 PRO PRO A . n 
A 1 372 GLN 372 369 369 GLN GLN A . n 
A 1 373 VAL 373 370 370 VAL VAL A . n 
A 1 374 SER 374 371 371 SER SER A . n 
A 1 375 ASP 375 372 372 ASP ASP A . n 
A 1 376 LEU 376 373 373 LEU LEU A . n 
A 1 377 ALA 377 374 374 ALA ALA A . n 
A 1 378 ALA 378 375 375 ALA ALA A . n 
A 1 379 GLU 379 376 376 GLU GLU A . n 
A 1 380 ALA 380 377 377 ALA ALA A . n 
A 1 381 VAL 381 378 378 VAL VAL A . n 
A 1 382 VAL 382 379 379 VAL VAL A . n 
A 1 383 LEU 383 380 380 LEU LEU A . n 
A 1 384 HIS 384 381 381 HIS HIS A . n 
A 1 385 TYR 385 382 382 TYR TYR A . n 
A 1 386 THR 386 383 383 THR THR A . n 
A 1 387 ASP 387 384 384 ASP ASP A . n 
A 1 388 TRP 388 385 385 TRP TRP A . n 
A 1 389 LEU 389 386 386 LEU LEU A . n 
A 1 390 HIS 390 387 387 HIS HIS A . n 
A 1 391 PRO 391 388 388 PRO PRO A . n 
A 1 392 GLU 392 389 389 GLU GLU A . n 
A 1 393 ASP 393 390 390 ASP ASP A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 ARG 396 393 393 ARG ARG A . n 
A 1 397 LEU 397 394 394 LEU LEU A . n 
A 1 398 ARG 398 395 395 ARG ARG A . n 
A 1 399 GLU 399 396 396 GLU GLU A . n 
A 1 400 ALA 400 397 397 ALA ALA A . n 
A 1 401 LEU 401 398 398 LEU LEU A . n 
A 1 402 SER 402 399 399 SER SER A . n 
A 1 403 ASP 403 400 400 ASP ASP A . n 
A 1 404 VAL 404 401 401 VAL VAL A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 GLY 406 403 403 GLY GLY A . n 
A 1 407 ASP 407 404 404 ASP ASP A . n 
A 1 408 HIS 408 405 405 HIS HIS A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 VAL 410 407 407 VAL VAL A . n 
A 1 411 VAL 411 408 408 VAL VAL A . n 
A 1 412 CYS 412 409 409 CYS CYS A . n 
A 1 413 PRO 413 410 410 PRO PRO A . n 
A 1 414 VAL 414 411 411 VAL VAL A . n 
A 1 415 ALA 415 412 412 ALA ALA A . n 
A 1 416 GLN 416 413 413 GLN GLN A . n 
A 1 417 LEU 417 414 414 LEU LEU A . n 
A 1 418 ALA 418 415 415 ALA ALA A . n 
A 1 419 GLY 419 416 416 GLY GLY A . n 
A 1 420 ARG 420 417 417 ARG ARG A . n 
A 1 421 LEU 421 418 418 LEU LEU A . n 
A 1 422 ALA 422 419 419 ALA ALA A . n 
A 1 423 ALA 423 420 420 ALA ALA A . n 
A 1 424 GLN 424 421 421 GLN GLN A . n 
A 1 425 GLY 425 422 422 GLY GLY A . n 
A 1 426 ALA 426 423 423 ALA ALA A . n 
A 1 427 ARG 427 424 424 ARG ARG A . n 
A 1 428 VAL 428 425 425 VAL VAL A . n 
A 1 429 TYR 429 426 426 TYR TYR A . n 
A 1 430 ALA 430 427 427 ALA ALA A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 VAL 432 429 429 VAL VAL A . n 
A 1 433 PHE 433 430 430 PHE PHE A . n 
A 1 434 GLU 434 431 431 GLU GLU A . n 
A 1 435 HIS 435 432 432 HIS HIS A . n 
A 1 436 ARG 436 433 433 ARG ARG A . n 
A 1 437 ALA 437 434 434 ALA ALA A . n 
A 1 438 SER 438 435 435 SER SER A . n 
A 1 439 THR 439 436 436 THR THR A . n 
A 1 440 LEU 440 437 437 LEU LEU A . n 
A 1 441 SER 441 438 438 SER SER A . n 
A 1 442 TRP 442 439 439 TRP TRP A . n 
A 1 443 PRO 443 440 440 PRO PRO A . n 
A 1 444 LEU 444 441 441 LEU LEU A . n 
A 1 445 TRP 445 442 442 TRP TRP A . n 
A 1 446 MET 446 443 443 MET MET A . n 
A 1 447 GLY 447 444 444 GLY GLY A . n 
A 1 448 VAL 448 445 445 VAL VAL A . n 
A 1 449 PRO 449 446 446 PRO PRO A . n 
A 1 450 HIS 450 447 447 HIS HIS A . n 
A 1 451 GLY 451 448 448 GLY GLY A . n 
A 1 452 TYR 452 449 449 TYR TYR A . n 
A 1 453 GLU 453 450 450 GLU GLU A . n 
A 1 454 ILE 454 451 451 ILE ILE A . n 
A 1 455 GLU 455 452 452 GLU GLU A . n 
A 1 456 PHE 456 453 453 PHE PHE A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PHE 458 455 455 PHE PHE A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 ILE 460 457 457 ILE ILE A . n 
A 1 461 PRO 461 458 458 PRO PRO A . n 
A 1 462 LEU 462 459 459 LEU LEU A . n 
A 1 463 ASP 463 460 460 ASP ASP A . n 
A 1 464 PRO 464 461 461 PRO PRO A . n 
A 1 465 SER 465 462 462 SER SER A . n 
A 1 466 ARG 466 463 463 ARG ARG A . n 
A 1 467 ASN 467 464 464 ASN ASN A . n 
A 1 468 TYR 468 465 465 TYR TYR A . n 
A 1 469 THR 469 466 466 THR THR A . n 
A 1 470 ALA 470 467 467 ALA ALA A . n 
A 1 471 GLU 471 468 468 GLU GLU A . n 
A 1 472 GLU 472 469 469 GLU GLU A . n 
A 1 473 LYS 473 470 470 LYS LYS A . n 
A 1 474 ILE 474 471 471 ILE ILE A . n 
A 1 475 PHE 475 472 472 PHE PHE A . n 
A 1 476 ALA 476 473 473 ALA ALA A . n 
A 1 477 GLN 477 474 474 GLN GLN A . n 
A 1 478 ARG 478 475 475 ARG ARG A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 MET 480 477 477 MET MET A . n 
A 1 481 ARG 481 478 478 ARG ARG A . n 
A 1 482 TYR 482 479 479 TYR TYR A . n 
A 1 483 TRP 483 480 480 TRP TRP A . n 
A 1 484 ALA 484 481 481 ALA ALA A . n 
A 1 485 ASN 485 482 482 ASN ASN A . n 
A 1 486 PHE 486 483 483 PHE PHE A . n 
A 1 487 ALA 487 484 484 ALA ALA A . n 
A 1 488 ARG 488 485 485 ARG ARG A . n 
A 1 489 THR 489 486 486 THR THR A . n 
A 1 490 GLY 490 487 487 GLY GLY A . n 
A 1 491 ASP 491 488 488 ASP ASP A . n 
A 1 492 PRO 492 489 489 PRO PRO A . n 
A 1 493 ASN 493 490 490 ASN ASN A . n 
A 1 494 GLU 494 491 491 GLU GLU A . n 
A 1 495 PRO 495 492 492 PRO PRO A . n 
A 1 496 ARG 496 493 493 ARG ARG A . n 
A 1 497 ASP 497 494 494 ASP ASP A . n 
A 1 498 PRO 498 495 495 PRO PRO A . n 
A 1 499 LYS 499 496 496 LYS LYS A . n 
A 1 500 ALA 500 497 497 ALA ALA A . n 
A 1 501 PRO 501 498 498 PRO PRO A . n 
A 1 502 GLN 502 499 499 GLN GLN A . n 
A 1 503 TRP 503 500 500 TRP TRP A . n 
A 1 504 PRO 504 501 501 PRO PRO A . n 
A 1 505 PRO 505 502 502 PRO PRO A . n 
A 1 506 TYR 506 503 503 TYR TYR A . n 
A 1 507 THR 507 504 504 THR THR A . n 
A 1 508 ALA 508 505 505 ALA ALA A . n 
A 1 509 GLY 509 506 506 GLY GLY A . n 
A 1 510 ALA 510 507 507 ALA ALA A . n 
A 1 511 GLN 511 508 508 GLN GLN A . n 
A 1 512 GLN 512 509 509 GLN GLN A . n 
A 1 513 TYR 513 510 510 TYR TYR A . n 
A 1 514 VAL 514 511 511 VAL VAL A . n 
A 1 515 SER 515 512 512 SER SER A . n 
A 1 516 LEU 516 513 513 LEU LEU A . n 
A 1 517 ASP 517 514 514 ASP ASP A . n 
A 1 518 LEU 518 515 515 LEU LEU A . n 
A 1 519 ARG 519 516 516 ARG ARG A . n 
A 1 520 PRO 520 517 517 PRO PRO A . n 
A 1 521 LEU 521 518 518 LEU LEU A . n 
A 1 522 GLU 522 519 519 GLU GLU A . n 
A 1 523 VAL 523 520 520 VAL VAL A . n 
A 1 524 ARG 524 521 521 ARG ARG A . n 
A 1 525 ARG 525 522 522 ARG ARG A . n 
A 1 526 GLY 526 523 523 GLY GLY A . n 
A 1 527 LEU 527 524 524 LEU LEU A . n 
A 1 528 ARG 528 525 525 ARG ARG A . n 
A 1 529 ALA 529 526 526 ALA ALA A . n 
A 1 530 GLN 530 527 527 GLN GLN A . n 
A 1 531 ALA 531 528 528 ALA ALA A . n 
A 1 532 CYS 532 529 529 CYS CYS A . n 
A 1 533 ALA 533 530 530 ALA ALA A . n 
A 1 534 PHE 534 531 531 PHE PHE A . n 
A 1 535 TRP 535 532 532 TRP TRP A . n 
A 1 536 ASN 536 533 533 ASN ASN A . n 
A 1 537 ARG 537 534 534 ARG ARG A . n 
A 1 538 PHE 538 535 535 PHE PHE A . n 
A 1 539 LEU 539 536 536 LEU LEU A . n 
A 1 540 PRO 540 537 537 PRO PRO A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 LEU 542 539 539 LEU LEU A . n 
A 1 543 LEU 543 540 540 LEU LEU A . n 
A 1 544 SER 544 541 541 SER SER A . n 
A 1 545 ALA 545 542 542 ALA ALA A . n 
A 1 546 THR 546 543 543 THR THR A . n 
A 1 547 ASP 547 544 ?   ?   ?   A . n 
A 1 548 THR 548 545 ?   ?   ?   A . n 
A 1 549 LEU 549 546 ?   ?   ?   A . n 
A 1 550 ASP 550 547 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   LEU 3   0   ?   ?   ?   B . n 
B 1 4   GLU 4   1   ?   ?   ?   B . n 
B 1 5   GLY 5   2   ?   ?   ?   B . n 
B 1 6   ARG 6   3   ?   ?   ?   B . n 
B 1 7   GLU 7   4   4   GLU GLU B . n 
B 1 8   ASP 8   5   5   ASP ASP B . n 
B 1 9   ALA 9   6   6   ALA ALA B . n 
B 1 10  GLU 10  7   7   GLU GLU B . n 
B 1 11  LEU 11  8   8   LEU LEU B . n 
B 1 12  LEU 12  9   9   LEU LEU B . n 
B 1 13  VAL 13  10  10  VAL VAL B . n 
B 1 14  THR 14  11  11  THR THR B . n 
B 1 15  VAL 15  12  12  VAL VAL B . n 
B 1 16  ARG 16  13  13  ARG ARG B . n 
B 1 17  GLY 17  14  14  GLY GLY B . n 
B 1 18  GLY 18  15  15  GLY GLY B . n 
B 1 19  ARG 19  16  16  ARG ARG B . n 
B 1 20  LEU 20  17  17  LEU LEU B . n 
B 1 21  ARG 21  18  18  ARG ARG B . n 
B 1 22  GLY 22  19  19  GLY GLY B . n 
B 1 23  ILE 23  20  20  ILE ILE B . n 
B 1 24  ARG 24  21  21  ARG ARG B . n 
B 1 25  LEU 25  22  22  LEU LEU B . n 
B 1 26  LYS 26  23  23  LYS LYS B . n 
B 1 27  THR 27  24  24  THR THR B . n 
B 1 28  PRO 28  25  25  PRO PRO B . n 
B 1 29  GLY 29  26  26  GLY GLY B . n 
