data_6O66
# 
_entry.id   6O66 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6O66         
WWPDB D_1000240095 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6o5r unspecified 
PDB . 6o5s unspecified 
PDB . 6o5v unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6O66 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gerlits, O.'    1 ? 
'Kovalevsky, A.' 2 ? 
'Radic, Z.'      3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            294 
_citation.language                  ? 
_citation.page_first                10607 
_citation.page_last                 10618 
_citation.title                     
;Productive reorientation of a bound oxime reactivator revealed in room temperature X-ray structures of native and VX-inhibited human acetylcholinesterase.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA119.008725 
_citation.pdbx_database_id_PubMed   31138650 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gerlits, O.'      1 ?                   
primary 'Kong, X.'         2 ?                   
primary 'Cheng, X.'        3 ?                   
primary 'Wymore, T.'       4 ?                   
primary 'Blumenthal, D.K.' 5 0000-0002-8614-1167 
primary 'Taylor, P.'       6 0000-0002-3081-131X 
primary 'Radic, Z.'        7 ?                   
primary 'Kovalevsky, A.'   8 0000-0003-4459-9142 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6O66 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     124.375 
_cell.length_a_esd                 ? 
_cell.length_b                     124.375 
_cell.length_b_esd                 ? 
_cell.length_c                     129.304 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6O66 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                   60394.031 2   3.1.1.7 ? ? 
? 
2 non-polymer syn '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' 274.298   2   ?       ? ? 
? 
3 non-polymer syn GLYCEROL                                                                               92.094    10  ?       ? ? 
? 
4 water       nat water                                                                                  18.015    231 ?       ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGE(SVX)AGAASVGMHLLSPPSRGLFHRAVLQSGAPN
GPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPE
ALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPAR
LREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFA
QRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLU n 
1 5   GLY n 
1 6   ARG n 
1 7   GLU n 
1 8   ASP n 
1 9   ALA n 
1 10  GLU n 
1 11  LEU n 
1 12  LEU n 
1 13  VAL n 
1 14  THR n 
1 15  VAL n 
1 16  ARG n 
1 17  GLY n 
1 18  GLY n 
1 19  ARG n 
1 20  LEU n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  ARG n 
1 25  LEU n 
1 26  LYS n 
1 27  THR n 
1 28  PRO n 
1 29  GLY n 
1 30  GLY n 
1 31  PRO n 
1 32  VAL n 
1 33  SER n 
1 34  ALA n 
1 35  PHE n 
1 36  LEU n 
1 37  GLY n 
1 38  ILE n 
1 39  PRO n 
1 40  PHE n 
1 41  ALA n 
1 42  GLU n 
1 43  PRO n 
1 44  PRO n 
1 45  MET n 
1 46  GLY n 
1 47  PRO n 
1 48  ARG n 
1 49  ARG n 
1 50  PHE n 
1 51  LEU n 
1 52  PRO n 
1 53  PRO n 
1 54  GLU n 
1 55  PRO n 
1 56  LYS n 
1 57  GLN n 
1 58  PRO n 
1 59  TRP n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  VAL n 
1 64  ASP n 
1 65  ALA n 
1 66  THR n 
1 67  THR n 
1 68  PHE n 
1 69  GLN n 
1 70  SER n 
1 71  VAL n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  TYR n 
1 76  VAL n 
1 77  ASP n 
1 78  THR n 
1 79  LEU n 
1 80  TYR n 
1 81  PRO n 
1 82  GLY n 
1 83  PHE n 
1 84  GLU n 
1 85  GLY n 
1 86  THR n 
1 87  GLU n 
1 88  MET n 
1 89  TRP n 
1 90  ASN n 
1 91  PRO n 
1 92  ASN n 
1 93  ARG n 
1 94  GLU n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  ASP n 
1 99  CYS n 
1 100 LEU n 
1 101 TYR n 
1 102 LEU n 
1 103 ASN n 
1 104 VAL n 
1 105 TRP n 
1 106 THR n 
1 107 PRO n 
1 108 TYR n 
1 109 PRO n 
1 110 ARG n 
1 111 PRO n 
1 112 THR n 
1 113 SER n 
1 114 PRO n 
1 115 THR n 
1 116 PRO n 
1 117 VAL n 
1 118 LEU n 
1 119 VAL n 
1 120 TRP n 
1 121 ILE n 
1 122 TYR n 
1 123 GLY n 
1 124 GLY n 
1 125 GLY n 
1 126 PHE n 
1 127 TYR n 
1 128 SER n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 SER n 
1 133 LEU n 
1 134 ASP n 
1 135 VAL n 
1 136 TYR n 
1 137 ASP n 
1 138 GLY n 
1 139 ARG n 
1 140 PHE n 
1 141 LEU n 
1 142 VAL n 
1 143 GLN n 
1 144 ALA n 
1 145 GLU n 
1 146 ARG n 
1 147 THR n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 SER n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ARG n 
1 156 VAL n 
1 157 GLY n 
1 158 ALA n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 LEU n 
1 163 ALA n 
1 164 LEU n 
1 165 PRO n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 GLU n 
1 170 ALA n 
1 171 PRO n 
1 172 GLY n 
1 173 ASN n 
1 174 VAL n 
1 175 GLY n 
1 176 LEU n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 ARG n 
1 181 LEU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 TRP n 
1 186 VAL n 
1 187 GLN n 
1 188 GLU n 
1 189 ASN n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 GLY n 
1 195 GLY n 
1 196 ASP n 
1 197 PRO n 
1 198 THR n 
1 199 SER n 
1 200 VAL n 
1 201 THR n 
1 202 LEU n 
1 203 PHE n 
1 204 GLY n 
1 205 GLU n 
1 206 SVX n 
1 207 ALA n 
1 208 GLY n 
1 209 ALA n 
1 210 ALA n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 MET n 
1 215 HIS n 
1 216 LEU n 
1 217 LEU n 
1 218 SER n 
1 219 PRO n 
1 220 PRO n 
1 221 SER n 
1 222 ARG n 
1 223 GLY n 
1 224 LEU n 
1 225 PHE n 
1 226 HIS n 
1 227 ARG n 
1 228 ALA n 
1 229 VAL n 
1 230 LEU n 
1 231 GLN n 
1 232 SER n 
1 233 GLY n 
1 234 ALA n 
1 235 PRO n 
1 236 ASN n 
1 237 GLY n 
1 238 PRO n 
1 239 TRP n 
1 240 ALA n 
1 241 THR n 
1 242 VAL n 
1 243 GLY n 
1 244 MET n 
1 245 GLY n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 ARG n 
1 250 ARG n 
1 251 ALA n 
1 252 THR n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 HIS n 
1 257 LEU n 
1 258 VAL n 
1 259 GLY n 
1 260 CYS n 
1 261 PRO n 
1 262 PRO n 
1 263 GLY n 
1 264 GLY n 
1 265 THR n 
1 266 GLY n 
1 267 GLY n 
1 268 ASN n 
1 269 ASP n 
1 270 THR n 
1 271 GLU n 
1 272 LEU n 
1 273 VAL n 
1 274 ALA n 
1 275 CYS n 
1 276 LEU n 
1 277 ARG n 
1 278 THR n 
1 279 ARG n 
1 280 PRO n 
1 281 ALA n 
1 282 GLN n 
1 283 VAL n 
1 284 LEU n 
1 285 VAL n 
1 286 ASN n 
1 287 HIS n 
1 288 GLU n 
1 289 TRP n 
1 290 HIS n 
1 291 VAL n 
1 292 LEU n 
1 293 PRO n 
1 294 GLN n 
1 295 GLU n 
1 296 SER n 
1 297 VAL n 
1 298 PHE n 
1 299 ARG n 
1 300 PHE n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 PRO n 
1 305 VAL n 
1 306 VAL n 
1 307 ASP n 
1 308 GLY n 
1 309 ASP n 
1 310 PHE n 
1 311 LEU n 
1 312 SER n 
1 313 ASP n 
1 314 THR n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 LEU n 
1 319 ILE n 
1 320 ASN n 
1 321 ALA n 
1 322 GLY n 
1 323 ASP n 
1 324 PHE n 
1 325 HIS n 
1 326 GLY n 
1 327 LEU n 
1 328 GLN n 
1 329 VAL n 
1 330 LEU n 
1 331 VAL n 
1 332 GLY n 
1 333 VAL n 
1 334 VAL n 
1 335 LYS n 
1 336 ASP n 
1 337 GLU n 
1 338 GLY n 
1 339 SER n 
1 340 TYR n 
1 341 PHE n 
1 342 LEU n 
1 343 VAL n 
1 344 TYR n 
1 345 GLY n 
1 346 ALA n 
1 347 PRO n 
1 348 GLY n 
1 349 PHE n 
1 350 SER n 
1 351 LYS n 
1 352 ASP n 
1 353 ASN n 
1 354 GLU n 
1 355 SER n 
1 356 LEU n 
1 357 ILE n 
1 358 SER n 
1 359 ARG n 
1 360 ALA n 
1 361 GLU n 
1 362 PHE n 
1 363 LEU n 
1 364 ALA n 
1 365 GLY n 
1 366 VAL n 
1 367 ARG n 
1 368 VAL n 
1 369 GLY n 
1 370 VAL n 
1 371 PRO n 
1 372 GLN n 
1 373 VAL n 
1 374 SER n 
1 375 ASP n 
1 376 LEU n 
1 377 ALA n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 LEU n 
1 384 HIS n 
1 385 TYR n 
1 386 THR n 
1 387 ASP n 
1 388 TRP n 
1 389 LEU n 
1 390 HIS n 
1 391 PRO n 
1 392 GLU n 
1 393 ASP n 
1 394 PRO n 
1 395 ALA n 
1 396 ARG n 
1 397 LEU n 
1 398 ARG n 
1 399 GLU n 
1 400 ALA n 
1 401 LEU n 
1 402 SER n 
1 403 ASP n 
1 404 VAL n 
1 405 VAL n 
1 406 GLY n 
1 407 ASP n 
1 408 HIS n 
1 409 ASN n 
1 410 VAL n 
1 411 VAL n 
1 412 CYS n 
1 413 PRO n 
1 414 VAL n 
1 415 ALA n 
1 416 GLN n 
1 417 LEU n 
1 418 ALA n 
1 419 GLY n 
1 420 ARG n 
1 421 LEU n 
1 422 ALA n 
1 423 ALA n 
1 424 GLN n 
1 425 GLY n 
1 426 ALA n 
1 427 ARG n 
1 428 VAL n 
1 429 TYR n 
1 430 ALA n 
1 431 TYR n 
1 432 VAL n 
1 433 PHE n 
1 434 GLU n 
1 435 HIS n 
1 436 ARG n 
1 437 ALA n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 SER n 
1 442 TRP n 
1 443 PRO n 
1 444 LEU n 
1 445 TRP n 
1 446 MET n 
1 447 GLY n 
1 448 VAL n 
1 449 PRO n 
1 450 HIS n 
1 451 GLY n 
1 452 TYR n 
1 453 GLU n 
1 454 ILE n 
1 455 GLU n 
1 456 PHE n 
1 457 ILE n 
1 458 PHE n 
1 459 GLY n 
1 460 ILE n 
1 461 PRO n 
1 462 LEU n 
1 463 ASP n 
1 464 PRO n 
1 465 SER n 
1 466 ARG n 
1 467 ASN n 
1 468 TYR n 
1 469 THR n 
1 470 ALA n 
1 471 GLU n 
1 472 GLU n 
1 473 LYS n 
1 474 ILE n 
1 475 PHE n 
1 476 ALA n 
1 477 GLN n 
1 478 ARG n 
1 479 LEU n 
1 480 MET n 
1 481 ARG n 
1 482 TYR n 
1 483 TRP n 
1 484 ALA n 
1 485 ASN n 
1 486 PHE n 
1 487 ALA n 
1 488 ARG n 
1 489 THR n 
1 490 GLY n 
1 491 ASP n 
1 492 PRO n 
1 493 ASN n 
1 494 GLU n 
1 495 PRO n 
1 496 ARG n 
1 497 ASP n 
1 498 PRO n 
1 499 LYS n 
1 500 ALA n 
1 501 PRO n 
1 502 GLN n 
1 503 TRP n 
1 504 PRO n 
1 505 PRO n 
1 506 TYR n 
1 507 THR n 
1 508 ALA n 
1 509 GLY n 
1 510 ALA n 
1 511 GLN n 
1 512 GLN n 
1 513 TYR n 
1 514 VAL n 
1 515 SER n 
1 516 LEU n 
1 517 ASP n 
1 518 LEU n 
1 519 ARG n 
1 520 PRO n 
1 521 LEU n 
1 522 GLU n 
1 523 VAL n 
1 524 ARG n 
1 525 ARG n 
1 526 GLY n 
1 527 LEU n 
1 528 ARG n 
1 529 ALA n 
1 530 GLN n 
1 531 ALA n 
1 532 CYS n 
1 533 ALA n 
1 534 PHE n 
1 535 TRP n 
1 536 ASN n 
1 537 ARG n 
1 538 PHE n 
1 539 LEU n 
1 540 PRO n 
1 541 LYS n 
1 542 LEU n 
1 543 LEU n 
1 544 SER n 
1 545 ALA n 
1 546 THR n 
1 547 ASP n 
1 548 THR n 
1 549 LEU n 
1 550 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   550 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6O66 A 4 ? 550 ? P22303 32 ? 578 ? 1 547 
2 1 6O66 B 4 ? 550 ? P22303 32 ? 578 ? 1 547 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6O66 GLY A 1 ? UNP P22303 ? ? 'expression tag' -2 1 
1 6O66 PRO A 2 ? UNP P22303 ? ? 'expression tag' -1 2 
1 6O66 LEU A 3 ? UNP P22303 ? ? 'expression tag' 0  3 
2 6O66 GLY B 1 ? UNP P22303 ? ? 'expression tag' -2 4 
2 6O66 PRO B 2 ? UNP P22303 ? ? 'expression tag' -1 5 
2 6O66 LEU B 3 ? UNP P22303 ? ? 'expression tag' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                               ? 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ? 'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                                                               
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                  ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                ? 'C6 H13 N O2' 
131.173 
LND non-polymer         . '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' ? 
'C13 H16 N5 O2 1' 274.298 
LYS 'L-peptide linking' y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ? 'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                 ? 'C3 H7 N O3' 
105.093 
SVX 'L-peptide linking' n 'O-[(R)-ETHOXY(METHYL)PHOSPHORYL]-L-SERINE'                                            ? 'C6 H14 N O5 P' 
211.153 
THR 'L-peptide linking' y THREONINE                                                                              ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ? 'C5 H11 N O2' 
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6O66 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.85 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         74.63 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10 mM sodium citrate, 100 mM HEPES, pH 7, and 6-8 % PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6O66 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.45 
_reflns.d_resolution_low                 40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       73508 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.8 
_reflns.pdbx_Rmerge_I_obs                0.040 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.45 
_reflns_shell.d_res_low                   2.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           7714 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.585 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6O66 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.452 
_refine.ls_d_res_low                             38.832 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     73508 
_refine.ls_number_reflns_R_free                  3677 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.62 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2077 
_refine.ls_R_factor_R_free                       0.2289 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2066 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.25 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.31 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8388 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         100 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               8719 
_refine_hist.d_res_high                       2.452 
_refine_hist.d_res_low                        38.832 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 8756  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.521  ? 11956 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.096 ? 5120  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1257  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 1579  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4519 2.4842  . . 109 2263 75.00 . . . 0.3348 . 0.3027 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4842 2.5182  . . 117 2322 78.00 . . . 0.3141 . 0.2847 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5182 2.5541  . . 112 2425 80.00 . . . 0.2827 . 0.2812 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5541 2.5923  . . 123 2503 82.00 . . . 0.2960 . 0.2842 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5923 2.6328  . . 139 2317 78.00 . . . 0.3468 . 0.2847 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6328 2.6759  . . 113 2313 77.00 . . . 0.3356 . 0.2715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6759 2.7220  . . 130 2651 88.00 . . . 0.2983 . 0.2798 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7220 2.7715  . . 163 2745 93.00 . . . 0.2964 . 0.2752 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7715 2.8248  . . 134 2831 93.00 . . . 0.3377 . 0.2748 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8248 2.8825  . . 156 2789 94.00 . . . 0.3184 . 0.2608 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8825 2.9451  . . 123 2842 94.00 . . . 0.3046 . 0.2599 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9451 3.0136  . . 150 2823 94.00 . . . 0.2718 . 0.2525 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0136 3.0889  . . 134 2849 94.00 . . . 0.2697 . 0.2425 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0889 3.1724  . . 154 2811 94.00 . . . 0.2756 . 0.2452 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1724 3.2657  . . 143 2826 93.00 . . . 0.2509 . 0.2373 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2657 3.3711  . . 145 2725 92.00 . . . 0.2742 . 0.2404 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3711 3.4915  . . 121 2543 85.00 . . . 0.2530 . 0.2181 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4915 3.6312  . . 153 2855 96.00 . . . 0.2146 . 0.2094 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6312 3.7963  . . 164 2893 97.00 . . . 0.2253 . 0.2001 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7963 3.9963  . . 153 2891 96.00 . . . 0.2183 . 0.1795 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9963 4.2464  . . 156 2841 96.00 . . . 0.1689 . 0.1683 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2464 4.5738  . . 162 2827 94.00 . . . 0.1697 . 0.1534 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5738 5.0332  . . 165 2671 90.00 . . . 0.1759 . 0.1526 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0332 5.7594  . . 137 2756 92.00 . . . 0.2050 . 0.1673 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7594 7.2486  . . 172 2854 96.00 . . . 0.1821 . 0.1662 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.2486 38.8369 . . 149 2665 89.00 . . . 0.1642 . 0.1447 . . . . . . . . . . 
# 
_struct.entry_id                     6O66 
_struct.title                        'Structure of VX-phosphonylated hAChE in complex with oxime reactivator RS-170B' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6O66 
_struct_keywords.text            
'human acetylcholinesterase, VX-phosphonylated, VX-hAChE, oxime reactivator, imidazole-based oxime, RS-170B, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 8   ? GLU A 10  ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 45  ? ARG A 49  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 83  ? MET A 88  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 133 ? ASP A 137 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 138 ? ARG A 146 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 156 ? LEU A 162 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 173 ? VAL A 190 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 191 ? PHE A 193 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SVX A 206 ? LEU A 217 ? SVX A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 218 ? GLY A 223 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 243 ? VAL A 258 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 268 ? ARG A 279 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 AB4 PRO A 280 ? ASN A 286 ? PRO A 277 ASN A 283 1 ? 7  
HELX_P HELX_P14 AB5 HIS A 287 ? LEU A 292 ? HIS A 284 LEU A 289 5 ? 6  
HELX_P HELX_P15 AB6 THR A 314 ? ALA A 321 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 GLY A 338 ? VAL A 343 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 358 ? VAL A 370 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 374 ? THR A 386 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 393 ? VAL A 410 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 410 ? ALA A 423 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 AC3 PRO A 443 ? GLY A 447 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 453 ? PHE A 458 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 459 ? ASP A 463 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 469 ? GLY A 490 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 528 ? ARG A 537 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 537 ? ALA A 545 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 8   ? GLU B 10  ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 45  ? ARG B 49  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 83  ? MET B 88  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 133 ? ASP B 137 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 138 ? ARG B 146 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 GLY B 157 ? LEU B 162 ? GLY B 154 LEU B 159 1 ? 6  
HELX_P HELX_P33 AD6 ASN B 173 ? VAL B 190 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 191 ? PHE B 193 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SVX B 206 ? LEU B 217 ? SVX B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 218 ? GLY B 223 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 GLY B 243 ? VAL B 258 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 AE2 ASN B 268 ? ARG B 277 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P39 AE3 PRO B 280 ? ASN B 286 ? PRO B 277 ASN B 283 1 ? 7  
HELX_P HELX_P40 AE4 HIS B 287 ? LEU B 292 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 AE5 THR B 314 ? ALA B 321 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 AE6 GLY B 338 ? GLY B 345 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P43 AE7 SER B 358 ? VAL B 370 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 374 ? THR B 386 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 393 ? VAL B 410 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 410 ? ALA B 423 ? VAL B 407 ALA B 420 1 ? 14 
HELX_P HELX_P47 AF2 PRO B 443 ? GLY B 447 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 453 ? PHE B 458 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 459 ? ASP B 463 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 469 ? GLY B 490 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 528 ? ARG B 537 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 537 ? ALA B 545 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 72  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ?    ? A CYS 260 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ?    ? A CYS 412 SG ? ? ? 1_555 A CYS 532 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4 disulf ?    ? B CYS 72  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf5 disulf ?    ? B CYS 260 SG ? ? ? 1_555 B CYS 275 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6 disulf ?    ? B CYS 412 SG ? ? ? 1_555 B CYS 532 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? 
covale1 covale both ? A GLU 205 C  ? ? ? 1_555 A SVX 206 N  ? ? A GLU 202 A SVX 203 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale2 covale both ? A SVX 206 C  ? ? ? 1_555 A ALA 207 N  ? ? A SVX 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale3 covale both ? B GLU 205 C  ? ? ? 1_555 B SVX 206 N  ? ? B GLU 202 B SVX 203 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4 covale both ? B SVX 206 C  ? ? ? 1_555 B ALA 207 N  ? ? B SVX 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.337 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 108 A . ? TYR 105 A PRO 109 A ? PRO 106 A 1 -0.55 
2 CYS 260 A . ? CYS 257 A PRO 261 A ? PRO 258 A 1 -2.86 
3 GLY 263 A . ? GLY 260 A GLY 264 A ? GLY 261 A 1 -0.68 
4 TYR 108 B . ? TYR 105 B PRO 109 B ? PRO 106 B 1 -1.30 
5 CYS 260 B . ? CYS 257 B PRO 261 B ? PRO 258 B 1 -2.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 12  ? VAL A 15  ? LEU A 9   VAL A 12  
AA1 2  GLY A 18  ? ARG A 21  ? GLY A 15  ARG A 18  
AA1 3  VAL A 62  ? ASP A 64  ? VAL A 59  ASP A 61  
AA2 1  ILE A 23  ? LEU A 25  ? ILE A 20  LEU A 22  
AA2 2  VAL A 32  ? PRO A 39  ? VAL A 29  PRO A 36  
AA2 3  TYR A 101 ? PRO A 107 ? TYR A 98  PRO A 104 
AA2 4  VAL A 148 ? MET A 152 ? VAL A 145 MET A 149 
AA2 5  THR A 115 ? ILE A 121 ? THR A 112 ILE A 118 
AA2 6  GLY A 195 ? GLU A 205 ? GLY A 192 GLU A 202 
AA2 7  ARG A 227 ? GLN A 231 ? ARG A 224 GLN A 228 
AA2 8  GLN A 328 ? VAL A 334 ? GLN A 325 VAL A 331 
AA2 9  ARG A 427 ? PHE A 433 ? ARG A 424 PHE A 430 
AA2 10 GLN A 512 ? LEU A 516 ? GLN A 509 LEU A 513 
AA2 11 GLU A 522 ? ARG A 525 ? GLU A 519 ARG A 522 
AA3 1  VAL A 71  ? CYS A 72  ? VAL A 68  CYS A 69  
AA3 2  LEU A 95  ? SER A 96  ? LEU A 92  SER A 93  
AA4 1  LEU B 12  ? THR B 14  ? LEU B 9   THR B 11  
AA4 2  ARG B 19  ? ARG B 21  ? ARG B 16  ARG B 18  
AA4 3  VAL B 62  ? ASP B 64  ? VAL B 59  ASP B 61  
AA5 1  ILE B 23  ? LEU B 25  ? ILE B 20  LEU B 22  
AA5 2  VAL B 32  ? PRO B 39  ? VAL B 29  PRO B 36  
AA5 3  TYR B 101 ? PRO B 107 ? TYR B 98  PRO B 104 
AA5 4  VAL B 148 ? MET B 152 ? VAL B 145 MET B 149 
AA5 5  THR B 115 ? ILE B 121 ? THR B 112 ILE B 118 
AA5 6  GLY B 195 ? GLU B 205 ? GLY B 192 GLU B 202 
AA5 7  ARG B 227 ? GLN B 231 ? ARG B 224 GLN B 228 
AA5 8  GLN B 328 ? VAL B 334 ? GLN B 325 VAL B 331 
AA5 9  ARG B 427 ? PHE B 433 ? ARG B 424 PHE B 430 
AA5 10 GLN B 512 ? LEU B 516 ? GLN B 509 LEU B 513 
AA5 11 GLU B 522 ? ARG B 525 ? GLU B 519 ARG B 522 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 15  ? N VAL A 12  O GLY A 18  ? O GLY A 15  
AA1 2  3  N ARG A 19  ? N ARG A 16  O VAL A 63  ? O VAL A 60  
AA2 1  2  N LEU A 25  ? N LEU A 22  O VAL A 32  ? O VAL A 29  
AA2 2  3  N ILE A 38  ? N ILE A 35  O LEU A 102 ? O LEU A 99  
AA2 3  4  N ASN A 103 ? N ASN A 100 O SER A 151 ? O SER A 148 
AA2 4  5  O VAL A 148 ? O VAL A 145 N LEU A 118 ? N LEU A 115 
AA2 5  6  N THR A 115 ? N THR A 112 O ASP A 196 ? O ASP A 193 
AA2 6  7  N GLY A 204 ? N GLY A 201 O GLN A 231 ? O GLN A 228 
AA2 7  8  N LEU A 230 ? N LEU A 227 O LEU A 330 ? O LEU A 327 
AA2 8  9  N VAL A 329 ? N VAL A 326 O ARG A 427 ? O ARG A 424 
AA2 9  10 N VAL A 432 ? N VAL A 429 O LEU A 516 ? O LEU A 513 
AA2 10 11 N TYR A 513 ? N TYR A 510 O ARG A 524 ? O ARG A 521 
AA3 1  2  N VAL A 71  ? N VAL A 68  O SER A 96  ? O SER A 93  
AA4 1  2  N VAL B 13  ? N VAL B 10  O LEU B 20  ? O LEU B 17  
AA4 2  3  N ARG B 19  ? N ARG B 16  O VAL B 63  ? O VAL B 60  
AA5 1  2  N LEU B 25  ? N LEU B 22  O VAL B 32  ? O VAL B 29  
AA5 2  3  N ILE B 38  ? N ILE B 35  O LEU B 102 ? O LEU B 99  
AA5 3  4  N ASN B 103 ? N ASN B 100 O SER B 151 ? O SER B 148 
AA5 4  5  O VAL B 148 ? O VAL B 145 N LEU B 118 ? N LEU B 115 
AA5 5  6  N THR B 115 ? N THR B 112 O ASP B 196 ? O ASP B 193 
AA5 6  7  N GLY B 204 ? N GLY B 201 O GLN B 231 ? O GLN B 228 
AA5 7  8  N LEU B 230 ? N LEU B 227 O LEU B 330 ? O LEU B 327 
AA5 8  9  N VAL B 331 ? N VAL B 328 O TYR B 429 ? O TYR B 426 
AA5 9  10 N VAL B 432 ? N VAL B 429 O LEU B 516 ? O LEU B 513 
AA5 10 11 N TYR B 513 ? N TYR B 510 O ARG B 524 ? O ARG B 521 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A LND 601 ? 9  'binding site for residue LND A 601' 
AC2 Software A GOL 602 ? 6  'binding site for residue GOL A 602' 
AC3 Software A GOL 603 ? 8  'binding site for residue GOL A 603' 
AC4 Software A GOL 604 ? 3  'binding site for residue GOL A 604' 
AC5 Software A GOL 605 ? 6  'binding site for residue GOL A 605' 
AC6 Software A GOL 606 ? 4  'binding site for residue GOL A 606' 
AC7 Software B LND 601 ? 10 'binding site for residue LND B 601' 
AC8 Software B GOL 602 ? 5  'binding site for residue GOL B 602' 
AC9 Software B GOL 603 ? 6  'binding site for residue GOL B 603' 
AD1 Software B GOL 604 ? 2  'binding site for residue GOL B 604' 
AD2 Software B GOL 605 ? 4  'binding site for residue GOL B 605' 
AD3 Software B GOL 606 ? 4  'binding site for residue GOL B 606' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  TYR A 75  ? TYR A 72  . ? 1_555 ? 
2  AC1 9  TYR A 127 ? TYR A 124 . ? 1_555 ? 
3  AC1 9  SVX A 206 ? SVX A 203 . ? 1_555 ? 
4  AC1 9  TRP A 289 ? TRP A 286 . ? 1_555 ? 
5  AC1 9  PHE A 298 ? PHE A 295 . ? 1_555 ? 
6  AC1 9  TYR A 340 ? TYR A 337 . ? 1_555 ? 
7  AC1 9  PHE A 341 ? PHE A 338 . ? 1_555 ? 
8  AC1 9  TYR A 344 ? TYR A 341 . ? 1_555 ? 
9  AC1 9  GOL D .   ? GOL A 602 . ? 1_555 ? 
10 AC2 6  TRP A 89  ? TRP A 86  . ? 1_555 ? 
11 AC2 6  GLU A 205 ? GLU A 202 . ? 1_555 ? 
12 AC2 6  SVX A 206 ? SVX A 203 . ? 1_555 ? 
13 AC2 6  TYR A 340 ? TYR A 337 . ? 1_555 ? 
14 AC2 6  HIS A 450 ? HIS A 447 . ? 1_555 ? 
15 AC2 6  LND C .   ? LND A 601 . ? 1_555 ? 
16 AC3 8  GLU A 84  ? GLU A 81  . ? 1_555 ? 
17 AC3 8  MET A 88  ? MET A 85  . ? 1_555 ? 
18 AC3 8  THR A 439 ? THR A 436 . ? 1_555 ? 
19 AC3 8  LEU A 440 ? LEU A 437 . ? 1_555 ? 
20 AC3 8  SER A 441 ? SER A 438 . ? 1_555 ? 
21 AC3 8  TYR A 452 ? TYR A 449 . ? 1_555 ? 
22 AC3 8  GLU A 455 ? GLU A 452 . ? 1_555 ? 
23 AC3 8  TYR A 468 ? TYR A 465 . ? 1_555 ? 
24 AC4 3  GLY A 46  ? GLY A 43  . ? 1_555 ? 
25 AC4 3  ARG A 277 ? ARG A 274 . ? 1_555 ? 
26 AC4 3  ARG A 279 ? ARG A 276 . ? 1_555 ? 
27 AC5 6  PRO A 55  ? PRO A 52  . ? 1_555 ? 
28 AC5 6  GLN A 184 ? GLN A 181 . ? 1_555 ? 
29 AC5 6  TRP A 185 ? TRP A 182 . ? 1_555 ? 
30 AC5 6  GLU A 188 ? GLU A 185 . ? 1_555 ? 
31 AC5 6  HOH O .   ? HOH A 729 . ? 1_555 ? 
32 AC5 6  HOH O .   ? HOH A 769 . ? 1_555 ? 
33 AC6 4  ASP A 336 ? ASP A 333 . ? 1_555 ? 
34 AC6 4  GLU A 399 ? GLU A 396 . ? 1_555 ? 
35 AC6 4  TRP A 445 ? TRP A 442 . ? 1_555 ? 
36 AC6 4  HOH O .   ? HOH A 706 . ? 1_555 ? 
37 AC7 10 TYR B 75  ? TYR B 72  . ? 1_555 ? 
38 AC7 10 TYR B 127 ? TYR B 124 . ? 1_555 ? 
39 AC7 10 SVX B 206 ? SVX B 203 . ? 1_555 ? 
40 AC7 10 TRP B 289 ? TRP B 286 . ? 1_555 ? 
41 AC7 10 VAL B 297 ? VAL B 294 . ? 1_555 ? 
42 AC7 10 PHE B 298 ? PHE B 295 . ? 1_555 ? 
43 AC7 10 TYR B 340 ? TYR B 337 . ? 1_555 ? 
44 AC7 10 PHE B 341 ? PHE B 338 . ? 1_555 ? 
45 AC7 10 TYR B 344 ? TYR B 341 . ? 1_555 ? 
46 AC7 10 GOL J .   ? GOL B 602 . ? 1_555 ? 
47 AC8 5  TRP B 89  ? TRP B 86  . ? 1_555 ? 
48 AC8 5  GLU B 205 ? GLU B 202 . ? 1_555 ? 
49 AC8 5  SVX B 206 ? SVX B 203 . ? 1_555 ? 
50 AC8 5  TYR B 340 ? TYR B 337 . ? 1_555 ? 
51 AC8 5  LND I .   ? LND B 601 . ? 1_555 ? 
52 AC9 6  GLU B 84  ? GLU B 81  . ? 1_555 ? 
53 AC9 6  MET B 88  ? MET B 85  . ? 1_555 ? 
54 AC9 6  THR B 439 ? THR B 436 . ? 1_555 ? 
55 AC9 6  SER B 441 ? SER B 438 . ? 1_555 ? 
56 AC9 6  TYR B 452 ? TYR B 449 . ? 1_555 ? 
57 AC9 6  GLU B 455 ? GLU B 452 . ? 1_555 ? 
58 AD1 2  ARG B 277 ? ARG B 274 . ? 1_555 ? 
59 AD1 2  THR B 278 ? THR B 275 . ? 1_555 ? 
60 AD2 4  PRO B 55  ? PRO B 52  . ? 1_555 ? 
61 AD2 4  GLN B 184 ? GLN B 181 . ? 1_555 ? 
62 AD2 4  TRP B 185 ? TRP B 182 . ? 1_555 ? 
63 AD2 4  GLU B 188 ? GLU B 185 . ? 1_555 ? 
64 AD3 4  LYS B 335 ? LYS B 332 . ? 1_555 ? 
65 AD3 4  ASP B 336 ? ASP B 333 . ? 1_555 ? 
66 AD3 4  GLU B 399 ? GLU B 396 . ? 1_555 ? 
67 AD3 4  TRP B 445 ? TRP B 442 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6O66 
_atom_sites.fract_transf_matrix[1][1]   0.008040 
_atom_sites.fract_transf_matrix[1][2]   0.004642 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009284 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 7   ? 67.035 184.326 -21.953 1.00 103.75 ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 7   ? 66.759 182.890 -22.126 1.00 100.87 ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 7   ? 67.920 182.137 -22.777 1.00 90.83  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 7   ? 69.095 182.228 -22.375 1.00 73.53  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 7   ? 65.490 182.697 -22.942 1.00 92.69  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 7   ? 65.418 183.490 -24.279 1.00 95.38  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 7   ? 64.258 182.982 -25.180 1.00 93.07  ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 7   ? 63.477 182.117 -24.740 1.00 81.23  ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 7   ? 64.141 183.447 -26.322 1.00 87.24  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 8   ? 67.542 181.361 -23.777 1.00 88.32  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 8   ? 68.393 180.833 -24.848 1.00 65.26  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 8   ? 67.438 180.532 -26.005 1.00 68.76  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 8   ? 66.384 179.934 -25.764 1.00 61.76  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 8   ? 69.158 179.580 -24.399 1.00 72.26  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 8   ? 70.234 179.159 -25.379 1.00 75.97  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 8   ? 71.287 178.645 -24.916 1.00 76.43  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 8   ? 70.051 179.356 -26.590 1.00 70.11  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 9   ? 67.743 180.971 -27.227 1.00 77.82  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 9   ? 66.844 180.672 -28.339 1.00 70.63  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 9   ? 66.746 179.174 -28.582 1.00 76.83  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 9   ? 65.722 178.687 -29.075 1.00 71.64  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 9   ? 67.292 181.382 -29.618 1.00 62.90  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 10  ? 67.786 178.428 -28.225 1.00 65.09  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 10  ? 67.847 176.998 -28.473 1.00 63.77  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 10  ? 67.236 176.168 -27.352 1.00 58.62  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 10  ? 67.156 174.943 -27.487 1.00 45.63  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 10  ? 69.298 176.578 -28.713 1.00 61.39  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 10  ? 69.914 177.229 -29.943 1.00 57.15  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 10  ? 71.270 176.659 -30.300 1.00 55.68  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 10  ? 71.825 175.886 -29.492 1.00 59.80  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 10  ? 71.780 176.983 -31.393 1.00 62.87  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 11  ? 66.808 176.792 -26.257 1.00 55.01  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 11  ? 66.054 176.095 -25.223 1.00 48.96  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 11  ? 64.559 176.074 -25.510 1.00 40.81  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 11  ? 63.788 175.578 -24.681 1.00 45.72  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 11  ? 66.312 176.729 -23.853 1.00 40.73  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 11  ? 67.732 176.580 -23.305 1.00 49.10  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 11  ? 67.832 177.169 -21.906 1.00 32.53  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 11  ? 68.174 175.126 -23.317 1.00 40.22  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 12  ? 64.137 176.602 -26.656 1.00 47.61  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 12  ? 62.750 176.559 -27.097 1.00 41.36  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 12  ? 62.669 175.738 -28.374 1.00 45.94  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 12  ? 63.367 176.032 -29.351 1.00 47.46  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 12  ? 62.204 177.965 -27.338 1.00 46.82  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 12  ? 62.142 178.896 -26.132 1.00 47.79  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 12  ? 61.829 180.292 -26.614 1.00 43.10  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 12  ? 61.095 178.427 -25.134 1.00 43.43  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 13  ? 61.821 174.713 -28.363 1.00 36.73  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 13  ? 61.684 173.790 -29.484 1.00 37.64  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 13  ? 60.211 173.454 -29.662 1.00 33.49  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 13  ? 59.485 173.252 -28.682 1.00 38.31  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 13  ? 62.522 172.510 -29.267 1.00 37.82  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 13  ? 62.089 171.405 -30.220 1.00 38.43  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 13  ? 63.998 172.806 -29.452 1.00 35.36  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 14  ? 59.770 173.405 -30.915 1.00 31.25  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 14  ? 58.420 172.988 -31.265 1.00 37.33  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 14  ? 58.466 171.588 -31.860 1.00 40.49  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 14  ? 59.222 171.335 -32.805 1.00 41.75  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 14  ? 57.780 173.962 -32.257 1.00 41.09  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 14  ? 57.715 175.269 -31.674 1.00 43.46  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 14  ? 56.375 173.504 -32.622 1.00 18.14  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 15  ? 57.669 170.683 -31.298 1.00 33.69  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 15  ? 57.515 169.340 -31.844 1.00 33.28  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 15  ? 56.093 169.207 -32.374 1.00 35.44  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 15  ? 55.330 170.180 -32.375 1.00 53.38  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 15  ? 57.834 168.264 -30.789 1.00 38.58  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 15  ? 59.333 168.204 -30.535 1.00 33.28  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 15  ? 57.092 168.556 -29.496 1.00 35.31  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 16  ? 55.724 168.007 -32.828 1.00 34.57  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 16  ? 54.413 167.819 -33.441 1.00 42.61  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 16  ? 53.265 168.018 -32.458 1.00 42.84  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 16  ? 52.145 168.308 -32.889 1.00 51.08  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 16  ? 54.311 166.429 -34.070 1.00 38.65  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 16  ? 55.132 166.250 -35.334 1.00 51.05  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 16  ? 54.668 165.029 -36.112 1.00 55.78  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 16  ? 55.496 164.780 -37.288 1.00 68.14  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 16  ? 55.254 163.826 -38.181 1.00 66.98  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 16  ? 54.202 163.031 -38.036 1.00 55.77  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 16  ? 56.062 163.669 -39.221 1.00 62.22  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 17  ? 53.513 167.870 -31.159 1.00 37.57  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 17  ? 52.456 167.996 -30.175 1.00 35.18  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 17  ? 52.312 169.391 -29.602 1.00 40.95  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 17  ? 51.273 169.728 -29.026 1.00 35.61  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 18  ? 53.341 170.209 -29.750 1.00 32.82  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 18  ? 53.323 171.555 -29.221 1.00 25.45  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 18  ? 54.737 172.036 -28.962 1.00 34.94  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 18  ? 55.696 171.504 -29.511 1.00 37.77  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 19  ? 54.840 173.049 -28.110 1.00 31.11  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 19  ? 56.110 173.682 -27.794 1.00 35.24  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 19  ? 56.673 173.156 -26.479 1.00 34.36  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 19  ? 55.945 172.683 -25.602 1.00 32.19  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 19  ? 55.954 175.202 -27.723 1.00 43.27  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 19  ? 55.761 175.872 -29.072 1.00 55.69  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 19  ? 55.379 177.327 -28.889 1.00 58.49  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 19  ? 54.051 177.455 -28.297 1.00 66.24  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 19  ? 53.632 178.522 -27.625 1.00 63.48  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 19  ? 54.442 179.557 -27.447 1.00 62.11  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 19  ? 52.406 178.550 -27.123 1.00 63.09  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 20  ? 57.995 173.253 -26.353 1.00 28.59  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 20  ? 58.710 172.778 -25.179 1.00 32.43  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 20  ? 59.750 173.813 -24.776 1.00 33.25  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 20  ? 60.211 174.612 -25.594 1.00 36.99  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 20  ? 59.395 171.428 -25.442 1.00 29.72  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 20  ? 58.511 170.248 -25.848 1.00 32.92  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 20  ? 59.344 169.169 -26.517 1.00 35.46  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 20  ? 57.791 169.687 -24.635 1.00 22.76  ? 17  LEU A CD2 1 
ATOM   107  N N   . ARG A 1 21  ? 60.117 173.791 -23.496 1.00 29.43  ? 18  ARG A N   1 
ATOM   108  C CA  . ARG A 1 21  ? 61.201 174.616 -22.979 1.00 40.38  ? 18  ARG A CA  1 
ATOM   109  C C   . ARG A 1 21  ? 62.181 173.720 -22.239 1.00 38.65  ? 18  ARG A C   1 
ATOM   110  O O   . ARG A 1 21  ? 61.814 173.086 -21.244 1.00 36.17  ? 18  ARG A O   1 
ATOM   111  C CB  . ARG A 1 21  ? 60.687 175.716 -22.049 1.00 38.40  ? 18  ARG A CB  1 
ATOM   112  C CG  . ARG A 1 21  ? 61.806 176.559 -21.460 1.00 40.94  ? 18  ARG A CG  1 
ATOM   113  C CD  . ARG A 1 21  ? 61.292 177.486 -20.384 1.00 50.31  ? 18  ARG A CD  1 
ATOM   114  N NE  . ARG A 1 21  ? 60.202 178.328 -20.867 1.00 50.06  ? 18  ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 21  ? 60.374 179.502 -21.464 1.00 48.37  ? 18  ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 21  ? 61.597 179.979 -21.656 1.00 53.12  ? 18  ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 21  ? 59.322 180.200 -21.870 1.00 51.31  ? 18  ARG A NH2 1 
ATOM   118  N N   . GLY A 1 22  ? 63.419 173.679 -22.714 1.00 32.31  ? 19  GLY A N   1 
ATOM   119  C CA  . GLY A 1 22  ? 64.447 172.847 -22.129 1.00 28.23  ? 19  GLY A CA  1 
ATOM   120  C C   . GLY A 1 22  ? 65.286 173.582 -21.106 1.00 36.95  ? 19  GLY A C   1 
ATOM   121  O O   . GLY A 1 22  ? 64.930 174.658 -20.618 1.00 45.64  ? 19  GLY A O   1 
ATOM   122  N N   . ILE A 1 23  ? 66.428 172.980 -20.781 1.00 33.49  ? 20  ILE A N   1 
ATOM   123  C CA  . ILE A 1 23  ? 67.348 173.515 -19.786 1.00 26.10  ? 20  ILE A CA  1 
ATOM   124  C C   . ILE A 1 23  ? 68.772 173.241 -20.250 1.00 39.87  ? 20  ILE A C   1 
ATOM   125  O O   . ILE A 1 23  ? 69.047 172.239 -20.917 1.00 40.38  ? 20  ILE A O   1 
ATOM   126  C CB  . ILE A 1 23  ? 67.083 172.906 -18.388 1.00 34.76  ? 20  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 23  ? 67.990 173.538 -17.328 1.00 29.58  ? 20  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 23  ? 67.252 171.392 -18.419 1.00 28.47  ? 20  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 23  ? 67.773 172.988 -15.935 1.00 31.68  ? 20  ILE A CD1 1 
ATOM   130  N N   . ARG A 1 24  ? 69.678 174.155 -19.910 1.00 33.79  ? 21  ARG A N   1 
ATOM   131  C CA  . ARG A 1 24  ? 71.089 174.010 -20.241 1.00 40.18  ? 21  ARG A CA  1 
ATOM   132  C C   . ARG A 1 24  ? 71.821 173.310 -19.103 1.00 36.86  ? 21  ARG A C   1 
ATOM   133  O O   . ARG A 1 24  ? 71.675 173.688 -17.937 1.00 36.02  ? 21  ARG A O   1 
ATOM   134  C CB  . ARG A 1 24  ? 71.721 175.374 -20.517 1.00 40.70  ? 21  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 24  ? 73.241 175.370 -20.469 1.00 51.08  ? 21  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 24  ? 73.810 176.717 -20.874 1.00 65.00  ? 21  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 24  ? 73.519 177.029 -22.269 1.00 70.54  ? 21  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 24  ? 73.984 178.098 -22.906 1.00 70.03  ? 21  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 24  ? 73.668 178.302 -24.178 1.00 68.44  ? 21  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 24  ? 74.766 178.961 -22.273 1.00 68.08  ? 21  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 25  ? 72.609 172.296 -19.449 1.00 41.05  ? 22  LEU A N   1 
ATOM   142  C CA  . LEU A 1 25  ? 73.392 171.535 -18.486 1.00 35.92  ? 22  LEU A CA  1 
ATOM   143  C C   . LEU A 1 25  ? 74.868 171.870 -18.644 1.00 29.25  ? 22  LEU A C   1 
ATOM   144  O O   . LEU A 1 25  ? 75.373 171.981 -19.766 1.00 44.18  ? 22  LEU A O   1 
ATOM   145  C CB  . LEU A 1 25  ? 73.179 170.031 -18.672 1.00 40.90  ? 22  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 25  ? 71.735 169.530 -18.663 1.00 36.41  ? 22  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 25  ? 71.701 168.035 -18.930 1.00 44.90  ? 22  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 25  ? 71.053 169.858 -17.343 1.00 25.01  ? 22  LEU A CD2 1 
ATOM   149  N N   . LYS A 1 26  ? 75.558 172.026 -17.519 1.00 33.27  ? 23  LYS A N   1 
ATOM   150  C CA  . LYS A 1 26  ? 76.975 172.355 -17.524 1.00 39.37  ? 23  LYS A CA  1 
ATOM   151  C C   . LYS A 1 26  ? 77.817 171.086 -17.480 1.00 47.64  ? 23  LYS A C   1 
ATOM   152  O O   . LYS A 1 26  ? 77.508 170.143 -16.745 1.00 53.81  ? 23  LYS A O   1 
ATOM   153  C CB  . LYS A 1 26  ? 77.328 173.252 -16.335 1.00 42.29  ? 23  LYS A CB  1 
ATOM   154  C CG  . LYS A 1 26  ? 76.474 174.509 -16.211 1.00 52.73  ? 23  LYS A CG  1 
ATOM   155  C CD  . LYS A 1 26  ? 77.241 175.766 -16.607 1.00 65.99  ? 23  LYS A CD  1 
ATOM   156  C CE  . LYS A 1 26  ? 77.448 175.854 -18.111 1.00 73.22  ? 23  LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 26  ? 78.153 177.106 -18.503 1.00 71.05  ? 23  LYS A NZ  1 
ATOM   158  N N   . THR A 1 27  ? 78.871 171.064 -18.284 1.00 47.91  ? 24  THR A N   1 
ATOM   159  C CA  . THR A 1 27  ? 79.893 170.031 -18.275 1.00 42.52  ? 24  THR A CA  1 
ATOM   160  C C   . THR A 1 27  ? 81.251 170.712 -18.283 1.00 53.46  ? 24  THR A C   1 
ATOM   161  O O   . THR A 1 27  ? 81.361 171.885 -18.657 1.00 50.78  ? 24  THR A O   1 
ATOM   162  C CB  . THR A 1 27  ? 79.781 169.092 -19.488 1.00 40.95  ? 24  THR A CB  1 
ATOM   163  O OG1 . THR A 1 27  ? 80.269 169.758 -20.659 1.00 55.05  ? 24  THR A OG1 1 
ATOM   164  C CG2 . THR A 1 27  ? 78.339 168.661 -19.718 1.00 37.69  ? 24  THR A CG2 1 
ATOM   165  N N   . PRO A 1 28  ? 82.309 170.009 -17.868 1.00 44.11  ? 25  PRO A N   1 
ATOM   166  C CA  . PRO A 1 28  ? 83.654 170.601 -17.958 1.00 48.81  ? 25  PRO A CA  1 
ATOM   167  C C   . PRO A 1 28  ? 84.075 170.952 -19.376 1.00 49.93  ? 25  PRO A C   1 
ATOM   168  O O   . PRO A 1 28  ? 85.031 171.718 -19.548 1.00 49.16  ? 25  PRO A O   1 
ATOM   169  C CB  . PRO A 1 28  ? 84.557 169.513 -17.361 1.00 52.49  ? 25  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 28  ? 83.662 168.732 -16.466 1.00 50.78  ? 25  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 28  ? 82.320 168.729 -17.137 1.00 41.51  ? 25  PRO A CD  1 
ATOM   172  N N   . GLY A 1 29  ? 83.395 170.427 -20.393 1.00 48.71  ? 26  GLY A N   1 
ATOM   173  C CA  . GLY A 1 29  ? 83.773 170.686 -21.768 1.00 55.50  ? 26  GLY A CA  1 
ATOM   174  C C   . GLY A 1 29  ? 82.863 171.653 -22.497 1.00 49.89  ? 26  GLY A C   1 
ATOM   175  O O   . GLY A 1 29  ? 83.181 172.088 -23.608 1.00 55.25  ? 26  GLY A O   1 
ATOM   176  N N   . GLY A 1 30  ? 81.728 171.995 -21.894 1.00 54.70  ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 30  ? 80.793 172.907 -22.507 1.00 36.55  ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 30  ? 79.353 172.591 -22.158 1.00 49.50  ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 30  ? 79.050 171.572 -21.530 1.00 48.94  ? 27  GLY A O   1 
ATOM   180  N N   . PRO A 1 31  ? 78.436 173.464 -22.561 1.00 53.35  ? 28  PRO A N   1 
ATOM   181  C CA  . PRO A 1 31  ? 77.024 173.266 -22.224 1.00 44.63  ? 28  PRO A CA  1 
ATOM   182  C C   . PRO A 1 31  ? 76.330 172.300 -23.174 1.00 44.40  ? 28  PRO A C   1 
ATOM   183  O O   . PRO A 1 31  ? 76.780 172.038 -24.291 1.00 51.15  ? 28  PRO A O   1 
ATOM   184  C CB  . PRO A 1 31  ? 76.437 174.675 -22.352 1.00 50.24  ? 28  PRO A CB  1 
ATOM   185  C CG  . PRO A 1 31  ? 77.275 175.314 -23.404 1.00 55.98  ? 28  PRO A CG  1 
ATOM   186  C CD  . PRO A 1 31  ? 78.666 174.747 -23.248 1.00 47.35  ? 28  PRO A CD  1 
ATOM   187  N N   . VAL A 1 32  ? 75.208 171.767 -22.694 1.00 41.17  ? 29  VAL A N   1 
ATOM   188  C CA  . VAL A 1 32  ? 74.361 170.853 -23.451 1.00 39.98  ? 29  VAL A CA  1 
ATOM   189  C C   . VAL A 1 32  ? 72.910 171.245 -23.209 1.00 40.35  ? 29  VAL A C   1 
ATOM   190  O O   . VAL A 1 32  ? 72.525 171.567 -22.080 1.00 44.00  ? 29  VAL A O   1 
ATOM   191  C CB  . VAL A 1 32  ? 74.607 169.380 -23.051 1.00 46.33  ? 29  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 32  ? 73.578 168.460 -23.695 1.00 38.24  ? 29  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 32  ? 76.014 168.948 -23.434 1.00 31.03  ? 29  VAL A CG2 1 
ATOM   194  N N   . SER A 1 33  ? 72.106 171.231 -24.270 1.00 30.00  ? 30  SER A N   1 
ATOM   195  C CA  . SER A 1 33  ? 70.681 171.506 -24.157 1.00 35.22  ? 30  SER A CA  1 
ATOM   196  C C   . SER A 1 33  ? 69.929 170.209 -23.888 1.00 40.09  ? 30  SER A C   1 
ATOM   197  O O   . SER A 1 33  ? 70.077 169.233 -24.631 1.00 38.03  ? 30  SER A O   1 
ATOM   198  C CB  . SER A 1 33  ? 70.153 172.172 -25.428 1.00 31.96  ? 30  SER A CB  1 
ATOM   199  O OG  . SER A 1 33  ? 70.807 173.407 -25.667 1.00 43.22  ? 30  SER A OG  1 
ATOM   200  N N   . ALA A 1 34  ? 69.128 170.202 -22.826 1.00 36.01  ? 31  ALA A N   1 
ATOM   201  C CA  . ALA A 1 34  ? 68.374 169.028 -22.413 1.00 32.90  ? 31  ALA A CA  1 
ATOM   202  C C   . ALA A 1 34  ? 66.889 169.352 -22.366 1.00 31.84  ? 31  ALA A C   1 
ATOM   203  O O   . ALA A 1 34  ? 66.492 170.424 -21.899 1.00 43.38  ? 31  ALA A O   1 
ATOM   204  C CB  . ALA A 1 34  ? 68.837 168.526 -21.043 1.00 34.24  ? 31  ALA A CB  1 
ATOM   205  N N   . PHE A 1 35  ? 66.075 168.418 -22.848 1.00 29.34  ? 32  PHE A N   1 
ATOM   206  C CA  . PHE A 1 35  ? 64.618 168.533 -22.840 1.00 31.32  ? 32  PHE A CA  1 
ATOM   207  C C   . PHE A 1 35  ? 64.084 167.305 -22.108 1.00 34.25  ? 32  PHE A C   1 
ATOM   208  O O   . PHE A 1 35  ? 63.825 166.264 -22.717 1.00 31.03  ? 32  PHE A O   1 
ATOM   209  C CB  . PHE A 1 35  ? 64.065 168.650 -24.261 1.00 32.28  ? 32  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 35  ? 64.518 169.888 -24.981 1.00 39.78  ? 32  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 35  ? 65.755 169.928 -25.605 1.00 41.91  ? 32  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 35  ? 63.713 171.013 -25.027 1.00 40.04  ? 32  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 35  ? 66.179 171.066 -26.263 1.00 39.60  ? 32  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 35  ? 64.131 172.155 -25.684 1.00 35.62  ? 32  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 35  ? 65.367 172.181 -26.302 1.00 41.62  ? 32  PHE A CZ  1 
ATOM   216  N N   . LEU A 1 36  ? 63.923 167.436 -20.794 1.00 36.69  ? 33  LEU A N   1 
ATOM   217  C CA  . LEU A 1 36  ? 63.595 166.318 -19.921 1.00 28.70  ? 33  LEU A CA  1 
ATOM   218  C C   . LEU A 1 36  ? 62.103 166.311 -19.615 1.00 34.47  ? 33  LEU A C   1 
ATOM   219  O O   . LEU A 1 36  ? 61.537 167.341 -19.238 1.00 37.69  ? 33  LEU A O   1 
ATOM   220  C CB  . LEU A 1 36  ? 64.394 166.404 -18.620 1.00 26.63  ? 33  LEU A CB  1 
ATOM   221  C CG  . LEU A 1 36  ? 65.873 166.769 -18.762 1.00 25.41  ? 33  LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 36  ? 66.519 166.952 -17.396 1.00 20.75  ? 33  LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 36  ? 66.611 165.712 -19.569 1.00 30.87  ? 33  LEU A CD2 1 
ATOM   224  N N   . GLY A 1 37  ? 61.475 165.148 -19.769 1.00 31.15  ? 34  GLY A N   1 
ATOM   225  C CA  . GLY A 1 37  ? 60.085 164.988 -19.393 1.00 28.12  ? 34  GLY A CA  1 
ATOM   226  C C   . GLY A 1 37  ? 59.096 165.334 -20.486 1.00 32.11  ? 34  GLY A C   1 
ATOM   227  O O   . GLY A 1 37  ? 58.036 165.904 -20.211 1.00 30.65  ? 34  GLY A O   1 
ATOM   228  N N   . ILE A 1 38  ? 59.426 164.992 -21.727 1.00 35.80  ? 35  ILE A N   1 
ATOM   229  C CA  . ILE A 1 38  ? 58.538 165.232 -22.862 1.00 24.42  ? 35  ILE A CA  1 
ATOM   230  C C   . ILE A 1 38  ? 57.458 164.158 -22.878 1.00 28.46  ? 35  ILE A C   1 
ATOM   231  O O   . ILE A 1 38  ? 57.778 162.965 -22.980 1.00 36.46  ? 35  ILE A O   1 
ATOM   232  C CB  . ILE A 1 38  ? 59.314 165.246 -24.188 1.00 30.35  ? 35  ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 38  ? 60.438 166.283 -24.142 1.00 29.02  ? 35  ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 38  ? 58.374 165.524 -25.350 1.00 30.45  ? 35  ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 38  ? 61.345 166.248 -25.355 1.00 26.34  ? 35  ILE A CD1 1 
ATOM   236  N N   . PRO A 1 39  ? 56.179 164.521 -22.782 1.00 39.14  ? 36  PRO A N   1 
ATOM   237  C CA  . PRO A 1 39  ? 55.113 163.510 -22.864 1.00 32.35  ? 36  PRO A CA  1 
ATOM   238  C C   . PRO A 1 39  ? 54.999 162.964 -24.280 1.00 35.62  ? 36  PRO A C   1 
ATOM   239  O O   . PRO A 1 39  ? 54.773 163.716 -25.231 1.00 44.56  ? 36  PRO A O   1 
ATOM   240  C CB  . PRO A 1 39  ? 53.857 164.284 -22.450 1.00 29.77  ? 36  PRO A CB  1 
ATOM   241  C CG  . PRO A 1 39  ? 54.168 165.706 -22.785 1.00 31.49  ? 36  PRO A CG  1 
ATOM   242  C CD  . PRO A 1 39  ? 55.645 165.874 -22.551 1.00 31.73  ? 36  PRO A CD  1 
ATOM   243  N N   . PHE A 1 40  ? 55.164 161.650 -24.419 1.00 31.89  ? 37  PHE A N   1 
ATOM   244  C CA  . PHE A 1 40  ? 55.000 160.986 -25.704 1.00 27.81  ? 37  PHE A CA  1 
ATOM   245  C C   . PHE A 1 40  ? 53.791 160.066 -25.743 1.00 26.44  ? 37  PHE A C   1 
ATOM   246  O O   . PHE A 1 40  ? 53.527 159.456 -26.784 1.00 27.51  ? 37  PHE A O   1 
ATOM   247  C CB  . PHE A 1 40  ? 56.269 160.202 -26.074 1.00 37.38  ? 37  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 40  ? 56.534 158.999 -25.205 1.00 30.87  ? 37  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 40  ? 56.013 157.757 -25.534 1.00 23.93  ? 37  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 40  ? 57.330 159.104 -24.075 1.00 29.33  ? 37  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 40  ? 56.261 156.650 -24.744 1.00 33.69  ? 37  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 40  ? 57.585 157.999 -23.282 1.00 31.88  ? 37  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 40  ? 57.049 156.771 -23.617 1.00 30.50  ? 37  PHE A CZ  1 
ATOM   254  N N   . ALA A 1 41  ? 53.047 159.953 -24.646 1.00 27.61  ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 41  ? 51.877 159.090 -24.610 1.00 30.35  ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 41  ? 50.879 159.634 -23.601 1.00 34.79  ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 41  ? 51.240 160.342 -22.658 1.00 33.88  ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 41  ? 52.253 157.645 -24.261 1.00 37.71  ? 38  ALA A CB  1 
ATOM   259  N N   . GLU A 1 42  ? 49.612 159.297 -23.817 1.00 32.04  ? 39  GLU A N   1 
ATOM   260  C CA  . GLU A 1 42  ? 48.593 159.616 -22.831 1.00 41.24  ? 39  GLU A CA  1 