B 1 30  GLY 30  27  27  GLY GLY B . n 
B 1 31  PRO 31  28  28  PRO PRO B . n 
B 1 32  VAL 32  29  29  VAL VAL B . n 
B 1 33  SER 33  30  30  SER SER B . n 
B 1 34  ALA 34  31  31  ALA ALA B . n 
B 1 35  PHE 35  32  32  PHE PHE B . n 
B 1 36  LEU 36  33  33  LEU LEU B . n 
B 1 37  GLY 37  34  34  GLY GLY B . n 
B 1 38  ILE 38  35  35  ILE ILE B . n 
B 1 39  PRO 39  36  36  PRO PRO B . n 
B 1 40  PHE 40  37  37  PHE PHE B . n 
B 1 41  ALA 41  38  38  ALA ALA B . n 
B 1 42  GLU 42  39  39  GLU GLU B . n 
B 1 43  PRO 43  40  40  PRO PRO B . n 
B 1 44  PRO 44  41  41  PRO PRO B . n 
B 1 45  MET 45  42  42  MET MET B . n 
B 1 46  GLY 46  43  43  GLY GLY B . n 
B 1 47  PRO 47  44  44  PRO PRO B . n 
B 1 48  ARG 48  45  45  ARG ARG B . n 
B 1 49  ARG 49  46  46  ARG ARG B . n 
B 1 50  PHE 50  47  47  PHE PHE B . n 
B 1 51  LEU 51  48  48  LEU LEU B . n 
B 1 52  PRO 52  49  49  PRO PRO B . n 
B 1 53  PRO 53  50  50  PRO PRO B . n 
B 1 54  GLU 54  51  51  GLU GLU B . n 
B 1 55  PRO 55  52  52  PRO PRO B . n 
B 1 56  LYS 56  53  53  LYS LYS B . n 
B 1 57  GLN 57  54  54  GLN GLN B . n 
B 1 58  PRO 58  55  55  PRO PRO B . n 
B 1 59  TRP 59  56  56  TRP TRP B . n 
B 1 60  SER 60  57  57  SER SER B . n 
B 1 61  GLY 61  58  58  GLY GLY B . n 
B 1 62  VAL 62  59  59  VAL VAL B . n 
B 1 63  VAL 63  60  60  VAL VAL B . n 
B 1 64  ASP 64  61  61  ASP ASP B . n 
B 1 65  ALA 65  62  62  ALA ALA B . n 
B 1 66  THR 66  63  63  THR THR B . n 
B 1 67  THR 67  64  64  THR THR B . n 
B 1 68  PHE 68  65  65  PHE PHE B . n 
B 1 69  GLN 69  66  66  GLN GLN B . n 
B 1 70  SER 70  67  67  SER SER B . n 
B 1 71  VAL 71  68  68  VAL VAL B . n 
B 1 72  CYS 72  69  69  CYS CYS B . n 
B 1 73  TYR 73  70  70  TYR TYR B . n 
B 1 74  GLN 74  71  71  GLN GLN B . n 
B 1 75  TYR 75  72  72  TYR TYR B . n 
B 1 76  VAL 76  73  73  VAL VAL B . n 
B 1 77  ASP 77  74  74  ASP ASP B . n 
B 1 78  THR 78  75  75  THR THR B . n 
B 1 79  LEU 79  76  76  LEU LEU B . n 
B 1 80  TYR 80  77  77  TYR TYR B . n 
B 1 81  PRO 81  78  78  PRO PRO B . n 
B 1 82  GLY 82  79  79  GLY GLY B . n 
B 1 83  PHE 83  80  80  PHE PHE B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  GLY 85  82  82  GLY GLY B . n 
B 1 86  THR 86  83  83  THR THR B . n 
B 1 87  GLU 87  84  84  GLU GLU B . n 
B 1 88  MET 88  85  85  MET MET B . n 
B 1 89  TRP 89  86  86  TRP TRP B . n 
B 1 90  ASN 90  87  87  ASN ASN B . n 
B 1 91  PRO 91  88  88  PRO PRO B . n 
B 1 92  ASN 92  89  89  ASN ASN B . n 
B 1 93  ARG 93  90  90  ARG ARG B . n 
B 1 94  GLU 94  91  91  GLU GLU B . n 
B 1 95  LEU 95  92  92  LEU LEU B . n 
B 1 96  SER 96  93  93  SER SER B . n 
B 1 97  GLU 97  94  94  GLU GLU B . n 
B 1 98  ASP 98  95  95  ASP ASP B . n 
B 1 99  CYS 99  96  96  CYS CYS B . n 
B 1 100 LEU 100 97  97  LEU LEU B . n 
B 1 101 TYR 101 98  98  TYR TYR B . n 
B 1 102 LEU 102 99  99  LEU LEU B . n 
B 1 103 ASN 103 100 100 ASN ASN B . n 
B 1 104 VAL 104 101 101 VAL VAL B . n 
B 1 105 TRP 105 102 102 TRP TRP B . n 
B 1 106 THR 106 103 103 THR THR B . n 
B 1 107 PRO 107 104 104 PRO PRO B . n 
B 1 108 TYR 108 105 105 TYR TYR B . n 
B 1 109 PRO 109 106 106 PRO PRO B . n 
B 1 110 ARG 110 107 107 ARG ARG B . n 
B 1 111 PRO 111 108 108 PRO PRO B . n 
B 1 112 THR 112 109 109 THR THR B . n 
B 1 113 SER 113 110 110 SER SER B . n 
B 1 114 PRO 114 111 111 PRO PRO B . n 
B 1 115 THR 115 112 112 THR THR B . n 
B 1 116 PRO 116 113 113 PRO PRO B . n 
B 1 117 VAL 117 114 114 VAL VAL B . n 
B 1 118 LEU 118 115 115 LEU LEU B . n 
B 1 119 VAL 119 116 116 VAL VAL B . n 
B 1 120 TRP 120 117 117 TRP TRP B . n 
B 1 121 ILE 121 118 118 ILE ILE B . n 
B 1 122 TYR 122 119 119 TYR TYR B . n 
B 1 123 GLY 123 120 120 GLY GLY B . n 
B 1 124 GLY 124 121 121 GLY GLY B . n 
B 1 125 GLY 125 122 122 GLY GLY B . n 
B 1 126 PHE 126 123 123 PHE PHE B . n 
B 1 127 TYR 127 124 124 TYR TYR B . n 
B 1 128 SER 128 125 125 SER SER B . n 
B 1 129 GLY 129 126 126 GLY GLY B . n 
B 1 130 ALA 130 127 127 ALA ALA B . n 
B 1 131 SER 131 128 128 SER SER B . n 
B 1 132 SER 132 129 129 SER SER B . n 
B 1 133 LEU 133 130 130 LEU LEU B . n 
B 1 134 ASP 134 131 131 ASP ASP B . n 
B 1 135 VAL 135 132 132 VAL VAL B . n 
B 1 136 TYR 136 133 133 TYR TYR B . n 
B 1 137 ASP 137 134 134 ASP ASP B . n 
B 1 138 GLY 138 135 135 GLY GLY B . n 
B 1 139 ARG 139 136 136 ARG ARG B . n 
B 1 140 PHE 140 137 137 PHE PHE B . n 
B 1 141 LEU 141 138 138 LEU LEU B . n 
B 1 142 VAL 142 139 139 VAL VAL B . n 
B 1 143 GLN 143 140 140 GLN GLN B . n 
B 1 144 ALA 144 141 141 ALA ALA B . n 
B 1 145 GLU 145 142 142 GLU GLU B . n 
B 1 146 ARG 146 143 143 ARG ARG B . n 
B 1 147 THR 147 144 144 THR THR B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 LEU 149 146 146 LEU LEU B . n 
B 1 150 VAL 150 147 147 VAL VAL B . n 
B 1 151 SER 151 148 148 SER SER B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 ASN 153 150 150 ASN ASN B . n 
B 1 154 TYR 154 151 151 TYR TYR B . n 
B 1 155 ARG 155 152 152 ARG ARG B . n 
B 1 156 VAL 156 153 153 VAL VAL B . n 
B 1 157 GLY 157 154 154 GLY GLY B . n 
B 1 158 ALA 158 155 155 ALA ALA B . n 
B 1 159 PHE 159 156 156 PHE PHE B . n 
B 1 160 GLY 160 157 157 GLY GLY B . n 
B 1 161 PHE 161 158 158 PHE PHE B . n 
B 1 162 LEU 162 159 159 LEU LEU B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 LEU 164 161 161 LEU LEU B . n 
B 1 165 PRO 165 162 162 PRO PRO B . n 
B 1 166 GLY 166 163 163 GLY GLY B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ARG 168 165 165 ARG ARG B . n 
B 1 169 GLU 169 166 166 GLU GLU B . n 
B 1 170 ALA 170 167 167 ALA ALA B . n 
B 1 171 PRO 171 168 168 PRO PRO B . n 
B 1 172 GLY 172 169 169 GLY GLY B . n 
B 1 173 ASN 173 170 170 ASN ASN B . n 
B 1 174 VAL 174 171 171 VAL VAL B . n 
B 1 175 GLY 175 172 172 GLY GLY B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 LEU 177 174 174 LEU LEU B . n 
B 1 178 ASP 178 175 175 ASP ASP B . n 
B 1 179 GLN 179 176 176 GLN GLN B . n 
B 1 180 ARG 180 177 177 ARG ARG B . n 
B 1 181 LEU 181 178 178 LEU LEU B . n 
B 1 182 ALA 182 179 179 ALA ALA B . n 
B 1 183 LEU 183 180 180 LEU LEU B . n 
B 1 184 GLN 184 181 181 GLN GLN B . n 
B 1 185 TRP 185 182 182 TRP TRP B . n 
B 1 186 VAL 186 183 183 VAL VAL B . n 
B 1 187 GLN 187 184 184 GLN GLN B . n 
B 1 188 GLU 188 185 185 GLU GLU B . n 
B 1 189 ASN 189 186 186 ASN ASN B . n 
B 1 190 VAL 190 187 187 VAL VAL B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 GLY 194 191 191 GLY GLY B . n 
B 1 195 GLY 195 192 192 GLY GLY B . n 
B 1 196 ASP 196 193 193 ASP ASP B . n 
B 1 197 PRO 197 194 194 PRO PRO B . n 
B 1 198 THR 198 195 195 THR THR B . n 
B 1 199 SER 199 196 196 SER SER B . n 
B 1 200 VAL 200 197 197 VAL VAL B . n 
B 1 201 THR 201 198 198 THR THR B . n 
B 1 202 LEU 202 199 199 LEU LEU B . n 
B 1 203 PHE 203 200 200 PHE PHE B . n 
B 1 204 GLY 204 201 201 GLY GLY B . n 
B 1 205 GLU 205 202 202 GLU GLU B . n 
B 1 206 SER 206 203 203 SER SER B . n 
B 1 207 ALA 207 204 204 ALA ALA B . n 
B 1 208 GLY 208 205 205 GLY GLY B . n 
B 1 209 ALA 209 206 206 ALA ALA B . n 
B 1 210 ALA 210 207 207 ALA ALA B . n 
B 1 211 SER 211 208 208 SER SER B . n 
B 1 212 VAL 212 209 209 VAL VAL B . n 
B 1 213 GLY 213 210 210 GLY GLY B . n 
B 1 214 MET 214 211 211 MET MET B . n 
B 1 215 HIS 215 212 212 HIS HIS B . n 
B 1 216 LEU 216 213 213 LEU LEU B . n 
B 1 217 LEU 217 214 214 LEU LEU B . n 
B 1 218 SER 218 215 215 SER SER B . n 
B 1 219 PRO 219 216 216 PRO PRO B . n 
B 1 220 PRO 220 217 217 PRO PRO B . n 
B 1 221 SER 221 218 218 SER SER B . n 
B 1 222 ARG 222 219 219 ARG ARG B . n 
B 1 223 GLY 223 220 220 GLY GLY B . n 
B 1 224 LEU 224 221 221 LEU LEU B . n 
B 1 225 PHE 225 222 222 PHE PHE B . n 
B 1 226 HIS 226 223 223 HIS HIS B . n 
B 1 227 ARG 227 224 224 ARG ARG B . n 
B 1 228 ALA 228 225 225 ALA ALA B . n 
B 1 229 VAL 229 226 226 VAL VAL B . n 
B 1 230 LEU 230 227 227 LEU LEU B . n 
B 1 231 GLN 231 228 228 GLN GLN B . n 
B 1 232 SER 232 229 229 SER SER B . n 
B 1 233 GLY 233 230 230 GLY GLY B . n 
B 1 234 ALA 234 231 231 ALA ALA B . n 
B 1 235 PRO 235 232 232 PRO PRO B . n 
B 1 236 ASN 236 233 233 ASN ASN B . n 
B 1 237 GLY 237 234 234 GLY GLY B . n 
B 1 238 PRO 238 235 235 PRO PRO B . n 
B 1 239 TRP 239 236 236 TRP TRP B . n 
B 1 240 ALA 240 237 237 ALA ALA B . n 
B 1 241 THR 241 238 238 THR THR B . n 
B 1 242 VAL 242 239 239 VAL VAL B . n 
B 1 243 GLY 243 240 240 GLY GLY B . n 
B 1 244 MET 244 241 241 MET MET B . n 
B 1 245 GLY 245 242 242 GLY GLY B . n 
B 1 246 GLU 246 243 243 GLU GLU B . n 
B 1 247 ALA 247 244 244 ALA ALA B . n 
B 1 248 ARG 248 245 245 ARG ARG B . n 
B 1 249 ARG 249 246 246 ARG ARG B . n 
B 1 250 ARG 250 247 247 ARG ARG B . n 
B 1 251 ALA 251 248 248 ALA ALA B . n 
B 1 252 THR 252 249 249 THR THR B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 HIS 256 253 253 HIS HIS B . n 
B 1 257 LEU 257 254 254 LEU LEU B . n 
B 1 258 VAL 258 255 255 VAL VAL B . n 
B 1 259 GLY 259 256 256 GLY GLY B . n 
B 1 260 CYS 260 257 257 CYS CYS B . n 
B 1 261 PRO 261 258 258 PRO PRO B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 GLY 263 260 260 GLY GLY B . n 
B 1 264 GLY 264 261 261 GLY GLY B . n 
B 1 265 THR 265 262 262 THR THR B . n 
B 1 266 GLY 266 263 263 GLY GLY B . n 
B 1 267 GLY 267 264 264 GLY GLY B . n 
B 1 268 ASN 268 265 265 ASN ASN B . n 
B 1 269 ASP 269 266 266 ASP ASP B . n 
B 1 270 THR 270 267 267 THR THR B . n 
B 1 271 GLU 271 268 268 GLU GLU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 VAL 273 270 270 VAL VAL B . n 
B 1 274 ALA 274 271 271 ALA ALA B . n 
B 1 275 CYS 275 272 272 CYS CYS B . n 
B 1 276 LEU 276 273 273 LEU LEU B . n 
B 1 277 ARG 277 274 274 ARG ARG B . n 
B 1 278 THR 278 275 275 THR THR B . n 
B 1 279 ARG 279 276 276 ARG ARG B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 ALA 281 278 278 ALA ALA B . n 
B 1 282 GLN 282 279 279 GLN GLN B . n 
B 1 283 VAL 283 280 280 VAL VAL B . n 
B 1 284 LEU 284 281 281 LEU LEU B . n 
B 1 285 VAL 285 282 282 VAL VAL B . n 
B 1 286 ASN 286 283 283 ASN ASN B . n 
B 1 287 HIS 287 284 284 HIS HIS B . n 
B 1 288 GLU 288 285 285 GLU GLU B . n 
B 1 289 TRP 289 286 286 TRP TRP B . n 
B 1 290 HIS 290 287 287 HIS HIS B . n 
B 1 291 VAL 291 288 288 VAL VAL B . n 
B 1 292 LEU 292 289 289 LEU LEU B . n 
B 1 293 PRO 293 290 290 PRO PRO B . n 
B 1 294 GLN 294 291 291 GLN GLN B . n 
B 1 295 GLU 295 292 292 GLU GLU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 VAL 297 294 294 VAL VAL B . n 
B 1 298 PHE 298 295 295 PHE PHE B . n 
B 1 299 ARG 299 296 296 ARG ARG B . n 
B 1 300 PHE 300 297 297 PHE PHE B . n 
B 1 301 SER 301 298 298 SER SER B . n 
B 1 302 PHE 302 299 299 PHE PHE B . n 
B 1 303 VAL 303 300 300 VAL VAL B . n 
B 1 304 PRO 304 301 301 PRO PRO B . n 
B 1 305 VAL 305 302 302 VAL VAL B . n 
B 1 306 VAL 306 303 303 VAL VAL B . n 
B 1 307 ASP 307 304 304 ASP ASP B . n 
B 1 308 GLY 308 305 305 GLY GLY B . n 
B 1 309 ASP 309 306 306 ASP ASP B . n 
B 1 310 PHE 310 307 307 PHE PHE B . n 
B 1 311 LEU 311 308 308 LEU LEU B . n 
B 1 312 SER 312 309 309 SER SER B . n 
B 1 313 ASP 313 310 310 ASP ASP B . n 
B 1 314 THR 314 311 311 THR THR B . n 
B 1 315 PRO 315 312 312 PRO PRO B . n 
B 1 316 GLU 316 313 313 GLU GLU B . n 
B 1 317 ALA 317 314 314 ALA ALA B . n 
B 1 318 LEU 318 315 315 LEU LEU B . n 
B 1 319 ILE 319 316 316 ILE ILE B . n 
B 1 320 ASN 320 317 317 ASN ASN B . n 
B 1 321 ALA 321 318 318 ALA ALA B . n 
B 1 322 GLY 322 319 319 GLY GLY B . n 
B 1 323 ASP 323 320 320 ASP ASP B . n 
B 1 324 PHE 324 321 321 PHE PHE B . n 
B 1 325 HIS 325 322 322 HIS HIS B . n 
B 1 326 GLY 326 323 323 GLY GLY B . n 
B 1 327 LEU 327 324 324 LEU LEU B . n 
B 1 328 GLN 328 325 325 GLN GLN B . n 
B 1 329 VAL 329 326 326 VAL VAL B . n 
B 1 330 LEU 330 327 327 LEU LEU B . n 
B 1 331 VAL 331 328 328 VAL VAL B . n 
B 1 332 GLY 332 329 329 GLY GLY B . n 
B 1 333 VAL 333 330 330 VAL VAL B . n 
B 1 334 VAL 334 331 331 VAL VAL B . n 
B 1 335 LYS 335 332 332 LYS LYS B . n 
B 1 336 ASP 336 333 333 ASP ASP B . n 
B 1 337 GLU 337 334 334 GLU GLU B . n 
B 1 338 GLY 338 335 335 GLY GLY B . n 
B 1 339 SER 339 336 336 SER SER B . n 
B 1 340 TYR 340 337 337 TYR TYR B . n 
B 1 341 PHE 341 338 338 PHE PHE B . n 
B 1 342 LEU 342 339 339 LEU LEU B . n 
B 1 343 VAL 343 340 340 VAL VAL B . n 
B 1 344 TYR 344 341 341 TYR TYR B . n 
B 1 345 GLY 345 342 342 GLY GLY B . n 
B 1 346 ALA 346 343 343 ALA ALA B . n 
B 1 347 PRO 347 344 344 PRO PRO B . n 
B 1 348 GLY 348 345 345 GLY GLY B . n 
B 1 349 PHE 349 346 346 PHE PHE B . n 
B 1 350 SER 350 347 347 SER SER B . n 
B 1 351 LYS 351 348 348 LYS LYS B . n 
B 1 352 ASP 352 349 349 ASP ASP B . n 
B 1 353 ASN 353 350 350 ASN ASN B . n 
B 1 354 GLU 354 351 351 GLU GLU B . n 
B 1 355 SER 355 352 352 SER SER B . n 
B 1 356 LEU 356 353 353 LEU LEU B . n 
B 1 357 ILE 357 354 354 ILE ILE B . n 
B 1 358 SER 358 355 355 SER SER B . n 
B 1 359 ARG 359 356 356 ARG ARG B . n 
B 1 360 ALA 360 357 357 ALA ALA B . n 
B 1 361 GLU 361 358 358 GLU GLU B . n 
B 1 362 PHE 362 359 359 PHE PHE B . n 
B 1 363 LEU 363 360 360 LEU LEU B . n 
B 1 364 ALA 364 361 361 ALA ALA B . n 
B 1 365 GLY 365 362 362 GLY GLY B . n 
B 1 366 VAL 366 363 363 VAL VAL B . n 
B 1 367 ARG 367 364 364 ARG ARG B . n 
B 1 368 VAL 368 365 365 VAL VAL B . n 
B 1 369 GLY 369 366 366 GLY GLY B . n 
B 1 370 VAL 370 367 367 VAL VAL B . n 
B 1 371 PRO 371 368 368 PRO PRO B . n 
B 1 372 GLN 372 369 369 GLN GLN B . n 
B 1 373 VAL 373 370 370 VAL VAL B . n 
B 1 374 SER 374 371 371 SER SER B . n 
B 1 375 ASP 375 372 372 ASP ASP B . n 
B 1 376 LEU 376 373 373 LEU LEU B . n 
B 1 377 ALA 377 374 374 ALA ALA B . n 
B 1 378 ALA 378 375 375 ALA ALA B . n 
B 1 379 GLU 379 376 376 GLU GLU B . n 
B 1 380 ALA 380 377 377 ALA ALA B . n 
B 1 381 VAL 381 378 378 VAL VAL B . n 
B 1 382 VAL 382 379 379 VAL VAL B . n 
B 1 383 LEU 383 380 380 LEU LEU B . n 
B 1 384 HIS 384 381 381 HIS HIS B . n 
B 1 385 TYR 385 382 382 TYR TYR B . n 
B 1 386 THR 386 383 383 THR THR B . n 
B 1 387 ASP 387 384 384 ASP ASP B . n 
B 1 388 TRP 388 385 385 TRP TRP B . n 
B 1 389 LEU 389 386 386 LEU LEU B . n 
B 1 390 HIS 390 387 387 HIS HIS B . n 
B 1 391 PRO 391 388 388 PRO PRO B . n 
B 1 392 GLU 392 389 389 GLU GLU B . n 
B 1 393 ASP 393 390 390 ASP ASP B . n 
B 1 394 PRO 394 391 391 PRO PRO B . n 
B 1 395 ALA 395 392 392 ALA ALA B . n 
B 1 396 ARG 396 393 393 ARG ARG B . n 
B 1 397 LEU 397 394 394 LEU LEU B . n 
B 1 398 ARG 398 395 395 ARG ARG B . n 
B 1 399 GLU 399 396 396 GLU GLU B . n 
B 1 400 ALA 400 397 397 ALA ALA B . n 
B 1 401 LEU 401 398 398 LEU LEU B . n 
B 1 402 SER 402 399 399 SER SER B . n 
B 1 403 ASP 403 400 400 ASP ASP B . n 
B 1 404 VAL 404 401 401 VAL VAL B . n 
B 1 405 VAL 405 402 402 VAL VAL B . n 
B 1 406 GLY 406 403 403 GLY GLY B . n 
B 1 407 ASP 407 404 404 ASP ASP B . n 
B 1 408 HIS 408 405 405 HIS HIS B . n 
B 1 409 ASN 409 406 406 ASN ASN B . n 
B 1 410 VAL 410 407 407 VAL VAL B . n 
B 1 411 VAL 411 408 408 VAL VAL B . n 
B 1 412 CYS 412 409 409 CYS CYS B . n 
B 1 413 PRO 413 410 410 PRO PRO B . n 
B 1 414 VAL 414 411 411 VAL VAL B . n 
B 1 415 ALA 415 412 412 ALA ALA B . n 
B 1 416 GLN 416 413 413 GLN GLN B . n 
B 1 417 LEU 417 414 414 LEU LEU B . n 
B 1 418 ALA 418 415 415 ALA ALA B . n 
B 1 419 GLY 419 416 416 GLY GLY B . n 
B 1 420 ARG 420 417 417 ARG ARG B . n 
B 1 421 LEU 421 418 418 LEU LEU B . n 
B 1 422 ALA 422 419 419 ALA ALA B . n 
B 1 423 ALA 423 420 420 ALA ALA B . n 
B 1 424 GLN 424 421 421 GLN GLN B . n 
B 1 425 GLY 425 422 422 GLY GLY B . n 
B 1 426 ALA 426 423 423 ALA ALA B . n 
B 1 427 ARG 427 424 424 ARG ARG B . n 
B 1 428 VAL 428 425 425 VAL VAL B . n 
B 1 429 TYR 429 426 426 TYR TYR B . n 
B 1 430 ALA 430 427 427 ALA ALA B . n 
B 1 431 TYR 431 428 428 TYR TYR B . n 
B 1 432 VAL 432 429 429 VAL VAL B . n 
B 1 433 PHE 433 430 430 PHE PHE B . n 
B 1 434 GLU 434 431 431 GLU GLU B . n 
B 1 435 HIS 435 432 432 HIS HIS B . n 
B 1 436 ARG 436 433 433 ARG ARG B . n 
B 1 437 ALA 437 434 434 ALA ALA B . n 
B 1 438 SER 438 435 435 SER SER B . n 
B 1 439 THR 439 436 436 THR THR B . n 
B 1 440 LEU 440 437 437 LEU LEU B . n 
B 1 441 SER 441 438 438 SER SER B . n 
B 1 442 TRP 442 439 439 TRP TRP B . n 
B 1 443 PRO 443 440 440 PRO PRO B . n 
B 1 444 LEU 444 441 441 LEU LEU B . n 
B 1 445 TRP 445 442 442 TRP TRP B . n 
B 1 446 MET 446 443 443 MET MET B . n 