ATOM   261  C C   . GLU A 1 42  ? 48.863 158.829 -21.551 1.00 38.58  ? 39  GLU A C   1 
ATOM   262  O O   . GLU A 1 42  ? 49.288 157.669 -21.616 1.00 39.38  ? 39  GLU A O   1 
ATOM   263  C CB  . GLU A 1 42  ? 47.198 159.291 -23.369 1.00 34.46  ? 39  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 42  ? 46.714 160.245 -24.449 1.00 47.24  ? 39  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 42  ? 46.507 161.653 -23.927 1.00 44.22  ? 39  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 42  ? 45.858 161.808 -22.871 1.00 52.08  ? 39  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 42  ? 47.001 162.604 -24.568 1.00 43.85  ? 39  GLU A OE2 1 
ATOM   268  N N   . PRO A 1 43  ? 48.653 159.427 -20.382 1.00 42.12  ? 40  PRO A N   1 
ATOM   269  C CA  . PRO A 1 43  ? 48.901 158.716 -19.122 1.00 34.26  ? 40  PRO A CA  1 
ATOM   270  C C   . PRO A 1 43  ? 48.073 157.448 -19.037 1.00 36.11  ? 40  PRO A C   1 
ATOM   271  O O   . PRO A 1 43  ? 46.834 157.500 -19.038 1.00 41.18  ? 40  PRO A O   1 
ATOM   272  C CB  . PRO A 1 43  ? 48.476 159.735 -18.054 1.00 34.56  ? 40  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 43  ? 48.651 161.060 -18.719 1.00 38.20  ? 40  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 43  ? 48.289 160.837 -20.162 1.00 33.83  ? 40  PRO A CD  1 
ATOM   275  N N   . PRO A 1 44  ? 48.740 156.254 -18.964 1.00 41.53  ? 41  PRO A N   1 
ATOM   276  C CA  . PRO A 1 44  ? 48.022 154.963 -18.936 1.00 35.25  ? 41  PRO A CA  1 
ATOM   277  C C   . PRO A 1 44  ? 47.392 154.688 -17.576 1.00 39.15  ? 41  PRO A C   1 
ATOM   278  O O   . PRO A 1 44  ? 47.775 153.778 -16.833 1.00 43.76  ? 41  PRO A O   1 
ATOM   279  C CB  . PRO A 1 44  ? 49.131 153.967 -19.286 1.00 32.85  ? 41  PRO A CB  1 
ATOM   280  C CG  . PRO A 1 44  ? 50.364 154.592 -18.718 1.00 34.03  ? 41  PRO A CG  1 
ATOM   281  C CD  . PRO A 1 44  ? 50.203 156.077 -18.901 1.00 28.72  ? 41  PRO A CD  1 
ATOM   282  N N   . MET A 1 45  ? 46.390 155.490 -17.232 1.00 39.72  ? 42  MET A N   1 
ATOM   283  C CA  . MET A 1 45  ? 45.764 155.433 -15.923 1.00 37.60  ? 42  MET A CA  1 
ATOM   284  C C   . MET A 1 45  ? 44.299 155.036 -16.052 1.00 40.87  ? 42  MET A C   1 
ATOM   285  O O   . MET A 1 45  ? 43.702 155.115 -17.130 1.00 36.43  ? 42  MET A O   1 
ATOM   286  C CB  . MET A 1 45  ? 45.879 156.780 -15.199 1.00 36.70  ? 42  MET A CB  1 
ATOM   287  C CG  . MET A 1 45  ? 47.283 157.364 -15.193 1.00 37.16  ? 42  MET A CG  1 
ATOM   288  S SD  . MET A 1 45  ? 47.404 158.842 -14.170 1.00 65.20  ? 42  MET A SD  1 
ATOM   289  C CE  . MET A 1 45  ? 46.888 158.188 -12.584 1.00 52.46  ? 42  MET A CE  1 
ATOM   290  N N   . GLY A 1 46  ? 43.729 154.606 -14.928 1.00 38.02  ? 43  GLY A N   1 
ATOM   291  C CA  . GLY A 1 46  ? 42.339 154.226 -14.862 1.00 36.53  ? 43  GLY A CA  1 
ATOM   292  C C   . GLY A 1 46  ? 42.006 153.071 -15.783 1.00 45.08  ? 43  GLY A C   1 
ATOM   293  O O   . GLY A 1 46  ? 42.563 151.973 -15.673 1.00 47.63  ? 43  GLY A O   1 
ATOM   294  N N   . PRO A 1 47  ? 41.084 153.302 -16.722 1.00 40.30  ? 44  PRO A N   1 
ATOM   295  C CA  . PRO A 1 47  ? 40.724 152.244 -17.678 1.00 41.29  ? 44  PRO A CA  1 
ATOM   296  C C   . PRO A 1 47  ? 41.838 151.890 -18.649 1.00 38.95  ? 44  PRO A C   1 
ATOM   297  O O   . PRO A 1 47  ? 41.707 150.894 -19.371 1.00 48.14  ? 44  PRO A O   1 
ATOM   298  C CB  . PRO A 1 47  ? 39.516 152.837 -18.415 1.00 45.10  ? 44  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 47  ? 39.709 154.315 -18.309 1.00 34.58  ? 44  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 47  ? 40.336 154.548 -16.962 1.00 36.24  ? 44  PRO A CD  1 
ATOM   301  N N   . ARG A 1 48  ? 42.921 152.663 -18.689 1.00 42.40  ? 45  ARG A N   1 
ATOM   302  C CA  . ARG A 1 48  ? 44.032 152.406 -19.595 1.00 45.81  ? 45  ARG A CA  1 
ATOM   303  C C   . ARG A 1 48  ? 45.119 151.535 -18.981 1.00 43.01  ? 45  ARG A C   1 
ATOM   304  O O   . ARG A 1 48  ? 46.089 151.207 -19.673 1.00 42.95  ? 45  ARG A O   1 
ATOM   305  C CB  . ARG A 1 48  ? 44.653 153.723 -20.063 1.00 41.79  ? 45  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 48  ? 43.714 154.610 -20.848 1.00 47.78  ? 45  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 48  ? 44.493 155.691 -21.570 1.00 57.29  ? 45  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 48  ? 43.617 156.695 -22.163 1.00 73.10  ? 45  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 48  ? 42.984 156.538 -23.320 1.00 79.73  ? 45  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 48  ? 42.207 157.503 -23.790 1.00 81.11  ? 45  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 48  ? 43.124 155.411 -24.002 1.00 80.88  ? 45  ARG A NH2 1 
ATOM   312  N N   . ARG A 1 49  ? 44.996 151.168 -17.707 1.00 39.00  ? 46  ARG A N   1 
ATOM   313  C CA  . ARG A 1 49  ? 45.969 150.272 -17.100 1.00 44.31  ? 46  ARG A CA  1 
ATOM   314  C C   . ARG A 1 49  ? 45.961 148.932 -17.824 1.00 29.85  ? 46  ARG A C   1 
ATOM   315  O O   . ARG A 1 49  ? 44.900 148.392 -18.150 1.00 40.19  ? 46  ARG A O   1 
ATOM   316  C CB  . ARG A 1 49  ? 45.660 150.080 -15.614 1.00 37.31  ? 46  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 49  ? 46.636 149.168 -14.886 1.00 36.16  ? 46  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 49  ? 46.239 148.981 -13.429 1.00 29.28  ? 46  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 49  ? 46.509 150.165 -12.618 1.00 33.03  ? 46  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 49  ? 46.151 150.292 -11.344 1.00 37.18  ? 46  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 49  ? 45.503 149.309 -10.735 1.00 36.20  ? 46  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 49  ? 46.437 151.402 -10.678 1.00 31.54  ? 46  ARG A NH2 1 
ATOM   323  N N   . PHE A 1 50  ? 47.161 148.412 -18.095 1.00 32.05  ? 47  PHE A N   1 
ATOM   324  C CA  . PHE A 1 50  ? 47.428 147.165 -18.812 1.00 40.98  ? 47  PHE A CA  1 
ATOM   325  C C   . PHE A 1 50  ? 47.160 147.269 -20.308 1.00 35.74  ? 47  PHE A C   1 
ATOM   326  O O   . PHE A 1 50  ? 47.311 146.267 -21.018 1.00 40.21  ? 47  PHE A O   1 
ATOM   327  C CB  . PHE A 1 50  ? 46.628 145.978 -18.254 1.00 29.93  ? 47  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 50  ? 46.710 145.840 -16.764 1.00 29.83  ? 47  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 50  ? 47.937 145.850 -16.122 1.00 35.74  ? 47  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 50  ? 45.561 145.715 -16.003 1.00 33.71  ? 47  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 50  ? 48.016 145.725 -14.749 1.00 36.04  ? 47  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 50  ? 45.632 145.592 -14.629 1.00 38.85  ? 47  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 50  ? 46.862 145.596 -14.001 1.00 31.26  ? 47  PHE A CZ  1 
ATOM   334  N N   . LEU A 1 51  ? 46.770 148.448 -20.819 1.00 39.47  ? 48  LEU A N   1 
ATOM   335  C CA  . LEU A 1 51  ? 46.459 148.614 -22.229 1.00 38.52  ? 48  LEU A CA  1 
ATOM   336  C C   . LEU A 1 51  ? 47.638 149.224 -22.980 1.00 34.33  ? 48  LEU A C   1 
ATOM   337  O O   . LEU A 1 51  ? 48.477 149.907 -22.383 1.00 31.99  ? 48  LEU A O   1 
ATOM   338  C CB  . LEU A 1 51  ? 45.228 149.508 -22.411 1.00 40.63  ? 48  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 51  ? 43.897 148.916 -21.951 1.00 44.97  ? 48  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 51  ? 42.747 149.842 -22.316 1.00 37.20  ? 48  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 51  ? 43.692 147.536 -22.553 1.00 39.42  ? 48  LEU A CD2 1 
ATOM   342  N N   . PRO A 1 52  ? 47.727 148.981 -24.287 1.00 38.04  ? 49  PRO A N   1 
ATOM   343  C CA  . PRO A 1 52  ? 48.800 149.582 -25.069 1.00 34.09  ? 49  PRO A CA  1 
ATOM   344  C C   . PRO A 1 52  ? 48.713 151.102 -25.017 1.00 31.92  ? 49  PRO A C   1 
ATOM   345  O O   . PRO A 1 52  ? 47.625 151.667 -24.820 1.00 32.56  ? 49  PRO A O   1 
ATOM   346  C CB  . PRO A 1 52  ? 48.546 149.054 -26.486 1.00 25.52  ? 49  PRO A CB  1 
ATOM   347  C CG  . PRO A 1 52  ? 47.805 147.784 -26.282 1.00 30.45  ? 49  PRO A CG  1 
ATOM   348  C CD  . PRO A 1 52  ? 46.939 148.020 -25.081 1.00 32.60  ? 49  PRO A CD  1 
ATOM   349  N N   . PRO A 1 53  ? 49.838 151.786 -25.190 1.00 28.81  ? 50  PRO A N   1 
ATOM   350  C CA  . PRO A 1 53  ? 49.820 153.248 -25.097 1.00 25.68  ? 50  PRO A CA  1 
ATOM   351  C C   . PRO A 1 53  ? 49.188 153.883 -26.324 1.00 43.36  ? 50  PRO A C   1 
ATOM   352  O O   . PRO A 1 53  ? 49.107 153.292 -27.403 1.00 40.61  ? 50  PRO A O   1 
ATOM   353  C CB  . PRO A 1 53  ? 51.304 153.609 -24.993 1.00 34.44  ? 50  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 53  ? 51.976 152.532 -25.780 1.00 28.95  ? 50  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 53  ? 51.188 151.275 -25.480 1.00 22.74  ? 50  PRO A CD  1 
ATOM   356  N N   . GLU A 1 54  ? 48.730 155.116 -26.136 1.00 48.09  ? 51  GLU A N   1 
ATOM   357  C CA  . GLU A 1 54  ? 48.246 155.964 -27.208 1.00 45.28  ? 51  GLU A CA  1 
ATOM   358  C C   . GLU A 1 54  ? 49.137 157.192 -27.326 1.00 42.43  ? 51  GLU A C   1 
ATOM   359  O O   . GLU A 1 54  ? 49.701 157.646 -26.326 1.00 39.84  ? 51  GLU A O   1 
ATOM   360  C CB  . GLU A 1 54  ? 46.800 156.410 -26.963 1.00 45.29  ? 51  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 54  ? 45.770 155.307 -27.098 1.00 66.41  ? 51  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 54  ? 44.381 155.777 -26.726 1.00 87.84  ? 51  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 54  ? 44.267 156.852 -26.099 1.00 84.28  ? 51  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 54  ? 43.402 155.074 -27.054 1.00 97.67  ? 51  GLU A OE2 1 
ATOM   365  N N   . PRO A 1 55  ? 49.294 157.745 -28.528 1.00 41.88  ? 52  PRO A N   1 
ATOM   366  C CA  . PRO A 1 55  ? 50.125 158.944 -28.677 1.00 42.74  ? 52  PRO A CA  1 
ATOM   367  C C   . PRO A 1 55  ? 49.582 160.102 -27.854 1.00 40.05  ? 52  PRO A C   1 
ATOM   368  O O   . PRO A 1 55  ? 48.373 160.247 -27.662 1.00 39.74  ? 52  PRO A O   1 
ATOM   369  C CB  . PRO A 1 55  ? 50.052 159.244 -30.180 1.00 37.88  ? 52  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 55  ? 49.681 157.943 -30.810 1.00 44.43  ? 52  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 55  ? 48.785 157.260 -29.822 1.00 36.39  ? 52  PRO A CD  1 
ATOM   372  N N   . LYS A 1 56  ? 50.501 160.924 -27.355 1.00 38.28  ? 53  LYS A N   1 
ATOM   373  C CA  . LYS A 1 56  ? 50.117 162.107 -26.597 1.00 41.21  ? 53  LYS A CA  1 
ATOM   374  C C   . LYS A 1 56  ? 49.392 163.092 -27.505 1.00 44.85  ? 53  LYS A C   1 
ATOM   375  O O   . LYS A 1 56  ? 49.907 163.475 -28.560 1.00 41.12  ? 53  LYS A O   1 
ATOM   376  C CB  . LYS A 1 56  ? 51.351 162.761 -25.977 1.00 38.82  ? 53  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 56  ? 51.078 164.077 -25.260 1.00 38.39  ? 53  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 56  ? 50.244 163.875 -24.006 1.00 37.65  ? 53  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 56  ? 50.116 165.173 -23.222 1.00 38.29  ? 53  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 56  ? 49.322 164.998 -21.975 1.00 43.88  ? 53  LYS A NZ  1 
ATOM   381  N N   . GLN A 1 57  ? 48.189 163.490 -27.100 1.00 46.02  ? 54  GLN A N   1 
ATOM   382  C CA  . GLN A 1 57  ? 47.434 164.454 -27.879 1.00 46.25  ? 54  GLN A CA  1 
ATOM   383  C C   . GLN A 1 57  ? 48.089 165.832 -27.783 1.00 39.91  ? 54  GLN A C   1 
ATOM   384  O O   . GLN A 1 57  ? 48.670 166.180 -26.751 1.00 41.88  ? 54  GLN A O   1 
ATOM   385  C CB  . GLN A 1 57  ? 45.989 164.521 -27.393 1.00 42.18  ? 54  GLN A CB  1 
ATOM   386  C CG  . GLN A 1 57  ? 45.255 163.190 -27.463 1.00 53.78  ? 54  GLN A CG  1 
ATOM   387  C CD  . GLN A 1 57  ? 43.944 163.285 -28.218 1.00 71.92  ? 54  GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 57  ? 43.903 163.112 -29.436 1.00 79.25  ? 54  GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 57  ? 42.863 163.563 -27.497 1.00 69.95  ? 54  GLN A NE2 1 
ATOM   390  N N   . PRO A 1 58  ? 48.020 166.628 -28.851 1.00 50.44  ? 55  PRO A N   1 
ATOM   391  C CA  . PRO A 1 58  ? 48.713 167.922 -28.852 1.00 43.22  ? 55  PRO A CA  1 
ATOM   392  C C   . PRO A 1 58  ? 48.224 168.833 -27.736 1.00 40.90  ? 55  PRO A C   1 
ATOM   393  O O   . PRO A 1 58  ? 47.067 168.773 -27.313 1.00 34.30  ? 55  PRO A O   1 
ATOM   394  C CB  . PRO A 1 58  ? 48.383 168.500 -30.233 1.00 40.62  ? 55  PRO A CB  1 
ATOM   395  C CG  . PRO A 1 58  ? 48.059 167.309 -31.072 1.00 34.68  ? 55  PRO A CG  1 
ATOM   396  C CD  . PRO A 1 58  ? 47.379 166.345 -30.146 1.00 40.40  ? 55  PRO A CD  1 
ATOM   397  N N   . TRP A 1 59  ? 49.128 169.687 -27.263 1.00 35.78  ? 56  TRP A N   1 
ATOM   398  C CA  . TRP A 1 59  ? 48.878 170.545 -26.118 1.00 42.07  ? 56  TRP A CA  1 
ATOM   399  C C   . TRP A 1 59  ? 49.028 172.010 -26.506 1.00 52.60  ? 56  TRP A C   1 
ATOM   400  O O   . TRP A 1 59  ? 49.734 172.357 -27.457 1.00 45.49  ? 56  TRP A O   1 
ATOM   401  C CB  . TRP A 1 59  ? 49.837 170.219 -24.966 1.00 35.88  ? 56  TRP A CB  1 
ATOM   402  C CG  . TRP A 1 59  ? 51.281 170.413 -25.323 1.00 38.78  ? 56  TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 59  ? 52.001 171.569 -25.230 1.00 38.49  ? 56  TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 59  ? 52.180 169.421 -25.834 1.00 34.06  ? 56  TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 59  ? 53.293 171.357 -25.648 1.00 38.76  ? 56  TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 59  ? 53.428 170.047 -26.024 1.00 39.79  ? 56  TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 59  ? 52.051 168.064 -26.148 1.00 32.99  ? 56  TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 59  ? 54.539 169.364 -26.515 1.00 35.85  ? 56  TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 59  ? 53.155 167.387 -26.634 1.00 31.74  ? 56  TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 59  ? 54.383 168.038 -26.813 1.00 35.85  ? 56  TRP A CH2 1 
ATOM   411  N N   . SER A 1 60  ? 48.355 172.868 -25.747 1.00 48.51  ? 57  SER A N   1 
ATOM   412  C CA  . SER A 1 60  ? 48.473 174.307 -25.908 1.00 42.68  ? 57  SER A CA  1 
ATOM   413  C C   . SER A 1 60  ? 49.586 174.848 -25.016 1.00 44.84  ? 57  SER A C   1 
ATOM   414  O O   . SER A 1 60  ? 49.966 174.238 -24.013 1.00 51.00  ? 57  SER A O   1 
ATOM   415  C CB  . SER A 1 60  ? 47.151 175.000 -25.573 1.00 47.43  ? 57  SER A CB  1 
ATOM   416  O OG  . SER A 1 60  ? 46.079 174.444 -26.315 1.00 61.85  ? 57  SER A OG  1 
ATOM   417  N N   . GLY A 1 61  ? 50.110 176.009 -25.398 1.00 44.41  ? 58  GLY A N   1 
ATOM   418  C CA  . GLY A 1 61  ? 51.139 176.636 -24.596 1.00 52.77  ? 58  GLY A CA  1 
ATOM   419  C C   . GLY A 1 61  ? 52.475 175.912 -24.682 1.00 51.68  ? 58  GLY A C   1 
ATOM   420  O O   . GLY A 1 61  ? 52.743 175.124 -25.594 1.00 55.11  ? 58  GLY A O   1 
ATOM   421  N N   . VAL A 1 62  ? 53.321 176.195 -23.696 1.00 40.31  ? 59  VAL A N   1 
ATOM   422  C CA  . VAL A 1 62  ? 54.677 175.663 -23.632 1.00 35.85  ? 59  VAL A CA  1 
ATOM   423  C C   . VAL A 1 62  ? 54.750 174.678 -22.473 1.00 39.43  ? 59  VAL A C   1 
ATOM   424  O O   . VAL A 1 62  ? 54.574 175.063 -21.310 1.00 44.87  ? 59  VAL A O   1 
ATOM   425  C CB  . VAL A 1 62  ? 55.716 176.783 -23.469 1.00 42.12  ? 59  VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 62  ? 57.126 176.213 -23.518 1.00 36.08  ? 59  VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 62  ? 55.523 177.847 -24.539 1.00 43.64  ? 59  VAL A CG2 1 
ATOM   428  N N   . VAL A 1 63  ? 55.006 173.412 -22.788 1.00 39.04  ? 60  VAL A N   1 
ATOM   429  C CA  . VAL A 1 63  ? 55.216 172.397 -21.762 1.00 41.37  ? 60  VAL A CA  1 
ATOM   430  C C   . VAL A 1 63  ? 56.612 172.569 -21.179 1.00 37.01  ? 60  VAL A C   1 
ATOM   431  O O   . VAL A 1 63  ? 57.595 172.711 -21.917 1.00 32.82  ? 60  VAL A O   1 
ATOM   432  C CB  . VAL A 1 63  ? 55.021 170.986 -22.340 1.00 33.77  ? 60  VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 63  ? 55.778 169.956 -21.512 1.00 38.71  ? 60  VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 63  ? 53.545 170.636 -22.379 1.00 27.89  ? 60  VAL A CG2 1 
ATOM   435  N N   . ASP A 1 64  ? 56.702 172.567 -19.852 1.00 31.90  ? 61  ASP A N   1 
ATOM   436  C CA  . ASP A 1 64  ? 57.990 172.695 -19.185 1.00 44.81  ? 61  ASP A CA  1 
ATOM   437  C C   . ASP A 1 64  ? 58.764 171.388 -19.299 1.00 38.59  ? 61  ASP A C   1 
ATOM   438  O O   . ASP A 1 64  ? 58.303 170.341 -18.830 1.00 34.59  ? 61  ASP A O   1 
ATOM   439  C CB  . ASP A 1 64  ? 57.793 173.078 -17.721 1.00 47.26  ? 61  ASP A CB  1 
ATOM   440  C CG  . ASP A 1 64  ? 59.105 173.261 -16.986 1.00 48.44  ? 61  ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 64  ? 59.714 174.345 -17.115 1.00 50.71  ? 61  ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 64  ? 59.528 172.324 -16.278 1.00 49.26  ? 61  ASP A OD2 1 
ATOM   443  N N   . ALA A 1 65  ? 59.937 171.447 -19.926 1.00 35.53  ? 62  ALA A N   1 
ATOM   444  C CA  . ALA A 1 65  ? 60.781 170.270 -20.075 1.00 33.12  ? 62  ALA A CA  1 
ATOM   445  C C   . ALA A 1 65  ? 62.148 170.514 -19.448 1.00 33.96  ? 62  ALA A C   1 
ATOM   446  O O   . ALA A 1 65  ? 63.181 170.322 -20.099 1.00 33.71  ? 62  ALA A O   1 
ATOM   447  C CB  . ALA A 1 65  ? 60.926 169.894 -21.550 1.00 35.27  ? 62  ALA A CB  1 
ATOM   448  N N   . THR A 1 66  ? 62.163 170.934 -18.184 1.00 33.60  ? 63  THR A N   1 
ATOM   449  C CA  . THR A 1 66  ? 63.393 171.290 -17.491 1.00 34.80  ? 63  THR A CA  1 
ATOM   450  C C   . THR A 1 66  ? 63.782 170.299 -16.402 1.00 36.22  ? 63  THR A C   1 
ATOM   451  O O   . THR A 1 66  ? 64.839 170.466 -15.785 1.00 28.02  ? 63  THR A O   1 
ATOM   452  C CB  . THR A 1 66  ? 63.267 172.692 -16.880 1.00 37.81  ? 63  THR A CB  1 
ATOM   453  O OG1 . THR A 1 66  ? 62.147 172.728 -15.987 1.00 30.92  ? 63  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 66  ? 63.070 173.732 -17.971 1.00 30.21  ? 63  THR A CG2 1 
ATOM   455  N N   . THR A 1 67  ? 62.965 169.279 -16.147 1.00 28.95  ? 64  THR A N   1 
ATOM   456  C CA  . THR A 1 67  ? 63.271 168.311 -15.104 1.00 33.33  ? 64  THR A CA  1 
ATOM   457  C C   . THR A 1 67  ? 62.631 166.975 -15.455 1.00 27.57  ? 64  THR A C   1 
ATOM   458  O O   . THR A 1 67  ? 61.660 166.908 -16.214 1.00 30.96  ? 64  THR A O   1 
ATOM   459  C CB  . THR A 1 67  ? 62.791 168.790 -13.727 1.00 38.61  ? 64  THR A CB  1 
ATOM   460  O OG1 . THR A 1 67  ? 63.160 167.832 -12.727 1.00 50.31  ? 64  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 67  ? 61.279 168.968 -13.719 1.00 24.65  ? 64  THR A CG2 1 
ATOM   462  N N   . PHE A 1 68  ? 63.193 165.910 -14.890 1.00 32.15  ? 65  PHE A N   1 
ATOM   463  C CA  . PHE A 1 68  ? 62.682 164.569 -15.135 1.00 30.99  ? 65  PHE A CA  1 
ATOM   464  C C   . PHE A 1 68  ? 61.281 164.408 -14.556 1.00 21.11  ? 65  PHE A C   1 
ATOM   465  O O   . PHE A 1 68  ? 60.943 164.976 -13.513 1.00 29.47  ? 65  PHE A O   1 
ATOM   466  C CB  . PHE A 1 68  ? 63.610 163.520 -14.526 1.00 26.99  ? 65  PHE A CB  1 
ATOM   467  C CG  . PHE A 1 68  ? 64.934 163.397 -15.223 1.00 24.12  ? 65  PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 68  ? 65.018 162.820 -16.480 1.00 25.27  ? 65  PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 68  ? 66.097 163.839 -14.615 1.00 21.89  ? 65  PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 68  ? 66.235 162.697 -17.122 1.00 22.19  ? 65  PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 68  ? 67.319 163.719 -15.252 1.00 26.95  ? 65  PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 68  ? 67.387 163.148 -16.508 1.00 24.73  ? 65  PHE A CZ  1 
ATOM   473  N N   . GLN A 1 69  ? 60.465 163.615 -15.243 1.00 20.04  ? 66  GLN A N   1 
ATOM   474  C CA  . GLN A 1 69  ? 59.100 163.361 -14.812 1.00 27.47  ? 66  GLN A CA  1 
ATOM   475  C C   . GLN A 1 69  ? 59.074 162.185 -13.835 1.00 32.25  ? 66  GLN A C   1 
ATOM   476  O O   . GLN A 1 69  ? 60.110 161.730 -13.343 1.00 29.77  ? 66  GLN A O   1 
ATOM   477  C CB  . GLN A 1 69  ? 58.200 163.123 -16.022 1.00 28.60  ? 66  GLN A CB  1 
ATOM   478  C CG  . GLN A 1 69  ? 57.474 164.369 -16.503 1.00 32.06  ? 66  GLN A CG  1 
ATOM   479  C CD  . GLN A 1 69  ? 56.352 164.788 -15.570 1.00 40.03  ? 66  GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 69  ? 55.957 164.037 -14.678 1.00 36.09  ? 66  GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 69  ? 55.831 165.992 -15.775 1.00 30.08  ? 66  GLN A NE2 1 
ATOM   482  N N   . SER A 1 70  ? 57.877 161.679 -13.551 1.00 29.96  ? 67  SER A N   1 
ATOM   483  C CA  . SER A 1 70  ? 57.708 160.666 -12.522 1.00 36.72  ? 67  SER A CA  1 
ATOM   484  C C   . SER A 1 70  ? 58.247 159.314 -12.977 1.00 34.34  ? 67  SER A C   1 
ATOM   485  O O   . SER A 1 70  ? 58.276 158.995 -14.168 1.00 34.19  ? 67  SER A O   1 
ATOM   486  C CB  . SER A 1 70  ? 56.233 160.534 -12.144 1.00 27.76  ? 67  SER A CB  1 
ATOM   487  O OG  . SER A 1 70  ? 55.722 161.759 -11.651 1.00 35.09  ? 67  SER A OG  1 
ATOM   488  N N   . VAL A 1 71  ? 58.676 158.520 -12.003 1.00 29.15  ? 68  VAL A N   1 
ATOM   489  C CA  . VAL A 1 71  ? 59.112 157.151 -12.248 1.00 20.52  ? 68  VAL A CA  1 
ATOM   490  C C   . VAL A 1 71  ? 57.889 156.246 -12.291 1.00 24.75  ? 68  VAL A C   1 
ATOM   491  O O   . VAL A 1 71  ? 56.956 156.399 -11.494 1.00 26.27  ? 68  VAL A O   1 
ATOM   492  C CB  . VAL A 1 71  ? 60.106 156.705 -11.161 1.00 30.62  ? 68  VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 71  ? 60.511 155.255 -11.361 1.00 25.99  ? 68  VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 71  ? 61.330 157.610 -11.157 1.00 24.42  ? 68  VAL A CG2 1 
ATOM   495  N N   . CYS A 1 72  ? 57.879 155.306 -13.235 1.00 24.28  ? 69  CYS A N   1 
ATOM   496  C CA  . CYS A 1 72  ? 56.782 154.352 -13.316 1.00 27.89  ? 69  CYS A CA  1 
ATOM   497  C C   . CYS A 1 72  ? 56.726 153.506 -12.051 1.00 29.73  ? 69  CYS A C   1 
ATOM   498  O O   . CYS A 1 72  ? 57.761 153.155 -11.475 1.00 26.52  ? 69  CYS A O   1 
ATOM   499  C CB  . CYS A 1 72  ? 56.943 153.458 -14.547 1.00 28.90  ? 69  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 72  ? 56.905 154.336 -16.130 1.00 37.07  ? 69  CYS A SG  1 
ATOM   501  N N   . TYR A 1 73  ? 55.505 153.189 -11.615 1.00 22.14  ? 70  TYR A N   1 
ATOM   502  C CA  . TYR A 1 73  ? 55.310 152.432 -10.383 1.00 32.50  ? 70  TYR A CA  1 
ATOM   503  C C   . TYR A 1 73  ? 56.090 151.125 -10.422 1.00 24.42  ? 70  TYR A C   1 
ATOM   504  O O   . TYR A 1 73  ? 55.980 150.348 -11.374 1.00 25.44  ? 70  TYR A O   1 
ATOM   505  C CB  . TYR A 1 73  ? 53.823 152.152 -10.164 1.00 32.60  ? 70  TYR A CB  1 
ATOM   506  C CG  . TYR A 1 73  ? 53.202 152.994 -9.072  1.00 37.07  ? 70  TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 73  ? 52.396 154.082 -9.379  1.00 34.44  ? 70  TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 73  ? 53.432 152.706 -7.733  1.00 29.72  ? 70  TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 73  ? 51.829 154.855 -8.383  1.00 31.09  ? 70  TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 73  ? 52.871 153.473 -6.730  1.00 29.76  ? 70  TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 73  ? 52.071 154.547 -7.061  1.00 36.01  ? 70  TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 73  ? 51.510 155.313 -6.065  1.00 47.47  ? 70  TYR A OH  1 
ATOM   513  N N   . GLN A 1 74  ? 56.884 150.892 -9.381  1.00 21.85  ? 71  GLN A N   1 
ATOM   514  C CA  . GLN A 1 74  ? 57.799 149.762 -9.381  1.00 22.40  ? 71  GLN A CA  1 
ATOM   515  C C   . GLN A 1 74  ? 58.204 149.437 -7.952  1.00 32.95  ? 71  GLN A C   1 
ATOM   516  O O   . GLN A 1 74  ? 58.048 150.250 -7.037  1.00 28.24  ? 71  GLN A O   1 
ATOM   517  C CB  . GLN A 1 74  ? 59.039 150.055 -10.232 1.00 21.62  ? 71  GLN A CB  1 
ATOM   518  C CG  . GLN A 1 74  ? 59.903 151.181 -9.687  1.00 17.63  ? 71  GLN A CG  1 
ATOM   519  C CD  . GLN A 1 74  ? 61.004 151.586 -10.644 1.00 21.07  ? 71  GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 74  ? 62.184 151.575 -10.293 1.00 27.13  ? 71  GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 74  ? 60.623 151.952 -11.861 1.00 23.84  ? 71  GLN A NE2 1 
ATOM   522  N N   . TYR A 1 75  ? 58.730 148.228 -7.781  1.00 30.16  ? 72  TYR A N   1 
ATOM   523  C CA  . TYR A 1 75  ? 59.274 147.803 -6.502  1.00 24.41  ? 72  TYR A CA  1 
ATOM   524  C C   . TYR A 1 75  ? 60.528 148.604 -6.165  1.00 28.43  ? 72  TYR A C   1 
ATOM   525  O O   . TYR A 1 75  ? 61.301 148.992 -7.045  1.00 33.98  ? 72  TYR A O   1 
ATOM   526  C CB  . TYR A 1 75  ? 59.589 146.307 -6.542  1.00 26.33  ? 72  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 75  ? 60.331 145.777 -5.337  1.00 23.62  ? 72  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 75  ? 59.653 145.425 -4.179  1.00 27.85  ? 72  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 75  ? 61.711 145.613 -5.365  1.00 25.46  ? 72  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 75  ? 60.328 144.934 -3.078  1.00 33.39  ? 72  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 75  ? 62.394 145.124 -4.269  1.00 31.29  ? 72  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 75  ? 61.698 144.786 -3.128  1.00 32.13  ? 72  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 75  ? 62.373 144.297 -2.034  1.00 44.63  ? 72  TYR A OH  1 
ATOM   534  N N   . VAL A 1 76  ? 60.721 148.856 -4.873  1.00 25.61  ? 73  VAL A N   1 
ATOM   535  C CA  . VAL A 1 76  ? 61.873 149.596 -4.369  1.00 27.14  ? 73  VAL A CA  1 
ATOM   536  C C   . VAL A 1 76  ? 62.761 148.630 -3.598  1.00 29.48  ? 73  VAL A C   1 
ATOM   537  O O   . VAL A 1 76  ? 62.289 147.931 -2.692  1.00 35.87  ? 73  VAL A O   1 
ATOM   538  C CB  . VAL A 1 76  ? 61.442 150.779 -3.485  1.00 35.25  ? 73  VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 76  ? 62.661 151.469 -2.891  1.00 31.60  ? 73  VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 76  ? 60.607 151.764 -4.289  1.00 30.83  ? 73  VAL A CG2 1 
ATOM   541  N N   . ASP A 1 77  ? 64.043 148.593 -3.956  1.00 31.14  ? 74  ASP A N   1 
ATOM   542  C CA  . ASP A 1 77  ? 64.970 147.648 -3.348  1.00 27.15  ? 74  ASP A CA  1 
ATOM   543  C C   . ASP A 1 77  ? 65.240 148.023 -1.895  1.00 32.89  ? 74  ASP A C   1 
ATOM   544  O O   . ASP A 1 77  ? 65.535 149.181 -1.584  1.00 38.19  ? 74  ASP A O   1 
ATOM   545  C CB  . ASP A 1 77  ? 66.277 147.613 -4.138  1.00 32.78  ? 74  ASP A CB  1 
ATOM   546  C CG  . ASP A 1 77  ? 67.178 146.468 -3.722  1.00 30.39  ? 74  ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 77  ? 67.926 146.625 -2.733  1.00 30.31  ? 74  ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 77  ? 67.138 145.411 -4.385  1.00 36.49  ? 74  ASP A OD2 1 
ATOM   549  N N   . THR A 1 78  ? 65.141 147.034 -1.001  1.00 33.14  ? 75  THR A N   1 
ATOM   550  C CA  . THR A 1 78  ? 65.350 147.252 0.426   1.00 41.45  ? 75  THR A CA  1 
ATOM   551  C C   . THR A 1 78  ? 66.355 146.268 1.017   1.00 36.33  ? 75  THR A C   1 
ATOM   552  O O   . THR A 1 78  ? 66.408 146.111 2.241   1.00 43.88  ? 75  THR A O   1 
ATOM   553  C CB  . THR A 1 78  ? 64.026 147.162 1.192   1.00 42.40  ? 75  THR A CB  1 
ATOM   554  O OG1 . THR A 1 78  ? 63.421 145.883 0.958   1.00 42.89  ? 75  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 78  ? 63.070 148.262 0.749   1.00 34.99  ? 75  THR A CG2 1 
ATOM   556  N N   . LEU A 1 79  ? 67.155 145.606 0.177   1.00 36.22  ? 76  LEU A N   1 
ATOM   557  C CA  . LEU A 1 79  ? 68.087 144.602 0.683   1.00 35.13  ? 76  LEU A CA  1 
ATOM   558  C C   . LEU A 1 79  ? 69.154 145.231 1.571   1.00 39.44  ? 76  LEU A C   1 
ATOM   559  O O   . LEU A 1 79  ? 69.492 144.687 2.628   1.00 40.12  ? 76  LEU A O   1 
ATOM   560  C CB  . LEU A 1 79  ? 68.732 143.846 -0.479  1.00 38.00  ? 76  LEU A CB  1 
ATOM   561  C CG  . LEU A 1 79  ? 69.681 142.711 -0.082  1.00 47.46  ? 76  LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 79  ? 68.945 141.646 0.718   1.00 38.63  ? 76  LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 79  ? 70.347 142.098 -1.305  1.00 34.51  ? 76  LEU A CD2 1 
ATOM   564  N N   . TYR A 1 80  ? 69.695 146.377 1.160   1.00 35.41  ? 77  TYR A N   1 
ATOM   565  C CA  . TYR A 1 80  ? 70.704 147.099 1.933   1.00 35.66  ? 77  TYR A CA  1 
ATOM   566  C C   . TYR A 1 80  ? 70.294 148.562 2.014   1.00 36.60  ? 77  TYR A C   1 
ATOM   567  O O   . TYR A 1 80  ? 70.706 149.382 1.181   1.00 31.78  ? 77  TYR A O   1 
ATOM   568  C CB  . TYR A 1 80  ? 72.092 146.947 1.314   1.00 31.96  ? 77  TYR A CB  1 
ATOM   569  C CG  . TYR A 1 80  ? 72.605 145.526 1.285   1.00 33.97  ? 77  TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 80  ? 72.932 144.862 2.460   1.00 32.36  ? 77  TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 80  ? 72.775 144.853 0.083   1.00 35.27  ? 77  TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 80  ? 73.407 143.563 2.439   1.00 30.67  ? 77  TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 80  ? 73.249 143.555 0.051   1.00 37.15  ? 77  TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 80  ? 73.563 142.915 1.230   1.00 38.80  ? 77  TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 80  ? 74.036 141.623 1.200   1.00 42.58  ? 77  TYR A OH  1 
ATOM   576  N N   . PRO A 1 81  ? 69.476 148.926 3.001   1.00 35.86  ? 78  PRO A N   1 
ATOM   577  C CA  . PRO A 1 81  ? 69.053 150.326 3.132   1.00 36.66  ? 78  PRO A CA  1 
ATOM   578  C C   . PRO A 1 81  ? 70.240 151.257 3.332   1.00 41.77  ? 78  PRO A C   1 
ATOM   579  O O   . PRO A 1 81  ? 71.169 150.961 4.088   1.00 36.65  ? 78  PRO A O   1 
ATOM   580  C CB  . PRO A 1 81  ? 68.140 150.306 4.364   1.00 29.59  ? 78  PRO A CB  1 
ATOM   581  C CG  . PRO A 1 81  ? 67.661 148.894 4.455   1.00 35.55  ? 78  PRO A CG  1 
ATOM   582  C CD  . PRO A 1 81  ? 68.804 148.050 3.976   1.00 28.94  ? 78  PRO A CD  1 
ATOM   583  N N   . GLY A 1 82  ? 70.201 152.394 2.639   1.00 32.61  ? 79  GLY A N   1 
ATOM   584  C CA  . GLY A 1 82  ? 71.253 153.383 2.716   1.00 38.12  ? 79  GLY A CA  1 
ATOM   585  C C   . GLY A 1 82  ? 72.515 153.047 1.953   1.00 43.15  ? 79  GLY A C   1 
ATOM   586  O O   . GLY A 1 82  ? 73.478 153.822 2.015   1.00 38.56  ? 79  GLY A O   1 
ATOM   587  N N   . PHE A 1 83  ? 72.544 151.928 1.234   1.00 34.34  ? 80  PHE A N   1 
ATOM   588  C CA  . PHE A 1 83  ? 73.731 151.501 0.508   1.00 34.01  ? 80  PHE A CA  1 
ATOM   589  C C   . PHE A 1 83  ? 73.744 152.122 -0.882  1.00 35.84  ? 80  PHE A C   1 
ATOM   590  O O   . PHE A 1 83  ? 72.733 152.097 -1.592  1.00 36.67  ? 80  PHE A O   1 
ATOM   591  C CB  . PHE A 1 83  ? 73.781 149.976 0.416   1.00 36.03  ? 80  PHE A CB  1 
ATOM   592  C CG  . PHE A 1 83  ? 75.010 149.445 -0.265  1.00 25.82  ? 80  PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 83  ? 76.273 149.820 0.162   1.00 32.38  ? 80  PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 83  ? 74.902 148.554 -1.320  1.00 27.03  ? 80  PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 83  ? 77.405 149.327 -0.459  1.00 28.06  ? 80  PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 83  ? 76.031 148.055 -1.943  1.00 31.87  ? 80  PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 83  ? 77.284 148.443 -1.513  1.00 29.41  ? 80  PHE A CZ  1 
ATOM   598  N N   . GLU A 1 84  ? 74.895 152.680 -1.263  1.00 28.65  ? 81  GLU A N   1 
ATOM   599  C CA  . GLU A 1 84  ? 75.018 153.333 -2.562  1.00 35.48  ? 81  GLU A CA  1 
ATOM   600  C C   . GLU A 1 84  ? 74.871 152.335 -3.706  1.00 34.06  ? 81  GLU A C   1 
ATOM   601  O O   . GLU A 1 84  ? 74.280 152.657 -4.744  1.00 33.01  ? 81  GLU A O   1 
ATOM   602  C CB  . GLU A 1 84  ? 76.361 154.060 -2.643  1.00 35.02  ? 81  GLU A CB  1 
ATOM   603  C CG  . GLU A 1 84  ? 76.767 154.500 -4.039  1.00 42.67  ? 81  GLU A CG  1 
ATOM   604  C CD  . GLU A 1 84  ? 78.128 155.169 -4.062  1.00 53.53  ? 81  GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 84  ? 78.382 156.035 -3.199  1.00 65.08  ? 81  GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 84  ? 78.949 154.821 -4.937  1.00 43.05  ? 81  GLU A OE2 1 
ATOM   607  N N   . GLY A 1 85  ? 75.386 151.117 -3.528  1.00 31.85  ? 82  GLY A N   1 
ATOM   608  C CA  . GLY A 1 85  ? 75.384 150.150 -4.614  1.00 36.19  ? 82  GLY A CA  1 
ATOM   609  C C   . GLY A 1 85  ? 73.997 149.717 -5.048  1.00 27.85  ? 82  GLY A C   1 
ATOM   610  O O   . GLY A 1 85  ? 73.786 149.387 -6.218  1.00 27.12  ? 82  GLY A O   1 
ATOM   611  N N   . THR A 1 86  ? 73.037 149.706 -4.125  1.00 28.73  ? 83  THR A N   1 
ATOM   612  C CA  . THR A 1 86  ? 71.668 149.324 -4.453  1.00 31.85  ? 83  THR A CA  1 
ATOM   613  C C   . THR A 1 86  ? 70.757 150.517 -4.707  1.00 22.28  ? 83  THR A C   1 
ATOM   614  O O   . THR A 1 86  ? 69.919 150.465 -5.612  1.00 29.21  ? 83  THR A O   1 
ATOM   615  C CB  . THR A 1 86  ? 71.063 148.463 -3.338  1.00 28.25  ? 83  THR A CB  1 
ATOM   616  O OG1 . THR A 1 86  ? 71.294 149.085 -2.068  1.00 30.82  ? 83  THR A OG1 1 
ATOM   617  C CG2 . THR A 1 86  ? 71.672 147.071 -3.344  1.00 33.91  ? 83  THR A CG2 1 
ATOM   618  N N   . GLU A 1 87  ? 70.895 151.594 -3.935  1.00 28.66  ? 84  GLU A N   1 
ATOM   619  C CA  . GLU A 1 87  ? 69.980 152.720 -4.061  1.00 35.00  ? 84  GLU A CA  1 
ATOM   620  C C   . GLU A 1 87  ? 70.273 153.606 -5.265  1.00 29.03  ? 84  GLU A C   1 
ATOM   621  O O   . GLU A 1 87  ? 69.460 154.482 -5.577  1.00 31.82  ? 84  GLU A O   1 
ATOM   622  C CB  . GLU A 1 87  ? 69.995 153.553 -2.777  1.00 33.55  ? 84  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 87  ? 69.037 153.020 -1.723  1.00 40.61  ? 84  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 87  ? 69.327 153.541 -0.332  1.00 49.89  ? 84  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 87  ? 68.711 153.030 0.627   1.00 48.93  ? 84  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 87  ? 70.169 154.454 -0.195  1.00 57.28  ? 84  GLU A OE2 1 
ATOM   627  N N   . MET A 1 88  ? 71.398 153.400 -5.954  1.00 32.14  ? 85  MET A N   1 
ATOM   628  C CA  . MET A 1 88  ? 71.643 154.131 -7.192  1.00 28.69  ? 85  MET A CA  1 
ATOM   629  C C   . MET A 1 88  ? 70.690 153.710 -8.302  1.00 24.63  ? 85  MET A C   1 
ATOM   630  O O   . MET A 1 88  ? 70.549 154.437 -9.290  1.00 28.02  ? 85  MET A O   1 
ATOM   631  C CB  . MET A 1 88  ? 73.090 153.938 -7.647  1.00 22.15  ? 85  MET A CB  1 
ATOM   632  C CG  . MET A 1 88  ? 73.482 152.488 -7.875  1.00 28.61  ? 85  MET A CG  1 
ATOM   633  S SD  . MET A 1 88  ? 75.169 152.310 -8.484  1.00 27.21  ? 85  MET A SD  1 
ATOM   634  C CE  . MET A 1 88  ? 75.011 152.981 -10.138 1.00 22.84  ? 85  MET A CE  1 
ATOM   635  N N   . TRP A 1 89  ? 70.036 152.557 -8.160  1.00 24.24  ? 86  TRP A N   1 
ATOM   636  C CA  . TRP A 1 89  ? 69.056 152.086 -9.128  1.00 26.66  ? 86  TRP A CA  1 
ATOM   637  C C   . TRP A 1 89  ? 67.619 152.337 -8.689  1.00 27.08  ? 86  TRP A C   1 
ATOM   638  O O   . TRP A 1 89  ? 66.704 152.177 -9.504  1.00 20.36  ? 86  TRP A O   1 
ATOM   639  C CB  . TRP A 1 89  ? 69.251 150.587 -9.392  1.00 27.02  ? 86  TRP A CB  1 
ATOM   640  C CG  . TRP A 1 89  ? 70.680 150.188 -9.617  1.00 28.78  ? 86  TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 89  ? 71.517 149.594 -8.717  1.00 36.92  ? 86  TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 89  ? 71.441 150.355 -10.820 1.00 34.38  ? 86  TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 89  ? 72.750 149.379 -9.284  1.00 28.52  ? 86  TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 89  ? 72.729 149.837 -10.575 1.00 34.30  ? 86  TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 89  ? 71.158 150.892 -12.080 1.00 33.40  ? 86  TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 89  ? 73.732 149.841 -11.543 1.00 25.33  ? 86  TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 89  ? 72.155 150.892 -13.040 1.00 28.36  ? 86  TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 89  ? 73.426 150.371 -12.766 1.00 30.90  ? 86  TRP A CH2 1 
ATOM   649  N N   . ASN A 1 90  ? 67.401 152.718 -7.432  1.00 28.89  ? 87  ASN A N   1 
ATOM   650  C CA  . ASN A 1 90  ? 66.061 152.976 -6.934  1.00 30.13  ? 87  ASN A CA  1 
ATOM   651  C C   . ASN A 1 90  ? 65.496 154.256 -7.550  1.00 29.94  ? 87  ASN A C   1 
ATOM   652  O O   . ASN A 1 90  ? 66.246 155.097 -8.051  1.00 24.80  ? 87  ASN A O   1 
ATOM   653  C CB  . ASN A 1 90  ? 66.078 153.080 -5.410  1.00 31.83  ? 87  ASN A CB  1 
ATOM   654  C CG  . ASN A 1 90  ? 66.069 151.723 -4.736  1.00 30.07  ? 87  ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 90  ? 65.570 150.745 -5.293  1.00 30.45  ? 87  ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 90  ? 66.617 151.657 -3.529  1.00 34.72  ? 87  ASN A ND2 1 
ATOM   657  N N   . PRO A 1 91  ? 64.172 154.419 -7.535  1.00 27.17  ? 88  PRO A N   1 
ATOM   658  C CA  . PRO A 1 91  ? 63.574 155.627 -8.121  1.00 30.86  ? 88  PRO A CA  1 
ATOM   659  C C   . PRO A 1 91  ? 64.060 156.890 -7.423  1.00 29.37  ? 88  PRO A C   1 
ATOM   660  O O   . PRO A 1 91  ? 64.100 156.966 -6.192  1.00 20.46  ? 88  PRO A O   1 
ATOM   661  C CB  . PRO A 1 91  ? 62.069 155.412 -7.915  1.00 22.40  ? 88  PRO A CB  1 
ATOM   662  C CG  . PRO A 1 91  ? 61.910 153.936 -7.800  1.00 25.23  ? 88  PRO A CG  1 
ATOM   663  C CD  . PRO A 1 91  ? 63.145 153.453 -7.104  1.00 25.79  ? 88  PRO A CD  1 
ATOM   664  N N   . ASN A 1 92  ? 64.441 157.883 -8.226  1.00 30.16  ? 89  ASN A N   1 
ATOM   665  C CA  . ASN A 1 92  ? 64.834 159.191 -7.721  1.00 27.44  ? 89  ASN A CA  1 
ATOM   666  C C   . ASN A 1 92  ? 63.786 160.261 -7.991  1.00 27.97  ? 89  ASN A C   1 
ATOM   667  O O   . ASN A 1 92  ? 64.016 161.434 -7.678  1.00 32.83  ? 89  ASN A O   1 
ATOM   668  C CB  . ASN A 1 92  ? 66.185 159.610 -8.316  1.00 28.93  ? 89  ASN A CB  1 
ATOM   669  C CG  . ASN A 1 92  ? 66.165 159.672 -9.828  1.00 35.61  ? 89  ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 92  ? 65.291 159.095 -10.475 1.00 30.13  ? 89  ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 92  ? 67.139 160.369 -10.402 1.00 27.35  ? 89  ASN A ND2 1 
ATOM   672  N N   . ARG A 1 93  ? 62.651 159.888 -8.578  1.00 27.96  ? 90  ARG A N   1 
ATOM   673  C CA  . ARG A 1 93  ? 61.468 160.730 -8.647  1.00 19.93  ? 90  ARG A CA  1 
ATOM   674  C C   . ARG A 1 93  ? 60.299 159.947 -8.066  1.00 25.26  ? 90  ARG A C   1 
ATOM   675  O O   . ARG A 1 93  ? 60.363 158.724 -7.917  1.00 40.42  ? 90  ARG A O   1 
ATOM   676  C CB  . ARG A 1 93  ? 61.157 161.170 -10.086 1.00 20.63  ? 90  ARG A CB  1 
ATOM   677  C CG  . ARG A 1 93  ? 62.232 162.036 -10.725 1.00 31.87  ? 90  ARG A CG  1 
ATOM   678  C CD  . ARG A 1 93  ? 62.443 163.327 -9.951  1.00 27.54  ? 90  ARG A CD  1 
ATOM   679  N NE  . ARG A 1 93  ? 63.284 164.268 -10.685 1.00 28.34  ? 90  ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 93  ? 64.612 164.273 -10.646 1.00 33.30  ? 90  ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 93  ? 65.259 163.384 -9.906  1.00 29.86  ? 90  ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 93  ? 65.294 165.167 -11.349 1.00 35.89  ? 90  ARG A NH2 1 
ATOM   683  N N   . GLU A 1 94  ? 59.227 160.658 -7.730  1.00 25.53  ? 91  GLU A N   1 
ATOM   684  C CA  . GLU A 1 94  ? 58.083 160.004 -7.112  1.00 28.62  ? 91  GLU A CA  1 
ATOM   685  C C   . GLU A 1 94  ? 57.398 159.066 -8.100  1.00 37.36  ? 91  GLU A C   1 
ATOM   686  O O   . GLU A 1 94  ? 57.395 159.294 -9.313  1.00 31.75  ? 91  GLU A O   1 
ATOM   687  C CB  . GLU A 1 94  ? 57.088 161.038 -6.583  1.00 30.14  ? 91  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 94  ? 56.371 161.846 -7.649  1.00 51.09  ? 91  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 94  ? 55.467 162.906 -7.050  1.00 71.86  ? 91  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 94  ? 55.992 163.841 -6.409  1.00 74.32  ? 91  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 94  ? 54.233 162.795 -7.206  1.00 64.47  ? 91  GLU A OE2 1 
ATOM   692  N N   . LEU A 1 95  ? 56.825 157.991 -7.566  1.00 24.14  ? 92  LEU A N   1 
ATOM   693  C CA  . LEU A 1 95  ? 56.175 156.984 -8.390  1.00 23.39  ? 92  LEU A CA  1 
ATOM   694  C C   . LEU A 1 95  ? 54.800 157.460 -8.842  1.00 25.90  ? 92  LEU A C   1 
ATOM   695  O O   . LEU A 1 95  ? 54.094 158.169 -8.119  1.00 33.67  ? 92  LEU A O   1 
ATOM   696  C CB  . LEU A 1 95  ? 56.039 155.667 -7.624  1.00 29.45  ? 92  LEU A CB  1 
ATOM   697  C CG  . LEU A 1 95  ? 57.325 155.039 -7.082  1.00 24.82  ? 92  LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 95  ? 57.018 153.737 -6.360  1.00 16.58  ? 92  LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 95  ? 58.330 154.814 -8.201  1.00 26.56  ? 92  LEU A CD2 1 
ATOM   700  N N   . SER A 1 96  ? 54.423 157.053 -10.051 1.00 30.34  ? 93  SER A N   1 
ATOM   701  C CA  . SER A 1 96  ? 53.127 157.390 -10.626 1.00 28.28  ? 93  SER A CA  1 
ATOM   702  C C   . SER A 1 96  ? 52.915 156.555 -11.878 1.00 30.21  ? 93  SER A C   1 
ATOM   703  O O   . SER A 1 96  ? 53.871 156.226 -12.586 1.00 28.94  ? 93  SER A O   1 
ATOM   704  C CB  . SER A 1 96  ? 53.030 158.883 -10.966 1.00 25.01  ? 93  SER A CB  1 
ATOM   705  O OG  . SER A 1 96  ? 51.865 159.160 -11.724 1.00 27.90  ? 93  SER A OG  1 
ATOM   706  N N   . GLU A 1 97  ? 51.651 156.212 -12.138 1.00 22.42  ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 97  ? 51.309 155.588 -13.410 1.00 21.52  ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 97  ? 51.397 156.579 -14.563 1.00 28.09  ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 97  ? 51.554 156.162 -15.715 1.00 31.76  ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 97  ? 49.909 154.976 -13.346 1.00 26.19  ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 97  ? 49.747 153.906 -12.278 1.00 23.13  ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 97  ? 48.449 153.136 -12.418 1.00 38.12  ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 97  ? 48.336 152.317 -13.356 1.00 33.68  ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 97  ? 47.535 153.356 -11.597 1.00 39.22  ? 94  GLU A OE2 1 
ATOM   715  N N   . ASP A 1 98  ? 51.296 157.877 -14.273 1.00 32.40  ? 95  ASP A N   1 
ATOM   716  C CA  . ASP A 1 98  ? 51.549 158.934 -15.251 1.00 32.28  ? 95  ASP A CA  1 
ATOM   717  C C   . ASP A 1 98  ? 53.063 159.095 -15.364 1.00 30.75  ? 95  ASP A C   1 
ATOM   718  O O   . ASP A 1 98  ? 53.686 159.950 -14.728 1.00 29.38  ? 95  ASP A O   1 
ATOM   719  C CB  . ASP A 1 98  ? 50.868 160.231 -14.828 1.00 30.03  ? 95  ASP A CB  1 
ATOM   720  C CG  . ASP A 1 98  ? 50.874 161.286 -15.921 1.00 34.04  ? 95  ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 98  ? 51.613 161.126 -16.915 1.00 31.13  ? 95  ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 98  ? 50.138 162.287 -15.782 1.00 42.00  ? 95  ASP A OD2 1 
ATOM   723  N N   . CYS A 1 99  ? 53.666 158.245 -16.196 1.00 28.44  ? 96  CYS A N   1 
ATOM   724  C CA  . CYS A 1 99  ? 55.118 158.192 -16.283 1.00 31.58  ? 96  CYS A CA  1 
ATOM   725  C C   . CYS A 1 99  ? 55.659 158.076 -17.700 1.00 24.92  ? 96  CYS A C   1 
ATOM   726  O O   . CYS A 1 99  ? 56.878 157.965 -17.861 1.00 29.58  ? 96  CYS A O   1 
ATOM   727  C CB  . CYS A 1 99  ? 55.653 157.014 -15.452 1.00 27.68  ? 96  CYS A CB  1 
ATOM   728  S SG  . CYS A 1 99  ? 55.161 155.381 -16.067 1.00 36.52  ? 96  CYS A SG  1 
ATOM   729  N N   . LEU A 1 100 ? 54.811 158.099 -18.728 1.00 26.43  ? 97  LEU A N   1 
ATOM   730  C CA  . LEU A 1 100 ? 55.266 157.886 -20.102 1.00 26.27  ? 97  LEU A CA  1 
ATOM   731  C C   . LEU A 1 100 ? 55.810 159.200 -20.656 1.00 26.25  ? 97  LEU A C   1 
ATOM   732  O O   . LEU A 1 100 ? 55.157 159.924 -21.411 1.00 34.40  ? 97  LEU A O   1 
ATOM   733  C CB  . LEU A 1 100 ? 54.141 157.320 -20.957 1.00 22.00  ? 97  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 100 ? 53.696 155.924 -20.509 1.00 27.00  ? 97  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 100 ? 52.724 155.304 -21.499 1.00 24.87  ? 97  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 100 ? 54.906 155.021 -20.300 1.00 19.15  ? 97  LEU A CD2 1 
ATOM   737  N N   . TYR A 1 101 ? 57.047 159.500 -20.269 1.00 23.55  ? 98  TYR A N   1 
ATOM   738  C CA  . TYR A 1 101 ? 57.756 160.689 -20.711 1.00 26.50  ? 98  TYR A CA  1 
ATOM   739  C C   . TYR A 1 101 ? 59.149 160.291 -21.178 1.00 30.58  ? 98  TYR A C   1 
ATOM   740  O O   . TYR A 1 101 ? 59.725 159.315 -20.691 1.00 35.03  ? 98  TYR A O   1 
ATOM   741  C CB  . TYR A 1 101 ? 57.858 161.734 -19.586 1.00 21.36  ? 98  TYR A CB  1 
ATOM   742  C CG  . TYR A 1 101 ? 56.520 162.204 -19.058 1.00 35.50  ? 98  TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 101 ? 55.960 163.397 -19.495 1.00 37.83  ? 98  TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 101 ? 55.817 161.456 -18.121 1.00 31.86  ? 98  TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 101 ? 54.739 163.832 -19.016 1.00 28.90  ? 98  TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 101 ? 54.595 161.882 -17.637 1.00 38.09  ? 98  TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 101 ? 54.061 163.071 -18.088 1.00 41.07  ? 98  TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 101 ? 52.845 163.499 -17.609 1.00 31.64  ? 98  TYR A OH  1 
ATOM   749  N N   . LEU A 1 102 ? 59.687 161.050 -22.132 1.00 29.60  ? 99  LEU A N   1 
ATOM   750  C CA  . LEU A 1 102 ? 61.016 160.788 -22.663 1.00 28.28  ? 99  LEU A CA  1 
ATOM   751  C C   . LEU A 1 102 ? 61.877 162.039 -22.544 1.00 27.19  ? 99  LEU A C   1 
ATOM   752  O O   . LEU A 1 102 ? 61.388 163.138 -22.273 1.00 30.66  ? 99  LEU A O   1 
ATOM   753  C CB  . LEU A 1 102 ? 60.960 160.297 -24.121 1.00 23.48  ? 99  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 102 ? 60.226 161.079 -25.217 1.00 29.83  ? 99  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 102 ? 61.039 162.261 -25.726 1.00 23.68  ? 99  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 102 ? 59.877 160.146 -26.367 1.00 16.40  ? 99  LEU A CD2 1 
ATOM   757  N N   . ASN A 1 103 ? 63.178 161.855 -22.759 1.00 28.98  ? 100 ASN A N   1 
ATOM   758  C CA  . ASN A 1 103 ? 64.159 162.919 -22.617 1.00 29.17  ? 100 ASN A CA  1 
ATOM   759  C C   . ASN A 1 103 ? 65.008 163.004 -23.877 1.00 28.47  ? 100 ASN A C   1 
ATOM   760  O O   . ASN A 1 103 ? 65.211 162.007 -24.574 1.00 30.40  ? 100 ASN A O   1 
ATOM   761  C CB  . ASN A 1 103 ? 65.057 162.684 -21.395 1.00 31.14  ? 100 ASN A CB  1 
ATOM   762  C CG  . ASN A 1 103 ? 64.304 162.065 -20.233 1.00 34.98  ? 100 ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 103 ? 63.656 162.764 -19.454 1.00 36.95  ? 100 ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 103 ? 64.386 160.745 -20.112 1.00 33.61  ? 100 ASN A ND2 1 
ATOM   765  N N   . VAL A 1 104 ? 65.499 164.210 -24.166 1.00 31.13  ? 101 VAL A N   1 
ATOM   766  C CA  . VAL A 1 104 ? 66.313 164.465 -25.352 1.00 25.43  ? 101 VAL A CA  1 
ATOM   767  C C   . VAL A 1 104 ? 67.482 165.356 -24.954 1.00 26.01  ? 101 VAL A C   1 
ATOM   768  O O   . VAL A 1 104 ? 67.276 166.479 -24.479 1.00 35.99  ? 101 VAL A O   1 
ATOM   769  C CB  . VAL A 1 104 ? 65.509 165.125 -26.487 1.00 25.94  ? 101 VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 104 ? 66.423 165.452 -27.661 1.00 34.58  ? 101 VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 104 ? 64.366 164.225 -26.936 1.00 22.18  ? 101 VAL A CG2 1 
ATOM   772  N N   . TRP A 1 105 ? 68.702 164.860 -25.142 1.00 30.41  ? 102 TRP A N   1 
ATOM   773  C CA  . TRP A 1 105 ? 69.915 165.655 -24.996 1.00 32.06  ? 102 TRP A CA  1 
ATOM   774  C C   . TRP A 1 105 ? 70.445 166.000 -26.383 1.00 39.96  ? 102 TRP A C   1 
ATOM   775  O O   . TRP A 1 105 ? 70.516 165.130 -27.258 1.00 41.10  ? 102 TRP A O   1 
ATOM   776  C CB  . TRP A 1 105 ? 70.985 164.904 -24.201 1.00 29.41  ? 102 TRP A CB  1 
ATOM   777  C CG  . TRP A 1 105 ? 70.679 164.700 -22.745 1.00 31.07  ? 102 TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 105 ? 71.086 165.483 -21.702 1.00 28.60  ? 102 TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 105 ? 69.922 163.629 -22.169 1.00 26.45  ? 102 TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 105 ? 70.621 164.970 -20.514 1.00 29.64  ? 102 TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 105 ? 69.903 163.832 -20.774 1.00 24.71  ? 102 TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 105 ? 69.253 162.520 -22.698 1.00 30.56  ? 102 TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 105 ? 69.242 162.968 -19.902 1.00 23.79  ? 102 TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 105 ? 68.597 161.664 -21.831 1.00 30.83  ? 102 TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 105 ? 68.596 161.893 -20.449 1.00 31.11  ? 102 TRP A CH2 1 
ATOM   786  N N   . THR A 1 106 ? 70.811 167.262 -26.580 1.00 38.58  ? 103 THR A N   1 
ATOM   787  C CA  . THR A 1 106 ? 71.341 167.733 -27.850 1.00 43.27  ? 103 THR A CA  1 
ATOM   788  C C   . THR A 1 106 ? 72.491 168.692 -27.582 1.00 38.59  ? 103 THR A C   1 
ATOM   789  O O   . THR A 1 106 ? 72.463 169.437 -26.596 1.00 42.33  ? 103 THR A O   1 
ATOM   790  C CB  . THR A 1 106 ? 70.257 168.420 -28.700 1.00 38.36  ? 103 THR A CB  1 
ATOM   791  O OG1 . THR A 1 106 ? 70.822 168.885 -29.932 1.00 43.45  ? 103 THR A OG1 1 
ATOM   792  C CG2 . THR A 1 106 ? 69.639 169.590 -27.953 1.00 30.37  ? 103 THR A CG2 1 
ATOM   793  N N   . PRO A 1 107 ? 73.521 168.678 -28.424 1.00 40.27  ? 104 PRO A N   1 
ATOM   794  C CA  . PRO A 1 107 ? 74.703 169.507 -28.160 1.00 46.05  ? 104 PRO A CA  1 
ATOM   795  C C   . PRO A 1 107 ? 74.406 170.991 -28.303 1.00 45.61  ? 104 PRO A C   1 
ATOM   796  O O   . PRO A 1 107 ? 73.437 171.407 -28.943 1.00 35.67  ? 104 PRO A O   1 
ATOM   797  C CB  . PRO A 1 107 ? 75.709 169.047 -29.223 1.00 40.01  ? 104 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 107 ? 75.194 167.729 -29.711 1.00 51.32  ? 104 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 107 ? 73.711 167.803 -29.593 1.00 38.39  ? 104 PRO A CD  1 
ATOM   800  N N   . TYR A 1 108 ? 75.267 171.794 -27.685 1.00 47.74  ? 105 TYR A N   1 
ATOM   801  C CA  . TYR A 1 108 ? 75.244 173.237 -27.890 1.00 51.75  ? 105 TYR A CA  1 
ATOM   802  C C   . TYR A 1 108 ? 76.533 173.692 -28.571 1.00 52.98  ? 105 TYR A C   1 
ATOM   803  O O   . TYR A 1 108 ? 77.627 173.389 -28.095 1.00 50.21  ? 105 TYR A O   1 
ATOM   804  C CB  . TYR A 1 108 ? 75.054 173.992 -26.574 1.00 56.88  ? 105 TYR A CB  1 
ATOM   805  C CG  . TYR A 1 108 ? 75.021 175.492 -26.764 1.00 58.55  ? 105 TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 108 ? 76.167 176.261 -26.593 1.00 62.07  ? 105 TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 108 ? 73.850 176.138 -27.138 1.00 57.12  ? 105 TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 108 ? 76.143 177.630 -26.777 1.00 70.85  ? 105 TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 108 ? 73.817 177.507 -27.324 1.00 65.48  ? 105 TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 108 ? 74.965 178.247 -27.142 1.00 77.32  ? 105 TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 108 ? 74.936 179.611 -27.326 1.00 81.93  ? 105 TYR A OH  1 
ATOM   812  N N   . PRO A 1 109 ? 76.408 174.426 -29.689 1.00 56.51  ? 106 PRO A N   1 
ATOM   813  C CA  . PRO A 1 109 ? 75.134 174.811 -30.307 1.00 52.69  ? 106 PRO A CA  1 
ATOM   814  C C   . PRO A 1 109 ? 74.435 173.641 -30.994 1.00 45.30  ? 106 PRO A C   1 
ATOM   815  O O   . PRO A 1 109 ? 75.081 172.634 -31.285 1.00 45.33  ? 106 PRO A O   1 
ATOM   816  C CB  . PRO A 1 109 ? 75.550 175.871 -31.329 1.00 45.90  ? 106 PRO A CB  1 
ATOM   817  C CG  . PRO A 1 109 ? 76.946 175.506 -31.686 1.00 59.97  ? 106 PRO A CG  1 
ATOM   818  C CD  . PRO A 1 109 ? 77.562 174.979 -30.420 1.00 59.97  ? 106 PRO A CD  1 
ATOM   819  N N   . ARG A 1 110 ? 73.132 173.778 -31.220 1.00 34.05  ? 107 ARG A N   1 
ATOM   820  C CA  . ARG A 1 110 ? 72.365 172.707 -31.835 1.00 37.27  ? 107 ARG A CA  1 
ATOM   821  C C   . ARG A 1 110 ? 72.969 172.345 -33.190 1.00 49.34  ? 107 ARG A C   1 
ATOM   822  O O   . ARG A 1 110 ? 73.374 173.237 -33.946 1.00 51.88  ? 107 ARG A O   1 
ATOM   823  C CB  . ARG A 1 110 ? 70.904 173.127 -32.005 1.00 35.97  ? 107 ARG A CB  1 
ATOM   824  C CG  . ARG A 1 110 ? 69.976 172.012 -32.458 1.00 37.56  ? 107 ARG A CG  1 
ATOM   825  C CD  . ARG A 1 110 ? 68.563 172.526 -32.655 1.00 38.98  ? 107 ARG A CD  1 
ATOM   826  N NE  . ARG A 1 110 ? 68.118 173.327 -31.518 1.00 52.27  ? 107 ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 110 ? 66.914 173.877 -31.418 1.00 56.99  ? 107 ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 110 ? 66.024 173.713 -32.387 1.00 57.24  ? 107 ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 110 ? 66.598 174.592 -30.348 1.00 59.71  ? 107 ARG A NH2 1 
ATOM   830  N N   . PRO A 1 111 ? 73.071 171.058 -33.516 1.00 57.94  ? 108 PRO A N   1 
ATOM   831  C CA  . PRO A 1 111 ? 73.613 170.672 -34.824 1.00 60.02  ? 108 PRO A CA  1 
ATOM   832  C C   . PRO A 1 111 ? 72.764 171.227 -35.958 1.00 59.46  ? 108 PRO A C   1 
ATOM   833  O O   . PRO A 1 111 ? 71.535 171.121 -35.949 1.00 52.52  ? 108 PRO A O   1 
ATOM   834  C CB  . PRO A 1 111 ? 73.577 169.140 -34.783 1.00 55.31  ? 108 PRO A CB  1 
ATOM   835  C CG  . PRO A 1 111 ? 73.603 168.801 -33.331 1.00 46.23  ? 108 PRO A CG  1 
ATOM   836  C CD  . PRO A 1 111 ? 72.830 169.891 -32.650 1.00 50.69  ? 108 PRO A CD  1 
ATOM   837  N N   . THR A 1 112 ? 73.436 171.834 -36.938 1.00 58.92  ? 109 THR A N   1 
ATOM   838  C CA  . THR A 1 112 ? 72.737 172.391 -38.090 1.00 60.63  ? 109 THR A CA  1 
ATOM   839  C C   . THR A 1 112 ? 72.429 171.327 -39.136 1.00 59.84  ? 109 THR A C   1 