B 1 447 GLY 447 444 444 GLY GLY B . n 
B 1 448 VAL 448 445 445 VAL VAL B . n 
B 1 449 PRO 449 446 446 PRO PRO B . n 
B 1 450 HIS 450 447 447 HIS HIS B . n 
B 1 451 GLY 451 448 448 GLY GLY B . n 
B 1 452 TYR 452 449 449 TYR TYR B . n 
B 1 453 GLU 453 450 450 GLU GLU B . n 
B 1 454 ILE 454 451 451 ILE ILE B . n 
B 1 455 GLU 455 452 452 GLU GLU B . n 
B 1 456 PHE 456 453 453 PHE PHE B . n 
B 1 457 ILE 457 454 454 ILE ILE B . n 
B 1 458 PHE 458 455 455 PHE PHE B . n 
B 1 459 GLY 459 456 456 GLY GLY B . n 
B 1 460 ILE 460 457 457 ILE ILE B . n 
B 1 461 PRO 461 458 458 PRO PRO B . n 
B 1 462 LEU 462 459 459 LEU LEU B . n 
B 1 463 ASP 463 460 460 ASP ASP B . n 
B 1 464 PRO 464 461 461 PRO PRO B . n 
B 1 465 SER 465 462 462 SER SER B . n 
B 1 466 ARG 466 463 463 ARG ARG B . n 
B 1 467 ASN 467 464 464 ASN ASN B . n 
B 1 468 TYR 468 465 465 TYR TYR B . n 
B 1 469 THR 469 466 466 THR THR B . n 
B 1 470 ALA 470 467 467 ALA ALA B . n 
B 1 471 GLU 471 468 468 GLU GLU B . n 
B 1 472 GLU 472 469 469 GLU GLU B . n 
B 1 473 LYS 473 470 470 LYS LYS B . n 
B 1 474 ILE 474 471 471 ILE ILE B . n 
B 1 475 PHE 475 472 472 PHE PHE B . n 
B 1 476 ALA 476 473 473 ALA ALA B . n 
B 1 477 GLN 477 474 474 GLN GLN B . n 
B 1 478 ARG 478 475 475 ARG ARG B . n 
B 1 479 LEU 479 476 476 LEU LEU B . n 
B 1 480 MET 480 477 477 MET MET B . n 
B 1 481 ARG 481 478 478 ARG ARG B . n 
B 1 482 TYR 482 479 479 TYR TYR B . n 
B 1 483 TRP 483 480 480 TRP TRP B . n 
B 1 484 ALA 484 481 481 ALA ALA B . n 
B 1 485 ASN 485 482 482 ASN ASN B . n 
B 1 486 PHE 486 483 483 PHE PHE B . n 
B 1 487 ALA 487 484 484 ALA ALA B . n 
B 1 488 ARG 488 485 485 ARG ARG B . n 
B 1 489 THR 489 486 486 THR THR B . n 
B 1 490 GLY 490 487 487 GLY GLY B . n 
B 1 491 ASP 491 488 488 ASP ASP B . n 
B 1 492 PRO 492 489 489 PRO PRO B . n 
B 1 493 ASN 493 490 490 ASN ASN B . n 
B 1 494 GLU 494 491 491 GLU GLU B . n 
B 1 495 PRO 495 492 492 PRO PRO B . n 
B 1 496 ARG 496 493 493 ARG ARG B . n 
B 1 497 ASP 497 494 494 ASP ASP B . n 
B 1 498 PRO 498 495 495 PRO PRO B . n 
B 1 499 LYS 499 496 496 LYS LYS B . n 
B 1 500 ALA 500 497 497 ALA ALA B . n 
B 1 501 PRO 501 498 498 PRO PRO B . n 
B 1 502 GLN 502 499 499 GLN GLN B . n 
B 1 503 TRP 503 500 500 TRP TRP B . n 
B 1 504 PRO 504 501 501 PRO PRO B . n 
B 1 505 PRO 505 502 502 PRO PRO B . n 
B 1 506 TYR 506 503 503 TYR TYR B . n 
B 1 507 THR 507 504 504 THR THR B . n 
B 1 508 ALA 508 505 505 ALA ALA B . n 
B 1 509 GLY 509 506 506 GLY GLY B . n 
B 1 510 ALA 510 507 507 ALA ALA B . n 
B 1 511 GLN 511 508 508 GLN GLN B . n 
B 1 512 GLN 512 509 509 GLN GLN B . n 
B 1 513 TYR 513 510 510 TYR TYR B . n 
B 1 514 VAL 514 511 511 VAL VAL B . n 
B 1 515 SER 515 512 512 SER SER B . n 
B 1 516 LEU 516 513 513 LEU LEU B . n 
B 1 517 ASP 517 514 514 ASP ASP B . n 
B 1 518 LEU 518 515 515 LEU LEU B . n 
B 1 519 ARG 519 516 516 ARG ARG B . n 
B 1 520 PRO 520 517 517 PRO PRO B . n 
B 1 521 LEU 521 518 518 LEU LEU B . n 
B 1 522 GLU 522 519 519 GLU GLU B . n 
B 1 523 VAL 523 520 520 VAL VAL B . n 
B 1 524 ARG 524 521 521 ARG ARG B . n 
B 1 525 ARG 525 522 522 ARG ARG B . n 
B 1 526 GLY 526 523 523 GLY GLY B . n 
B 1 527 LEU 527 524 524 LEU LEU B . n 
B 1 528 ARG 528 525 525 ARG ARG B . n 
B 1 529 ALA 529 526 526 ALA ALA B . n 
B 1 530 GLN 530 527 527 GLN GLN B . n 
B 1 531 ALA 531 528 528 ALA ALA B . n 
B 1 532 CYS 532 529 529 CYS CYS B . n 
B 1 533 ALA 533 530 530 ALA ALA B . n 
B 1 534 PHE 534 531 531 PHE PHE B . n 
B 1 535 TRP 535 532 532 TRP TRP B . n 
B 1 536 ASN 536 533 533 ASN ASN B . n 
B 1 537 ARG 537 534 534 ARG ARG B . n 
B 1 538 PHE 538 535 535 PHE PHE B . n 
B 1 539 LEU 539 536 536 LEU LEU B . n 
B 1 540 PRO 540 537 537 PRO PRO B . n 
B 1 541 LYS 541 538 538 LYS LYS B . n 
B 1 542 LEU 542 539 539 LEU LEU B . n 
B 1 543 LEU 543 540 540 LEU LEU B . n 
B 1 544 SER 544 541 541 SER SER B . n 
B 1 545 ALA 545 542 542 ALA ALA B . n 
B 1 546 THR 546 543 543 THR THR B . n 
B 1 547 ASP 547 544 ?   ?   ?   B . n 
B 1 548 THR 548 545 ?   ?   ?   B . n 
B 1 549 LEU 549 546 ?   ?   ?   B . n 
B 1 550 ASP 550 547 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 LND 1   601  1    LND DRG A . 
D 3 NO3 1   602  1    NO3 NO3 A . 
E 3 NO3 1   603  2    NO3 NO3 A . 
F 4 GOL 1   604  1    GOL GOL A . 
G 4 GOL 1   605  2    GOL GOL A . 
H 2 LND 1   601  2    LND DRG B . 
I 4 GOL 1   602  3    GOL GOL B . 
J 4 GOL 1   603  4    GOL GOL B . 
K 5 HOH 1   701  1023 HOH HOH A . 
K 5 HOH 2   702  84   HOH HOH A . 
K 5 HOH 3   703  64   HOH HOH A . 
K 5 HOH 4   704  303  HOH HOH A . 
K 5 HOH 5   705  555  HOH HOH A . 
K 5 HOH 6   706  402  HOH HOH A . 
K 5 HOH 7   707  980  HOH HOH A . 
K 5 HOH 8   708  861  HOH HOH A . 
K 5 HOH 9   709  223  HOH HOH A . 
K 5 HOH 10  710  19   HOH HOH A . 
K 5 HOH 11  711  383  HOH HOH A . 
K 5 HOH 12  712  318  HOH HOH A . 
K 5 HOH 13  713  502  HOH HOH A . 
K 5 HOH 14  714  805  HOH HOH A . 
K 5 HOH 15  715  420  HOH HOH A . 
K 5 HOH 16  716  839  HOH HOH A . 
K 5 HOH 17  717  857  HOH HOH A . 
K 5 HOH 18  718  617  HOH HOH A . 
K 5 HOH 19  719  521  HOH HOH A . 
K 5 HOH 20  720  185  HOH HOH A . 
K 5 HOH 21  721  902  HOH HOH A . 
K 5 HOH 22  722  292  HOH HOH A . 
K 5 HOH 23  723  237  HOH HOH A . 
K 5 HOH 24  724  2    HOH HOH A . 
K 5 HOH 25  725  524  HOH HOH A . 
K 5 HOH 26  726  945  HOH HOH A . 
K 5 HOH 27  727  274  HOH HOH A . 
K 5 HOH 28  728  7    HOH HOH A . 
K 5 HOH 29  729  802  HOH HOH A . 
K 5 HOH 30  730  125  HOH HOH A . 
K 5 HOH 31  731  107  HOH HOH A . 
K 5 HOH 32  732  967  HOH HOH A . 
K 5 HOH 33  733  21   HOH HOH A . 
K 5 HOH 34  734  42   HOH HOH A . 
K 5 HOH 35  735  374  HOH HOH A . 
K 5 HOH 36  736  217  HOH HOH A . 
K 5 HOH 37  737  619  HOH HOH A . 
K 5 HOH 38  738  126  HOH HOH A . 
K 5 HOH 39  739  822  HOH HOH A . 
K 5 HOH 40  740  62   HOH HOH A . 
K 5 HOH 41  741  916  HOH HOH A . 
K 5 HOH 42  742  951  HOH HOH A . 
K 5 HOH 43  743  32   HOH HOH A . 
K 5 HOH 44  744  959  HOH HOH A . 
K 5 HOH 45  745  364  HOH HOH A . 
K 5 HOH 46  746  5    HOH HOH A . 
K 5 HOH 47  747  227  HOH HOH A . 
K 5 HOH 48  748  620  HOH HOH A . 
K 5 HOH 49  749  160  HOH HOH A . 
K 5 HOH 50  750  804  HOH HOH A . 
K 5 HOH 51  751  164  HOH HOH A . 
K 5 HOH 52  752  301  HOH HOH A . 
K 5 HOH 53  753  46   HOH HOH A . 
K 5 HOH 54  754  141  HOH HOH A . 
K 5 HOH 55  755  977  HOH HOH A . 
K 5 HOH 56  756  187  HOH HOH A . 
K 5 HOH 57  757  219  HOH HOH A . 
K 5 HOH 58  758  559  HOH HOH A . 
K 5 HOH 59  759  65   HOH HOH A . 
K 5 HOH 60  760  109  HOH HOH A . 
K 5 HOH 61  761  363  HOH HOH A . 
K 5 HOH 62  762  930  HOH HOH A . 
K 5 HOH 63  763  958  HOH HOH A . 
K 5 HOH 64  764  398  HOH HOH A . 
K 5 HOH 65  765  415  HOH HOH A . 
K 5 HOH 66  766  38   HOH HOH A . 
K 5 HOH 67  767  240  HOH HOH A . 
K 5 HOH 68  768  346  HOH HOH A . 
K 5 HOH 69  769  184  HOH HOH A . 
K 5 HOH 70  770  458  HOH HOH A . 
K 5 HOH 71  771  24   HOH HOH A . 
K 5 HOH 72  772  58   HOH HOH A . 
K 5 HOH 73  773  111  HOH HOH A . 
K 5 HOH 74  774  816  HOH HOH A . 
K 5 HOH 75  775  557  HOH HOH A . 
K 5 HOH 76  776  660  HOH HOH A . 
K 5 HOH 77  777  203  HOH HOH A . 
K 5 HOH 78  778  426  HOH HOH A . 
K 5 HOH 79  779  694  HOH HOH A . 
K 5 HOH 80  780  112  HOH HOH A . 
K 5 HOH 81  781  477  HOH HOH A . 
K 5 HOH 82  782  222  HOH HOH A . 
K 5 HOH 83  783  180  HOH HOH A . 
K 5 HOH 84  784  715  HOH HOH A . 
K 5 HOH 85  785  3    HOH HOH A . 
K 5 HOH 86  786  765  HOH HOH A . 
K 5 HOH 87  787  492  HOH HOH A . 
K 5 HOH 88  788  514  HOH HOH A . 
K 5 HOH 89  789  248  HOH HOH A . 
K 5 HOH 90  790  278  HOH HOH A . 
K 5 HOH 91  791  796  HOH HOH A . 
K 5 HOH 92  792  787  HOH HOH A . 
K 5 HOH 93  793  289  HOH HOH A . 
K 5 HOH 94  794  507  HOH HOH A . 
K 5 HOH 95  795  846  HOH HOH A . 
K 5 HOH 96  796  444  HOH HOH A . 
K 5 HOH 97  797  44   HOH HOH A . 
K 5 HOH 98  798  72   HOH HOH A . 
K 5 HOH 99  799  817  HOH HOH A . 
K 5 HOH 100 800  638  HOH HOH A . 
K 5 HOH 101 801  9    HOH HOH A . 
K 5 HOH 102 802  837  HOH HOH A . 
K 5 HOH 103 803  151  HOH HOH A . 
K 5 HOH 104 804  204  HOH HOH A . 
K 5 HOH 105 805  135  HOH HOH A . 