ATOM   840  O O   . THR A 1 112 ? 71.443 171.453 -39.871 1.00 56.89  ? 109 THR A O   1 
ATOM   841  C CB  . THR A 1 112 ? 73.565 173.515 -38.713 1.00 54.14  ? 109 THR A CB  1 
ATOM   842  O OG1 . THR A 1 112 ? 74.861 173.017 -39.066 1.00 68.54  ? 109 THR A OG1 1 
ATOM   843  C CG2 . THR A 1 112 ? 73.721 174.665 -37.729 1.00 53.30  ? 109 THR A CG2 1 
ATOM   844  N N   . SER A 1 113 ? 73.252 170.286 -39.216 1.00 63.02  ? 110 SER A N   1 
ATOM   845  C CA  . SER A 1 113 ? 73.100 169.136 -40.089 1.00 62.37  ? 110 SER A CA  1 
ATOM   846  C C   . SER A 1 113 ? 72.604 167.930 -39.297 1.00 68.03  ? 110 SER A C   1 
ATOM   847  O O   . SER A 1 113 ? 72.816 167.849 -38.083 1.00 59.65  ? 110 SER A O   1 
ATOM   848  C CB  . SER A 1 113 ? 74.431 168.796 -40.768 1.00 61.57  ? 110 SER A CB  1 
ATOM   849  O OG  . SER A 1 113 ? 75.479 168.692 -39.820 1.00 71.57  ? 110 SER A OG  1 
ATOM   850  N N   . PRO A 1 114 ? 71.923 166.989 -39.952 1.00 64.48  ? 111 PRO A N   1 
ATOM   851  C CA  . PRO A 1 114 ? 71.414 165.811 -39.236 1.00 54.48  ? 111 PRO A CA  1 
ATOM   852  C C   . PRO A 1 114 ? 72.535 165.028 -38.565 1.00 55.06  ? 111 PRO A C   1 
ATOM   853  O O   . PRO A 1 114 ? 73.537 164.677 -39.191 1.00 56.41  ? 111 PRO A O   1 
ATOM   854  C CB  . PRO A 1 114 ? 70.734 164.996 -40.342 1.00 60.42  ? 111 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 114 ? 70.348 166.009 -41.363 1.00 59.20  ? 111 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 114 ? 71.444 167.037 -41.345 1.00 54.84  ? 111 PRO A CD  1 
ATOM   857  N N   . THR A 1 115 ? 72.349 164.754 -37.268 1.00 53.92  ? 112 THR A N   1 
ATOM   858  C CA  . THR A 1 115 ? 73.288 164.082 -36.383 1.00 49.15  ? 112 THR A CA  1 
ATOM   859  C C   . THR A 1 115 ? 72.743 162.724 -35.950 1.00 50.94  ? 112 THR A C   1 
ATOM   860  O O   . THR A 1 115 ? 71.544 162.602 -35.674 1.00 43.54  ? 112 THR A O   1 
ATOM   861  C CB  . THR A 1 115 ? 73.564 164.948 -35.143 1.00 52.09  ? 112 THR A CB  1 
ATOM   862  O OG1 . THR A 1 115 ? 74.313 166.107 -35.527 1.00 54.80  ? 112 THR A OG1 1 
ATOM   863  C CG2 . THR A 1 115 ? 74.341 164.178 -34.086 1.00 50.20  ? 112 THR A CG2 1 
ATOM   864  N N   . PRO A 1 116 ? 73.584 161.686 -35.908 1.00 45.93  ? 113 PRO A N   1 
ATOM   865  C CA  . PRO A 1 116 ? 73.113 160.371 -35.456 1.00 53.05  ? 113 PRO A CA  1 
ATOM   866  C C   . PRO A 1 116 ? 72.519 160.429 -34.055 1.00 48.11  ? 113 PRO A C   1 
ATOM   867  O O   . PRO A 1 116 ? 72.876 161.279 -33.236 1.00 42.51  ? 113 PRO A O   1 
ATOM   868  C CB  . PRO A 1 116 ? 74.381 159.511 -35.491 1.00 51.43  ? 113 PRO A CB  1 
ATOM   869  C CG  . PRO A 1 116 ? 75.230 160.156 -36.534 1.00 44.92  ? 113 PRO A CG  1 
ATOM   870  C CD  . PRO A 1 116 ? 74.964 161.632 -36.422 1.00 45.81  ? 113 PRO A CD  1 
ATOM   871  N N   . VAL A 1 117 ? 71.599 159.504 -33.786 1.00 35.53  ? 114 VAL A N   1 
ATOM   872  C CA  . VAL A 1 117 ? 70.796 159.512 -32.569 1.00 40.89  ? 114 VAL A CA  1 
ATOM   873  C C   . VAL A 1 117 ? 71.052 158.229 -31.792 1.00 42.35  ? 114 VAL A C   1 
ATOM   874  O O   . VAL A 1 117 ? 70.971 157.129 -32.352 1.00 40.50  ? 114 VAL A O   1 
ATOM   875  C CB  . VAL A 1 117 ? 69.296 159.662 -32.885 1.00 43.77  ? 114 VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 117 ? 68.483 159.704 -31.599 1.00 35.36  ? 114 VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 117 ? 69.050 160.907 -33.722 1.00 38.26  ? 114 VAL A CG2 1 
ATOM   878  N N   . LEU A 1 118 ? 71.355 158.373 -30.504 1.00 46.10  ? 115 LEU A N   1 
ATOM   879  C CA  . LEU A 1 118 ? 71.439 157.253 -29.577 1.00 32.01  ? 115 LEU A CA  1 
ATOM   880  C C   . LEU A 1 118 ? 70.182 157.230 -28.718 1.00 39.14  ? 115 LEU A C   1 
ATOM   881  O O   . LEU A 1 118 ? 69.749 158.272 -28.218 1.00 43.81  ? 115 LEU A O   1 
ATOM   882  C CB  . LEU A 1 118 ? 72.683 157.361 -28.693 1.00 32.09  ? 115 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 118 ? 74.019 156.959 -29.317 1.00 36.37  ? 115 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 118 ? 75.171 157.347 -28.406 1.00 36.84  ? 115 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 118 ? 74.039 155.465 -29.595 1.00 29.79  ? 115 LEU A CD2 1 
ATOM   886  N N   . VAL A 1 119 ? 69.595 156.047 -28.556 1.00 36.77  ? 116 VAL A N   1 
ATOM   887  C CA  . VAL A 1 119 ? 68.360 155.879 -27.797 1.00 39.02  ? 116 VAL A CA  1 
ATOM   888  C C   . VAL A 1 119 ? 68.610 154.855 -26.698 1.00 36.69  ? 116 VAL A C   1 
ATOM   889  O O   . VAL A 1 119 ? 68.870 153.680 -26.985 1.00 35.42  ? 116 VAL A O   1 
ATOM   890  C CB  . VAL A 1 119 ? 67.189 155.450 -28.693 1.00 33.28  ? 116 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 119 ? 65.933 155.266 -27.861 1.00 23.72  ? 116 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 119 ? 66.959 156.475 -29.793 1.00 33.10  ? 116 VAL A CG2 1 
ATOM   893  N N   . TRP A 1 120 ? 68.515 155.298 -25.446 1.00 32.69  ? 117 TRP A N   1 
ATOM   894  C CA  . TRP A 1 120 ? 68.808 154.456 -24.294 1.00 26.69  ? 117 TRP A CA  1 
ATOM   895  C C   . TRP A 1 120 ? 67.543 153.792 -23.767 1.00 28.31  ? 117 TRP A C   1 
ATOM   896  O O   . TRP A 1 120 ? 66.479 154.414 -23.699 1.00 33.68  ? 117 TRP A O   1 
ATOM   897  C CB  . TRP A 1 120 ? 69.468 155.279 -23.186 1.00 28.85  ? 117 TRP A CB  1 
ATOM   898  C CG  . TRP A 1 120 ? 69.717 154.515 -21.915 1.00 35.58  ? 117 TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 120 ? 69.071 154.673 -20.722 1.00 33.26  ? 117 TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 120 ? 70.679 153.472 -21.713 1.00 39.72  ? 117 TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 120 ? 69.574 153.796 -19.791 1.00 32.01  ? 117 TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 120 ? 70.561 153.046 -20.375 1.00 33.77  ? 117 TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 120 ? 71.628 152.856 -22.534 1.00 33.05  ? 117 TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 120 ? 71.357 152.035 -19.840 1.00 32.73  ? 117 TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 120 ? 72.418 151.853 -22.001 1.00 33.48  ? 117 TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 120 ? 72.277 151.453 -20.667 1.00 35.57  ? 117 TRP A CH2 1 
ATOM   907  N N   . ILE A 1 121 ? 67.668 152.519 -23.403 1.00 24.95  ? 118 ILE A N   1 
ATOM   908  C CA  . ILE A 1 121 ? 66.597 151.753 -22.776 1.00 26.51  ? 118 ILE A CA  1 
ATOM   909  C C   . ILE A 1 121 ? 67.168 151.166 -21.494 1.00 32.30  ? 118 ILE A C   1 
ATOM   910  O O   . ILE A 1 121 ? 68.039 150.288 -21.543 1.00 32.96  ? 118 ILE A O   1 
ATOM   911  C CB  . ILE A 1 121 ? 66.054 150.646 -23.690 1.00 25.44  ? 118 ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 121 ? 65.588 151.231 -25.024 1.00 32.18  ? 118 ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 121 ? 64.912 149.906 -23.009 1.00 26.11  ? 118 ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 121 ? 65.084 150.191 -26.003 1.00 31.27  ? 118 ILE A CD1 1 
ATOM   915  N N   . TYR A 1 122 ? 66.689 151.648 -20.350 1.00 33.47  ? 119 TYR A N   1 
ATOM   916  C CA  . TYR A 1 122 ? 67.237 151.210 -19.077 1.00 28.67  ? 119 TYR A CA  1 
ATOM   917  C C   . TYR A 1 122 ? 66.860 149.759 -18.790 1.00 26.37  ? 119 TYR A C   1 
ATOM   918  O O   . TYR A 1 122 ? 65.880 149.221 -19.315 1.00 21.32  ? 119 TYR A O   1 
ATOM   919  C CB  . TYR A 1 122 ? 66.756 152.112 -17.937 1.00 24.03  ? 119 TYR A CB  1 
ATOM   920  C CG  . TYR A 1 122 ? 65.251 152.232 -17.791 1.00 21.39  ? 119 TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 122 ? 64.504 151.224 -17.192 1.00 22.50  ? 119 TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 122 ? 64.583 153.370 -18.226 1.00 30.81  ? 119 TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 122 ? 63.134 151.338 -17.049 1.00 27.14  ? 119 TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 122 ? 63.213 153.493 -18.085 1.00 16.37  ? 119 TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 122 ? 62.495 152.475 -17.497 1.00 22.32  ? 119 TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 122 ? 61.131 152.590 -17.355 1.00 23.54  ? 119 TYR A OH  1 
ATOM   927  N N   . GLY A 1 123 ? 67.664 149.125 -17.939 1.00 27.76  ? 120 GLY A N   1 
ATOM   928  C CA  . GLY A 1 123 ? 67.391 147.785 -17.471 1.00 28.00  ? 120 GLY A CA  1 
ATOM   929  C C   . GLY A 1 123 ? 66.660 147.790 -16.144 1.00 35.23  ? 120 GLY A C   1 
ATOM   930  O O   . GLY A 1 123 ? 66.166 148.815 -15.669 1.00 26.40  ? 120 GLY A O   1 
ATOM   931  N N   . GLY A 1 124 ? 66.598 146.610 -15.535 1.00 32.69  ? 121 GLY A N   1 
ATOM   932  C CA  . GLY A 1 124 ? 65.919 146.464 -14.265 1.00 24.30  ? 121 GLY A CA  1 
ATOM   933  C C   . GLY A 1 124 ? 64.981 145.277 -14.226 1.00 34.70  ? 121 GLY A C   1 
ATOM   934  O O   . GLY A 1 124 ? 63.962 145.309 -13.529 1.00 26.32  ? 121 GLY A O   1 
ATOM   935  N N   . GLY A 1 125 ? 65.310 144.230 -14.981 1.00 31.33  ? 122 GLY A N   1 
ATOM   936  C CA  . GLY A 1 125 ? 64.543 142.997 -14.959 1.00 25.88  ? 122 GLY A CA  1 
ATOM   937  C C   . GLY A 1 125 ? 63.086 143.138 -15.333 1.00 23.54  ? 122 GLY A C   1 
ATOM   938  O O   . GLY A 1 125 ? 62.274 142.294 -14.944 1.00 28.27  ? 122 GLY A O   1 
ATOM   939  N N   . PHE A 1 126 ? 62.730 144.184 -16.077 1.00 22.89  ? 123 PHE A N   1 
ATOM   940  C CA  . PHE A 1 126 ? 61.359 144.507 -16.467 1.00 24.70  ? 123 PHE A CA  1 
ATOM   941  C C   . PHE A 1 126 ? 60.454 144.793 -15.273 1.00 23.12  ? 123 PHE A C   1 
ATOM   942  O O   . PHE A 1 126 ? 59.231 144.882 -15.437 1.00 25.57  ? 123 PHE A O   1 
ATOM   943  C CB  . PHE A 1 126 ? 60.737 143.404 -17.336 1.00 22.35  ? 123 PHE A CB  1 
ATOM   944  C CG  . PHE A 1 126 ? 61.463 143.167 -18.630 1.00 27.11  ? 123 PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 126 ? 61.275 144.015 -19.710 1.00 27.76  ? 123 PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 126 ? 62.325 142.092 -18.770 1.00 28.47  ? 123 PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 126 ? 61.940 143.799 -20.903 1.00 29.37  ? 123 PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 126 ? 62.993 141.870 -19.961 1.00 30.52  ? 123 PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 126 ? 62.800 142.724 -21.029 1.00 30.54  ? 123 PHE A CZ  1 
ATOM   950  N N   . TYR A 1 127 ? 61.021 144.945 -14.073 1.00 22.61  ? 124 TYR A N   1 
ATOM   951  C CA  . TYR A 1 127 ? 60.248 145.282 -12.888 1.00 25.91  ? 124 TYR A CA  1 
ATOM   952  C C   . TYR A 1 127 ? 60.625 146.624 -12.278 1.00 28.94  ? 124 TYR A C   1 
ATOM   953  O O   . TYR A 1 127 ? 59.928 147.083 -11.366 1.00 28.20  ? 124 TYR A O   1 
ATOM   954  C CB  . TYR A 1 127 ? 60.394 144.189 -11.814 1.00 23.61  ? 124 TYR A CB  1 
ATOM   955  C CG  . TYR A 1 127 ? 61.726 144.181 -11.089 1.00 33.68  ? 124 TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 127 ? 61.931 144.961 -9.955  1.00 27.47  ? 124 TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 127 ? 62.772 143.378 -11.526 1.00 28.00  ? 124 TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 127 ? 63.142 144.957 -9.293  1.00 25.35  ? 124 TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 127 ? 63.987 143.368 -10.867 1.00 29.37  ? 124 TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 127 ? 64.165 144.158 -9.751  1.00 27.19  ? 124 TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 127 ? 65.371 144.150 -9.090  1.00 30.64  ? 124 TYR A OH  1 
ATOM   962  N N   . SER A 1 128 ? 61.699 147.257 -12.738 1.00 25.64  ? 125 SER A N   1 
ATOM   963  C CA  . SER A 1 128 ? 62.178 148.497 -12.143 1.00 22.18  ? 125 SER A CA  1 
ATOM   964  C C   . SER A 1 128 ? 62.980 149.256 -13.193 1.00 23.33  ? 125 SER A C   1 
ATOM   965  O O   . SER A 1 128 ? 63.139 148.804 -14.330 1.00 23.60  ? 125 SER A O   1 
ATOM   966  C CB  . SER A 1 128 ? 63.015 148.221 -10.891 1.00 28.45  ? 125 SER A CB  1 
ATOM   967  O OG  . SER A 1 128 ? 64.168 147.459 -11.205 1.00 23.97  ? 125 SER A OG  1 
ATOM   968  N N   . GLY A 1 129 ? 63.488 150.412 -12.798 1.00 26.54  ? 126 GLY A N   1 
ATOM   969  C CA  . GLY A 1 129 ? 64.280 151.245 -13.674 1.00 23.25  ? 126 GLY A CA  1 
ATOM   970  C C   . GLY A 1 129 ? 63.596 152.570 -13.972 1.00 29.18  ? 126 GLY A C   1 
ATOM   971  O O   . GLY A 1 129 ? 62.377 152.725 -13.847 1.00 26.51  ? 126 GLY A O   1 
ATOM   972  N N   . ALA A 1 130 ? 64.411 153.539 -14.379 1.00 23.13  ? 127 ALA A N   1 
ATOM   973  C CA  . ALA A 1 130 ? 63.930 154.876 -14.690 1.00 29.57  ? 127 ALA A CA  1 
ATOM   974  C C   . ALA A 1 130 ? 64.989 155.591 -15.513 1.00 26.77  ? 127 ALA A C   1 
ATOM   975  O O   . ALA A 1 130 ? 66.189 155.373 -15.326 1.00 21.66  ? 127 ALA A O   1 
ATOM   976  C CB  . ALA A 1 130 ? 63.611 155.671 -13.418 1.00 18.34  ? 127 ALA A CB  1 
ATOM   977  N N   . SER A 1 131 ? 64.531 156.444 -16.430 1.00 28.61  ? 128 SER A N   1 
ATOM   978  C CA  . SER A 1 131 ? 65.448 157.229 -17.245 1.00 30.95  ? 128 SER A CA  1 
ATOM   979  C C   . SER A 1 131 ? 66.074 158.389 -16.482 1.00 28.19  ? 128 SER A C   1 
ATOM   980  O O   . SER A 1 131 ? 66.995 159.026 -17.004 1.00 37.49  ? 128 SER A O   1 
ATOM   981  C CB  . SER A 1 131 ? 64.728 157.762 -18.488 1.00 21.95  ? 128 SER A CB  1 
ATOM   982  O OG  . SER A 1 131 ? 63.674 158.641 -18.134 1.00 33.67  ? 128 SER A OG  1 
ATOM   983  N N   . SER A 1 132 ? 65.611 158.666 -15.264 1.00 27.69  ? 129 SER A N   1 
ATOM   984  C CA  . SER A 1 132 ? 66.070 159.806 -14.482 1.00 27.85  ? 129 SER A CA  1 
ATOM   985  C C   . SER A 1 132 ? 67.259 159.489 -13.585 1.00 28.59  ? 129 SER A C   1 
ATOM   986  O O   . SER A 1 132 ? 67.748 160.389 -12.895 1.00 24.52  ? 129 SER A O   1 
ATOM   987  C CB  . SER A 1 132 ? 64.921 160.347 -13.625 1.00 26.71  ? 129 SER A CB  1 
ATOM   988  O OG  . SER A 1 132 ? 64.370 159.328 -12.809 1.00 28.23  ? 129 SER A OG  1 
ATOM   989  N N   . LEU A 1 133 ? 67.731 158.243 -13.574 1.00 25.20  ? 130 LEU A N   1 
ATOM   990  C CA  . LEU A 1 133 ? 68.826 157.868 -12.688 1.00 29.89  ? 130 LEU A CA  1 
ATOM   991  C C   . LEU A 1 133 ? 70.088 158.652 -13.028 1.00 24.26  ? 130 LEU A C   1 
ATOM   992  O O   . LEU A 1 133 ? 70.378 158.919 -14.197 1.00 28.33  ? 130 LEU A O   1 
ATOM   993  C CB  . LEU A 1 133 ? 69.091 156.365 -12.785 1.00 26.96  ? 130 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 133 ? 67.940 155.444 -12.372 1.00 27.72  ? 130 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 133 ? 68.361 153.985 -12.451 1.00 20.85  ? 130 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 133 ? 67.449 155.786 -10.975 1.00 22.01  ? 130 LEU A CD2 1 
ATOM   997  N N   . ASP A 1 134 ? 70.837 159.027 -11.985 1.00 31.60  ? 131 ASP A N   1 
ATOM   998  C CA  . ASP A 1 134 ? 72.040 159.834 -12.175 1.00 31.33  ? 131 ASP A CA  1 
ATOM   999  C C   . ASP A 1 134 ? 73.043 159.152 -13.095 1.00 33.96  ? 131 ASP A C   1 
ATOM   1000 O O   . ASP A 1 134 ? 73.755 159.828 -13.847 1.00 34.45  ? 131 ASP A O   1 
ATOM   1001 C CB  . ASP A 1 134 ? 72.694 160.136 -10.825 1.00 22.19  ? 131 ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 134 ? 71.815 160.978 -9.922  1.00 27.17  ? 131 ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 134 ? 70.829 161.559 -10.423 1.00 33.86  ? 131 ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 134 ? 72.116 161.066 -8.713  1.00 36.85  ? 131 ASP A OD2 1 
ATOM   1005 N N   . VAL A 1 135 ? 73.111 157.819 -13.057 1.00 35.38  ? 132 VAL A N   1 
ATOM   1006 C CA  . VAL A 1 135 ? 74.073 157.087 -13.871 1.00 31.79  ? 132 VAL A CA  1 
ATOM   1007 C C   . VAL A 1 135 ? 73.699 157.069 -15.347 1.00 28.28  ? 132 VAL A C   1 
ATOM   1008 O O   . VAL A 1 135 ? 74.503 156.628 -16.177 1.00 29.71  ? 132 VAL A O   1 
ATOM   1009 C CB  . VAL A 1 135 ? 74.225 155.658 -13.307 1.00 26.28  ? 132 VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 135 ? 73.019 154.806 -13.672 1.00 25.42  ? 132 VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 135 ? 75.529 155.017 -13.768 1.00 29.97  ? 132 VAL A CG2 1 
ATOM   1012 N N   . TYR A 1 136 ? 72.509 157.552 -15.702 1.00 32.92  ? 133 TYR A N   1 
ATOM   1013 C CA  . TYR A 1 136 ? 72.087 157.657 -17.092 1.00 26.96  ? 133 TYR A CA  1 
ATOM   1014 C C   . TYR A 1 136 ? 72.171 159.084 -17.622 1.00 31.42  ? 133 TYR A C   1 
ATOM   1015 O O   . TYR A 1 136 ? 71.624 159.370 -18.692 1.00 32.29  ? 133 TYR A O   1 
ATOM   1016 C CB  . TYR A 1 136 ? 70.660 157.128 -17.258 1.00 24.01  ? 133 TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 136 ? 70.465 155.692 -16.823 1.00 33.39  ? 133 TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 136 ? 71.508 154.776 -16.879 1.00 26.62  ? 133 TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 136 ? 69.233 155.252 -16.354 1.00 34.06  ? 133 TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 136 ? 71.329 153.463 -16.480 1.00 29.54  ? 133 TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 136 ? 69.045 153.943 -15.954 1.00 26.27  ? 133 TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 136 ? 70.095 153.053 -16.018 1.00 29.77  ? 133 TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 136 ? 69.912 151.749 -15.621 1.00 27.13  ? 133 TYR A OH  1 
ATOM   1024 N N   . ASP A 1 137 ? 72.835 159.983 -16.897 1.00 33.55  ? 134 ASP A N   1 
ATOM   1025 C CA  . ASP A 1 137 ? 72.939 161.374 -17.319 1.00 29.33  ? 134 ASP A CA  1 
ATOM   1026 C C   . ASP A 1 137 ? 73.709 161.473 -18.629 1.00 35.47  ? 134 ASP A C   1 
ATOM   1027 O O   . ASP A 1 137 ? 74.884 161.100 -18.700 1.00 34.38  ? 134 ASP A O   1 
ATOM   1028 C CB  . ASP A 1 137 ? 73.622 162.199 -16.228 1.00 31.57  ? 134 ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 137 ? 73.616 163.685 -16.527 1.00 42.03  ? 134 ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 137 ? 72.789 164.124 -17.355 1.00 43.74  ? 134 ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 137 ? 74.433 164.415 -15.929 1.00 36.94  ? 134 ASP A OD2 1 
ATOM   1032 N N   . GLY A 1 138 ? 73.046 161.980 -19.664 1.00 34.83  ? 135 GLY A N   1 
ATOM   1033 C CA  . GLY A 1 138 ? 73.629 162.000 -20.990 1.00 42.63  ? 135 GLY A CA  1 
ATOM   1034 C C   . GLY A 1 138 ? 74.279 163.307 -21.390 1.00 40.38  ? 135 GLY A C   1 
ATOM   1035 O O   . GLY A 1 138 ? 74.446 163.578 -22.582 1.00 37.97  ? 135 GLY A O   1 
ATOM   1036 N N   . ARG A 1 139 ? 74.662 164.128 -20.410 1.00 36.39  ? 136 ARG A N   1 
ATOM   1037 C CA  . ARG A 1 139 ? 75.289 165.403 -20.736 1.00 43.62  ? 136 ARG A CA  1 
ATOM   1038 C C   . ARG A 1 139 ? 76.742 165.235 -21.164 1.00 46.21  ? 136 ARG A C   1 
ATOM   1039 O O   . ARG A 1 139 ? 77.246 166.044 -21.950 1.00 49.34  ? 136 ARG A O   1 
ATOM   1040 C CB  . ARG A 1 139 ? 75.198 166.361 -19.546 1.00 26.40  ? 136 ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 139 ? 76.152 166.052 -18.405 1.00 36.98  ? 136 ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 139 ? 75.960 167.034 -17.265 1.00 34.44  ? 136 ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 139 ? 74.624 166.924 -16.690 1.00 39.18  ? 136 ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 139 ? 74.127 167.760 -15.785 1.00 40.03  ? 136 ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 139 ? 74.855 168.779 -15.350 1.00 35.68  ? 136 ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 139 ? 72.899 167.579 -15.319 1.00 45.44  ? 136 ARG A NH2 1 
ATOM   1047 N N   . PHE A 1 140 ? 77.423 164.197 -20.674 1.00 38.49  ? 137 PHE A N   1 
ATOM   1048 C CA  . PHE A 1 140 ? 78.830 164.011 -21.012 1.00 39.28  ? 137 PHE A CA  1 
ATOM   1049 C C   . PHE A 1 140 ? 78.994 163.290 -22.344 1.00 35.45  ? 137 PHE A C   1 
ATOM   1050 O O   . PHE A 1 140 ? 79.916 163.596 -23.108 1.00 39.27  ? 137 PHE A O   1 
ATOM   1051 C CB  . PHE A 1 140 ? 79.538 163.248 -19.892 1.00 32.63  ? 137 PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 140 ? 79.371 163.875 -18.537 1.00 38.58  ? 137 PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 140 ? 78.436 163.384 -17.641 1.00 39.59  ? 137 PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 140 ? 80.140 164.966 -18.164 1.00 32.06  ? 137 PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 140 ? 78.277 163.963 -16.396 1.00 36.42  ? 137 PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 140 ? 79.985 165.549 -16.921 1.00 35.35  ? 137 PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 140 ? 79.052 165.047 -16.035 1.00 37.18  ? 137 PHE A CZ  1 
ATOM   1058 N N   . LEU A 1 141 ? 78.109 162.337 -22.642 1.00 45.79  ? 138 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 141 ? 78.178 161.631 -23.917 1.00 44.85  ? 138 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 141 ? 77.807 162.547 -25.077 1.00 42.57  ? 138 LEU A C   1 
ATOM   1061 O O   . LEU A 1 141 ? 78.374 162.436 -26.170 1.00 42.77  ? 138 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 141 ? 77.263 160.407 -23.884 1.00 31.15  ? 138 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 141 ? 77.146 159.579 -25.165 1.00 42.48  ? 138 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 141 ? 78.486 158.961 -25.533 1.00 48.12  ? 138 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 141 ? 76.079 158.508 -25.008 1.00 36.45  ? 138 LEU A CD2 1 
ATOM   1066 N N   . VAL A 1 142 ? 76.860 163.459 -24.856 1.00 46.25  ? 139 VAL A N   1 
ATOM   1067 C CA  . VAL A 1 142 ? 76.426 164.362 -25.917 1.00 34.88  ? 139 VAL A CA  1 
ATOM   1068 C C   . VAL A 1 142 ? 77.444 165.475 -26.134 1.00 38.38  ? 139 VAL A C   1 
ATOM   1069 O O   . VAL A 1 142 ? 77.685 165.899 -27.269 1.00 42.65  ? 139 VAL A O   1 
ATOM   1070 C CB  . VAL A 1 142 ? 75.027 164.913 -25.589 1.00 37.99  ? 139 VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 142 ? 74.705 166.129 -26.442 1.00 44.43  ? 139 VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 142 ? 73.984 163.829 -25.797 1.00 31.14  ? 139 VAL A CG2 1 
ATOM   1073 N N   . GLN A 1 143 ? 78.069 165.958 -25.059 1.00 39.69  ? 140 GLN A N   1 
ATOM   1074 C CA  . GLN A 1 143 ? 79.069 167.010 -25.202 1.00 37.95  ? 140 GLN A CA  1 
ATOM   1075 C C   . GLN A 1 143 ? 80.330 166.478 -25.873 1.00 45.13  ? 140 GLN A C   1 
ATOM   1076 O O   . GLN A 1 143 ? 80.875 167.112 -26.784 1.00 53.27  ? 140 GLN A O   1 
ATOM   1077 C CB  . GLN A 1 143 ? 79.396 167.611 -23.832 1.00 36.84  ? 140 GLN A CB  1 
ATOM   1078 C CG  . GLN A 1 143 ? 80.188 168.917 -23.875 1.00 42.59  ? 140 GLN A CG  1 
ATOM   1079 C CD  . GLN A 1 143 ? 81.660 168.714 -24.186 1.00 53.05  ? 140 GLN A CD  1 
ATOM   1080 O OE1 . GLN A 1 143 ? 82.239 167.677 -23.860 1.00 53.52  ? 140 GLN A OE1 1 
ATOM   1081 N NE2 . GLN A 1 143 ? 82.270 169.702 -24.830 1.00 55.21  ? 140 GLN A NE2 1 
ATOM   1082 N N   . ALA A 1 144 ? 80.808 165.311 -25.435 1.00 48.35  ? 141 ALA A N   1 
ATOM   1083 C CA  . ALA A 1 144 ? 82.103 164.822 -25.899 1.00 47.78  ? 141 ALA A CA  1 
ATOM   1084 C C   . ALA A 1 144 ? 82.041 164.290 -27.325 1.00 39.33  ? 141 ALA A C   1 
ATOM   1085 O O   . ALA A 1 144 ? 83.058 164.292 -28.027 1.00 39.76  ? 141 ALA A O   1 
ATOM   1086 C CB  . ALA A 1 144 ? 82.624 163.739 -24.955 1.00 36.16  ? 141 ALA A CB  1 
ATOM   1087 N N   . GLU A 1 145 ? 80.872 163.835 -27.774 1.00 38.09  ? 142 GLU A N   1 
ATOM   1088 C CA  . GLU A 1 145 ? 80.750 163.192 -29.073 1.00 35.22  ? 142 GLU A CA  1 
ATOM   1089 C C   . GLU A 1 145 ? 79.755 163.869 -30.004 1.00 45.22  ? 142 GLU A C   1 
ATOM   1090 O O   . GLU A 1 145 ? 79.589 163.409 -31.141 1.00 40.98  ? 142 GLU A O   1 
ATOM   1091 C CB  . GLU A 1 145 ? 80.368 161.717 -28.891 1.00 42.46  ? 142 GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 145 ? 81.443 160.901 -28.191 1.00 39.02  ? 142 GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 145 ? 82.724 160.817 -29.001 1.00 42.16  ? 142 GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 145 ? 82.636 160.723 -30.244 1.00 45.03  ? 142 GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 145 ? 83.817 160.854 -28.398 1.00 41.37  ? 142 GLU A OE2 1 
ATOM   1096 N N   . ARG A 1 146 ? 79.098 164.943 -29.562 1.00 55.84  ? 143 ARG A N   1 
ATOM   1097 C CA  . ARG A 1 146 ? 78.157 165.703 -30.388 1.00 49.01  ? 143 ARG A CA  1 
ATOM   1098 C C   . ARG A 1 146 ? 77.103 164.793 -31.015 1.00 42.19  ? 143 ARG A C   1 
ATOM   1099 O O   . ARG A 1 146 ? 76.773 164.905 -32.197 1.00 51.92  ? 143 ARG A O   1 
ATOM   1100 C CB  . ARG A 1 146 ? 78.892 166.515 -31.455 1.00 47.00  ? 143 ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 146 ? 79.903 167.493 -30.878 1.00 54.49  ? 143 ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 146 ? 80.159 168.661 -31.814 1.00 58.18  ? 143 ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 146 ? 78.989 169.525 -31.943 1.00 57.16  ? 143 ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 146 ? 78.676 170.492 -31.087 1.00 57.64  ? 143 ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 146 ? 79.445 170.720 -30.030 1.00 57.49  ? 143 ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 146 ? 77.592 171.230 -31.283 1.00 54.78  ? 143 ARG A NH2 1 
ATOM   1107 N N   . THR A 1 147 ? 76.578 163.878 -30.209 1.00 49.63  ? 144 THR A N   1 
ATOM   1108 C CA  . THR A 1 147 ? 75.492 162.993 -30.596 1.00 49.27  ? 144 THR A CA  1 
ATOM   1109 C C   . THR A 1 147 ? 74.191 163.481 -29.968 1.00 43.24  ? 144 THR A C   1 
ATOM   1110 O O   . THR A 1 147 ? 74.191 164.270 -29.020 1.00 47.01  ? 144 THR A O   1 
ATOM   1111 C CB  . THR A 1 147 ? 75.784 161.553 -30.156 1.00 45.72  ? 144 THR A CB  1 
ATOM   1112 O OG1 . THR A 1 147 ? 77.193 161.304 -30.237 1.00 58.55  ? 144 THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 147 ? 75.060 160.552 -31.046 1.00 45.57  ? 144 THR A CG2 1 
ATOM   1114 N N   . VAL A 1 148 ? 73.074 163.016 -30.518 1.00 38.47  ? 145 VAL A N   1 
ATOM   1115 C CA  . VAL A 1 148 ? 71.756 163.261 -29.944 1.00 40.43  ? 145 VAL A CA  1 
ATOM   1116 C C   . VAL A 1 148 ? 71.356 162.022 -29.158 1.00 41.65  ? 145 VAL A C   1 
ATOM   1117 O O   . VAL A 1 148 ? 71.310 160.916 -29.709 1.00 42.95  ? 145 VAL A O   1 
ATOM   1118 C CB  . VAL A 1 148 ? 70.718 163.594 -31.026 1.00 32.98  ? 145 VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 148 ? 69.322 163.636 -30.423 1.00 36.91  ? 145 VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 148 ? 71.052 164.923 -31.689 1.00 47.13  ? 145 VAL A CG2 1 
ATOM   1121 N N   . LEU A 1 149 ? 71.076 162.197 -27.870 1.00 40.25  ? 146 LEU A N   1 
ATOM   1122 C CA  . LEU A 1 149 ? 70.724 161.094 -26.988 1.00 32.42  ? 146 LEU A CA  1 
ATOM   1123 C C   . LEU A 1 149 ? 69.268 161.219 -26.565 1.00 34.78  ? 146 LEU A C   1 
ATOM   1124 O O   . LEU A 1 149 ? 68.834 162.287 -26.120 1.00 42.00  ? 146 LEU A O   1 
ATOM   1125 C CB  . LEU A 1 149 ? 71.636 161.058 -25.759 1.00 36.96  ? 146 LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 149 ? 71.345 159.962 -24.730 1.00 37.40  ? 146 LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 149 ? 71.294 158.593 -25.388 1.00 33.21  ? 146 LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 149 ? 72.387 159.979 -23.629 1.00 35.71  ? 146 LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 150 ? 68.522 160.129 -26.713 1.00 28.83  ? 147 VAL A N   1 
ATOM   1130 C CA  . VAL A 1 150 ? 67.124 160.050 -26.313 1.00 33.02  ? 147 VAL A CA  1 
ATOM   1131 C C   . VAL A 1 150 ? 66.970 158.885 -25.345 1.00 34.46  ? 147 VAL A C   1 
ATOM   1132 O O   . VAL A 1 150 ? 67.610 157.842 -25.511 1.00 34.28  ? 147 VAL A O   1 
ATOM   1133 C CB  . VAL A 1 150 ? 66.190 159.876 -27.531 1.00 33.04  ? 147 VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 150 ? 64.731 159.878 -27.097 1.00 23.52  ? 147 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 150 ? 66.446 160.965 -28.564 1.00 29.54  ? 147 VAL A CG2 1 
ATOM   1136 N N   . SER A 1 151 ? 66.137 159.070 -24.325 1.00 29.85  ? 148 SER A N   1 
ATOM   1137 C CA  . SER A 1 151 ? 65.806 158.002 -23.393 1.00 31.85  ? 148 SER A CA  1 
ATOM   1138 C C   . SER A 1 151 ? 64.363 158.170 -22.951 1.00 31.16  ? 148 SER A C   1 
ATOM   1139 O O   . SER A 1 151 ? 63.883 159.295 -22.791 1.00 33.19  ? 148 SER A O   1 
ATOM   1140 C CB  . SER A 1 151 ? 66.736 157.997 -22.174 1.00 28.23  ? 148 SER A CB  1 
ATOM   1141 O OG  . SER A 1 151 ? 66.598 159.186 -21.417 1.00 25.95  ? 148 SER A OG  1 
ATOM   1142 N N   . MET A 1 152 ? 63.675 157.048 -22.757 1.00 29.02  ? 149 MET A N   1 
ATOM   1143 C CA  . MET A 1 152 ? 62.263 157.062 -22.416 1.00 28.79  ? 149 MET A CA  1 
ATOM   1144 C C   . MET A 1 152 ? 62.012 156.208 -21.183 1.00 39.64  ? 149 MET A C   1 
ATOM   1145 O O   . MET A 1 152 ? 62.795 155.318 -20.839 1.00 29.14  ? 149 MET A O   1 
ATOM   1146 C CB  . MET A 1 152 ? 61.395 156.553 -23.577 1.00 25.24  ? 149 MET A CB  1 
ATOM   1147 C CG  . MET A 1 152 ? 61.256 155.036 -23.636 1.00 30.79  ? 149 MET A CG  1 
ATOM   1148 S SD  . MET A 1 152 ? 62.802 154.186 -24.005 1.00 33.13  ? 149 MET A SD  1 
ATOM   1149 C CE  . MET A 1 152 ? 63.045 154.665 -25.712 1.00 33.48  ? 149 MET A CE  1 
ATOM   1150 N N   . ASN A 1 153 ? 60.904 156.507 -20.512 1.00 29.16  ? 150 ASN A N   1 
ATOM   1151 C CA  . ASN A 1 153 ? 60.359 155.638 -19.483 1.00 27.05  ? 150 ASN A CA  1 
ATOM   1152 C C   . ASN A 1 153 ? 59.367 154.674 -20.118 1.00 30.57  ? 150 ASN A C   1 
ATOM   1153 O O   . ASN A 1 153 ? 58.617 155.046 -21.026 1.00 31.95  ? 150 ASN A O   1 
ATOM   1154 C CB  . ASN A 1 153 ? 59.664 156.451 -18.390 1.00 23.54  ? 150 ASN A CB  1 
ATOM   1155 C CG  . ASN A 1 153 ? 60.625 156.957 -17.333 1.00 31.08  ? 150 ASN A CG  1 
ATOM   1156 O OD1 . ASN A 1 153 ? 61.838 156.789 -17.445 1.00 37.21  ? 150 ASN A OD1 1 
ATOM   1157 N ND2 . ASN A 1 153 ? 60.082 157.587 -16.296 1.00 24.86  ? 150 ASN A ND2 1 
ATOM   1158 N N   . TYR A 1 154 ? 59.377 153.432 -19.648 1.00 25.17  ? 151 TYR A N   1 
ATOM   1159 C CA  . TYR A 1 154 ? 58.394 152.445 -20.061 1.00 25.40  ? 151 TYR A CA  1 
ATOM   1160 C C   . TYR A 1 154 ? 57.868 151.724 -18.831 1.00 26.79  ? 151 TYR A C   1 
ATOM   1161 O O   . TYR A 1 154 ? 58.578 151.565 -17.833 1.00 27.89  ? 151 TYR A O   1 
ATOM   1162 C CB  . TYR A 1 154 ? 58.976 151.439 -21.070 1.00 28.77  ? 151 TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 154 ? 60.149 150.629 -20.564 1.00 25.36  ? 151 TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 154 ? 61.449 151.102 -20.688 1.00 22.01  ? 151 TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 154 ? 59.958 149.382 -19.983 1.00 25.32  ? 151 TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 154 ? 62.523 150.362 -20.235 1.00 26.25  ? 151 TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 154 ? 61.026 148.635 -19.527 1.00 27.06  ? 151 TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 154 ? 62.306 149.129 -19.655 1.00 28.52  ? 151 TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 154 ? 63.371 148.386 -19.201 1.00 23.47  ? 151 TYR A OH  1 
ATOM   1170 N N   . ARG A 1 155 ? 56.609 151.303 -18.908 1.00 21.55  ? 152 ARG A N   1 
ATOM   1171 C CA  . ARG A 1 155 ? 55.975 150.639 -17.779 1.00 25.92  ? 152 ARG A CA  1 
ATOM   1172 C C   . ARG A 1 155 ? 56.677 149.325 -17.463 1.00 31.38  ? 152 ARG A C   1 
ATOM   1173 O O   . ARG A 1 155 ? 57.003 148.541 -18.358 1.00 31.35  ? 152 ARG A O   1 
ATOM   1174 C CB  . ARG A 1 155 ? 54.496 150.392 -18.073 1.00 27.82  ? 152 ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 155 ? 53.615 151.617 -17.902 1.00 32.47  ? 152 ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 155 ? 52.220 151.365 -18.447 1.00 28.60  ? 152 ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 155 ? 52.201 151.368 -19.907 1.00 25.47  ? 152 ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 155 ? 51.151 151.020 -20.643 1.00 28.01  ? 152 ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 155 ? 50.028 150.630 -20.056 1.00 22.09  ? 152 ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 155 ? 51.226 151.057 -21.966 1.00 29.45  ? 152 ARG A NH2 1 
ATOM   1181 N N   . VAL A 1 156 ? 56.913 149.092 -16.174 1.00 27.03  ? 153 VAL A N   1 
ATOM   1182 C CA  . VAL A 1 156 ? 57.558 147.881 -15.693 1.00 19.27  ? 153 VAL A CA  1 
ATOM   1183 C C   . VAL A 1 156 ? 56.591 147.149 -14.770 1.00 25.78  ? 153 VAL A C   1 
ATOM   1184 O O   . VAL A 1 156 ? 55.526 147.657 -14.416 1.00 27.31  ? 153 VAL A O   1 
ATOM   1185 C CB  . VAL A 1 156 ? 58.888 148.174 -14.973 1.00 23.80  ? 153 VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 156 ? 59.937 148.647 -15.966 1.00 18.42  ? 153 VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 156 ? 58.677 149.211 -13.882 1.00 14.58  ? 153 VAL A CG2 1 
ATOM   1188 N N   . GLY A 1 157 ? 56.981 145.938 -14.382 1.00 26.03  ? 154 GLY A N   1 
ATOM   1189 C CA  . GLY A 1 157 ? 56.169 145.145 -13.483 1.00 18.95  ? 154 GLY A CA  1 
ATOM   1190 C C   . GLY A 1 157 ? 54.837 144.768 -14.103 1.00 23.46  ? 154 GLY A C   1 
ATOM   1191 O O   . GLY A 1 157 ? 54.698 144.623 -15.322 1.00 27.26  ? 154 GLY A O   1 
ATOM   1192 N N   . ALA A 1 158 ? 53.832 144.609 -13.237 1.00 22.19  ? 155 ALA A N   1 
ATOM   1193 C CA  . ALA A 1 158 ? 52.501 144.235 -13.704 1.00 25.72  ? 155 ALA A CA  1 
ATOM   1194 C C   . ALA A 1 158 ? 51.924 145.289 -14.639 1.00 34.35  ? 155 ALA A C   1 
ATOM   1195 O O   . ALA A 1 158 ? 51.236 144.960 -15.611 1.00 27.72  ? 155 ALA A O   1 
ATOM   1196 C CB  . ALA A 1 158 ? 51.572 144.012 -12.512 1.00 26.15  ? 155 ALA A CB  1 
ATOM   1197 N N   . PHE A 1 159 ? 52.199 146.564 -14.364 1.00 35.36  ? 156 PHE A N   1 
ATOM   1198 C CA  . PHE A 1 159 ? 51.641 147.633 -15.184 1.00 32.16  ? 156 PHE A CA  1 
ATOM   1199 C C   . PHE A 1 159 ? 52.154 147.569 -16.615 1.00 31.67  ? 156 PHE A C   1 
ATOM   1200 O O   . PHE A 1 159 ? 51.489 148.057 -17.536 1.00 27.80  ? 156 PHE A O   1 
ATOM   1201 C CB  . PHE A 1 159 ? 51.962 148.990 -14.559 1.00 23.00  ? 156 PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 159 ? 51.659 149.062 -13.092 1.00 30.08  ? 156 PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 159 ? 52.646 148.809 -12.154 1.00 28.22  ? 156 PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 159 ? 50.384 149.371 -12.650 1.00 25.81  ? 156 PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 159 ? 52.367 148.870 -10.802 1.00 28.21  ? 156 PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 159 ? 50.100 149.434 -11.300 1.00 22.26  ? 156 PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 159 ? 51.093 149.183 -10.375 1.00 26.99  ? 156 PHE A CZ  1 
ATOM   1208 N N   . GLY A 1 160 ? 53.319 146.966 -16.824 1.00 34.77  ? 157 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 160 ? 53.889 146.897 -18.150 1.00 27.93  ? 157 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 160 ? 53.838 145.523 -18.783 1.00 38.85  ? 157 GLY A C   1 
ATOM   1211 O O   . GLY A 1 160 ? 53.901 145.407 -20.010 1.00 34.68  ? 157 GLY A O   1 
ATOM   1212 N N   . PHE A 1 161 ? 53.725 144.467 -17.970 1.00 31.58  ? 158 PHE A N   1 
ATOM   1213 C CA  . PHE A 1 161 ? 53.877 143.124 -18.515 1.00 26.80  ? 158 PHE A CA  1 
ATOM   1214 C C   . PHE A 1 161 ? 52.958 142.078 -17.890 1.00 28.64  ? 158 PHE A C   1 
ATOM   1215 O O   . PHE A 1 161 ? 53.143 140.884 -18.160 1.00 28.85  ? 158 PHE A O   1 
ATOM   1216 C CB  . PHE A 1 161 ? 55.337 142.673 -18.387 1.00 20.79  ? 158 PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 161 ? 56.303 143.563 -19.113 1.00 22.27  ? 158 PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 161 ? 56.990 144.558 -18.438 1.00 21.75  ? 158 PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 161 ? 56.506 143.420 -20.475 1.00 25.75  ? 158 PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 161 ? 57.872 145.386 -19.105 1.00 21.49  ? 158 PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 161 ? 57.387 144.244 -21.149 1.00 34.81  ? 158 PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 161 ? 58.070 145.229 -20.463 1.00 28.03  ? 158 PHE A CZ  1 
ATOM   1223 N N   . LEU A 1 162 ? 51.982 142.467 -17.073 1.00 27.16  ? 159 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 162 ? 50.945 141.518 -16.691 1.00 25.01  ? 159 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 162 ? 50.147 141.135 -17.928 1.00 33.68  ? 159 LEU A C   1 
ATOM   1226 O O   . LEU A 1 162 ? 49.631 142.001 -18.640 1.00 33.40  ? 159 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 162 ? 50.024 142.111 -15.623 1.00 25.80  ? 159 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 162 ? 48.862 141.226 -15.158 1.00 28.69  ? 159 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 162 ? 48.715 141.285 -13.648 1.00 29.60  ? 159 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 162 ? 47.556 141.627 -15.831 1.00 26.73  ? 159 LEU A CD2 1 
ATOM   1231 N N   . ALA A 1 163 ? 50.056 139.834 -18.190 1.00 35.54  ? 160 ALA A N   1 
ATOM   1232 C CA  . ALA A 1 163 ? 49.498 139.338 -19.441 1.00 34.75  ? 160 ALA A CA  1 
ATOM   1233 C C   . ALA A 1 163 ? 48.480 138.245 -19.162 1.00 36.91  ? 160 ALA A C   1 
ATOM   1234 O O   . ALA A 1 163 ? 48.801 137.241 -18.518 1.00 45.60  ? 160 ALA A O   1 
ATOM   1235 C CB  . ALA A 1 163 ? 50.603 138.810 -20.361 1.00 38.87  ? 160 ALA A CB  1 
ATOM   1236 N N   . LEU A 1 164 ? 47.252 138.453 -19.638 1.00 40.03  ? 161 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 164 ? 46.255 137.398 -19.792 1.00 42.89  ? 161 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 164 ? 46.132 137.140 -21.287 1.00 44.05  ? 161 LEU A C   1 
ATOM   1239 O O   . LEU A 1 164 ? 45.334 137.798 -21.972 1.00 54.74  ? 161 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 164 ? 44.908 137.799 -19.186 1.00 39.18  ? 161 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 164 ? 44.832 137.801 -17.658 1.00 41.41  ? 161 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 164 ? 43.461 138.257 -17.188 1.00 44.60  ? 161 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 164 ? 45.158 136.422 -17.104 1.00 34.85  ? 161 LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 165 ? 46.909 136.210 -21.843 1.00 47.86  ? 162 PRO A N   1 
ATOM   1245 C CA  . PRO A 1 165 ? 47.014 136.103 -23.304 1.00 46.71  ? 162 PRO A CA  1 
ATOM   1246 C C   . PRO A 1 165 ? 45.676 135.794 -23.959 1.00 51.12  ? 162 PRO A C   1 
ATOM   1247 O O   . PRO A 1 165 ? 44.914 134.943 -23.496 1.00 40.84  ? 162 PRO A O   1 
ATOM   1248 C CB  . PRO A 1 165 ? 48.015 134.959 -23.504 1.00 39.17  ? 162 PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 165 ? 48.777 134.886 -22.217 1.00 43.34  ? 162 PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 165 ? 47.793 135.257 -21.152 1.00 39.83  ? 162 PRO A CD  1 
ATOM   1251 N N   . GLY A 1 166 ? 45.398 136.503 -25.051 1.00 60.68  ? 163 GLY A N   1 
ATOM   1252 C CA  . GLY A 1 166 ? 44.159 136.331 -25.781 1.00 53.17  ? 163 GLY A CA  1 
ATOM   1253 C C   . GLY A 1 166 ? 43.178 137.464 -25.561 1.00 55.41  ? 163 GLY A C   1 
ATOM   1254 O O   . GLY A 1 166 ? 42.527 137.924 -26.504 1.00 68.98  ? 163 GLY A O   1 
ATOM   1255 N N   . SER A 1 167 ? 43.067 137.924 -24.318 1.00 56.08  ? 164 SER A N   1 
ATOM   1256 C CA  . SER A 1 167 ? 42.121 138.976 -23.986 1.00 57.12  ? 164 SER A CA  1 
ATOM   1257 C C   . SER A 1 167 ? 42.598 140.325 -24.517 1.00 51.95  ? 164 SER A C   1 
ATOM   1258 O O   . SER A 1 167 ? 43.776 140.523 -24.830 1.00 46.02  ? 164 SER A O   1 
ATOM   1259 C CB  . SER A 1 167 ? 41.916 139.056 -22.472 1.00 55.97  ? 164 SER A CB  1 
ATOM   1260 O OG  . SER A 1 167 ? 43.101 139.480 -21.819 1.00 54.63  ? 164 SER A OG  1 
ATOM   1261 N N   . ARG A 1 168 ? 41.656 141.261 -24.618 1.00 53.79  ? 165 ARG A N   1 
ATOM   1262 C CA  . ARG A 1 168 ? 41.965 142.625 -25.018 1.00 57.57  ? 165 ARG A CA  1 
ATOM   1263 C C   . ARG A 1 168 ? 42.204 143.553 -23.834 1.00 47.72  ? 165 ARG A C   1 
ATOM   1264 O O   . ARG A 1 168 ? 42.700 144.667 -24.032 1.00 45.32  ? 165 ARG A O   1 
ATOM   1265 C CB  . ARG A 1 168 ? 40.838 143.199 -25.882 1.00 63.72  ? 165 ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 168 ? 40.717 142.574 -27.260 1.00 77.32  ? 165 ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 168 ? 40.233 143.607 -28.262 1.00 90.64  ? 165 ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 168 ? 41.215 144.676 -28.435 1.00 102.31 ? 165 ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 168 ? 40.936 145.879 -28.924 1.00 102.49 ? 165 ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 168 ? 39.696 146.181 -29.284 1.00 102.76 ? 165 ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 168 ? 41.897 146.786 -29.045 1.00 80.02  ? 165 ARG A NH2 1 
ATOM   1272 N N   . GLU A 1 169 ? 41.864 143.125 -22.616 1.00 50.65  ? 166 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 169 ? 42.029 143.987 -21.452 1.00 45.00  ? 166 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 169 ? 43.453 143.957 -20.911 1.00 51.73  ? 166 GLU A C   1 
ATOM   1275 O O   . GLU A 1 169 ? 43.905 144.942 -20.316 1.00 50.88  ? 166 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 169 ? 41.044 143.583 -20.352 1.00 44.04  ? 166 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 169 ? 39.577 143.670 -20.755 1.00 54.12  ? 166 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 169 ? 39.057 142.391 -21.388 1.00 71.62  ? 166 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 169 ? 37.827 142.173 -21.364 1.00 54.09  ? 166 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 169 ? 39.877 141.601 -21.904 1.00 65.78  ? 166 GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 170 ? 44.170 142.851 -21.101 1.00 45.81  ? 167 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 170 ? 45.553 142.727 -20.635 1.00 44.54  ? 167 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 170 ? 46.328 141.871 -21.623 1.00 46.85  ? 167 ALA A C   1 
ATOM   1284 O O   . ALA A 1 170 ? 46.630 140.700 -21.361 1.00 49.24  ? 167 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 170 ? 45.614 142.131 -19.229 1.00 38.51  ? 167 ALA A CB  1 
ATOM   1286 N N   . PRO A 1 171 ? 46.677 142.431 -22.785 1.00 41.22  ? 168 PRO A N   1 
ATOM   1287 C CA  . PRO A 1 171 ? 47.370 141.626 -23.802 1.00 38.93  ? 168 PRO A CA  1 
ATOM   1288 C C   . PRO A 1 171 ? 48.819 141.335 -23.464 1.00 42.33  ? 168 PRO A C   1 
ATOM   1289 O O   . PRO A 1 171 ? 49.382 140.377 -24.008 1.00 51.41  ? 168 PRO A O   1 
ATOM   1290 C CB  . PRO A 1 171 ? 47.259 142.491 -25.063 1.00 36.87  ? 168 PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 171 ? 47.219 143.888 -24.533 1.00 30.91  ? 168 PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 171 ? 46.450 143.816 -23.236 1.00 38.27  ? 168 PRO A CD  1 
ATOM   1293 N N   . GLY A 1 172 ? 49.438 142.120 -22.589 1.00 43.13  ? 169 GLY A N   1 
ATOM   1294 C CA  . GLY A 1 172 ? 50.843 141.967 -22.284 1.00 30.64  ? 169 GLY A CA  1 
ATOM   1295 C C   . GLY A 1 172 ? 51.730 142.729 -23.251 1.00 36.49  ? 169 GLY A C   1 
ATOM   1296 O O   . GLY A 1 172 ? 51.297 143.235 -24.289 1.00 34.87  ? 169 GLY A O   1 
ATOM   1297 N N   . ASN A 1 173 ? 53.007 142.819 -22.881 1.00 33.26  ? 170 ASN A N   1 
ATOM   1298 C CA  . ASN A 1 173 ? 54.055 143.478 -23.656 1.00 32.23  ? 170 ASN A CA  1 
ATOM   1299 C C   . ASN A 1 173 ? 53.801 144.966 -23.869 1.00 39.47  ? 170 ASN A C   1 
ATOM   1300 O O   . ASN A 1 173 ? 54.444 145.578 -24.731 1.00 35.29  ? 170 ASN A O   1 
ATOM   1301 C CB  . ASN A 1 173 ? 54.263 142.798 -25.017 1.00 32.27  ? 170 ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 173 ? 54.624 141.335 -24.887 1.00 40.53  ? 170 ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 173 ? 55.301 140.935 -23.943 1.00 34.37  ? 170 ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 173 ? 54.173 140.527 -25.838 1.00 35.94  ? 170 ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 174 ? 52.885 145.570 -23.107 1.00 33.32  ? 171 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 174 ? 52.594 146.989 -23.299 1.00 30.13  ? 171 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 174 ? 53.802 147.841 -22.931 1.00 27.06  ? 171 VAL A C   1 
ATOM   1308 O O   . VAL A 1 174 ? 53.956 148.961 -23.434 1.00 30.91  ? 171 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 174 ? 51.341 147.404 -22.500 1.00 31.14  ? 171 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 174 ? 50.162 146.510 -22.858 1.00 32.90  ? 171 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 174 ? 51.612 147.374 -21.004 1.00 33.72  ? 171 VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 175 ? 54.677 147.333 -22.061 1.00 27.56  ? 172 GLY A N   1 
ATOM   1313 C CA  . GLY A 1 175 ? 55.911 148.045 -21.771 1.00 25.62  ? 172 GLY A CA  1 
ATOM   1314 C C   . GLY A 1 175 ? 56.833 148.109 -22.972 1.00 33.74  ? 172 GLY A C   1 
ATOM   1315 O O   . GLY A 1 175 ? 57.518 149.112 -23.187 1.00 33.73  ? 172 GLY A O   1 
ATOM   1316 N N   . LEU A 1 176 ? 56.867 147.039 -23.770 1.00 31.69  ? 173 LEU A N   1 
ATOM   1317 C CA  . LEU A 1 176 ? 57.622 147.074 -25.018 1.00 32.32  ? 173 LEU A CA  1 
ATOM   1318 C C   . LEU A 1 176 ? 56.968 148.010 -26.025 1.00 33.22  ? 173 LEU A C   1 
ATOM   1319 O O   . LEU A 1 176 ? 57.660 148.675 -26.805 1.00 29.59  ? 173 LEU A O   1 
ATOM   1320 C CB  . LEU A 1 176 ? 57.752 145.666 -25.598 1.00 32.05  ? 173 LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 176 ? 58.707 144.709 -24.881 1.00 33.50  ? 173 LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 176 ? 58.570 143.304 -25.442 1.00 30.70  ? 173 LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 176 ? 60.140 145.199 -25.008 1.00 29.12  ? 173 LEU A CD2 1 
ATOM   1324 N N   . LEU A 1 177 ? 55.634 148.076 -26.021 1.00 28.51  ? 174 LEU A N   1 
ATOM   1325 C CA  . LEU A 1 177 ? 54.939 149.014 -26.895 1.00 28.81  ? 174 LEU A CA  1 
ATOM   1326 C C   . LEU A 1 177 ? 55.203 150.458 -26.487 1.00 37.44  ? 174 LEU A C   1 
ATOM   1327 O O   . LEU A 1 177 ? 55.261 151.343 -27.351 1.00 35.37  ? 174 LEU A O   1 
ATOM   1328 C CB  . LEU A 1 177 ? 53.440 148.719 -26.895 1.00 25.12  ? 174 LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 177 ? 53.037 147.355 -27.459 1.00 33.31  ? 174 LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 177 ? 51.529 147.169 -27.407 1.00 21.74  ? 174 LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 177 ? 53.550 147.192 -28.882 1.00 23.53  ? 174 LEU A CD2 1 
ATOM   1332 N N   . ASP A 1 178 ? 55.362 150.716 -25.185 1.00 31.27  ? 175 ASP A N   1 
ATOM   1333 C CA  . ASP A 1 178 ? 55.779 152.040 -24.733 1.00 24.24  ? 175 ASP A CA  1 
ATOM   1334 C C   . ASP A 1 178 ? 57.097 152.441 -25.381 1.00 25.27  ? 175 ASP A C   1 
ATOM   1335 O O   . ASP A 1 178 ? 57.251 153.569 -25.864 1.00 32.20  ? 175 ASP A O   1 
ATOM   1336 C CB  . ASP A 1 178 ? 55.912 152.068 -23.207 1.00 26.79  ? 175 ASP A CB  1 
ATOM   1337 C CG  . ASP A 1 178 ? 54.584 151.903 -22.495 1.00 30.43  ? 175 ASP A CG  1 
ATOM   1338 O OD1 . ASP A 1 178 ? 53.530 152.042 -23.146 1.00 26.50  ? 175 ASP A OD1 1 
ATOM   1339 O OD2 . ASP A 1 178 ? 54.596 151.642 -21.272 1.00 27.44  ? 175 ASP A OD2 1 
ATOM   1340 N N   . GLN A 1 179 ? 58.064 151.519 -25.399 1.00 31.46  ? 176 GLN A N   1 
ATOM   1341 C CA  . GLN A 1 179 ? 59.351 151.798 -26.025 1.00 32.80  ? 176 GLN A CA  1 
ATOM   1342 C C   . GLN A 1 179 ? 59.197 152.030 -27.522 1.00 29.27  ? 176 GLN A C   1 
ATOM   1343 O O   . GLN A 1 179 ? 59.845 152.916 -28.091 1.00 33.12  ? 176 GLN A O   1 
ATOM   1344 C CB  . GLN A 1 179 ? 60.320 150.647 -25.761 1.00 32.20  ? 176 GLN A CB  1 
ATOM   1345 C CG  . GLN A 1 179 ? 60.479 150.281 -24.296 1.00 30.32  ? 176 GLN A CG  1 
ATOM   1346 C CD  . GLN A 1 179 ? 61.355 149.060 -24.103 1.00 38.04  ? 176 GLN A CD  1 
ATOM   1347 O OE1 . GLN A 1 179 ? 61.934 148.544 -25.059 1.00 31.36  ? 176 GLN A OE1 1 
ATOM   1348 N NE2 . GLN A 1 179 ? 61.453 148.588 -22.865 1.00 32.36  ? 176 GLN A NE2 1 
ATOM   1349 N N   . ARG A 1 180 ? 58.343 151.238 -28.178 1.00 30.29  ? 177 ARG A N   1 
ATOM   1350 C CA  . ARG A 1 180 ? 58.119 151.410 -29.610 1.00 36.13  ? 177 ARG A CA  1 
ATOM   1351 C C   . ARG A 1 180 ? 57.513 152.773 -29.916 1.00 34.75  ? 177 ARG A C   1 
ATOM   1352 O O   . ARG A 1 180 ? 57.939 153.452 -30.858 1.00 32.59  ? 177 ARG A O   1 
ATOM   1353 C CB  . ARG A 1 180 ? 57.218 150.293 -30.136 1.00 28.65  ? 177 ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 180 ? 56.707 150.522 -31.549 1.00 39.47  ? 177 ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 180 ? 55.711 149.450 -31.952 1.00 33.85  ? 177 ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 180 ? 56.347 148.146 -32.123 1.00 38.10  ? 177 ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 180 ? 55.681 147.012 -32.312 1.00 39.54  ? 177 ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 180 ? 54.355 147.018 -32.347 1.00 31.37  ? 177 ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 180 ? 56.339 145.871 -32.463 1.00 39.53  ? 177 ARG A NH2 1 
ATOM   1360 N N   . LEU A 1 181 ? 56.515 153.189 -29.131 1.00 36.47  ? 178 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 181 ? 55.908 154.501 -29.335 1.00 35.60  ? 178 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 181 ? 56.938 155.611 -29.176 1.00 32.11  ? 178 LEU A C   1 
ATOM   1363 O O   . LEU A 1 181 ? 56.920 156.597 -29.921 1.00 39.34  ? 178 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 181 ? 54.749 154.701 -28.359 1.00 26.24  ? 178 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 181 ? 53.950 155.996 -28.512 1.00 33.77  ? 178 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 181 ? 53.342 156.090 -29.902 1.00 32.91  ? 178 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 181 ? 52.869 156.078 -27.450 1.00 34.86  ? 178 LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 182 ? 57.846 155.466 -28.208 1.00 32.27  ? 179 ALA A N   1 
ATOM   1369 C CA  . ALA A 1 182 ? 58.922 156.437 -28.057 1.00 28.54  ? 179 ALA A CA  1 
ATOM   1370 C C   . ALA A 1 182 ? 59.845 156.438 -29.267 1.00 37.34  ? 179 ALA A C   1 
ATOM   1371 O O   . ALA A 1 182 ? 60.413 157.480 -29.612 1.00 34.63  ? 179 ALA A O   1 
ATOM   1372 C CB  . ALA A 1 182 ? 59.714 156.149 -26.782 1.00 18.81  ? 179 ALA A CB  1 
ATOM   1373 N N   . LEU A 1 183 ? 60.007 155.286 -29.922 1.00 40.05  ? 180 LEU A N   1 
ATOM   1374 C CA  . LEU A 1 183 ? 60.802 155.241 -31.145 1.00 42.62  ? 180 LEU A CA  1 
ATOM   1375 C C   . LEU A 1 183 ? 60.052 155.878 -32.307 1.00 39.98  ? 180 LEU A C   1 
ATOM   1376 O O   . LEU A 1 183 ? 60.660 156.541 -33.157 1.00 35.60  ? 180 LEU A O   1 
ATOM   1377 C CB  . LEU A 1 183 ? 61.183 153.799 -31.473 1.00 33.33  ? 180 LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 183 ? 62.041 153.091 -30.423 1.00 35.92  ? 180 LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 183 ? 62.421 151.693 -30.886 1.00 38.65  ? 180 LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 183 ? 63.275 153.917 -30.105 1.00 34.92  ? 180 LEU A CD2 1 
ATOM   1381 N N   . GLN A 1 184 ? 58.732 155.684 -32.365 1.00 34.66  ? 181 GLN A N   1 
ATOM   1382 C CA  . GLN A 1 184 ? 57.927 156.388 -33.356 1.00 35.35  ? 181 GLN A CA  1 
ATOM   1383 C C   . GLN A 1 184 ? 57.963 157.892 -33.114 1.00 45.55  ? 181 GLN A C   1 
ATOM   1384 O O   . GLN A 1 184 ? 57.989 158.682 -34.065 1.00 42.77  ? 181 GLN A O   1 
ATOM   1385 C CB  . GLN A 1 184 ? 56.490 155.868 -33.328 1.00 35.93  ? 181 GLN A CB  1 
ATOM   1386 C CG  . GLN A 1 184 ? 56.351 154.416 -33.760 1.00 41.73  ? 181 GLN A CG  1 
ATOM   1387 C CD  . GLN A 1 184 ? 54.955 153.868 -33.537 1.00 49.92  ? 181 GLN A CD  1 
ATOM   1388 O OE1 . GLN A 1 184 ? 54.187 154.401 -32.736 1.00 53.27  ? 181 GLN A OE1 1 
ATOM   1389 N NE2 . GLN A 1 184 ? 54.618 152.797 -34.247 1.00 43.04  ? 181 GLN A NE2 1 
ATOM   1390 N N   . TRP A 1 185 ? 57.971 158.305 -31.843 1.00 44.79  ? 182 TRP A N   1 
ATOM   1391 C CA  . TRP A 1 185 ? 58.129 159.720 -31.523 1.00 39.25  ? 182 TRP A CA  1 
ATOM   1392 C C   . TRP A 1 185 ? 59.484 160.236 -31.990 1.00 38.77  ? 182 TRP A C   1 
ATOM   1393 O O   . TRP A 1 185 ? 59.601 161.382 -32.437 1.00 42.86  ? 182 TRP A O   1 
ATOM   1394 C CB  . TRP A 1 185 ? 57.959 159.940 -30.019 1.00 33.31  ? 182 TRP A CB  1 
ATOM   1395 C CG  . TRP A 1 185 ? 57.920 161.386 -29.607 1.00 31.80  ? 182 TRP A CG  1 
ATOM   1396 C CD1 . TRP A 1 185 ? 56.807 162.140 -29.371 1.00 37.39  ? 182 TRP A CD1 1 
ATOM   1397 C CD2 . TRP A 1 185 ? 59.043 162.248 -29.378 1.00 26.00  ? 182 TRP A CD2 1 
ATOM   1398 N NE1 . TRP A 1 185 ? 57.166 163.417 -29.012 1.00 27.61  ? 182 TRP A NE1 1 
ATOM   1399 C CE2 . TRP A 1 185 ? 58.533 163.509 -29.009 1.00 31.70  ? 182 TRP A CE2 1 
ATOM   1400 C CE3 . TRP A 1 185 ? 60.430 162.076 -29.449 1.00 23.85  ? 182 TRP A CE3 1 
ATOM   1401 C CZ2 . TRP A 1 185 ? 59.360 164.592 -28.714 1.00 25.90  ? 182 TRP A CZ2 1 
ATOM   1402 C CZ3 . TRP A 1 185 ? 61.248 163.153 -29.158 1.00 21.64  ? 182 TRP A CZ3 1 
ATOM   1403 C CH2 . TRP A 1 185 ? 60.711 164.394 -28.793 1.00 33.16  ? 182 TRP A CH2 1 
ATOM   1404 N N   . VAL A 1 186 ? 60.521 159.402 -31.888 1.00 36.55  ? 183 VAL A N   1 
ATOM   1405 C CA  . VAL A 1 186 ? 61.849 159.808 -32.337 1.00 31.24  ? 183 VAL A CA  1 
ATOM   1406 C C   . VAL A 1 186 ? 61.879 159.958 -33.854 1.00 37.09  ? 183 VAL A C   1 
ATOM   1407 O O   . VAL A 1 186 ? 62.503 160.882 -34.387 1.00 33.42  ? 183 VAL A O   1 
ATOM   1408 C CB  . VAL A 1 186 ? 62.909 158.808 -31.837 1.00 42.94  ? 183 VAL A CB  1 
ATOM   1409 C CG1 . VAL A 1 186 ? 64.217 158.980 -32.595 1.00 32.23  ? 183 VAL A CG1 1 
ATOM   1410 C CG2 . VAL A 1 186 ? 63.141 158.990 -30.345 1.00 29.08  ? 183 VAL A CG2 1 
ATOM   1411 N N   . GLN A 1 187 ? 61.191 159.068 -34.574 1.00 34.28  ? 184 GLN A N   1 
ATOM   1412 C CA  . GLN A 1 187 ? 61.159 159.176 -36.029 1.00 45.39  ? 184 GLN A CA  1 
ATOM   1413 C C   . GLN A 1 187 ? 60.431 160.430 -36.491 1.00 42.58  ? 184 GLN A C   1 
ATOM   1414 O O   . GLN A 1 187 ? 60.718 160.945 -37.578 1.00 42.96  ? 184 GLN A O   1 
ATOM   1415 C CB  . GLN A 1 187 ? 60.507 157.935 -36.638 1.00 34.75  ? 184 GLN A CB  1 
ATOM   1416 C CG  . GLN A 1 187 ? 61.424 156.728 -36.690 1.00 43.14  ? 184 GLN A CG  1 
ATOM   1417 C CD  . GLN A 1 187 ? 62.705 157.012 -37.448 1.00 36.72  ? 184 GLN A CD  1 
ATOM   1418 O OE1 . GLN A 1 187 ? 62.691 157.663 -38.494 1.00 47.81  ? 184 GLN A OE1 1 
ATOM   1419 N NE2 . GLN A 1 187 ? 63.824 156.534 -36.919 1.00 40.90  ? 184 GLN A NE2 1 
ATOM   1420 N N   . GLU A 1 188 ? 59.501 160.943 -35.686 1.00 43.31  ? 185 GLU A N   1 
ATOM   1421 C CA  . GLU A 1 188 ? 58.668 162.067 -36.089 1.00 43.33  ? 185 GLU A CA  1 
ATOM   1422 C C   . GLU A 1 188 ? 59.117 163.404 -35.512 1.00 41.70  ? 185 GLU A C   1 
ATOM   1423 O O   . GLU A 1 188 ? 58.605 164.442 -35.945 1.00 44.51  ? 185 GLU A O   1 
ATOM   1424 C CB  . GLU A 1 188 ? 57.210 161.815 -35.684 1.00 36.46  ? 185 GLU A CB  1 
ATOM   1425 C CG  . GLU A 1 188 ? 56.554 160.645 -36.396 1.00 43.35  ? 185 GLU A CG  1 
ATOM   1426 C CD  . GLU A 1 188 ? 55.138 160.393 -35.913 1.00 55.85  ? 185 GLU A CD  1 
ATOM   1427 O OE1 . GLU A 1 188 ? 54.660 159.246 -36.040 1.00 54.34  ? 185 GLU A OE1 1 
ATOM   1428 O OE2 . GLU A 1 188 ? 54.505 161.341 -35.402 1.00 56.23  ? 185 GLU A OE2 1 
ATOM   1429 N N   . ASN A 1 189 ? 60.049 163.417 -34.557 1.00 33.96  ? 186 ASN A N   1 
ATOM   1430 C CA  . ASN A 1 189 ? 60.379 164.667 -33.880 1.00 33.30  ? 186 ASN A CA  1 
ATOM   1431 C C   . ASN A 1 189 ? 61.858 164.892 -33.598 1.00 33.59  ? 186 ASN A C   1 
ATOM   1432 O O   . ASN A 1 189 ? 62.206 166.000 -33.178 1.00 40.23  ? 186 ASN A O   1 
ATOM   1433 C CB  . ASN A 1 189 ? 59.614 164.767 -32.551 1.00 30.23  ? 186 ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 189 ? 58.110 164.771 -32.743 1.00 31.54  ? 186 ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 189 ? 57.518 165.798 -33.073 1.00 42.73  ? 186 ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 189 ? 57.483 163.619 -32.532 1.00 38.90  ? 186 ASN A ND2 1 
ATOM   1437 N N   . VAL A 1 190 ? 62.740 163.911 -33.805 1.00 23.27  ? 187 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 190 ? 64.141 164.113 -33.447 1.00 33.87  ? 187 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 190 ? 64.825 165.111 -34.373 1.00 35.55  ? 187 VAL A C   1 
ATOM   1440 O O   . VAL A 1 190 ? 65.863 165.677 -34.008 1.00 40.13  ? 187 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 190 ? 64.902 162.772 -33.432 1.00 43.93  ? 187 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 190 ? 65.298 162.357 -34.843 1.00 40.63  ? 187 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 190 ? 66.123 162.860 -32.526 1.00 33.02  ? 187 VAL A CG2 1 
ATOM   1444 N N   . ALA A 1 191 ? 64.269 165.351 -35.565 1.00 40.09  ? 188 ALA A N   1 
ATOM   1445 C CA  . ALA A 1 191 ? 64.853 166.341 -36.465 1.00 42.49  ? 188 ALA A CA  1 
ATOM   1446 C C   . ALA A 1 191 ? 64.777 167.743 -35.878 1.00 37.62  ? 188 ALA A C   1 
ATOM   1447 O O   . ALA A 1 191 ? 65.674 168.562 -36.108 1.00 38.14  ? 188 ALA A O   1 
ATOM   1448 C CB  . ALA A 1 191 ? 64.153 166.295 -37.823 1.00 31.96  ? 188 ALA A CB  1 
ATOM   1449 N N   . ALA A 1 192 ? 63.721 168.036 -35.112 1.00 38.22  ? 189 ALA A N   1 
ATOM   1450 C CA  . ALA A 1 192 ? 63.586 169.346 -34.487 1.00 29.81  ? 189 ALA A CA  1 
ATOM   1451 C C   . ALA A 1 192 ? 64.710 169.636 -33.503 1.00 39.69  ? 189 ALA A C   1 
ATOM   1452 O O   . ALA A 1 192 ? 64.957 170.804 -33.187 1.00 42.83  ? 189 ALA A O   1 
ATOM   1453 C CB  . ALA A 1 192 ? 62.234 169.453 -33.780 1.00 30.44  ? 189 ALA A CB  1 
ATOM   1454 N N   . PHE A 1 193 ? 65.394 168.604 -33.014 1.00 41.15  ? 190 PHE A N   1 
ATOM   1455 C CA  . PHE A 1 193 ? 66.514 168.763 -32.100 1.00 36.64  ? 190 PHE A CA  1 
ATOM   1456 C C   . PHE A 1 193 ? 67.862 168.642 -32.797 1.00 41.88  ? 190 PHE A C   1 
ATOM   1457 O O   . PHE A 1 193 ? 68.898 168.692 -32.126 1.00 39.19  ? 190 PHE A O   1 
ATOM   1458 C CB  . PHE A 1 193 ? 66.421 167.731 -30.969 1.00 38.56  ? 190 PHE A CB  1 
ATOM   1459 C CG  . PHE A 1 193 ? 65.136 167.796 -30.191 1.00 29.28  ? 190 PHE A CG  1 
ATOM   1460 C CD1 . PHE A 1 193 ? 64.014 167.103 -30.617 1.00 22.25  ? 190 PHE A CD1 1 
ATOM   1461 C CD2 . PHE A 1 193 ? 65.052 168.546 -29.029 1.00 28.03  ? 190 PHE A CD2 1 
ATOM   1462 C CE1 . PHE A 1 193 ? 62.831 167.160 -29.904 1.00 32.27  ? 190 PHE A CE1 1 
ATOM   1463 C CE2 . PHE A 1 193 ? 63.872 168.608 -28.310 1.00 34.24  ? 190 PHE A CE2 1 
ATOM   1464 C CZ  . PHE A 1 193 ? 62.760 167.913 -28.749 1.00 30.45  ? 190 PHE A CZ  1 
ATOM   1465 N N   . GLY A 1 194 ? 67.874 168.488 -34.118 1.00 37.60  ? 191 GLY A N   1 
ATOM   1466 C CA  . GLY A 1 194 ? 69.105 168.325 -34.861 1.00 37.53  ? 191 GLY A CA  1 
ATOM   1467 C C   . GLY A 1 194 ? 69.538 166.895 -35.085 1.00 45.73  ? 191 GLY A C   1 
ATOM   1468 O O   . GLY A 1 194 ? 70.682 166.670 -35.498 1.00 45.35  ? 191 GLY A O   1 
ATOM   1469 N N   . GLY A 1 195 ? 68.666 165.924 -34.834 1.00 41.49  ? 192 GLY A N   1 
ATOM   1470 C CA  . GLY A 1 195 ? 69.007 164.521 -34.960 1.00 43.61  ? 192 GLY A CA  1 
ATOM   1471 C C   . GLY A 1 195 ? 68.549 163.923 -36.278 1.00 48.12  ? 192 GLY A C   1 
ATOM   1472 O O   . GLY A 1 195 ? 67.523 164.309 -36.832 1.00 50.16  ? 192 GLY A O   1 
ATOM   1473 N N   . ASP A 1 196 ? 69.331 162.961 -36.770 1.00 44.25  ? 193 ASP A N   1 
ATOM   1474 C CA  . ASP A 1 196 ? 69.034 162.291 -38.029 1.00 41.79  ? 193 ASP A CA  1 
ATOM   1475 C C   . ASP A 1 196 ? 68.137 161.092 -37.754 1.00 40.87  ? 193 ASP A C   1 
ATOM   1476 O O   . ASP A 1 196 ? 68.597 160.119 -37.137 1.00 45.78  ? 193 ASP A O   1 
ATOM   1477 C CB  . ASP A 1 196 ? 70.321 161.845 -38.712 1.00 51.15  ? 193 ASP A CB  1 
ATOM   1478 C CG  . ASP A 1 196 ? 70.108 161.430 -40.159 1.00 42.83  ? 193 ASP A CG  1 
ATOM   1479 O OD1 . ASP A 1 196 ? 68.970 161.072 -40.529 1.00 42.96  ? 193 ASP A OD1 1 
ATOM   1480 O OD2 . ASP A 1 196 ? 71.089 161.458 -40.932 1.00 52.35  ? 193 ASP A OD2 1 
ATOM   1481 N N   . PRO A 1 197 ? 66.873 161.102 -38.189 1.00 43.20  ? 194 PRO A N   1 
ATOM   1482 C CA  . PRO A 1 197 ? 66.018 159.923 -37.986 1.00 36.99  ? 194 PRO A CA  1 
ATOM   1483 C C   . PRO A 1 197 ? 66.411 158.724 -38.836 1.00 42.60  ? 194 PRO A C   1 
ATOM   1484 O O   . PRO A 1 197 ? 65.830 157.647 -38.653 1.00 46.27  ? 194 PRO A O   1 
ATOM   1485 C CB  . PRO A 1 197 ? 64.621 160.434 -38.360 1.00 31.95  ? 194 PRO A CB  1 
ATOM   1486 C CG  . PRO A 1 197 ? 64.876 161.559 -39.306 1.00 20.99  ? 194 PRO A CG  1 
ATOM   1487 C CD  . PRO A 1 197 ? 66.152 162.207 -38.845 1.00 34.97  ? 194 PRO A CD  1 
ATOM   1488 N N   . THR A 1 198 ? 67.367 158.870 -39.751 1.00 45.14  ? 195 THR A N   1 
ATOM   1489 C CA  . THR A 1 198 ? 67.842 157.753 -40.557 1.00 51.63  ? 195 THR A CA  1 
ATOM   1490 C C   . THR A 1 198 ? 69.071 157.075 -39.963 1.00 49.83  ? 195 THR A C   1 
ATOM   1491 O O   . THR A 1 198 ? 69.557 156.096 -40.538 1.00 58.14  ? 195 THR A O   1 
ATOM   1492 C CB  . THR A 1 198 ? 68.160 158.218 -41.982 1.00 49.45  ? 195 THR A CB  1 
ATOM   1493 O OG1 . THR A 1 198 ? 69.297 159.090 -41.959 1.00 37.57  ? 195 THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 198 ? 66.972 158.957 -42.578 1.00 28.87  ? 195 THR A CG2 1 
ATOM   1495 N N   . SER A 1 199 ? 69.582 157.567 -38.831 1.00 46.89  ? 196 SER A N   1 
ATOM   1496 C CA  . SER A 1 199 ? 70.750 156.988 -38.167 1.00 36.62  ? 196 SER A CA  1 
ATOM   1497 C C   . SER A 1 199 ? 70.447 156.877 -36.669 1.00 46.25  ? 196 SER A C   1 
ATOM   1498 O O   . SER A 1 199 ? 71.028 157.585 -35.843 1.00 49.97  ? 196 SER A O   1 
ATOM   1499 C CB  . SER A 1 199 ? 72.005 157.823 -38.431 1.00 36.65  ? 196 SER A CB  1 
ATOM   1500 O OG  . SER A 1 199 ? 73.153 157.222 -37.856 1.00 43.12  ? 196 SER A OG  1 
ATOM   1501 N N   . VAL A 1 200 ? 69.530 155.977 -36.324 1.00 41.41  ? 197 VAL A N   1 
ATOM   1502 C CA  . VAL A 1 200 ? 69.102 155.767 -34.945 1.00 38.87  ? 197 VAL A CA  1 
ATOM   1503 C C   . VAL A 1 200 ? 69.732 154.477 -34.437 1.00 39.15  ? 197 VAL A C   1 
ATOM   1504 O O   . VAL A 1 200 ? 69.545 153.409 -35.032 1.00 37.65  ? 197 VAL A O   1 
ATOM   1505 C CB  . VAL A 1 200 ? 67.571 155.716 -34.835 1.00 40.37  ? 197 VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 200 ? 67.153 155.436 -33.400 1.00 33.97  ? 197 VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 200 ? 66.957 157.017 -35.330 1.00 31.26  ? 197 VAL A CG2 1 
ATOM   1508 N N   . THR A 1 201 ? 70.472 154.572 -33.333 1.00 36.57  ? 198 THR A N   1 
ATOM   1509 C CA  . THR A 1 201 ? 71.179 153.437 -32.747 1.00 33.99  ? 198 THR A CA  1 
ATOM   1510 C C   . THR A 1 201 ? 70.616 153.169 -31.357 1.00 34.41  ? 198 THR A C   1 
ATOM   1511 O O   . THR A 1 201 ? 70.819 153.968 -30.436 1.00 34.52  ? 198 THR A O   1 
ATOM   1512 C CB  . THR A 1 201 ? 72.684 153.703 -32.678 1.00 41.25  ? 198 THR A CB  1 
ATOM   1513 O OG1 . THR A 1 201 ? 73.191 153.942 -33.997 1.00 44.61  ? 198 THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 201 ? 73.408 152.509 -32.069 1.00 37.92  ? 198 THR A CG2 1 
ATOM   1515 N N   . LEU A 1 202 ? 69.917 152.047 -31.207 1.00 31.80  ? 199 LEU A N   1 
ATOM   1516 C CA  . LEU A 1 202 ? 69.410 151.637 -29.906 1.00 28.95  ? 199 LEU A CA  1 
ATOM   1517 C C   . LEU A 1 202 ? 70.531 151.043 -29.065 1.00 33.04  ? 199 LEU A C   1 
ATOM   1518 O O   . LEU A 1 202 ? 71.392 150.320 -29.574 1.00 43.80  ? 199 LEU A O   1 
ATOM   1519 C CB  . LEU A 1 202 ? 68.291 150.606 -30.063 1.00 26.76  ? 199 LEU A CB  1 
ATOM   1520 C CG  . LEU A 1 202 ? 67.019 151.021 -30.801 1.00 33.29  ? 199 LEU A CG  1 
ATOM   1521 C CD1 . LEU A 1 202 ? 65.992 149.900 -30.755 1.00 28.56  ? 199 LEU A CD1 1 
ATOM   1522 C CD2 . LEU A 1 202 ? 66.453 152.289 -30.201 1.00 47.84  ? 199 LEU A CD2 1 
ATOM   1523 N N   . PHE A 1 203 ? 70.519 151.351 -27.770 1.00 34.01  ? 200 PHE A N   1 
ATOM   1524 C CA  . PHE A 1 203 ? 71.432 150.699 -26.843 1.00 30.27  ? 200 PHE A CA  1 
ATOM   1525 C C   . PHE A 1 203 ? 70.786 150.622 -25.467 1.00 36.82  ? 200 PHE A C   1 
ATOM   1526 O O   . PHE A 1 203 ? 70.153 151.578 -25.011 1.00 41.81  ? 200 PHE A O   1 
ATOM   1527 C CB  . PHE A 1 203 ? 72.803 151.399 -26.782 1.00 33.95  ? 200 PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 203 ? 72.807 152.747 -26.110 1.00 35.41  ? 200 PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 203 ? 73.806 153.060 -25.202 1.00 33.94  ? 200 PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 203 ? 71.868 153.715 -26.419 1.00 37.11  ? 200 PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 203 ? 73.847 154.296 -24.587 1.00 34.36  ? 200 PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 203 ? 71.903 154.954 -25.805 1.00 33.14  ? 200 PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 203 ? 72.893 155.244 -24.888 1.00 30.04  ? 200 PHE A CZ  1 
ATOM   1534 N N   . GLY A 1 204 ? 70.932 149.461 -24.828 1.00 30.11  ? 201 GLY A N   1 
ATOM   1535 C CA  . GLY A 1 204 ? 70.350 149.217 -23.524 1.00 30.97  ? 201 GLY A CA  1 
ATOM   1536 C C   . GLY A 1 204 ? 71.146 148.168 -22.780 1.00 37.09  ? 201 GLY A C   1 
ATOM   1537 O O   . GLY A 1 204 ? 72.027 147.511 -23.339 1.00 33.64  ? 201 GLY A O   1 
ATOM   1538 N N   . GLU A 1 205 ? 70.817 148.012 -21.500 1.00 35.20  ? 202 GLU A N   1 
ATOM   1539 C CA  . GLU A 1 205 ? 71.563 147.134 -20.610 1.00 31.07  ? 202 GLU A CA  1 
ATOM   1540 C C   . GLU A 1 205 ? 70.609 146.202 -19.876 1.00 31.00  ? 202 GLU A C   1 
ATOM   1541 O O   . GLU A 1 205 ? 69.492 146.594 -19.526 1.00 33.77  ? 202 GLU A O   1 
ATOM   1542 C CB  . GLU A 1 205 ? 72.395 147.953 -19.612 1.00 31.19  ? 202 GLU A CB  1 
ATOM   1543 C CG  . GLU A 1 205 ? 73.485 147.168 -18.905 1.00 26.25  ? 202 GLU A CG  1 
ATOM   1544 C CD  . GLU A 1 205 ? 73.030 146.618 -17.572 1.00 32.28  ? 202 GLU A CD  1 
ATOM   1545 O OE1 . GLU A 1 205 ? 71.896 146.932 -17.157 1.00 34.64  ? 202 GLU A OE1 1 
ATOM   1546 O OE2 . GLU A 1 205 ? 73.808 145.876 -16.937 1.00 41.51  ? 202 GLU A OE2 1 
HETATM 1547 N N   . SVX A 1 206 ? 71.063 144.967 -19.651 1.00 38.13  ? 203 SVX A N   1 
HETATM 1548 C CA  . SVX A 1 206 ? 70.284 143.921 -18.992 1.00 33.60  ? 203 SVX A CA  1 
HETATM 1549 C C   . SVX A 1 206 ? 68.917 143.745 -19.643 1.00 30.55  ? 203 SVX A C   1 
HETATM 1550 C CB  . SVX A 1 206 ? 70.118 144.221 -17.500 1.00 40.22  ? 203 SVX A CB  1 
HETATM 1551 O O   . SVX A 1 206 ? 68.824 143.325 -20.801 1.00 31.46  ? 203 SVX A O   1 
HETATM 1552 O OG  . SVX A 1 206 ? 70.013 143.014 -16.763 1.00 45.44  ? 203 SVX A OG  1 
HETATM 1553 P P1  . SVX A 1 206 ? 68.840 143.048 -15.647 1.00 33.76  ? 203 SVX A P1  1 
HETATM 1554 C C4  . SVX A 1 206 ? 68.025 141.383 -15.793 1.00 33.70  ? 203 SVX A C4  1 
HETATM 1555 C C2  . SVX A 1 206 ? 68.725 143.933 -13.185 1.00 38.96  ? 203 SVX A C2  1 
HETATM 1556 O O6  . SVX A 1 206 ? 67.840 144.143 -15.934 1.00 39.59  ? 203 SVX A O6  1 
HETATM 1557 O O5  . SVX A 1 206 ? 69.469 143.227 -14.136 1.00 36.11  ? 203 SVX A O5  1 
HETATM 1558 C C1  . SVX A 1 206 ? 67.652 143.035 -12.577 1.00 42.25  ? 203 SVX A C1  1 
ATOM   1559 N N   . ALA A 1 207 ? 67.851 144.057 -18.900 1.00 25.47  ? 204 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 207 ? 66.510 143.984 -19.469 1.00 32.76  ? 204 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 207 ? 66.335 144.984 -20.603 1.00 25.57  ? 204 ALA A C   1 
ATOM   1562 O O   . ALA A 1 207 ? 65.534 144.753 -21.516 1.00 23.73  ? 204 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 207 ? 65.461 144.218 -18.382 1.00 32.37  ? 204 ALA A CB  1 
ATOM   1564 N N   . GLY A 1 208 ? 67.070 146.096 -20.562 1.00 28.82  ? 205 GLY A N   1 
ATOM   1565 C CA  . GLY A 1 208 ? 67.056 147.018 -21.684 1.00 28.93  ? 205 GLY A CA  1 
ATOM   1566 C C   . GLY A 1 208 ? 67.720 146.433 -22.916 1.00 31.44  ? 205 GLY A C   1 
ATOM   1567 O O   . GLY A 1 208 ? 67.237 146.614 -24.037 1.00 32.54  ? 205 GLY A O   1 
ATOM   1568 N N   . ALA A 1 209 ? 68.837 145.725 -22.726 1.00 31.20  ? 206 ALA A N   1 
ATOM   1569 C CA  . ALA A 1 209 ? 69.474 145.036 -23.844 1.00 30.27  ? 206 ALA A CA  1 
ATOM   1570 C C   . ALA A 1 209 ? 68.556 143.968 -24.420 1.00 29.86  ? 206 ALA A C   1 
ATOM   1571 O O   . ALA A 1 209 ? 68.489 143.787 -25.642 1.00 31.98  ? 206 ALA A O   1 
ATOM   1572 C CB  . ALA A 1 209 ? 70.800 144.422 -23.397 1.00 28.70  ? 206 ALA A CB  1 
ATOM   1573 N N   . ALA A 1 210 ? 67.840 143.248 -23.553 1.00 27.44  ? 207 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 210 ? 66.859 142.282 -24.032 1.00 25.98  ? 207 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 210 ? 65.746 142.973 -24.809 1.00 36.65  ? 207 ALA A C   1 
ATOM   1576 O O   . ALA A 1 210 ? 65.251 142.438 -25.808 1.00 29.93  ? 207 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 210 ? 66.287 141.489 -22.858 1.00 17.02  ? 207 ALA A CB  1 
ATOM   1578 N N   . SER A 1 211 ? 65.344 144.169 -24.369 1.00 32.48  ? 208 SER A N   1 
ATOM   1579 C CA  . SER A 1 211 ? 64.328 144.923 -25.096 1.00 29.69  ? 208 SER A CA  1 
ATOM   1580 C C   . SER A 1 211 ? 64.824 145.324 -26.479 1.00 25.80  ? 208 SER A C   1 
ATOM   1581 O O   . SER A 1 211 ? 64.077 145.243 -27.462 1.00 29.38  ? 208 SER A O   1 
ATOM   1582 C CB  . SER A 1 211 ? 63.918 146.159 -24.296 1.00 28.42  ? 208 SER A CB  1 
ATOM   1583 O OG  . SER A 1 211 ? 63.276 145.797 -23.087 1.00 22.78  ? 208 SER A OG  1 
ATOM   1584 N N   . VAL A 1 212 ? 66.081 145.764 -26.573 1.00 24.15  ? 209 VAL A N   1 
ATOM   1585 C CA  . VAL A 1 212 ? 66.662 146.109 -27.869 1.00 29.64  ? 209 VAL A CA  1 
ATOM   1586 C C   . VAL A 1 212 ? 66.654 144.898 -28.793 1.00 40.04  ? 209 VAL A C   1 
ATOM   1587 O O   . VAL A 1 212 ? 66.399 145.017 -29.998 1.00 36.79  ? 209 VAL A O   1 
ATOM   1588 C CB  . VAL A 1 212 ? 68.084 146.672 -27.680 1.00 27.33  ? 209 VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 212 ? 68.748 146.918 -29.025 1.00 29.03  ? 209 VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 212 ? 68.044 147.951 -26.860 1.00 27.28  ? 209 VAL A CG2 1 
ATOM   1591 N N   . GLY A 1 213 ? 66.920 143.713 -28.242 1.00 32.54  ? 210 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 213 ? 66.904 142.510 -29.057 1.00 40.53  ? 210 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 213 ? 65.511 142.137 -29.528 1.00 33.77  ? 210 GLY A C   1 
ATOM   1594 O O   . GLY A 1 213 ? 65.339 141.636 -30.643 1.00 37.56  ? 210 GLY A O   1 
ATOM   1595 N N   . MET A 1 214 ? 64.498 142.374 -28.690 1.00 36.69  ? 211 MET A N   1 
ATOM   1596 C CA  . MET A 1 214 ? 63.131 142.054 -29.089 1.00 33.57  ? 211 MET A CA  1 
ATOM   1597 C C   . MET A 1 214 ? 62.618 143.016 -30.152 1.00 39.15  ? 211 MET A C   1 
ATOM   1598 O O   . MET A 1 214 ? 61.724 142.658 -30.928 1.00 35.40  ? 211 MET A O   1 
ATOM   1599 C CB  . MET A 1 214 ? 62.207 142.057 -27.872 1.00 33.69  ? 211 MET A CB  1 
ATOM   1600 C CG  . MET A 1 214 ? 62.609 141.058 -26.803 1.00 36.60  ? 211 MET A CG  1 
ATOM   1601 S SD  . MET A 1 214 ? 61.396 140.859 -25.487 1.00 48.79  ? 211 MET A SD  1 
ATOM   1602 C CE  . MET A 1 214 ? 62.356 139.928 -24.295 1.00 37.69  ? 211 MET A CE  1 
ATOM   1603 N N   . HIS A 1 215 ? 63.160 144.235 -30.202 1.00 33.07  ? 212 HIS A N   1 
ATOM   1604 C CA  . HIS A 1 215 ? 62.804 145.144 -31.285 1.00 39.78  ? 212 HIS A CA  1 
ATOM   1605 C C   . HIS A 1 215 ? 63.445 144.720 -32.599 1.00 38.04  ? 212 HIS A C   1 
ATOM   1606 O O   . HIS A 1 215 ? 62.892 144.988 -33.671 1.00 39.91  ? 212 HIS A O   1 
ATOM   1607 C CB  . HIS A 1 215 ? 63.201 146.576 -30.926 1.00 33.08  ? 212 HIS A CB  1 
ATOM   1608 C CG  . HIS A 1 215 ? 62.366 147.177 -29.838 1.00 36.65  ? 212 HIS A CG  1 
ATOM   1609 N ND1 . HIS A 1 215 ? 60.988 147.153 -29.860 1.00 39.82  ? 212 HIS A ND1 1 
ATOM   1610 C CD2 . HIS A 1 215 ? 62.713 147.819 -28.698 1.00 24.59  ? 212 HIS A CD2 1 
ATOM   1611 C CE1 . HIS A 1 215 ? 60.522 147.753 -28.780 1.00 32.86  ? 212 HIS A CE1 1 
ATOM   1612 N NE2 . HIS A 1 215 ? 61.548 148.167 -28.058 1.00 39.78  ? 212 HIS A NE2 1 
ATOM   1613 N N   . LEU A 1 216 ? 64.608 144.065 -32.537 1.00 38.05  ? 213 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 216 ? 65.187 143.471 -33.737 1.00 39.71  ? 213 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 216 ? 64.274 142.395 -34.309 1.00 28.51  ? 213 LEU A C   1 
ATOM   1616 O O   . LEU A 1 216 ? 64.126 142.277 -35.531 1.00 41.31  ? 213 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 216 ? 66.563 142.881 -33.423 1.00 31.15  ? 213 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 216 ? 67.725 143.831 -33.136 1.00 39.59  ? 213 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 216 ? 68.908 143.062 -32.569 1.00 38.28  ? 213 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 216 ? 68.124 144.559 -34.404 1.00 35.94  ? 213 LEU A CD2 1 
ATOM   1621 N N   . LEU A 1 217 ? 63.648 141.609 -33.438 1.00 38.71  ? 214 LEU A N   1 
ATOM   1622 C CA  . LEU A 1 217 ? 62.830 140.476 -33.845 1.00 40.84  ? 214 LEU A CA  1 
ATOM   1623 C C   . LEU A 1 217 ? 61.367 140.840 -34.063 1.00 39.76  ? 214 LEU A C   1 
ATOM   1624 O O   . LEU A 1 217 ? 60.569 139.957 -34.394 1.00 37.28  ? 214 LEU A O   1 
ATOM   1625 C CB  . LEU A 1 217 ? 62.937 139.361 -32.800 1.00 32.70  ? 214 LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 217 ? 64.369 138.974 -32.419 1.00 40.13  ? 214 LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 217 ? 64.371 137.905 -31.338 1.00 31.74  ? 214 LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 217 ? 65.147 138.512 -33.642 1.00 37.21  ? 214 LEU A CD2 1 
ATOM   1629 N N   . SER A 1 218 ? 60.995 142.107 -33.887 1.00 44.07  ? 215 SER A N   1 
ATOM   1630 C CA  . SER A 1 218 ? 59.627 142.548 -34.117 1.00 53.37  ? 215 SER A CA  1 
ATOM   1631 C C   . SER A 1 218 ? 59.582 143.406 -35.372 1.00 48.70  ? 215 SER A C   1 
ATOM   1632 O O   . SER A 1 218 ? 60.246 144.453 -35.420 1.00 49.88  ? 215 SER A O   1 
ATOM   1633 C CB  . SER A 1 218 ? 59.094 143.326 -32.915 1.00 43.25  ? 215 SER A CB  1 
ATOM   1634 O OG  . SER A 1 218 ? 57.684 143.457 -32.977 1.00 48.30  ? 215 SER A OG  1 
ATOM   1635 N N   . PRO A 1 219 ? 58.838 143.003 -36.400 1.00 43.18  ? 216 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 219 ? 58.823 143.754 -37.666 1.00 45.67  ? 216 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 219 ? 58.388 145.202 -37.491 1.00 41.42  ? 216 PRO A C   1 
ATOM   1638 O O   . PRO A 1 219 ? 59.041 146.100 -38.043 1.00 40.82  ? 216 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 219 ? 57.831 142.963 -38.534 1.00 45.46  ? 216 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 219 ? 57.923 141.572 -38.008 1.00 49.27  ? 216 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 219 ? 58.158 141.700 -36.522 1.00 42.57  ? 216 PRO A CD  1 
ATOM   1642 N N   . PRO A 1 220 ? 57.301 145.494 -36.756 1.00 40.89  ? 217 PRO A N   1 
ATOM   1643 C CA  . PRO A 1 220 ? 56.910 146.910 -36.623 1.00 36.81  ? 217 PRO A CA  1 
ATOM   1644 C C   . PRO A 1 220 ? 57.964 147.768 -35.948 1.00 42.07  ? 217 PRO A C   1 
ATOM   1645 O O   . PRO A 1 220 ? 58.049 148.969 -36.232 1.00 39.69  ? 217 PRO A O   1 
ATOM   1646 C CB  . PRO A 1 220 ? 55.621 146.846 -35.791 1.00 23.83  ? 217 PRO A CB  1 
ATOM   1647 C CG  . PRO A 1 220 ? 55.106 145.479 -35.993 1.00 41.03  ? 217 PRO A CG  1 
ATOM   1648 C CD  . PRO A 1 220 ? 56.328 144.626 -36.064 1.00 36.95  ? 217 PRO A CD  1 
ATOM   1649 N N   . SER A 1 221 ? 58.777 147.189 -35.066 1.00 37.50  ? 218 SER A N   1 
ATOM   1650 C CA  . SER A 1 221 ? 59.817 147.961 -34.397 1.00 35.40  ? 218 SER A CA  1 
ATOM   1651 C C   . SER A 1 221 ? 61.095 148.033 -35.220 1.00 39.52  ? 218 SER A C   1 
ATOM   1652 O O   . SER A 1 221 ? 61.867 148.987 -35.072 1.00 43.72  ? 218 SER A O   1 
ATOM   1653 C CB  . SER A 1 221 ? 60.120 147.361 -33.023 1.00 34.37  ? 218 SER A CB  1 
ATOM   1654 O OG  . SER A 1 221 ? 58.943 147.236 -32.243 1.00 36.02  ? 218 SER A OG  1 
ATOM   1655 N N   . ARG A 1 222 ? 61.329 147.044 -36.088 1.00 48.20  ? 219 ARG A N   1 
ATOM   1656 C CA  . ARG A 1 222 ? 62.594 146.965 -36.811 1.00 50.92  ? 219 ARG A CA  1 
ATOM   1657 C C   . ARG A 1 222 ? 62.811 148.171 -37.717 1.00 46.04  ? 219 ARG A C   1 
ATOM   1658 O O   . ARG A 1 222 ? 63.953 148.606 -37.908 1.00 45.97  ? 219 ARG A O   1 
ATOM   1659 C CB  . ARG A 1 222 ? 62.650 145.670 -37.623 1.00 46.18  ? 219 ARG A CB  1 
ATOM   1660 C CG  . ARG A 1 222 ? 63.942 145.469 -38.400 1.00 45.08  ? 219 ARG A CG  1 
ATOM   1661 C CD  . ARG A 1 222 ? 65.147 145.413 -37.473 1.00 50.80  ? 219 ARG A CD  1 
ATOM   1662 N NE  . ARG A 1 222 ? 66.404 145.319 -38.212 1.00 52.72  ? 219 ARG A NE  1 
ATOM   1663 C CZ  . ARG A 1 222 ? 67.133 146.367 -38.583 1.00 52.39  ? 219 ARG A CZ  1 
ATOM   1664 N NH1 . ARG A 1 222 ? 66.731 147.594 -38.285 1.00 53.78  ? 219 ARG A NH1 1 
ATOM   1665 N NH2 . ARG A 1 222 ? 68.264 146.188 -39.252 1.00 53.99  ? 219 ARG A NH2 1 
ATOM   1666 N N   . GLY A 1 223 ? 61.739 148.730 -38.272 1.00 43.67  ? 220 GLY A N   1 
ATOM   1667 C CA  . GLY A 1 223 ? 61.857 149.871 -39.155 1.00 39.80  ? 220 GLY A CA  1 
ATOM   1668 C C   . GLY A 1 223 ? 62.081 151.206 -38.483 1.00 46.96  ? 220 GLY A C   1 
ATOM   1669 O O   . GLY A 1 223 ? 62.175 152.225 -39.172 1.00 51.17  ? 220 GLY A O   1 
ATOM   1670 N N   . LEU A 1 224 ? 62.176 151.235 -37.155 1.00 37.66  ? 221 LEU A N   1 
ATOM   1671 C CA  . LEU A 1 224 ? 62.332 152.476 -36.409 1.00 33.75  ? 221 LEU A CA  1 
ATOM   1672 C C   . LEU A 1 224 ? 63.773 152.750 -36.000 1.00 42.75  ? 221 LEU A C   1 
ATOM   1673 O O   . LEU A 1 224 ? 64.045 153.799 -35.408 1.00 45.21  ? 221 LEU A O   1 
ATOM   1674 C CB  . LEU A 1 224 ? 61.438 152.453 -35.165 1.00 38.60  ? 221 LEU A CB  1 
ATOM   1675 C CG  . LEU A 1 224 ? 59.948 152.225 -35.426 1.00 39.83  ? 221 LEU A CG  1 
ATOM   1676 C CD1 . LEU A 1 224 ? 59.193 152.072 -34.117 1.00 37.97  ? 221 LEU A CD1 1 
ATOM   1677 C CD2 . LEU A 1 224 ? 59.368 153.362 -36.254 1.00 25.94  ? 221 LEU A CD2 1 
ATOM   1678 N N   . PHE A 1 225 ? 64.698 151.842 -36.300 1.00 45.26  ? 222 PHE A N   1 
ATOM   1679 C CA  . PHE A 1 225 ? 66.095 152.024 -35.936 1.00 38.45  ? 222 PHE A CA  1 
ATOM   1680 C C   . PHE A 1 225 ? 66.960 151.261 -36.929 1.00 37.02  ? 222 PHE A C   1 
ATOM   1681 O O   . PHE A 1 225 ? 66.465 150.482 -37.747 1.00 38.01  ? 222 PHE A O   1 
ATOM   1682 C CB  . PHE A 1 225 ? 66.365 151.569 -34.497 1.00 38.09  ? 222 PHE A CB  1 
ATOM   1683 C CG  . PHE A 1 225 ? 66.166 150.096 -34.277 1.00 33.61  ? 222 PHE A CG  1 
ATOM   1684 C CD1 . PHE A 1 225 ? 64.893 149.565 -34.144 1.00 35.83  ? 222 PHE A CD1 1 
ATOM   1685 C CD2 . PHE A 1 225 ? 67.254 149.244 -34.193 1.00 34.35  ? 222 PHE A CD2 1 
ATOM   1686 C CE1 . PHE A 1 225 ? 64.710 148.212 -33.940 1.00 40.80  ? 222 PHE A CE1 1 
ATOM   1687 C CE2 . PHE A 1 225 ? 67.077 147.892 -33.988 1.00 41.36  ? 222 PHE A CE2 1 
ATOM   1688 C CZ  . PHE A 1 225 ? 65.804 147.374 -33.861 1.00 36.51  ? 222 PHE A CZ  1 
ATOM   1689 N N   . HIS A 1 226 ? 68.269 151.490 -36.844 1.00 38.59  ? 223 HIS A N   1 
ATOM   1690 C CA  . HIS A 1 226 ? 69.205 150.948 -37.819 1.00 46.23  ? 223 HIS A CA  1 
ATOM   1691 C C   . HIS A 1 226 ? 70.386 150.208 -37.211 1.00 44.58  ? 223 HIS A C   1 
ATOM   1692 O O   . HIS A 1 226 ? 71.015 149.413 -37.919 1.00 47.56  ? 223 HIS A O   1 
ATOM   1693 C CB  . HIS A 1 226 ? 69.730 152.071 -38.724 1.00 43.19  ? 223 HIS A CB  1 
ATOM   1694 C CG  . HIS A 1 226 ? 68.653 152.977 -39.233 1.00 53.48  ? 223 HIS A CG  1 
ATOM   1695 N ND1 . HIS A 1 226 ? 68.119 153.996 -38.473 1.00 58.48  ? 223 HIS A ND1 1 
ATOM   1696 C CD2 . HIS A 1 226 ? 67.992 153.003 -40.414 1.00 56.74  ? 223 HIS A CD2 1 
ATOM   1697 C CE1 . HIS A 1 226 ? 67.182 154.616 -39.168 1.00 49.96  ? 223 HIS A CE1 1 
ATOM   1698 N NE2 . HIS A 1 226 ? 67.087 154.034 -40.350 1.00 59.96  ? 223 HIS A NE2 1 
ATOM   1699 N N   . ARG A 1 227 ? 70.709 150.433 -35.941 1.00 40.26  ? 224 ARG A N   1 
ATOM   1700 C CA  . ARG A 1 227 ? 71.767 149.699 -35.264 1.00 37.95  ? 224 ARG A CA  1 
ATOM   1701 C C   . ARG A 1 227 ? 71.295 149.338 -33.865 1.00 43.07  ? 224 ARG A C   1 
ATOM   1702 O O   . ARG A 1 227 ? 70.322 149.895 -33.352 1.00 47.09  ? 224 ARG A O   1 
ATOM   1703 C CB  . ARG A 1 227 ? 73.068 150.508 -35.204 1.00 43.37  ? 224 ARG A CB  1 
ATOM   1704 C CG  . ARG A 1 227 ? 73.737 150.685 -36.553 1.00 42.83  ? 224 ARG A CG  1 
ATOM   1705 C CD  . ARG A 1 227 ? 74.572 151.948 -36.599 1.00 42.34  ? 224 ARG A CD  1 
ATOM   1706 N NE  . ARG A 1 227 ? 75.120 152.179 -37.931 1.00 54.34  ? 224 ARG A NE  1 
ATOM   1707 C CZ  . ARG A 1 227 ? 75.527 153.363 -38.375 1.00 63.09  ? 224 ARG A CZ  1 
ATOM   1708 N NH1 . ARG A 1 227 ? 75.440 154.429 -37.594 1.00 62.57  ? 224 ARG A NH1 1 
ATOM   1709 N NH2 . ARG A 1 227 ? 76.012 153.483 -39.603 1.00 63.55  ? 224 ARG A NH2 1 
ATOM   1710 N N   . ALA A 1 228 ? 71.998 148.391 -33.250 1.00 43.94  ? 225 ALA A N   1 
ATOM   1711 C CA  . ALA A 1 228 ? 71.621 147.890 -31.938 1.00 32.96  ? 225 ALA A CA  1 
ATOM   1712 C C   . ALA A 1 228 ? 72.866 147.631 -31.106 1.00 34.66  ? 225 ALA A C   1 
ATOM   1713 O O   . ALA A 1 228 ? 73.868 147.121 -31.613 1.00 40.44  ? 225 ALA A O   1 
ATOM   1714 C CB  . ALA A 1 228 ? 70.791 146.605 -32.048 1.00 32.14  ? 225 ALA A CB  1 
ATOM   1715 N N   . VAL A 1 229 ? 72.795 147.994 -29.828 1.00 42.84  ? 226 VAL A N   1 
ATOM   1716 C CA  . VAL A 1 229 ? 73.831 147.678 -28.853 1.00 32.81  ? 226 VAL A CA  1 
ATOM   1717 C C   . VAL A 1 229 ? 73.167 146.972 -27.681 1.00 34.56  ? 226 VAL A C   1 
ATOM   1718 O O   . VAL A 1 229 ? 72.193 147.482 -27.115 1.00 38.95  ? 226 VAL A O   1 
ATOM   1719 C CB  . VAL A 1 229 ? 74.582 148.934 -28.372 1.00 28.35  ? 226 VAL A CB  1 
ATOM   1720 C CG1 . VAL A 1 229 ? 75.700 148.550 -27.412 1.00 30.40  ? 226 VAL A CG1 1 
ATOM   1721 C CG2 . VAL A 1 229 ? 75.123 149.727 -29.550 1.00 35.01  ? 226 VAL A CG2 1 
ATOM   1722 N N   . LEU A 1 230 ? 73.687 145.802 -27.322 1.00 37.66  ? 227 LEU A N   1 
ATOM   1723 C CA  . LEU A 1 230 ? 73.124 144.979 -26.256 1.00 30.91  ? 227 LEU A CA  1 
ATOM   1724 C C   . LEU A 1 230 ? 74.200 144.763 -25.201 1.00 32.81  ? 227 LEU A C   1 
ATOM   1725 O O   . LEU A 1 230 ? 75.163 144.023 -25.431 1.00 36.94  ? 227 LEU A O   1 
ATOM   1726 C CB  . LEU A 1 230 ? 72.604 143.648 -26.802 1.00 28.45  ? 227 LEU A CB  1 
ATOM   1727 C CG  . LEU A 1 230 ? 71.374 143.689 -27.719 1.00 23.29  ? 227 LEU A CG  1 
ATOM   1728 C CD1 . LEU A 1 230 ? 71.736 144.076 -29.150 1.00 34.02  ? 227 LEU A CD1 1 
ATOM   1729 C CD2 . LEU A 1 230 ? 70.634 142.360 -27.693 1.00 28.16  ? 227 LEU A CD2 1 
ATOM   1730 N N   . GLN A 1 231 ? 74.035 145.407 -24.048 1.00 32.19  ? 228 GLN A N   1 
ATOM   1731 C CA  . GLN A 1 231 ? 75.015 145.359 -22.969 1.00 28.93  ? 228 GLN A CA  1 
ATOM   1732 C C   . GLN A 1 231 ? 74.500 144.426 -21.879 1.00 37.71  ? 228 GLN A C   1 
ATOM   1733 O O   . GLN A 1 231 ? 73.529 144.749 -21.186 1.00 35.15  ? 228 GLN A O   1 
ATOM   1734 C CB  . GLN A 1 231 ? 75.275 146.759 -22.417 1.00 22.76  ? 228 GLN A CB  1 
ATOM   1735 C CG  . GLN A 1 231 ? 75.619 147.794 -23.477 1.00 27.32  ? 228 GLN A CG  1 
ATOM   1736 C CD  . GLN A 1 231 ? 75.826 149.178 -22.891 1.00 38.54  ? 228 GLN A CD  1 
ATOM   1737 O OE1 . GLN A 1 231 ? 75.856 150.174 -23.615 1.00 36.54  ? 228 GLN A OE1 1 
ATOM   1738 N NE2 . GLN A 1 231 ? 75.972 149.246 -21.573 1.00 29.56  ? 228 GLN A NE2 1 
ATOM   1739 N N   . SER A 1 232 ? 75.144 143.266 -21.738 1.00 25.74  ? 229 SER A N   1 
ATOM   1740 C CA  . SER A 1 232 ? 74.855 142.325 -20.654 1.00 28.81  ? 229 SER A CA  1 
ATOM   1741 C C   . SER A 1 232 ? 73.396 141.871 -20.670 1.00 22.89  ? 229 SER A C   1 
ATOM   1742 O O   . SER A 1 232 ? 72.734 141.819 -19.632 1.00 23.79  ? 229 SER A O   1 
ATOM   1743 C CB  . SER A 1 232 ? 75.214 142.925 -19.293 1.00 24.66  ? 229 SER A CB  1 
ATOM   1744 O OG  . SER A 1 232 ? 76.573 143.325 -19.251 1.00 31.28  ? 229 SER A OG  1 
ATOM   1745 N N   . GLY A 1 233 ? 72.891 141.536 -21.849 1.00 25.99  ? 230 GLY A N   1 
ATOM   1746 C CA  . GLY A 1 233 ? 71.513 141.098 -21.964 1.00 20.15  ? 230 GLY A CA  1 
ATOM   1747 C C   . GLY A 1 233 ? 71.208 140.657 -23.379 1.00 20.66  ? 230 GLY A C   1 
ATOM   1748 O O   . GLY A 1 233 ? 71.871 141.063 -24.339 1.00 30.29  ? 230 GLY A O   1 
ATOM   1749 N N   . ALA A 1 234 ? 70.183 139.814 -23.487 1.00 24.96  ? 231 ALA A N   1 
ATOM   1750 C CA  . ALA A 1 234 ? 69.749 139.273 -24.767 1.00 26.06  ? 231 ALA A CA  1 
ATOM   1751 C C   . ALA A 1 234 ? 68.294 138.857 -24.640 1.00 29.04  ? 231 ALA A C   1 
ATOM   1752 O O   . ALA A 1 234 ? 67.854 138.491 -23.543 1.00 30.23  ? 231 ALA A O   1 
ATOM   1753 C CB  . ALA A 1 234 ? 70.615 138.076 -25.188 1.00 28.37  ? 231 ALA A CB  1 
ATOM   1754 N N   . PRO A 1 235 ? 67.521 138.903 -25.729 1.00 27.13  ? 232 PRO A N   1 
ATOM   1755 C CA  . PRO A 1 235 ? 66.110 138.497 -25.636 1.00 28.42  ? 232 PRO A CA  1 
ATOM   1756 C C   . PRO A 1 235 ? 65.915 137.005 -25.440 1.00 35.28  ? 232 PRO A C   1 
ATOM   1757 O O   . PRO A 1 235 ? 64.840 136.596 -24.985 1.00 32.56  ? 232 PRO A O   1 
ATOM   1758 C CB  . PRO A 1 235 ? 65.523 138.961 -26.976 1.00 26.58  ? 232 PRO A CB  1 
ATOM   1759 C CG  . PRO A 1 235 ? 66.686 138.952 -27.910 1.00 25.62  ? 232 PRO A CG  1 
ATOM   1760 C CD  . PRO A 1 235 ? 67.878 139.360 -27.084 1.00 28.85  ? 232 PRO A CD  1 
ATOM   1761 N N   . ASN A 1 236 ? 66.913 136.182 -25.757 1.00 34.52  ? 233 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 236 ? 66.772 134.733 -25.721 1.00 45.64  ? 233 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 236 ? 67.166 134.124 -24.379 1.00 42.99  ? 233 ASN A C   1 
ATOM   1764 O O   . ASN A 1 236 ? 67.238 132.896 -24.270 1.00 52.44  ? 233 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 236 ? 67.598 134.099 -26.845 1.00 26.90  ? 233 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 236 ? 69.041 134.569 -26.849 1.00 39.51  ? 233 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 236 ? 69.337 135.692 -27.256 1.00 36.64  ? 233 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 236 ? 69.948 133.705 -26.406 1.00 32.36  ? 233 ASN A ND2 1 
ATOM   1769 N N   . GLY A 1 237 ? 67.413 134.944 -23.361 1.00 48.93  ? 234 GLY A N   1 
ATOM   1770 C CA  . GLY A 1 237 ? 67.786 134.446 -22.059 1.00 52.90  ? 234 GLY A CA  1 
ATOM   1771 C C   . GLY A 1 237 ? 66.652 133.705 -21.379 1.00 46.32  ? 234 GLY A C   1 
ATOM   1772 O O   . GLY A 1 237 ? 65.483 133.828 -21.758 1.00 54.78  ? 234 GLY A O   1 
ATOM   1773 N N   . PRO A 1 238 ? 66.980 132.912 -20.354 1.00 38.04  ? 235 PRO A N   1 
ATOM   1774 C CA  . PRO A 1 238 ? 65.940 132.171 -19.625 1.00 33.79  ? 235 PRO A CA  1 
ATOM   1775 C C   . PRO A 1 238 ? 65.087 133.035 -18.710 1.00 34.58  ? 235 PRO A C   1 
ATOM   1776 O O   . PRO A 1 238 ? 64.205 132.500 -18.029 1.00 28.93  ? 235 PRO A O   1 
ATOM   1777 C CB  . PRO A 1 238 ? 66.751 131.151 -18.814 1.00 29.84  ? 235 PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 238 ? 68.062 131.828 -18.592 1.00 31.48  ? 235 PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 238 ? 68.332 132.610 -19.850 1.00 29.58  ? 235 PRO A CD  1 
ATOM   1780 N N   . TRP A 1 239 ? 65.320 134.347 -18.672 1.00 33.93  ? 236 TRP A N   1 
ATOM   1781 C CA  . TRP A 1 239 ? 64.590 135.253 -17.800 1.00 34.37  ? 236 TRP A CA  1 
ATOM   1782 C C   . TRP A 1 239 ? 63.815 136.332 -18.539 1.00 38.05  ? 236 TRP A C   1 
ATOM   1783 O O   . TRP A 1 239 ? 62.925 136.944 -17.938 1.00 35.96  ? 236 TRP A O   1 
ATOM   1784 C CB  . TRP A 1 239 ? 65.556 135.939 -16.821 1.00 28.11  ? 236 TRP A CB  1 
ATOM   1785 C CG  . TRP A 1 239 ? 66.691 136.617 -17.526 1.00 34.45  ? 236 TRP A CG  1 
ATOM   1786 C CD1 . TRP A 1 239 ? 67.915 136.084 -17.807 1.00 28.75  ? 236 TRP A CD1 1 
ATOM   1787 C CD2 . TRP A 1 239 ? 66.699 137.946 -18.062 1.00 33.86  ? 236 TRP A CD2 1 
ATOM   1788 N NE1 . TRP A 1 239 ? 68.689 137.002 -18.475 1.00 28.29  ? 236 TRP A NE1 1 
ATOM   1789 C CE2 . TRP A 1 239 ? 67.965 138.153 -18.645 1.00 29.86  ? 236 TRP A CE2 1 
ATOM   1790 C CE3 . TRP A 1 239 ? 65.762 138.983 -18.099 1.00 28.16  ? 236 TRP A CE3 1 
ATOM   1791 C CZ2 . TRP A 1 239 ? 68.317 139.354 -19.258 1.00 28.85  ? 236 TRP A CZ2 1 
ATOM   1792 C CZ3 . TRP A 1 239 ? 66.112 140.174 -18.711 1.00 31.22  ? 236 TRP A CZ3 1 
ATOM   1793 C CH2 . TRP A 1 239 ? 67.380 140.349 -19.281 1.00 31.18  ? 236 TRP A CH2 1 
ATOM   1794 N N   . ALA A 1 240 ? 64.123 136.584 -19.813 1.00 38.88  ? 237 ALA A N   1 
ATOM   1795 C CA  . ALA A 1 240 ? 63.565 137.731 -20.517 1.00 26.14  ? 237 ALA A CA  1 
ATOM   1796 C C   . ALA A 1 240 ? 62.172 137.478 -21.075 1.00 35.09  ? 237 ALA A C   1 
ATOM   1797 O O   . ALA A 1 240 ? 61.473 138.441 -21.407 1.00 40.13  ? 237 ALA A O   1 
ATOM   1798 C CB  . ALA A 1 240 ? 64.501 138.154 -21.652 1.00 25.54  ? 237 ALA A CB  1 
ATOM   1799 N N   . THR A 1 241 ? 61.754 136.221 -21.193 1.00 26.20  ? 238 THR A N   1 
ATOM   1800 C CA  . THR A 1 241 ? 60.447 135.887 -21.737 1.00 26.31  ? 238 THR A CA  1 
ATOM   1801 C C   . THR A 1 241 ? 59.768 134.858 -20.844 1.00 27.05  ? 238 THR A C   1 
ATOM   1802 O O   . THR A 1 241 ? 60.396 134.231 -19.987 1.00 30.76  ? 238 THR A O   1 
ATOM   1803 C CB  . THR A 1 241 ? 60.549 135.354 -23.173 1.00 31.49  ? 238 THR A CB  1 
ATOM   1804 O OG1 . THR A 1 241 ? 61.435 134.228 -23.206 1.00 44.97  ? 238 THR A OG1 1 
ATOM   1805 C CG2 . THR A 1 241 ? 61.067 136.434 -24.110 1.00 30.19  ? 238 THR A CG2 1 
ATOM   1806 N N   . VAL A 1 242 ? 58.464 134.688 -21.057 1.00 25.59  ? 239 VAL A N   1 
ATOM   1807 C CA  . VAL A 1 242 ? 57.670 133.741 -20.287 1.00 28.06  ? 239 VAL A CA  1 
ATOM   1808 C C   . VAL A 1 242 ? 56.570 133.198 -21.189 1.00 36.20  ? 239 VAL A C   1 
ATOM   1809 O O   . VAL A 1 242 ? 56.143 133.853 -22.143 1.00 36.37  ? 239 VAL A O   1 
ATOM   1810 C CB  . VAL A 1 242 ? 57.092 134.394 -19.007 1.00 33.25  ? 239 VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 242 ? 55.880 135.259 -19.334 1.00 30.38  ? 239 VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 242 ? 56.753 133.339 -17.968 1.00 38.04  ? 239 VAL A CG2 1 
ATOM   1813 N N   . GLY A 1 243 ? 56.122 131.977 -20.889 1.00 34.11  ? 240 GLY A N   1 
ATOM   1814 C CA  . GLY A 1 243 ? 55.103 131.347 -21.698 1.00 37.19  ? 240 GLY A CA  1 
ATOM   1815 C C   . GLY A 1 243 ? 53.714 131.895 -21.431 1.00 40.46  ? 240 GLY A C   1 
ATOM   1816 O O   . GLY A 1 243 ? 53.454 132.549 -20.421 1.00 41.18  ? 240 GLY A O   1 
ATOM   1817 N N   . MET A 1 244 ? 52.807 131.615 -22.371 1.00 38.79  ? 241 MET A N   1 
ATOM   1818 C CA  . MET A 1 244 ? 51.431 132.086 -22.240 1.00 43.59  ? 241 MET A CA  1 
ATOM   1819 C C   . MET A 1 244 ? 50.756 131.492 -21.010 1.00 46.15  ? 241 MET A C   1 
ATOM   1820 O O   . MET A 1 244 ? 50.079 132.205 -20.260 1.00 43.28  ? 241 MET A O   1 
ATOM   1821 C CB  . MET A 1 244 ? 50.636 131.745 -23.501 1.00 39.77  ? 241 MET A CB  1 
ATOM   1822 C CG  . MET A 1 244 ? 50.920 132.653 -24.686 1.00 52.19  ? 241 MET A CG  1 
ATOM   1823 S SD  . MET A 1 244 ? 50.064 132.123 -26.182 1.00 68.45  ? 241 MET A SD  1 
ATOM   1824 C CE  . MET A 1 244 ? 48.379 132.001 -25.587 1.00 43.01  ? 241 MET A CE  1 
ATOM   1825 N N   . GLY A 1 245 ? 50.928 130.189 -20.787 1.00 40.04  ? 242 GLY A N   1 
ATOM   1826 C CA  . GLY A 1 245 ? 50.304 129.560 -19.635 1.00 35.30  ? 242 GLY A CA  1 
ATOM   1827 C C   . GLY A 1 245 ? 50.869 130.054 -18.318 1.00 39.72  ? 242 GLY A C   1 
ATOM   1828 O O   . GLY A 1 245 ? 50.130 130.246 -17.348 1.00 37.65  ? 242 GLY A O   1 
ATOM   1829 N N   . GLU A 1 246 ? 52.185 130.273 -18.263 1.00 44.58  ? 243 GLU A N   1 
ATOM   1830 C CA  . GLU A 1 246 ? 52.803 130.733 -17.024 1.00 45.85  ? 243 GLU A CA  1 
ATOM   1831 C C   . GLU A 1 246 ? 52.465 132.192 -16.743 1.00 39.09  ? 243 GLU A C   1 
ATOM   1832 O O   . GLU A 1 246 ? 52.250 132.573 -15.586 1.00 35.26  ? 243 GLU A O   1 
ATOM   1833 C CB  . GLU A 1 246 ? 54.317 130.528 -17.085 1.00 39.32  ? 243 GLU A CB  1 
ATOM   1834 C CG  . GLU A 1 246 ? 55.068 130.999 -15.847 1.00 39.99  ? 243 GLU A CG  1 
ATOM   1835 C CD  . GLU A 1 246 ? 54.698 130.226 -14.595 1.00 39.41  ? 243 GLU A CD  1 
ATOM   1836 O OE1 . GLU A 1 246 ? 54.178 129.096 -14.713 1.00 46.89  ? 243 GLU A OE1 1 
ATOM   1837 O OE2 . GLU A 1 246 ? 54.932 130.752 -13.487 1.00 38.55  ? 243 GLU A OE2 1 
ATOM   1838 N N   . ALA A 1 247 ? 52.414 133.025 -17.786 1.00 40.11  ? 244 ALA A N   1 
ATOM   1839 C CA  . ALA A 1 247 ? 52.027 134.419 -17.596 1.00 35.47  ? 244 ALA A CA  1 
ATOM   1840 C C   . ALA A 1 247 ? 50.590 134.535 -17.107 1.00 39.27  ? 244 ALA A C   1 
ATOM   1841 O O   . ALA A 1 247 ? 50.265 135.454 -16.346 1.00 43.38  ? 244 ALA A O   1 
ATOM   1842 C CB  . ALA A 1 247 ? 52.212 135.201 -18.896 1.00 39.84  ? 244 ALA A CB  1 
ATOM   1843 N N   . ARG A 1 248 ? 49.721 133.614 -17.528 1.00 38.08  ? 245 ARG A N   1 
ATOM   1844 C CA  . ARG A 1 248 ? 48.345 133.618 -17.044 1.00 37.28  ? 245 ARG A CA  1 
ATOM   1845 C C   . ARG A 1 248 ? 48.274 133.208 -15.578 1.00 33.68  ? 245 ARG A C   1 
ATOM   1846 O O   . ARG A 1 248 ? 47.491 133.775 -14.806 1.00 37.76  ? 245 ARG A O   1 
ATOM   1847 C CB  . ARG A 1 248 ? 47.486 132.693 -17.906 1.00 36.37  ? 245 ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 248 ? 46.105 132.409 -17.338 1.00 34.09  ? 245 ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 248 ? 45.231 131.702 -18.357 1.00 31.61  ? 245 ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 248 ? 45.031 132.524 -19.547 1.00 40.93  ? 245 ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 248 ? 44.031 133.385 -19.699 1.00 51.84  ? 245 ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 248 ? 43.132 133.538 -18.736 1.00 43.79  ? 245 ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 248 ? 43.929 134.094 -20.815 1.00 45.50  ? 245 ARG A NH2 1 
ATOM   1854 N N   . ARG A 1 249 ? 49.088 132.228 -15.175 1.00 34.46  ? 246 ARG A N   1 
ATOM   1855 C CA  . ARG A 1 249 ? 49.069 131.774 -13.788 1.00 38.08  ? 246 ARG A CA  1 
ATOM   1856 C C   . ARG A 1 249 ? 49.526 132.874 -12.837 1.00 35.23  ? 246 ARG A C   1 
ATOM   1857 O O   . ARG A 1 249 ? 48.957 133.039 -11.752 1.00 38.85  ? 246 ARG A O   1 
ATOM   1858 C CB  . ARG A 1 249 ? 49.948 130.535 -13.626 1.00 37.08  ? 246 ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 249 ? 49.864 129.908 -12.244 1.00 39.25  ? 246 ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 249 ? 51.049 129.002 -11.958 1.00 45.70  ? 246 ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 249 ? 52.310 129.738 -11.944 1.00 50.32  ? 246 ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 249 ? 52.746 130.456 -10.914 1.00 49.45  ? 246 ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 249 ? 52.019 130.544 -9.808  1.00 42.51  ? 246 ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 249 ? 53.907 131.092 -10.990 1.00 39.19  ? 246 ARG A NH2 1 
ATOM   1865 N N   . ARG A 1 250 ? 50.551 133.636 -13.225 1.00 35.04  ? 247 ARG A N   1 
ATOM   1866 C CA  . ARG A 1 250 ? 51.049 134.701 -12.360 1.00 35.88  ? 247 ARG A CA  1 
ATOM   1867 C C   . ARG A 1 250 ? 50.058 135.855 -12.275 1.00 32.38  ? 247 ARG A C   1 
ATOM   1868 O O   . ARG A 1 250 ? 49.822 136.397 -11.188 1.00 37.13  ? 247 ARG A O   1 
ATOM   1869 C CB  . ARG A 1 250 ? 52.406 135.189 -12.863 1.00 30.99  ? 247 ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 250 ? 53.463 134.100 -12.903 1.00 38.47  ? 247 ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 250 ? 54.755 134.586 -13.535 1.00 36.61  ? 247 ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 250 ? 55.772 133.540 -13.538 1.00 30.39  ? 247 ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 250 ? 56.998 133.689 -14.029 1.00 31.94  ? 247 ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 250 ? 57.364 134.846 -14.561 1.00 39.05  ? 247 ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 250 ? 57.858 132.681 -13.988 1.00 32.43  ? 247 ARG A NH2 1 
ATOM   1876 N N   . ALA A 1 251 ? 49.471 136.246 -13.410 1.00 31.77  ? 248 ALA A N   1 
ATOM   1877 C CA  . ALA A 1 251 ? 48.457 137.296 -13.394 1.00 30.84  ? 248 ALA A CA  1 
ATOM   1878 C C   . ALA A 1 251 ? 47.253 136.885 -12.558 1.00 31.42  ? 248 ALA A C   1 
ATOM   1879 O O   . ALA A 1 251 ? 46.665 137.712 -11.851 1.00 36.37  ? 248 ALA A O   1 
ATOM   1880 C CB  . ALA A 1 251 ? 48.029 137.636 -14.822 1.00 29.22  ? 248 ALA A CB  1 
ATOM   1881 N N   . THR A 1 252 ? 46.873 135.607 -12.625 1.00 34.01  ? 249 THR A N   1 
ATOM   1882 C CA  . THR A 1 252 ? 45.781 135.116 -11.791 1.00 37.28  ? 249 THR A CA  1 
ATOM   1883 C C   . THR A 1 252 ? 46.193 135.061 -10.325 1.00 32.84  ? 249 THR A C   1 
ATOM   1884 O O   . THR A 1 252 ? 45.394 135.380 -9.437  1.00 31.95  ? 249 THR A O   1 
ATOM   1885 C CB  . THR A 1 252 ? 45.329 133.738 -12.276 1.00 30.07  ? 249 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 252 ? 44.983 133.809 -13.665 1.00 37.64  ? 249 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 252 ? 44.120 133.259 -11.485 1.00 28.50  ? 249 THR A CG2 1 
ATOM   1888 N N   . GLN A 1 253 ? 47.440 134.667 -10.055 1.00 29.83  ? 250 GLN A N   1 
ATOM   1889 C CA  . GLN A 1 253 ? 47.917 134.621 -8.676  1.00 34.46  ? 250 GLN A CA  1 
ATOM   1890 C C   . GLN A 1 253 ? 48.011 136.018 -8.075  1.00 41.63  ? 250 GLN A C   1 
ATOM   1891 O O   . GLN A 1 253 ? 47.616 136.229 -6.922  1.00 35.55  ? 250 GLN A O   1 
ATOM   1892 C CB  . GLN A 1 253 ? 49.271 133.912 -8.612  1.00 35.51  ? 250 GLN A CB  1 
ATOM   1893 C CG  . GLN A 1 253 ? 49.954 133.973 -7.250  1.00 39.10  ? 250 GLN A CG  1 
ATOM   1894 C CD  . GLN A 1 253 ? 49.203 133.215 -6.168  1.00 51.28  ? 250 GLN A CD  1 
ATOM   1895 O OE1 . GLN A 1 253 ? 48.274 132.457 -6.447  1.00 64.15  ? 250 GLN A OE1 1 
ATOM   1896 N NE2 . GLN A 1 253 ? 49.609 133.418 -4.919  1.00 49.71  ? 250 GLN A NE2 1 
ATOM   1897 N N   . LEU A 1 254 ? 48.531 136.984 -8.838  1.00 36.77  ? 251 LEU A N   1 
ATOM   1898 C CA  . LEU A 1 254 ? 48.567 138.361 -8.356  1.00 31.95  ? 251 LEU A CA  1 
ATOM   1899 C C   . LEU A 1 254 ? 47.163 138.883 -8.086  1.00 35.99  ? 251 LEU A C   1 
ATOM   1900 O O   . LEU A 1 254 ? 46.932 139.582 -7.092  1.00 36.37  ? 251 LEU A O   1 
ATOM   1901 C CB  . LEU A 1 254 ? 49.282 139.260 -9.365  1.00 33.69  ? 251 LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 254 ? 49.332 140.740 -8.977  1.00 34.45  ? 251 LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 254 ? 50.248 140.954 -7.779  1.00 22.74  ? 251 LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 254 ? 49.759 141.608 -10.150 1.00 35.32  ? 251 LEU A CD2 1 
ATOM   1905 N N   . ALA A 1 255 ? 46.211 138.554 -8.963  1.00 36.90  ? 252 ALA A N   1 
ATOM   1906 C CA  . ALA A 1 255 ? 44.823 138.935 -8.725  1.00 34.94  ? 252 ALA A CA  1 
ATOM   1907 C C   . ALA A 1 255 ? 44.302 138.324 -7.431  1.00 32.36  ? 252 ALA A C   1 
ATOM   1908 O O   . ALA A 1 255 ? 43.600 138.989 -6.661  1.00 39.58  ? 252 ALA A O   1 
ATOM   1909 C CB  . ALA A 1 255 ? 43.954 138.512 -9.909  1.00 42.83  ? 252 ALA A CB  1 
ATOM   1910 N N   . HIS A 1 256 ? 44.644 137.060 -7.171  1.00 32.06  ? 253 HIS A N   1 
ATOM   1911 C CA  . HIS A 1 256 ? 44.192 136.404 -5.948  1.00 35.63  ? 253 HIS A CA  1 
ATOM   1912 C C   . HIS A 1 256 ? 44.752 137.090 -4.709  1.00 33.90  ? 253 HIS A C   1 
ATOM   1913 O O   . HIS A 1 256 ? 44.041 137.265 -3.712  1.00 37.16  ? 253 HIS A O   1 
ATOM   1914 C CB  . HIS A 1 256 ? 44.594 134.929 -5.966  1.00 30.75  ? 253 HIS A CB  1 
ATOM   1915 C CG  . HIS A 1 256 ? 44.401 134.235 -4.654  1.00 40.91  ? 253 HIS A CG  1 
ATOM   1916 N ND1 . HIS A 1 256 ? 43.169 133.801 -4.216  1.00 39.18  ? 253 HIS A ND1 1 
ATOM   1917 C CD2 . HIS A 1 256 ? 45.284 133.906 -3.681  1.00 38.27  ? 253 HIS A CD2 1 
ATOM   1918 C CE1 . HIS A 1 256 ? 43.301 133.231 -3.031  1.00 37.81  ? 253 HIS A CE1 1 
ATOM   1919 N NE2 . HIS A 1 256 ? 44.575 133.282 -2.684  1.00 39.08  ? 253 HIS A NE2 1 
ATOM   1920 N N   . LEU A 1 257 ? 46.026 137.488 -4.752  1.00 33.79  ? 254 LEU A N   1 
ATOM   1921 C CA  . LEU A 1 257 ? 46.662 138.094 -3.589  1.00 34.36  ? 254 LEU A CA  1 
ATOM   1922 C C   . LEU A 1 257 ? 46.066 139.449 -3.229  1.00 33.48  ? 254 LEU A C   1 
ATOM   1923 O O   . LEU A 1 257 ? 46.189 139.876 -2.076  1.00 34.94  ? 254 LEU A O   1 
ATOM   1924 C CB  . LEU A 1 257 ? 48.166 138.234 -3.830  1.00 27.01  ? 254 LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 257 ? 48.946 136.919 -3.905  1.00 30.36  ? 254 LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 257 ? 50.385 137.168 -4.330  1.00 27.75  ? 254 LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 257 ? 48.899 136.193 -2.567  1.00 23.55  ? 254 LEU A CD2 1 
ATOM   1928 N N   . VAL A 1 258 ? 45.428 140.132 -4.175  1.00 33.24  ? 255 VAL A N   1 
ATOM   1929 C CA  . VAL A 1 258 ? 44.829 141.435 -3.921  1.00 35.82  ? 255 VAL A CA  1 
ATOM   1930 C C   . VAL A 1 258 ? 43.304 141.345 -3.865  1.00 37.42  ? 255 VAL A C   1 
ATOM   1931 O O   . VAL A 1 258 ? 42.618 142.359 -3.979  1.00 42.18  ? 255 VAL A O   1 
ATOM   1932 C CB  . VAL A 1 258 ? 45.291 142.474 -4.956  1.00 35.29  ? 255 VAL A CB  1 
ATOM   1933 C CG1 . VAL A 1 258 ? 46.801 142.652 -4.889  1.00 32.52  ? 255 VAL A CG1 1 
ATOM   1934 C CG2 . VAL A 1 258 ? 44.856 142.064 -6.354  1.00 35.84  ? 255 VAL A CG2 1 
ATOM   1935 N N   . GLY A 1 259 ? 42.765 140.140 -3.692  1.00 36.46  ? 256 GLY A N   1 
ATOM   1936 C CA  . GLY A 1 259 ? 41.334 139.972 -3.537  1.00 40.97  ? 256 GLY A CA  1 
ATOM   1937 C C   . GLY A 1 259 ? 40.541 139.909 -4.821  1.00 38.86  ? 256 GLY A C   1 
ATOM   1938 O O   . GLY A 1 259 ? 39.333 140.160 -4.799  1.00 39.65  ? 256 GLY A O   1 
ATOM   1939 N N   . CYS A 1 260 ? 41.178 139.581 -5.940  1.00 34.22  ? 257 CYS A N   1 
ATOM   1940 C CA  . CYS A 1 260 ? 40.475 139.477 -7.214  1.00 48.72  ? 257 CYS A CA  1 
ATOM   1941 C C   . CYS A 1 260 ? 40.419 138.030 -7.693  1.00 48.31  ? 257 CYS A C   1 
ATOM   1942 O O   . CYS A 1 260 ? 41.438 137.342 -7.716  1.00 52.37  ? 257 CYS A O   1 
ATOM   1943 C CB  . CYS A 1 260 ? 41.149 140.352 -8.275  1.00 44.36  ? 257 CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 260 ? 41.076 142.129 -7.956  1.00 52.35  ? 257 CYS A SG  1 
ATOM   1945 N N   . PRO A 1 261 ? 39.221 137.561 -8.073  1.00 60.86  ? 258 PRO A N   1 
ATOM   1946 C CA  . PRO A 1 261 ? 37.969 138.319 -8.002  1.00 62.31  ? 258 PRO A CA  1 
ATOM   1947 C C   . PRO A 1 261 ? 37.314 138.210 -6.628  1.00 68.41  ? 258 PRO A C   1 
ATOM   1948 O O   . PRO A 1 261 ? 37.649 137.294 -5.876  1.00 63.24  ? 258 PRO A O   1 
ATOM   1949 C CB  . PRO A 1 261 ? 37.109 137.651 -9.074  1.00 66.81  ? 258 PRO A CB  1 
ATOM   1950 C CG  . PRO A 1 261 ? 37.553 136.229 -9.044  1.00 65.57  ? 258 PRO A CG  1 
ATOM   1951 C CD  . PRO A 1 261 ? 39.029 136.247 -8.713  1.00 62.75  ? 258 PRO A CD  1 
ATOM   1952 N N   . PRO A 1 262 ? 36.406 139.137 -6.299  1.00 69.55  ? 259 PRO A N   1 
ATOM   1953 C CA  . PRO A 1 262 ? 35.693 139.045 -5.017  1.00 69.80  ? 259 PRO A CA  1 
ATOM   1954 C C   . PRO A 1 262 ? 34.924 137.740 -4.886  1.00 83.52  ? 259 PRO A C   1 
ATOM   1955 O O   . PRO A 1 262 ? 33.960 137.503 -5.621  1.00 88.78  ? 259 PRO A O   1 
ATOM   1956 C CB  . PRO A 1 262 ? 34.751 140.255 -5.050  1.00 68.77  ? 259 PRO A CB  1 
ATOM   1957 C CG  . PRO A 1 262 ? 35.402 141.213 -5.992  1.00 67.01  ? 259 PRO A CG  1 
ATOM   1958 C CD  . PRO A 1 262 ? 36.058 140.363 -7.039  1.00 62.28  ? 259 PRO A CD  1 
ATOM   1959 N N   . GLY A 1 263 ? 35.350 136.889 -3.957  1.00 81.81  ? 260 GLY A N   1 
ATOM   1960 C CA  . GLY A 1 263 ? 34.759 135.574 -3.782  1.00 88.08  ? 260 GLY A CA  1 
ATOM   1961 C C   . GLY A 1 263 ? 33.272 135.574 -3.486  1.00 95.11  ? 260 GLY A C   1 
ATOM   1962 O O   . GLY A 1 263 ? 32.815 136.242 -2.558  1.00 97.90  ? 260 GLY A O   1 
ATOM   1963 N N   . GLY A 1 264 ? 32.513 134.825 -4.281  1.00 99.13  ? 261 GLY A N   1 
ATOM   1964 C CA  . GLY A 1 264 ? 33.071 134.060 -5.382  1.00 93.64  ? 261 GLY A CA  1 
ATOM   1965 C C   . GLY A 1 264 ? 32.558 134.513 -6.734  1.00 95.85  ? 261 GLY A C   1 
ATOM   1966 O O   . GLY A 1 264 ? 32.307 133.696 -7.621  1.00 95.65  ? 261 GLY A O   1 
ATOM   1967 N N   . THR A 1 265 ? 32.405 135.824 -6.892  1.00 96.52  ? 262 THR A N   1 
ATOM   1968 C CA  . THR A 1 265 ? 31.876 136.407 -8.118  1.00 93.76  ? 262 THR A CA  1 
ATOM   1969 C C   . THR A 1 265 ? 33.032 136.790 -9.035  1.00 96.33  ? 262 THR A C   1 
ATOM   1970 O O   . THR A 1 265 ? 33.867 137.626 -8.674  1.00 89.59  ? 262 THR A O   1 
ATOM   1971 C CB  . THR A 1 265 ? 31.013 137.630 -7.807  1.00 92.75  ? 262 THR A CB  1 
ATOM   1972 O OG1 . THR A 1 265 ? 30.128 137.329 -6.721  1.00 100.12 ? 262 THR A OG1 1 
ATOM   1973 C CG2 . THR A 1 265 ? 30.191 138.024 -9.025  1.00 88.92  ? 262 THR A CG2 1 
ATOM   1974 N N   . GLY A 1 266 ? 33.077 136.183 -10.214 1.00 96.99  ? 263 GLY A N   1 
ATOM   1975 C CA  . GLY A 1 266 ? 34.106 136.463 -11.195 1.00 85.55  ? 263 GLY A CA  1 
ATOM   1976 C C   . GLY A 1 266 ? 34.814 135.201 -11.648 1.00 87.94  ? 263 GLY A C   1 
ATOM   1977 O O   . GLY A 1 266 ? 34.644 134.116 -11.094 1.00 88.34  ? 263 GLY A O   1 
ATOM   1978 N N   . GLY A 1 267 ? 35.627 135.373 -12.688 1.00 78.01  ? 264 GLY A N   1 
ATOM   1979 C CA  . GLY A 1 267 ? 36.380 134.265 -13.239 1.00 83.23  ? 264 GLY A CA  1 
ATOM   1980 C C   . GLY A 1 267 ? 37.087 134.585 -14.540 1.00 71.09  ? 264 GLY A C   1 
ATOM   1981 O O   . GLY A 1 267 ? 38.307 134.425 -14.643 1.00 61.53  ? 264 GLY A O   1 
ATOM   1982 N N   . ASN A 1 268 ? 36.334 135.039 -15.540 1.00 66.87  ? 265 ASN A N   1 
ATOM   1983 C CA  . ASN A 1 268 ? 36.910 135.303 -16.849 1.00 68.56  ? 265 ASN A CA  1 
ATOM   1984 C C   . ASN A 1 268 ? 37.859 136.501 -16.790 1.00 61.16  ? 265 ASN A C   1 
ATOM   1985 O O   . ASN A 1 268 ? 37.945 137.220 -15.790 1.00 56.21  ? 265 ASN A O   1 
ATOM   1986 C CB  . ASN A 1 268 ? 35.810 135.539 -17.885 1.00 63.25  ? 265 ASN A CB  1 
ATOM   1987 C CG  . ASN A 1 268 ? 34.894 136.688 -17.515 1.00 62.92  ? 265 ASN A CG  1 
ATOM   1988 O OD1 . ASN A 1 268 ? 35.247 137.855 -17.679 1.00 61.46  ? 265 ASN A OD1 1 
ATOM   1989 N ND2 . ASN A 1 268 ? 33.705 136.361 -17.023 1.00 66.99  ? 265 ASN A ND2 1 
ATOM   1990 N N   . ASP A 1 269 ? 38.576 136.713 -17.897 1.00 53.42  ? 266 ASP A N   1 
ATOM   1991 C CA  . ASP A 1 269 ? 39.628 137.724 -17.922 1.00 53.32  ? 266 ASP A CA  1 
ATOM   1992 C C   . ASP A 1 269 ? 39.073 139.139 -17.804 1.00 57.01  ? 266 ASP A C   1 
ATOM   1993 O O   . ASP A 1 269 ? 39.751 140.021 -17.267 1.00 56.16  ? 266 ASP A O   1 
ATOM   1994 C CB  . ASP A 1 269 ? 40.457 137.586 -19.199 1.00 49.50  ? 266 ASP A CB  1 
ATOM   1995 C CG  . ASP A 1 269 ? 41.185 136.259 -19.279 1.00 54.09  ? 266 ASP A CG  1 
ATOM   1996 O OD1 . ASP A 1 269 ? 41.348 135.606 -18.226 1.00 54.24  ? 266 ASP A OD1 1 
ATOM   1997 O OD2 . ASP A 1 269 ? 41.600 135.873 -20.392 1.00 49.81  ? 266 ASP A OD2 1 
ATOM   1998 N N   . THR A 1 270 ? 37.857 139.378 -18.299 1.00 58.11  ? 267 THR A N   1 
ATOM   1999 C CA  . THR A 1 270 ? 37.280 140.717 -18.224 1.00 59.46  ? 267 THR A CA  1 
ATOM   2000 C C   . THR A 1 270 ? 37.043 141.131 -16.776 1.00 55.55  ? 267 THR A C   1 
ATOM   2001 O O   . THR A 1 270 ? 37.427 142.230 -16.360 1.00 48.11  ? 267 THR A O   1 
ATOM   2002 C CB  . THR A 1 270 ? 35.976 140.777 -19.022 1.00 52.09  ? 267 THR A CB  1 
ATOM   2003 O OG1 . THR A 1 270 ? 36.256 140.591 -20.415 1.00 48.52  ? 267 THR A OG1 1 
ATOM   2004 C CG2 . THR A 1 270 ? 35.289 142.121 -18.823 1.00 38.65  ? 267 THR A CG2 1 
ATOM   2005 N N   . GLU A 1 271 ? 36.410 140.256 -15.991 1.00 49.59  ? 268 GLU A N   1 
ATOM   2006 C CA  . GLU A 1 271 ? 36.176 140.558 -14.583 1.00 55.27  ? 268 GLU A CA  1 
ATOM   2007 C C   . GLU A 1 271 ? 37.478 140.628 -13.797 1.00 52.12  ? 268 GLU A C   1 
ATOM   2008 O O   . GLU A 1 271 ? 37.584 141.407 -12.843 1.00 50.45  ? 268 GLU A O   1 