K 5 HOH 106 806  30   HOH HOH A . 
K 5 HOH 107 807  247  HOH HOH A . 
K 5 HOH 108 808  80   HOH HOH A . 
K 5 HOH 109 809  13   HOH HOH A . 
K 5 HOH 110 810  438  HOH HOH A . 
K 5 HOH 111 811  309  HOH HOH A . 
K 5 HOH 112 812  317  HOH HOH A . 
K 5 HOH 113 813  56   HOH HOH A . 
K 5 HOH 114 814  641  HOH HOH A . 
K 5 HOH 115 815  53   HOH HOH A . 
K 5 HOH 116 816  177  HOH HOH A . 
K 5 HOH 117 817  495  HOH HOH A . 
K 5 HOH 118 818  134  HOH HOH A . 
K 5 HOH 119 819  664  HOH HOH A . 
K 5 HOH 120 820  421  HOH HOH A . 
K 5 HOH 121 821  52   HOH HOH A . 
K 5 HOH 122 822  20   HOH HOH A . 
K 5 HOH 123 823  212  HOH HOH A . 
K 5 HOH 124 824  29   HOH HOH A . 
K 5 HOH 125 825  122  HOH HOH A . 
K 5 HOH 126 826  728  HOH HOH A . 
K 5 HOH 127 827  137  HOH HOH A . 
K 5 HOH 128 828  50   HOH HOH A . 
K 5 HOH 129 829  96   HOH HOH A . 
K 5 HOH 130 830  471  HOH HOH A . 
K 5 HOH 131 831  94   HOH HOH A . 
K 5 HOH 132 832  969  HOH HOH A . 
K 5 HOH 133 833  371  HOH HOH A . 
K 5 HOH 134 834  22   HOH HOH A . 
K 5 HOH 135 835  267  HOH HOH A . 
K 5 HOH 136 836  48   HOH HOH A . 
K 5 HOH 137 837  534  HOH HOH A . 
K 5 HOH 138 838  465  HOH HOH A . 
K 5 HOH 139 839  98   HOH HOH A . 
K 5 HOH 140 840  97   HOH HOH A . 
K 5 HOH 141 841  604  HOH HOH A . 
K 5 HOH 142 842  1005 HOH HOH A . 
K 5 HOH 143 843  71   HOH HOH A . 
K 5 HOH 144 844  178  HOH HOH A . 
K 5 HOH 145 845  489  HOH HOH A . 
K 5 HOH 146 846  272  HOH HOH A . 
K 5 HOH 147 847  572  HOH HOH A . 
K 5 HOH 148 848  504  HOH HOH A . 
K 5 HOH 149 849  713  HOH HOH A . 
K 5 HOH 150 850  468  HOH HOH A . 
K 5 HOH 151 851  854  HOH HOH A . 
K 5 HOH 152 852  627  HOH HOH A . 
K 5 HOH 153 853  245  HOH HOH A . 
K 5 HOH 154 854  792  HOH HOH A . 
K 5 HOH 155 855  69   HOH HOH A . 
K 5 HOH 156 856  211  HOH HOH A . 
K 5 HOH 157 857  279  HOH HOH A . 
K 5 HOH 158 858  893  HOH HOH A . 
K 5 HOH 159 859  759  HOH HOH A . 
K 5 HOH 160 860  198  HOH HOH A . 
K 5 HOH 161 861  254  HOH HOH A . 
K 5 HOH 162 862  239  HOH HOH A . 
K 5 HOH 163 863  560  HOH HOH A . 
K 5 HOH 164 864  70   HOH HOH A . 
K 5 HOH 165 865  308  HOH HOH A . 
K 5 HOH 166 866  328  HOH HOH A . 
K 5 HOH 167 867  681  HOH HOH A . 
K 5 HOH 168 868  225  HOH HOH A . 
K 5 HOH 169 869  316  HOH HOH A . 
K 5 HOH 170 870  4    HOH HOH A . 
K 5 HOH 171 871  148  HOH HOH A . 
K 5 HOH 172 872  172  HOH HOH A . 
K 5 HOH 173 873  1001 HOH HOH A . 
K 5 HOH 174 874  258  HOH HOH A . 
K 5 HOH 175 875  1013 HOH HOH A . 
K 5 HOH 176 876  123  HOH HOH A . 
K 5 HOH 177 877  214  HOH HOH A . 
K 5 HOH 178 878  503  HOH HOH A . 
K 5 HOH 179 879  153  HOH HOH A . 
K 5 HOH 180 880  527  HOH HOH A . 
K 5 HOH 181 881  966  HOH HOH A . 
K 5 HOH 182 882  978  HOH HOH A . 
K 5 HOH 183 883  950  HOH HOH A . 
K 5 HOH 184 884  259  HOH HOH A . 
K 5 HOH 185 885  597  HOH HOH A . 
K 5 HOH 186 886  375  HOH HOH A . 
K 5 HOH 187 887  418  HOH HOH A . 
K 5 HOH 188 888  811  HOH HOH A . 
K 5 HOH 189 889  209  HOH HOH A . 
K 5 HOH 190 890  772  HOH HOH A . 
K 5 HOH 191 891  351  HOH HOH A . 
K 5 HOH 192 892  257  HOH HOH A . 
K 5 HOH 193 893  59   HOH HOH A . 
K 5 HOH 194 894  551  HOH HOH A . 
K 5 HOH 195 895  611  HOH HOH A . 
K 5 HOH 196 896  613  HOH HOH A . 
K 5 HOH 197 897  799  HOH HOH A . 
K 5 HOH 198 898  753  HOH HOH A . 
K 5 HOH 199 899  49   HOH HOH A . 
K 5 HOH 200 900  544  HOH HOH A . 
K 5 HOH 201 901  901  HOH HOH A . 
K 5 HOH 202 902  195  HOH HOH A . 
K 5 HOH 203 903  1006 HOH HOH A . 
K 5 HOH 204 904  566  HOH HOH A . 
K 5 HOH 205 905  840  HOH HOH A . 
K 5 HOH 206 906  85   HOH HOH A . 
K 5 HOH 207 907  970  HOH HOH A . 
K 5 HOH 208 908  302  HOH HOH A . 
K 5 HOH 209 909  657  HOH HOH A . 
K 5 HOH 210 910  600  HOH HOH A . 
K 5 HOH 211 911  561  HOH HOH A . 
K 5 HOH 212 912  366  HOH HOH A . 
K 5 HOH 213 913  417  HOH HOH A . 
K 5 HOH 214 914  314  HOH HOH A . 
K 5 HOH 215 915  161  HOH HOH A . 
K 5 HOH 216 916  6    HOH HOH A . 
K 5 HOH 217 917  850  HOH HOH A . 
K 5 HOH 218 918  697  HOH HOH A . 
K 5 HOH 219 919  188  HOH HOH A . 
K 5 HOH 220 920  435  HOH HOH A . 
K 5 HOH 221 921  76   HOH HOH A . 
K 5 HOH 222 922  509  HOH HOH A . 
K 5 HOH 223 923  399  HOH HOH A . 
K 5 HOH 224 924  481  HOH HOH A . 
K 5 HOH 225 925  808  HOH HOH A . 
K 5 HOH 226 926  246  HOH HOH A . 
K 5 HOH 227 927  14   HOH HOH A . 
K 5 HOH 228 928  515  HOH HOH A . 
K 5 HOH 229 929  829  HOH HOH A . 
K 5 HOH 230 930  1020 HOH HOH A . 
K 5 HOH 231 931  658  HOH HOH A . 
K 5 HOH 232 932  281  HOH HOH A . 
K 5 HOH 233 933  307  HOH HOH A . 
K 5 HOH 234 934  243  HOH HOH A . 
K 5 HOH 235 935  124  HOH HOH A . 
K 5 HOH 236 936  880  HOH HOH A . 
K 5 HOH 237 937  813  HOH HOH A . 
K 5 HOH 238 938  649  HOH HOH A . 
K 5 HOH 239 939  165  HOH HOH A . 
K 5 HOH 240 940  401  HOH HOH A . 
K 5 HOH 241 941  581  HOH HOH A . 
K 5 HOH 242 942  266  HOH HOH A . 
K 5 HOH 243 943  541  HOH HOH A . 
K 5 HOH 244 944  158  HOH HOH A . 
K 5 HOH 245 945  372  HOH HOH A . 
K 5 HOH 246 946  157  HOH HOH A . 
K 5 HOH 247 947  770  HOH HOH A . 
K 5 HOH 248 948  785  HOH HOH A . 
K 5 HOH 249 949  283  HOH HOH A . 
K 5 HOH 250 950  451  HOH HOH A . 
K 5 HOH 251 951  962  HOH HOH A . 
K 5 HOH 252 952  731  HOH HOH A . 
K 5 HOH 253 953  270  HOH HOH A . 
K 5 HOH 254 954  300  HOH HOH A . 
K 5 HOH 255 955  454  HOH HOH A . 
K 5 HOH 256 956  971  HOH HOH A . 
K 5 HOH 257 957  836  HOH HOH A . 
K 5 HOH 258 958  389  HOH HOH A . 
K 5 HOH 259 959  748  HOH HOH A . 
K 5 HOH 260 960  155  HOH HOH A . 
K 5 HOH 261 961  291  HOH HOH A . 
K 5 HOH 262 962  682  HOH HOH A . 
K 5 HOH 263 963  591  HOH HOH A . 
K 5 HOH 264 964  832  HOH HOH A . 
K 5 HOH 265 965  472  HOH HOH A . 
K 5 HOH 266 966  81   HOH HOH A . 
K 5 HOH 267 967  194  HOH HOH A . 
K 5 HOH 268 968  1007 HOH HOH A . 
K 5 HOH 269 969  648  HOH HOH A . 
K 5 HOH 270 970  199  HOH HOH A . 
K 5 HOH 271 971  599  HOH HOH A . 
K 5 HOH 272 972  396  HOH HOH A . 
K 5 HOH 273 973  90   HOH HOH A . 
K 5 HOH 274 974  202  HOH HOH A . 
K 5 HOH 275 975  358  HOH HOH A . 
K 5 HOH 276 976  131  HOH HOH A . 
K 5 HOH 277 977  61   HOH HOH A . 
K 5 HOH 278 978  392  HOH HOH A . 
K 5 HOH 279 979  181  HOH HOH A . 
K 5 HOH 280 980  40   HOH HOH A . 
K 5 HOH 281 981  51   HOH HOH A . 
K 5 HOH 282 982  826  HOH HOH A . 
K 5 HOH 283 983  336  HOH HOH A . 
K 5 HOH 284 984  1019 HOH HOH A . 
K 5 HOH 285 985  568  HOH HOH A . 
K 5 HOH 286 986  450  HOH HOH A . 
K 5 HOH 287 987  460  HOH HOH A . 
K 5 HOH 288 988  750  HOH HOH A . 
K 5 HOH 289 989  299  HOH HOH A . 
K 5 HOH 290 990  410  HOH HOH A . 
K 5 HOH 291 991  91   HOH HOH A . 
K 5 HOH 292 992  167  HOH HOH A . 
K 5 HOH 293 993  386  HOH HOH A . 
K 5 HOH 294 994  216  HOH HOH A . 
K 5 HOH 295 995  286  HOH HOH A . 
K 5 HOH 296 996  548  HOH HOH A . 
K 5 HOH 297 997  818  HOH HOH A . 
K 5 HOH 298 998  432  HOH HOH A . 
K 5 HOH 299 999  423  HOH HOH A . 
K 5 HOH 300 1000 998  HOH HOH A . 
K 5 HOH 301 1001 411  HOH HOH A . 
K 5 HOH 302 1002 106  HOH HOH A . 
K 5 HOH 303 1003 807  HOH HOH A . 
K 5 HOH 304 1004 475  HOH HOH A . 
K 5 HOH 305 1005 956  HOH HOH A . 
K 5 HOH 306 1006 519  HOH HOH A . 
K 5 HOH 307 1007 459  HOH HOH A . 
K 5 HOH 308 1008 256  HOH HOH A . 
K 5 HOH 309 1009 858  HOH HOH A . 
K 5 HOH 310 1010 639  HOH HOH A . 
K 5 HOH 311 1011 82   HOH HOH A . 
K 5 HOH 312 1012 436  HOH HOH A . 
K 5 HOH 313 1013 957  HOH HOH A . 
K 5 HOH 314 1014 45   HOH HOH A . 
K 5 HOH 315 1015 483  HOH HOH A . 
K 5 HOH 316 1016 174  HOH HOH A . 
K 5 HOH 317 1017 441  HOH HOH A . 
K 5 HOH 318 1018 139  HOH HOH A . 
K 5 HOH 319 1019 809  HOH HOH A . 
K 5 HOH 320 1020 74   HOH HOH A . 
K 5 HOH 321 1021 938  HOH HOH A . 
K 5 HOH 322 1022 92   HOH HOH A . 
K 5 HOH 323 1023 564  HOH HOH A . 
K 5 HOH 324 1024 306  HOH HOH A . 
K 5 HOH 325 1025 906  HOH HOH A . 