ATOM   2009 C CB  . GLU A 1 271 ? 35.248 139.509 -13.973 1.00 55.94  ? 268 GLU A CB  1 
ATOM   2010 C CG  . GLU A 1 271 ? 33.892 139.413 -14.648 1.00 72.24  ? 268 GLU A CG  1 
ATOM   2011 C CD  . GLU A 1 271 ? 33.177 138.115 -14.332 1.00 86.40  ? 268 GLU A CD  1 
ATOM   2012 O OE1 . GLU A 1 271 ? 33.791 137.040 -14.503 1.00 76.57  ? 268 GLU A OE1 1 
ATOM   2013 O OE2 . GLU A 1 271 ? 32.004 138.168 -13.906 1.00 80.98  ? 268 GLU A OE2 1 
ATOM   2014 N N   . LEU A 1 272 ? 38.475 139.829 -14.181 1.00 50.31  ? 269 LEU A N   1 
ATOM   2015 C CA  . LEU A 1 272 ? 39.736 139.809 -13.448 1.00 44.96  ? 269 LEU A CA  1 
ATOM   2016 C C   . LEU A 1 272 ? 40.503 141.113 -13.636 1.00 47.57  ? 269 LEU A C   1 
ATOM   2017 O O   . LEU A 1 272 ? 40.980 141.710 -12.663 1.00 45.10  ? 269 LEU A O   1 
ATOM   2018 C CB  . LEU A 1 272 ? 40.579 138.614 -13.897 1.00 51.04  ? 269 LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 272 ? 41.556 138.044 -12.870 1.00 52.30  ? 269 LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 272 ? 40.802 137.573 -11.639 1.00 43.83  ? 269 LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 272 ? 42.366 136.905 -13.470 1.00 43.03  ? 269 LEU A CD2 1 
ATOM   2022 N N   . VAL A 1 273 ? 40.629 141.572 -14.883 1.00 40.29  ? 270 VAL A N   1 
ATOM   2023 C CA  . VAL A 1 273 ? 41.347 142.815 -15.147 1.00 47.04  ? 270 VAL A CA  1 
ATOM   2024 C C   . VAL A 1 273 ? 40.570 144.009 -14.605 1.00 39.79  ? 270 VAL A C   1 
ATOM   2025 O O   . VAL A 1 273 ? 41.158 144.970 -14.095 1.00 48.51  ? 270 VAL A O   1 
ATOM   2026 C CB  . VAL A 1 273 ? 41.633 142.958 -16.654 1.00 42.76  ? 270 VAL A CB  1 
ATOM   2027 C CG1 . VAL A 1 273 ? 42.333 144.277 -16.944 1.00 45.57  ? 270 VAL A CG1 1 
ATOM   2028 C CG2 . VAL A 1 273 ? 42.475 141.791 -17.146 1.00 41.44  ? 270 VAL A CG2 1 
ATOM   2029 N N   . ALA A 1 274 ? 39.238 143.968 -14.701 1.00 44.27  ? 271 ALA A N   1 
ATOM   2030 C CA  . ALA A 1 274 ? 38.426 145.053 -14.158 1.00 37.89  ? 271 ALA A CA  1 
ATOM   2031 C C   . ALA A 1 274 ? 38.611 145.176 -12.650 1.00 46.53  ? 271 ALA A C   1 
ATOM   2032 O O   . ALA A 1 274 ? 38.623 146.287 -12.107 1.00 48.29  ? 271 ALA A O   1 
ATOM   2033 C CB  . ALA A 1 274 ? 36.953 144.832 -14.502 1.00 40.02  ? 271 ALA A CB  1 
ATOM   2034 N N   . CYS A 1 275 ? 38.760 144.044 -11.959 1.00 51.20  ? 272 CYS A N   1 
ATOM   2035 C CA  . CYS A 1 275 ? 39.028 144.081 -10.525 1.00 41.61  ? 272 CYS A CA  1 
ATOM   2036 C C   . CYS A 1 275 ? 40.433 144.597 -10.241 1.00 42.74  ? 272 CYS A C   1 
ATOM   2037 O O   . CYS A 1 275 ? 40.650 145.319 -9.261  1.00 40.80  ? 272 CYS A O   1 
ATOM   2038 C CB  . CYS A 1 275 ? 38.830 142.690 -9.923  1.00 42.28  ? 272 CYS A CB  1 
ATOM   2039 S SG  . CYS A 1 275 ? 39.102 142.579 -8.138  1.00 66.74  ? 272 CYS A SG  1 
ATOM   2040 N N   . LEU A 1 276 ? 41.400 144.238 -11.090 1.00 40.75  ? 273 LEU A N   1 
ATOM   2041 C CA  . LEU A 1 276 ? 42.768 144.713 -10.907 1.00 38.43  ? 273 LEU A CA  1 
ATOM   2042 C C   . LEU A 1 276 ? 42.876 146.219 -11.106 1.00 43.53  ? 273 LEU A C   1 
ATOM   2043 O O   . LEU A 1 276 ? 43.705 146.870 -10.460 1.00 40.07  ? 273 LEU A O   1 
ATOM   2044 C CB  . LEU A 1 276 ? 43.710 143.987 -11.867 1.00 36.12  ? 273 LEU A CB  1 
ATOM   2045 C CG  . LEU A 1 276 ? 44.122 142.564 -11.494 1.00 42.77  ? 273 LEU A CG  1 
ATOM   2046 C CD1 . LEU A 1 276 ? 44.923 141.930 -12.620 1.00 33.78  ? 273 LEU A CD1 1 
ATOM   2047 C CD2 . LEU A 1 276 ? 44.924 142.568 -10.203 1.00 27.74  ? 273 LEU A CD2 1 
ATOM   2048 N N   . ARG A 1 277 ? 42.056 146.789 -11.991 1.00 42.52  ? 274 ARG A N   1 
ATOM   2049 C CA  . ARG A 1 277 ? 42.124 148.221 -12.256 1.00 42.82  ? 274 ARG A CA  1 
ATOM   2050 C C   . ARG A 1 277 ? 41.638 149.057 -11.081 1.00 37.76  ? 274 ARG A C   1 
ATOM   2051 O O   . ARG A 1 277 ? 42.039 150.219 -10.959 1.00 40.86  ? 274 ARG A O   1 
ATOM   2052 C CB  . ARG A 1 277 ? 41.315 148.558 -13.508 1.00 43.67  ? 274 ARG A CB  1 
ATOM   2053 C CG  . ARG A 1 277 ? 42.059 148.283 -14.801 1.00 45.34  ? 274 ARG A CG  1 
ATOM   2054 C CD  . ARG A 1 277 ? 41.104 148.066 -15.957 1.00 46.34  ? 274 ARG A CD  1 
ATOM   2055 N NE  . ARG A 1 277 ? 41.803 148.062 -17.237 1.00 53.82  ? 274 ARG A NE  1 
ATOM   2056 C CZ  . ARG A 1 277 ? 41.307 147.548 -18.357 1.00 54.20  ? 274 ARG A CZ  1 
ATOM   2057 N NH1 . ARG A 1 277 ? 40.107 146.984 -18.354 1.00 52.32  ? 274 ARG A NH1 1 
ATOM   2058 N NH2 . ARG A 1 277 ? 42.014 147.591 -19.478 1.00 48.92  ? 274 ARG A NH2 1 
ATOM   2059 N N   . THR A 1 278 ? 40.788 148.500 -10.218 1.00 36.80  ? 275 THR A N   1 
ATOM   2060 C CA  . THR A 1 278 ? 40.303 149.243 -9.062  1.00 36.63  ? 275 THR A CA  1 
ATOM   2061 C C   . THR A 1 278 ? 41.312 149.279 -7.923  1.00 38.61  ? 275 THR A C   1 
ATOM   2062 O O   . THR A 1 278 ? 41.211 150.149 -7.052  1.00 46.89  ? 275 THR A O   1 
ATOM   2063 C CB  . THR A 1 278 ? 38.988 148.642 -8.559  1.00 37.84  ? 275 THR A CB  1 
ATOM   2064 O OG1 . THR A 1 278 ? 39.232 147.339 -8.015  1.00 45.19  ? 275 THR A OG1 1 
ATOM   2065 C CG2 . THR A 1 278 ? 37.984 148.530 -9.697  1.00 36.80  ? 275 THR A CG2 1 
ATOM   2066 N N   . ARG A 1 279 ? 42.277 148.365 -7.914  1.00 39.53  ? 276 ARG A N   1 
ATOM   2067 C CA  . ARG A 1 279 ? 43.247 148.320 -6.831  1.00 39.57  ? 276 ARG A CA  1 
ATOM   2068 C C   . ARG A 1 279 ? 44.244 149.468 -6.964  1.00 37.41  ? 276 ARG A C   1 
ATOM   2069 O O   . ARG A 1 279 ? 44.635 149.828 -8.080  1.00 37.02  ? 276 ARG A O   1 
ATOM   2070 C CB  . ARG A 1 279 ? 43.992 146.986 -6.831  1.00 33.79  ? 276 ARG A CB  1 
ATOM   2071 C CG  . ARG A 1 279 ? 43.118 145.781 -6.528  1.00 37.47  ? 276 ARG A CG  1 
ATOM   2072 C CD  . ARG A 1 279 ? 42.555 145.852 -5.119  1.00 41.76  ? 276 ARG A CD  1 
ATOM   2073 N NE  . ARG A 1 279 ? 41.762 144.673 -4.788  1.00 46.04  ? 276 ARG A NE  1 
ATOM   2074 C CZ  . ARG A 1 279 ? 40.461 144.555 -5.032  1.00 49.71  ? 276 ARG A CZ  1 
ATOM   2075 N NH1 . ARG A 1 279 ? 39.801 145.547 -5.613  1.00 56.53  ? 276 ARG A NH1 1 
ATOM   2076 N NH2 . ARG A 1 279 ? 39.819 143.444 -4.696  1.00 50.53  ? 276 ARG A NH2 1 
ATOM   2077 N N   . PRO A 1 280 ? 44.667 150.067 -5.851  1.00 38.03  ? 277 PRO A N   1 
ATOM   2078 C CA  . PRO A 1 280 ? 45.739 151.065 -5.917  1.00 41.55  ? 277 PRO A CA  1 
ATOM   2079 C C   . PRO A 1 280 ? 47.013 150.452 -6.477  1.00 37.69  ? 277 PRO A C   1 
ATOM   2080 O O   . PRO A 1 280 ? 47.267 149.253 -6.337  1.00 41.39  ? 277 PRO A O   1 
ATOM   2081 C CB  . PRO A 1 280 ? 45.918 151.496 -4.456  1.00 34.28  ? 277 PRO A CB  1 
ATOM   2082 C CG  . PRO A 1 280 ? 44.624 151.149 -3.794  1.00 32.40  ? 277 PRO A CG  1 
ATOM   2083 C CD  . PRO A 1 280 ? 44.134 149.913 -4.487  1.00 34.61  ? 277 PRO A CD  1 
ATOM   2084 N N   . ALA A 1 281 ? 47.819 151.296 -7.125  1.00 35.36  ? 278 ALA A N   1 
ATOM   2085 C CA  . ALA A 1 281 ? 49.022 150.807 -7.789  1.00 33.97  ? 278 ALA A CA  1 
ATOM   2086 C C   . ALA A 1 281 ? 50.003 150.201 -6.792  1.00 33.42  ? 278 ALA A C   1 
ATOM   2087 O O   . ALA A 1 281 ? 50.653 149.191 -7.086  1.00 29.91  ? 278 ALA A O   1 
ATOM   2088 C CB  . ALA A 1 281 ? 49.684 151.938 -8.573  1.00 28.54  ? 278 ALA A CB  1 
ATOM   2089 N N   . GLN A 1 282 ? 50.119 150.800 -5.604  1.00 36.01  ? 279 GLN A N   1 
ATOM   2090 C CA  . GLN A 1 282 ? 51.056 150.287 -4.610  1.00 32.69  ? 279 GLN A CA  1 
ATOM   2091 C C   . GLN A 1 282 ? 50.651 148.903 -4.119  1.00 30.36  ? 279 GLN A C   1 
ATOM   2092 O O   . GLN A 1 282 ? 51.514 148.102 -3.743  1.00 34.94  ? 279 GLN A O   1 
ATOM   2093 C CB  . GLN A 1 282 ? 51.161 151.261 -3.436  1.00 25.35  ? 279 GLN A CB  1 
ATOM   2094 C CG  . GLN A 1 282 ? 52.279 150.935 -2.459  1.00 24.81  ? 279 GLN A CG  1 
ATOM   2095 C CD  . GLN A 1 282 ? 53.647 150.956 -3.115  1.00 31.19  ? 279 GLN A CD  1 
ATOM   2096 O OE1 . GLN A 1 282 ? 54.058 151.966 -3.687  1.00 30.40  ? 279 GLN A OE1 1 
ATOM   2097 N NE2 . GLN A 1 282 ? 54.357 149.836 -3.041  1.00 26.10  ? 279 GLN A NE2 1 
ATOM   2098 N N   . VAL A 1 283 ? 49.351 148.600 -4.123  1.00 33.85  ? 280 VAL A N   1 
ATOM   2099 C CA  . VAL A 1 283 ? 48.890 147.295 -3.658  1.00 31.20  ? 280 VAL A CA  1 
ATOM   2100 C C   . VAL A 1 283 ? 49.363 146.191 -4.596  1.00 36.76  ? 280 VAL A C   1 
ATOM   2101 O O   . VAL A 1 283 ? 49.772 145.113 -4.149  1.00 35.54  ? 280 VAL A O   1 
ATOM   2102 C CB  . VAL A 1 283 ? 47.358 147.296 -3.503  1.00 31.20  ? 280 VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 283 ? 46.858 145.907 -3.137  1.00 29.77  ? 280 VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 283 ? 46.934 148.310 -2.452  1.00 25.26  ? 280 VAL A CG2 1 
ATOM   2105 N N   . LEU A 1 284 ? 49.322 146.440 -5.908  1.00 34.20  ? 281 LEU A N   1 
ATOM   2106 C CA  . LEU A 1 284 ? 49.804 145.442 -6.858  1.00 36.23  ? 281 LEU A CA  1 
ATOM   2107 C C   . LEU A 1 284 ? 51.307 145.229 -6.719  1.00 37.08  ? 281 LEU A C   1 
ATOM   2108 O O   . LEU A 1 284 ? 51.788 144.093 -6.807  1.00 33.07  ? 281 LEU A O   1 
ATOM   2109 C CB  . LEU A 1 284 ? 49.454 145.859 -8.287  1.00 24.92  ? 281 LEU A CB  1 
ATOM   2110 C CG  . LEU A 1 284 ? 47.973 146.067 -8.611  1.00 32.67  ? 281 LEU A CG  1 
ATOM   2111 C CD1 . LEU A 1 284 ? 47.779 146.299 -10.103 1.00 24.58  ? 281 LEU A CD1 1 
ATOM   2112 C CD2 . LEU A 1 284 ? 47.144 144.883 -8.136  1.00 25.55  ? 281 LEU A CD2 1 
ATOM   2113 N N   . VAL A 1 285 ? 52.060 146.308 -6.495  1.00 34.29  ? 282 VAL A N   1 
ATOM   2114 C CA  . VAL A 1 285 ? 53.509 146.195 -6.348  1.00 30.95  ? 282 VAL A CA  1 
ATOM   2115 C C   . VAL A 1 285 ? 53.860 145.381 -5.108  1.00 33.69  ? 282 VAL A C   1 
ATOM   2116 O O   . VAL A 1 285 ? 54.817 144.598 -5.110  1.00 34.96  ? 282 VAL A O   1 
ATOM   2117 C CB  . VAL A 1 285 ? 54.151 147.595 -6.306  1.00 35.27  ? 282 VAL A CB  1 
ATOM   2118 C CG1 . VAL A 1 285 ? 55.651 147.493 -6.078  1.00 34.22  ? 282 VAL A CG1 1 
ATOM   2119 C CG2 . VAL A 1 285 ? 53.855 148.356 -7.588  1.00 31.65  ? 282 VAL A CG2 1 
ATOM   2120 N N   . ASN A 1 286 ? 53.083 145.542 -4.035  1.00 29.52  ? 283 ASN A N   1 
ATOM   2121 C CA  . ASN A 1 286 ? 53.381 144.885 -2.767  1.00 27.18  ? 283 ASN A CA  1 
ATOM   2122 C C   . ASN A 1 286 ? 53.247 143.368 -2.824  1.00 36.06  ? 283 ASN A C   1 
ATOM   2123 O O   . ASN A 1 286 ? 53.665 142.695 -1.876  1.00 32.16  ? 283 ASN A O   1 
ATOM   2124 C CB  . ASN A 1 286 ? 52.473 145.441 -1.668  1.00 31.28  ? 283 ASN A CB  1 
ATOM   2125 C CG  . ASN A 1 286 ? 52.843 146.855 -1.268  1.00 26.76  ? 283 ASN A CG  1 
ATOM   2126 O OD1 . ASN A 1 286 ? 53.748 147.459 -1.845  1.00 25.94  ? 283 ASN A OD1 1 
ATOM   2127 N ND2 . ASN A 1 286 ? 52.141 147.393 -0.279  1.00 28.11  ? 283 ASN A ND2 1 
ATOM   2128 N N   . HIS A 1 287 ? 52.682 142.813 -3.897  1.00 37.09  ? 284 HIS A N   1 
ATOM   2129 C CA  . HIS A 1 287 ? 52.525 141.369 -4.037  1.00 35.67  ? 284 HIS A CA  1 
ATOM   2130 C C   . HIS A 1 287 ? 53.157 140.845 -5.322  1.00 37.09  ? 284 HIS A C   1 
ATOM   2131 O O   . HIS A 1 287 ? 52.800 139.756 -5.785  1.00 46.32  ? 284 HIS A O   1 
ATOM   2132 C CB  . HIS A 1 287 ? 51.046 140.983 -3.981  1.00 29.09  ? 284 HIS A CB  1 
ATOM   2133 C CG  . HIS A 1 287 ? 50.371 141.364 -2.701  1.00 29.34  ? 284 HIS A CG  1 
ATOM   2134 N ND1 . HIS A 1 287 ? 50.520 140.641 -1.537  1.00 34.44  ? 284 HIS A ND1 1 
ATOM   2135 C CD2 . HIS A 1 287 ? 49.541 142.391 -2.401  1.00 30.32  ? 284 HIS A CD2 1 
ATOM   2136 C CE1 . HIS A 1 287 ? 49.813 141.208 -0.575  1.00 29.91  ? 284 HIS A CE1 1 
ATOM   2137 N NE2 . HIS A 1 287 ? 49.209 142.271 -1.074  1.00 34.76  ? 284 HIS A NE2 1 
ATOM   2138 N N   . GLU A 1 288 ? 54.097 141.592 -5.902  1.00 34.56  ? 285 GLU A N   1 
ATOM   2139 C CA  . GLU A 1 288 ? 54.652 141.214 -7.198  1.00 41.56  ? 285 GLU A CA  1 
ATOM   2140 C C   . GLU A 1 288 ? 55.581 140.011 -7.080  1.00 44.98  ? 285 GLU A C   1 
ATOM   2141 O O   . GLU A 1 288 ? 55.495 139.069 -7.876  1.00 40.12  ? 285 GLU A O   1 
ATOM   2142 C CB  . GLU A 1 288 ? 55.389 142.401 -7.817  1.00 31.83  ? 285 GLU A CB  1 
ATOM   2143 C CG  . GLU A 1 288 ? 56.120 142.060 -9.100  1.00 42.74  ? 285 GLU A CG  1 
ATOM   2144 C CD  . GLU A 1 288 ? 56.944 143.215 -9.623  1.00 39.72  ? 285 GLU A CD  1 
ATOM   2145 O OE1 . GLU A 1 288 ? 56.513 144.377 -9.469  1.00 40.94  ? 285 GLU A OE1 1 
ATOM   2146 O OE2 . GLU A 1 288 ? 58.029 142.958 -10.182 1.00 39.46  ? 285 GLU A OE2 1 
ATOM   2147 N N   . TRP A 1 289 ? 56.481 140.025 -6.096  1.00 35.72  ? 286 TRP A N   1 
ATOM   2148 C CA  . TRP A 1 289 ? 57.458 138.950 -5.967  1.00 48.95  ? 286 TRP A CA  1 
ATOM   2149 C C   . TRP A 1 289 ? 56.856 137.654 -5.441  1.00 49.22  ? 286 TRP A C   1 
ATOM   2150 O O   . TRP A 1 289 ? 57.542 136.626 -5.456  1.00 58.40  ? 286 TRP A O   1 
ATOM   2151 C CB  . TRP A 1 289 ? 58.606 139.392 -5.057  1.00 39.44  ? 286 TRP A CB  1 
ATOM   2152 C CG  . TRP A 1 289 ? 59.464 140.453 -5.667  1.00 50.90  ? 286 TRP A CG  1 
ATOM   2153 C CD1 . TRP A 1 289 ? 59.452 141.787 -5.377  1.00 44.97  ? 286 TRP A CD1 1 
ATOM   2154 C CD2 . TRP A 1 289 ? 60.456 140.273 -6.684  1.00 51.59  ? 286 TRP A CD2 1 
ATOM   2155 N NE1 . TRP A 1 289 ? 60.380 142.447 -6.146  1.00 41.60  ? 286 TRP A NE1 1 
ATOM   2156 C CE2 . TRP A 1 289 ? 61.009 141.540 -6.958  1.00 44.99  ? 286 TRP A CE2 1 
ATOM   2157 C CE3 . TRP A 1 289 ? 60.932 139.163 -7.388  1.00 45.92  ? 286 TRP A CE3 1 
ATOM   2158 C CZ2 . TRP A 1 289 ? 62.014 141.727 -7.904  1.00 42.05  ? 286 TRP A CZ2 1 
ATOM   2159 C CZ3 . TRP A 1 289 ? 61.930 139.350 -8.327  1.00 38.04  ? 286 TRP A CZ3 1 
ATOM   2160 C CH2 . TRP A 1 289 ? 62.459 140.622 -8.578  1.00 43.54  ? 286 TRP A CH2 1 
ATOM   2161 N N   . HIS A 1 290 ? 55.603 137.670 -4.989  1.00 47.75  ? 287 HIS A N   1 
ATOM   2162 C CA  . HIS A 1 290 ? 54.967 136.495 -4.411  1.00 48.16  ? 287 HIS A CA  1 
ATOM   2163 C C   . HIS A 1 290 ? 54.240 135.644 -5.449  1.00 48.42  ? 287 HIS A C   1 
ATOM   2164 O O   . HIS A 1 290 ? 53.428 134.789 -5.076  1.00 55.63  ? 287 HIS A O   1 
ATOM   2165 C CB  . HIS A 1 290 ? 54.003 136.916 -3.300  1.00 48.76  ? 287 HIS A CB  1 
ATOM   2166 C CG  . HIS A 1 290 ? 54.661 137.666 -2.184  1.00 70.04  ? 287 HIS A CG  1 
ATOM   2167 N ND1 . HIS A 1 290 ? 56.002 137.540 -1.892  1.00 68.80  ? 287 HIS A ND1 1 
ATOM   2168 C CD2 . HIS A 1 290 ? 54.165 138.558 -1.294  1.00 65.99  ? 287 HIS A CD2 1 
ATOM   2169 C CE1 . HIS A 1 290 ? 56.303 138.318 -0.867  1.00 70.13  ? 287 HIS A CE1 1 
ATOM   2170 N NE2 . HIS A 1 290 ? 55.206 138.947 -0.486  1.00 81.07  ? 287 HIS A NE2 1 
ATOM   2171 N N   . VAL A 1 291 ? 54.512 135.854 -6.736  1.00 41.09  ? 288 VAL A N   1 
ATOM   2172 C CA  . VAL A 1 291 ? 53.938 135.040 -7.801  1.00 44.34  ? 288 VAL A CA  1 
ATOM   2173 C C   . VAL A 1 291 ? 54.983 134.204 -8.516  1.00 41.34  ? 288 VAL A C   1 
ATOM   2174 O O   . VAL A 1 291 ? 54.623 133.387 -9.378  1.00 39.35  ? 288 VAL A O   1 
ATOM   2175 C CB  . VAL A 1 291 ? 53.160 135.901 -8.816  1.00 37.64  ? 288 VAL A CB  1 
ATOM   2176 C CG1 . VAL A 1 291 ? 52.167 136.807 -8.100  1.00 45.73  ? 288 VAL A CG1 1 
ATOM   2177 C CG2 . VAL A 1 291 ? 54.116 136.709 -9.678  1.00 35.60  ? 288 VAL A CG2 1 
ATOM   2178 N N   . LEU A 1 292 ? 56.263 134.378 -8.195  1.00 41.86  ? 289 LEU A N   1 
ATOM   2179 C CA  . LEU A 1 292 ? 57.297 133.559 -8.804  1.00 48.95  ? 289 LEU A CA  1 
ATOM   2180 C C   . LEU A 1 292 ? 57.151 132.105 -8.358  1.00 55.24  ? 289 LEU A C   1 
ATOM   2181 O O   . LEU A 1 292 ? 56.690 131.830 -7.246  1.00 48.39  ? 289 LEU A O   1 
ATOM   2182 C CB  . LEU A 1 292 ? 58.683 134.082 -8.439  1.00 39.04  ? 289 LEU A CB  1 
ATOM   2183 C CG  . LEU A 1 292 ? 59.162 135.310 -9.215  1.00 39.26  ? 289 LEU A CG  1 
ATOM   2184 C CD1 . LEU A 1 292 ? 60.570 135.696 -8.792  1.00 28.70  ? 289 LEU A CD1 1 
ATOM   2185 C CD2 . LEU A 1 292 ? 59.100 135.054 -10.714 1.00 37.44  ? 289 LEU A CD2 1 
ATOM   2186 N N   . PRO A 1 293 ? 57.530 131.151 -9.212  1.00 65.45  ? 290 PRO A N   1 
ATOM   2187 C CA  . PRO A 1 293 ? 57.316 129.740 -8.857  1.00 63.84  ? 290 PRO A CA  1 
ATOM   2188 C C   . PRO A 1 293 ? 58.251 129.224 -7.774  1.00 62.88  ? 290 PRO A C   1 
ATOM   2189 O O   . PRO A 1 293 ? 57.825 128.392 -6.964  1.00 72.24  ? 290 PRO A O   1 
ATOM   2190 C CB  . PRO A 1 293 ? 57.531 129.011 -10.190 1.00 58.54  ? 290 PRO A CB  1 
ATOM   2191 C CG  . PRO A 1 293 ? 58.428 129.909 -10.968 1.00 64.70  ? 290 PRO A CG  1 
ATOM   2192 C CD  . PRO A 1 293 ? 58.038 131.308 -10.586 1.00 58.46  ? 290 PRO A CD  1 
ATOM   2193 N N   . GLN A 1 294 ? 59.503 129.678 -7.722  1.00 67.69  ? 291 GLN A N   1 
ATOM   2194 C CA  . GLN A 1 294 ? 60.463 129.142 -6.767  1.00 75.23  ? 291 GLN A CA  1 
ATOM   2195 C C   . GLN A 1 294 ? 61.179 130.253 -6.016  1.00 74.48  ? 291 GLN A C   1 
ATOM   2196 O O   . GLN A 1 294 ? 61.086 131.439 -6.346  1.00 73.01  ? 291 GLN A O   1 
ATOM   2197 C CB  . GLN A 1 294 ? 61.531 128.266 -7.441  1.00 69.06  ? 291 GLN A CB  1 
ATOM   2198 C CG  . GLN A 1 294 ? 61.005 127.114 -8.251  1.00 76.15  ? 291 GLN A CG  1 
ATOM   2199 C CD  . GLN A 1 294 ? 60.724 127.505 -9.679  1.00 74.78  ? 291 GLN A CD  1 
ATOM   2200 O OE1 . GLN A 1 294 ? 59.833 126.953 -10.317 1.00 73.40  ? 291 GLN A OE1 1 
ATOM   2201 N NE2 . GLN A 1 294 ? 61.489 128.463 -10.194 1.00 69.58  ? 291 GLN A NE2 1 
ATOM   2202 N N   . GLU A 1 295 ? 61.891 129.825 -4.977  1.00 66.55  ? 292 GLU A N   1 
ATOM   2203 C CA  . GLU A 1 295 ? 63.022 130.571 -4.448  1.00 66.39  ? 292 GLU A CA  1 
ATOM   2204 C C   . GLU A 1 295 ? 64.121 130.588 -5.504  1.00 64.13  ? 292 GLU A C   1 
ATOM   2205 O O   . GLU A 1 295 ? 64.645 129.532 -5.876  1.00 69.32  ? 292 GLU A O   1 
ATOM   2206 C CB  . GLU A 1 295 ? 63.506 129.908 -3.160  1.00 66.34  ? 292 GLU A CB  1 
ATOM   2207 C CG  . GLU A 1 295 ? 64.736 130.515 -2.515  1.00 78.89  ? 292 GLU A CG  1 
ATOM   2208 C CD  . GLU A 1 295 ? 65.160 129.744 -1.277  1.00 84.75  ? 292 GLU A CD  1 
ATOM   2209 O OE1 . GLU A 1 295 ? 66.363 129.432 -1.146  1.00 69.40  ? 292 GLU A OE1 1 
ATOM   2210 O OE2 . GLU A 1 295 ? 64.284 129.435 -0.441  1.00 96.96  ? 292 GLU A OE2 1 
ATOM   2211 N N   . SER A 1 296 ? 64.455 131.773 -6.009  1.00 60.52  ? 293 SER A N   1 
ATOM   2212 C CA  . SER A 1 296 ? 65.373 131.852 -7.137  1.00 54.39  ? 293 SER A CA  1 
ATOM   2213 C C   . SER A 1 296 ? 65.983 133.243 -7.213  1.00 52.16  ? 293 SER A C   1 
ATOM   2214 O O   . SER A 1 296 ? 65.481 134.199 -6.617  1.00 57.24  ? 293 SER A O   1 
ATOM   2215 C CB  . SER A 1 296 ? 64.666 131.513 -8.455  1.00 51.11  ? 293 SER A CB  1 
ATOM   2216 O OG  . SER A 1 296 ? 63.629 132.441 -8.730  1.00 51.83  ? 293 SER A OG  1 
ATOM   2217 N N   . VAL A 1 297 ? 67.082 133.334 -7.960  1.00 44.12  ? 294 VAL A N   1 
ATOM   2218 C CA  . VAL A 1 297 ? 67.701 134.601 -8.316  1.00 38.09  ? 294 VAL A CA  1 
ATOM   2219 C C   . VAL A 1 297 ? 67.657 134.737 -9.832  1.00 36.94  ? 294 VAL A C   1 
ATOM   2220 O O   . VAL A 1 297 ? 67.556 133.750 -10.566 1.00 44.10  ? 294 VAL A O   1 
ATOM   2221 C CB  . VAL A 1 297 ? 69.150 134.723 -7.798  1.00 37.25  ? 294 VAL A CB  1 
ATOM   2222 C CG1 . VAL A 1 297 ? 69.186 134.600 -6.282  1.00 41.18  ? 294 VAL A CG1 1 
ATOM   2223 C CG2 . VAL A 1 297 ? 70.043 133.675 -8.449  1.00 33.09  ? 294 VAL A CG2 1 
ATOM   2224 N N   . PHE A 1 298 ? 67.719 135.987 -10.295 1.00 41.58  ? 295 PHE A N   1 
ATOM   2225 C CA  . PHE A 1 298 ? 67.714 136.313 -11.723 1.00 41.53  ? 295 PHE A CA  1 
ATOM   2226 C C   . PHE A 1 298 ? 66.432 135.843 -12.408 1.00 33.40  ? 295 PHE A C   1 
ATOM   2227 O O   . PHE A 1 298 ? 66.443 135.461 -13.581 1.00 33.91  ? 295 PHE A O   1 
ATOM   2228 C CB  . PHE A 1 298 ? 68.947 135.735 -12.425 1.00 32.67  ? 295 PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 298 ? 69.574 136.668 -13.422 1.00 31.85  ? 295 PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 298 ? 68.803 137.308 -14.378 1.00 34.31  ? 295 PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 298 ? 70.937 136.914 -13.393 1.00 27.64  ? 295 PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 298 ? 69.381 138.166 -15.294 1.00 32.65  ? 295 PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 298 ? 71.520 137.771 -14.306 1.00 26.71  ? 295 PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 298 ? 70.742 138.400 -15.256 1.00 29.80  ? 295 PHE A CZ  1 
ATOM   2235 N N   . ARG A 1 299 ? 65.319 135.863 -11.677 1.00 31.31  ? 296 ARG A N   1 
ATOM   2236 C CA  . ARG A 1 299 ? 64.003 135.561 -12.221 1.00 33.55  ? 296 ARG A CA  1 
ATOM   2237 C C   . ARG A 1 299 ? 63.041 136.667 -11.816 1.00 32.75  ? 296 ARG A C   1 
ATOM   2238 O O   . ARG A 1 299 ? 63.092 137.162 -10.686 1.00 25.47  ? 296 ARG A O   1 
ATOM   2239 C CB  . ARG A 1 299 ? 63.484 134.203 -11.734 1.00 22.14  ? 296 ARG A CB  1 
ATOM   2240 C CG  . ARG A 1 299 ? 64.274 133.012 -12.255 1.00 33.57  ? 296 ARG A CG  1 
ATOM   2241 C CD  . ARG A 1 299 ? 64.270 132.967 -13.775 1.00 29.16  ? 296 ARG A CD  1 
ATOM   2242 N NE  . ARG A 1 299 ? 64.911 131.759 -14.290 1.00 34.76  ? 296 ARG A NE  1 
ATOM   2243 C CZ  . ARG A 1 299 ? 66.185 131.687 -14.661 1.00 37.63  ? 296 ARG A CZ  1 
ATOM   2244 N NH1 . ARG A 1 299 ? 66.964 132.756 -14.579 1.00 31.05  ? 296 ARG A NH1 1 
ATOM   2245 N NH2 . ARG A 1 299 ? 66.680 130.544 -15.118 1.00 34.19  ? 296 ARG A NH2 1 
ATOM   2246 N N   . PHE A 1 300 ? 62.165 137.053 -12.740 1.00 26.53  ? 297 PHE A N   1 
ATOM   2247 C CA  . PHE A 1 300 ? 61.305 138.210 -12.552 1.00 27.33  ? 297 PHE A CA  1 
ATOM   2248 C C   . PHE A 1 300 ? 59.870 137.856 -12.915 1.00 27.91  ? 297 PHE A C   1 
ATOM   2249 O O   . PHE A 1 300 ? 59.617 137.029 -13.796 1.00 40.86  ? 297 PHE A O   1 
ATOM   2250 C CB  . PHE A 1 300 ? 61.817 139.394 -13.379 1.00 24.18  ? 297 PHE A CB  1 
ATOM   2251 C CG  . PHE A 1 300 ? 63.308 139.569 -13.303 1.00 27.68  ? 297 PHE A CG  1 
ATOM   2252 C CD1 . PHE A 1 300 ? 63.904 140.050 -12.148 1.00 23.12  ? 297 PHE A CD1 1 
ATOM   2253 C CD2 . PHE A 1 300 ? 64.116 139.227 -14.375 1.00 27.63  ? 297 PHE A CD2 1 
ATOM   2254 C CE1 . PHE A 1 300 ? 65.278 140.201 -12.069 1.00 25.50  ? 297 PHE A CE1 1 
ATOM   2255 C CE2 . PHE A 1 300 ? 65.489 139.375 -14.302 1.00 23.69  ? 297 PHE A CE2 1 
ATOM   2256 C CZ  . PHE A 1 300 ? 66.070 139.863 -13.147 1.00 26.95  ? 297 PHE A CZ  1 
ATOM   2257 N N   . SER A 1 301 ? 58.930 138.504 -12.221 1.00 26.00  ? 298 SER A N   1 
ATOM   2258 C CA  . SER A 1 301 ? 57.540 138.060 -12.242 1.00 28.03  ? 298 SER A CA  1 
ATOM   2259 C C   . SER A 1 301 ? 56.864 138.373 -13.571 1.00 34.05  ? 298 SER A C   1 
ATOM   2260 O O   . SER A 1 301 ? 56.265 137.491 -14.197 1.00 32.85  ? 298 SER A O   1 
ATOM   2261 C CB  . SER A 1 301 ? 56.774 138.701 -11.085 1.00 28.99  ? 298 SER A CB  1 
ATOM   2262 O OG  . SER A 1 301 ? 57.291 138.278 -9.836  1.00 43.28  ? 298 SER A OG  1 
ATOM   2263 N N   . PHE A 1 302 ? 56.934 139.625 -14.014 1.00 25.93  ? 299 PHE A N   1 
ATOM   2264 C CA  . PHE A 1 302 ? 56.207 140.077 -15.198 1.00 30.46  ? 299 PHE A CA  1 
ATOM   2265 C C   . PHE A 1 302 ? 57.215 140.532 -16.248 1.00 31.26  ? 299 PHE A C   1 
ATOM   2266 O O   . PHE A 1 302 ? 57.798 141.616 -16.140 1.00 27.29  ? 299 PHE A O   1 
ATOM   2267 C CB  . PHE A 1 302 ? 55.219 141.179 -14.832 1.00 22.64  ? 299 PHE A CB  1 
ATOM   2268 C CG  . PHE A 1 302 ? 54.188 140.745 -13.829 1.00 28.66  ? 299 PHE A CG  1 
ATOM   2269 C CD1 . PHE A 1 302 ? 53.142 139.919 -14.208 1.00 24.40  ? 299 PHE A CD1 1 
ATOM   2270 C CD2 . PHE A 1 302 ? 54.273 141.147 -12.506 1.00 25.74  ? 299 PHE A CD2 1 
ATOM   2271 C CE1 . PHE A 1 302 ? 52.194 139.509 -13.289 1.00 32.20  ? 299 PHE A CE1 1 
ATOM   2272 C CE2 . PHE A 1 302 ? 53.326 140.741 -11.582 1.00 29.87  ? 299 PHE A CE2 1 
ATOM   2273 C CZ  . PHE A 1 302 ? 52.286 139.921 -11.975 1.00 24.85  ? 299 PHE A CZ  1 
ATOM   2274 N N   . VAL A 1 303 ? 57.409 139.696 -17.262 1.00 26.36  ? 300 VAL A N   1 
ATOM   2275 C CA  . VAL A 1 303 ? 58.378 139.932 -18.329 1.00 25.96  ? 300 VAL A CA  1 
ATOM   2276 C C   . VAL A 1 303 ? 57.639 139.830 -19.660 1.00 26.23  ? 300 VAL A C   1 
ATOM   2277 O O   . VAL A 1 303 ? 56.453 139.468 -19.669 1.00 22.76  ? 300 VAL A O   1 
ATOM   2278 C CB  . VAL A 1 303 ? 59.544 138.934 -18.240 1.00 30.89  ? 300 VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 303 ? 60.334 139.155 -16.960 1.00 26.88  ? 300 VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 303 ? 59.022 137.509 -18.311 1.00 22.88  ? 300 VAL A CG2 1 
ATOM   2281 N N   . PRO A 1 304 ? 58.266 140.158 -20.792 1.00 22.83  ? 301 PRO A N   1 
ATOM   2282 C CA  . PRO A 1 304 ? 57.601 139.952 -22.084 1.00 25.95  ? 301 PRO A CA  1 
ATOM   2283 C C   . PRO A 1 304 ? 57.116 138.518 -22.254 1.00 30.60  ? 301 PRO A C   1 
ATOM   2284 O O   . PRO A 1 304 ? 57.773 137.563 -21.837 1.00 28.61  ? 301 PRO A O   1 
ATOM   2285 C CB  . PRO A 1 304 ? 58.695 140.302 -23.098 1.00 22.30  ? 301 PRO A CB  1 
ATOM   2286 C CG  . PRO A 1 304 ? 59.513 141.322 -22.401 1.00 30.48  ? 301 PRO A CG  1 
ATOM   2287 C CD  . PRO A 1 304 ? 59.502 140.953 -20.939 1.00 26.80  ? 301 PRO A CD  1 
ATOM   2288 N N   . VAL A 1 305 ? 55.945 138.375 -22.868 1.00 27.28  ? 302 VAL A N   1 
ATOM   2289 C CA  . VAL A 1 305 ? 55.303 137.081 -23.065 1.00 35.72  ? 302 VAL A CA  1 
ATOM   2290 C C   . VAL A 1 305 ? 55.377 136.717 -24.542 1.00 45.22  ? 302 VAL A C   1 
ATOM   2291 O O   . VAL A 1 305 ? 55.263 137.586 -25.415 1.00 45.61  ? 302 VAL A O   1 
ATOM   2292 C CB  . VAL A 1 305 ? 53.843 137.096 -22.564 1.00 32.82  ? 302 VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 305 ? 53.020 138.142 -23.310 1.00 35.13  ? 302 VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 305 ? 53.210 135.715 -22.683 1.00 40.27  ? 302 VAL A CG2 1 
ATOM   2295 N N   . VAL A 1 306 ? 55.595 135.432 -24.819 1.00 47.56  ? 303 VAL A N   1 
ATOM   2296 C CA  . VAL A 1 306 ? 55.582 134.915 -26.186 1.00 53.39  ? 303 VAL A CA  1 
ATOM   2297 C C   . VAL A 1 306 ? 54.122 134.659 -26.548 1.00 46.85  ? 303 VAL A C   1 
ATOM   2298 O O   . VAL A 1 306 ? 53.570 133.600 -26.246 1.00 54.97  ? 303 VAL A O   1 
ATOM   2299 C CB  . VAL A 1 306 ? 56.435 133.653 -26.330 1.00 54.66  ? 303 VAL A CB  1 
ATOM   2300 C CG1 . VAL A 1 306 ? 56.442 133.180 -27.776 1.00 47.17  ? 303 VAL A CG1 1 
ATOM   2301 C CG2 . VAL A 1 306 ? 57.851 133.915 -25.841 1.00 40.94  ? 303 VAL A CG2 1 
ATOM   2302 N N   . ASP A 1 307 ? 53.491 135.634 -27.203 1.00 51.36  ? 304 ASP A N   1 
ATOM   2303 C CA  . ASP A 1 307 ? 52.057 135.607 -27.448 1.00 56.25  ? 304 ASP A CA  1 
ATOM   2304 C C   . ASP A 1 307 ? 51.675 135.387 -28.903 1.00 57.74  ? 304 ASP A C   1 
ATOM   2305 O O   . ASP A 1 307 ? 50.533 135.000 -29.170 1.00 50.91  ? 304 ASP A O   1 
ATOM   2306 C CB  . ASP A 1 307 ? 51.419 136.918 -26.967 1.00 45.65  ? 304 ASP A CB  1 
ATOM   2307 C CG  . ASP A 1 307 ? 52.072 138.141 -27.583 1.00 57.94  ? 304 ASP A CG  1 
ATOM   2308 O OD1 . ASP A 1 307 ? 51.432 139.212 -27.611 1.00 67.56  ? 304 ASP A OD1 1 
ATOM   2309 O OD2 . ASP A 1 307 ? 53.227 138.029 -28.046 1.00 56.30  ? 304 ASP A OD2 1 
ATOM   2310 N N   . GLY A 1 308 ? 52.589 135.620 -29.843 1.00 56.95  ? 305 GLY A N   1 
ATOM   2311 C CA  . GLY A 1 308 ? 52.278 135.559 -31.254 1.00 57.69  ? 305 GLY A CA  1 
ATOM   2312 C C   . GLY A 1 308 ? 52.005 136.903 -31.893 1.00 62.33  ? 305 GLY A C   1 
ATOM   2313 O O   . GLY A 1 308 ? 51.845 136.967 -33.119 1.00 67.12  ? 305 GLY A O   1 
ATOM   2314 N N   . ASP A 1 309 ? 51.950 137.974 -31.102 1.00 57.46  ? 306 ASP A N   1 
ATOM   2315 C CA  . ASP A 1 309 ? 51.690 139.309 -31.626 1.00 50.42  ? 306 ASP A CA  1 
ATOM   2316 C C   . ASP A 1 309 ? 52.985 140.105 -31.732 1.00 55.93  ? 306 ASP A C   1 
ATOM   2317 O O   . ASP A 1 309 ? 53.548 140.239 -32.824 1.00 57.00  ? 306 ASP A O   1 
ATOM   2318 C CB  . ASP A 1 309 ? 50.679 140.042 -30.742 1.00 58.91  ? 306 ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 309 ? 50.287 141.394 -31.302 1.00 58.98  ? 306 ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 309 ? 49.847 142.258 -30.515 1.00 66.48  ? 306 ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 309 ? 50.417 141.594 -32.528 1.00 65.53  ? 306 ASP A OD2 1 
ATOM   2322 N N   . PHE A 1 310 ? 53.462 140.643 -30.606 1.00 54.36  ? 307 PHE A N   1 
ATOM   2323 C CA  . PHE A 1 310 ? 54.733 141.361 -30.615 1.00 45.65  ? 307 PHE A CA  1 
ATOM   2324 C C   . PHE A 1 310 ? 55.880 140.432 -30.991 1.00 43.72  ? 307 PHE A C   1 
ATOM   2325 O O   . PHE A 1 310 ? 56.820 140.840 -31.684 1.00 45.90  ? 307 PHE A O   1 
ATOM   2326 C CB  . PHE A 1 310 ? 54.985 142.005 -29.251 1.00 38.65  ? 307 PHE A CB  1 
ATOM   2327 C CG  . PHE A 1 310 ? 56.117 142.997 -29.244 1.00 37.50  ? 307 PHE A CG  1 
ATOM   2328 C CD1 . PHE A 1 310 ? 57.429 142.576 -29.090 1.00 34.29  ? 307 PHE A CD1 1 
ATOM   2329 C CD2 . PHE A 1 310 ? 55.868 144.352 -29.385 1.00 36.60  ? 307 PHE A CD2 1 
ATOM   2330 C CE1 . PHE A 1 310 ? 58.469 143.486 -29.084 1.00 29.97  ? 307 PHE A CE1 1 
ATOM   2331 C CE2 . PHE A 1 310 ? 56.905 145.267 -29.376 1.00 35.19  ? 307 PHE A CE2 1 
ATOM   2332 C CZ  . PHE A 1 310 ? 58.207 144.833 -29.227 1.00 32.58  ? 307 PHE A CZ  1 
ATOM   2333 N N   . LEU A 1 311 ? 55.818 139.182 -30.543 1.00 51.66  ? 308 LEU A N   1 
ATOM   2334 C CA  . LEU A 1 311 ? 56.799 138.155 -30.884 1.00 49.14  ? 308 LEU A CA  1 
ATOM   2335 C C   . LEU A 1 311 ? 56.044 137.015 -31.559 1.00 52.20  ? 308 LEU A C   1 
ATOM   2336 O O   . LEU A 1 311 ? 55.358 136.237 -30.888 1.00 50.48  ? 308 LEU A O   1 
ATOM   2337 C CB  . LEU A 1 311 ? 57.548 137.674 -29.644 1.00 46.92  ? 308 LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 311 ? 58.414 138.703 -28.915 1.00 46.54  ? 308 LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 311 ? 58.891 138.149 -27.582 1.00 44.44  ? 308 LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 311 ? 59.595 139.117 -29.778 1.00 45.43  ? 308 LEU A CD2 1 
ATOM   2341 N N   . SER A 1 312 ? 56.166 136.918 -32.886 1.00 53.72  ? 309 SER A N   1 
ATOM   2342 C CA  . SER A 1 312 ? 55.465 135.873 -33.625 1.00 52.74  ? 309 SER A CA  1 
ATOM   2343 C C   . SER A 1 312 ? 55.892 134.477 -33.195 1.00 56.33  ? 309 SER A C   1 
ATOM   2344 O O   . SER A 1 312 ? 55.132 133.521 -33.383 1.00 56.29  ? 309 SER A O   1 
ATOM   2345 C CB  . SER A 1 312 ? 55.692 136.050 -35.127 1.00 49.10  ? 309 SER A CB  1 
ATOM   2346 O OG  . SER A 1 312 ? 57.072 135.991 -35.444 1.00 52.18  ? 309 SER A OG  1 
ATOM   2347 N N   . ASP A 1 313 ? 57.086 134.339 -32.626 1.00 51.18  ? 310 ASP A N   1 
ATOM   2348 C CA  . ASP A 1 313 ? 57.555 133.073 -32.084 1.00 55.07  ? 310 ASP A CA  1 
ATOM   2349 C C   . ASP A 1 313 ? 58.501 133.383 -30.931 1.00 50.30  ? 310 ASP A C   1 
ATOM   2350 O O   . ASP A 1 313 ? 58.720 134.546 -30.581 1.00 46.89  ? 310 ASP A O   1 
ATOM   2351 C CB  . ASP A 1 313 ? 58.229 132.225 -33.168 1.00 56.51  ? 310 ASP A CB  1 
ATOM   2352 C CG  . ASP A 1 313 ? 58.109 130.736 -32.904 1.00 64.29  ? 310 ASP A CG  1 
ATOM   2353 O OD1 . ASP A 1 313 ? 57.866 130.354 -31.740 1.00 62.77  ? 310 ASP A OD1 1 
ATOM   2354 O OD2 . ASP A 1 313 ? 58.258 129.948 -33.863 1.00 66.97  ? 310 ASP A OD2 1 
ATOM   2355 N N   . THR A 1 314 ? 59.062 132.333 -30.336 1.00 46.04  ? 311 THR A N   1 
ATOM   2356 C CA  . THR A 1 314 ? 60.036 132.525 -29.274 1.00 45.53  ? 311 THR A CA  1 
ATOM   2357 C C   . THR A 1 314 ? 61.243 133.291 -29.814 1.00 40.09  ? 311 THR A C   1 
ATOM   2358 O O   . THR A 1 314 ? 61.552 133.213 -31.008 1.00 51.00  ? 311 THR A O   1 
ATOM   2359 C CB  . THR A 1 314 ? 60.488 131.183 -28.701 1.00 43.45  ? 311 THR A CB  1 
ATOM   2360 O OG1 . THR A 1 314 ? 61.258 130.477 -29.682 1.00 49.62  ? 311 THR A OG1 1 
ATOM   2361 C CG2 . THR A 1 314 ? 59.286 130.339 -28.304 1.00 43.78  ? 311 THR A CG2 1 
ATOM   2362 N N   . PRO A 1 315 ? 61.929 134.060 -28.964 1.00 44.97  ? 312 PRO A N   1 
ATOM   2363 C CA  . PRO A 1 315 ? 63.147 134.741 -29.433 1.00 44.36  ? 312 PRO A CA  1 
ATOM   2364 C C   . PRO A 1 315 ? 64.177 133.788 -30.011 1.00 39.93  ? 312 PRO A C   1 
ATOM   2365 O O   . PRO A 1 315 ? 64.835 134.125 -31.001 1.00 49.22  ? 312 PRO A O   1 
ATOM   2366 C CB  . PRO A 1 315 ? 63.659 135.444 -28.169 1.00 36.57  ? 312 PRO A CB  1 
ATOM   2367 C CG  . PRO A 1 315 ? 62.435 135.664 -27.352 1.00 31.86  ? 312 PRO A CG  1 
ATOM   2368 C CD  . PRO A 1 315 ? 61.570 134.457 -27.591 1.00 39.35  ? 312 PRO A CD  1 
ATOM   2369 N N   . GLU A 1 316 ? 64.324 132.595 -29.427 1.00 47.62  ? 313 GLU A N   1 
ATOM   2370 C CA  . GLU A 1 316 ? 65.263 131.618 -29.969 1.00 50.20  ? 313 GLU A CA  1 
ATOM   2371 C C   . GLU A 1 316 ? 64.890 131.228 -31.394 1.00 46.74  ? 313 GLU A C   1 
ATOM   2372 O O   . GLU A 1 316 ? 65.760 131.138 -32.270 1.00 40.05  ? 313 GLU A O   1 
ATOM   2373 C CB  . GLU A 1 316 ? 65.312 130.381 -29.073 1.00 46.73  ? 313 GLU A CB  1 
ATOM   2374 C CG  . GLU A 1 316 ? 66.394 129.381 -29.454 1.00 59.44  ? 313 GLU A CG  1 
ATOM   2375 C CD  . GLU A 1 316 ? 66.341 128.117 -28.618 1.00 70.28  ? 313 GLU A CD  1 
ATOM   2376 O OE1 . GLU A 1 316 ? 65.270 127.477 -28.572 1.00 71.44  ? 313 GLU A OE1 1 
ATOM   2377 O OE2 . GLU A 1 316 ? 67.370 127.768 -28.001 1.00 80.23  ? 313 GLU A OE2 1 
ATOM   2378 N N   . ALA A 1 317 ? 63.600 130.999 -31.648 1.00 42.60  ? 314 ALA A N   1 
ATOM   2379 C CA  . ALA A 1 317 ? 63.164 130.628 -32.990 1.00 37.61  ? 314 ALA A CA  1 
ATOM   2380 C C   . ALA A 1 317 ? 63.371 131.770 -33.976 1.00 49.82  ? 314 ALA A C   1 
ATOM   2381 O O   . ALA A 1 317 ? 63.842 131.551 -35.099 1.00 50.87  ? 314 ALA A O   1 
ATOM   2382 C CB  . ALA A 1 317 ? 61.698 130.198 -32.965 1.00 42.67  ? 314 ALA A CB  1 
ATOM   2383 N N   . LEU A 1 318 ? 63.031 132.998 -33.575 1.00 51.36  ? 315 LEU A N   1 
ATOM   2384 C CA  . LEU A 1 318 ? 63.172 134.137 -34.475 1.00 40.97  ? 315 LEU A CA  1 
ATOM   2385 C C   . LEU A 1 318 ? 64.634 134.468 -34.748 1.00 37.01  ? 315 LEU A C   1 
ATOM   2386 O O   . LEU A 1 318 ? 64.965 134.953 -35.835 1.00 51.73  ? 315 LEU A O   1 
ATOM   2387 C CB  . LEU A 1 318 ? 62.450 135.354 -33.897 1.00 43.42  ? 315 LEU A CB  1 
ATOM   2388 C CG  . LEU A 1 318 ? 60.947 135.199 -33.651 1.00 47.11  ? 315 LEU A CG  1 
ATOM   2389 C CD1 . LEU A 1 318 ? 60.383 136.439 -32.974 1.00 45.57  ? 315 LEU A CD1 1 
ATOM   2390 C CD2 . LEU A 1 318 ? 60.212 134.914 -34.953 1.00 37.24  ? 315 LEU A CD2 1 
ATOM   2391 N N   . ILE A 1 319 ? 65.519 134.216 -33.781 1.00 43.08  ? 316 ILE A N   1 
ATOM   2392 C CA  . ILE A 1 319 ? 66.940 134.482 -33.987 1.00 45.33  ? 316 ILE A CA  1 
ATOM   2393 C C   . ILE A 1 319 ? 67.532 133.489 -34.981 1.00 47.69  ? 316 ILE A C   1 
ATOM   2394 O O   . ILE A 1 319 ? 68.339 133.858 -35.843 1.00 53.20  ? 316 ILE A O   1 
ATOM   2395 C CB  . ILE A 1 319 ? 67.687 134.457 -32.640 1.00 44.92  ? 316 ILE A CB  1 
ATOM   2396 C CG1 . ILE A 1 319 ? 67.342 135.696 -31.811 1.00 37.05  ? 316 ILE A CG1 1 
ATOM   2397 C CG2 . ILE A 1 319 ? 69.191 134.375 -32.854 1.00 41.12  ? 316 ILE A CG2 1 
ATOM   2398 C CD1 . ILE A 1 319 ? 67.723 135.576 -30.349 1.00 30.08  ? 316 ILE A CD1 1 
ATOM   2399 N N   . ASN A 1 320 ? 67.132 132.218 -34.888 1.00 48.11  ? 317 ASN A N   1 
ATOM   2400 C CA  . ASN A 1 320 ? 67.685 131.203 -35.779 1.00 44.82  ? 317 ASN A CA  1 
ATOM   2401 C C   . ASN A 1 320 ? 67.203 131.395 -37.213 1.00 44.18  ? 317 ASN A C   1 
ATOM   2402 O O   . ASN A 1 320 ? 67.977 131.220 -38.161 1.00 49.09  ? 317 ASN A O   1 
ATOM   2403 C CB  . ASN A 1 320 ? 67.323 129.806 -35.275 1.00 41.93  ? 317 ASN A CB  1 
ATOM   2404 C CG  . ASN A 1 320 ? 67.924 129.502 -33.916 1.00 37.38  ? 317 ASN A CG  1 
ATOM   2405 O OD1 . ASN A 1 320 ? 68.948 130.069 -33.536 1.00 42.41  ? 317 ASN A OD1 1 
ATOM   2406 N ND2 . ASN A 1 320 ? 67.290 128.598 -33.178 1.00 40.93  ? 317 ASN A ND2 1 
ATOM   2407 N N   . ALA A 1 321 ? 65.935 131.755 -37.392 1.00 42.52  ? 318 ALA A N   1 
ATOM   2408 C CA  . ALA A 1 321 ? 65.344 131.901 -38.715 1.00 42.55  ? 318 ALA A CA  1 
ATOM   2409 C C   . ALA A 1 321 ? 65.461 133.316 -39.270 1.00 52.46  ? 318 ALA A C   1 
ATOM   2410 O O   . ALA A 1 321 ? 64.861 133.613 -40.307 1.00 59.09  ? 318 ALA A O   1 
ATOM   2411 C CB  . ALA A 1 321 ? 63.873 131.480 -38.681 1.00 36.81  ? 318 ALA A CB  1 
ATOM   2412 N N   . GLY A 1 322 ? 66.223 134.187 -38.615 1.00 55.81  ? 319 GLY A N   1 
ATOM   2413 C CA  . GLY A 1 322 ? 66.293 135.577 -39.014 1.00 45.49  ? 319 GLY A CA  1 
ATOM   2414 C C   . GLY A 1 322 ? 67.351 135.856 -40.067 1.00 49.94  ? 319 GLY A C   1 
ATOM   2415 O O   . GLY A 1 322 ? 68.382 135.191 -40.139 1.00 50.99  ? 319 GLY A O   1 
ATOM   2416 N N   . ASP A 1 323 ? 67.071 136.863 -40.892 1.00 47.09  ? 320 ASP A N   1 
ATOM   2417 C CA  . ASP A 1 323 ? 68.003 137.376 -41.890 1.00 46.43  ? 320 ASP A CA  1 
ATOM   2418 C C   . ASP A 1 323 ? 68.388 138.790 -41.473 1.00 50.63  ? 320 ASP A C   1 
ATOM   2419 O O   . ASP A 1 323 ? 67.560 139.706 -41.527 1.00 52.25  ? 320 ASP A O   1 
ATOM   2420 C CB  . ASP A 1 323 ? 67.380 137.357 -43.285 1.00 44.77  ? 320 ASP A CB  1 
ATOM   2421 C CG  . ASP A 1 323 ? 68.255 138.032 -44.326 1.00 58.57  ? 320 ASP A CG  1 
ATOM   2422 O OD1 . ASP A 1 323 ? 67.703 138.552 -45.318 1.00 62.36  ? 320 ASP A OD1 1 
ATOM   2423 O OD2 . ASP A 1 323 ? 69.493 138.043 -44.154 1.00 54.46  ? 320 ASP A OD2 1 
ATOM   2424 N N   . PHE A 1 324 ? 69.643 138.966 -41.061 1.00 47.10  ? 321 PHE A N   1 
ATOM   2425 C CA  . PHE A 1 324 ? 70.106 140.216 -40.472 1.00 37.96  ? 321 PHE A CA  1 
ATOM   2426 C C   . PHE A 1 324 ? 71.116 140.939 -41.359 1.00 48.24  ? 321 PHE A C   1 
ATOM   2427 O O   . PHE A 1 324 ? 72.018 141.613 -40.857 1.00 46.76  ? 321 PHE A O   1 
ATOM   2428 C CB  . PHE A 1 324 ? 70.705 139.957 -39.091 1.00 48.91  ? 321 PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 324 ? 69.787 139.216 -38.163 1.00 45.54  ? 321 PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 324 ? 68.842 139.897 -37.414 1.00 41.05  ? 321 PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 324 ? 69.869 137.839 -38.039 1.00 41.99  ? 321 PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 324 ? 67.995 139.218 -36.558 1.00 49.69  ? 321 PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 324 ? 69.025 137.154 -37.185 1.00 41.14  ? 321 PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 324 ? 68.087 137.844 -36.444 1.00 53.67  ? 321 PHE A CZ  1 
ATOM   2435 N N   . HIS A 1 325 ? 70.978 140.814 -42.676 1.00 54.23  ? 322 HIS A N   1 
ATOM   2436 C CA  . HIS A 1 325 ? 71.860 141.538 -43.581 1.00 56.44  ? 322 HIS A CA  1 
ATOM   2437 C C   . HIS A 1 325 ? 71.549 143.029 -43.542 1.00 49.50  ? 322 HIS A C   1 
ATOM   2438 O O   . HIS A 1 325 ? 70.386 143.439 -43.507 1.00 45.39  ? 322 HIS A O   1 
ATOM   2439 C CB  . HIS A 1 325 ? 71.724 141.001 -45.005 1.00 57.25  ? 322 HIS A CB  1 
ATOM   2440 C CG  . HIS A 1 325 ? 72.395 139.679 -45.216 1.00 57.70  ? 322 HIS A CG  1 
ATOM   2441 N ND1 . HIS A 1 325 ? 71.781 138.478 -44.936 1.00 63.09  ? 322 HIS A ND1 1 
ATOM   2442 C CD2 . HIS A 1 325 ? 73.633 139.372 -45.671 1.00 51.41  ? 322 HIS A CD2 1 
ATOM   2443 C CE1 . HIS A 1 325 ? 72.609 137.487 -45.215 1.00 58.27  ? 322 HIS A CE1 1 
ATOM   2444 N NE2 . HIS A 1 325 ? 73.739 138.002 -45.662 1.00 60.04  ? 322 HIS A NE2 1 
ATOM   2445 N N   . GLY A 1 326 ? 72.603 143.842 -43.545 1.00 52.05  ? 323 GLY A N   1 
ATOM   2446 C CA  . GLY A 1 326 ? 72.437 145.274 -43.400 1.00 50.38  ? 323 GLY A CA  1 
ATOM   2447 C C   . GLY A 1 326 ? 72.240 145.728 -41.973 1.00 60.75  ? 323 GLY A C   1 
ATOM   2448 O O   . GLY A 1 326 ? 71.604 146.760 -41.739 1.00 63.66  ? 323 GLY A O   1 
ATOM   2449 N N   . LEU A 1 327 ? 72.774 144.983 -41.007 1.00 62.95  ? 324 LEU A N   1 
ATOM   2450 C CA  . LEU A 1 327 ? 72.590 145.267 -39.590 1.00 51.03  ? 324 LEU A CA  1 
ATOM   2451 C C   . LEU A 1 327 ? 73.942 145.245 -38.893 1.00 47.03  ? 324 LEU A C   1 
ATOM   2452 O O   . LEU A 1 327 ? 74.749 144.338 -39.124 1.00 53.64  ? 324 LEU A O   1 
ATOM   2453 C CB  . LEU A 1 327 ? 71.640 144.247 -38.949 1.00 58.23  ? 324 LEU A CB  1 
ATOM   2454 C CG  . LEU A 1 327 ? 71.535 144.193 -37.423 1.00 55.06  ? 324 LEU A CG  1 
ATOM   2455 C CD1 . LEU A 1 327 ? 71.116 145.538 -36.851 1.00 46.94  ? 324 LEU A CD1 1 
ATOM   2456 C CD2 . LEU A 1 327 ? 70.560 143.103 -37.002 1.00 48.82  ? 324 LEU A CD2 1 
ATOM   2457 N N   . GLN A 1 328 ? 74.186 146.244 -38.050 1.00 43.76  ? 325 GLN A N   1 
ATOM   2458 C CA  . GLN A 1 328 ? 75.394 146.325 -37.240 1.00 44.40  ? 325 GLN A CA  1 
ATOM   2459 C C   . GLN A 1 328 ? 75.010 146.208 -35.772 1.00 48.93  ? 325 GLN A C   1 
ATOM   2460 O O   . GLN A 1 328 ? 74.153 146.956 -35.291 1.00 39.98  ? 325 GLN A O   1 
ATOM   2461 C CB  . GLN A 1 328 ? 76.147 147.635 -37.489 1.00 45.24  ? 325 GLN A CB  1 
ATOM   2462 C CG  . GLN A 1 328 ? 76.595 147.841 -38.928 1.00 49.07  ? 325 GLN A CG  1 
ATOM   2463 C CD  . GLN A 1 328 ? 75.475 148.332 -39.823 1.00 47.01  ? 325 GLN A CD  1 
ATOM   2464 O OE1 . GLN A 1 328 ? 74.860 149.365 -39.556 1.00 55.14  ? 325 GLN A OE1 1 
ATOM   2465 N NE2 . GLN A 1 328 ? 75.197 147.589 -40.887 1.00 51.55  ? 325 GLN A NE2 1 
ATOM   2466 N N   . VAL A 1 329 ? 75.636 145.268 -35.069 1.00 45.13  ? 326 VAL A N   1 
ATOM   2467 C CA  . VAL A 1 329 ? 75.333 144.997 -33.669 1.00 37.83  ? 326 VAL A CA  1 
ATOM   2468 C C   . VAL A 1 329 ? 76.614 145.114 -32.855 1.00 45.50  ? 326 VAL A C   1 
ATOM   2469 O O   . VAL A 1 329 ? 77.689 144.702 -33.305 1.00 49.99  ? 326 VAL A O   1 
ATOM   2470 C CB  . VAL A 1 329 ? 74.697 143.603 -33.479 1.00 40.15  ? 326 VAL A CB  1 
ATOM   2471 C CG1 . VAL A 1 329 ? 74.168 143.449 -32.060 1.00 36.27  ? 326 VAL A CG1 1 
ATOM   2472 C CG2 . VAL A 1 329 ? 73.588 143.375 -34.492 1.00 42.95  ? 326 VAL A CG2 1 
ATOM   2473 N N   . LEU A 1 330 ? 76.492 145.681 -31.657 1.00 43.43  ? 327 LEU A N   1 
ATOM   2474 C CA  . LEU A 1 330 ? 77.578 145.745 -30.684 1.00 36.71  ? 327 LEU A CA  1 
ATOM   2475 C C   . LEU A 1 330 ? 77.087 145.083 -29.403 1.00 41.15  ? 327 LEU A C   1 
ATOM   2476 O O   . LEU A 1 330 ? 76.195 145.610 -28.731 1.00 40.21  ? 327 LEU A O   1 
ATOM   2477 C CB  . LEU A 1 330 ? 78.010 147.190 -30.431 1.00 33.01  ? 327 LEU A CB  1 
ATOM   2478 C CG  . LEU A 1 330 ? 79.054 147.414 -29.335 1.00 39.30  ? 327 LEU A CG  1 
ATOM   2479 C CD1 . LEU A 1 330 ? 80.322 146.627 -29.622 1.00 44.42  ? 327 LEU A CD1 1 
ATOM   2480 C CD2 . LEU A 1 330 ? 79.364 148.896 -29.184 1.00 39.95  ? 327 LEU A CD2 1 
ATOM   2481 N N   . VAL A 1 331 ? 77.656 143.927 -29.072 1.00 34.58  ? 328 VAL A N   1 
ATOM   2482 C CA  . VAL A 1 331 ? 77.260 143.185 -27.884 1.00 29.82  ? 328 VAL A CA  1 
ATOM   2483 C C   . VAL A 1 331 ? 78.468 143.038 -26.971 1.00 32.15  ? 328 VAL A C   1 
ATOM   2484 O O   . VAL A 1 331 ? 79.616 143.217 -27.380 1.00 34.99  ? 328 VAL A O   1 
ATOM   2485 C CB  . VAL A 1 331 ? 76.670 141.803 -28.228 1.00 34.25  ? 328 VAL A CB  1 
ATOM   2486 C CG1 . VAL A 1 331 ? 75.335 141.959 -28.936 1.00 28.44  ? 328 VAL A CG1 1 
ATOM   2487 C CG2 . VAL A 1 331 ? 77.646 141.011 -29.084 1.00 34.28  ? 328 VAL A CG2 1 
ATOM   2488 N N   . GLY A 1 332 ? 78.192 142.707 -25.716 1.00 32.58  ? 329 GLY A N   1 
ATOM   2489 C CA  . GLY A 1 332 ? 79.259 142.520 -24.751 1.00 26.15  ? 329 GLY A CA  1 
ATOM   2490 C C   . GLY A 1 332 ? 78.693 142.207 -23.385 1.00 29.97  ? 329 GLY A C   1 
ATOM   2491 O O   . GLY A 1 332 ? 77.476 142.206 -23.171 1.00 29.46  ? 329 GLY A O   1 
ATOM   2492 N N   . VAL A 1 333 ? 79.609 141.933 -22.455 1.00 25.23  ? 330 VAL A N   1 
ATOM   2493 C CA  . VAL A 1 333 ? 79.282 141.579 -21.080 1.00 26.77  ? 330 VAL A CA  1 
ATOM   2494 C C   . VAL A 1 333 ? 80.331 142.198 -20.163 1.00 29.29  ? 330 VAL A C   1 
ATOM   2495 O O   . VAL A 1 333 ? 81.351 142.722 -20.611 1.00 29.52  ? 330 VAL A O   1 
ATOM   2496 C CB  . VAL A 1 333 ? 79.225 140.050 -20.864 1.00 32.73  ? 330 VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 333 ? 78.057 139.435 -21.622 1.00 32.74  ? 330 VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 333 ? 80.538 139.409 -21.287 1.00 30.31  ? 330 VAL A CG2 1 
ATOM   2499 N N   . VAL A 1 334 ? 80.065 142.133 -18.858 1.00 28.91  ? 331 VAL A N   1 
ATOM   2500 C CA  . VAL A 1 334 ? 81.060 142.516 -17.863 1.00 28.41  ? 331 VAL A CA  1 
ATOM   2501 C C   . VAL A 1 334 ? 81.782 141.254 -17.414 1.00 22.93  ? 331 VAL A C   1 
ATOM   2502 O O   . VAL A 1 334 ? 81.361 140.138 -17.737 1.00 30.04  ? 331 VAL A O   1 
ATOM   2503 C CB  . VAL A 1 334 ? 80.430 143.256 -16.667 1.00 30.85  ? 331 VAL A CB  1 
ATOM   2504 C CG1 . VAL A 1 334 ? 79.642 144.466 -17.145 1.00 27.94  ? 331 VAL A CG1 1 
ATOM   2505 C CG2 . VAL A 1 334 ? 79.556 142.317 -15.854 1.00 25.68  ? 331 VAL A CG2 1 
ATOM   2506 N N   . LYS A 1 335 ? 82.871 141.419 -16.662 1.00 27.23  ? 332 LYS A N   1 
ATOM   2507 C CA  . LYS A 1 335 ? 83.711 140.274 -16.329 1.00 33.39  ? 332 LYS A CA  1 
ATOM   2508 C C   . LYS A 1 335 ? 83.017 139.330 -15.353 1.00 39.69  ? 332 LYS A C   1 
ATOM   2509 O O   . LYS A 1 335 ? 83.187 138.108 -15.439 1.00 39.58  ? 332 LYS A O   1 
ATOM   2510 C CB  . LYS A 1 335 ? 85.050 140.753 -15.766 1.00 42.30  ? 332 LYS A CB  1 
ATOM   2511 C CG  . LYS A 1 335 ? 86.026 139.630 -15.450 1.00 41.33  ? 332 LYS A CG  1 
ATOM   2512 C CD  . LYS A 1 335 ? 87.391 140.167 -15.049 1.00 41.28  ? 332 LYS A CD  1 
ATOM   2513 C CE  . LYS A 1 335 ? 88.332 139.033 -14.670 1.00 48.53  ? 332 LYS A CE  1 
ATOM   2514 N NZ  . LYS A 1 335 ? 89.664 139.530 -14.232 1.00 51.45  ? 332 LYS A NZ  1 
ATOM   2515 N N   . ASP A 1 336 ? 82.225 139.872 -14.422 1.00 33.49  ? 333 ASP A N   1 
ATOM   2516 C CA  . ASP A 1 336 ? 81.569 139.079 -13.377 1.00 35.11  ? 333 ASP A CA  1 
ATOM   2517 C C   . ASP A 1 336 ? 80.067 139.364 -13.414 1.00 31.01  ? 333 ASP A C   1 
ATOM   2518 O O   . ASP A 1 336 ? 79.554 140.169 -12.634 1.00 35.16  ? 333 ASP A O   1 
ATOM   2519 C CB  . ASP A 1 336 ? 82.172 139.385 -12.009 1.00 36.85  ? 333 ASP A CB  1 
ATOM   2520 C CG  . ASP A 1 336 ? 83.666 139.136 -11.963 1.00 41.20  ? 333 ASP A CG  1 
ATOM   2521 O OD1 . ASP A 1 336 ? 84.070 137.956 -11.891 1.00 45.59  ? 333 ASP A OD1 1 
ATOM   2522 O OD2 . ASP A 1 336 ? 84.436 140.120 -11.992 1.00 34.06  ? 333 ASP A OD2 1 
ATOM   2523 N N   . GLU A 1 337 ? 79.362 138.678 -14.316 1.00 31.17  ? 334 GLU A N   1 
ATOM   2524 C CA  . GLU A 1 337 ? 77.941 138.948 -14.510 1.00 31.06  ? 334 GLU A CA  1 
ATOM   2525 C C   . GLU A 1 337 ? 77.090 138.457 -13.345 1.00 36.39  ? 334 GLU A C   1 
ATOM   2526 O O   . GLU A 1 337 ? 76.066 139.073 -13.029 1.00 37.09  ? 334 GLU A O   1 
ATOM   2527 C CB  . GLU A 1 337 ? 77.462 138.309 -15.814 1.00 31.87  ? 334 GLU A CB  1 
ATOM   2528 C CG  . GLU A 1 337 ? 77.946 139.015 -17.070 1.00 35.07  ? 334 GLU A CG  1 
ATOM   2529 C CD  . GLU A 1 337 ? 77.206 140.314 -17.331 1.00 37.91  ? 334 GLU A CD  1 
ATOM   2530 O OE1 . GLU A 1 337 ? 76.182 140.564 -16.663 1.00 33.38  ? 334 GLU A OE1 1 
ATOM   2531 O OE2 . GLU A 1 337 ? 77.649 141.084 -18.209 1.00 37.60  ? 334 GLU A OE2 1 
ATOM   2532 N N   . GLY A 1 338 ? 77.486 137.364 -12.694 1.00 28.75  ? 335 GLY A N   1 
ATOM   2533 C CA  . GLY A 1 338 ? 76.625 136.734 -11.712 1.00 25.56  ? 335 GLY A CA  1 
ATOM   2534 C C   . GLY A 1 338 ? 76.790 137.166 -10.271 1.00 31.80  ? 335 GLY A C   1 
ATOM   2535 O O   . GLY A 1 338 ? 75.932 136.843 -9.445  1.00 34.48  ? 335 GLY A O   1 
ATOM   2536 N N   . SER A 1 339 ? 77.858 137.899 -9.942  1.00 27.35  ? 336 SER A N   1 
ATOM   2537 C CA  . SER A 1 339 ? 78.159 138.179 -8.540  1.00 27.49  ? 336 SER A CA  1 
ATOM   2538 C C   . SER A 1 339 ? 77.125 139.096 -7.894  1.00 36.66  ? 336 SER A C   1 
ATOM   2539 O O   . SER A 1 339 ? 76.829 138.944 -6.703  1.00 42.02  ? 336 SER A O   1 
ATOM   2540 C CB  . SER A 1 339 ? 79.557 138.786 -8.417  1.00 33.02  ? 336 SER A CB  1 
ATOM   2541 O OG  . SER A 1 339 ? 79.670 139.970 -9.185  1.00 34.56  ? 336 SER A OG  1 
ATOM   2542 N N   . TYR A 1 340 ? 76.571 140.048 -8.650  1.00 34.31  ? 337 TYR A N   1 
ATOM   2543 C CA  . TYR A 1 340 ? 75.589 140.974 -8.088  1.00 30.72  ? 337 TYR A CA  1 
ATOM   2544 C C   . TYR A 1 340 ? 74.349 140.239 -7.597  1.00 32.57  ? 337 TYR A C   1 
ATOM   2545 O O   . TYR A 1 340 ? 73.762 140.607 -6.573  1.00 40.26  ? 337 TYR A O   1 
ATOM   2546 C CB  . TYR A 1 340 ? 75.214 142.024 -9.137  1.00 38.93  ? 337 TYR A CB  1 
ATOM   2547 C CG  . TYR A 1 340 ? 74.126 143.000 -8.740  1.00 26.11  ? 337 TYR A CG  1 
ATOM   2548 C CD1 . TYR A 1 340 ? 74.439 144.209 -8.135  1.00 46.93  ? 337 TYR A CD1 1 
ATOM   2549 C CD2 . TYR A 1 340 ? 72.789 142.729 -9.005  1.00 39.42  ? 337 TYR A CD2 1 
ATOM   2550 C CE1 . TYR A 1 340 ? 73.451 145.112 -7.785  1.00 45.16  ? 337 TYR A CE1 1 
ATOM   2551 C CE2 . TYR A 1 340 ? 71.794 143.623 -8.656  1.00 50.05  ? 337 TYR A CE2 1 
ATOM   2552 C CZ  . TYR A 1 340 ? 72.131 144.813 -8.046  1.00 52.97  ? 337 TYR A CZ  1 
ATOM   2553 O OH  . TYR A 1 340 ? 71.144 145.707 -7.698  1.00 53.21  ? 337 TYR A OH  1 
ATOM   2554 N N   . PHE A 1 341 ? 73.941 139.193 -8.309  1.00 28.08  ? 338 PHE A N   1 
ATOM   2555 C CA  . PHE A 1 341 ? 72.677 138.524 -8.041  1.00 30.55  ? 338 PHE A CA  1 
ATOM   2556 C C   . PHE A 1 341 ? 72.776 137.471 -6.946  1.00 29.37  ? 338 PHE A C   1 
ATOM   2557 O O   . PHE A 1 341 ? 71.740 136.954 -6.514  1.00 31.77  ? 338 PHE A O   1 
ATOM   2558 C CB  . PHE A 1 341 ? 72.152 137.892 -9.334  1.00 28.29  ? 338 PHE A CB  1 
ATOM   2559 C CG  . PHE A 1 341 ? 71.999 138.875 -10.465 1.00 40.02  ? 338 PHE A CG  1 
ATOM   2560 C CD1 . PHE A 1 341 ? 73.075 139.198 -11.278 1.00 39.13  ? 338 PHE A CD1 1 
ATOM   2561 C CD2 . PHE A 1 341 ? 70.780 139.481 -10.708 1.00 46.89  ? 338 PHE A CD2 1 
ATOM   2562 C CE1 . PHE A 1 341 ? 72.934 140.109 -12.312 1.00 38.16  ? 338 PHE A CE1 1 
ATOM   2563 C CE2 . PHE A 1 341 ? 70.630 140.389 -11.740 1.00 40.75  ? 338 PHE A CE2 1 
ATOM   2564 C CZ  . PHE A 1 341 ? 71.708 140.704 -12.543 1.00 43.28  ? 338 PHE A CZ  1 
ATOM   2565 N N   . LEU A 1 342 ? 73.985 137.152 -6.476  1.00 31.81  ? 339 LEU A N   1 
ATOM   2566 C CA  . LEU A 1 342 ? 74.131 136.084 -5.493  1.00 29.89  ? 339 LEU A CA  1 
ATOM   2567 C C   . LEU A 1 342 ? 73.696 136.528 -4.103  1.00 33.93  ? 339 LEU A C   1 
ATOM   2568 O O   . LEU A 1 342 ? 73.241 135.699 -3.306  1.00 32.16  ? 339 LEU A O   1 
ATOM   2569 C CB  . LEU A 1 342 ? 75.576 135.584 -5.471  1.00 22.95  ? 339 LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 342 ? 76.043 134.956 -6.788  1.00 36.91  ? 339 LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 342 ? 77.475 134.456 -6.691  1.00 29.42  ? 339 LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 342 ? 75.104 133.832 -7.198  1.00 25.33  ? 339 LEU A CD2 1 
ATOM   2573 N N   . VAL A 1 343 ? 73.823 137.822 -3.789  1.00 30.68  ? 340 VAL A N   1 
ATOM   2574 C CA  . VAL A 1 343 ? 73.383 138.325 -2.488  1.00 31.10  ? 340 VAL A CA  1 
ATOM   2575 C C   . VAL A 1 343 ? 71.873 138.446 -2.397  1.00 32.85  ? 340 VAL A C   1 
ATOM   2576 O O   . VAL A 1 343 ? 71.356 138.883 -1.361  1.00 29.33  ? 340 VAL A O   1 
ATOM   2577 C CB  . VAL A 1 343 ? 74.014 139.693 -2.159  1.00 35.99  ? 340 VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 343 ? 75.509 139.542 -1.918  1.00 35.21  ? 340 VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 343 ? 73.739 140.698 -3.274  1.00 28.40  ? 340 VAL A CG2 1 
ATOM   2580 N N   . TYR A 1 344 ? 71.147 138.068 -3.449  1.00 27.89  ? 341 TYR A N   1 
ATOM   2581 C CA  . TYR A 1 344 ? 69.693 138.138 -3.472  1.00 36.38  ? 341 TYR A CA  1 
ATOM   2582 C C   . TYR A 1 344 ? 69.038 136.768 -3.328  1.00 38.97  ? 341 TYR A C   1 
ATOM   2583 O O   . TYR A 1 344 ? 67.941 136.551 -3.852  1.00 53.53  ? 341 TYR A O   1 
ATOM   2584 C CB  . TYR A 1 344 ? 69.213 138.815 -4.756  1.00 35.49  ? 341 TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 344 ? 69.336 140.322 -4.752  1.00 37.52  ? 341 TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 344 ? 68.339 141.114 -4.203  1.00 33.22  ? 341 TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 344 ? 70.443 140.952 -5.308  1.00 38.22  ? 341 TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 344 ? 68.439 142.491 -4.205  1.00 39.61  ? 341 TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 344 ? 70.553 142.331 -5.312  1.00 42.82  ? 341 TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 344 ? 69.550 143.094 -4.760  1.00 39.26  ? 341 TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 344 ? 69.669 144.465 -4.769  1.00 40.34  ? 341 TYR A OH  1 
ATOM   2592 N N   . GLY A 1 345 ? 69.677 135.841 -2.619  1.00 34.27  ? 342 GLY A N   1 
ATOM   2593 C CA  . GLY A 1 345 ? 69.046 134.555 -2.395  1.00 45.92  ? 342 GLY A CA  1 
ATOM   2594 C C   . GLY A 1 345 ? 69.978 133.374 -2.222  1.00 40.57  ? 342 GLY A C   1 
ATOM   2595 O O   . GLY A 1 345 ? 69.617 132.398 -1.558  1.00 49.41  ? 342 GLY A O   1 
ATOM   2596 N N   . ALA A 1 346 ? 71.162 133.435 -2.817  1.00 33.37  ? 343 ALA A N   1 
ATOM   2597 C CA  . ALA A 1 346 ? 72.100 132.324 -2.709  1.00 35.80  ? 343 ALA A CA  1 
ATOM   2598 C C   . ALA A 1 346 ? 72.573 132.190 -1.265  1.00 39.86  ? 343 ALA A C   1 
ATOM   2599 O O   . ALA A 1 346 ? 73.040 133.173 -0.677  1.00 37.66  ? 343 ALA A O   1 
ATOM   2600 C CB  . ALA A 1 346 ? 73.288 132.530 -3.644  1.00 30.15  ? 343 ALA A CB  1 
ATOM   2601 N N   . PRO A 1 347 ? 72.467 131.006 -0.662  1.00 35.47  ? 344 PRO A N   1 
ATOM   2602 C CA  . PRO A 1 347 ? 72.817 130.870 0.757   1.00 32.15  ? 344 PRO A CA  1 
ATOM   2603 C C   . PRO A 1 347 ? 74.307 131.055 0.994   1.00 34.23  ? 344 PRO A C   1 
ATOM   2604 O O   . PRO A 1 347 ? 75.143 130.650 0.181   1.00 31.96  ? 344 PRO A O   1 
ATOM   2605 C CB  . PRO A 1 347 ? 72.369 129.443 1.096   1.00 32.30  ? 344 PRO A CB  1 
ATOM   2606 C CG  . PRO A 1 347 ? 72.399 128.722 -0.212  1.00 44.91  ? 344 PRO A CG  1 
ATOM   2607 C CD  . PRO A 1 347 ? 72.003 129.737 -1.246  1.00 32.80  ? 344 PRO A CD  1 
ATOM   2608 N N   . GLY A 1 348 ? 74.632 131.680 2.125   1.00 32.83  ? 345 GLY A N   1 
ATOM   2609 C CA  . GLY A 1 348 ? 76.004 131.930 2.504   1.00 26.41  ? 345 GLY A CA  1 
ATOM   2610 C C   . GLY A 1 348 ? 76.605 133.200 1.945   1.00 30.24  ? 345 GLY A C   1 
ATOM   2611 O O   . GLY A 1 348 ? 77.734 133.546 2.315   1.00 27.06  ? 345 GLY A O   1 
ATOM   2612 N N   . PHE A 1 349 ? 75.893 133.908 1.073   1.00 35.00  ? 346 PHE A N   1 
ATOM   2613 C CA  . PHE A 1 349 ? 76.423 135.107 0.442   1.00 41.75  ? 346 PHE A CA  1 
ATOM   2614 C C   . PHE A 1 349 ? 75.996 136.358 1.195   1.00 35.27  ? 346 PHE A C   1 
ATOM   2615 O O   . PHE A 1 349 ? 74.872 136.448 1.700   1.00 38.23  ? 346 PHE A O   1 
ATOM   2616 C CB  . PHE A 1 349 ? 75.973 135.195 -1.017  1.00 34.15  ? 346 PHE A CB  1 
ATOM   2617 C CG  . PHE A 1 349 ? 76.784 134.344 -1.947  1.00 32.45  ? 346 PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1 349 ? 77.910 134.856 -2.569  1.00 36.84  ? 346 PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1 349 ? 76.428 133.029 -2.192  1.00 35.41  ? 346 PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1 349 ? 78.663 134.075 -3.423  1.00 36.96  ? 346 PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1 349 ? 77.175 132.243 -3.046  1.00 27.69  ? 346 PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1 349 ? 78.294 132.766 -3.662  1.00 40.09  ? 346 PHE A CZ  1 
ATOM   2623 N N   . SER A 1 350 ? 76.908 137.324 1.260   1.00 39.05  ? 347 SER A N   1 
ATOM   2624 C CA  . SER A 1 350 ? 76.675 138.592 1.931   1.00 36.89  ? 347 SER A CA  1 
ATOM   2625 C C   . SER A 1 350 ? 77.690 139.594 1.408   1.00 31.09  ? 347 SER A C   1 
ATOM   2626 O O   . SER A 1 350 ? 78.875 139.274 1.286   1.00 44.34  ? 347 SER A O   1 
ATOM   2627 C CB  . SER A 1 350 ? 76.795 138.454 3.454   1.00 29.84  ? 347 SER A CB  1 
ATOM   2628 O OG  . SER A 1 350 ? 76.883 139.723 4.077   1.00 38.01  ? 347 SER A OG  1 
ATOM   2629 N N   . LYS A 1 351 ? 77.218 140.802 1.095   1.00 35.36  ? 348 LYS A N   1 
ATOM   2630 C CA  . LYS A 1 351 ? 78.124 141.839 0.620   1.00 34.67  ? 348 LYS A CA  1 
ATOM   2631 C C   . LYS A 1 351 ? 79.056 142.332 1.718   1.00 33.25  ? 348 LYS A C   1 
ATOM   2632 O O   . LYS A 1 351 ? 80.071 142.967 1.414   1.00 30.93  ? 348 LYS A O   1 
ATOM   2633 C CB  . LYS A 1 351 ? 77.333 143.016 0.047   1.00 34.47  ? 348 LYS A CB  1 
ATOM   2634 C CG  . LYS A 1 351 ? 76.936 144.059 1.081   1.00 33.54  ? 348 LYS A CG  1 
ATOM   2635 C CD  . LYS A 1 351 ? 76.325 145.286 0.425   1.00 31.91  ? 348 LYS A CD  1 
ATOM   2636 C CE  . LYS A 1 351 ? 76.032 146.372 1.448   1.00 28.84  ? 348 LYS A CE  1 
ATOM   2637 N NZ  . LYS A 1 351 ? 77.274 146.864 2.107   1.00 28.37  ? 348 LYS A NZ  1 
ATOM   2638 N N   . ASP A 1 352 ? 78.744 142.042 2.982   1.00 33.93  ? 349 ASP A N   1 
ATOM   2639 C CA  . ASP A 1 352 ? 79.504 142.563 4.109   1.00 34.83  ? 349 ASP A CA  1 
ATOM   2640 C C   . ASP A 1 352 ? 80.541 141.586 4.649   1.00 37.07  ? 349 ASP A C   1 
ATOM   2641 O O   . ASP A 1 352 ? 81.314 141.963 5.536   1.00 40.66  ? 349 ASP A O   1 
ATOM   2642 C CB  . ASP A 1 352 ? 78.548 142.987 5.229   1.00 35.13  ? 349 ASP A CB  1 
ATOM   2643 C CG  . ASP A 1 352 ? 77.655 144.144 4.818   1.00 30.94  ? 349 ASP A CG  1 
ATOM   2644 O OD1 . ASP A 1 352 ? 78.171 145.101 4.203   1.00 24.44  ? 349 ASP A OD1 1 
ATOM   2645 O OD2 . ASP A 1 352 ? 76.439 144.091 5.092   1.00 30.29  ? 349 ASP A OD2 1 
ATOM   2646 N N   . ASN A 1 353 ? 80.576 140.354 4.152   1.00 29.50  ? 350 ASN A N   1 
ATOM   2647 C CA  . ASN A 1 353 ? 81.710 139.463 4.365   1.00 33.03  ? 350 ASN A CA  1 
ATOM   2648 C C   . ASN A 1 353 ? 82.243 139.025 2.999   1.00 33.99  ? 350 ASN A C   1 
ATOM   2649 O O   . ASN A 1 353 ? 81.839 139.548 1.956   1.00 38.06  ? 350 ASN A O   1 
ATOM   2650 C CB  . ASN A 1 353 ? 81.335 138.280 5.270   1.00 25.62  ? 350 ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 353 ? 80.242 137.391 4.687   1.00 32.49  ? 350 ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 353 ? 80.136 137.211 3.475   1.00 33.38  ? 350 ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 353 ? 79.430 136.816 5.567   1.00 30.76  ? 350 ASN A ND2 1 
ATOM   2654 N N   . GLU A 1 354 ? 83.155 138.057 3.007   1.00 41.50  ? 351 GLU A N   1 
ATOM   2655 C CA  . GLU A 1 354 ? 83.821 137.626 1.786   1.00 40.21  ? 351 GLU A CA  1 
ATOM   2656 C C   . GLU A 1 354 ? 83.130 136.445 1.113   1.00 28.39  ? 351 GLU A C   1 
ATOM   2657 O O   . GLU A 1 354 ? 83.643 135.933 0.112   1.00 38.30  ? 351 GLU A O   1 
ATOM   2658 C CB  . GLU A 1 354 ? 85.286 137.299 2.082   1.00 41.71  ? 351 GLU A CB  1 
ATOM   2659 C CG  . GLU A 1 354 ? 86.052 138.496 2.632   1.00 45.69  ? 351 GLU A CG  1 
ATOM   2660 C CD  . GLU A 1 354 ? 87.546 138.266 2.697   1.00 80.48  ? 351 GLU A CD  1 
ATOM   2661 O OE1 . GLU A 1 354 ? 87.994 137.155 2.346   1.00 82.57  ? 351 GLU A OE1 1 
ATOM   2662 O OE2 . GLU A 1 354 ? 88.273 139.200 3.097   1.00 86.30  ? 351 GLU A OE2 1 
ATOM   2663 N N   . SER A 1 355 ? 81.981 136.010 1.638   1.00 25.20  ? 352 SER A N   1 
ATOM   2664 C CA  . SER A 1 355 ? 81.113 135.032 0.975   1.00 32.07  ? 352 SER A CA  1 
ATOM   2665 C C   . SER A 1 355 ? 81.862 133.752 0.614   1.00 32.14  ? 352 SER A C   1 
ATOM   2666 O O   . SER A 1 355 ? 81.685 133.183 -0.466  1.00 30.51  ? 352 SER A O   1 
ATOM   2667 C CB  . SER A 1 355 ? 80.453 135.642 -0.262  1.00 30.29  ? 352 SER A CB  1 
ATOM   2668 O OG  . SER A 1 355 ? 79.454 136.577 0.106   1.00 35.01  ? 352 SER A OG  1 
ATOM   2669 N N   . LEU A 1 356 ? 82.709 133.293 1.530   1.00 37.10  ? 353 LEU A N   1 
ATOM   2670 C CA  . LEU A 1 356 ? 83.439 132.038 1.358   1.00 37.10  ? 353 LEU A CA  1 
ATOM   2671 C C   . LEU A 1 356 ? 82.482 130.898 1.685   1.00 29.14  ? 353 LEU A C   1 
ATOM   2672 O O   . LEU A 1 356 ? 82.419 130.411 2.815   1.00 31.95  ? 353 LEU A O   1 
ATOM   2673 C CB  . LEU A 1 356 ? 84.678 132.015 2.244   1.00 31.19  ? 353 LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 356 ? 85.664 133.161 2.013   1.00 30.54  ? 353 LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 356 ? 86.623 133.285 3.184   1.00 35.25  ? 353 LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 356 ? 86.428 132.963 0.712   1.00 26.87  ? 353 LEU A CD2 1 
ATOM   2677 N N   . ILE A 1 357 ? 81.722 130.470 0.679   1.00 27.28  ? 354 ILE A N   1 
ATOM   2678 C CA  . ILE A 1 357 ? 80.671 129.485 0.897   1.00 35.83  ? 354 ILE A CA  1 
ATOM   2679 C C   . ILE A 1 357 ? 81.268 128.084 0.987   1.00 39.30  ? 354 ILE A C   1 
ATOM   2680 O O   . ILE A 1 357 ? 82.381 127.815 0.529   1.00 38.46  ? 354 ILE A O   1 
ATOM   2681 C CB  . ILE A 1 357 ? 79.603 129.564 -0.208  1.00 29.65  ? 354 ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 357 ? 80.248 129.373 -1.582  1.00 27.02  ? 354 ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 357 ? 78.861 130.889 -0.135  1.00 32.19  ? 354 ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 357 ? 79.258 129.331 -2.722  1.00 28.50  ? 354 ILE A CD1 1 
ATOM   2685 N N   . SER A 1 358 ? 80.502 127.179 1.587   1.00 45.56  ? 355 SER A N   1 
ATOM   2686 C CA  . SER A 1 358 ? 80.894 125.787 1.722   1.00 34.89  ? 355 SER A CA  1 
ATOM   2687 C C   . SER A 1 358 ? 80.408 124.976 0.522   1.00 42.74  ? 355 SER A C   1 
ATOM   2688 O O   . SER A 1 358 ? 79.639 125.453 -0.317  1.00 39.70  ? 355 SER A O   1 
ATOM   2689 C CB  . SER A 1 358 ? 80.341 125.200 3.022   1.00 25.72  ? 355 SER A CB  1 
ATOM   2690 O OG  . SER A 1 358 ? 78.924 125.221 3.033   1.00 35.64  ? 355 SER A OG  1 
ATOM   2691 N N   . ARG A 1 359 ? 80.879 123.728 0.447   1.00 45.01  ? 356 ARG A N   1 
ATOM   2692 C CA  . ARG A 1 359 ? 80.456 122.835 -0.629  1.00 34.77  ? 356 ARG A CA  1 
ATOM   2693 C C   . ARG A 1 359 ? 78.948 122.630 -0.613  1.00 32.66  ? 356 ARG A C   1 
ATOM   2694 O O   . ARG A 1 359 ? 78.307 122.596 -1.670  1.00 39.45  ? 356 ARG A O   1 
ATOM   2695 C CB  . ARG A 1 359 ? 81.180 121.494 -0.511  1.00 41.61  ? 356 ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 359 ? 80.819 120.488 -1.595  1.00 39.96  ? 356 ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 359 ? 81.352 120.923 -2.949  1.00 41.82  ? 356 ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 359 ? 80.987 119.991 -4.012  1.00 41.01  ? 356 ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 359 ? 81.348 120.131 -5.283  1.00 40.89  ? 356 ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 359 ? 82.089 121.167 -5.652  1.00 32.71  ? 356 ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 359 ? 80.969 119.237 -6.186  1.00 43.20  ? 356 ARG A NH2 1 
ATOM   2702 N N   . ALA A 1 360 ? 78.363 122.491 0.579   1.00 30.02  ? 357 ALA A N   1 
ATOM   2703 C CA  . ALA A 1 360 ? 76.918 122.312 0.678   1.00 39.81  ? 357 ALA A CA  1 
ATOM   2704 C C   . ALA A 1 360 ? 76.173 123.555 0.211   1.00 35.01  ? 357 ALA A C   1 
ATOM   2705 O O   . ALA A 1 360 ? 75.158 123.451 -0.486  1.00 37.45  ? 357 ALA A O   1 
ATOM   2706 C CB  . ALA A 1 360 ? 76.530 121.961 2.114   1.00 26.44  ? 357 ALA A CB  1 
ATOM   2707 N N   . GLU A 1 361 ? 76.661 124.740 0.587   1.00 43.44  ? 358 GLU A N   1 
ATOM   2708 C CA  . GLU A 1 361 ? 76.011 125.974 0.157   1.00 43.93  ? 358 GLU A CA  1 
ATOM   2709 C C   . GLU A 1 361 ? 76.121 126.157 -1.351  1.00 33.81  ? 358 GLU A C   1 
ATOM   2710 O O   . GLU A 1 361 ? 75.203 126.687 -1.987  1.00 28.33  ? 358 GLU A O   1 
ATOM   2711 C CB  . GLU A 1 361 ? 76.611 127.170 0.898   1.00 33.15  ? 358 GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 361 ? 76.238 127.222 2.371   1.00 29.83  ? 358 GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 361 ? 77.029 128.258 3.145   1.00 37.90  ? 358 GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 361 ? 78.172 128.560 2.741   1.00 37.79  ? 358 GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 361 ? 76.508 128.772 4.157   1.00 45.63  ? 358 GLU A OE2 1 
ATOM   2716 N N   . PHE A 1 362 ? 77.237 125.719 -1.941  1.00 35.83  ? 359 PHE A N   1 
ATOM   2717 C CA  . PHE A 1 362 ? 77.372 125.776 -3.392  1.00 36.25  ? 359 PHE A CA  1 
ATOM   2718 C C   . PHE A 1 362 ? 76.340 124.888 -4.074  1.00 38.48  ? 359 PHE A C   1 
ATOM   2719 O O   . PHE A 1 362 ? 75.704 125.299 -5.052  1.00 37.05  ? 359 PHE A O   1 
ATOM   2720 C CB  . PHE A 1 362 ? 78.787 125.373 -3.808  1.00 28.40  ? 359 PHE A CB  1 
ATOM   2721 C CG  . PHE A 1 362 ? 78.962 125.228 -5.295  1.00 32.03  ? 359 PHE A CG  1 
ATOM   2722 C CD1 . PHE A 1 362 ? 79.125 126.344 -6.099  1.00 30.83  ? 359 PHE A CD1 1 
ATOM   2723 C CD2 . PHE A 1 362 ? 78.971 123.975 -5.888  1.00 37.22  ? 359 PHE A CD2 1 
ATOM   2724 C CE1 . PHE A 1 362 ? 79.287 126.215 -7.467  1.00 32.31  ? 359 PHE A CE1 1 
ATOM   2725 C CE2 . PHE A 1 362 ? 79.133 123.839 -7.255  1.00 33.17  ? 359 PHE A CE2 1 
ATOM   2726 C CZ  . PHE A 1 362 ? 79.292 124.960 -8.045  1.00 36.05  ? 359 PHE A CZ  1 
ATOM   2727 N N   . LEU A 1 363 ? 76.156 123.666 -3.567  1.00 37.85  ? 360 LEU A N   1 
ATOM   2728 C CA  . LEU A 1 363 ? 75.174 122.759 -4.154  1.00 45.63  ? 360 LEU A CA  1 
ATOM   2729 C C   . LEU A 1 363 ? 73.757 123.299 -4.014  1.00 41.18  ? 360 LEU A C   1 
ATOM   2730 O O   . LEU A 1 363 ? 72.920 123.078 -4.896  1.00 44.29  ? 360 LEU A O   1 
ATOM   2731 C CB  . LEU A 1 363 ? 75.285 121.378 -3.507  1.00 46.39  ? 360 LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 363 ? 76.610 120.640 -3.713  1.00 40.14  ? 360 LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 363 ? 76.636 119.350 -2.911  1.00 36.29  ? 360 LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 363 ? 76.845 120.361 -5.189  1.00 40.12  ? 360 LEU A CD2 1 
ATOM   2735 N N   . ALA A 1 364 ? 73.469 124.008 -2.920  1.00 35.56  ? 361 ALA A N   1 
ATOM   2736 C CA  . ALA A 1 364 ? 72.149 124.608 -2.760  1.00 37.93  ? 361 ALA A CA  1 
ATOM   2737 C C   . ALA A 1 364 ? 71.984 125.824 -3.662  1.00 38.73  ? 361 ALA A C   1 
ATOM   2738 O O   . ALA A 1 364 ? 70.899 126.058 -4.206  1.00 37.10  ? 361 ALA A O   1 
ATOM   2739 C CB  . ALA A 1 364 ? 71.918 124.987 -1.297  1.00 23.91  ? 361 ALA A CB  1 
ATOM   2740 N N   . GLY A 1 365 ? 73.051 126.608 -3.834  1.00 35.80  ? 362 GLY A N   1 
ATOM   2741 C CA  . GLY A 1 365 ? 72.968 127.787 -4.679  1.00 33.30  ? 362 GLY A CA  1 
ATOM   2742 C C   . GLY A 1 365 ? 72.750 127.466 -6.143  1.00 35.19  ? 362 GLY A C   1 
ATOM   2743 O O   . GLY A 1 365 ? 72.149 128.262 -6.871  1.00 39.68  ? 362 GLY A O   1 
ATOM   2744 N N   . VAL A 1 366 ? 73.233 126.306 -6.596  1.00 33.53  ? 363 VAL A N   1 
ATOM   2745 C CA  . VAL A 1 366 ? 73.027 125.906 -7.986  1.00 29.92  ? 363 VAL A CA  1 
ATOM   2746 C C   . VAL A 1 366 ? 71.541 125.739 -8.276  1.00 31.71  ? 363 VAL A C   1 
ATOM   2747 O O   . VAL A 1 366 ? 71.064 126.071 -9.369  1.00 36.25  ? 363 VAL A O   1 
ATOM   2748 C CB  . VAL A 1 366 ? 73.819 124.621 -8.296  1.00 33.70  ? 363 VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 366 ? 73.468 124.091 -9.679  1.00 29.71  ? 363 VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 366 ? 75.313 124.882 -8.194  1.00 28.29  ? 363 VAL A CG2 1 
ATOM   2751 N N   . ARG A 1 367 ? 70.781 125.236 -7.299  1.00 26.10  ? 364 ARG A N   1 
ATOM   2752 C CA  . ARG A 1 367 ? 69.341 125.101 -7.488  1.00 36.06  ? 364 ARG A CA  1 
ATOM   2753 C C   . ARG A 1 367 ? 68.647 126.457 -7.482  1.00 45.81  ? 364 ARG A C   1 
ATOM   2754 O O   . ARG A 1 367 ? 67.622 126.630 -8.152  1.00 43.48  ? 364 ARG A O   1 
ATOM   2755 C CB  . ARG A 1 367 ? 68.747 124.194 -6.409  1.00 30.52  ? 364 ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 367 ? 69.450 122.852 -6.267  1.00 43.29  ? 364 ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 367 ? 69.650 122.180 -7.618  1.00 47.35  ? 364 ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 367 ? 68.398 121.719 -8.210  1.00 61.44  ? 364 ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 367 ? 67.990 120.454 -8.199  1.00 58.25  ? 364 ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 367 ? 68.737 119.520 -7.627  1.00 57.68  ? 364 ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 367 ? 66.836 120.121 -8.762  1.00 56.50  ? 364 ARG A NH2 1 
ATOM   2762 N N   . VAL A 1 368 ? 69.183 127.424 -6.735  1.00 42.47  ? 365 VAL A N   1 
ATOM   2763 C CA  . VAL A 1 368 ? 68.626 128.772 -6.756  1.00 39.03  ? 365 VAL A CA  1 
ATOM   2764 C C   . VAL A 1 368 ? 69.015 129.486 -8.044  1.00 35.44  ? 365 VAL A C   1 
ATOM   2765 O O   . VAL A 1 368 ? 68.196 130.182 -8.658  1.00 41.54  ? 365 VAL A O   1 
ATOM   2766 C CB  . VAL A 1 368 ? 69.080 129.556 -5.510  1.00 43.52  ? 365 VAL A CB  1 
ATOM   2767 C CG1 . VAL A 1 368 ? 68.582 130.993 -5.567  1.00 32.75  ? 365 VAL A CG1 1 
ATOM   2768 C CG2 . VAL A 1 368 ? 68.593 128.866 -4.244  1.00 41.38  ? 365 VAL A CG2 1 
ATOM   2769 N N   . GLY A 1 369 ? 70.265 129.320 -8.480  1.00 32.68  ? 366 GLY A N   1 
ATOM   2770 C CA  . GLY A 1 369 ? 70.705 129.955 -9.710  1.00 30.32  ? 366 GLY A CA  1 
ATOM   2771 C C   . GLY A 1 369 ? 70.134 129.311 -10.956 1.00 40.23  ? 366 GLY A C   1 
ATOM   2772 O O   . GLY A 1 369 ? 69.925 129.988 -11.968 1.00 39.74  ? 366 GLY A O   1 
ATOM   2773 N N   . VAL A 1 370 ? 69.881 128.006 -10.911 1.00 34.95  ? 367 VAL A N   1 
ATOM   2774 C CA  . VAL A 1 370 ? 69.295 127.291 -12.042 1.00 42.44  ? 367 VAL A CA  1 
ATOM   2775 C C   . VAL A 1 370 ? 68.006 126.621 -11.581 1.00 40.78  ? 367 VAL A C   1 
ATOM   2776 O O   . VAL A 1 370 ? 68.005 125.415 -11.292 1.00 44.05  ? 367 VAL A O   1 
ATOM   2777 C CB  . VAL A 1 370 ? 70.274 126.261 -12.627 1.00 35.37  ? 367 VAL A CB  1 
ATOM   2778 C CG1 . VAL A 1 370 ? 69.815 125.817 -14.007 1.00 32.25  ? 367 VAL A CG1 1 
ATOM   2779 C CG2 . VAL A 1 370 ? 71.682 126.832 -12.687 1.00 28.25  ? 367 VAL A CG2 1 
ATOM   2780 N N   . PRO A 1 371 ? 66.898 127.348 -11.489 1.00 43.94  ? 368 PRO A N   1 
ATOM   2781 C CA  . PRO A 1 371 ? 65.643 126.733 -11.049 1.00 36.62  ? 368 PRO A CA  1 
ATOM   2782 C C   . PRO A 1 371 ? 64.958 125.965 -12.171 1.00 42.86  ? 368 PRO A C   1 
ATOM   2783 O O   . PRO A 1 371 ? 65.192 126.193 -13.359 1.00 57.95  ? 368 PRO A O   1 
ATOM   2784 C CB  . PRO A 1 371 ? 64.801 127.935 -10.610 1.00 43.27  ? 368 PRO A CB  1 
ATOM   2785 C CG  . PRO A 1 371 ? 65.292 129.051 -11.467 1.00 41.16  ? 368 PRO A CG  1 
ATOM   2786 C CD  . PRO A 1 371 ? 66.764 128.802 -11.684 1.00 42.63  ? 368 PRO A CD  1 
ATOM   2787 N N   . GLN A 1 372 ? 64.096 125.034 -11.755 1.00 50.18  ? 369 GLN A N   1 
ATOM   2788 C CA  . GLN A 1 372 ? 63.292 124.210 -12.662 1.00 58.61  ? 369 GLN A CA  1 
ATOM   2789 C C   . GLN A 1 372 ? 64.167 123.345 -13.566 1.00 58.60  ? 369 GLN A C   1 
ATOM   2790 O O   . GLN A 1 372 ? 64.001 123.313 -14.787 1.00 65.82  ? 369 GLN A O   1 
ATOM   2791 C CB  . GLN A 1 372 ? 62.337 125.067 -13.494 1.00 72.97  ? 369 GLN A CB  1 
ATOM   2792 C CG  . GLN A 1 372 ? 61.359 125.860 -12.669 1.00 76.30  ? 369 GLN A CG  1 
ATOM   2793 C CD  . GLN A 1 372 ? 59.984 125.925 -13.298 1.00 87.37  ? 369 GLN A CD  1 
ATOM   2794 O OE1 . GLN A 1 372 ? 59.803 125.568 -14.461 1.00 103.13 ? 369 GLN A OE1 1 
ATOM   2795 N NE2 . GLN A 1 372 ? 59.001 126.376 -12.526 1.00 72.23  ? 369 GLN A NE2 1 
ATOM   2796 N N   . VAL A 1 373 ? 65.107 122.631 -12.955 1.00 53.15  ? 370 VAL A N   1 
ATOM   2797 C CA  . VAL A 1 373 ? 65.916 121.651 -13.664 1.00 56.23  ? 370 VAL A CA  1 
ATOM   2798 C C   . VAL A 1 373 ? 65.934 120.365 -12.854 1.00 61.46  ? 370 VAL A C   1 
ATOM   2799 O O   . VAL A 1 373 ? 65.897 120.383 -11.619 1.00 55.64  ? 370 VAL A O   1 
ATOM   2800 C CB  . VAL A 1 373 ? 67.354 122.151 -13.933 1.00 49.53  ? 370 VAL A CB  1 
ATOM   2801 C CG1 . VAL A 1 373 ? 67.338 123.317 -14.910 1.00 50.85  ? 370 VAL A CG1 1 
ATOM   2802 C CG2 . VAL A 1 373 ? 68.039 122.539 -12.633 1.00 48.89  ? 370 VAL A CG2 1 
ATOM   2803 N N   . SER A 1 374 ? 65.976 119.241 -13.564 1.00 56.65  ? 371 SER A N   1 
ATOM   2804 C CA  . SER A 1 374 ? 66.021 117.943 -12.911 1.00 50.82  ? 371 SER A CA  1 
ATOM   2805 C C   . SER A 1 374 ? 67.290 117.811 -12.074 1.00 55.12  ? 371 SER A C   1 
ATOM   2806 O O   . SER A 1 374 ? 68.287 118.509 -12.289 1.00 50.39  ? 371 SER A O   1 
ATOM   2807 C CB  . SER A 1 374 ? 65.953 116.823 -13.949 1.00 49.96  ? 371 SER A CB  1 
ATOM   2808 O OG  . SER A 1 374 ? 66.951 116.989 -14.943 1.00 57.54  ? 371 SER A OG  1 
ATOM   2809 N N   . ASP A 1 375 ? 67.240 116.902 -11.097 1.00 51.67  ? 372 ASP A N   1 
ATOM   2810 C CA  . ASP A 1 375 ? 68.412 116.651 -10.266 1.00 50.44  ? 372 ASP A CA  1 
ATOM   2811 C C   . ASP A 1 375 ? 69.590 116.165 -11.099 1.00 52.10  ? 372 ASP A C   1 
ATOM   2812 O O   . ASP A 1 375 ? 70.748 116.362 -10.712 1.00 55.94  ? 372 ASP A O   1 
ATOM   2813 C CB  . ASP A 1 375 ? 68.073 115.638 -9.172  1.00 56.34  ? 372 ASP A CB  1 
ATOM   2814 C CG  . ASP A 1 375 ? 66.969 116.123 -8.254  1.00 72.98  ? 372 ASP A CG  1 
ATOM   2815 O OD1 . ASP A 1 375 ? 66.864 117.349 -8.042  1.00 66.57  ? 372 ASP A OD1 1 
ATOM   2816 O OD2 . ASP A 1 375 ? 66.203 115.277 -7.744  1.00 78.78  ? 372 ASP A OD2 1 
ATOM   2817 N N   . LEU A 1 376 ? 69.318 115.531 -12.242 1.00 41.34  ? 373 LEU A N   1 
ATOM   2818 C CA  . LEU A 1 376 ? 70.389 115.175 -13.165 1.00 45.95  ? 373 LEU A CA  1 
ATOM   2819 C C   . LEU A 1 376 ? 70.967 116.414 -13.839 1.00 50.27  ? 373 LEU A C   1 
ATOM   2820 O O   . LEU A 1 376 ? 72.186 116.517 -14.021 1.00 48.92  ? 373 LEU A O   1 
ATOM   2821 C CB  . LEU A 1 376 ? 69.873 114.188 -14.212 1.00 48.10  ? 373 LEU A CB  1 
ATOM   2822 C CG  . LEU A 1 376 ? 70.824 113.842 -15.360 1.00 51.26  ? 373 LEU A CG  1 
ATOM   2823 C CD1 . LEU A 1 376 ? 72.065 113.134 -14.839 1.00 53.82  ? 373 LEU A CD1 1 
ATOM   2824 C CD2 . LEU A 1 376 ? 70.117 112.996 -16.406 1.00 44.41  ? 373 LEU A CD2 1 
ATOM   2825 N N   . ALA A 1 377 ? 70.105 117.362 -14.218 1.00 48.36  ? 374 ALA A N   1 
ATOM   2826 C CA  . ALA A 1 377 ? 70.585 118.586 -14.851 1.00 42.61  ? 374 ALA A CA  1 
ATOM   2827 C C   . ALA A 1 377 ? 71.437 119.403 -13.892 1.00 38.60  ? 374 ALA A C   1 
ATOM   2828 O O   . ALA A 1 377 ? 72.467 119.963 -14.286 1.00 43.00  ? 374 ALA A O   1 
ATOM   2829 C CB  . ALA A 1 377 ? 69.405 119.413 -15.359 1.00 44.85  ? 374 ALA A CB  1 
ATOM   2830 N N   . ALA A 1 378 ? 71.024 119.482 -12.625 1.00 39.85  ? 375 ALA A N   1 
ATOM   2831 C CA  . ALA A 1 378 ? 71.820 120.193 -11.632 1.00 35.57  ? 375 ALA A CA  1 
ATOM   2832 C C   . ALA A 1 378 ? 73.173 119.524 -11.432 1.00 46.13  ? 375 ALA A C   1 
ATOM   2833 O O   . ALA A 1 378 ? 74.192 120.205 -11.263 1.00 45.23  ? 375 ALA A O   1 
ATOM   2834 C CB  . ALA A 1 378 ? 71.057 120.275 -10.311 1.00 38.53  ? 375 ALA A CB  1 
ATOM   2835 N N   . GLU A 1 379 ? 73.205 118.189 -11.454 1.00 51.72  ? 376 GLU A N   1 
ATOM   2836 C CA  . GLU A 1 379 ? 74.474 117.479 -11.336 1.00 47.86  ? 376 GLU A CA  1 
ATOM   2837 C C   . GLU A 1 379 ? 75.385 117.751 -12.526 1.00 43.79  ? 376 GLU A C   1 
ATOM   2838 O O   . GLU A 1 379 ? 76.610 117.812 -12.364 1.00 45.60  ? 376 GLU A O   1 
ATOM   2839 C CB  . GLU A 1 379 ? 74.226 115.978 -11.188 1.00 55.76  ? 376 GLU A CB  1 
ATOM   2840 C CG  . GLU A 1 379 ? 73.949 115.542 -9.761  1.00 65.38  ? 376 GLU A CG  1 
ATOM   2841 C CD  . GLU A 1 379 ? 75.198 115.540 -8.901  1.00 73.88  ? 376 GLU A CD  1 
ATOM   2842 O OE1 . GLU A 1 379 ? 76.311 115.505 -9.466  1.00 77.25  ? 376 GLU A OE1 1 
ATOM   2843 O OE2 . GLU A 1 379 ? 75.066 115.574 -7.660  1.00 79.17  ? 376 GLU A OE2 1 
ATOM   2844 N N   . ALA A 1 380 ? 74.814 117.913 -13.722 1.00 39.34  ? 377 ALA A N   1 
ATOM   2845 C CA  . ALA A 1 380 ? 75.622 118.294 -14.875 1.00 43.58  ? 377 ALA A CA  1 
ATOM   2846 C C   . ALA A 1 380 ? 76.211 119.687 -14.693 1.00 42.19  ? 377 ALA A C   1 
ATOM   2847 O O   . ALA A 1 380 ? 77.342 119.950 -15.120 1.00 44.48  ? 377 ALA A O   1 
ATOM   2848 C CB  . ALA A 1 380 ? 74.784 118.226 -16.151 1.00 48.27  ? 377 ALA A CB  1 
ATOM   2849 N N   . VAL A 1 381 ? 75.460 120.590 -14.059 1.00 43.26  ? 378 VAL A N   1 
ATOM   2850 C CA  . VAL A 1 381 ? 75.985 121.919 -13.766 1.00 37.50  ? 378 VAL A CA  1 
ATOM   2851 C C   . VAL A 1 381 ? 77.096 121.834 -12.727 1.00 36.44  ? 378 VAL A C   1 
ATOM   2852 O O   . VAL A 1 381 ? 78.127 122.508 -12.844 1.00 36.15  ? 378 VAL A O   1 
ATOM   2853 C CB  . VAL A 1 381 ? 74.849 122.851 -13.305 1.00 39.83  ? 378 VAL A CB  1 
ATOM   2854 C CG1 . VAL A 1 381 ? 75.392 124.237 -12.990 1.00 34.21  ? 378 VAL A CG1 1 
ATOM   2855 C CG2 . VAL A 1 381 ? 73.761 122.928 -14.364 1.00 35.16  ? 378 VAL A CG2 1 
ATOM   2856 N N   . VAL A 1 382 ? 76.907 121.003 -11.699 1.00 34.65  ? 379 VAL A N   1 
ATOM   2857 C CA  . VAL A 1 382 ? 77.921 120.862 -10.657 1.00 34.28  ? 379 VAL A CA  1 
ATOM   2858 C C   . VAL A 1 382 ? 79.204 120.279 -11.235 1.00 43.58  ? 379 VAL A C   1 
ATOM   2859 O O   . VAL A 1 382 ? 80.309 120.717 -10.893 1.00 42.18  ? 379 VAL A O   1 
ATOM   2860 C CB  . VAL A 1 382 ? 77.379 120.007 -9.495  1.00 32.12  ? 379 VAL A CB  1 
ATOM   2861 C CG1 . VAL A 1 382 ? 78.475 119.729 -8.478  1.00 38.67  ? 379 VAL A CG1 1 
ATOM   2862 C CG2 . VAL A 1 382 ? 76.202 120.705 -8.831  1.00 34.56  ? 379 VAL A CG2 1 
ATOM   2863 N N   . LEU A 1 383 ? 79.081 119.292 -12.126 1.00 42.17  ? 380 LEU A N   1 
ATOM   2864 C CA  . LEU A 1 383 ? 80.264 118.697 -12.743 1.00 36.61  ? 380 LEU A CA  1 
ATOM   2865 C C   . LEU A 1 383 ? 81.070 119.737 -13.511 1.00 44.16  ? 380 LEU A C   1 
ATOM   2866 O O   . LEU A 1 383 ? 82.297 119.815 -13.375 1.00 45.29  ? 380 LEU A O   1 
ATOM   2867 C CB  . LEU A 1 383 ? 79.856 117.557 -13.676 1.00 53.65  ? 380 LEU A CB  1 
ATOM   2868 C CG  . LEU A 1 383 ? 80.919 117.194 -14.720 1.00 55.16  ? 380 LEU A CG  1 
ATOM   2869 C CD1 . LEU A 1 383 ? 82.016 116.329 -14.113 1.00 41.08  ? 380 LEU A CD1 1 
ATOM   2870 C CD2 . LEU A 1 383 ? 80.299 116.526 -15.938 1.00 43.32  ? 380 LEU A CD2 1 
ATOM   2871 N N   . HIS A 1 384 ? 80.392 120.552 -14.321 1.00 39.80  ? 381 HIS A N   1 
ATOM   2872 C CA  . HIS A 1 384 ? 81.101 121.464 -15.211 1.00 41.62  ? 381 HIS A CA  1 
ATOM   2873 C C   . HIS A 1 384 ? 81.791 122.588 -14.450 1.00 36.57  ? 381 HIS A C   1 
ATOM   2874 O O   . HIS A 1 384 ? 82.828 123.089 -14.898 1.00 40.53  ? 381 HIS A O   1 
ATOM   2875 C CB  . HIS A 1 384 ? 80.137 122.046 -16.244 1.00 37.46  ? 381 HIS A CB  1 
ATOM   2876 C CG  . HIS A 1 384 ? 80.818 122.793 -17.347 1.00 39.76  ? 381 HIS A CG  1 
ATOM   2877 N ND1 . HIS A 1 384 ? 81.045 122.241 -18.590 1.00 38.53  ? 381 HIS A ND1 1 
ATOM   2878 C CD2 . HIS A 1 384 ? 81.334 124.044 -17.391 1.00 44.34  ? 381 HIS A CD2 1 
ATOM   2879 C CE1 . HIS A 1 384 ? 81.665 123.122 -19.354 1.00 53.86  ? 381 HIS A CE1 1 
ATOM   2880 N NE2 . HIS A 1 384 ? 81.854 124.224 -18.650 1.00 55.68  ? 381 HIS A NE2 1 
ATOM   2881 N N   . TYR A 1 385 ? 81.245 122.997 -13.307 1.00 33.27  ? 382 TYR A N   1 
ATOM   2882 C CA  . TYR A 1 385 ? 81.751 124.157 -12.586 1.00 42.66  ? 382 TYR A CA  1 
ATOM   2883 C C   . TYR A 1 385 ? 82.506 123.790 -11.316 1.00 40.12  ? 382 TYR A C   1 
ATOM   2884 O O   . TYR A 1 385 ? 82.863 124.685 -10.541 1.00 43.94  ? 382 TYR A O   1 
ATOM   2885 C CB  . TYR A 1 385 ? 80.602 125.116 -12.269 1.00 38.55  ? 382 TYR A CB  1 
ATOM   2886 C CG  . TYR A 1 385 ? 80.106 125.855 -13.488 1.00 34.16  ? 382 TYR A CG  1 
ATOM   2887 C CD1 . TYR A 1 385 ? 80.693 127.051 -13.881 1.00 33.86  ? 382 TYR A CD1 1 
ATOM   2888 C CD2 . TYR A 1 385 ? 79.064 125.352 -14.257 1.00 34.07  ? 382 TYR A CD2 1 
ATOM   2889 C CE1 . TYR A 1 385 ? 80.251 127.729 -14.998 1.00 30.52  ? 382 TYR A CE1 1 
ATOM   2890 C CE2 . TYR A 1 385 ? 78.615 126.024 -15.377 1.00 32.01  ? 382 TYR A CE2 1 
ATOM   2891 C CZ  . TYR A 1 385 ? 79.213 127.212 -15.743 1.00 30.56  ? 382 TYR A CZ  1 
ATOM   2892 O OH  . TYR A 1 385 ? 78.772 127.888 -16.856 1.00 39.55  ? 382 TYR A OH  1 
ATOM   2893 N N   . THR A 1 386 ? 82.770 122.508 -11.086 1.00 47.40  ? 383 THR A N   1 
ATOM   2894 C CA  . THR A 1 386 ? 83.566 122.068 -9.948  1.00 40.48  ? 383 THR A CA  1 
ATOM   2895 C C   . THR A 1 386 ? 85.001 121.834 -10.403 1.00 37.77  ? 383 THR A C   1 
ATOM   2896 O O   . THR A 1 386 ? 85.241 121.074 -11.348 1.00 49.86  ? 383 THR A O   1 
ATOM   2897 C CB  . THR A 1 386 ? 83.001 120.789 -9.329  1.00 36.41  ? 383 THR A CB  1 
ATOM   2898 O OG1 . THR A 1 386 ? 81.710 121.053 -8.765  1.00 41.84  ? 383 THR A OG1 1 
ATOM   2899 C CG2 . THR A 1 386 ? 83.931 120.267 -8.241  1.00 38.70  ? 383 THR A CG2 1 
ATOM   2900 N N   . ASP A 1 387 ? 85.946 122.494 -9.740  1.00 44.19  ? 384 ASP A N   1 
ATOM   2901 C CA  . ASP A 1 387 ? 87.355 122.144 -9.863  1.00 39.15  ? 384 ASP A CA  1 
ATOM   2902 C C   . ASP A 1 387 ? 87.591 120.915 -8.995  1.00 48.14  ? 384 ASP A C   1 
ATOM   2903 O O   . ASP A 1 387 ? 87.561 121.003 -7.765  1.00 46.51  ? 384 ASP A O   1 
ATOM   2904 C CB  . ASP A 1 387 ? 88.242 123.310 -9.434  1.00 41.22  ? 384 ASP A CB  1 
ATOM   2905 C CG  . ASP A 1 387 ? 89.714 123.083 -9.749  1.00 51.15  ? 384 ASP A CG  1 
ATOM   2906 O OD1 . ASP A 1 387 ? 90.432 124.084 -9.953  1.00 47.97  ? 384 ASP A OD1 1 
ATOM   2907 O OD2 . ASP A 1 387 ? 90.159 121.916 -9.795  1.00 49.96  ? 384 ASP A OD2 1 
ATOM   2908 N N   . TRP A 1 388 ? 87.812 119.766 -9.627  1.00 47.67  ? 385 TRP A N   1 
ATOM   2909 C CA  . TRP A 1 388 ? 87.907 118.525 -8.873  1.00 50.92  ? 385 TRP A CA  1 
ATOM   2910 C C   . TRP A 1 388 ? 89.269 118.321 -8.227  1.00 37.69  ? 385 TRP A C   1 
ATOM   2911 O O   . TRP A 1 388 ? 89.442 117.354 -7.477  1.00 46.12  ? 385 TRP A O   1 
ATOM   2912 C CB  . TRP A 1 388 ? 87.545 117.350 -9.781  1.00 46.66  ? 385 TRP A CB  1 
ATOM   2913 C CG  . TRP A 1 388 ? 86.123 117.442 -10.230 1.00 37.66  ? 385 TRP A CG  1 
ATOM   2914 C CD1 . TRP A 1 388 ? 85.668 117.894 -11.434 1.00 45.39  ? 385 TRP A CD1 1 
ATOM   2915 C CD2 . TRP A 1 388 ? 84.961 117.118 -9.458  1.00 30.04  ? 385 TRP A CD2 1 
ATOM   2916 N NE1 . TRP A 1 388 ? 84.295 117.849 -11.468 1.00 39.06  ? 385 TRP A NE1 1 
ATOM   2917 C CE2 . TRP A 1 388 ? 83.837 117.377 -10.266 1.00 35.07  ? 385 TRP A CE2 1 
ATOM   2918 C CE3 . TRP A 1 388 ? 84.764 116.623 -8.165  1.00 33.54  ? 385 TRP A CE3 1 
ATOM   2919 C CZ2 . TRP A 1 388 ? 82.534 117.158 -9.823  1.00 38.60  ? 385 TRP A CZ2 1 
ATOM   2920 C CZ3 . TRP A 1 388 ? 83.470 116.407 -7.727  1.00 34.61  ? 385 TRP A CZ3 1 
ATOM   2921 C CH2 . TRP A 1 388 ? 82.372 116.674 -8.554  1.00 34.84  ? 385 TRP A CH2 1 
ATOM   2922 N N   . LEU A 1 389 ? 90.232 119.205 -8.489  1.00 41.12  ? 386 LEU A N   1 
ATOM   2923 C CA  . LEU A 1 389 ? 91.439 119.258 -7.676  1.00 47.77  ? 386 LEU A CA  1 
ATOM   2924 C C   . LEU A 1 389 ? 91.235 120.066 -6.402  1.00 51.82  ? 386 LEU A C   1 
ATOM   2925 O O   . LEU A 1 389 ? 91.995 119.891 -5.444  1.00 61.59  ? 386 LEU A O   1 
ATOM   2926 C CB  . LEU A 1 389 ? 92.601 119.843 -8.482  1.00 49.14  ? 386 LEU A CB  1 
ATOM   2927 C CG  . LEU A 1 389 ? 93.485 118.833 -9.213  1.00 52.94  ? 386 LEU A CG  1 
ATOM   2928 C CD1 . LEU A 1 389 ? 94.530 119.544 -10.058 1.00 51.17  ? 386 LEU A CD1 1 
ATOM   2929 C CD2 . LEU A 1 389 ? 94.149 117.895 -8.217  1.00 50.64  ? 386 LEU A CD2 1 
ATOM   2930 N N   . HIS A 1 390 ? 90.231 120.944 -6.374  1.00 48.68  ? 387 HIS A N   1 
ATOM   2931 C CA  . HIS A 1 390 ? 89.889 121.721 -5.180  1.00 45.08  ? 387 HIS A CA  1 
ATOM   2932 C C   . HIS A 1 390 ? 88.371 121.815 -5.058  1.00 50.37  ? 387 HIS A C   1 
ATOM   2933 O O   . HIS A 1 390 ? 87.790 122.899 -5.154  1.00 43.44  ? 387 HIS A O   1 
ATOM   2934 C CB  . HIS A 1 390 ? 90.520 123.112 -5.239  1.00 36.95  ? 387 HIS A CB  1 
ATOM   2935 C CG  . HIS A 1 390 ? 91.958 123.110 -5.656  1.00 51.08  ? 387 HIS A CG  1 
ATOM   2936 N ND1 . HIS A 1 390 ? 92.984 122.793 -4.792  1.00 58.97  ? 387 HIS A ND1 1 
ATOM   2937 C CD2 . HIS A 1 390 ? 92.542 123.390 -6.845  1.00 49.09  ? 387 HIS A CD2 1 
ATOM   2938 C CE1 . HIS A 1 390 ? 94.137 122.876 -5.431  1.00 54.94  ? 387 HIS A CE1 1 
ATOM   2939 N NE2 . HIS A 1 390 ? 93.897 123.238 -6.679  1.00 56.08  ? 387 HIS A NE2 1 
ATOM   2940 N N   . PRO A 1 391 ? 87.692 120.683 -4.842  1.00 50.16  ? 388 PRO A N   1 
ATOM   2941 C CA  . PRO A 1 391 ? 86.220 120.708 -4.817  1.00 40.27  ? 388 PRO A CA  1 
ATOM   2942 C C   . PRO A 1 391 ? 85.638 121.343 -3.567  1.00 42.56  ? 388 PRO A C   1 
ATOM   2943 O O   . PRO A 1 391 ? 84.419 121.557 -3.517  1.00 46.93  ? 388 PRO A O   1 
ATOM   2944 C CB  . PRO A 1 391 ? 85.847 119.225 -4.908  1.00 44.20  ? 388 PRO A CB  1 
ATOM   2945 C CG  . PRO A 1 391 ? 86.980 118.531 -4.237  1.00 38.56  ? 388 PRO A CG  1 
ATOM   2946 C CD  . PRO A 1 391 ? 88.220 119.335 -4.561  1.00 49.16  ? 388 PRO A CD  1 
ATOM   2947 N N   . GLU A 1 392 ? 86.458 121.656 -2.565  1.00 45.69  ? 389 GLU A N   1 
ATOM   2948 C CA  . GLU A 1 392 ? 85.978 122.217 -1.311  1.00 49.69  ? 389 GLU A CA  1 
ATOM   2949 C C   . GLU A 1 392 ? 86.467 123.636 -1.057  1.00 42.08  ? 389 GLU A C   1 
ATOM   2950 O O   . GLU A 1 392 ? 86.063 124.240 -0.056  1.00 38.06  ? 389 GLU A O   1 
ATOM   2951 C CB  . GLU A 1 392 ? 86.397 121.323 -0.135  1.00 49.38  ? 389 GLU A CB  1 
ATOM   2952 C CG  . GLU A 1 392 ? 85.975 119.865 -0.262  1.00 55.11  ? 389 GLU A CG  1 
ATOM   2953 C CD  . GLU A 1 392 ? 84.513 119.644 0.074   1.00 63.62  ? 389 GLU A CD  1 
ATOM   2954 O OE1 . GLU A 1 392 ? 83.851 118.852 -0.629  1.00 68.81  ? 389 GLU A OE1 1 
ATOM   2955 O OE2 . GLU A 1 392 ? 84.025 120.263 1.044   1.00 66.50  ? 389 GLU A OE2 1 
ATOM   2956 N N   . ASP A 1 393 ? 87.318 124.182 -1.920  1.00 38.71  ? 390 ASP A N   1 
ATOM   2957 C CA  . ASP A 1 393 ? 87.879 125.510 -1.703  1.00 41.77  ? 390 ASP A CA  1 
ATOM   2958 C C   . ASP A 1 393 ? 86.774 126.560 -1.726  1.00 40.76  ? 390 ASP A C   1 
ATOM   2959 O O   . ASP A 1 393 ? 86.120 126.736 -2.765  1.00 38.93  ? 390 ASP A O   1 
ATOM   2960 C CB  . ASP A 1 393 ? 88.931 125.825 -2.764  1.00 36.38  ? 390 ASP A CB  1 
ATOM   2961 C CG  . ASP A 1 393 ? 89.645 127.139 -2.505  1.00 42.70  ? 390 ASP A CG  1 
ATOM   2962 O OD1 . ASP A 1 393 ? 89.723 127.555 -1.331  1.00 49.83  ? 390 ASP A OD1 1 
ATOM   2963 O OD2 . ASP A 1 393 ? 90.132 127.755 -3.476  1.00 57.63  ? 390 ASP A OD2 1 
ATOM   2964 N N   . PRO A 1 394 ? 86.532 127.271 -0.620  1.00 40.73  ? 391 PRO A N   1 
ATOM   2965 C CA  . PRO A 1 394 ? 85.416 128.234 -0.602  1.00 39.08  ? 391 PRO A CA  1 
ATOM   2966 C C   . PRO A 1 394 ? 85.548 129.339 -1.633  1.00 32.43  ? 391 PRO A C   1 
ATOM   2967 O O   . PRO A 1 394 ? 84.548 129.720 -2.256  1.00 29.04  ? 391 PRO A O   1 
ATOM   2968 C CB  . PRO A 1 394 ? 85.460 128.786 0.831   1.00 40.29  ? 391 PRO A CB  1 
ATOM   2969 C CG  . PRO A 1 394 ? 86.172 127.736 1.624   1.00 44.07  ? 391 PRO A CG  1 
ATOM   2970 C CD  . PRO A 1 394 ? 87.192 127.163 0.691   1.00 40.01  ? 391 PRO A CD  1 
ATOM   2971 N N   . ALA A 1 395 ? 86.758 129.866 -1.834  1.00 32.91  ? 392 ALA A N   1 
ATOM   2972 C CA  . ALA A 1 395 ? 86.948 130.942 -2.801  1.00 32.68  ? 392 ALA A CA  1 
ATOM   2973 C C   . ALA A 1 395 ? 86.570 130.489 -4.206  1.00 40.27  ? 392 ALA A C   1 
ATOM   2974 O O   . ALA A 1 395 ? 85.814 131.171 -4.907  1.00 43.25  ? 392 ALA A O   1 
ATOM   2975 C CB  . ALA A 1 395 ? 88.394 131.435 -2.761  1.00 30.70  ? 392 ALA A CB  1 
ATOM   2976 N N   . ARG A 1 396 ? 87.079 129.329 -4.630  1.00 40.04  ? 393 ARG A N   1 
ATOM   2977 C CA  . ARG A 1 396 ? 86.761 128.823 -5.962  1.00 36.32  ? 393 ARG A CA  1 
ATOM   2978 C C   . ARG A 1 396 ? 85.274 128.521 -6.103  1.00 35.72  ? 393 ARG A C   1 
ATOM   2979 O O   . ARG A 1 396 ? 84.679 128.780 -7.156  1.00 37.73  ? 393 ARG A O   1 
ATOM   2980 C CB  . ARG A 1 396 ? 87.592 127.577 -6.266  1.00 31.52  ? 393 ARG A CB  1 
ATOM   2981 C CG  . ARG A 1 396 ? 89.062 127.853 -6.537  1.00 42.82  ? 393 ARG A CG  1 
ATOM   2982 C CD  . ARG A 1 396 ? 89.780 126.584 -6.968  1.00 52.01  ? 393 ARG A CD  1 
ATOM   2983 N NE  . ARG A 1 396 ? 91.194 126.815 -7.251  1.00 54.56  ? 393 ARG A NE  1 
ATOM   2984 C CZ  . ARG A 1 396 ? 92.167 126.669 -6.357  1.00 51.86  ? 393 ARG A CZ  1 
ATOM   2985 N NH1 . ARG A 1 396 ? 91.881 126.291 -5.119  1.00 50.13  ? 393 ARG A NH1 1 
ATOM   2986 N NH2 . ARG A 1 396 ? 93.426 126.899 -6.702  1.00 37.24  ? 393 ARG A NH2 1 
ATOM   2987 N N   . LEU A 1 397 ? 84.656 127.970 -5.055  1.00 33.11  ? 394 LEU A N   1 
ATOM   2988 C CA  . LEU A 1 397 ? 83.219 127.717 -5.097  1.00 32.69  ? 394 LEU A CA  1 
ATOM   2989 C C   . LEU A 1 397 ? 82.427 129.012 -5.212  1.00 38.45  ? 394 LEU A C   1 
ATOM   2990 O O   . LEU A 1 397 ? 81.368 129.038 -5.850  1.00 35.97  ? 394 LEU A O   1 
ATOM   2991 C CB  . LEU A 1 397 ? 82.784 126.939 -3.854  1.00 26.58  ? 394 LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 397 ? 83.301 125.505 -3.729  1.00 36.53  ? 394 LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 397 ? 82.905 124.909 -2.388  1.00 37.42  ? 394 LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 397 ? 82.785 124.647 -4.873  1.00 25.11  ? 394 LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 398 ? 82.924 130.092 -4.605  1.00 34.07  ? 395 ARG A N   1 
ATOM   2996 C CA  . ARG A 1 398 ? 82.247 131.381 -4.702  1.00 37.56  ? 395 ARG A CA  1 
ATOM   2997 C C   . ARG A 1 398 ? 82.229 131.882 -6.141  1.00 37.12  ? 395 ARG A C   1 
ATOM   2998 O O   . ARG A 1 398 ? 81.177 132.269 -6.663  1.00 32.39  ? 395 ARG A O   1 
ATOM   2999 C CB  . ARG A 1 398 ? 82.929 132.393 -3.782  1.00 31.92  ? 395 ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 398 ? 82.293 133.771 -3.773  1.00 31.34  ? 395 ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 398 ? 83.152 134.736 -2.978  1.00 28.06  ? 395 ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 398 ? 84.485 134.858 -3.558  1.00 28.14  ? 395 ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 398 ? 85.559 135.265 -2.890  1.00 28.61  ? 395 ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 398 ? 85.463 135.581 -1.606  1.00 26.79  ? 395 ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 398 ? 86.732 135.346 -3.504  1.00 19.05  ? 395 ARG A NH2 1 
ATOM   3006 N N   . GLU A 1 399 ? 83.390 131.879 -6.802  1.00 32.05  ? 396 GLU A N   1 
ATOM   3007 C CA  . GLU A 1 399 ? 83.444 132.308 -8.195  1.00 34.66  ? 396 GLU A CA  1 
ATOM   3008 C C   . GLU A 1 399 ? 82.787 131.304 -9.131  1.00 32.03  ? 396 GLU A C   1 
ATOM   3009 O O   . GLU A 1 399 ? 82.376 131.682 -10.233 1.00 34.94  ? 396 GLU A O   1 
ATOM   3010 C CB  . GLU A 1 399 ? 84.894 132.547 -8.626  1.00 28.01  ? 396 GLU A CB  1 
ATOM   3011 C CG  . GLU A 1 399 ? 85.864 132.854 -7.490  1.00 41.68  ? 396 GLU A CG  1 
ATOM   3012 C CD  . GLU A 1 399 ? 85.758 134.275 -6.959  1.00 55.44  ? 396 GLU A CD  1 
ATOM   3013 O OE1 . GLU A 1 399 ? 86.778 134.796 -6.459  1.00 56.33  ? 396 GLU A OE1 1 
ATOM   3014 O OE2 . GLU A 1 399 ? 84.665 134.875 -7.038  1.00 56.91  ? 396 GLU A OE2 1 
ATOM   3015 N N   . ALA A 1 400 ? 82.677 130.039 -8.719  1.00 34.97  ? 397 ALA A N   1 
ATOM   3016 C CA  . ALA A 1 400 ? 82.012 129.044 -9.553  1.00 33.85  ? 397 ALA A CA  1 
ATOM   3017 C C   . ALA A 1 400 ? 80.518 129.327 -9.657  1.00 29.92  ? 397 ALA A C   1 
ATOM   3018 O O   . ALA A 1 400 ? 79.956 129.346 -10.758 1.00 32.68  ? 397 ALA A O   1 
ATOM   3019 C CB  . ALA A 1 400 ? 82.259 127.640 -8.998  1.00 35.84  ? 397 ALA A CB  1 
ATOM   3020 N N   . LEU A 1 401 ? 79.857 129.552 -8.517  1.00 32.03  ? 398 LEU A N   1 
ATOM   3021 C CA  . LEU A 1 401 ? 78.435 129.879 -8.547  1.00 34.84  ? 398 LEU A CA  1 
ATOM   3022 C C   . LEU A 1 401 ? 78.184 131.199 -9.261  1.00 29.83  ? 398 LEU A C   1 
ATOM   3023 O O   . LEU A 1 401 ? 77.156 131.355 -9.931  1.00 35.32  ? 398 LEU A O   1 
ATOM   3024 C CB  . LEU A 1 401 ? 77.870 129.927 -7.126  1.00 32.00  ? 398 LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 401 ? 76.345 130.025 -7.042  1.00 30.68  ? 398 LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 401 ? 75.700 128.854 -7.770  1.00 28.03  ? 398 LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 401 ? 75.878 130.084 -5.597  1.00 30.74  ? 398 LEU A CD2 1 
ATOM   3028 N N   . SER A 1 402 ? 79.104 132.158 -9.130  1.00 25.14  ? 399 SER A N   1 
ATOM   3029 C CA  . SER A 1 402 ? 78.997 133.393 -9.899  1.00 32.15  ? 399 SER A CA  1 
ATOM   3030 C C   . SER A 1 402 ? 79.040 133.113 -11.394 1.00 33.26  ? 399 SER A C   1 
ATOM   3031 O O   . SER A 1 402 ? 78.284 133.711 -12.169 1.00 30.25  ? 399 SER A O   1 
ATOM   3032 C CB  . SER A 1 402 ? 80.114 134.358 -9.500  1.00 27.85  ? 399 SER A CB  1 
ATOM   3033 O OG  . SER A 1 402 ? 80.192 135.450 -10.401 1.00 28.09  ? 399 SER A OG  1 
ATOM   3034 N N   . ASP A 1 403 ? 79.919 132.202 -11.819 1.00 36.98  ? 400 ASP A N   1 
ATOM   3035 C CA  . ASP A 1 403 ? 79.971 131.830 -13.228 1.00 33.82  ? 400 ASP A CA  1 
ATOM   3036 C C   . ASP A 1 403 ? 78.706 131.094 -13.651 1.00 34.14  ? 400 ASP A C   1 
ATOM   3037 O O   . ASP A 1 403 ? 78.224 131.276 -14.775 1.00 29.15  ? 400 ASP A O   1 
ATOM   3038 C CB  . ASP A 1 403 ? 81.207 130.974 -13.504 1.00 34.88  ? 400 ASP A CB  1 
ATOM   3039 C CG  . ASP A 1 403 ? 82.498 131.761 -13.392 1.00 36.61  ? 400 ASP A CG  1 
ATOM   3040 O OD1 . ASP A 1 403 ? 82.480 132.981 -13.659 1.00 46.24  ? 400 ASP A OD1 1 
ATOM   3041 O OD2 . ASP A 1 403 ? 83.534 131.158 -13.040 1.00 35.73  ? 400 ASP A OD2 1 
ATOM   3042 N N   . VAL A 1 404 ? 78.153 130.262 -12.765 1.00 31.61  ? 401 VAL A N   1 
ATOM   3043 C CA  . VAL A 1 404 ? 76.932 129.526 -13.090 1.00 34.46  ? 401 VAL A CA  1 
ATOM   3044 C C   . VAL A 1 404 ? 75.802 130.493 -13.423 1.00 36.75  ? 401 VAL A C   1 
ATOM   3045 O O   . VAL A 1 404 ? 75.129 130.361 -14.452 1.00 31.17  ? 401 VAL A O   1 
ATOM   3046 C CB  . VAL A 1 404 ? 76.542 128.588 -11.934 1.00 31.76  ? 401 VAL A CB  1 
ATOM   3047 C CG1 . VAL A 1 404 ? 75.160 128.001 -12.172 1.00 21.57  ? 401 VAL A CG1 1 
ATOM   3048 C CG2 . VAL A 1 404 ? 77.568 127.482 -11.776 1.00 30.52  ? 401 VAL A CG2 1 
ATOM   3049 N N   . VAL A 1 405 ? 75.584 131.484 -12.558 1.00 28.58  ? 402 VAL A N   1 
ATOM   3050 C CA  . VAL A 1 405 ? 74.496 132.431 -12.772 1.00 31.93  ? 402 VAL A CA  1 
ATOM   3051 C C   . VAL A 1 405 ? 74.799 133.341 -13.956 1.00 28.91  ? 402 VAL A C   1 
ATOM   3052 O O   . VAL A 1 405 ? 73.914 133.647 -14.765 1.00 27.92  ? 402 VAL A O   1 
ATOM   3053 C CB  . VAL A 1 405 ? 74.236 133.234 -11.485 1.00 36.07  ? 402 VAL A CB  1 
ATOM   3054 C CG1 . VAL A 1 405 ? 73.155 134.279 -11.714 1.00 26.45  ? 402 VAL A CG1 1 
ATOM   3055 C CG2 . VAL A 1 405 ? 73.848 132.297 -10.351 1.00 27.68  ? 402 VAL A CG2 1 
ATOM   3056 N N   . GLY A 1 406 ? 76.053 133.776 -14.088 1.00 28.82  ? 403 GLY A N   1 
ATOM   3057 C CA  . GLY A 1 406 ? 76.396 134.700 -15.157 1.00 24.33  ? 403 GLY A CA  1 
ATOM   3058 C C   . GLY A 1 406 ? 76.365 134.060 -16.532 1.00 30.69  ? 403 GLY A C   1 
ATOM   3059 O O   . GLY A 1 406 ? 75.900 134.671 -17.498 1.00 34.82  ? 403 GLY A O   1 
ATOM   3060 N N   . ASP A 1 407 ? 76.865 132.827 -16.644 1.00 35.13  ? 404 ASP A N   1 
ATOM   3061 C CA  . ASP A 1 407 ? 76.841 132.143 -17.933 1.00 26.88  ? 404 ASP A CA  1 
ATOM   3062 C C   . ASP A 1 407 ? 75.421 131.760 -18.327 1.00 28.23  ? 404 ASP A C   1 
ATOM   3063 O O   . ASP A 1 407 ? 75.016 131.954 -19.478 1.00 31.30  ? 404 ASP A O   1 
ATOM   3064 C CB  . ASP A 1 407 ? 77.734 130.902 -17.894 1.00 31.41  ? 404 ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 407 ? 79.179 131.232 -17.582 1.00 34.81  ? 404 ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 407 ? 79.570 132.405 -17.749 1.00 38.30  ? 404 ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 407 ? 79.923 130.317 -17.170 1.00 41.47  ? 404 ASP A OD2 1 
ATOM   3068 N N   . HIS A 1 408 ? 74.648 131.222 -17.380 1.00 29.70  ? 405 HIS A N   1 
ATOM   3069 C CA  . HIS A 1 408 ? 73.301 130.753 -17.688 1.00 32.16  ? 405 HIS A CA  1 
ATOM   3070 C C   . HIS A 1 408 ? 72.376 131.897 -18.084 1.00 36.29  ? 405 HIS A C   1 
ATOM   3071 O O   . HIS A 1 408 ? 71.501 131.719 -18.938 1.00 33.06  ? 405 HIS A O   1 
ATOM   3072 C CB  . HIS A 1 408 ? 72.736 129.998 -16.483 1.00 26.12  ? 405 HIS A CB  1 
ATOM   3073 C CG  . HIS A 1 408 ? 71.298 129.607 -16.625 1.00 27.37  ? 405 HIS A CG  1 
ATOM   3074 N ND1 . HIS A 1 408 ? 70.814 128.927 -17.721 1.00 35.67  ? 405 HIS A ND1 1 
ATOM   3075 C CD2 . HIS A 1 408 ? 70.242 129.789 -15.797 1.00 31.00  ? 405 HIS A CD2 1 
ATOM   3076 C CE1 . HIS A 1 408 ? 69.519 128.712 -17.566 1.00 37.34  ? 405 HIS A CE1 1 
ATOM   3077 N NE2 . HIS A 1 408 ? 69.147 129.225 -16.407 1.00 30.62  ? 405 HIS A NE2 1 
ATOM   3078 N N   . ASN A 1 409 ? 72.561 133.077 -17.493 1.00 33.10  ? 406 ASN A N   1 
ATOM   3079 C CA  . ASN A 1 409 ? 71.622 134.176 -17.670 1.00 34.48  ? 406 ASN A CA  1 
ATOM   3080 C C   . ASN A 1 409 ? 72.089 135.241 -18.652 1.00 25.53  ? 406 ASN A C   1 
ATOM   3081 O O   . ASN A 1 409 ? 71.247 135.878 -19.294 1.00 28.19  ? 406 ASN A O   1 
ATOM   3082 C CB  . ASN A 1 409 ? 71.329 134.840 -16.320 1.00 25.20  ? 406 ASN A CB  1 
ATOM   3083 C CG  . ASN A 1 409 ? 70.446 133.987 -15.431 1.00 28.59  ? 406 ASN A CG  1 
ATOM   3084 O OD1 . ASN A 1 409 ? 69.361 133.568 -15.833 1.00 30.47  ? 406 ASN A OD1 1 
ATOM   3085 N ND2 . ASN A 1 409 ? 70.913 133.716 -14.218 1.00 25.54  ? 406 ASN A ND2 1 
ATOM   3086 N N   . VAL A 1 410 ? 73.396 135.461 -18.792 1.00 29.73  ? 407 VAL A N   1 
ATOM   3087 C CA  . VAL A 1 410 ? 73.875 136.584 -19.592 1.00 23.58  ? 407 VAL A CA  1 
ATOM   3088 C C   . VAL A 1 410 ? 74.859 136.135 -20.665 1.00 30.02  ? 407 VAL A C   1 
ATOM   3089 O O   . VAL A 1 410 ? 74.592 136.285 -21.862 1.00 29.74  ? 407 VAL A O   1 
ATOM   3090 C CB  . VAL A 1 410 ? 74.517 137.662 -18.699 1.00 32.02  ? 407 VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 410 ? 75.066 138.790 -19.556 1.00 29.32  ? 407 VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 410 ? 73.510 138.197 -17.695 1.00 23.31  ? 407 VAL A CG2 1 
ATOM   3093 N N   . VAL A 1 411 ? 76.001 135.585 -20.243 1.00 30.62  ? 408 VAL A N   1 
ATOM   3094 C CA  . VAL A 1 411 ? 77.135 135.413 -21.151 1.00 27.93  ? 408 VAL A CA  1 
ATOM   3095 C C   . VAL A 1 411 ? 76.781 134.464 -22.292 1.00 32.75  ? 408 VAL A C   1 
ATOM   3096 O O   . VAL A 1 411 ? 77.079 134.734 -23.461 1.00 34.58  ? 408 VAL A O   1 
ATOM   3097 C CB  . VAL A 1 411 ? 78.372 134.924 -20.377 1.00 33.46  ? 408 VAL A CB  1 
ATOM   3098 C CG1 . VAL A 1 411 ? 79.570 134.815 -21.307 1.00 37.37  ? 408 VAL A CG1 1 
ATOM   3099 C CG2 . VAL A 1 411 ? 78.671 135.860 -19.217 1.00 33.32  ? 408 VAL A CG2 1 
ATOM   3100 N N   . CYS A 1 412 ? 76.147 133.344 -21.974 1.00 30.48  ? 409 CYS A N   1 
ATOM   3101 C CA  . CYS A 1 412 ? 75.848 132.354 -23.002 1.00 33.44  ? 409 CYS A CA  1 
ATOM   3102 C C   . CYS A 1 412 ? 74.628 132.727 -23.843 1.00 33.78  ? 409 CYS A C   1 
ATOM   3103 O O   . CYS A 1 412 ? 74.619 132.442 -25.048 1.00 37.33  ? 409 CYS A O   1 
ATOM   3104 C CB  . CYS A 1 412 ? 75.674 130.972 -22.371 1.00 31.21  ? 409 CYS A CB  1 
ATOM   3105 S SG  . CYS A 1 412 ? 77.180 130.403 -21.553 1.00 32.17  ? 409 CYS A SG  1 
ATOM   3106 N N   . PRO A 1 413 ? 73.578 133.341 -23.277 1.00 33.06  ? 410 PRO A N   1 
ATOM   3107 C CA  . PRO A 1 413 ? 72.537 133.899 -24.159 1.00 31.45  ? 410 PRO A CA  1 
ATOM   3108 C C   . PRO A 1 413 ? 73.071 134.957 -25.108 1.00 29.27  ? 410 PRO A C   1 
ATOM   3109 O O   . PRO A 1 413 ? 72.628 135.035 -26.261 1.00 27.56  ? 410 PRO A O   1 
ATOM   3110 C CB  . PRO A 1 413 ? 71.517 134.482 -23.172 1.00 28.90  ? 410 PRO A CB  1 
ATOM   3111 C CG  . PRO A 1 413 ? 71.684 133.678 -21.950 1.00 29.63  ? 410 PRO A CG  1 
ATOM   3112 C CD  . PRO A 1 413 ? 73.153 133.372 -21.864 1.00 29.25  ? 410 PRO A CD  1 
ATOM   3113 N N   . VAL A 1 414 ? 74.021 135.776 -24.652 1.00 30.33  ? 411 VAL A N   1 
ATOM   3114 C CA  . VAL A 1 414 ? 74.600 136.800 -25.516 1.00 30.76  ? 411 VAL A CA  1 
ATOM   3115 C C   . VAL A 1 414 ? 75.485 136.164 -26.581 1.00 39.00  ? 411 VAL A C   1 
ATOM   3116 O O   . VAL A 1 414 ? 75.438 136.548 -27.756 1.00 34.76  ? 411 VAL A O   1 
ATOM   3117 C CB  . VAL A 1 414 ? 75.373 137.832 -24.675 1.00 26.75  ? 411 VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 414 ? 76.268 138.680 -25.563 1.00 24.80  ? 411 VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 414 ? 74.408 138.716 -23.901 1.00 28.52  ? 411 VAL A CG2 1 
ATOM   3120 N N   . ALA A 1 415 ? 76.302 135.181 -26.192 1.00 35.21  ? 412 ALA A N   1 
ATOM   3121 C CA  . ALA A 1 415 ? 77.196 134.537 -27.151 1.00 28.93  ? 412 ALA A CA  1 
ATOM   3122 C C   . ALA A 1 415 ? 76.413 133.805 -28.232 1.00 33.83  ? 412 ALA A C   1 
ATOM   3123 O O   . ALA A 1 415 ? 76.791 133.834 -29.410 1.00 26.54  ? 412 ALA A O   1 
ATOM   3124 C CB  . ALA A 1 415 ? 78.140 133.577 -26.428 1.00 30.31  ? 412 ALA A CB  1 
ATOM   3125 N N   . GLN A 1 416 ? 75.318 133.141 -27.853 1.00 30.95  ? 413 GLN A N   1 
ATOM   3126 C CA  . GLN A 1 416 ? 74.489 132.461 -28.841 1.00 29.78  ? 413 GLN A CA  1 
ATOM   3127 C C   . GLN A 1 416 ? 73.875 133.454 -29.819 1.00 38.50  ? 413 GLN A C   1 
ATOM   3128 O O   . GLN A 1 416 ? 73.794 133.184 -31.023 1.00 36.30  ? 413 GLN A O   1 
ATOM   3129 C CB  . GLN A 1 416 ? 73.397 131.650 -28.142 1.00 34.40  ? 413 GLN A CB  1 
ATOM   3130 C CG  . GLN A 1 416 ? 72.545 130.815 -29.083 1.00 37.68  ? 413 GLN A CG  1 
ATOM   3131 C CD  . GLN A 1 416 ? 71.509 129.985 -28.350 1.00 51.03  ? 413 GLN A CD  1 
ATOM   3132 O OE1 . GLN A 1 416 ? 71.432 128.770 -28.528 1.00 66.28  ? 413 GLN A OE1 1 
ATOM   3133 N NE2 . GLN A 1 416 ? 70.702 130.640 -27.523 1.00 52.82  ? 413 GLN A NE2 1 
ATOM   3134 N N   . LEU A 1 417 ? 73.441 134.613 -29.318 1.00 43.76  ? 414 LEU A N   1 
ATOM   3135 C CA  . LEU A 1 417 ? 72.887 135.640 -30.193 1.00 35.68  ? 414 LEU A CA  1 
ATOM   3136 C C   . LEU A 1 417 ? 73.961 136.221 -31.105 1.00 30.81  ? 414 LEU A C   1 
ATOM   3137 O O   . LEU A 1 417 ? 73.743 136.383 -32.311 1.00 29.55  ? 414 LEU A O   1 
ATOM   3138 C CB  . LEU A 1 417 ? 72.234 136.742 -29.359 1.00 36.42  ? 414 LEU A CB  1 
ATOM   3139 C CG  . LEU A 1 417 ? 71.717 137.958 -30.131 1.00 35.91  ? 414 LEU A CG  1 
ATOM   3140 C CD1 . LEU A 1 417 ? 70.623 137.554 -31.106 1.00 35.00  ? 414 LEU A CD1 1 
ATOM   3141 C CD2 . LEU A 1 417 ? 71.221 139.031 -29.175 1.00 42.30  ? 414 LEU A CD2 1 
ATOM   3142 N N   . ALA A 1 418 ? 75.131 136.534 -30.543 1.00 30.73  ? 415 ALA A N   1 
ATOM   3143 C CA  . ALA A 1 418 ? 76.197 137.140 -31.336 1.00 30.88  ? 415 ALA A CA  1 
ATOM   3144 C C   . ALA A 1 418 ? 76.661 136.208 -32.449 1.00 41.57  ? 415 ALA A C   1 
ATOM   3145 O O   . ALA A 1 418 ? 76.998 136.661 -33.548 1.00 43.88  ? 415 ALA A O   1 
ATOM   3146 C CB  . ALA A 1 418 ? 77.368 137.524 -30.432 1.00 29.81  ? 415 ALA A CB  1 
ATOM   3147 N N   . GLY A 1 419 ? 76.682 134.900 -32.184 1.00 41.52  ? 416 GLY A N   1 
ATOM   3148 C CA  . GLY A 1 419 ? 77.085 133.958 -33.214 1.00 35.56  ? 416 GLY A CA  1 
ATOM   3149 C C   . GLY A 1 419 ? 76.049 133.814 -34.312 1.00 37.40  ? 416 GLY A C   1 
ATOM   3150 O O   . GLY A 1 419 ? 76.390 133.782 -35.498 1.00 40.58  ? 416 GLY A O   1 
ATOM   3151 N N   . ARG A 1 420 ? 74.770 133.729 -33.937 1.00 34.79  ? 417 ARG A N   1 
ATOM   3152 C CA  . ARG A 1 420 ? 73.716 133.587 -34.936 1.00 38.23  ? 417 ARG A CA  1 
ATOM   3153 C C   . ARG A 1 420 ? 73.568 134.852 -35.773 1.00 47.57  ? 417 ARG A C   1 
ATOM   3154 O O   . ARG A 1 420 ? 73.286 134.775 -36.974 1.00 50.95  ? 417 ARG A O   1 
ATOM   3155 C CB  . ARG A 1 420 ? 72.391 133.233 -34.260 1.00 34.80  ? 417 ARG A CB  1 
ATOM   3156 C CG  . ARG A 1 420 ? 72.283 131.782 -33.817 1.00 45.97  ? 417 ARG A CG  1 
ATOM   3157 C CD  . ARG A 1 420 ? 72.739 130.837 -34.918 1.00 54.68  ? 417 ARG A CD  1 
ATOM   3158 N NE  . ARG A 1 420 ? 72.049 129.552 -34.866 1.00 61.12  ? 417 ARG A NE  1 
ATOM   3159 C CZ  . ARG A 1 420 ? 71.092 129.186 -35.714 1.00 52.79  ? 417 ARG A CZ  1 
ATOM   3160 N NH1 . ARG A 1 420 ? 70.717 130.006 -36.686 1.00 49.14  ? 417 ARG A NH1 1 
ATOM   3161 N NH2 . ARG A 1 420 ? 70.515 127.998 -35.595 1.00 50.73  ? 417 ARG A NH2 1 
ATOM   3162 N N   . LEU A 1 421 ? 73.751 136.023 -35.160 1.00 45.56  ? 418 LEU A N   1 
ATOM   3163 C CA  . LEU A 1 421 ? 73.658 137.273 -35.909 1.00 45.67  ? 418 LEU A CA  1 
ATOM   3164 C C   . LEU A 1 421 ? 74.768 137.375 -36.947 1.00 42.30  ? 418 LEU A C   1 
ATOM   3165 O O   . LEU A 1 421 ? 74.511 137.672 -38.119 1.00 45.41  ? 418 LEU A O   1 
ATOM   3166 C CB  . LEU A 1 421 ? 73.707 138.467 -34.954 1.00 40.24  ? 418 LEU A CB  1 
ATOM   3167 C CG  . LEU A 1 421 ? 72.478 138.741 -34.085 1.00 40.73  ? 418 LEU A CG  1 
ATOM   3168 C CD1 . LEU A 1 421 ? 72.729 139.933 -33.175 1.00 33.20  ? 418 LEU A CD1 1 
ATOM   3169 C CD2 . LEU A 1 421 ? 71.250 138.974 -34.945 1.00 41.62  ? 418 LEU A CD2 1 
ATOM   3170 N N   . ALA A 1 422 ? 76.014 137.129 -36.532 1.00 36.75  ? 419 ALA A N   1 
ATOM   3171 C CA  . ALA A 1 422 ? 77.141 137.255 -37.450 1.00 41.39  ? 419 ALA A CA  1 
ATOM   3172 C C   . ALA A 1 422 ? 77.049 136.247 -38.588 1.00 44.65  ? 419 ALA A C   1 
ATOM   3173 O O   . ALA A 1 422 ? 77.332 136.579 -39.745 1.00 49.63  ? 419 ALA A O   1 
ATOM   3174 C CB  . ALA A 1 422 ? 78.456 137.085 -36.689 1.00 37.62  ? 419 ALA A CB  1 
ATOM   3175 N N   . ALA A 1 423 ? 76.648 135.015 -38.283 1.00 48.32  ? 420 ALA A N   1 
ATOM   3176 C CA  . ALA A 1 423 ? 76.560 133.964 -39.288 1.00 44.70  ? 420 ALA A CA  1 
ATOM   3177 C C   . ALA A 1 423 ? 75.338 134.094 -40.188 1.00 49.26  ? 420 ALA A C   1 
ATOM   3178 O O   . ALA A 1 423 ? 75.168 133.268 -41.092 1.00 61.11  ? 420 ALA A O   1 
ATOM   3179 C CB  . ALA A 1 423 ? 76.554 132.590 -38.612 1.00 38.37  ? 420 ALA A CB  1 
ATOM   3180 N N   . GLN A 1 424 ? 74.487 135.098 -39.972 1.00 49.00  ? 421 GLN A N   1 
ATOM   3181 C CA  . GLN A 1 424 ? 73.271 135.255 -40.762 1.00 46.18  ? 421 GLN A CA  1 
ATOM   3182 C C   . GLN A 1 424 ? 73.141 136.670 -41.316 1.00 45.52  ? 421 GLN A C   1 
ATOM   3183 O O   . GLN A 1 424 ? 72.029 137.152 -41.548 1.00 55.19  ? 421 GLN A O   1 
ATOM   3184 C CB  . GLN A 1 424 ? 72.038 134.874 -39.942 1.00 37.53  ? 421 GLN A CB  1 
ATOM   3185 C CG  . GLN A 1 424 ? 71.983 133.389 -39.601 1.00 45.99  ? 421 GLN A CG  1 
ATOM   3186 C CD  . GLN A 1 424 ? 70.976 133.065 -38.515 1.00 48.17  ? 421 GLN A CD  1 
ATOM   3187 O OE1 . GLN A 1 424 ? 71.118 132.076 -37.797 1.00 49.37  ? 421 GLN A OE1 1 
ATOM   3188 N NE2 . GLN A 1 424 ? 69.949 133.897 -38.392 1.00 47.28  ? 421 GLN A NE2 1 
ATOM   3189 N N   . GLY A 1 425 ? 74.269 137.348 -41.535 1.00 40.96  ? 422 GLY A N   1 
ATOM   3190 C CA  . GLY A 1 425 ? 74.307 138.590 -42.280 1.00 48.83  ? 422 GLY A CA  1 
ATOM   3191 C C   . GLY A 1 425 ? 74.654 139.823 -41.471 1.00 52.51  ? 422 GLY A C   1 
ATOM   3192 O O   . GLY A 1 425 ? 75.019 140.847 -42.063 1.00 47.13  ? 422 GLY A O   1 
ATOM   3193 N N   . ALA A 1 426 ? 74.554 139.765 -40.147 1.00 45.50  ? 423 ALA A N   1 
ATOM   3194 C CA  . ALA A 1 426 ? 74.779 140.951 -39.335 1.00 38.68  ? 423 ALA A CA  1 
ATOM   3195 C C   . ALA A 1 426 ? 76.264 141.170 -39.070 1.00 38.13  ? 423 ALA A C   1 
ATOM   3196 O O   . ALA A 1 426 ? 77.043 140.223 -38.934 1.00 43.96  ? 423 ALA A O   1 
ATOM   3197 C CB  . ALA A 1 426 ? 74.030 140.849 -38.007 1.00 43.66  ? 423 ALA A CB  1 
ATOM   3198 N N   . ARG A 1 427 ? 76.648 142.442 -39.006 1.00 38.87  ? 424 ARG A N   1 
ATOM   3199 C CA  . ARG A 1 427 ? 77.976 142.841 -38.562 1.00 38.66  ? 424 ARG A CA  1 
ATOM   3200 C C   . ARG A 1 427 ? 77.958 142.955 -37.043 1.00 45.24  ? 424 ARG A C   1 
ATOM   3201 O O   . ARG A 1 427 ? 77.188 143.745 -36.486 1.00 47.44  ? 424 ARG A O   1 
ATOM   3202 C CB  . ARG A 1 427 ? 78.383 144.168 -39.199 1.00 38.36  ? 424 ARG A CB  1 
ATOM   3203 C CG  . ARG A 1 427 ? 79.777 144.641 -38.831 1.00 48.01  ? 424 ARG A CG  1 