K 5 HOH 326 1026 329  HOH HOH A . 
K 5 HOH 327 1027 271  HOH HOH A . 
K 5 HOH 328 1028 843  HOH HOH A . 
K 5 HOH 329 1029 624  HOH HOH A . 
K 5 HOH 330 1030 510  HOH HOH A . 
K 5 HOH 331 1031 242  HOH HOH A . 
K 5 HOH 332 1032 387  HOH HOH A . 
K 5 HOH 333 1033 905  HOH HOH A . 
K 5 HOH 334 1034 562  HOH HOH A . 
K 5 HOH 335 1035 235  HOH HOH A . 
K 5 HOH 336 1036 831  HOH HOH A . 
K 5 HOH 337 1037 526  HOH HOH A . 
K 5 HOH 338 1038 586  HOH HOH A . 
K 5 HOH 339 1039 350  HOH HOH A . 
K 5 HOH 340 1040 695  HOH HOH A . 
K 5 HOH 341 1041 506  HOH HOH A . 
K 5 HOH 342 1042 618  HOH HOH A . 
K 5 HOH 343 1043 741  HOH HOH A . 
K 5 HOH 344 1044 1004 HOH HOH A . 
K 5 HOH 345 1045 696  HOH HOH A . 
K 5 HOH 346 1046 670  HOH HOH A . 
K 5 HOH 347 1047 491  HOH HOH A . 
K 5 HOH 348 1048 381  HOH HOH A . 
K 5 HOH 349 1049 327  HOH HOH A . 
K 5 HOH 350 1050 628  HOH HOH A . 
K 5 HOH 351 1051 512  HOH HOH A . 
K 5 HOH 352 1052 869  HOH HOH A . 
K 5 HOH 353 1053 910  HOH HOH A . 
K 5 HOH 354 1054 717  HOH HOH A . 
K 5 HOH 355 1055 918  HOH HOH A . 
K 5 HOH 356 1056 936  HOH HOH A . 
K 5 HOH 357 1057 533  HOH HOH A . 
K 5 HOH 358 1058 601  HOH HOH A . 
K 5 HOH 359 1059 747  HOH HOH A . 
K 5 HOH 360 1060 678  HOH HOH A . 
K 5 HOH 361 1061 576  HOH HOH A . 
K 5 HOH 362 1062 961  HOH HOH A . 
K 5 HOH 363 1063 159  HOH HOH A . 
K 5 HOH 364 1064 699  HOH HOH A . 
K 5 HOH 365 1065 856  HOH HOH A . 
K 5 HOH 366 1066 769  HOH HOH A . 
K 5 HOH 367 1067 803  HOH HOH A . 
K 5 HOH 368 1068 1009 HOH HOH A . 
K 5 HOH 369 1069 834  HOH HOH A . 
K 5 HOH 370 1070 777  HOH HOH A . 
K 5 HOH 371 1071 687  HOH HOH A . 
K 5 HOH 372 1072 480  HOH HOH A . 
K 5 HOH 373 1073 595  HOH HOH A . 
K 5 HOH 374 1074 986  HOH HOH A . 
K 5 HOH 375 1075 960  HOH HOH A . 
K 5 HOH 376 1076 754  HOH HOH A . 
K 5 HOH 377 1077 487  HOH HOH A . 
K 5 HOH 378 1078 733  HOH HOH A . 
K 5 HOH 379 1079 812  HOH HOH A . 
K 5 HOH 380 1080 974  HOH HOH A . 
K 5 HOH 381 1081 531  HOH HOH A . 
K 5 HOH 382 1082 874  HOH HOH A . 
K 5 HOH 383 1083 853  HOH HOH A . 
K 5 HOH 384 1084 968  HOH HOH A . 
K 5 HOH 385 1085 821  HOH HOH A . 
K 5 HOH 386 1086 973  HOH HOH A . 
K 5 HOH 387 1087 532  HOH HOH A . 
K 5 HOH 388 1088 453  HOH HOH A . 
K 5 HOH 389 1089 915  HOH HOH A . 
K 5 HOH 390 1090 669  HOH HOH A . 
K 5 HOH 391 1091 614  HOH HOH A . 
K 5 HOH 392 1092 790  HOH HOH A . 
K 5 HOH 393 1093 635  HOH HOH A . 
K 5 HOH 394 1094 965  HOH HOH A . 
K 5 HOH 395 1095 463  HOH HOH A . 
K 5 HOH 396 1096 925  HOH HOH A . 
K 5 HOH 397 1097 412  HOH HOH A . 
K 5 HOH 398 1098 546  HOH HOH A . 
K 5 HOH 399 1099 409  HOH HOH A . 
K 5 HOH 400 1100 341  HOH HOH A . 
K 5 HOH 401 1101 643  HOH HOH A . 
K 5 HOH 402 1102 394  HOH HOH A . 
K 5 HOH 403 1103 976  HOH HOH A . 
K 5 HOH 404 1104 408  HOH HOH A . 
K 5 HOH 405 1105 736  HOH HOH A . 
K 5 HOH 406 1106 573  HOH HOH A . 
K 5 HOH 407 1107 189  HOH HOH A . 
K 5 HOH 408 1108 707  HOH HOH A . 
K 5 HOH 409 1109 964  HOH HOH A . 
K 5 HOH 410 1110 377  HOH HOH A . 
K 5 HOH 411 1111 603  HOH HOH A . 
K 5 HOH 412 1112 845  HOH HOH A . 
K 5 HOH 413 1113 882  HOH HOH A . 
K 5 HOH 414 1114 700  HOH HOH A . 
K 5 HOH 415 1115 661  HOH HOH A . 
K 5 HOH 416 1116 943  HOH HOH A . 
K 5 HOH 417 1117 536  HOH HOH A . 
K 5 HOH 418 1118 778  HOH HOH A . 
K 5 HOH 419 1119 702  HOH HOH A . 
K 5 HOH 420 1120 508  HOH HOH A . 
K 5 HOH 421 1121 528  HOH HOH A . 
K 5 HOH 422 1122 833  HOH HOH A . 
K 5 HOH 423 1123 791  HOH HOH A . 
K 5 HOH 424 1124 645  HOH HOH A . 
K 5 HOH 425 1125 298  HOH HOH A . 
K 5 HOH 426 1126 226  HOH HOH A . 
K 5 HOH 427 1127 651  HOH HOH A . 
K 5 HOH 428 1128 742  HOH HOH A . 
K 5 HOH 429 1129 656  HOH HOH A . 
K 5 HOH 430 1130 596  HOH HOH A . 
K 5 HOH 431 1131 870  HOH HOH A . 
K 5 HOH 432 1132 897  HOH HOH A . 
K 5 HOH 433 1133 904  HOH HOH A . 
K 5 HOH 434 1134 914  HOH HOH A . 
K 5 HOH 435 1135 866  HOH HOH A . 
K 5 HOH 436 1136 585  HOH HOH A . 
K 5 HOH 437 1137 545  HOH HOH A . 
K 5 HOH 438 1138 547  HOH HOH A . 
K 5 HOH 439 1139 406  HOH HOH A . 
K 5 HOH 440 1140 721  HOH HOH A . 
K 5 HOH 441 1141 647  HOH HOH A . 
K 5 HOH 442 1142 996  HOH HOH A . 
K 5 HOH 443 1143 563  HOH HOH A . 
K 5 HOH 444 1144 345  HOH HOH A . 
K 5 HOH 445 1145 333  HOH HOH A . 
K 5 HOH 446 1146 757  HOH HOH A . 
K 5 HOH 447 1147 683  HOH HOH A . 
K 5 HOH 448 1148 864  HOH HOH A . 
K 5 HOH 449 1149 820  HOH HOH A . 
K 5 HOH 450 1150 774  HOH HOH A . 
K 5 HOH 451 1151 972  HOH HOH A . 
K 5 HOH 452 1152 952  HOH HOH A . 
K 5 HOH 453 1153 908  HOH HOH A . 
K 5 HOH 454 1154 709  HOH HOH A . 
K 5 HOH 455 1155 577  HOH HOH A . 
K 5 HOH 456 1156 764  HOH HOH A . 
K 5 HOH 457 1157 923  HOH HOH A . 
K 5 HOH 458 1158 801  HOH HOH A . 
K 5 HOH 459 1159 838  HOH HOH A . 
K 5 HOH 460 1160 517  HOH HOH A . 
K 5 HOH 461 1161 852  HOH HOH A . 
K 5 HOH 462 1162 447  HOH HOH A . 
K 5 HOH 463 1163 287  HOH HOH A . 
L 5 HOH 1   701  335  HOH HOH B . 
L 5 HOH 2   702  844  HOH HOH B . 
L 5 HOH 3   703  236  HOH HOH B . 
L 5 HOH 4   704  975  HOH HOH B . 
L 5 HOH 5   705  395  HOH HOH B . 
L 5 HOH 6   706  296  HOH HOH B . 
L 5 HOH 7   707  995  HOH HOH B . 
L 5 HOH 8   708  323  HOH HOH B . 
L 5 HOH 9   709  703  HOH HOH B . 
L 5 HOH 10  710  955  HOH HOH B . 
L 5 HOH 11  711  518  HOH HOH B . 
L 5 HOH 12  712  369  HOH HOH B . 
L 5 HOH 13  713  815  HOH HOH B . 
L 5 HOH 14  714  170  HOH HOH B . 
L 5 HOH 15  715  674  HOH HOH B . 
L 5 HOH 16  716  17   HOH HOH B . 
L 5 HOH 17  717  405  HOH HOH B . 
L 5 HOH 18  718  101  HOH HOH B . 
L 5 HOH 19  719  712  HOH HOH B . 
L 5 HOH 20  720  133  HOH HOH B . 
L 5 HOH 21  721  359  HOH HOH B . 
L 5 HOH 22  722  132  HOH HOH B . 
L 5 HOH 23  723  213  HOH HOH B . 
L 5 HOH 24  724  25   HOH HOH B . 
L 5 HOH 25  725  294  HOH HOH B . 
L 5 HOH 26  726  558  HOH HOH B . 
L 5 HOH 27  727  119  HOH HOH B . 
L 5 HOH 28  728  79   HOH HOH B . 
L 5 HOH 29  729  26   HOH HOH B . 
L 5 HOH 30  730  28   HOH HOH B . 
L 5 HOH 31  731  8    HOH HOH B . 
L 5 HOH 32  732  162  HOH HOH B . 
L 5 HOH 33  733  941  HOH HOH B . 
L 5 HOH 34  734  206  HOH HOH B . 
L 5 HOH 35  735  68   HOH HOH B . 
L 5 HOH 36  736  273  HOH HOH B . 
L 5 HOH 37  737  175  HOH HOH B . 
L 5 HOH 38  738  208  HOH HOH B . 
L 5 HOH 39  739  705  HOH HOH B . 
L 5 HOH 40  740  872  HOH HOH B . 
L 5 HOH 41  741  663  HOH HOH B . 
L 5 HOH 42  742  295  HOH HOH B . 
L 5 HOH 43  743  583  HOH HOH B . 
L 5 HOH 44  744  1021 HOH HOH B . 
L 5 HOH 45  745  594  HOH HOH B . 
L 5 HOH 46  746  268  HOH HOH B . 
L 5 HOH 47  747  348  HOH HOH B . 
L 5 HOH 48  748  190  HOH HOH B . 
L 5 HOH 49  749  147  HOH HOH B . 
L 5 HOH 50  750  326  HOH HOH B . 
L 5 HOH 51  751  428  HOH HOH B . 
L 5 HOH 52  752  1016 HOH HOH B . 
L 5 HOH 53  753  110  HOH HOH B . 
L 5 HOH 54  754  55   HOH HOH B . 
L 5 HOH 55  755  249  HOH HOH B . 
L 5 HOH 56  756  884  HOH HOH B . 
L 5 HOH 57  757  37   HOH HOH B . 
L 5 HOH 58  758  136  HOH HOH B . 
L 5 HOH 59  759  993  HOH HOH B . 
L 5 HOH 60  760  173  HOH HOH B . 
L 5 HOH 61  761  115  HOH HOH B . 
L 5 HOH 62  762  67   HOH HOH B . 
L 5 HOH 63  763  425  HOH HOH B . 
L 5 HOH 64  764  205  HOH HOH B . 
L 5 HOH 65  765  1003 HOH HOH B . 
L 5 HOH 66  766  530  HOH HOH B . 
L 5 HOH 67  767  88   HOH HOH B . 
L 5 HOH 68  768  525  HOH HOH B . 
L 5 HOH 69  769  1    HOH HOH B . 
L 5 HOH 70  770  234  HOH HOH B . 
L 5 HOH 71  771  253  HOH HOH B . 
L 5 HOH 72  772  859  HOH HOH B . 
L 5 HOH 73  773  171  HOH HOH B . 
L 5 HOH 74  774  575  HOH HOH B . 
L 5 HOH 75  775  440  HOH HOH B . 
L 5 HOH 76  776  23   HOH HOH B . 
L 5 HOH 77  777  231  HOH HOH B . 