ATOM   3204 C CD  . ARG A 1 427 ? 80.841 143.815 -39.532 1.00 53.71  ? 424 ARG A CD  1 
ATOM   3205 N NE  . ARG A 1 427 ? 82.039 144.605 -39.798 1.00 64.75  ? 424 ARG A NE  1 
ATOM   3206 C CZ  . ARG A 1 427 ? 82.157 145.452 -40.815 1.00 74.34  ? 424 ARG A CZ  1 
ATOM   3207 N NH1 . ARG A 1 427 ? 81.149 145.621 -41.660 1.00 66.23  ? 424 ARG A NH1 1 
ATOM   3208 N NH2 . ARG A 1 427 ? 83.281 146.134 -40.988 1.00 83.43  ? 424 ARG A NH2 1 
ATOM   3209 N N   . VAL A 1 428 ? 78.795 142.167 -36.374 1.00 43.12  ? 425 VAL A N   1 
ATOM   3210 C CA  . VAL A 1 428 ? 78.771 142.053 -34.922 1.00 34.33  ? 425 VAL A CA  1 
ATOM   3211 C C   . VAL A 1 428 ? 80.135 142.431 -34.363 1.00 41.83  ? 425 VAL A C   1 
ATOM   3212 O O   . VAL A 1 428 ? 81.172 142.016 -34.893 1.00 44.99  ? 425 VAL A O   1 
ATOM   3213 C CB  . VAL A 1 428 ? 78.373 140.631 -34.474 1.00 30.26  ? 425 VAL A CB  1 
ATOM   3214 C CG1 . VAL A 1 428 ? 78.313 140.545 -32.956 1.00 39.01  ? 425 VAL A CG1 1 
ATOM   3215 C CG2 . VAL A 1 428 ? 77.039 140.235 -35.088 1.00 32.29  ? 425 VAL A CG2 1 
ATOM   3216 N N   . TYR A 1 429 ? 80.127 143.226 -33.296 1.00 35.65  ? 426 TYR A N   1 
ATOM   3217 C CA  . TYR A 1 429 ? 81.317 143.536 -32.517 1.00 35.27  ? 426 TYR A CA  1 
ATOM   3218 C C   . TYR A 1 429 ? 81.063 143.134 -31.071 1.00 34.20  ? 426 TYR A C   1 
ATOM   3219 O O   . TYR A 1 429 ? 80.004 143.445 -30.515 1.00 37.21  ? 426 TYR A O   1 
ATOM   3220 C CB  . TYR A 1 429 ? 81.673 145.022 -32.606 1.00 36.44  ? 426 TYR A CB  1 
ATOM   3221 C CG  . TYR A 1 429 ? 82.100 145.474 -33.984 1.00 44.17  ? 426 TYR A CG  1 
ATOM   3222 C CD1 . TYR A 1 429 ? 83.436 145.446 -34.362 1.00 42.55  ? 426 TYR A CD1 1 
ATOM   3223 C CD2 . TYR A 1 429 ? 81.168 145.933 -34.905 1.00 42.83  ? 426 TYR A CD2 1 
ATOM   3224 C CE1 . TYR A 1 429 ? 83.831 145.860 -35.621 1.00 48.93  ? 426 TYR A CE1 1 
ATOM   3225 C CE2 . TYR A 1 429 ? 81.553 146.349 -36.166 1.00 34.24  ? 426 TYR A CE2 1 
ATOM   3226 C CZ  . TYR A 1 429 ? 82.885 146.311 -36.519 1.00 47.42  ? 426 TYR A CZ  1 
ATOM   3227 O OH  . TYR A 1 429 ? 83.273 146.724 -37.773 1.00 46.15  ? 426 TYR A OH  1 
ATOM   3228 N N   . ALA A 1 430 ? 82.025 142.440 -30.470 1.00 40.66  ? 427 ALA A N   1 
ATOM   3229 C CA  . ALA A 1 430 ? 81.882 141.906 -29.125 1.00 33.16  ? 427 ALA A CA  1 
ATOM   3230 C C   . ALA A 1 430 ? 82.974 142.453 -28.216 1.00 33.83  ? 427 ALA A C   1 
ATOM   3231 O O   . ALA A 1 430 ? 84.093 142.729 -28.659 1.00 39.43  ? 427 ALA A O   1 
ATOM   3232 C CB  . ALA A 1 430 ? 81.927 140.373 -29.128 1.00 30.41  ? 427 ALA A CB  1 
ATOM   3233 N N   . TYR A 1 431 ? 82.637 142.604 -26.935 1.00 30.42  ? 428 TYR A N   1 
ATOM   3234 C CA  . TYR A 1 431 ? 83.569 143.117 -25.943 1.00 33.56  ? 428 TYR A CA  1 
ATOM   3235 C C   . TYR A 1 431 ? 83.347 142.404 -24.616 1.00 32.20  ? 428 TYR A C   1 
ATOM   3236 O O   . TYR A 1 431 ? 82.332 141.737 -24.400 1.00 31.56  ? 428 TYR A O   1 
ATOM   3237 C CB  . TYR A 1 431 ? 83.422 144.637 -25.756 1.00 35.97  ? 428 TYR A CB  1 
ATOM   3238 C CG  . TYR A 1 431 ? 82.123 145.069 -25.101 1.00 33.46  ? 428 TYR A CG  1 
ATOM   3239 C CD1 . TYR A 1 431 ? 81.990 145.094 -23.716 1.00 33.82  ? 428 TYR A CD1 1 
ATOM   3240 C CD2 . TYR A 1 431 ? 81.036 145.468 -25.868 1.00 36.42  ? 428 TYR A CD2 1 
ATOM   3241 C CE1 . TYR A 1 431 ? 80.809 145.485 -23.117 1.00 35.50  ? 428 TYR A CE1 1 
ATOM   3242 C CE2 . TYR A 1 431 ? 79.851 145.866 -25.276 1.00 32.76  ? 428 TYR A CE2 1 
ATOM   3243 C CZ  . TYR A 1 431 ? 79.744 145.872 -23.901 1.00 32.98  ? 428 TYR A CZ  1 
ATOM   3244 O OH  . TYR A 1 431 ? 78.567 146.264 -23.307 1.00 31.05  ? 428 TYR A OH  1 
ATOM   3245 N N   . VAL A 1 432 ? 84.319 142.563 -23.720 1.00 31.00  ? 429 VAL A N   1 
ATOM   3246 C CA  . VAL A 1 432 ? 84.197 142.167 -22.322 1.00 29.90  ? 429 VAL A CA  1 
ATOM   3247 C C   . VAL A 1 432 ? 84.754 143.303 -21.477 1.00 37.61  ? 429 VAL A C   1 
ATOM   3248 O O   . VAL A 1 432 ? 85.908 143.709 -21.662 1.00 32.34  ? 429 VAL A O   1 
ATOM   3249 C CB  . VAL A 1 432 ? 84.928 140.849 -22.015 1.00 34.60  ? 429 VAL A CB  1 
ATOM   3250 C CG1 . VAL A 1 432 ? 85.069 140.661 -20.514 1.00 32.88  ? 429 VAL A CG1 1 
ATOM   3251 C CG2 . VAL A 1 432 ? 84.174 139.678 -22.614 1.00 38.12  ? 429 VAL A CG2 1 
ATOM   3252 N N   . PHE A 1 433 ? 83.936 143.821 -20.565 1.00 30.51  ? 430 PHE A N   1 
ATOM   3253 C CA  . PHE A 1 433 ? 84.317 144.939 -19.712 1.00 28.39  ? 430 PHE A CA  1 
ATOM   3254 C C   . PHE A 1 433 ? 85.015 144.402 -18.468 1.00 30.89  ? 430 PHE A C   1 
ATOM   3255 O O   . PHE A 1 433 ? 84.411 143.661 -17.684 1.00 29.71  ? 430 PHE A O   1 
ATOM   3256 C CB  . PHE A 1 433 ? 83.083 145.758 -19.337 1.00 34.22  ? 430 PHE A CB  1 
ATOM   3257 C CG  . PHE A 1 433 ? 83.398 147.105 -18.760 1.00 32.41  ? 430 PHE A CG  1 
ATOM   3258 C CD1 . PHE A 1 433 ? 83.614 148.191 -19.590 1.00 23.50  ? 430 PHE A CD1 1 
ATOM   3259 C CD2 . PHE A 1 433 ? 83.468 147.289 -17.390 1.00 23.95  ? 430 PHE A CD2 1 
ATOM   3260 C CE1 . PHE A 1 433 ? 83.900 149.434 -19.066 1.00 30.32  ? 430 PHE A CE1 1 
ATOM   3261 C CE2 . PHE A 1 433 ? 83.753 148.531 -16.860 1.00 39.20  ? 430 PHE A CE2 1 
ATOM   3262 C CZ  . PHE A 1 433 ? 83.970 149.605 -17.699 1.00 32.96  ? 430 PHE A CZ  1 
ATOM   3263 N N   . GLU A 1 434 ? 86.283 144.780 -18.284 1.00 36.46  ? 431 GLU A N   1 
ATOM   3264 C CA  . GLU A 1 434 ? 87.115 144.209 -17.229 1.00 34.11  ? 431 GLU A CA  1 
ATOM   3265 C C   . GLU A 1 434 ? 87.720 145.262 -16.307 1.00 37.40  ? 431 GLU A C   1 
ATOM   3266 O O   . GLU A 1 434 ? 88.744 144.997 -15.670 1.00 47.39  ? 431 GLU A O   1 
ATOM   3267 C CB  . GLU A 1 434 ? 88.232 143.355 -17.831 1.00 37.40  ? 431 GLU A CB  1 
ATOM   3268 C CG  . GLU A 1 434 ? 87.757 142.230 -18.723 1.00 43.82  ? 431 GLU A CG  1 
ATOM   3269 C CD  . GLU A 1 434 ? 88.862 141.245 -19.041 1.00 47.93  ? 431 GLU A CD  1 
ATOM   3270 O OE1 . GLU A 1 434 ? 88.578 140.030 -19.104 1.00 48.43  ? 431 GLU A OE1 1 
ATOM   3271 O OE2 . GLU A 1 434 ? 90.018 141.685 -19.215 1.00 42.54  ? 431 GLU A OE2 1 
ATOM   3272 N N   . HIS A 1 435 ? 87.124 146.446 -16.213 1.00 35.68  ? 432 HIS A N   1 
ATOM   3273 C CA  . HIS A 1 435 ? 87.611 147.476 -15.304 1.00 35.40  ? 432 HIS A CA  1 
ATOM   3274 C C   . HIS A 1 435 ? 86.641 147.624 -14.141 1.00 35.97  ? 432 HIS A C   1 
ATOM   3275 O O   . HIS A 1 435 ? 85.453 147.895 -14.348 1.00 42.41  ? 432 HIS A O   1 
ATOM   3276 C CB  . HIS A 1 435 ? 87.793 148.819 -16.008 1.00 34.74  ? 432 HIS A CB  1 
ATOM   3277 C CG  . HIS A 1 435 ? 88.204 149.923 -15.082 1.00 35.99  ? 432 HIS A CG  1 
ATOM   3278 N ND1 . HIS A 1 435 ? 89.384 149.895 -14.371 1.00 35.31  ? 432 HIS A ND1 1 
ATOM   3279 C CD2 . HIS A 1 435 ? 87.582 151.073 -14.733 1.00 34.20  ? 432 HIS A CD2 1 
ATOM   3280 C CE1 . HIS A 1 435 ? 89.477 150.987 -13.633 1.00 28.35  ? 432 HIS A CE1 1 
ATOM   3281 N NE2 . HIS A 1 435 ? 88.396 151.718 -13.834 1.00 39.25  ? 432 HIS A NE2 1 
ATOM   3282 N N   . ARG A 1 436 ? 87.149 147.448 -12.927 1.00 31.94  ? 433 ARG A N   1 
ATOM   3283 C CA  . ARG A 1 436 ? 86.380 147.701 -11.717 1.00 35.51  ? 433 ARG A CA  1 
ATOM   3284 C C   . ARG A 1 436 ? 86.585 149.154 -11.308 1.00 39.19  ? 433 ARG A C   1 
ATOM   3285 O O   . ARG A 1 436 ? 87.722 149.586 -11.086 1.00 34.50  ? 433 ARG A O   1 
ATOM   3286 C CB  . ARG A 1 436 ? 86.805 146.755 -10.595 1.00 32.58  ? 433 ARG A CB  1 
ATOM   3287 C CG  . ARG A 1 436 ? 86.175 147.073 -9.250  1.00 31.57  ? 433 ARG A CG  1 
ATOM   3288 C CD  . ARG A 1 436 ? 86.706 146.157 -8.161  1.00 33.59  ? 433 ARG A CD  1 
ATOM   3289 N NE  . ARG A 1 436 ? 86.271 146.580 -6.833  1.00 28.73  ? 433 ARG A NE  1 
ATOM   3290 C CZ  . ARG A 1 436 ? 85.188 146.120 -6.215  1.00 38.78  ? 433 ARG A CZ  1 
ATOM   3291 N NH1 . ARG A 1 436 ? 84.421 145.212 -6.804  1.00 34.83  ? 433 ARG A NH1 1 
ATOM   3292 N NH2 . ARG A 1 436 ? 84.874 146.567 -5.007  1.00 29.32  ? 433 ARG A NH2 1 
ATOM   3293 N N   . ALA A 1 437 ? 85.488 149.904 -11.220 1.00 33.48  ? 434 ALA A N   1 
ATOM   3294 C CA  . ALA A 1 437 ? 85.570 151.322 -10.898 1.00 35.10  ? 434 ALA A CA  1 
ATOM   3295 C C   . ALA A 1 437 ? 86.242 151.533 -9.547  1.00 33.56  ? 434 ALA A C   1 
ATOM   3296 O O   . ALA A 1 437 ? 86.017 150.780 -8.596  1.00 42.08  ? 434 ALA A O   1 
ATOM   3297 C CB  . ALA A 1 437 ? 84.175 151.947 -10.897 1.00 33.69  ? 434 ALA A CB  1 
ATOM   3298 N N   . SER A 1 438 ? 87.081 152.570 -9.473  1.00 33.19  ? 435 SER A N   1 
ATOM   3299 C CA  . SER A 1 438 ? 87.796 152.874 -8.239  1.00 32.74  ? 435 SER A CA  1 
ATOM   3300 C C   . SER A 1 438 ? 86.862 153.302 -7.116  1.00 36.52  ? 435 SER A C   1 
ATOM   3301 O O   . SER A 1 438 ? 87.234 153.195 -5.943  1.00 34.76  ? 435 SER A O   1 
ATOM   3302 C CB  . SER A 1 438 ? 88.837 153.965 -8.493  1.00 32.80  ? 435 SER A CB  1 
ATOM   3303 O OG  . SER A 1 438 ? 88.225 155.150 -8.976  1.00 41.18  ? 435 SER A OG  1 
ATOM   3304 N N   . THR A 1 439 ? 85.664 153.781 -7.444  1.00 34.31  ? 436 THR A N   1 
ATOM   3305 C CA  . THR A 1 439 ? 84.696 154.230 -6.455  1.00 40.22  ? 436 THR A CA  1 
ATOM   3306 C C   . THR A 1 439 ? 83.605 153.201 -6.192  1.00 39.10  ? 436 THR A C   1 
ATOM   3307 O O   . THR A 1 439 ? 82.586 153.538 -5.581  1.00 35.88  ? 436 THR A O   1 
ATOM   3308 C CB  . THR A 1 439 ? 84.066 155.550 -6.899  1.00 41.22  ? 436 THR A CB  1 
ATOM   3309 O OG1 . THR A 1 439 ? 83.515 155.397 -8.213  1.00 34.92  ? 436 THR A OG1 1 
ATOM   3310 C CG2 . THR A 1 439 ? 85.110 156.655 -6.919  1.00 38.86  ? 436 THR A CG2 1 
ATOM   3311 N N   . LEU A 1 440 ? 83.796 151.960 -6.631  1.00 32.37  ? 437 LEU A N   1 
ATOM   3312 C CA  . LEU A 1 440 ? 82.761 150.943 -6.499  1.00 41.75  ? 437 LEU A CA  1 
ATOM   3313 C C   . LEU A 1 440 ? 82.530 150.597 -5.032  1.00 35.53  ? 437 LEU A C   1 
ATOM   3314 O O   . LEU A 1 440 ? 83.477 150.317 -4.291  1.00 34.83  ? 437 LEU A O   1 
ATOM   3315 C CB  . LEU A 1 440 ? 83.149 149.696 -7.289  1.00 40.89  ? 437 LEU A CB  1 
ATOM   3316 C CG  . LEU A 1 440 ? 82.076 148.622 -7.448  1.00 40.92  ? 437 LEU A CG  1 
ATOM   3317 C CD1 . LEU A 1 440 ? 80.757 149.253 -7.855  1.00 34.14  ? 437 LEU A CD1 1 
ATOM   3318 C CD2 . LEU A 1 440 ? 82.522 147.606 -8.480  1.00 41.28  ? 437 LEU A CD2 1 
ATOM   3319 N N   . SER A 1 441 ? 81.262 150.613 -4.617  1.00 31.44  ? 438 SER A N   1 
ATOM   3320 C CA  . SER A 1 441 ? 80.904 150.364 -3.228  1.00 36.15  ? 438 SER A CA  1 
ATOM   3321 C C   . SER A 1 441 ? 80.646 148.894 -2.925  1.00 27.25  ? 438 SER A C   1 
ATOM   3322 O O   . SER A 1 441 ? 80.658 148.508 -1.751  1.00 29.85  ? 438 SER A O   1 
ATOM   3323 C CB  . SER A 1 441 ? 79.668 151.186 -2.848  1.00 26.19  ? 438 SER A CB  1 
ATOM   3324 O OG  . SER A 1 441 ? 78.591 150.929 -3.731  1.00 30.96  ? 438 SER A OG  1 
ATOM   3325 N N   . TRP A 1 442 ? 80.409 148.071 -3.945  1.00 32.57  ? 439 TRP A N   1 
ATOM   3326 C CA  . TRP A 1 442 ? 80.228 146.645 -3.734  1.00 31.87  ? 439 TRP A CA  1 
ATOM   3327 C C   . TRP A 1 442 ? 81.542 146.009 -3.284  1.00 29.60  ? 439 TRP A C   1 
ATOM   3328 O O   . TRP A 1 442 ? 82.623 146.538 -3.558  1.00 27.04  ? 439 TRP A O   1 
ATOM   3329 C CB  . TRP A 1 442 ? 79.719 145.980 -5.011  1.00 21.53  ? 439 TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 442 ? 78.276 146.270 -5.300  1.00 25.50  ? 439 TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 442 ? 77.785 147.130 -6.237  1.00 28.65  ? 439 TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 442 ? 77.137 145.703 -4.639  1.00 34.66  ? 439 TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 442 ? 76.411 147.132 -6.205  1.00 28.64  ? 439 TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 442 ? 75.989 146.264 -5.232  1.00 35.90  ? 439 TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 442 ? 76.976 144.776 -3.604  1.00 32.28  ? 439 TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 442 ? 74.700 145.930 -4.825  1.00 30.49  ? 439 TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 442 ? 75.695 144.443 -3.204  1.00 23.92  ? 439 TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 442 ? 74.573 145.018 -3.813  1.00 31.76  ? 439 TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 443 ? 81.476 144.875 -2.583  1.00 34.15  ? 440 PRO A N   1 
ATOM   3340 C CA  . PRO A 1 443 ? 82.703 144.255 -2.069  1.00 30.95  ? 440 PRO A CA  1 
ATOM   3341 C C   . PRO A 1 443 ? 83.645 143.835 -3.188  1.00 32.16  ? 440 PRO A C   1 
ATOM   3342 O O   . PRO A 1 443 ? 83.259 143.689 -4.350  1.00 35.64  ? 440 PRO A O   1 
ATOM   3343 C CB  . PRO A 1 443 ? 82.190 143.039 -1.286  1.00 26.35  ? 440 PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 443 ? 80.838 142.765 -1.853  1.00 33.90  ? 440 PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 443 ? 80.278 144.112 -2.192  1.00 34.01  ? 440 PRO A CD  1 
ATOM   3346 N N   . LEU A 1 444 ? 84.910 143.636 -2.809  1.00 36.12  ? 441 LEU A N   1 
ATOM   3347 C CA  . LEU A 1 444 ? 85.948 143.335 -3.790  1.00 35.73  ? 441 LEU A CA  1 
ATOM   3348 C C   . LEU A 1 444 ? 85.749 141.968 -4.433  1.00 34.27  ? 441 LEU A C   1 
ATOM   3349 O O   . LEU A 1 444 ? 86.131 141.774 -5.593  1.00 40.25  ? 441 LEU A O   1 
ATOM   3350 C CB  . LEU A 1 444 ? 87.325 143.421 -3.129  1.00 36.84  ? 441 LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 444 ? 88.561 143.174 -3.998  1.00 45.98  ? 441 LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 444 ? 88.575 144.101 -5.204  1.00 40.48  ? 441 LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 444 ? 89.829 143.345 -3.176  1.00 42.29  ? 441 LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 445 ? 85.151 141.013 -3.713  1.00 30.60  ? 442 TRP A N   1 
ATOM   3355 C CA  . TRP A 1 445 ? 84.998 139.673 -4.268  1.00 36.63  ? 442 TRP A CA  1 
ATOM   3356 C C   . TRP A 1 445 ? 84.008 139.630 -5.425  1.00 42.88  ? 442 TRP A C   1 
ATOM   3357 O O   . TRP A 1 445 ? 83.998 138.649 -6.176  1.00 46.79  ? 442 TRP A O   1 
ATOM   3358 C CB  . TRP A 1 445 ? 84.577 138.675 -3.182  1.00 26.75  ? 442 TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 445 ? 83.218 138.905 -2.569  1.00 36.74  ? 442 TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 445 ? 82.953 139.504 -1.371  1.00 39.84  ? 442 TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 445 ? 81.946 138.513 -3.109  1.00 29.67  ? 442 TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 445 ? 81.599 139.519 -1.136  1.00 33.41  ? 442 TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 445 ? 80.958 138.918 -2.188  1.00 25.95  ? 442 TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 445 ? 81.546 137.865 -4.283  1.00 29.07  ? 442 TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 445 ? 79.599 138.699 -2.405  1.00 24.10  ? 442 TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 445 ? 80.196 137.649 -4.497  1.00 27.69  ? 442 TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 445 ? 79.239 138.065 -3.562  1.00 27.26  ? 442 TRP A CH2 1 
ATOM   3368 N N   . MET A 1 446 ? 83.181 140.661 -5.589  1.00 37.41  ? 443 MET A N   1 
ATOM   3369 C CA  . MET A 1 446 ? 82.264 140.706 -6.719  1.00 34.11  ? 443 MET A CA  1 
ATOM   3370 C C   . MET A 1 446 ? 82.953 141.068 -8.030  1.00 35.46  ? 443 MET A C   1 
ATOM   3371 O O   . MET A 1 446 ? 82.343 140.907 -9.092  1.00 35.20  ? 443 MET A O   1 
ATOM   3372 C CB  . MET A 1 446 ? 81.132 141.697 -6.445  1.00 35.02  ? 443 MET A CB  1 
ATOM   3373 C CG  . MET A 1 446 ? 80.056 141.159 -5.517  1.00 31.11  ? 443 MET A CG  1 
ATOM   3374 S SD  . MET A 1 446 ? 78.681 142.305 -5.322  1.00 39.87  ? 443 MET A SD  1 
ATOM   3375 C CE  . MET A 1 446 ? 77.531 141.291 -4.399  1.00 28.19  ? 443 MET A CE  1 
ATOM   3376 N N   . GLY A 1 447 ? 84.198 141.544 -7.982  1.00 39.12  ? 444 GLY A N   1 
ATOM   3377 C CA  . GLY A 1 447 ? 84.931 141.916 -9.175  1.00 34.65  ? 444 GLY A CA  1 
ATOM   3378 C C   . GLY A 1 447 ? 84.309 143.053 -9.960  1.00 38.57  ? 444 GLY A C   1 
ATOM   3379 O O   . GLY A 1 447 ? 84.149 144.162 -9.438  1.00 41.53  ? 444 GLY A O   1 
ATOM   3380 N N   . VAL A 1 448 ? 83.964 142.791 -11.217 1.00 36.82  ? 445 VAL A N   1 
ATOM   3381 C CA  . VAL A 1 448 ? 83.280 143.770 -12.057 1.00 30.01  ? 445 VAL A CA  1 
ATOM   3382 C C   . VAL A 1 448 ? 81.818 143.353 -12.165 1.00 28.79  ? 445 VAL A C   1 
ATOM   3383 O O   . VAL A 1 448 ? 81.458 142.588 -13.072 1.00 28.96  ? 445 VAL A O   1 
ATOM   3384 C CB  . VAL A 1 448 ? 83.942 143.880 -13.440 1.00 37.49  ? 445 VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 448 ? 83.400 145.087 -14.198 1.00 28.13  ? 445 VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 448 ? 85.454 143.965 -13.301 1.00 32.30  ? 445 VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 449 ? 80.947 143.825 -11.276 1.00 34.72  ? 446 PRO A N   1 
ATOM   3388 C CA  . PRO A 1 449 ? 79.581 143.297 -11.222 1.00 30.08  ? 446 PRO A CA  1 
ATOM   3389 C C   . PRO A 1 449 ? 78.749 143.750 -12.412 1.00 30.97  ? 446 PRO A C   1 
ATOM   3390 O O   . PRO A 1 449 ? 79.117 144.638 -13.183 1.00 30.04  ? 446 PRO A O   1 
ATOM   3391 C CB  . PRO A 1 449 ? 79.022 143.864 -9.911  1.00 24.45  ? 446 PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 449 ? 80.214 144.395 -9.162  1.00 33.30  ? 446 PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 449 ? 81.186 144.815 -10.217 1.00 29.20  ? 446 PRO A CD  1 
ATOM   3394 N N   . HIS A 1 450 ? 77.592 143.107 -12.538 1.00 38.23  ? 447 HIS A N   1 
ATOM   3395 C CA  . HIS A 1 450 ? 76.641 143.435 -13.589 1.00 27.83  ? 447 HIS A CA  1 
ATOM   3396 C C   . HIS A 1 450 ? 76.138 144.864 -13.431 1.00 29.93  ? 447 HIS A C   1 
ATOM   3397 O O   . HIS A 1 450 ? 75.711 145.270 -12.347 1.00 35.09  ? 447 HIS A O   1 
ATOM   3398 C CB  . HIS A 1 450 ? 75.474 142.447 -13.542 1.00 31.20  ? 447 HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 450 ? 74.324 142.815 -14.426 1.00 36.04  ? 447 HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 450 ? 74.241 142.420 -15.743 1.00 30.69  ? 447 HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 450 ? 73.202 143.531 -14.176 1.00 36.13  ? 447 HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 450 ? 73.121 142.881 -16.269 1.00 41.14  ? 447 HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 450 ? 72.472 143.559 -15.339 1.00 46.41  ? 447 HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 451 ? 76.201 145.631 -14.518 1.00 35.39  ? 448 GLY A N   1 
ATOM   3405 C CA  . GLY A 1 451 ? 75.653 146.971 -14.547 1.00 35.69  ? 448 GLY A CA  1 
ATOM   3406 C C   . GLY A 1 451 ? 76.639 148.094 -14.326 1.00 35.29  ? 448 GLY A C   1 
ATOM   3407 O O   . GLY A 1 451 ? 76.245 149.262 -14.419 1.00 37.81  ? 448 GLY A O   1 
ATOM   3408 N N   . TYR A 1 452 ? 77.906 147.791 -14.048 1.00 24.76  ? 449 TYR A N   1 
ATOM   3409 C CA  . TYR A 1 452 ? 78.865 148.820 -13.667 1.00 24.57  ? 449 TYR A CA  1 
ATOM   3410 C C   . TYR A 1 452 ? 79.846 149.156 -14.784 1.00 24.98  ? 449 TYR A C   1 
ATOM   3411 O O   . TYR A 1 452 ? 80.957 149.625 -14.515 1.00 26.56  ? 449 TYR A O   1 
ATOM   3412 C CB  . TYR A 1 452 ? 79.584 148.409 -12.384 1.00 21.25  ? 449 TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 452 ? 78.648 148.525 -11.208 1.00 34.00  ? 449 TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 452 ? 78.495 149.732 -10.540 1.00 31.43  ? 449 TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 452 ? 77.869 147.448 -10.804 1.00 25.00  ? 449 TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 452 ? 77.622 149.855 -9.480  1.00 34.17  ? 449 TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 452 ? 76.992 147.562 -9.745  1.00 30.11  ? 449 TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 452 ? 76.872 148.768 -9.086  1.00 29.45  ? 449 TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 452 ? 76.001 148.890 -8.029  1.00 34.22  ? 449 TYR A OH  1 
ATOM   3420 N N   . GLU A 1 453 ? 79.449 148.931 -16.034 1.00 25.90  ? 450 GLU A N   1 
ATOM   3421 C CA  . GLU A 1 453 ? 80.064 149.575 -17.184 1.00 36.52  ? 450 GLU A CA  1 
ATOM   3422 C C   . GLU A 1 453 ? 79.259 150.773 -17.665 1.00 35.11  ? 450 GLU A C   1 
ATOM   3423 O O   . GLU A 1 453 ? 79.760 151.551 -18.483 1.00 32.92  ? 450 GLU A O   1 
ATOM   3424 C CB  . GLU A 1 453 ? 80.221 148.575 -18.339 1.00 20.23  ? 450 GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 453 ? 79.013 148.484 -19.273 1.00 21.35  ? 450 GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 453 ? 77.817 147.771 -18.657 1.00 26.82  ? 450 GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 453 ? 77.857 147.438 -17.453 1.00 28.80  ? 450 GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 453 ? 76.830 147.536 -19.387 1.00 30.37  ? 450 GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 454 ? 78.031 150.936 -17.164 1.00 27.02  ? 451 ILE A N   1 
ATOM   3430 C CA  . ILE A 1 454 ? 77.148 151.997 -17.641 1.00 33.74  ? 451 ILE A CA  1 
ATOM   3431 C C   . ILE A 1 454 ? 77.723 153.366 -17.308 1.00 34.51  ? 451 ILE A C   1 
ATOM   3432 O O   . ILE A 1 454 ? 77.684 154.288 -18.132 1.00 38.20  ? 451 ILE A O   1 
ATOM   3433 C CB  . ILE A 1 454 ? 75.738 151.816 -17.047 1.00 30.17  ? 451 ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 454 ? 75.165 150.451 -17.435 1.00 29.40  ? 451 ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 454 ? 74.813 152.933 -17.505 1.00 28.63  ? 451 ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 454 ? 73.835 150.136 -16.780 1.00 32.33  ? 451 ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 455 ? 78.270 153.521 -16.099 1.00 28.20  ? 452 GLU A N   1 
ATOM   3438 C CA  . GLU A 1 455 ? 78.781 154.823 -15.684 1.00 30.53  ? 452 GLU A CA  1 
ATOM   3439 C C   . GLU A 1 455 ? 79.951 155.273 -16.549 1.00 36.56  ? 452 GLU A C   1 
ATOM   3440 O O   . GLU A 1 455 ? 80.213 156.475 -16.661 1.00 40.10  ? 452 GLU A O   1 
ATOM   3441 C CB  . GLU A 1 455 ? 79.185 154.786 -14.210 1.00 27.30  ? 452 GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 455 ? 80.016 153.577 -13.818 1.00 29.01  ? 452 GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 455 ? 80.156 153.430 -12.314 1.00 36.79  ? 452 GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 455 ? 81.031 154.098 -11.724 1.00 33.64  ? 452 GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 455 ? 79.381 152.651 -11.719 1.00 33.41  ? 452 GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 456 ? 80.661 154.334 -17.170 1.00 30.94  ? 453 PHE A N   1 
ATOM   3447 C CA  . PHE A 1 456 ? 81.747 154.719 -18.060 1.00 34.48  ? 453 PHE A CA  1 
ATOM   3448 C C   . PHE A 1 456 ? 81.252 155.000 -19.472 1.00 30.66  ? 453 PHE A C   1 
ATOM   3449 O O   . PHE A 1 456 ? 81.842 155.826 -20.178 1.00 39.59  ? 453 PHE A O   1 
ATOM   3450 C CB  . PHE A 1 456 ? 82.822 153.634 -18.074 1.00 32.11  ? 453 PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 456 ? 83.577 153.515 -16.784 1.00 24.21  ? 453 PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 456 ? 83.178 152.613 -15.812 1.00 24.76  ? 453 PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 456 ? 84.685 154.309 -16.541 1.00 24.94  ? 453 PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 456 ? 83.874 152.502 -14.621 1.00 26.65  ? 453 PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 456 ? 85.386 154.202 -15.353 1.00 31.59  ? 453 PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 456 ? 84.979 153.298 -14.393 1.00 31.72  ? 453 PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 457 ? 80.176 154.334 -19.897 1.00 33.81  ? 454 ILE A N   1 
ATOM   3458 C CA  . ILE A 1 457 ? 79.608 154.608 -21.212 1.00 29.65  ? 454 ILE A CA  1 
ATOM   3459 C C   . ILE A 1 457 ? 79.016 156.012 -21.254 1.00 39.75  ? 454 ILE A C   1 
ATOM   3460 O O   . ILE A 1 457 ? 79.115 156.711 -22.269 1.00 38.30  ? 454 ILE A O   1 
ATOM   3461 C CB  . ILE A 1 457 ? 78.560 153.539 -21.572 1.00 32.80  ? 454 ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 457 ? 79.197 152.148 -21.595 1.00 30.83  ? 454 ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 457 ? 77.918 153.851 -22.915 1.00 27.15  ? 454 ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 457 ? 80.308 152.002 -22.610 1.00 32.05  ? 454 ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 458 ? 78.405 156.450 -20.156 1.00 32.81  ? 455 PHE A N   1 
ATOM   3466 C CA  . PHE A 1 458 ? 77.780 157.762 -20.082 1.00 36.73  ? 455 PHE A CA  1 
ATOM   3467 C C   . PHE A 1 458 ? 78.732 158.850 -19.594 1.00 34.92  ? 455 PHE A C   1 
ATOM   3468 O O   . PHE A 1 458 ? 78.285 159.970 -19.325 1.00 40.89  ? 455 PHE A O   1 
ATOM   3469 C CB  . PHE A 1 458 ? 76.543 157.704 -19.182 1.00 27.63  ? 455 PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 458 ? 75.349 157.069 -19.835 1.00 30.11  ? 455 PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 458 ? 75.157 155.698 -19.779 1.00 25.52  ? 455 PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 458 ? 74.421 157.843 -20.510 1.00 22.37  ? 455 PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 458 ? 74.058 155.113 -20.382 1.00 22.60  ? 455 PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 458 ? 73.322 157.265 -21.115 1.00 24.43  ? 455 PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 458 ? 73.140 155.898 -21.050 1.00 29.00  ? 455 PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 459 ? 80.022 158.548 -19.473 1.00 30.55  ? 456 GLY A N   1 
ATOM   3477 C CA  . GLY A 1 459 ? 81.006 159.558 -19.128 1.00 30.89  ? 456 GLY A CA  1 
ATOM   3478 C C   . GLY A 1 459 ? 80.861 160.150 -17.744 1.00 38.51  ? 456 GLY A C   1 
ATOM   3479 O O   . GLY A 1 459 ? 81.260 161.301 -17.528 1.00 44.17  ? 456 GLY A O   1 
ATOM   3480 N N   . ILE A 1 460 ? 80.304 159.398 -16.799 1.00 35.83  ? 457 ILE A N   1 
ATOM   3481 C CA  . ILE A 1 460 ? 80.112 159.857 -15.424 1.00 26.56  ? 457 ILE A CA  1 
ATOM   3482 C C   . ILE A 1 460 ? 81.439 160.216 -14.752 1.00 33.41  ? 457 ILE A C   1 
ATOM   3483 O O   . ILE A 1 460 ? 81.461 161.154 -13.940 1.00 41.27  ? 457 ILE A O   1 
ATOM   3484 C CB  . ILE A 1 460 ? 79.335 158.815 -14.603 1.00 29.41  ? 457 ILE A CB  1 
ATOM   3485 C CG1 . ILE A 1 460 ? 78.016 158.467 -15.291 1.00 34.11  ? 457 ILE A CG1 1 
ATOM   3486 C CG2 . ILE A 1 460 ? 79.039 159.337 -13.205 1.00 27.34  ? 457 ILE A CG2 1 
ATOM   3487 C CD1 . ILE A 1 460 ? 77.138 159.670 -15.558 1.00 30.07  ? 457 ILE A CD1 1 
ATOM   3488 N N   . PRO A 1 461 ? 82.574 159.517 -15.033 1.00 37.89  ? 458 PRO A N   1 
ATOM   3489 C CA  . PRO A 1 461 ? 83.855 159.966 -14.464 1.00 39.00  ? 458 PRO A CA  1 
ATOM   3490 C C   . PRO A 1 461 ? 84.198 161.421 -14.749 1.00 46.59  ? 458 PRO A C   1 
ATOM   3491 O O   . PRO A 1 461 ? 84.958 162.035 -13.994 1.00 43.74  ? 458 PRO A O   1 
ATOM   3492 C CB  . PRO A 1 461 ? 84.872 159.024 -15.117 1.00 35.99  ? 458 PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 461 ? 84.126 157.772 -15.289 1.00 40.43  ? 458 PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 461 ? 82.715 158.177 -15.641 1.00 33.99  ? 458 PRO A CD  1 
ATOM   3495 N N   . LEU A 1 462 ? 83.652 161.986 -15.829 1.00 37.21  ? 459 LEU A N   1 
ATOM   3496 C CA  . LEU A 1 462 ? 83.911 163.385 -16.147 1.00 41.30  ? 459 LEU A CA  1 
ATOM   3497 C C   . LEU A 1 462 ? 83.222 164.350 -15.190 1.00 48.15  ? 459 LEU A C   1 
ATOM   3498 O O   . LEU A 1 462 ? 83.529 165.546 -15.221 1.00 44.02  ? 459 LEU A O   1 
ATOM   3499 C CB  . LEU A 1 462 ? 83.480 163.690 -17.583 1.00 35.63  ? 459 LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 462 ? 84.259 162.965 -18.681 1.00 36.93  ? 459 LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 462 ? 83.744 163.362 -20.056 1.00 46.69  ? 459 LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 462 ? 85.747 163.248 -18.558 1.00 31.88  ? 459 LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 463 ? 82.308 163.868 -14.356 1.00 39.72  ? 460 ASP A N   1 
ATOM   3504 C CA  . ASP A 1 463 ? 81.634 164.716 -13.382 1.00 38.80  ? 460 ASP A CA  1 
ATOM   3505 C C   . ASP A 1 463 ? 82.651 165.259 -12.383 1.00 45.81  ? 460 ASP A C   1 
ATOM   3506 O O   . ASP A 1 463 ? 83.274 164.470 -11.656 1.00 45.58  ? 460 ASP A O   1 
ATOM   3507 C CB  . ASP A 1 463 ? 80.542 163.926 -12.661 1.00 46.90  ? 460 ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 463 ? 79.573 164.814 -11.894 1.00 46.14  ? 460 ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 463 ? 80.007 165.832 -11.315 1.00 40.62  ? 460 ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 463 ? 78.368 164.484 -11.867 1.00 50.44  ? 460 ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 464 ? 82.848 166.579 -12.308 1.00 48.29  ? 461 PRO A N   1 
ATOM   3512 C CA  . PRO A 1 464 ? 83.858 167.116 -11.381 1.00 47.20  ? 461 PRO A CA  1 
ATOM   3513 C C   . PRO A 1 464 ? 83.516 166.909 -9.916  1.00 48.29  ? 461 PRO A C   1 
ATOM   3514 O O   . PRO A 1 464 ? 84.419 166.989 -9.074  1.00 45.20  ? 461 PRO A O   1 
ATOM   3515 C CB  . PRO A 1 464 ? 83.902 168.608 -11.738 1.00 43.99  ? 461 PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 464 ? 82.552 168.891 -12.315 1.00 49.11  ? 461 PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 464 ? 82.154 167.643 -13.053 1.00 46.34  ? 461 PRO A CD  1 
ATOM   3518 N N   . SER A 1 465 ? 82.253 166.647 -9.583  1.00 44.67  ? 462 SER A N   1 
ATOM   3519 C CA  . SER A 1 465 ? 81.848 166.414 -8.203  1.00 50.67  ? 462 SER A CA  1 
ATOM   3520 C C   . SER A 1 465 ? 82.062 164.973 -7.756  1.00 48.19  ? 462 SER A C   1 
ATOM   3521 O O   . SER A 1 465 ? 81.591 164.599 -6.677  1.00 52.70  ? 462 SER A O   1 
ATOM   3522 C CB  . SER A 1 465 ? 80.378 166.798 -8.011  1.00 37.35  ? 462 SER A CB  1 
ATOM   3523 O OG  . SER A 1 465 ? 79.522 165.915 -8.716  1.00 56.65  ? 462 SER A OG  1 
ATOM   3524 N N   . ARG A 1 466 ? 82.752 164.161 -8.551  1.00 45.82  ? 463 ARG A N   1 
ATOM   3525 C CA  . ARG A 1 466 ? 82.990 162.764 -8.229  1.00 46.86  ? 463 ARG A CA  1 
ATOM   3526 C C   . ARG A 1 466 ? 84.487 162.485 -8.199  1.00 46.91  ? 463 ARG A C   1 
ATOM   3527 O O   . ARG A 1 466 ? 85.292 163.228 -8.766  1.00 55.63  ? 463 ARG A O   1 
ATOM   3528 C CB  . ARG A 1 466 ? 82.284 161.842 -9.230  1.00 43.84  ? 463 ARG A CB  1 
ATOM   3529 C CG  . ARG A 1 466 ? 80.772 162.008 -9.219  1.00 43.99  ? 463 ARG A CG  1 
ATOM   3530 C CD  . ARG A 1 466 ? 80.087 161.145 -10.261 1.00 50.11  ? 463 ARG A CD  1 
ATOM   3531 N NE  . ARG A 1 466 ? 78.638 161.321 -10.228 1.00 57.31  ? 463 ARG A NE  1 
ATOM   3532 C CZ  . ARG A 1 466 ? 77.809 160.566 -9.515  1.00 55.78  ? 463 ARG A CZ  1 
ATOM   3533 N NH1 . ARG A 1 466 ? 78.285 159.574 -8.775  1.00 56.13  ? 463 ARG A NH1 1 
ATOM   3534 N NH2 . ARG A 1 466 ? 76.504 160.801 -9.542  1.00 46.92  ? 463 ARG A NH2 1 
ATOM   3535 N N   . ASN A 1 467 ? 84.851 161.394 -7.526  1.00 46.75  ? 464 ASN A N   1 
ATOM   3536 C CA  . ASN A 1 467 ? 86.251 161.119 -7.230  1.00 51.39  ? 464 ASN A CA  1 
ATOM   3537 C C   . ASN A 1 467 ? 86.810 159.986 -8.085  1.00 42.09  ? 464 ASN A C   1 
ATOM   3538 O O   . ASN A 1 467 ? 87.366 159.018 -7.556  1.00 52.43  ? 464 ASN A O   1 
ATOM   3539 C CB  . ASN A 1 467 ? 86.412 160.792 -5.743  1.00 46.62  ? 464 ASN A CB  1 
ATOM   3540 C CG  . ASN A 1 467 ? 87.854 160.857 -5.284  1.00 52.34  ? 464 ASN A CG  1 
ATOM   3541 O OD1 . ASN A 1 467 ? 88.704 161.442 -5.955  1.00 56.63  ? 464 ASN A OD1 1 
ATOM   3542 N ND2 . ASN A 1 467 ? 88.137 160.254 -4.135  1.00 56.86  ? 464 ASN A ND2 1 
ATOM   3543 N N   . TYR A 1 468 ? 86.672 160.096 -9.403  1.00 42.48  ? 465 TYR A N   1 
ATOM   3544 C CA  . TYR A 1 468 ? 87.297 159.137 -10.300 1.00 38.49  ? 465 TYR A CA  1 
ATOM   3545 C C   . TYR A 1 468 ? 88.754 159.517 -10.550 1.00 44.91  ? 465 TYR A C   1 
ATOM   3546 O O   . TYR A 1 468 ? 89.164 160.669 -10.379 1.00 46.12  ? 465 TYR A O   1 
ATOM   3547 C CB  . TYR A 1 468 ? 86.543 159.063 -11.630 1.00 35.22  ? 465 TYR A CB  1 
ATOM   3548 C CG  . TYR A 1 468 ? 85.214 158.343 -11.560 1.00 39.52  ? 465 TYR A CG  1 
ATOM   3549 C CD1 . TYR A 1 468 ? 84.067 159.000 -11.134 1.00 36.41  ? 465 TYR A CD1 1 
ATOM   3550 C CD2 . TYR A 1 468 ? 85.104 157.008 -11.932 1.00 38.73  ? 465 TYR A CD2 1 
ATOM   3551 C CE1 . TYR A 1 468 ? 82.849 158.347 -11.076 1.00 32.86  ? 465 TYR A CE1 1 
ATOM   3552 C CE2 . TYR A 1 468 ? 83.890 156.347 -11.876 1.00 36.32  ? 465 TYR A CE2 1 
ATOM   3553 C CZ  . TYR A 1 468 ? 82.766 157.021 -11.447 1.00 39.72  ? 465 TYR A CZ  1 
ATOM   3554 O OH  . TYR A 1 468 ? 81.556 156.369 -11.389 1.00 36.53  ? 465 TYR A OH  1 
ATOM   3555 N N   . THR A 1 469 ? 89.541 158.526 -10.957 1.00 39.23  ? 466 THR A N   1 
ATOM   3556 C CA  . THR A 1 469 ? 90.939 158.772 -11.270 1.00 43.56  ? 466 THR A CA  1 
ATOM   3557 C C   . THR A 1 469 ? 91.072 159.432 -12.639 1.00 38.80  ? 466 THR A C   1 
ATOM   3558 O O   . THR A 1 469 ? 90.140 159.441 -13.449 1.00 34.44  ? 466 THR A O   1 
ATOM   3559 C CB  . THR A 1 469 ? 91.743 157.471 -11.249 1.00 40.91  ? 466 THR A CB  1 
ATOM   3560 O OG1 . THR A 1 469 ? 91.396 156.675 -12.389 1.00 48.08  ? 466 THR A OG1 1 
ATOM   3561 C CG2 . THR A 1 469 ? 91.451 156.683 -9.982  1.00 36.30  ? 466 THR A CG2 1 
ATOM   3562 N N   . ALA A 1 470 ? 92.258 159.991 -12.890 1.00 47.24  ? 467 ALA A N   1 
ATOM   3563 C CA  . ALA A 1 470 ? 92.527 160.588 -14.193 1.00 45.17  ? 467 ALA A CA  1 
ATOM   3564 C C   . ALA A 1 470 ? 92.530 159.539 -15.296 1.00 42.07  ? 467 ALA A C   1 
ATOM   3565 O O   . ALA A 1 470 ? 92.150 159.833 -16.435 1.00 44.10  ? 467 ALA A O   1 
ATOM   3566 C CB  . ALA A 1 470 ? 93.861 161.334 -14.165 1.00 38.27  ? 467 ALA A CB  1 
ATOM   3567 N N   . GLU A 1 471 ? 92.952 158.313 -14.977 1.00 48.49  ? 468 GLU A N   1 
ATOM   3568 C CA  . GLU A 1 471 ? 92.947 157.246 -15.972 1.00 47.44  ? 468 GLU A CA  1 
ATOM   3569 C C   . GLU A 1 471 ? 91.525 156.827 -16.323 1.00 38.78  ? 468 GLU A C   1 
ATOM   3570 O O   . GLU A 1 471 ? 91.239 156.486 -17.477 1.00 42.01  ? 468 GLU A O   1 
ATOM   3571 C CB  . GLU A 1 471 ? 93.749 156.051 -15.461 1.00 54.58  ? 468 GLU A CB  1 
ATOM   3572 C CG  . GLU A 1 471 ? 95.188 156.379 -15.100 1.00 68.74  ? 468 GLU A CG  1 
ATOM   3573 C CD  . GLU A 1 471 ? 95.955 155.169 -14.607 1.00 89.92  ? 468 GLU A CD  1 
ATOM   3574 O OE1 . GLU A 1 471 ? 95.433 154.447 -13.731 1.00 83.31  ? 468 GLU A OE1 1 
ATOM   3575 O OE2 . GLU A 1 471 ? 97.076 154.933 -15.104 1.00 88.67  ? 468 GLU A OE2 1 
ATOM   3576 N N   . GLU A 1 472 ? 90.621 156.847 -15.342 1.00 43.46  ? 469 GLU A N   1 
ATOM   3577 C CA  . GLU A 1 472 ? 89.234 156.482 -15.608 1.00 43.33  ? 469 GLU A CA  1 
ATOM   3578 C C   . GLU A 1 472 ? 88.529 157.531 -16.458 1.00 42.94  ? 469 GLU A C   1 
ATOM   3579 O O   . GLU A 1 472 ? 87.604 157.198 -17.208 1.00 37.89  ? 469 GLU A O   1 
ATOM   3580 C CB  . GLU A 1 472 ? 88.490 156.265 -14.290 1.00 42.85  ? 469 GLU A CB  1 
ATOM   3581 C CG  . GLU A 1 472 ? 88.902 154.997 -13.560 1.00 41.59  ? 469 GLU A CG  1 
ATOM   3582 C CD  . GLU A 1 472 ? 88.341 154.917 -12.155 1.00 44.34  ? 469 GLU A CD  1 
ATOM   3583 O OE1 . GLU A 1 472 ? 88.349 155.948 -11.450 1.00 43.28  ? 469 GLU A OE1 1 
ATOM   3584 O OE2 . GLU A 1 472 ? 87.889 153.822 -11.757 1.00 40.27  ? 469 GLU A OE2 1 
ATOM   3585 N N   . LYS A 1 473 ? 88.949 158.794 -16.361 1.00 47.97  ? 470 LYS A N   1 
ATOM   3586 C CA  . LYS A 1 473 ? 88.386 159.828 -17.223 1.00 50.88  ? 470 LYS A CA  1 
ATOM   3587 C C   . LYS A 1 473 ? 88.797 159.611 -18.674 1.00 40.75  ? 470 LYS A C   1 
ATOM   3588 O O   . LYS A 1 473 ? 87.963 159.683 -19.584 1.00 48.15  ? 470 LYS A O   1 
ATOM   3589 C CB  . LYS A 1 473 ? 88.821 161.212 -16.737 1.00 48.49  ? 470 LYS A CB  1 
ATOM   3590 C CG  . LYS A 1 473 ? 88.293 161.579 -15.359 1.00 44.79  ? 470 LYS A CG  1 
ATOM   3591 C CD  . LYS A 1 473 ? 88.800 162.941 -14.916 1.00 51.41  ? 470 LYS A CD  1 
ATOM   3592 C CE  . LYS A 1 473 ? 88.264 163.306 -13.541 1.00 55.48  ? 470 LYS A CE  1 
ATOM   3593 N NZ  . LYS A 1 473 ? 88.810 164.604 -13.058 1.00 53.47  ? 470 LYS A NZ  1 
ATOM   3594 N N   . ILE A 1 474 ? 90.084 159.341 -18.908 1.00 43.65  ? 471 ILE A N   1 
ATOM   3595 C CA  . ILE A 1 474 ? 90.547 159.025 -20.257 1.00 41.89  ? 471 ILE A CA  1 
ATOM   3596 C C   . ILE A 1 474 ? 89.901 157.736 -20.748 1.00 41.82  ? 471 ILE A C   1 
ATOM   3597 O O   . ILE A 1 474 ? 89.532 157.613 -21.922 1.00 42.17  ? 471 ILE A O   1 
ATOM   3598 C CB  . ILE A 1 474 ? 92.085 158.937 -20.285 1.00 44.03  ? 471 ILE A CB  1 
ATOM   3599 C CG1 . ILE A 1 474 ? 92.703 160.270 -19.857 1.00 36.39  ? 471 ILE A CG1 1 
ATOM   3600 C CG2 . ILE A 1 474 ? 92.578 158.530 -21.667 1.00 39.49  ? 471 ILE A CG2 1 
ATOM   3601 C CD1 . ILE A 1 474 ? 94.217 160.255 -19.795 1.00 38.86  ? 471 ILE A CD1 1 
ATOM   3602 N N   . PHE A 1 475 ? 89.745 156.758 -19.852 1.00 46.29  ? 472 PHE A N   1 
ATOM   3603 C CA  . PHE A 1 475 ? 89.109 155.498 -20.223 1.00 37.03  ? 472 PHE A CA  1 
ATOM   3604 C C   . PHE A 1 475 ? 87.645 155.707 -20.591 1.00 38.66  ? 472 PHE A C   1 
ATOM   3605 O O   . PHE A 1 475 ? 87.135 155.077 -21.525 1.00 40.88  ? 472 PHE A O   1 
ATOM   3606 C CB  . PHE A 1 475 ? 89.247 154.497 -19.076 1.00 44.08  ? 472 PHE A CB  1 
ATOM   3607 C CG  . PHE A 1 475 ? 88.534 153.195 -19.308 1.00 33.69  ? 472 PHE A CG  1 
ATOM   3608 C CD1 . PHE A 1 475 ? 88.769 152.451 -20.451 1.00 36.47  ? 472 PHE A CD1 1 
ATOM   3609 C CD2 . PHE A 1 475 ? 87.647 152.703 -18.364 1.00 35.21  ? 472 PHE A CD2 1 
ATOM   3610 C CE1 . PHE A 1 475 ? 88.118 151.249 -20.657 1.00 38.31  ? 472 PHE A CE1 1 
ATOM   3611 C CE2 . PHE A 1 475 ? 86.996 151.502 -18.564 1.00 39.29  ? 472 PHE A CE2 1 
ATOM   3612 C CZ  . PHE A 1 475 ? 87.233 150.772 -19.711 1.00 41.75  ? 472 PHE A CZ  1 
ATOM   3613 N N   . ALA A 1 476 ? 86.954 156.593 -19.869 1.00 34.13  ? 473 ALA A N   1 
ATOM   3614 C CA  . ALA A 1 476 ? 85.556 156.871 -20.180 1.00 36.22  ? 473 ALA A CA  1 
ATOM   3615 C C   . ALA A 1 476 ? 85.416 157.542 -21.540 1.00 37.06  ? 473 ALA A C   1 
ATOM   3616 O O   . ALA A 1 476 ? 84.486 157.239 -22.297 1.00 37.27  ? 473 ALA A O   1 
ATOM   3617 C CB  . ALA A 1 476 ? 84.937 157.737 -19.085 1.00 38.90  ? 473 ALA A CB  1 
ATOM   3618 N N   . GLN A 1 477 ? 86.333 158.456 -21.870 1.00 34.41  ? 474 GLN A N   1 
ATOM   3619 C CA  . GLN A 1 477 ? 86.281 159.121 -23.167 1.00 38.55  ? 474 GLN A CA  1 
ATOM   3620 C C   . GLN A 1 477 ? 86.537 158.140 -24.304 1.00 40.99  ? 474 GLN A C   1 
ATOM   3621 O O   . GLN A 1 477 ? 85.918 158.242 -25.370 1.00 38.83  ? 474 GLN A O   1 
ATOM   3622 C CB  . GLN A 1 477 ? 87.289 160.270 -23.205 1.00 31.58  ? 474 GLN A CB  1 
ATOM   3623 C CG  . GLN A 1 477 ? 86.944 161.417 -22.270 1.00 40.68  ? 474 GLN A CG  1 
ATOM   3624 C CD  . GLN A 1 477 ? 88.074 162.415 -22.125 1.00 43.53  ? 474 GLN A CD  1 
ATOM   3625 O OE1 . GLN A 1 477 ? 89.230 162.038 -21.934 1.00 41.64  ? 474 GLN A OE1 1 
ATOM   3626 N NE2 . GLN A 1 477 ? 87.746 163.698 -22.217 1.00 49.24  ? 474 GLN A NE2 1 
ATOM   3627 N N   . ARG A 1 478 ? 87.442 157.179 -24.096 1.00 36.25  ? 475 ARG A N   1 
ATOM   3628 C CA  . ARG A 1 478 ? 87.701 156.178 -25.126 1.00 39.54  ? 475 ARG A CA  1 
ATOM   3629 C C   . ARG A 1 478 ? 86.480 155.295 -25.354 1.00 41.40  ? 475 ARG A C   1 
ATOM   3630 O O   . ARG A 1 478 ? 86.204 154.888 -26.488 1.00 44.61  ? 475 ARG A O   1 
ATOM   3631 C CB  . ARG A 1 478 ? 88.919 155.335 -24.748 1.00 44.31  ? 475 ARG A CB  1 
ATOM   3632 C CG  . ARG A 1 478 ? 89.278 154.269 -25.773 1.00 52.96  ? 475 ARG A CG  1 
ATOM   3633 C CD  . ARG A 1 478 ? 90.740 153.857 -25.675 1.00 54.44  ? 475 ARG A CD  1 
ATOM   3634 N NE  . ARG A 1 478 ? 91.076 153.298 -24.369 1.00 41.67  ? 475 ARG A NE  1 
ATOM   3635 C CZ  . ARG A 1 478 ? 90.956 152.013 -24.053 1.00 43.17  ? 475 ARG A CZ  1 
ATOM   3636 N NH1 . ARG A 1 478 ? 90.500 151.146 -24.948 1.00 34.24  ? 475 ARG A NH1 1 
ATOM   3637 N NH2 . ARG A 1 478 ? 91.289 151.593 -22.840 1.00 36.55  ? 475 ARG A NH2 1 
ATOM   3638 N N   . LEU A 1 479 ? 85.732 154.996 -24.289 1.00 36.95  ? 476 LEU A N   1 
ATOM   3639 C CA  . LEU A 1 479 ? 84.521 154.195 -24.441 1.00 40.29  ? 476 LEU A CA  1 
ATOM   3640 C C   . LEU A 1 479 ? 83.418 154.985 -25.133 1.00 37.57  ? 476 LEU A C   1 
ATOM   3641 O O   . LEU A 1 479 ? 82.695 154.441 -25.976 1.00 36.30  ? 476 LEU A O   1 
ATOM   3642 C CB  . LEU A 1 479 ? 84.047 153.694 -23.079 1.00 40.93  ? 476 LEU A CB  1 
ATOM   3643 C CG  . LEU A 1 479 ? 84.950 152.671 -22.392 1.00 39.28  ? 476 LEU A CG  1 
ATOM   3644 C CD1 . LEU A 1 479 ? 84.404 152.337 -21.020 1.00 44.11  ? 476 LEU A CD1 1 
ATOM   3645 C CD2 . LEU A 1 479 ? 85.082 151.415 -23.240 1.00 39.43  ? 476 LEU A CD2 1 
ATOM   3646 N N   . MET A 1 480 ? 83.266 156.266 -24.784 1.00 34.73  ? 477 MET A N   1 
ATOM   3647 C CA  . MET A 1 480 ? 82.293 157.105 -25.476 1.00 31.20  ? 477 MET A CA  1 
ATOM   3648 C C   . MET A 1 480 ? 82.635 157.246 -26.953 1.00 40.22  ? 477 MET A C   1 
ATOM   3649 O O   . MET A 1 480 ? 81.732 157.350 -27.792 1.00 32.36  ? 477 MET A O   1 
ATOM   3650 C CB  . MET A 1 480 ? 82.211 158.480 -24.813 1.00 42.60  ? 477 MET A CB  1 
ATOM   3651 C CG  . MET A 1 480 ? 81.547 158.469 -23.446 1.00 40.13  ? 477 MET A CG  1 
ATOM   3652 S SD  . MET A 1 480 ? 81.299 160.120 -22.764 1.00 41.85  ? 477 MET A SD  1 
ATOM   3653 C CE  . MET A 1 480 ? 82.990 160.625 -22.464 1.00 34.16  ? 477 MET A CE  1 
ATOM   3654 N N   . ARG A 1 481 ? 83.928 157.247 -27.288 1.00 41.97  ? 478 ARG A N   1 
ATOM   3655 C CA  . ARG A 1 481 ? 84.330 157.264 -28.690 1.00 40.42  ? 478 ARG A CA  1 
ATOM   3656 C C   . ARG A 1 481 ? 83.885 155.993 -29.402 1.00 46.55  ? 478 ARG A C   1 
ATOM   3657 O O   . ARG A 1 481 ? 83.379 156.049 -30.530 1.00 38.71  ? 478 ARG A O   1 
ATOM   3658 C CB  . ARG A 1 481 ? 85.845 157.434 -28.796 1.00 43.94  ? 478 ARG A CB  1 
ATOM   3659 C CG  . ARG A 1 481 ? 86.368 157.470 -30.222 1.00 53.38  ? 478 ARG A CG  1 
ATOM   3660 C CD  . ARG A 1 481 ? 86.032 158.788 -30.895 1.00 57.25  ? 478 ARG A CD  1 
ATOM   3661 N NE  . ARG A 1 481 ? 86.754 159.902 -30.287 1.00 58.65  ? 478 ARG A NE  1 
ATOM   3662 C CZ  . ARG A 1 481 ? 86.522 161.182 -30.560 1.00 60.02  ? 478 ARG A CZ  1 
ATOM   3663 N NH1 . ARG A 1 481 ? 85.580 161.516 -31.431 1.00 58.78  ? 478 ARG A NH1 1 
ATOM   3664 N NH2 . ARG A 1 481 ? 87.230 162.128 -29.958 1.00 74.73  ? 478 ARG A NH2 1 
ATOM   3665 N N   . TYR A 1 482 ? 84.066 154.837 -28.757 1.00 39.60  ? 479 TYR A N   1 
ATOM   3666 C CA  . TYR A 1 482 ? 83.639 153.571 -29.348 1.00 36.43  ? 479 TYR A CA  1 
ATOM   3667 C C   . TYR A 1 482 ? 82.143 153.575 -29.635 1.00 39.39  ? 479 TYR A C   1 
ATOM   3668 O O   . TYR A 1 482 ? 81.709 153.250 -30.747 1.00 41.05  ? 479 TYR A O   1 
ATOM   3669 C CB  . TYR A 1 482 ? 83.994 152.410 -28.418 1.00 47.19  ? 479 TYR A CB  1 
ATOM   3670 C CG  . TYR A 1 482 ? 85.473 152.125 -28.279 1.00 44.70  ? 479 TYR A CG  1 
ATOM   3671 C CD1 . TYR A 1 482 ? 86.333 152.241 -29.363 1.00 45.17  ? 479 TYR A CD1 1 
ATOM   3672 C CD2 . TYR A 1 482 ? 86.008 151.728 -27.060 1.00 41.75  ? 479 TYR A CD2 1 
ATOM   3673 C CE1 . TYR A 1 482 ? 87.685 151.974 -29.235 1.00 40.14  ? 479 TYR A CE1 1 
ATOM   3674 C CE2 . TYR A 1 482 ? 87.355 151.460 -26.922 1.00 43.38  ? 479 TYR A CE2 1 
ATOM   3675 C CZ  . TYR A 1 482 ? 88.190 151.584 -28.011 1.00 40.36  ? 479 TYR A CZ  1 
ATOM   3676 O OH  . TYR A 1 482 ? 89.532 151.317 -27.873 1.00 42.68  ? 479 TYR A OH  1 
ATOM   3677 N N   . TRP A 1 483 ? 81.336 153.940 -28.636 1.00 34.83  ? 480 TRP A N   1 
ATOM   3678 C CA  . TRP A 1 483 ? 79.886 153.900 -28.799 1.00 35.40  ? 480 TRP A CA  1 
ATOM   3679 C C   . TRP A 1 483 ? 79.410 154.914 -29.833 1.00 34.07  ? 480 TRP A C   1 
ATOM   3680 O O   . TRP A 1 483 ? 78.472 154.640 -30.590 1.00 33.62  ? 480 TRP A O   1 
ATOM   3681 C CB  . TRP A 1 483 ? 79.205 154.139 -27.452 1.00 30.36  ? 480 TRP A CB  1 
ATOM   3682 C CG  . TRP A 1 483 ? 78.772 152.876 -26.768 1.00 33.14  ? 480 TRP A CG  1 
ATOM   3683 C CD1 . TRP A 1 483 ? 77.493 152.501 -26.479 1.00 26.98  ? 480 TRP A CD1 1 
ATOM   3684 C CD2 . TRP A 1 483 ? 79.616 151.814 -26.302 1.00 36.70  ? 480 TRP A CD2 1 
ATOM   3685 N NE1 . TRP A 1 483 ? 77.488 151.277 -25.854 1.00 30.00  ? 480 TRP A NE1 1 
ATOM   3686 C CE2 . TRP A 1 483 ? 78.778 150.834 -25.734 1.00 32.76  ? 480 TRP A CE2 1 
ATOM   3687 C CE3 . TRP A 1 483 ? 80.999 151.600 -26.305 1.00 38.17  ? 480 TRP A CE3 1 
ATOM   3688 C CZ2 . TRP A 1 483 ? 79.276 149.658 -25.177 1.00 27.03  ? 480 TRP A CZ2 1 
ATOM   3689 C CZ3 . TRP A 1 483 ? 81.491 150.431 -25.750 1.00 36.35  ? 480 TRP A CZ3 1 
ATOM   3690 C CH2 . TRP A 1 483 ? 80.631 149.475 -25.194 1.00 27.38  ? 480 TRP A CH2 1 
ATOM   3691 N N   . ALA A 1 484 ? 80.044 156.088 -29.885 1.00 35.96  ? 481 ALA A N   1 
ATOM   3692 C CA  . ALA A 1 484 ? 79.625 157.101 -30.848 1.00 37.33  ? 481 ALA A CA  1 
ATOM   3693 C C   . ALA A 1 484 ? 80.052 156.733 -32.263 1.00 41.17  ? 481 ALA A C   1 
ATOM   3694 O O   . ALA A 1 484 ? 79.279 156.906 -33.213 1.00 38.41  ? 481 ALA A O   1 
ATOM   3695 C CB  . ALA A 1 484 ? 80.189 158.465 -30.458 1.00 35.69  ? 481 ALA A CB  1 
ATOM   3696 N N   . ASN A 1 485 ? 81.282 156.236 -32.426 1.00 45.74  ? 482 ASN A N   1 
ATOM   3697 C CA  . ASN A 1 485 ? 81.732 155.798 -33.744 1.00 40.61  ? 482 ASN A CA  1 
ATOM   3698 C C   . ASN A 1 485 ? 80.834 154.697 -34.291 1.00 37.97  ? 482 ASN A C   1 
ATOM   3699 O O   . ASN A 1 485 ? 80.537 154.665 -35.491 1.00 41.70  ? 482 ASN A O   1 
ATOM   3700 C CB  . ASN A 1 485 ? 83.183 155.320 -33.682 1.00 36.50  ? 482 ASN A CB  1 
ATOM   3701 C CG  . ASN A 1 485 ? 84.168 156.460 -33.509 1.00 40.21  ? 482 ASN A CG  1 
ATOM   3702 O OD1 . ASN A 1 485 ? 83.842 157.622 -33.756 1.00 55.00  ? 482 ASN A OD1 1 
ATOM   3703 N ND2 . ASN A 1 485 ? 85.385 156.131 -33.094 1.00 42.78  ? 482 ASN A ND2 1 
ATOM   3704 N N   . PHE A 1 486 ? 80.388 153.786 -33.423 1.00 36.35  ? 483 PHE A N   1 
ATOM   3705 C CA  . PHE A 1 486 ? 79.442 152.763 -33.855 1.00 41.28  ? 483 PHE A CA  1 
ATOM   3706 C C   . PHE A 1 486 ? 78.090 153.374 -34.199 1.00 39.99  ? 483 PHE A C   1 
ATOM   3707 O O   . PHE A 1 486 ? 77.409 152.910 -35.120 1.00 38.26  ? 483 PHE A O   1 
ATOM   3708 C CB  . PHE A 1 486 ? 79.288 151.696 -32.772 1.00 32.66  ? 483 PHE A CB  1 
ATOM   3709 C CG  . PHE A 1 486 ? 78.277 150.638 -33.108 1.00 32.29  ? 483 PHE A CG  1 
ATOM   3710 C CD1 . PHE A 1 486 ? 78.613 149.583 -33.939 1.00 28.50  ? 483 PHE A CD1 1 
ATOM   3711 C CD2 . PHE A 1 486 ? 76.991 150.699 -32.596 1.00 28.54  ? 483 PHE A CD2 1 
ATOM   3712 C CE1 . PHE A 1 486 ? 77.686 148.608 -34.255 1.00 41.90  ? 483 PHE A CE1 1 
ATOM   3713 C CE2 . PHE A 1 486 ? 76.059 149.727 -32.909 1.00 37.82  ? 483 PHE A CE2 1 
ATOM   3714 C CZ  . PHE A 1 486 ? 76.407 148.680 -33.738 1.00 40.32  ? 483 PHE A CZ  1 
ATOM   3715 N N   . ALA A 1 487 ? 77.681 154.410 -33.464 1.00 46.76  ? 484 ALA A N   1 
ATOM   3716 C CA  . ALA A 1 487 ? 76.413 155.065 -33.766 1.00 42.67  ? 484 ALA A CA  1 
ATOM   3717 C C   . ALA A 1 487 ? 76.477 155.834 -35.076 1.00 42.38  ? 484 ALA A C   1 
ATOM   3718 O O   . ALA A 1 487 ? 75.471 155.932 -35.785 1.00 41.25  ? 484 ALA A O   1 
ATOM   3719 C CB  . ALA A 1 487 ? 76.015 156.000 -32.626 1.00 39.16  ? 484 ALA A CB  1 
ATOM   3720 N N   . ARG A 1 488 ? 77.643 156.382 -35.416 1.00 33.84  ? 485 ARG A N   1 
ATOM   3721 C CA  . ARG A 1 488 ? 77.765 157.162 -36.641 1.00 37.87  ? 485 ARG A CA  1 
ATOM   3722 C C   . ARG A 1 488 ? 78.029 156.268 -37.847 1.00 44.90  ? 485 ARG A C   1 
ATOM   3723 O O   . ARG A 1 488 ? 77.327 156.358 -38.861 1.00 36.96  ? 485 ARG A O   1 
ATOM   3724 C CB  . ARG A 1 488 ? 78.875 158.207 -36.495 1.00 37.91  ? 485 ARG A CB  1 
ATOM   3725 C CG  . ARG A 1 488 ? 78.594 159.298 -35.471 1.00 39.08  ? 485 ARG A CG  1 
ATOM   3726 C CD  . ARG A 1 488 ? 79.705 160.342 -35.458 1.00 26.09  ? 485 ARG A CD  1 
ATOM   3727 N NE  . ARG A 1 488 ? 80.938 159.832 -34.861 1.00 48.29  ? 485 ARG A NE  1 
ATOM   3728 C CZ  . ARG A 1 488 ? 81.321 160.080 -33.613 1.00 39.67  ? 485 ARG A CZ  1 
ATOM   3729 N NH1 . ARG A 1 488 ? 80.571 160.839 -32.825 1.00 46.64  ? 485 ARG A NH1 1 
ATOM   3730 N NH2 . ARG A 1 488 ? 82.457 159.575 -33.151 1.00 42.57  ? 485 ARG A NH2 1 
ATOM   3731 N N   . THR A 1 489 ? 79.029 155.392 -37.752 1.00 47.23  ? 486 THR A N   1 
ATOM   3732 C CA  . THR A 1 489 ? 79.498 154.628 -38.898 1.00 43.27  ? 486 THR A CA  1 
ATOM   3733 C C   . THR A 1 489 ? 79.142 153.149 -38.849 1.00 45.02  ? 486 THR A C   1 
ATOM   3734 O O   . THR A 1 489 ? 79.265 152.470 -39.875 1.00 43.24  ? 486 THR A O   1 
ATOM   3735 C CB  . THR A 1 489 ? 81.022 154.760 -39.035 1.00 45.68  ? 486 THR A CB  1 
ATOM   3736 O OG1 . THR A 1 489 ? 81.661 154.046 -37.970 1.00 39.45  ? 486 THR A OG1 1 
ATOM   3737 C CG2 . THR A 1 489 ? 81.438 156.223 -38.977 1.00 41.45  ? 486 THR A CG2 1 
ATOM   3738 N N   . GLY A 1 490 ? 78.711 152.629 -37.703 1.00 52.25  ? 487 GLY A N   1 
ATOM   3739 C CA  . GLY A 1 490 ? 78.498 151.203 -37.567 1.00 36.41  ? 487 GLY A CA  1 
ATOM   3740 C C   . GLY A 1 490 ? 79.739 150.410 -37.232 1.00 42.34  ? 487 GLY A C   1 
ATOM   3741 O O   . GLY A 1 490 ? 79.690 149.175 -37.242 1.00 38.36  ? 487 GLY A O   1 
ATOM   3742 N N   . ASP A 1 491 ? 80.849 151.082 -36.935 1.00 40.53  ? 488 ASP A N   1 
ATOM   3743 C CA  . ASP A 1 491 ? 82.124 150.452 -36.625 1.00 44.34  ? 488 ASP A CA  1 
ATOM   3744 C C   . ASP A 1 491 ? 82.793 151.221 -35.490 1.00 45.77  ? 488 ASP A C   1 
ATOM   3745 O O   . ASP A 1 491 ? 83.108 152.407 -35.647 1.00 46.24  ? 488 ASP A O   1 
ATOM   3746 C CB  . ASP A 1 491 ? 83.013 150.414 -37.871 1.00 46.34  ? 488 ASP A CB  1 
ATOM   3747 C CG  . ASP A 1 491 ? 84.386 149.822 -37.602 1.00 53.59  ? 488 ASP A CG  1 
ATOM   3748 O OD1 . ASP A 1 491 ? 84.545 149.086 -36.606 1.00 62.61  ? 488 ASP A OD1 1 
ATOM   3749 O OD2 . ASP A 1 491 ? 85.308 150.088 -38.401 1.00 65.31  ? 488 ASP A OD2 1 
ATOM   3750 N N   . PRO A 1 492 ? 83.019 150.587 -34.335 1.00 45.99  ? 489 PRO A N   1 
ATOM   3751 C CA  . PRO A 1 492 ? 83.593 151.322 -33.195 1.00 43.04  ? 489 PRO A CA  1 
ATOM   3752 C C   . PRO A 1 492 ? 85.009 151.822 -33.429 1.00 50.42  ? 489 PRO A C   1 
ATOM   3753 O O   . PRO A 1 492 ? 85.460 152.704 -32.688 1.00 48.50  ? 489 PRO A O   1 
ATOM   3754 C CB  . PRO A 1 492 ? 83.545 150.297 -32.053 1.00 48.20  ? 489 PRO A CB  1 
ATOM   3755 C CG  . PRO A 1 492 ? 83.490 148.967 -32.737 1.00 50.79  ? 489 PRO A CG  1 
ATOM   3756 C CD  . PRO A 1 492 ? 82.701 149.191 -33.991 1.00 41.27  ? 489 PRO A CD  1 
ATOM   3757 N N   . ASN A 1 493 ? 85.723 151.295 -34.420 1.00 55.73  ? 490 ASN A N   1 
ATOM   3758 C CA  . ASN A 1 493 ? 87.060 151.789 -34.717 1.00 60.76  ? 490 ASN A CA  1 
ATOM   3759 C C   . ASN A 1 493 ? 86.986 153.199 -35.290 1.00 56.08  ? 490 ASN A C   1 
ATOM   3760 O O   . ASN A 1 493 ? 86.063 153.533 -36.038 1.00 55.69  ? 490 ASN A O   1 
ATOM   3761 C CB  . ASN A 1 493 ? 87.766 150.858 -35.702 1.00 59.28  ? 490 ASN A CB  1 
ATOM   3762 C CG  . ASN A 1 493 ? 87.865 149.435 -35.191 1.00 44.07  ? 490 ASN A CG  1 
ATOM   3763 O OD1 . ASN A 1 493 ? 88.772 149.099 -34.432 1.00 56.27  ? 490 ASN A OD1 1 
ATOM   3764 N ND2 . ASN A 1 493 ? 86.930 148.590 -35.608 1.00 43.94  ? 490 ASN A ND2 1 
ATOM   3765 N N   . GLU A 1 494 ? 87.960 154.029 -34.929 1.00 56.39  ? 491 GLU A N   1 
ATOM   3766 C CA  . GLU A 1 494 ? 88.009 155.380 -35.468 1.00 88.13  ? 491 GLU A CA  1 
ATOM   3767 C C   . GLU A 1 494 ? 88.230 155.316 -36.977 1.00 91.52  ? 491 GLU A C   1 
ATOM   3768 O O   . GLU A 1 494 ? 89.089 154.553 -37.441 1.00 94.30  ? 491 GLU A O   1 
ATOM   3769 C CB  . GLU A 1 494 ? 89.106 156.198 -34.788 1.00 85.82  ? 491 GLU A CB  1 
ATOM   3770 C CG  . GLU A 1 494 ? 88.815 156.508 -33.325 1.00 73.97  ? 491 GLU A CG  1 
ATOM   3771 C CD  . GLU A 1 494 ? 89.902 157.334 -32.665 1.00 97.15  ? 491 GLU A CD  1 
ATOM   3772 O OE1 . GLU A 1 494 ? 90.349 158.332 -33.269 1.00 104.92 ? 491 GLU A OE1 1 
ATOM   3773 O OE2 . GLU A 1 494 ? 90.313 156.980 -31.540 1.00 97.53  ? 491 GLU A OE2 1 
ATOM   3774 N N   . PRO A 1 495 ? 87.486 156.093 -37.768 1.00 84.15  ? 492 PRO A N   1 
ATOM   3775 C CA  . PRO A 1 495 ? 87.397 155.811 -39.212 1.00 94.42  ? 492 PRO A CA  1 
ATOM   3776 C C   . PRO A 1 495 ? 88.708 155.943 -39.971 1.00 110.32 ? 492 PRO A C   1 
ATOM   3777 O O   . PRO A 1 495 ? 88.883 155.267 -40.993 1.00 108.92 ? 492 PRO A O   1 
ATOM   3778 C CB  . PRO A 1 495 ? 86.363 156.837 -39.700 1.00 90.41  ? 492 PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 495 ? 85.583 157.211 -38.473 1.00 78.27  ? 492 PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 495 ? 86.574 157.172 -37.354 1.00 72.07  ? 492 PRO A CD  1 
ATOM   3781 N N   . ARG A 1 496 ? 89.632 156.786 -39.518 1.00 109.04 ? 493 ARG A N   1 
ATOM   3782 C CA  . ARG A 1 496 ? 90.878 157.037 -40.235 1.00 107.89 ? 493 ARG A CA  1 
ATOM   3783 C C   . ARG A 1 496 ? 92.077 156.839 -39.323 1.00 109.14 ? 493 ARG A C   1 
ATOM   3784 O O   . ARG A 1 496 ? 93.048 157.600 -39.375 1.00 115.61 ? 493 ARG A O   1 
ATOM   3785 C CB  . ARG A 1 496 ? 90.899 158.449 -40.817 1.00 103.90 ? 493 ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 496 ? 89.655 158.859 -41.583 1.00 110.00 ? 493 ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 496 ? 89.560 160.376 -41.651 1.00 108.79 ? 493 ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 496 ? 88.528 160.833 -42.576 1.00 112.40 ? 493 ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 496 ? 88.766 161.210 -43.828 1.00 122.63 ? 493 ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 496 ? 90.003 161.186 -44.305 1.00 124.37 ? 493 ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 496 ? 87.768 161.613 -44.602 1.00 122.68 ? 493 ARG A NH2 1 
ATOM   3792 N N   . ASP A 1 497 ? 92.046 155.812 -38.475 1.00 106.88 ? 494 ASP A N   1 
ATOM   3793 C CA  . ASP A 1 497 ? 92.987 155.710 -37.362 1.00 107.67 ? 494 ASP A CA  1 