L 5 HOH 78  778  66   HOH HOH B . 
L 5 HOH 79  779  39   HOH HOH B . 
L 5 HOH 80  780  935  HOH HOH B . 
L 5 HOH 81  781  587  HOH HOH B . 
L 5 HOH 82  782  933  HOH HOH B . 
L 5 HOH 83  783  75   HOH HOH B . 
L 5 HOH 84  784  928  HOH HOH B . 
L 5 HOH 85  785  130  HOH HOH B . 
L 5 HOH 86  786  321  HOH HOH B . 
L 5 HOH 87  787  15   HOH HOH B . 
L 5 HOH 88  788  93   HOH HOH B . 
L 5 HOH 89  789  849  HOH HOH B . 
L 5 HOH 90  790  397  HOH HOH B . 
L 5 HOH 91  791  100  HOH HOH B . 
L 5 HOH 92  792  118  HOH HOH B . 
L 5 HOH 93  793  625  HOH HOH B . 
L 5 HOH 94  794  337  HOH HOH B . 
L 5 HOH 95  795  493  HOH HOH B . 
L 5 HOH 96  796  120  HOH HOH B . 
L 5 HOH 97  797  34   HOH HOH B . 
L 5 HOH 98  798  403  HOH HOH B . 
L 5 HOH 99  799  983  HOH HOH B . 
L 5 HOH 100 800  27   HOH HOH B . 
L 5 HOH 101 801  1008 HOH HOH B . 
L 5 HOH 102 802  419  HOH HOH B . 
L 5 HOH 103 803  218  HOH HOH B . 
L 5 HOH 104 804  220  HOH HOH B . 
L 5 HOH 105 805  353  HOH HOH B . 
L 5 HOH 106 806  378  HOH HOH B . 
L 5 HOH 107 807  193  HOH HOH B . 
L 5 HOH 108 808  113  HOH HOH B . 
L 5 HOH 109 809  86   HOH HOH B . 
L 5 HOH 110 810  146  HOH HOH B . 
L 5 HOH 111 811  732  HOH HOH B . 
L 5 HOH 112 812  735  HOH HOH B . 
L 5 HOH 113 813  35   HOH HOH B . 
L 5 HOH 114 814  626  HOH HOH B . 
L 5 HOH 115 815  12   HOH HOH B . 
L 5 HOH 116 816  244  HOH HOH B . 
L 5 HOH 117 817  138  HOH HOH B . 
L 5 HOH 118 818  379  HOH HOH B . 
L 5 HOH 119 819  892  HOH HOH B . 
L 5 HOH 120 820  788  HOH HOH B . 
L 5 HOH 121 821  355  HOH HOH B . 
L 5 HOH 122 822  269  HOH HOH B . 
L 5 HOH 123 823  265  HOH HOH B . 
L 5 HOH 124 824  334  HOH HOH B . 
L 5 HOH 125 825  73   HOH HOH B . 
L 5 HOH 126 826  230  HOH HOH B . 
L 5 HOH 127 827  315  HOH HOH B . 
L 5 HOH 128 828  127  HOH HOH B . 
L 5 HOH 129 829  734  HOH HOH B . 
L 5 HOH 130 830  473  HOH HOH B . 
L 5 HOH 131 831  210  HOH HOH B . 
L 5 HOH 132 832  466  HOH HOH B . 
L 5 HOH 133 833  63   HOH HOH B . 
L 5 HOH 134 834  793  HOH HOH B . 
L 5 HOH 135 835  262  HOH HOH B . 
L 5 HOH 136 836  43   HOH HOH B . 
L 5 HOH 137 837  340  HOH HOH B . 
L 5 HOH 138 838  671  HOH HOH B . 
L 5 HOH 139 839  529  HOH HOH B . 
L 5 HOH 140 840  494  HOH HOH B . 
L 5 HOH 141 841  142  HOH HOH B . 
L 5 HOH 142 842  114  HOH HOH B . 
L 5 HOH 143 843  121  HOH HOH B . 
L 5 HOH 144 844  646  HOH HOH B . 
L 5 HOH 145 845  464  HOH HOH B . 
L 5 HOH 146 846  207  HOH HOH B . 
L 5 HOH 147 847  280  HOH HOH B . 
L 5 HOH 148 848  144  HOH HOH B . 
L 5 HOH 149 849  232  HOH HOH B . 
L 5 HOH 150 850  990  HOH HOH B . 
L 5 HOH 151 851  760  HOH HOH B . 
L 5 HOH 152 852  105  HOH HOH B . 
L 5 HOH 153 853  54   HOH HOH B . 
L 5 HOH 154 854  553  HOH HOH B . 
L 5 HOH 155 855  830  HOH HOH B . 
L 5 HOH 156 856  250  HOH HOH B . 
L 5 HOH 157 857  83   HOH HOH B . 
L 5 HOH 158 858  182  HOH HOH B . 
L 5 HOH 159 859  288  HOH HOH B . 
L 5 HOH 160 860  476  HOH HOH B . 
L 5 HOH 161 861  163  HOH HOH B . 
L 5 HOH 162 862  293  HOH HOH B . 
L 5 HOH 163 863  347  HOH HOH B . 
L 5 HOH 164 864  150  HOH HOH B . 
L 5 HOH 165 865  330  HOH HOH B . 
L 5 HOH 166 866  10   HOH HOH B . 
L 5 HOH 167 867  313  HOH HOH B . 
L 5 HOH 168 868  443  HOH HOH B . 
L 5 HOH 169 869  33   HOH HOH B . 
L 5 HOH 170 870  197  HOH HOH B . 
L 5 HOH 171 871  224  HOH HOH B . 
L 5 HOH 172 872  275  HOH HOH B . 
L 5 HOH 173 873  380  HOH HOH B . 
L 5 HOH 174 874  31   HOH HOH B . 
L 5 HOH 175 875  842  HOH HOH B . 
L 5 HOH 176 876  229  HOH HOH B . 
L 5 HOH 177 877  385  HOH HOH B . 
L 5 HOH 178 878  633  HOH HOH B . 
L 5 HOH 179 879  357  HOH HOH B . 
L 5 HOH 180 880  738  HOH HOH B . 
L 5 HOH 181 881  166  HOH HOH B . 
L 5 HOH 182 882  429  HOH HOH B . 
L 5 HOH 183 883  191  HOH HOH B . 
L 5 HOH 184 884  490  HOH HOH B . 
L 5 HOH 185 885  238  HOH HOH B . 
L 5 HOH 186 886  782  HOH HOH B . 
L 5 HOH 187 887  322  HOH HOH B . 
L 5 HOH 188 888  795  HOH HOH B . 
L 5 HOH 189 889  140  HOH HOH B . 
L 5 HOH 190 890  179  HOH HOH B . 
L 5 HOH 191 891  99   HOH HOH B . 
L 5 HOH 192 892  16   HOH HOH B . 
L 5 HOH 193 893  176  HOH HOH B . 
L 5 HOH 194 894  263  HOH HOH B . 
L 5 HOH 195 895  116  HOH HOH B . 
L 5 HOH 196 896  800  HOH HOH B . 
L 5 HOH 197 897  431  HOH HOH B . 
L 5 HOH 198 898  221  HOH HOH B . 
L 5 HOH 199 899  609  HOH HOH B . 
L 5 HOH 200 900  1022 HOH HOH B . 
L 5 HOH 201 901  154  HOH HOH B . 
L 5 HOH 202 902  186  HOH HOH B . 
L 5 HOH 203 903  413  HOH HOH B . 
L 5 HOH 204 904  255  HOH HOH B . 
L 5 HOH 205 905  516  HOH HOH B . 
L 5 HOH 206 906  567  HOH HOH B . 
L 5 HOH 207 907  912  HOH HOH B . 
L 5 HOH 208 908  654  HOH HOH B . 
L 5 HOH 209 909  368  HOH HOH B . 
L 5 HOH 210 910  41   HOH HOH B . 
L 5 HOH 211 911  18   HOH HOH B . 
L 5 HOH 212 912  276  HOH HOH B . 
L 5 HOH 213 913  192  HOH HOH B . 
L 5 HOH 214 914  612  HOH HOH B . 
L 5 HOH 215 915  895  HOH HOH B . 
L 5 HOH 216 916  365  HOH HOH B . 
L 5 HOH 217 917  714  HOH HOH B . 
L 5 HOH 218 918  455  HOH HOH B . 
L 5 HOH 219 919  77   HOH HOH B . 
L 5 HOH 220 920  535  HOH HOH B . 
L 5 HOH 221 921  991  HOH HOH B . 
L 5 HOH 222 922  448  HOH HOH B . 
L 5 HOH 223 923  630  HOH HOH B . 
L 5 HOH 224 924  819  HOH HOH B . 
L 5 HOH 225 925  579  HOH HOH B . 
L 5 HOH 226 926  442  HOH HOH B . 
L 5 HOH 227 927  11   HOH HOH B . 
L 5 HOH 228 928  338  HOH HOH B . 
L 5 HOH 229 929  710  HOH HOH B . 
L 5 HOH 230 930  461  HOH HOH B . 
L 5 HOH 231 931  391  HOH HOH B . 
L 5 HOH 232 932  482  HOH HOH B . 
L 5 HOH 233 933  589  HOH HOH B . 
L 5 HOH 234 934  310  HOH HOH B . 
L 5 HOH 235 935  899  HOH HOH B . 
L 5 HOH 236 936  87   HOH HOH B . 
L 5 HOH 237 937  168  HOH HOH B . 
L 5 HOH 238 938  78   HOH HOH B . 
L 5 HOH 239 939  825  HOH HOH B . 
L 5 HOH 240 940  470  HOH HOH B . 
L 5 HOH 241 941  228  HOH HOH B . 
L 5 HOH 242 942  332  HOH HOH B . 
L 5 HOH 243 943  183  HOH HOH B . 
L 5 HOH 244 944  129  HOH HOH B . 
L 5 HOH 245 945  282  HOH HOH B . 
L 5 HOH 246 946  688  HOH HOH B . 
L 5 HOH 247 947  537  HOH HOH B . 
L 5 HOH 248 948  434  HOH HOH B . 
L 5 HOH 249 949  108  HOH HOH B . 
L 5 HOH 250 950  312  HOH HOH B . 
L 5 HOH 251 951  496  HOH HOH B . 
L 5 HOH 252 952  746  HOH HOH B . 
L 5 HOH 253 953  60   HOH HOH B . 
L 5 HOH 254 954  622  HOH HOH B . 
L 5 HOH 255 955  264  HOH HOH B . 
L 5 HOH 256 956  169  HOH HOH B . 
L 5 HOH 257 957  932  HOH HOH B . 
L 5 HOH 258 958  1011 HOH HOH B . 
L 5 HOH 259 959  552  HOH HOH B . 
L 5 HOH 260 960  767  HOH HOH B . 
L 5 HOH 261 961  430  HOH HOH B . 
L 5 HOH 262 962  305  HOH HOH B . 
L 5 HOH 263 963  806  HOH HOH B . 
L 5 HOH 264 964  424  HOH HOH B . 
L 5 HOH 265 965  57   HOH HOH B . 
L 5 HOH 266 966  128  HOH HOH B . 
L 5 HOH 267 967  143  HOH HOH B . 
L 5 HOH 268 968  720  HOH HOH B . 
L 5 HOH 269 969  497  HOH HOH B . 
L 5 HOH 270 970  478  HOH HOH B . 
L 5 HOH 271 971  284  HOH HOH B . 
L 5 HOH 272 972  95   HOH HOH B . 
L 5 HOH 273 973  538  HOH HOH B . 
L 5 HOH 274 974  629  HOH HOH B . 
L 5 HOH 275 975  814  HOH HOH B . 
L 5 HOH 276 976  325  HOH HOH B . 
L 5 HOH 277 977  894  HOH HOH B . 
L 5 HOH 278 978  36   HOH HOH B . 
L 5 HOH 279 979  946  HOH HOH B . 
L 5 HOH 280 980  745  HOH HOH B . 
L 5 HOH 281 981  103  HOH HOH B . 
L 5 HOH 282 982  342  HOH HOH B . 
L 5 HOH 283 983  479  HOH HOH B . 
L 5 HOH 284 984  730  HOH HOH B . 
L 5 HOH 285 985  485  HOH HOH B . 
L 5 HOH 286 986  252  HOH HOH B . 
L 5 HOH 287 987  511  HOH HOH B . 
L 5 HOH 288 988  354  HOH HOH B . 
L 5 HOH 289 989  362  HOH HOH B . 
L 5 HOH 290 990  285  HOH HOH B . 
L 5 HOH 291 991  644  HOH HOH B . 
L 5 HOH 292 992  427  HOH HOH B . 
L 5 HOH 293 993  679  HOH HOH B . 
L 5 HOH 294 994  324  HOH HOH B . 
L 5 HOH 295 995  373  HOH HOH B . 
L 5 HOH 296 996  102  HOH HOH B . 
L 5 HOH 297 997  456  HOH HOH B . 
L 5 HOH 298 998  706  HOH HOH B . 
L 5 HOH 299 999  692  HOH HOH B . 
L 5 HOH 300 1000 260  HOH HOH B . 
L 5 HOH 301 1001 445  HOH HOH B . 
L 5 HOH 302 1002 988  HOH HOH B . 
L 5 HOH 303 1003 550  HOH HOH B . 
L 5 HOH 304 1004 570  HOH HOH B . 
L 5 HOH 305 1005 104  HOH HOH B . 
L 5 HOH 306 1006 449  HOH HOH B . 
L 5 HOH 307 1007 921  HOH HOH B . 
L 5 HOH 308 1008 616  HOH HOH B . 
L 5 HOH 309 1009 592  HOH HOH B . 
L 5 HOH 310 1010 911  HOH HOH B . 
L 5 HOH 311 1011 569  HOH HOH B . 
L 5 HOH 312 1012 156  HOH HOH B . 
L 5 HOH 313 1013 117  HOH HOH B . 
L 5 HOH 314 1014 862  HOH HOH B . 
L 5 HOH 315 1015 698  HOH HOH B . 
L 5 HOH 316 1016 201  HOH HOH B . 
L 5 HOH 317 1017 992  HOH HOH B . 
L 5 HOH 318 1018 370  HOH HOH B . 
L 5 HOH 319 1019 47   HOH HOH B . 
L 5 HOH 320 1020 484  HOH HOH B . 
L 5 HOH 321 1021 582  HOH HOH B . 
L 5 HOH 322 1022 215  HOH HOH B . 
L 5 HOH 323 1023 621  HOH HOH B . 
L 5 HOH 324 1024 89   HOH HOH B . 
L 5 HOH 325 1025 873  HOH HOH B . 
L 5 HOH 326 1026 571  HOH HOH B . 
L 5 HOH 327 1027 887  HOH HOH B . 
L 5 HOH 328 1028 642  HOH HOH B . 
L 5 HOH 329 1029 1014 HOH HOH B . 
L 5 HOH 330 1030 565  HOH HOH B . 
L 5 HOH 331 1031 686  HOH HOH B . 
L 5 HOH 332 1032 662  HOH HOH B . 
L 5 HOH 333 1033 277  HOH HOH B . 
L 5 HOH 334 1034 462  HOH HOH B . 
L 5 HOH 335 1035 994  HOH HOH B . 
L 5 HOH 336 1036 543  HOH HOH B . 
L 5 HOH 337 1037 798  HOH HOH B . 
L 5 HOH 338 1038 725  HOH HOH B . 
L 5 HOH 339 1039 304  HOH HOH B . 
L 5 HOH 340 1040 290  HOH HOH B . 
L 5 HOH 341 1041 783  HOH HOH B . 
L 5 HOH 342 1042 1002 HOH HOH B . 
L 5 HOH 343 1043 877  HOH HOH B . 
L 5 HOH 344 1044 1018 HOH HOH B . 
L 5 HOH 345 1045 349  HOH HOH B . 
L 5 HOH 346 1046 680  HOH HOH B . 
L 5 HOH 347 1047 539  HOH HOH B . 
L 5 HOH 348 1048 704  HOH HOH B . 
L 5 HOH 349 1049 920  HOH HOH B . 
L 5 HOH 350 1050 499  HOH HOH B . 
L 5 HOH 351 1051 241  HOH HOH B . 
L 5 HOH 352 1052 404  HOH HOH B . 
L 5 HOH 353 1053 520  HOH HOH B . 
L 5 HOH 354 1054 513  HOH HOH B . 
L 5 HOH 355 1055 384  HOH HOH B . 
L 5 HOH 356 1056 632  HOH HOH B . 
L 5 HOH 357 1057 200  HOH HOH B . 
L 5 HOH 358 1058 719  HOH HOH B . 
L 5 HOH 359 1059 865  HOH HOH B . 
L 5 HOH 360 1060 549  HOH HOH B . 
L 5 HOH 361 1061 823  HOH HOH B . 
L 5 HOH 362 1062 675  HOH HOH B . 
L 5 HOH 363 1063 685  HOH HOH B . 
L 5 HOH 364 1064 653  HOH HOH B . 
L 5 HOH 365 1065 149  HOH HOH B . 
L 5 HOH 366 1066 909  HOH HOH B . 
L 5 HOH 367 1067 794  HOH HOH B . 
L 5 HOH 368 1068 985  HOH HOH B . 
L 5 HOH 369 1069 756  HOH HOH B . 
L 5 HOH 370 1070 593  HOH HOH B . 
L 5 HOH 371 1071 868  HOH HOH B . 
L 5 HOH 372 1072 634  HOH HOH B . 
L 5 HOH 373 1073 666  HOH HOH B . 
L 5 HOH 374 1074 652  HOH HOH B . 
L 5 HOH 375 1075 367  HOH HOH B . 
L 5 HOH 376 1076 376  HOH HOH B . 
L 5 HOH 377 1077 668  HOH HOH B . 
L 5 HOH 378 1078 997  HOH HOH B . 
L 5 HOH 379 1079 690  HOH HOH B . 
L 5 HOH 380 1080 556  HOH HOH B . 
L 5 HOH 381 1081 947  HOH HOH B . 
L 5 HOH 382 1082 523  HOH HOH B . 
L 5 HOH 383 1083 650  HOH HOH B . 
L 5 HOH 384 1084 771  HOH HOH B . 
L 5 HOH 385 1085 949  HOH HOH B . 
L 5 HOH 386 1086 1015 HOH HOH B . 
L 5 HOH 387 1087 677  HOH HOH B . 
L 5 HOH 388 1088 393  HOH HOH B . 
L 5 HOH 389 1089 414  HOH HOH B . 
L 5 HOH 390 1090 881  HOH HOH B . 
L 5 HOH 391 1091 847  HOH HOH B . 
L 5 HOH 392 1092 1000 HOH HOH B . 
L 5 HOH 393 1093 554  HOH HOH B . 
L 5 HOH 394 1094 588  HOH HOH B . 
L 5 HOH 395 1095 665  HOH HOH B . 
L 5 HOH 396 1096 917  HOH HOH B . 
L 5 HOH 397 1097 602  HOH HOH B . 
L 5 HOH 398 1098 457  HOH HOH B . 
L 5 HOH 399 1099 540  HOH HOH B . 
L 5 HOH 400 1100 737  HOH HOH B . 
L 5 HOH 401 1101 574  HOH HOH B . 
L 5 HOH 402 1102 584  HOH HOH B . 
L 5 HOH 403 1103 883  HOH HOH B . 
L 5 HOH 404 1104 261  HOH HOH B . 
L 5 HOH 405 1105 708  HOH HOH B . 
L 5 HOH 406 1106 1010 HOH HOH B . 
L 5 HOH 407 1107 233  HOH HOH B . 
L 5 HOH 408 1108 689  HOH HOH B . 
L 5 HOH 409 1109 876  HOH HOH B . 
L 5 HOH 410 1110 773  HOH HOH B . 
L 5 HOH 411 1111 848  HOH HOH B . 
L 5 HOH 412 1112 948  HOH HOH B . 
L 5 HOH 413 1113 446  HOH HOH B . 
L 5 HOH 414 1114 931  HOH HOH B . 
L 5 HOH 415 1115 711  HOH HOH B . 
L 5 HOH 416 1116 501  HOH HOH B . 
L 5 HOH 417 1117 580  HOH HOH B . 
L 5 HOH 418 1118 607  HOH HOH B . 
L 5 HOH 419 1119 598  HOH HOH B . 
L 5 HOH 420 1120 879  HOH HOH B . 
L 5 HOH 421 1121 319  HOH HOH B . 
L 5 HOH 422 1122 722  HOH HOH B . 
L 5 HOH 423 1123 684  HOH HOH B . 
L 5 HOH 424 1124 888  HOH HOH B . 
L 5 HOH 425 1125 999  HOH HOH B . 
L 5 HOH 426 1126 542  HOH HOH B . 
L 5 HOH 427 1127 835  HOH HOH B . 
L 5 HOH 428 1128 827  HOH HOH B . 
L 5 HOH 429 1129 889  HOH HOH B . 
L 5 HOH 430 1130 953  HOH HOH B . 
L 5 HOH 431 1131 755  HOH HOH B . 
L 5 HOH 432 1132 693  HOH HOH B . 
L 5 HOH 433 1133 407  HOH HOH B . 
L 5 HOH 434 1134 667  HOH HOH B . 
L 5 HOH 435 1135 320  HOH HOH B . 
L 5 HOH 436 1136 437  HOH HOH B . 
L 5 HOH 437 1137 934  HOH HOH B . 
L 5 HOH 438 1138 590  HOH HOH B . 
L 5 HOH 439 1139 898  HOH HOH B . 
L 5 HOH 440 1140 841  HOH HOH B . 
L 5 HOH 441 1141 498  HOH HOH B . 
L 5 HOH 442 1142 810  HOH HOH B . 
L 5 HOH 443 1143 505  HOH HOH B . 
L 5 HOH 444 1144 890  HOH HOH B . 
L 5 HOH 445 1145 488  HOH HOH B . 
L 5 HOH 446 1146 855  HOH HOH B . 
L 5 HOH 447 1147 610  HOH HOH B . 
L 5 HOH 448 1148 768  HOH HOH B . 
L 5 HOH 449 1149 691  HOH HOH B . 
L 5 HOH 450 1150 751  HOH HOH B . 
L 5 HOH 451 1151 944  HOH HOH B . 
L 5 HOH 452 1152 749  HOH HOH B . 
L 5 HOH 453 1153 896  HOH HOH B . 
L 5 HOH 454 1154 744  HOH HOH B . 
L 5 HOH 455 1155 871  HOH HOH B . 
L 5 HOH 456 1156 927  HOH HOH B . 
L 5 HOH 457 1157 356  HOH HOH B . 
L 5 HOH 458 1158 701  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L 
2 1 A,C,D,E,F,G,K           
2 2 B,H,I,J,L               
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2710  ? 
1 MORE         -7    ? 
1 'SSA (A^2)'  38870 ? 
2 'ABSA (A^2)' 3410  ? 
2 MORE         -17   ? 
2 'SSA (A^2)'  38180 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 2_655 -y+1,x-y,z+1/3 -0.5000000000 -0.8660254038 0.0000000000 124.4420000000 0.8660254038 
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 43.2680000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-05-29 
2 'Structure model' 1 1 2019-06-12 
3 'Structure model' 1 2 2019-07-17 
4 'Structure model' 1 3 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Data collection'            
4 3 'Structure model' 'Database references'        
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 3 'Structure model' citation           
4 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_DOI'           
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
3 2 'Structure model' '_citation.title'                          
4 2 'Structure model' '_citation_author.identifier_ORCID'        
5 3 'Structure model' '_citation.journal_volume'                 
6 3 'Structure model' '_citation.page_first'                     
7 3 'Structure model' '_citation.page_last'                      
8 3 'Structure model' '_citation.title'                          
9 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10.1_2155)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .               2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .               3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .               4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 80.88   -1.55   
2  1 ALA A 167 ? ? -152.92 78.87   
3  1 SER A 203 ? ? 51.91   -117.94 
4  1 ASP A 306 ? ? -104.52 -84.85  
5  1 HIS A 387 ? ? -141.54 55.64   
6  1 VAL A 407 ? ? -127.03 -59.73  
7  1 ASP A 494 ? ? -50.10  108.87  
8  1 SER B 203 ? ? 53.87   -116.02 
9  1 ASP B 306 ? ? -96.53  -87.09  
10 1 VAL B 407 ? ? -125.90 -59.15  
11 1 ALA B 542 ? ? -78.81  20.30   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1162 ? 5.87 . 
2 1 O ? A HOH 1163 ? 6.17 . 
3 1 O ? B HOH 1158 ? 5.82 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A PRO -1  ? A PRO 2   
3  1 Y 1 A LEU 0   ? A LEU 3   
4  1 Y 1 A GLU 1   ? A GLU 4   
5  1 Y 1 A GLY 2   ? A GLY 5   
6  1 Y 1 A ARG 3   ? A ARG 6   
7  1 Y 1 A ASP 544 ? A ASP 547 
8  1 Y 1 A THR 545 ? A THR 548 
9  1 Y 1 A LEU 546 ? A LEU 549 
10 1 Y 1 A ASP 547 ? A ASP 550 
11 1 Y 1 B GLY -2  ? B GLY 1   
12 1 Y 1 B PRO -1  ? B PRO 2   
13 1 Y 1 B LEU 0   ? B LEU 3   
14 1 Y 1 B GLU 1   ? B GLU 4   
15 1 Y 1 B GLY 2   ? B GLY 5   
16 1 Y 1 B ARG 3   ? B ARG 6   
17 1 Y 1 B ASP 544 ? B ASP 547 
18 1 Y 1 B THR 545 ? B THR 548 
19 1 Y 1 B LEU 546 ? B LEU 549 
20 1 Y 1 B ASP 547 ? B ASP 550 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           1U01NS083451 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' LND 
3 'NITRATE ION'                                                                          NO3 
4 GLYCEROL                                                                               GOL 
5 water                                                                                  HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#