ATOM   3794 C C   . ASP A 1 497 ? 93.441 154.275 -37.124 1.00 115.66 ? 494 ASP A C   1 
ATOM   3795 O O   . ASP A 1 497 ? 92.729 153.491 -36.475 1.00 115.29 ? 494 ASP A O   1 
ATOM   3796 C CB  . ASP A 1 497 ? 92.361 156.288 -36.096 1.00 102.92 ? 494 ASP A CB  1 
ATOM   3797 C CG  . ASP A 1 497 ? 93.368 156.501 -34.992 1.00 109.23 ? 494 ASP A CG  1 
ATOM   3798 O OD1 . ASP A 1 497 ? 93.844 157.644 -34.846 1.00 111.65 ? 494 ASP A OD1 1 
ATOM   3799 O OD2 . ASP A 1 497 ? 93.680 155.532 -34.269 1.00 107.58 ? 494 ASP A OD2 1 
ATOM   3800 N N   . PRO A 1 498 ? 94.609 153.891 -37.636 1.00 118.64 ? 495 PRO A N   1 
ATOM   3801 C CA  . PRO A 1 498 ? 95.282 152.675 -37.155 1.00 111.65 ? 495 PRO A CA  1 
ATOM   3802 C C   . PRO A 1 498 ? 96.271 152.904 -36.019 1.00 109.38 ? 495 PRO A C   1 
ATOM   3803 O O   . PRO A 1 498 ? 97.030 151.983 -35.702 1.00 103.28 ? 495 PRO A O   1 
ATOM   3804 C CB  . PRO A 1 498 ? 96.024 152.180 -38.410 1.00 102.67 ? 495 PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 498 ? 95.553 153.053 -39.552 1.00 105.40 ? 495 PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 498 ? 95.164 154.342 -38.918 1.00 110.91 ? 495 PRO A CD  1 
ATOM   3807 N N   . LYS A 1 499 ? 96.295 154.097 -35.417 1.00 108.29 ? 496 LYS A N   1 
ATOM   3808 C CA  . LYS A 1 499 ? 97.187 154.347 -34.288 1.00 108.90 ? 496 LYS A CA  1 
ATOM   3809 C C   . LYS A 1 499 ? 96.864 153.415 -33.126 1.00 110.91 ? 496 LYS A C   1 
ATOM   3810 O O   . LYS A 1 499 ? 97.733 152.686 -32.632 1.00 102.53 ? 496 LYS A O   1 
ATOM   3811 C CB  . LYS A 1 499 ? 97.092 155.811 -33.850 1.00 99.46  ? 496 LYS A CB  1 
ATOM   3812 C CG  . LYS A 1 499 ? 97.886 156.783 -34.714 1.00 92.68  ? 496 LYS A CG  1 
ATOM   3813 C CD  . LYS A 1 499 ? 97.957 158.165 -34.075 1.00 92.78  ? 496 LYS A CD  1 
ATOM   3814 C CE  . LYS A 1 499 ? 96.585 158.815 -33.999 1.00 97.77  ? 496 LYS A CE  1 
ATOM   3815 N NZ  . LYS A 1 499 ? 96.601 160.102 -33.250 1.00 76.36  ? 496 LYS A NZ  1 
ATOM   3816 N N   . ALA A 1 500 ? 95.616 153.428 -32.677 1.00 113.72 ? 497 ALA A N   1 
ATOM   3817 C CA  . ALA A 1 500 ? 95.171 152.474 -31.677 1.00 101.19 ? 497 ALA A CA  1 
ATOM   3818 C C   . ALA A 1 500 ? 94.866 151.130 -32.337 1.00 95.98  ? 497 ALA A C   1 
ATOM   3819 O O   . ALA A 1 500 ? 94.491 151.082 -33.512 1.00 91.36  ? 497 ALA A O   1 
ATOM   3820 C CB  . ALA A 1 500 ? 93.931 152.994 -30.958 1.00 90.97  ? 497 ALA A CB  1 
ATOM   3821 N N   . PRO A 1 501 ? 95.036 150.025 -31.610 1.00 91.84  ? 498 PRO A N   1 
ATOM   3822 C CA  . PRO A 1 501 ? 94.748 148.711 -32.196 1.00 82.99  ? 498 PRO A CA  1 
ATOM   3823 C C   . PRO A 1 501 ? 93.291 148.598 -32.617 1.00 66.98  ? 498 PRO A C   1 
ATOM   3824 O O   . PRO A 1 501 ? 92.396 149.189 -32.010 1.00 67.28  ? 498 PRO A O   1 
ATOM   3825 C CB  . PRO A 1 501 ? 95.082 147.734 -31.062 1.00 78.54  ? 498 PRO A CB  1 
ATOM   3826 C CG  . PRO A 1 501 ? 96.030 148.482 -30.184 1.00 80.67  ? 498 PRO A CG  1 
ATOM   3827 C CD  . PRO A 1 501 ? 95.585 149.913 -30.248 1.00 77.00  ? 498 PRO A CD  1 
ATOM   3828 N N   . GLN A 1 502 ? 93.061 147.826 -33.674 1.00 63.87  ? 499 GLN A N   1 
ATOM   3829 C CA  . GLN A 1 502 ? 91.730 147.724 -34.247 1.00 63.17  ? 499 GLN A CA  1 
ATOM   3830 C C   . GLN A 1 502 ? 90.863 146.748 -33.456 1.00 55.96  ? 499 GLN A C   1 
ATOM   3831 O O   . GLN A 1 502 ? 91.352 145.860 -32.752 1.00 54.67  ? 499 GLN A O   1 
ATOM   3832 C CB  . GLN A 1 502 ? 91.804 147.290 -35.712 1.00 60.45  ? 499 GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 502 ? 92.434 148.325 -36.630 1.00 69.76  ? 499 GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 502 ? 91.679 149.640 -36.630 1.00 69.95  ? 499 GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 502 ? 90.595 149.748 -37.203 1.00 56.35  ? 499 GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 502 ? 92.249 150.649 -35.981 1.00 67.61  ? 499 GLN A NE2 1 
ATOM   3837 N N   . TRP A 1 503 ? 89.548 146.935 -33.583 1.00 50.41  ? 500 TRP A N   1 
ATOM   3838 C CA  . TRP A 1 503 ? 88.543 146.085 -32.964 1.00 47.42  ? 500 TRP A CA  1 
ATOM   3839 C C   . TRP A 1 503 ? 87.969 145.171 -34.038 1.00 45.72  ? 500 TRP A C   1 
ATOM   3840 O O   . TRP A 1 503 ? 87.106 145.604 -34.817 1.00 46.56  ? 500 TRP A O   1 
ATOM   3841 C CB  . TRP A 1 503 ? 87.442 146.941 -32.328 1.00 51.47  ? 500 TRP A CB  1 
ATOM   3842 C CG  . TRP A 1 503 ? 86.385 146.196 -31.550 1.00 47.87  ? 500 TRP A CG  1 
ATOM   3843 C CD1 . TRP A 1 503 ? 86.015 144.888 -31.692 1.00 45.57  ? 500 TRP A CD1 1 
ATOM   3844 C CD2 . TRP A 1 503 ? 85.562 146.732 -30.506 1.00 45.00  ? 500 TRP A CD2 1 
ATOM   3845 N NE1 . TRP A 1 503 ? 85.013 144.580 -30.805 1.00 44.54  ? 500 TRP A NE1 1 
ATOM   3846 C CE2 . TRP A 1 503 ? 84.717 145.694 -30.066 1.00 48.82  ? 500 TRP A CE2 1 
ATOM   3847 C CE3 . TRP A 1 503 ? 85.458 147.989 -29.903 1.00 45.61  ? 500 TRP A CE3 1 
ATOM   3848 C CZ2 . TRP A 1 503 ? 83.783 145.874 -29.048 1.00 49.67  ? 500 TRP A CZ2 1 
ATOM   3849 C CZ3 . TRP A 1 503 ? 84.529 148.166 -28.894 1.00 47.18  ? 500 TRP A CZ3 1 
ATOM   3850 C CH2 . TRP A 1 503 ? 83.704 147.115 -28.477 1.00 49.10  ? 500 TRP A CH2 1 
ATOM   3851 N N   . PRO A 1 504 ? 88.404 143.912 -34.129 1.00 40.44  ? 501 PRO A N   1 
ATOM   3852 C CA  . PRO A 1 504 ? 87.920 143.054 -35.207 1.00 37.32  ? 501 PRO A CA  1 
ATOM   3853 C C   . PRO A 1 504 ? 86.483 142.643 -34.968 1.00 36.14  ? 501 PRO A C   1 
ATOM   3854 O O   . PRO A 1 504 ? 86.048 142.485 -33.813 1.00 46.03  ? 501 PRO A O   1 
ATOM   3855 C CB  . PRO A 1 504 ? 88.869 141.844 -35.146 1.00 41.75  ? 501 PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 504 ? 89.293 141.789 -33.720 1.00 45.05  ? 501 PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 504 ? 89.370 143.221 -33.257 1.00 38.49  ? 501 PRO A CD  1 
ATOM   3858 N N   . PRO A 1 505 ? 85.695 142.463 -36.028 1.00 37.12  ? 502 PRO A N   1 
ATOM   3859 C CA  . PRO A 1 505 ? 84.313 142.006 -35.856 1.00 39.07  ? 502 PRO A CA  1 
ATOM   3860 C C   . PRO A 1 505 ? 84.251 140.615 -35.241 1.00 41.86  ? 502 PRO A C   1 
ATOM   3861 O O   . PRO A 1 505 ? 85.220 139.853 -35.248 1.00 44.65  ? 502 PRO A O   1 
ATOM   3862 C CB  . PRO A 1 505 ? 83.755 142.006 -37.285 1.00 27.94  ? 502 PRO A CB  1 
ATOM   3863 C CG  . PRO A 1 505 ? 84.627 142.963 -38.032 1.00 42.37  ? 502 PRO A CG  1 
ATOM   3864 C CD  . PRO A 1 505 ? 85.992 142.817 -37.427 1.00 37.96  ? 502 PRO A CD  1 
ATOM   3865 N N   . TYR A 1 506 ? 83.081 140.294 -34.698 1.00 44.10  ? 503 TYR A N   1 
ATOM   3866 C CA  . TYR A 1 506 ? 82.823 138.986 -34.113 1.00 39.91  ? 503 TYR A CA  1 
ATOM   3867 C C   . TYR A 1 506 ? 82.181 138.085 -35.160 1.00 46.63  ? 503 TYR A C   1 
ATOM   3868 O O   . TYR A 1 506 ? 81.193 138.468 -35.795 1.00 50.54  ? 503 TYR A O   1 
ATOM   3869 C CB  . TYR A 1 506 ? 81.917 139.119 -32.886 1.00 45.81  ? 503 TYR A CB  1 
ATOM   3870 C CG  . TYR A 1 506 ? 81.547 137.810 -32.217 1.00 37.42  ? 503 TYR A CG  1 
ATOM   3871 C CD1 . TYR A 1 506 ? 80.429 137.091 -32.623 1.00 32.91  ? 503 TYR A CD1 1 
ATOM   3872 C CD2 . TYR A 1 506 ? 82.303 137.305 -31.167 1.00 33.60  ? 503 TYR A CD2 1 
ATOM   3873 C CE1 . TYR A 1 506 ? 80.084 135.901 -32.014 1.00 34.77  ? 503 TYR A CE1 1 
ATOM   3874 C CE2 . TYR A 1 506 ? 81.962 136.116 -30.548 1.00 29.03  ? 503 TYR A CE2 1 
ATOM   3875 C CZ  . TYR A 1 506 ? 80.852 135.419 -30.976 1.00 36.12  ? 503 TYR A CZ  1 
ATOM   3876 O OH  . TYR A 1 506 ? 80.509 134.234 -30.365 1.00 36.29  ? 503 TYR A OH  1 
ATOM   3877 N N   . THR A 1 507 ? 82.748 136.895 -35.342 1.00 37.68  ? 504 THR A N   1 
ATOM   3878 C CA  . THR A 1 507 ? 82.241 135.921 -36.294 1.00 45.42  ? 504 THR A CA  1 
ATOM   3879 C C   . THR A 1 507 ? 81.954 134.604 -35.584 1.00 40.21  ? 504 THR A C   1 
ATOM   3880 O O   . THR A 1 507 ? 82.508 134.314 -34.521 1.00 43.95  ? 504 THR A O   1 
ATOM   3881 C CB  . THR A 1 507 ? 83.232 135.691 -37.445 1.00 43.47  ? 504 THR A CB  1 
ATOM   3882 O OG1 . THR A 1 507 ? 84.529 135.392 -36.910 1.00 36.20  ? 504 THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 507 ? 83.322 136.928 -38.328 1.00 27.76  ? 504 THR A CG2 1 
ATOM   3884 N N   . ALA A 1 508 ? 81.069 133.805 -36.185 1.00 32.65  ? 505 ALA A N   1 
ATOM   3885 C CA  . ALA A 1 508 ? 80.717 132.516 -35.602 1.00 37.77  ? 505 ALA A CA  1 
ATOM   3886 C C   . ALA A 1 508 ? 81.894 131.551 -35.571 1.00 53.28  ? 505 ALA A C   1 
ATOM   3887 O O   . ALA A 1 508 ? 81.876 130.597 -34.786 1.00 56.02  ? 505 ALA A O   1 
ATOM   3888 C CB  . ALA A 1 508 ? 79.550 131.892 -36.368 1.00 38.19  ? 505 ALA A CB  1 
ATOM   3889 N N   . GLY A 1 509 ? 82.912 131.777 -36.399 1.00 40.84  ? 506 GLY A N   1 
ATOM   3890 C CA  . GLY A 1 509 ? 84.074 130.912 -36.425 1.00 32.02  ? 506 GLY A CA  1 
ATOM   3891 C C   . GLY A 1 509 ? 85.199 131.384 -35.527 1.00 38.86  ? 506 GLY A C   1 
ATOM   3892 O O   . GLY A 1 509 ? 85.599 130.675 -34.598 1.00 49.21  ? 506 GLY A O   1 
ATOM   3893 N N   . ALA A 1 510 ? 85.719 132.585 -35.793 1.00 36.98  ? 507 ALA A N   1 
ATOM   3894 C CA  . ALA A 1 510 ? 86.842 133.091 -35.010 1.00 38.15  ? 507 ALA A CA  1 
ATOM   3895 C C   . ALA A 1 510 ? 86.406 133.503 -33.609 1.00 47.44  ? 507 ALA A C   1 
ATOM   3896 O O   . ALA A 1 510 ? 87.160 133.330 -32.644 1.00 46.84  ? 507 ALA A O   1 
ATOM   3897 C CB  . ALA A 1 510 ? 87.503 134.263 -35.735 1.00 34.03  ? 507 ALA A CB  1 
ATOM   3898 N N   . GLN A 1 511 ? 85.196 134.054 -33.481 1.00 47.64  ? 508 GLN A N   1 
ATOM   3899 C CA  . GLN A 1 511 ? 84.627 134.446 -32.189 1.00 41.54  ? 508 GLN A CA  1 
ATOM   3900 C C   . GLN A 1 511 ? 85.535 135.435 -31.459 1.00 38.32  ? 508 GLN A C   1 
ATOM   3901 O O   . GLN A 1 511 ? 85.836 135.284 -30.273 1.00 50.07  ? 508 GLN A O   1 
ATOM   3902 C CB  . GLN A 1 511 ? 84.341 133.217 -31.320 1.00 39.14  ? 508 GLN A CB  1 
ATOM   3903 C CG  . GLN A 1 511 ? 83.436 132.191 -31.980 1.00 48.57  ? 508 GLN A CG  1 
ATOM   3904 C CD  . GLN A 1 511 ? 83.232 130.959 -31.123 1.00 49.28  ? 508 GLN A CD  1 
ATOM   3905 O OE1 . GLN A 1 511 ? 83.305 131.023 -29.896 1.00 49.53  ? 508 GLN A OE1 1 
ATOM   3906 N NE2 . GLN A 1 511 ? 82.982 129.824 -31.766 1.00 51.91  ? 508 GLN A NE2 1 
ATOM   3907 N N   . GLN A 1 512 ? 85.967 136.464 -32.182 1.00 43.38  ? 509 GLN A N   1 
ATOM   3908 C CA  . GLN A 1 512 ? 86.893 137.449 -31.643 1.00 43.32  ? 509 GLN A CA  1 
ATOM   3909 C C   . GLN A 1 512 ? 86.149 138.534 -30.876 1.00 46.16  ? 509 GLN A C   1 
ATOM   3910 O O   . GLN A 1 512 ? 85.063 138.965 -31.274 1.00 46.65  ? 509 GLN A O   1 
ATOM   3911 C CB  . GLN A 1 512 ? 87.719 138.084 -32.761 1.00 47.61  ? 509 GLN A CB  1 
ATOM   3912 C CG  . GLN A 1 512 ? 88.636 137.117 -33.485 1.00 49.31  ? 509 GLN A CG  1 
ATOM   3913 C CD  . GLN A 1 512 ? 89.388 137.777 -34.621 1.00 40.41  ? 509 GLN A CD  1 
ATOM   3914 O OE1 . GLN A 1 512 ? 90.499 138.275 -34.439 1.00 40.30  ? 509 GLN A OE1 1 
ATOM   3915 N NE2 . GLN A 1 512 ? 88.784 137.788 -35.804 1.00 44.31  ? 509 GLN A NE2 1 
ATOM   3916 N N   . TYR A 1 513 ? 86.750 138.972 -29.773 1.00 42.79  ? 510 TYR A N   1 
ATOM   3917 C CA  . TYR A 1 513 ? 86.236 140.084 -28.990 1.00 39.88  ? 510 TYR A CA  1 
ATOM   3918 C C   . TYR A 1 513 ? 87.422 140.817 -28.382 1.00 40.80  ? 510 TYR A C   1 
ATOM   3919 O O   . TYR A 1 513 ? 88.552 140.323 -28.390 1.00 48.31  ? 510 TYR A O   1 
ATOM   3920 C CB  . TYR A 1 513 ? 85.260 139.609 -27.906 1.00 39.57  ? 510 TYR A CB  1 
ATOM   3921 C CG  . TYR A 1 513 ? 85.903 138.800 -26.801 1.00 39.23  ? 510 TYR A CG  1 
ATOM   3922 C CD1 . TYR A 1 513 ? 86.117 137.435 -26.946 1.00 40.34  ? 510 TYR A CD1 1 
ATOM   3923 C CD2 . TYR A 1 513 ? 86.287 139.400 -25.609 1.00 40.15  ? 510 TYR A CD2 1 
ATOM   3924 C CE1 . TYR A 1 513 ? 86.702 136.693 -25.937 1.00 41.59  ? 510 TYR A CE1 1 
ATOM   3925 C CE2 . TYR A 1 513 ? 86.874 138.666 -24.596 1.00 41.30  ? 510 TYR A CE2 1 
ATOM   3926 C CZ  . TYR A 1 513 ? 87.077 137.314 -24.764 1.00 40.39  ? 510 TYR A CZ  1 
ATOM   3927 O OH  . TYR A 1 513 ? 87.659 136.581 -23.756 1.00 48.24  ? 510 TYR A OH  1 
ATOM   3928 N N   . VAL A 1 514 ? 87.158 142.008 -27.855 1.00 33.72  ? 511 VAL A N   1 
ATOM   3929 C CA  . VAL A 1 514 ? 88.198 142.816 -27.233 1.00 35.47  ? 511 VAL A CA  1 
ATOM   3930 C C   . VAL A 1 514 ? 87.864 143.005 -25.761 1.00 31.91  ? 511 VAL A C   1 
ATOM   3931 O O   . VAL A 1 514 ? 86.698 142.979 -25.356 1.00 32.12  ? 511 VAL A O   1 
ATOM   3932 C CB  . VAL A 1 514 ? 88.374 144.183 -27.931 1.00 45.83  ? 511 VAL A CB  1 
ATOM   3933 C CG1 . VAL A 1 514 ? 88.672 143.992 -29.412 1.00 40.28  ? 511 VAL A CG1 1 
ATOM   3934 C CG2 . VAL A 1 514 ? 87.140 145.048 -27.732 1.00 38.81  ? 511 VAL A CG2 1 
ATOM   3935 N N   . SER A 1 515 ? 88.906 143.185 -24.956 1.00 40.31  ? 512 SER A N   1 
ATOM   3936 C CA  . SER A 1 515 ? 88.747 143.484 -23.541 1.00 42.72  ? 512 SER A CA  1 
ATOM   3937 C C   . SER A 1 515 ? 88.783 144.993 -23.343 1.00 38.06  ? 512 SER A C   1 
ATOM   3938 O O   . SER A 1 515 ? 89.637 145.681 -23.913 1.00 36.97  ? 512 SER A O   1 
ATOM   3939 C CB  . SER A 1 515 ? 89.842 142.808 -22.716 1.00 38.08  ? 512 SER A CB  1 
ATOM   3940 O OG  . SER A 1 515 ? 91.129 143.246 -23.117 1.00 41.95  ? 512 SER A OG  1 
ATOM   3941 N N   . LEU A 1 516 ? 87.853 145.504 -22.544 1.00 39.18  ? 513 LEU A N   1 
ATOM   3942 C CA  . LEU A 1 516 ? 87.735 146.935 -22.279 1.00 33.53  ? 513 LEU A CA  1 
ATOM   3943 C C   . LEU A 1 516 ? 88.209 147.201 -20.855 1.00 29.95  ? 513 LEU A C   1 
ATOM   3944 O O   . LEU A 1 516 ? 87.504 146.898 -19.888 1.00 36.91  ? 513 LEU A O   1 
ATOM   3945 C CB  . LEU A 1 516 ? 86.301 147.411 -22.491 1.00 30.30  ? 513 LEU A CB  1 
ATOM   3946 C CG  . LEU A 1 516 ? 85.753 147.307 -23.916 1.00 30.85  ? 513 LEU A CG  1 
ATOM   3947 C CD1 . LEU A 1 516 ? 84.310 147.781 -23.972 1.00 21.86  ? 513 LEU A CD1 1 
ATOM   3948 C CD2 . LEU A 1 516 ? 86.616 148.101 -24.884 1.00 31.34  ? 513 LEU A CD2 1 
ATOM   3949 N N   . ASP A 1 517 ? 89.408 147.760 -20.731 1.00 30.12  ? 514 ASP A N   1 
ATOM   3950 C CA  . ASP A 1 517 ? 89.939 148.196 -19.447 1.00 32.11  ? 514 ASP A CA  1 
ATOM   3951 C C   . ASP A 1 517 ? 90.894 149.358 -19.701 1.00 40.26  ? 514 ASP A C   1 
ATOM   3952 O O   . ASP A 1 517 ? 90.937 149.918 -20.800 1.00 38.47  ? 514 ASP A O   1 
ATOM   3953 C CB  . ASP A 1 517 ? 90.607 147.030 -18.702 1.00 37.74  ? 514 ASP A CB  1 
ATOM   3954 C CG  . ASP A 1 517 ? 91.588 146.257 -19.567 1.00 51.14  ? 514 ASP A CG  1 
ATOM   3955 O OD1 . ASP A 1 517 ? 92.169 146.847 -20.502 1.00 50.57  ? 514 ASP A OD1 1 
ATOM   3956 O OD2 . ASP A 1 517 ? 91.781 145.051 -19.306 1.00 58.00  ? 514 ASP A OD2 1 
ATOM   3957 N N   . LEU A 1 518 ? 91.667 149.719 -18.674 1.00 32.31  ? 515 LEU A N   1 
ATOM   3958 C CA  . LEU A 1 518 ? 92.590 150.842 -18.806 1.00 35.57  ? 515 LEU A CA  1 
ATOM   3959 C C   . LEU A 1 518 ? 93.684 150.553 -19.826 1.00 44.85  ? 515 LEU A C   1 
ATOM   3960 O O   . LEU A 1 518 ? 94.215 151.482 -20.447 1.00 48.89  ? 515 LEU A O   1 
ATOM   3961 C CB  . LEU A 1 518 ? 93.203 151.178 -17.447 1.00 30.63  ? 515 LEU A CB  1 
ATOM   3962 C CG  . LEU A 1 518 ? 92.202 151.438 -16.318 1.00 39.09  ? 515 LEU A CG  1 
ATOM   3963 C CD1 . LEU A 1 518 ? 92.919 151.824 -15.033 1.00 33.44  ? 515 LEU A CD1 1 
ATOM   3964 C CD2 . LEU A 1 518 ? 91.204 152.512 -16.721 1.00 34.33  ? 515 LEU A CD2 1 
ATOM   3965 N N   . ARG A 1 519 ? 94.032 149.282 -20.014 1.00 48.98  ? 516 ARG A N   1 
ATOM   3966 C CA  . ARG A 1 519 ? 95.021 148.910 -21.007 1.00 40.10  ? 516 ARG A CA  1 
ATOM   3967 C C   . ARG A 1 519 ? 94.454 149.099 -22.413 1.00 47.13  ? 516 ARG A C   1 
ATOM   3968 O O   . ARG A 1 519 ? 93.236 149.159 -22.599 1.00 49.98  ? 516 ARG A O   1 
ATOM   3969 C CB  . ARG A 1 519 ? 95.452 147.459 -20.807 1.00 47.03  ? 516 ARG A CB  1 
ATOM   3970 C CG  . ARG A 1 519 ? 96.003 147.153 -19.424 1.00 48.29  ? 516 ARG A CG  1 
ATOM   3971 C CD  . ARG A 1 519 ? 96.409 145.690 -19.292 1.00 65.29  ? 516 ARG A CD  1 
ATOM   3972 N NE  . ARG A 1 519 ? 95.290 144.780 -19.525 1.00 65.92  ? 516 ARG A NE  1 
ATOM   3973 C CZ  . ARG A 1 519 ? 95.127 144.060 -20.631 1.00 69.27  ? 516 ARG A CZ  1 
ATOM   3974 N NH1 . ARG A 1 519 ? 96.016 144.136 -21.611 1.00 68.22  ? 516 ARG A NH1 1 
ATOM   3975 N NH2 . ARG A 1 519 ? 94.076 143.260 -20.755 1.00 61.74  ? 516 ARG A NH2 1 
ATOM   3976 N N   . PRO A 1 520 ? 95.321 149.209 -23.420 1.00 46.31  ? 517 PRO A N   1 
ATOM   3977 C CA  . PRO A 1 520 ? 94.841 149.245 -24.807 1.00 39.56  ? 517 PRO A CA  1 
ATOM   3978 C C   . PRO A 1 520 ? 94.074 147.979 -25.162 1.00 44.30  ? 517 PRO A C   1 
ATOM   3979 O O   . PRO A 1 520 ? 94.094 146.975 -24.446 1.00 51.32  ? 517 PRO A O   1 
ATOM   3980 C CB  . PRO A 1 520 ? 96.129 149.371 -25.626 1.00 42.41  ? 517 PRO A CB  1 
ATOM   3981 C CG  . PRO A 1 520 ? 97.095 150.021 -24.697 1.00 52.28  ? 517 PRO A CG  1 
ATOM   3982 C CD  . PRO A 1 520 ? 96.766 149.484 -23.332 1.00 50.37  ? 517 PRO A CD  1 
ATOM   3983 N N   . LEU A 1 521 ? 93.386 148.042 -26.301 1.00 44.45  ? 518 LEU A N   1 
ATOM   3984 C CA  . LEU A 1 521 ? 92.556 146.928 -26.739 1.00 46.93  ? 518 LEU A CA  1 
ATOM   3985 C C   . LEU A 1 521 ? 93.381 145.658 -26.895 1.00 54.75  ? 518 LEU A C   1 
ATOM   3986 O O   . LEU A 1 521 ? 94.496 145.677 -27.425 1.00 53.66  ? 518 LEU A O   1 
ATOM   3987 C CB  . LEU A 1 521 ? 91.864 147.264 -28.061 1.00 43.31  ? 518 LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 521 ? 90.660 148.204 -27.999 1.00 43.10  ? 518 LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 521 ? 90.007 148.323 -29.368 1.00 50.94  ? 518 LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 521 ? 89.657 147.724 -26.962 1.00 40.02  ? 518 LEU A CD2 1 
ATOM   3991 N N   . GLU A 1 522 ? 92.822 144.548 -26.420 1.00 54.07  ? 519 GLU A N   1 
ATOM   3992 C CA  . GLU A 1 522 ? 93.440 143.233 -26.531 1.00 40.36  ? 519 GLU A CA  1 
ATOM   3993 C C   . GLU A 1 522 ? 92.413 142.278 -27.116 1.00 43.34  ? 519 GLU A C   1 
ATOM   3994 O O   . GLU A 1 522 ? 91.317 142.133 -26.567 1.00 52.88  ? 519 GLU A O   1 
ATOM   3995 C CB  . GLU A 1 522 ? 93.930 142.735 -25.168 1.00 49.61  ? 519 GLU A CB  1 
ATOM   3996 C CG  . GLU A 1 522 ? 94.448 141.307 -25.172 1.00 54.36  ? 519 GLU A CG  1 
ATOM   3997 C CD  . GLU A 1 522 ? 94.825 140.825 -23.785 1.00 66.47  ? 519 GLU A CD  1 
ATOM   3998 O OE1 . GLU A 1 522 ? 94.839 141.654 -22.851 1.00 65.45  ? 519 GLU A OE1 1 
ATOM   3999 O OE2 . GLU A 1 522 ? 95.103 139.617 -23.628 1.00 63.52  ? 519 GLU A OE2 1 
ATOM   4000 N N   . VAL A 1 523 ? 92.762 141.636 -28.225 1.00 44.08  ? 520 VAL A N   1 
ATOM   4001 C CA  . VAL A 1 523 ? 91.848 140.740 -28.922 1.00 45.06  ? 520 VAL A CA  1 
ATOM   4002 C C   . VAL A 1 523 ? 91.943 139.353 -28.305 1.00 49.88  ? 520 VAL A C   1 
ATOM   4003 O O   . VAL A 1 523 ? 93.042 138.817 -28.117 1.00 54.22  ? 520 VAL A O   1 
ATOM   4004 C CB  . VAL A 1 523 ? 92.159 140.695 -30.427 1.00 42.23  ? 520 VAL A CB  1 
ATOM   4005 C CG1 . VAL A 1 523 ? 91.182 139.772 -31.141 1.00 42.44  ? 520 VAL A CG1 1 
ATOM   4006 C CG2 . VAL A 1 523 ? 92.108 142.093 -31.018 1.00 36.22  ? 520 VAL A CG2 1 
ATOM   4007 N N   . ARG A 1 524 ? 90.790 138.774 -27.984 1.00 44.84  ? 521 ARG A N   1 
ATOM   4008 C CA  . ARG A 1 524 ? 90.691 137.416 -27.474 1.00 45.61  ? 521 ARG A CA  1 
ATOM   4009 C C   . ARG A 1 524 ? 89.688 136.651 -28.329 1.00 41.86  ? 521 ARG A C   1 
ATOM   4010 O O   . ARG A 1 524 ? 89.056 137.209 -29.230 1.00 45.87  ? 521 ARG A O   1 
ATOM   4011 C CB  . ARG A 1 524 ? 90.290 137.411 -25.994 1.00 44.14  ? 521 ARG A CB  1 
ATOM   4012 C CG  . ARG A 1 524 ? 91.251 138.182 -25.108 1.00 46.70  ? 521 ARG A CG  1 
ATOM   4013 C CD  . ARG A 1 524 ? 90.705 138.355 -23.705 1.00 53.80  ? 521 ARG A CD  1 
ATOM   4014 N NE  . ARG A 1 524 ? 91.551 139.238 -22.909 1.00 51.20  ? 521 ARG A NE  1 
ATOM   4015 C CZ  . ARG A 1 524 ? 91.249 139.658 -21.686 1.00 42.06  ? 521 ARG A CZ  1 
ATOM   4016 N NH1 . ARG A 1 524 ? 90.116 139.275 -21.115 1.00 38.36  ? 521 ARG A NH1 1 
ATOM   4017 N NH2 . ARG A 1 524 ? 92.079 140.463 -21.036 1.00 42.68  ? 521 ARG A NH2 1 
ATOM   4018 N N   . ARG A 1 525 ? 89.542 135.360 -28.045 1.00 37.85  ? 522 ARG A N   1 
ATOM   4019 C CA  . ARG A 1 525 ? 88.687 134.484 -28.836 1.00 45.09  ? 522 ARG A CA  1 
ATOM   4020 C C   . ARG A 1 525 ? 87.801 133.661 -27.916 1.00 45.42  ? 522 ARG A C   1 
ATOM   4021 O O   . ARG A 1 525 ? 88.279 133.097 -26.927 1.00 50.73  ? 522 ARG A O   1 
ATOM   4022 C CB  . ARG A 1 525 ? 89.520 133.559 -29.727 1.00 53.05  ? 522 ARG A CB  1 
ATOM   4023 C CG  . ARG A 1 525 ? 90.206 134.251 -30.892 1.00 56.20  ? 522 ARG A CG  1 
ATOM   4024 C CD  . ARG A 1 525 ? 91.008 133.243 -31.693 1.00 54.00  ? 522 ARG A CD  1 
ATOM   4025 N NE  . ARG A 1 525 ? 90.233 132.030 -31.941 1.00 62.64  ? 522 ARG A NE  1 
ATOM   4026 C CZ  . ARG A 1 525 ? 89.766 131.667 -33.131 1.00 62.72  ? 522 ARG A CZ  1 
ATOM   4027 N NH1 . ARG A 1 525 ? 90.006 132.416 -34.198 1.00 67.72  ? 522 ARG A NH1 1 
ATOM   4028 N NH2 . ARG A 1 525 ? 89.066 130.547 -33.254 1.00 49.97  ? 522 ARG A NH2 1 
ATOM   4029 N N   . GLY A 1 526 ? 86.515 133.588 -28.251 1.00 44.83  ? 523 GLY A N   1 
ATOM   4030 C CA  . GLY A 1 526 ? 85.581 132.772 -27.502 1.00 35.31  ? 523 GLY A CA  1 
ATOM   4031 C C   . GLY A 1 526 ? 85.071 133.427 -26.235 1.00 44.94  ? 523 GLY A C   1 
ATOM   4032 O O   . GLY A 1 526 ? 85.846 133.720 -25.320 1.00 49.23  ? 523 GLY A O   1 
ATOM   4033 N N   . LEU A 1 527 ? 83.760 133.662 -26.175 1.00 47.96  ? 524 LEU A N   1 
ATOM   4034 C CA  . LEU A 1 527 ? 83.116 134.205 -24.978 1.00 47.10  ? 524 LEU A CA  1 
ATOM   4035 C C   . LEU A 1 527 ? 82.676 133.034 -24.104 1.00 44.13  ? 524 LEU A C   1 
ATOM   4036 O O   . LEU A 1 527 ? 81.507 132.643 -24.070 1.00 40.94  ? 524 LEU A O   1 
ATOM   4037 C CB  . LEU A 1 527 ? 81.946 135.102 -25.360 1.00 41.91  ? 524 LEU A CB  1 
ATOM   4038 C CG  . LEU A 1 527 ? 82.307 136.431 -26.023 1.00 40.51  ? 524 LEU A CG  1 
ATOM   4039 C CD1 . LEU A 1 527 ? 81.223 136.854 -26.999 1.00 51.50  ? 524 LEU A CD1 1 
ATOM   4040 C CD2 . LEU A 1 527 ? 82.516 137.499 -24.967 1.00 43.05  ? 524 LEU A CD2 1 
ATOM   4041 N N   . ARG A 1 528 ? 83.645 132.473 -23.382 1.00 47.57  ? 525 ARG A N   1 
ATOM   4042 C CA  . ARG A 1 528 ? 83.447 131.277 -22.566 1.00 42.32  ? 525 ARG A CA  1 
ATOM   4043 C C   . ARG A 1 528 ? 82.847 130.152 -23.410 1.00 37.27  ? 525 ARG A C   1 
ATOM   4044 O O   . ARG A 1 528 ? 81.758 129.640 -23.146 1.00 40.52  ? 525 ARG A O   1 
ATOM   4045 C CB  . ARG A 1 528 ? 82.583 131.586 -21.339 1.00 40.53  ? 525 ARG A CB  1 
ATOM   4046 C CG  . ARG A 1 528 ? 83.125 132.727 -20.492 1.00 43.30  ? 525 ARG A CG  1 
ATOM   4047 C CD  . ARG A 1 528 ? 82.416 132.830 -19.153 1.00 46.86  ? 525 ARG A CD  1 
ATOM   4048 N NE  . ARG A 1 528 ? 83.014 133.858 -18.305 1.00 58.89  ? 525 ARG A NE  1 
ATOM   4049 C CZ  . ARG A 1 528 ? 82.641 134.110 -17.054 1.00 62.01  ? 525 ARG A CZ  1 
ATOM   4050 N NH1 . ARG A 1 528 ? 81.665 133.406 -16.496 1.00 45.30  ? 525 ARG A NH1 1 
ATOM   4051 N NH2 . ARG A 1 528 ? 83.245 135.065 -16.360 1.00 51.30  ? 525 ARG A NH2 1 
ATOM   4052 N N   . ALA A 1 529 ? 83.600 129.778 -24.448 1.00 36.82  ? 526 ALA A N   1 
ATOM   4053 C CA  . ALA A 1 529 ? 83.084 128.853 -25.453 1.00 33.92  ? 526 ALA A CA  1 
ATOM   4054 C C   . ALA A 1 529 ? 82.798 127.478 -24.860 1.00 45.51  ? 526 ALA A C   1 
ATOM   4055 O O   . ALA A 1 529 ? 81.792 126.846 -25.202 1.00 46.91  ? 526 ALA A O   1 
ATOM   4056 C CB  . ALA A 1 529 ? 84.070 128.743 -26.615 1.00 42.83  ? 526 ALA A CB  1 
ATOM   4057 N N   . GLN A 1 530 ? 83.669 126.997 -23.970 1.00 41.56  ? 527 GLN A N   1 
ATOM   4058 C CA  . GLN A 1 530 ? 83.468 125.667 -23.403 1.00 38.36  ? 527 GLN A CA  1 
ATOM   4059 C C   . GLN A 1 530 ? 82.290 125.647 -22.437 1.00 45.08  ? 527 GLN A C   1 
ATOM   4060 O O   . GLN A 1 530 ? 81.488 124.706 -22.448 1.00 44.85  ? 527 GLN A O   1 
ATOM   4061 C CB  . GLN A 1 530 ? 84.744 125.187 -22.712 1.00 39.74  ? 527 GLN A CB  1 
ATOM   4062 C CG  . GLN A 1 530 ? 85.931 125.031 -23.651 1.00 50.31  ? 527 GLN A CG  1 
ATOM   4063 C CD  . GLN A 1 530 ? 85.614 124.164 -24.856 1.00 49.81  ? 527 GLN A CD  1 
ATOM   4064 O OE1 . GLN A 1 530 ? 85.914 124.530 -25.993 1.00 53.80  ? 527 GLN A OE1 1 
ATOM   4065 N NE2 . GLN A 1 530 ? 85.009 123.006 -24.613 1.00 43.68  ? 527 GLN A NE2 1 
ATOM   4066 N N   . ALA A 1 531 ? 82.166 126.677 -21.595 1.00 39.15  ? 528 ALA A N   1 
ATOM   4067 C CA  . ALA A 1 531 ? 81.043 126.735 -20.666 1.00 31.60  ? 528 ALA A CA  1 
ATOM   4068 C C   . ALA A 1 531 ? 79.725 126.936 -21.403 1.00 35.91  ? 528 ALA A C   1 
ATOM   4069 O O   . ALA A 1 531 ? 78.709 126.324 -21.048 1.00 40.12  ? 528 ALA A O   1 
ATOM   4070 C CB  . ALA A 1 531 ? 81.262 127.850 -19.644 1.00 35.52  ? 528 ALA A CB  1 
ATOM   4071 N N   . CYS A 1 532 ? 79.720 127.782 -22.434 1.00 33.90  ? 529 CYS A N   1 
ATOM   4072 C CA  . CYS A 1 532 ? 78.491 128.060 -23.167 1.00 34.94  ? 529 CYS A CA  1 
ATOM   4073 C C   . CYS A 1 532 ? 78.077 126.919 -24.084 1.00 40.41  ? 529 CYS A C   1 
ATOM   4074 O O   . CYS A 1 532 ? 76.905 126.851 -24.469 1.00 37.76  ? 529 CYS A O   1 
ATOM   4075 C CB  . CYS A 1 532 ? 78.641 129.353 -23.968 1.00 34.64  ? 529 CYS A CB  1 
ATOM   4076 S SG  . CYS A 1 532 ? 78.634 130.814 -22.913 1.00 39.49  ? 529 CYS A SG  1 
ATOM   4077 N N   . ALA A 1 533 ? 79.001 126.027 -24.444 1.00 35.65  ? 530 ALA A N   1 
ATOM   4078 C CA  . ALA A 1 533 ? 78.598 124.810 -25.139 1.00 40.00  ? 530 ALA A CA  1 
ATOM   4079 C C   . ALA A 1 533 ? 77.761 123.914 -24.237 1.00 42.58  ? 530 ALA A C   1 
ATOM   4080 O O   . ALA A 1 533 ? 76.868 123.210 -24.720 1.00 35.98  ? 530 ALA A O   1 
ATOM   4081 C CB  . ALA A 1 533 ? 79.826 124.057 -25.646 1.00 31.91  ? 530 ALA A CB  1 
ATOM   4082 N N   . PHE A 1 534 ? 78.032 123.931 -22.930 1.00 35.98  ? 531 PHE A N   1 
ATOM   4083 C CA  . PHE A 1 534 ? 77.228 123.148 -21.999 1.00 39.11  ? 531 PHE A CA  1 
ATOM   4084 C C   . PHE A 1 534 ? 75.807 123.688 -21.905 1.00 41.62  ? 531 PHE A C   1 
ATOM   4085 O O   . PHE A 1 534 ? 74.844 122.914 -21.870 1.00 41.50  ? 531 PHE A O   1 
ATOM   4086 C CB  . PHE A 1 534 ? 77.890 123.131 -20.621 1.00 31.29  ? 531 PHE A CB  1 
ATOM   4087 C CG  . PHE A 1 534 ? 76.986 122.658 -19.519 1.00 42.62  ? 531 PHE A CG  1 
ATOM   4088 C CD1 . PHE A 1 534 ? 76.747 121.307 -19.333 1.00 40.73  ? 531 PHE A CD1 1 
ATOM   4089 C CD2 . PHE A 1 534 ? 76.379 123.565 -18.664 1.00 39.97  ? 531 PHE A CD2 1 
ATOM   4090 C CE1 . PHE A 1 534 ? 75.916 120.869 -18.319 1.00 44.21  ? 531 PHE A CE1 1 
ATOM   4091 C CE2 . PHE A 1 534 ? 75.547 123.133 -17.649 1.00 43.20  ? 531 PHE A CE2 1 
ATOM   4092 C CZ  . PHE A 1 534 ? 75.315 121.782 -17.476 1.00 47.66  ? 531 PHE A CZ  1 
ATOM   4093 N N   . TRP A 1 535 ? 75.654 125.013 -21.867 1.00 39.50  ? 532 TRP A N   1 
ATOM   4094 C CA  . TRP A 1 535 ? 74.326 125.599 -21.721 1.00 34.91  ? 532 TRP A CA  1 
ATOM   4095 C C   . TRP A 1 535 ? 73.554 125.592 -23.034 1.00 31.56  ? 532 TRP A C   1 
ATOM   4096 O O   . TRP A 1 535 ? 72.353 125.305 -23.047 1.00 34.81  ? 532 TRP A O   1 
ATOM   4097 C CB  . TRP A 1 535 ? 74.433 127.028 -21.185 1.00 32.97  ? 532 TRP A CB  1 
ATOM   4098 C CG  . TRP A 1 535 ? 75.006 127.123 -19.804 1.00 30.74  ? 532 TRP A CG  1 
ATOM   4099 C CD1 . TRP A 1 535 ? 76.266 127.524 -19.464 1.00 27.34  ? 532 TRP A CD1 1 
ATOM   4100 C CD2 . TRP A 1 535 ? 74.339 126.812 -18.575 1.00 22.78  ? 532 TRP A CD2 1 
ATOM   4101 N NE1 . TRP A 1 535 ? 76.423 127.482 -18.099 1.00 27.11  ? 532 TRP A NE1 1 
ATOM   4102 C CE2 . TRP A 1 535 ? 75.255 127.048 -17.531 1.00 22.20  ? 532 TRP A CE2 1 
ATOM   4103 C CE3 . TRP A 1 535 ? 73.056 126.358 -18.256 1.00 20.50  ? 532 TRP A CE3 1 
ATOM   4104 C CZ2 . TRP A 1 535 ? 74.929 126.844 -16.192 1.00 25.84  ? 532 TRP A CZ2 1 
ATOM   4105 C CZ3 . TRP A 1 535 ? 72.735 126.156 -16.926 1.00 19.15  ? 532 TRP A CZ3 1 
ATOM   4106 C CH2 . TRP A 1 535 ? 73.667 126.398 -15.911 1.00 25.46  ? 532 TRP A CH2 1 
ATOM   4107 N N   . ASN A 1 536 ? 74.221 125.901 -24.146 1.00 31.00  ? 533 ASN A N   1 
ATOM   4108 C CA  . ASN A 1 536 ? 73.524 126.091 -25.412 1.00 39.80  ? 533 ASN A CA  1 
ATOM   4109 C C   . ASN A 1 536 ? 73.368 124.808 -26.217 1.00 36.60  ? 533 ASN A C   1 
ATOM   4110 O O   . ASN A 1 536 ? 72.446 124.713 -27.036 1.00 45.78  ? 533 ASN A O   1 
ATOM   4111 C CB  . ASN A 1 536 ? 74.251 127.137 -26.264 1.00 34.67  ? 533 ASN A CB  1 
ATOM   4112 C CG  . ASN A 1 536 ? 74.300 128.501 -25.599 1.00 33.78  ? 533 ASN A CG  1 
ATOM   4113 O OD1 . ASN A 1 536 ? 73.464 128.824 -24.755 1.00 39.22  ? 533 ASN A OD1 1 
ATOM   4114 N ND2 . ASN A 1 536 ? 75.280 129.311 -25.983 1.00 27.48  ? 533 ASN A ND2 1 
ATOM   4115 N N   . ARG A 1 537 ? 74.237 123.818 -26.012 1.00 40.86  ? 534 ARG A N   1 
ATOM   4116 C CA  . ARG A 1 537 ? 74.221 122.604 -26.818 1.00 42.64  ? 534 ARG A CA  1 
ATOM   4117 C C   . ARG A 1 537 ? 73.801 121.376 -26.020 1.00 44.16  ? 534 ARG A C   1 
ATOM   4118 O O   . ARG A 1 537 ? 72.853 120.686 -26.405 1.00 46.97  ? 534 ARG A O   1 
ATOM   4119 C CB  . ARG A 1 537 ? 75.600 122.374 -27.454 1.00 39.91  ? 534 ARG A CB  1 
ATOM   4120 C CG  . ARG A 1 537 ? 76.081 123.507 -28.345 1.00 36.13  ? 534 ARG A CG  1 
ATOM   4121 C CD  . ARG A 1 537 ? 77.481 123.224 -28.865 1.00 40.22  ? 534 ARG A CD  1 
ATOM   4122 N NE  . ARG A 1 537 ? 78.003 124.317 -29.681 1.00 58.21  ? 534 ARG A NE  1 
ATOM   4123 C CZ  . ARG A 1 537 ? 77.894 124.380 -31.004 1.00 53.80  ? 534 ARG A CZ  1 
ATOM   4124 N NH1 . ARG A 1 537 ? 77.280 123.409 -31.668 1.00 37.29  ? 534 ARG A NH1 1 
ATOM   4125 N NH2 . ARG A 1 537 ? 78.401 125.412 -31.664 1.00 36.59  ? 534 ARG A NH2 1 
ATOM   4126 N N   . PHE A 1 538 ? 74.481 121.079 -24.911 1.00 45.12  ? 535 PHE A N   1 
ATOM   4127 C CA  . PHE A 1 538 ? 74.259 119.802 -24.239 1.00 45.61  ? 535 PHE A CA  1 
ATOM   4128 C C   . PHE A 1 538 ? 73.039 119.836 -23.324 1.00 38.44  ? 535 PHE A C   1 
ATOM   4129 O O   . PHE A 1 538 ? 72.178 118.954 -23.400 1.00 41.43  ? 535 PHE A O   1 
ATOM   4130 C CB  . PHE A 1 538 ? 75.501 119.395 -23.446 1.00 41.95  ? 535 PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 538 ? 75.301 118.163 -22.611 1.00 45.62  ? 535 PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 538 ? 75.021 116.945 -23.210 1.00 44.60  ? 535 PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 538 ? 75.386 118.221 -21.230 1.00 42.94  ? 535 PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 538 ? 74.831 115.808 -22.449 1.00 42.90  ? 535 PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 538 ? 75.199 117.086 -20.462 1.00 44.54  ? 535 PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 538 ? 74.921 115.879 -21.073 1.00 46.81  ? 535 PHE A CZ  1 
ATOM   4137 N N   . LEU A 1 539 ? 72.957 120.836 -22.446 1.00 42.70  ? 536 LEU A N   1 
ATOM   4138 C CA  . LEU A 1 539 ? 71.893 120.851 -21.445 1.00 42.73  ? 536 LEU A CA  1 
ATOM   4139 C C   . LEU A 1 539 ? 70.486 120.815 -22.035 1.00 40.86  ? 536 LEU A C   1 
ATOM   4140 O O   . LEU A 1 539 ? 69.614 120.175 -21.422 1.00 48.67  ? 536 LEU A O   1 
ATOM   4141 C CB  . LEU A 1 539 ? 72.060 122.066 -20.523 1.00 38.17  ? 536 LEU A CB  1 
ATOM   4142 C CG  . LEU A 1 539 ? 71.163 122.042 -19.283 1.00 50.40  ? 536 LEU A CG  1 
ATOM   4143 C CD1 . LEU A 1 539 ? 71.351 120.743 -18.513 1.00 56.48  ? 536 LEU A CD1 1 
ATOM   4144 C CD2 . LEU A 1 539 ? 71.435 123.235 -18.387 1.00 40.07  ? 536 LEU A CD2 1 
ATOM   4145 N N   . PRO A 1 540 ? 70.181 121.464 -23.168 1.00 48.38  ? 537 PRO A N   1 
ATOM   4146 C CA  . PRO A 1 540 ? 68.851 121.256 -23.766 1.00 51.30  ? 537 PRO A CA  1 
ATOM   4147 C C   . PRO A 1 540 ? 68.566 119.804 -24.108 1.00 54.93  ? 537 PRO A C   1 
ATOM   4148 O O   . PRO A 1 540 ? 67.442 119.332 -23.893 1.00 56.63  ? 537 PRO A O   1 
ATOM   4149 C CB  . PRO A 1 540 ? 68.891 122.141 -25.019 1.00 39.17  ? 537 PRO A CB  1 
ATOM   4150 C CG  . PRO A 1 540 ? 69.843 123.218 -24.672 1.00 39.32  ? 537 PRO A CG  1 
ATOM   4151 C CD  . PRO A 1 540 ? 70.906 122.560 -23.840 1.00 40.99  ? 537 PRO A CD  1 
ATOM   4152 N N   . LYS A 1 541 ? 69.556 119.076 -24.634 1.00 60.57  ? 538 LYS A N   1 
ATOM   4153 C CA  . LYS A 1 541 ? 69.356 117.658 -24.910 1.00 62.32  ? 538 LYS A CA  1 
ATOM   4154 C C   . LYS A 1 541 ? 69.108 116.872 -23.631 1.00 61.76  ? 538 LYS A C   1 
ATOM   4155 O O   . LYS A 1 541 ? 68.353 115.892 -23.640 1.00 65.05  ? 538 LYS A O   1 
ATOM   4156 C CB  . LYS A 1 541 ? 70.563 117.079 -25.650 1.00 54.93  ? 538 LYS A CB  1 
ATOM   4157 C CG  . LYS A 1 541 ? 70.949 117.813 -26.922 1.00 59.65  ? 538 LYS A CG  1 
ATOM   4158 C CD  . LYS A 1 541 ? 71.822 116.928 -27.801 1.00 68.68  ? 538 LYS A CD  1 
ATOM   4159 C CE  . LYS A 1 541 ? 72.606 117.740 -28.818 1.00 67.17  ? 538 LYS A CE  1 
ATOM   4160 N NZ  . LYS A 1 541 ? 73.717 118.498 -28.176 1.00 74.80  ? 538 LYS A NZ  1 
ATOM   4161 N N   . LEU A 1 542 ? 69.733 117.282 -22.525 1.00 52.55  ? 539 LEU A N   1 
ATOM   4162 C CA  . LEU A 1 542 ? 69.532 116.585 -21.259 1.00 62.60  ? 539 LEU A CA  1 
ATOM   4163 C C   . LEU A 1 542 ? 68.143 116.849 -20.692 1.00 68.19  ? 539 LEU A C   1 
ATOM   4164 O O   . LEU A 1 542 ? 67.578 115.983 -20.015 1.00 74.88  ? 539 LEU A O   1 
ATOM   4165 C CB  . LEU A 1 542 ? 70.615 117.000 -20.260 1.00 56.91  ? 539 LEU A CB  1 
ATOM   4166 C CG  . LEU A 1 542 ? 70.800 116.172 -18.985 1.00 58.97  ? 539 LEU A CG  1 
ATOM   4167 C CD1 . LEU A 1 542 ? 72.255 116.207 -18.545 1.00 48.38  ? 539 LEU A CD1 1 
ATOM   4168 C CD2 . LEU A 1 542 ? 69.904 116.672 -17.863 1.00 61.75  ? 539 LEU A CD2 1 
ATOM   4169 N N   . LEU A 1 543 ? 67.581 118.030 -20.952 1.00 68.46  ? 540 LEU A N   1 
ATOM   4170 C CA  . LEU A 1 543 ? 66.235 118.331 -20.481 1.00 66.28  ? 540 LEU A CA  1 
ATOM   4171 C C   . LEU A 1 543 ? 65.169 117.682 -21.355 1.00 75.96  ? 540 LEU A C   1 
ATOM   4172 O O   . LEU A 1 543 ? 64.056 117.430 -20.881 1.00 79.87  ? 540 LEU A O   1 
ATOM   4173 C CB  . LEU A 1 543 ? 66.024 119.844 -20.423 1.00 64.53  ? 540 LEU A CB  1 
ATOM   4174 C CG  . LEU A 1 543 ? 66.932 120.602 -19.452 1.00 62.30  ? 540 LEU A CG  1 
ATOM   4175 C CD1 . LEU A 1 543 ? 66.707 122.101 -19.562 1.00 49.29  ? 540 LEU A CD1 1 
ATOM   4176 C CD2 . LEU A 1 543 ? 66.708 120.127 -18.024 1.00 59.44  ? 540 LEU A CD2 1 
ATOM   4177 N N   . SER A 1 544 ? 65.487 117.410 -22.623 1.00 70.61  ? 541 SER A N   1 
ATOM   4178 C CA  . SER A 1 544 ? 64.542 116.714 -23.492 1.00 74.78  ? 541 SER A CA  1 
ATOM   4179 C C   . SER A 1 544 ? 64.279 115.303 -22.983 1.00 85.14  ? 541 SER A C   1 
ATOM   4180 O O   . SER A 1 544 ? 63.127 114.909 -22.771 1.00 82.25  ? 541 SER A O   1 
ATOM   4181 C CB  . SER A 1 544 ? 65.076 116.685 -24.924 1.00 78.72  ? 541 SER A CB  1 
ATOM   4182 O OG  . SER A 1 544 ? 65.401 117.990 -25.370 1.00 78.43  ? 541 SER A OG  1 
ATOM   4183 N N   . ALA A 1 545 ? 65.342 114.526 -22.783 1.00 88.16  ? 542 ALA A N   1 
ATOM   4184 C CA  . ALA A 1 545 ? 65.247 113.221 -22.133 1.00 84.10  ? 542 ALA A CA  1 
ATOM   4185 C C   . ALA A 1 545 ? 65.334 113.463 -20.632 1.00 87.34  ? 542 ALA A C   1 
ATOM   4186 O O   . ALA A 1 545 ? 66.414 113.448 -20.039 1.00 82.64  ? 542 ALA A O   1 
ATOM   4187 C CB  . ALA A 1 545 ? 66.341 112.283 -22.627 1.00 76.38  ? 542 ALA A CB  1 
ATOM   4188 N N   . THR A 1 546 ? 64.178 113.697 -20.016 1.00 95.70  ? 543 THR A N   1 
ATOM   4189 C CA  . THR A 1 546 ? 64.089 114.088 -18.610 1.00 93.40  ? 543 THR A CA  1 
ATOM   4190 C C   . THR A 1 546 ? 64.814 113.129 -17.669 1.00 94.26  ? 543 THR A C   1 
ATOM   4191 O O   . THR A 1 546 ? 65.017 111.958 -17.990 1.00 101.85 ? 543 THR A O   1 
ATOM   4192 C CB  . THR A 1 546 ? 62.619 114.191 -18.159 1.00 87.98  ? 543 THR A CB  1 
ATOM   4193 O OG1 . THR A 1 546 ? 61.914 115.095 -19.018 1.00 85.50  ? 543 THR A OG1 1 
ATOM   4194 C CG2 . THR A 1 546 ? 62.538 114.693 -16.726 1.00 78.35  ? 543 THR A CG2 1 
ATOM   4195 N N   . GLU B 1 7   ? 56.253 185.948 28.402  1.00 100.09 ? 4   GLU B N   1 
ATOM   4196 C CA  . GLU B 1 7   ? 57.078 184.747 28.453  1.00 106.41 ? 4   GLU B CA  1 
ATOM   4197 C C   . GLU B 1 7   ? 56.546 183.751 29.479  1.00 103.76 ? 4   GLU B C   1 
ATOM   4198 O O   . GLU B 1 7   ? 56.436 184.064 30.665  1.00 101.06 ? 4   GLU B O   1 
ATOM   4199 C CB  . GLU B 1 7   ? 58.531 185.109 28.773  1.00 103.24 ? 4   GLU B CB  1 
ATOM   4200 C CG  . GLU B 1 7   ? 59.416 183.921 29.129  1.00 107.18 ? 4   GLU B CG  1 
ATOM   4201 C CD  . GLU B 1 7   ? 59.686 183.000 27.951  1.00 103.21 ? 4   GLU B CD  1 
ATOM   4202 O OE1 . GLU B 1 7   ? 59.382 183.382 26.801  1.00 79.35  ? 4   GLU B OE1 1 
ATOM   4203 O OE2 . GLU B 1 7   ? 60.209 181.888 28.179  1.00 93.82  ? 4   GLU B OE2 1 
ATOM   4204 N N   . ASP B 1 8   ? 56.219 182.549 29.012  1.00 95.27  ? 5   ASP B N   1 
ATOM   4205 C CA  . ASP B 1 8   ? 55.694 181.500 29.880  1.00 81.27  ? 5   ASP B CA  1 
ATOM   4206 C C   . ASP B 1 8   ? 56.841 180.911 30.690  1.00 74.36  ? 5   ASP B C   1 
ATOM   4207 O O   . ASP B 1 8   ? 57.741 180.271 30.135  1.00 56.05  ? 5   ASP B O   1 
ATOM   4208 C CB  . ASP B 1 8   ? 54.994 180.425 29.053  1.00 74.74  ? 5   ASP B CB  1 
ATOM   4209 C CG  . ASP B 1 8   ? 54.151 179.488 29.900  1.00 82.55  ? 5   ASP B CG  1 
ATOM   4210 O OD1 . ASP B 1 8   ? 54.279 179.520 31.142  1.00 78.84  ? 5   ASP B OD1 1 
ATOM   4211 O OD2 . ASP B 1 8   ? 53.361 178.715 29.320  1.00 76.46  ? 5   ASP B OD2 1 
ATOM   4212 N N   . ALA B 1 9   ? 56.811 181.124 32.007  1.00 78.80  ? 6   ALA B N   1 
ATOM   4213 C CA  . ALA B 1 9   ? 57.844 180.569 32.874  1.00 73.08  ? 6   ALA B CA  1 
ATOM   4214 C C   . ALA B 1 9   ? 57.662 179.076 33.106  1.00 72.61  ? 6   ALA B C   1 
ATOM   4215 O O   . ALA B 1 9   ? 58.600 178.415 33.565  1.00 61.28  ? 6   ALA B O   1 
ATOM   4216 C CB  . ALA B 1 9   ? 57.860 181.308 34.213  1.00 63.26  ? 6   ALA B CB  1 
ATOM   4217 N N   . GLU B 1 10  ? 56.482 178.531 32.797  1.00 60.07  ? 7   GLU B N   1 
ATOM   4218 C CA  . GLU B 1 10  ? 56.250 177.103 32.990  1.00 58.62  ? 7   GLU B CA  1 
ATOM   4219 C C   . GLU B 1 10  ? 57.094 176.259 32.044  1.00 50.16  ? 7   GLU B C   1 
ATOM   4220 O O   . GLU B 1 10  ? 57.414 175.108 32.363  1.00 46.58  ? 7   GLU B O   1 
ATOM   4221 C CB  . GLU B 1 10  ? 54.767 176.782 32.800  1.00 68.35  ? 7   GLU B CB  1 
ATOM   4222 C CG  . GLU B 1 10  ? 53.840 177.431 33.818  1.00 64.01  ? 7   GLU B CG  1 
ATOM   4223 C CD  . GLU B 1 10  ? 53.516 176.516 34.983  1.00 61.73  ? 7   GLU B CD  1 
ATOM   4224 O OE1 . GLU B 1 10  ? 54.195 176.608 36.027  1.00 66.98  ? 7   GLU B OE1 1 
ATOM   4225 O OE2 . GLU B 1 10  ? 52.583 175.696 34.847  1.00 61.62  ? 7   GLU B OE2 1 
ATOM   4226 N N   . LEU B 1 11  ? 57.464 176.805 30.887  1.00 54.28  ? 8   LEU B N   1 
ATOM   4227 C CA  . LEU B 1 11  ? 58.265 176.083 29.906  1.00 42.46  ? 8   LEU B CA  1 
ATOM   4228 C C   . LEU B 1 11  ? 59.753 176.081 30.238  1.00 34.70  ? 8   LEU B C   1 
ATOM   4229 O O   . LEU B 1 11  ? 60.556 175.638 29.411  1.00 45.23  ? 8   LEU B O   1 
ATOM   4230 C CB  . LEU B 1 11  ? 58.046 176.673 28.510  1.00 36.05  ? 8   LEU B CB  1 
ATOM   4231 C CG  . LEU B 1 11  ? 56.609 176.665 27.985  1.00 49.73  ? 8   LEU B CG  1 
ATOM   4232 C CD1 . LEU B 1 11  ? 56.559 177.173 26.553  1.00 31.38  ? 8   LEU B CD1 1 
ATOM   4233 C CD2 . LEU B 1 11  ? 56.004 175.273 28.086  1.00 41.70  ? 8   LEU B CD2 1 
ATOM   4234 N N   . LEU B 1 12  ? 60.135 176.565 31.418  1.00 45.05  ? 9   LEU B N   1 
ATOM   4235 C CA  . LEU B 1 12  ? 61.520 176.565 31.871  1.00 42.35  ? 9   LEU B CA  1 
ATOM   4236 C C   . LEU B 1 12  ? 61.611 175.748 33.151  1.00 41.09  ? 9   LEU B C   1 
ATOM   4237 O O   . LEU B 1 12  ? 60.926 176.051 34.134  1.00 51.04  ? 9   LEU B O   1 
ATOM   4238 C CB  . LEU B 1 12  ? 62.026 177.991 32.103  1.00 39.59  ? 9   LEU B CB  1 
ATOM   4239 C CG  . LEU B 1 12  ? 62.190 178.867 30.861  1.00 46.70  ? 9   LEU B CG  1 
ATOM   4240 C CD1 . LEU B 1 12  ? 62.465 180.308 31.258  1.00 39.51  ? 9   LEU B CD1 1 
ATOM   4241 C CD2 . LEU B 1 12  ? 63.303 178.334 29.970  1.00 39.63  ? 9   LEU B CD2 1 
ATOM   4242 N N   . VAL B 1 13  ? 62.451 174.716 33.136  1.00 35.29  ? 10  VAL B N   1 
ATOM   4243 C CA  . VAL B 1 13  ? 62.612 173.808 34.267  1.00 38.90  ? 10  VAL B CA  1 
ATOM   4244 C C   . VAL B 1 13  ? 64.091 173.487 34.426  1.00 33.35  ? 10  VAL B C   1 
ATOM   4245 O O   . VAL B 1 13  ? 64.809 173.307 33.437  1.00 37.75  ? 10  VAL B O   1 
ATOM   4246 C CB  . VAL B 1 13  ? 61.781 172.518 34.080  1.00 39.64  ? 10  VAL B CB  1 
ATOM   4247 C CG1 . VAL B 1 13  ? 62.225 171.433 35.050  1.00 37.28  ? 10  VAL B CG1 1 
ATOM   4248 C CG2 . VAL B 1 13  ? 60.304 172.809 34.270  1.00 35.79  ? 10  VAL B CG2 1 
ATOM   4249 N N   . THR B 1 14  ? 64.547 173.430 35.674  1.00 31.75  ? 11  THR B N   1 
ATOM   4250 C CA  . THR B 1 14  ? 65.904 173.022 36.009  1.00 32.02  ? 11  THR B CA  1 
ATOM   4251 C C   . THR B 1 14  ? 65.873 171.616 36.593  1.00 39.95  ? 11  THR B C   1 
ATOM   4252 O O   . THR B 1 14  ? 65.064 171.330 37.483  1.00 42.94  ? 11  THR B O   1 
ATOM   4253 C CB  . THR B 1 14  ? 66.543 173.995 37.005  1.00 39.19  ? 11  THR B CB  1 
ATOM   4254 O OG1 . THR B 1 14  ? 66.615 175.301 36.423  1.00 47.86  ? 11  THR B OG1 1 
ATOM   4255 C CG2 . THR B 1 14  ? 67.943 173.534 37.384  1.00 25.92  ? 11  THR B CG2 1 
ATOM   4256 N N   . VAL B 1 15  ? 66.743 170.742 36.088  1.00 35.05  ? 12  VAL B N   1 
ATOM   4257 C CA  . VAL B 1 15  ? 66.873 169.390 36.624  1.00 35.72  ? 12  VAL B CA  1 
ATOM   4258 C C   . VAL B 1 15  ? 68.287 169.201 37.157  1.00 36.03  ? 12  VAL B C   1 
ATOM   4259 O O   . VAL B 1 15  ? 69.077 170.150 37.194  1.00 50.15  ? 12  VAL B O   1 
ATOM   4260 C CB  . VAL B 1 15  ? 66.529 168.327 35.566  1.00 40.26  ? 12  VAL B CB  1 
ATOM   4261 C CG1 . VAL B 1 15  ? 65.070 168.439 35.155  1.00 37.05  ? 12  VAL B CG1 1 
ATOM   4262 C CG2 . VAL B 1 15  ? 67.444 168.459 34.362  1.00 39.57  ? 12  VAL B CG2 1 
ATOM   4263 N N   . ARG B 1 16  ? 68.621 167.974 37.569  1.00 41.24  ? 13  ARG B N   1 
ATOM   4264 C CA  . ARG B 1 16  ? 69.907 167.731 38.217  1.00 42.28  ? 13  ARG B CA  1 
ATOM   4265 C C   . ARG B 1 16  ? 71.094 167.936 37.288  1.00 47.87  ? 13  ARG B C   1 
ATOM   4266 O O   . ARG B 1 16  ? 72.219 168.092 37.778  1.00 57.26  ? 13  ARG B O   1 
ATOM   4267 C CB  . ARG B 1 16  ? 69.960 166.311 38.788  1.00 38.43  ? 13  ARG B CB  1 
ATOM   4268 C CG  . ARG B 1 16  ? 69.476 166.183 40.218  1.00 50.62  ? 13  ARG B CG  1 
ATOM   4269 C CD  . ARG B 1 16  ? 69.898 164.847 40.808  1.00 56.68  ? 13  ARG B CD  1 
ATOM   4270 N NE  . ARG B 1 16  ? 69.106 164.501 41.983  1.00 65.62  ? 13  ARG B NE  1 
ATOM   4271 C CZ  . ARG B 1 16  ? 69.350 163.460 42.772  1.00 72.34  ? 13  ARG B CZ  1 
ATOM   4272 N NH1 . ARG B 1 16  ? 70.376 162.658 42.520  1.00 65.53  ? 13  ARG B NH1 1 
ATOM   4273 N NH2 . ARG B 1 16  ? 68.570 163.225 43.818  1.00 66.41  ? 13  ARG B NH2 1 
ATOM   4274 N N   . GLY B 1 17  ? 70.886 167.925 35.977  1.00 54.27  ? 14  GLY B N   1 
ATOM   4275 C CA  . GLY B 1 17  ? 71.992 168.056 35.053  1.00 42.49  ? 14  GLY B CA  1 
ATOM   4276 C C   . GLY B 1 17  ? 72.110 169.430 34.425  1.00 42.34  ? 14  GLY B C   1 
ATOM   4277 O O   . GLY B 1 17  ? 73.157 169.782 33.872  1.00 38.85  ? 14  GLY B O   1 
ATOM   4278 N N   . GLY B 1 18  ? 71.042 170.214 34.499  1.00 30.73  ? 15  GLY B N   1 
ATOM   4279 C CA  . GLY B 1 18  ? 71.051 171.545 33.921  1.00 26.64  ? 15  GLY B CA  1 
ATOM   4280 C C   . GLY B 1 18  ? 69.631 172.039 33.707  1.00 33.08  ? 15  GLY B C   1 
ATOM   4281 O O   . GLY B 1 18  ? 68.685 171.525 34.298  1.00 35.32  ? 15  GLY B O   1 
ATOM   4282 N N   . ARG B 1 19  ? 69.516 173.041 32.844  1.00 32.61  ? 16  ARG B N   1 
ATOM   4283 C CA  . ARG B 1 19  ? 68.245 173.681 32.545  1.00 37.34  ? 16  ARG B CA  1 
ATOM   4284 C C   . ARG B 1 19  ? 67.678 173.175 31.223  1.00 32.88  ? 16  ARG B C   1 
ATOM   4285 O O   . ARG B 1 19  ? 68.405 172.723 30.336  1.00 30.97  ? 16  ARG B O   1 
ATOM   4286 C CB  . ARG B 1 19  ? 68.404 175.202 32.498  1.00 44.34  ? 16  ARG B CB  1 
ATOM   4287 C CG  . ARG B 1 19  ? 68.647 175.843 33.853  1.00 52.94  ? 16  ARG B CG  1 
ATOM   4288 C CD  . ARG B 1 19  ? 69.057 177.294 33.695  1.00 59.54  ? 16  ARG B CD  1 
ATOM   4289 N NE  . ARG B 1 19  ? 70.393 177.410 33.118  1.00 59.14  ? 16  ARG B NE  1 
ATOM   4290 C CZ  . ARG B 1 19  ? 70.837 178.481 32.470  1.00 54.58  ? 16  ARG B CZ  1 
ATOM   4291 N NH1 . ARG B 1 19  ? 70.048 179.533 32.301  1.00 48.50  ? 16  ARG B NH1 1 
ATOM   4292 N NH2 . ARG B 1 19  ? 72.070 178.496 31.980  1.00 60.76  ? 16  ARG B NH2 1 
ATOM   4293 N N   . LEU B 1 20  ? 66.355 173.266 31.105  1.00 31.29  ? 17  LEU B N   1 
ATOM   4294 C CA  . LEU B 1 20  ? 65.637 172.800 29.929  1.00 35.78  ? 17  LEU B CA  1 
ATOM   4295 C C   . LEU B 1 20  ? 64.582 173.824 29.544  1.00 35.33  ? 17  LEU B C   1 
ATOM   4296 O O   . LEU B 1 20  ? 64.057 174.547 30.395  1.00 40.46  ? 17  LEU B O   1 
ATOM   4297 C CB  . LEU B 1 20  ? 64.963 171.442 30.178  1.00 32.78  ? 17  LEU B CB  1 
ATOM   4298 C CG  . LEU B 1 20  ? 65.828 170.294 30.698  1.00 34.45  ? 17  LEU B CG  1 
ATOM   4299 C CD1 . LEU B 1 20  ? 64.949 169.154 31.180  1.00 39.47  ? 17  LEU B CD1 1 
ATOM   4300 C CD2 . LEU B 1 20  ? 66.783 169.813 29.621  1.00 30.68  ? 17  LEU B CD2 1 
ATOM   4301 N N   . ARG B 1 21  ? 64.272 173.877 28.251  1.00 29.78  ? 18  ARG B N   1 
ATOM   4302 C CA  . ARG B 1 21  ? 63.169 174.678 27.737  1.00 39.16  ? 18  ARG B CA  1 
ATOM   4303 C C   . ARG B 1 21  ? 62.207 173.760 26.999  1.00 38.09  ? 18  ARG B C   1 
ATOM   4304 O O   . ARG B 1 21  ? 62.585 173.132 26.004  1.00 37.79  ? 18  ARG B O   1 
ATOM   4305 C CB  . ARG B 1 21  ? 63.658 175.788 26.808  1.00 34.75  ? 18  ARG B CB  1 
ATOM   4306 C CG  . ARG B 1 21  ? 62.523 176.623 26.241  1.00 35.60  ? 18  ARG B CG  1 
ATOM   4307 C CD  . ARG B 1 21  ? 63.015 177.589 25.188  1.00 48.03  ? 18  ARG B CD  1 
ATOM   4308 N NE  . ARG B 1 21  ? 64.070 178.457 25.700  1.00 53.63  ? 18  ARG B NE  1 
ATOM   4309 C CZ  . ARG B 1 21  ? 63.855 179.634 26.276  1.00 58.51  ? 18  ARG B CZ  1 
ATOM   4310 N NH1 . ARG B 1 21  ? 62.617 180.090 26.418  1.00 57.86  ? 18  ARG B NH1 1 
ATOM   4311 N NH2 . ARG B 1 21  ? 64.878 180.356 26.712  1.00 53.54  ? 18  ARG B NH2 1 
ATOM   4312 N N   . GLY B 1 22  ? 60.972 173.690 27.480  1.00 34.34  ? 19  GLY B N   1 
ATOM   4313 C CA  . GLY B 1 22  ? 59.956 172.846 26.892  1.00 32.25  ? 19  GLY B CA  1 
ATOM   4314 C C   . GLY B 1 22  ? 59.134 173.565 25.844  1.00 37.44  ? 19  GLY B C   1 
ATOM   4315 O O   . GLY B 1 22  ? 59.528 174.601 25.303  1.00 39.23  ? 19  GLY B O   1 
ATOM   4316 N N   . ILE B 1 23  ? 57.963 172.997 25.560  1.00 37.92  ? 20  ILE B N   1 
ATOM   4317 C CA  . ILE B 1 23  ? 57.065 173.525 24.543  1.00 29.36  ? 20  ILE B CA  1 
ATOM   4318 C C   . ILE B 1 23  ? 55.634 173.294 25.008  1.00 38.27  ? 20  ILE B C   1 
ATOM   4319 O O   . ILE B 1 23  ? 55.342 172.329 25.719  1.00 36.76  ? 20  ILE B O   1 
ATOM   4320 C CB  . ILE B 1 23  ? 57.333 172.871 23.164  1.00 33.74  ? 20  ILE B CB  1 
ATOM   4321 C CG1 . ILE B 1 23  ? 56.488 173.526 22.068  1.00 32.05  ? 20  ILE B CG1 1 
ATOM   4322 C CG2 . ILE B 1 23  ? 57.086 171.369 23.224  1.00 29.64  ? 20  ILE B CG2 1 
ATOM   4323 C CD1 . ILE B 1 23  ? 56.750 172.972 20.683  1.00 30.38  ? 20  ILE B CD1 1 
ATOM   4324 N N   . ARG B 1 24  ? 54.741 174.202 24.621  1.00 39.13  ? 21  ARG B N   1 
ATOM   4325 C CA  . ARG B 1 24  ? 53.326 174.077 24.939  1.00 39.52  ? 21  ARG B CA  1 
ATOM   4326 C C   . ARG B 1 24  ? 52.603 173.344 23.815  1.00 38.25  ? 21  ARG B C   1 
ATOM   4327 O O   . ARG B 1 24  ? 52.708 173.729 22.646  1.00 44.01  ? 21  ARG B O   1 
ATOM   4328 C CB  . ARG B 1 24  ? 52.690 175.449 25.163  1.00 36.85  ? 21  ARG B CB  1 
ATOM   4329 C CG  . ARG B 1 24  ? 51.171 175.427 25.080  1.00 51.17  ? 21  ARG B CG  1 
ATOM   4330 C CD  . ARG B 1 24  ? 50.557 176.752 25.491  1.00 60.64  ? 21  ARG B CD  1 
ATOM   4331 N NE  . ARG B 1 24  ? 50.809 177.055 26.895  1.00 77.79  ? 21  ARG B NE  1 
ATOM   4332 C CZ  . ARG B 1 24  ? 50.178 178.003 27.579  1.00 69.25  ? 21  ARG B CZ  1 
ATOM   4333 N NH1 . ARG B 1 24  ? 49.248 178.741 26.989  1.00 66.32  ? 21  ARG B NH1 1 
ATOM   4334 N NH2 . ARG B 1 24  ? 50.473 178.210 28.855  1.00 73.01  ? 21  ARG B NH2 1 
ATOM   4335 N N   . LEU B 1 25  ? 51.868 172.296 24.175  1.00 38.43  ? 22  LEU B N   1 
ATOM   4336 C CA  . LEU B 1 25  ? 51.099 171.506 23.225  1.00 36.42  ? 22  LEU B CA  1 
ATOM   4337 C C   . LEU B 1 25  ? 49.613 171.780 23.409  1.00 40.31  ? 22  LEU B C   1 
ATOM   4338 O O   . LEU B 1 25  ? 49.124 171.879 24.538  1.00 47.76  ? 22  LEU B O   1 
ATOM   4339 C CB  . LEU B 1 25  ? 51.381 170.012 23.396  1.00 36.26  ? 22  LEU B CB  1 
ATOM   4340 C CG  . LEU B 1 25  ? 52.832 169.578 23.185  1.00 39.04  ? 22  LEU B CG  1 
ATOM   4341 C CD1 . LEU B 1 25  ? 52.956 168.068 23.292  1.00 42.28  ? 22  LEU B CD1 1 
ATOM   4342 C CD2 . LEU B 1 25  ? 53.348 170.069 21.841  1.00 30.81  ? 22  LEU B CD2 1 
ATOM   4343 N N   . LYS B 1 26  ? 48.899 171.896 22.293  1.00 32.31  ? 23  LYS B N   1 
ATOM   4344 C CA  . LYS B 1 26  ? 47.480 172.215 22.312  1.00 38.85  ? 23  LYS B CA  1 
ATOM   4345 C C   . LYS B 1 26  ? 46.634 170.948 22.298  1.00 46.98  ? 23  LYS B C   1 
ATOM   4346 O O   . LYS B 1 26  ? 46.949 169.980 21.601  1.00 44.59  ? 23  LYS B O   1 
ATOM   4347 C CB  . LYS B 1 26  ? 47.110 173.095 21.117  1.00 37.64  ? 23  LYS B CB  1 
ATOM   4348 C CG  . LYS B 1 26  ? 47.510 174.551 21.266  1.00 54.15  ? 23  LYS B CG  1 
ATOM   4349 C CD  . LYS B 1 26  ? 46.899 175.150 22.522  1.00 74.09  ? 23  LYS B CD  1 
ATOM   4350 C CE  . LYS B 1 26  ? 46.897 176.667 22.470  1.00 67.38  ? 23  LYS B CE  1 
ATOM   4351 N NZ  . LYS B 1 26  ? 46.244 177.248 23.675  1.00 64.72  ? 23  LYS B NZ  1 
ATOM   4352 N N   . THR B 1 27  ? 45.567 170.961 23.085  1.00 44.74  ? 24  THR B N   1 
ATOM   4353 C CA  . THR B 1 27  ? 44.518 169.956 23.077  1.00 43.80  ? 24  THR B CA  1 
ATOM   4354 C C   . THR B 1 27  ? 43.181 170.677 23.067  1.00 53.59  ? 24  THR B C   1 
ATOM   4355 O O   . THR B 1 27  ? 43.098 171.849 23.453  1.00 50.87  ? 24  THR B O   1 
ATOM   4356 C CB  . THR B 1 27  ? 44.591 169.025 24.299  1.00 41.57  ? 24  THR B CB  1 
ATOM   4357 O OG1 . THR B 1 27  ? 44.060 169.698 25.447  1.00 51.21  ? 24  THR B OG1 1 
ATOM   4358 C CG2 . THR B 1 27  ? 46.026 168.601 24.584  1.00 37.64  ? 24  THR B CG2 1 
ATOM   4359 N N   . PRO B 1 28  ? 42.111 170.013 22.621  1.00 47.79  ? 25  PRO B N   1 
ATOM   4360 C CA  . PRO B 1 28  ? 40.786 170.654 22.669  1.00 46.47  ? 25  PRO B CA  1 
ATOM   4361 C C   . PRO B 1 28  ? 40.330 171.017 24.073  1.00 48.95  ? 25  PRO B C   1 
ATOM   4362 O O   . PRO B 1 28  ? 39.388 171.807 24.214  1.00 51.08  ? 25  PRO B O   1 
ATOM   4363 C CB  . PRO B 1 28  ? 39.863 169.601 22.039  1.00 54.90  ? 25  PRO B CB  1 
ATOM   4364 C CG  . PRO B 1 28  ? 40.757 168.784 21.179  1.00 50.96  ? 25  PRO B CG  1 
ATOM   4365 C CD  . PRO B 1 28  ? 42.076 168.733 21.890  1.00 43.11  ? 25  PRO B CD  1 
ATOM   4366 N N   . GLY B 1 29  ? 40.964 170.477 25.111  1.00 41.12  ? 26  GLY B N   1 
ATOM   4367 C CA  . GLY B 1 29  ? 40.556 170.756 26.474  1.00 48.73  ? 26  GLY B CA  1 
ATOM   4368 C C   . GLY B 1 29  ? 41.470 171.712 27.213  1.00 53.76  ? 26  GLY B C   1 
ATOM   4369 O O   . GLY B 1 29  ? 41.142 172.160 28.315  1.00 54.06  ? 26  GLY B O   1 
ATOM   4370 N N   . GLY B 1 30  ? 42.621 172.030 26.625  1.00 52.66  ? 27  GLY B N   1 
ATOM   4371 C CA  . GLY B 1 30  ? 43.565 172.928 27.246  1.00 36.80  ? 27  GLY B CA  1 
ATOM   4372 C C   . GLY B 1 30  ? 45.000 172.612 26.878  1.00 48.07  ? 27  GLY B C   1 
ATOM   4373 O O   . GLY B 1 30  ? 45.296 171.592 26.249  1.00 51.19  ? 27  GLY B O   1 
ATOM   4374 N N   . PRO B 1 31  ? 45.922 173.487 27.268  1.00 53.50  ? 28  PRO B N   1 
ATOM   4375 C CA  . PRO B 1 31  ? 47.331 173.286 26.920  1.00 47.08  ? 28  PRO B CA  1 
ATOM   4376 C C   . PRO B 1 31  ? 48.031 172.324 27.870  1.00 44.13  ? 28  PRO B C   1 
ATOM   4377 O O   . PRO B 1 31  ? 47.570 172.042 28.978  1.00 47.36  ? 28  PRO B O   1 
ATOM   4378 C CB  . PRO B 1 31  ? 47.920 174.695 27.038  1.00 51.81  ? 28  PRO B CB  1 
ATOM   4379 C CG  . PRO B 1 31  ? 47.091 175.338 28.097  1.00 55.91  ? 28  PRO B CG  1 
ATOM   4380 C CD  . PRO B 1 31  ? 45.697 174.775 27.947  1.00 52.54  ? 28  PRO B CD  1 
ATOM   4381 N N   . VAL B 1 32  ? 49.173 171.822 27.403  1.00 43.54  ? 29  VAL B N   1 
ATOM   4382 C CA  . VAL B 1 32  ? 50.021 170.908 28.161  1.00 40.15  ? 29  VAL B CA  1 
ATOM   4383 C C   . VAL B 1 32  ? 51.472 171.311 27.935  1.00 36.58  ? 29  VAL B C   1 
ATOM   4384 O O   . VAL B 1 32  ? 51.862 171.661 26.816  1.00 45.48  ? 29  VAL B O   1 
ATOM   4385 C CB  . VAL B 1 32  ? 49.787 169.436 27.749  1.00 44.27  ? 29  VAL B CB  1 
ATOM   4386 C CG1 . VAL B 1 32  ? 50.841 168.522 28.361  1.00 41.84  ? 29  VAL B CG1 1 
ATOM   4387 C CG2 . VAL B 1 32  ? 48.395 168.980 28.153  1.00 33.35  ? 29  VAL B CG2 1 
ATOM   4388 N N   . SER B 1 33  ? 52.270 171.275 29.000  1.00 32.96  ? 30  SER B N   1 
ATOM   4389 C CA  . SER B 1 33  ? 53.697 171.557 28.907  1.00 37.54  ? 30  SER B CA  1 
ATOM   4390 C C   . SER B 1 33  ? 54.447 170.256 28.649  1.00 41.42  ? 30  SER B C   1 
ATOM   4391 O O   . SER B 1 33  ? 54.349 169.309 29.437  1.00 40.99  ? 30  SER B O   1 
ATOM   4392 C CB  . SER B 1 33  ? 54.204 172.227 30.183  1.00 29.45  ? 30  SER B CB  1 
ATOM   4393 O OG  . SER B 1 33  ? 53.537 173.455 30.417  1.00 43.36  ? 30  SER B OG  1 
ATOM   4394 N N   . ALA B 1 34  ? 55.193 170.211 27.548  1.00 35.01  ? 31  ALA B N   1 
ATOM   4395 C CA  . ALA B 1 34  ? 55.950 169.033 27.154  1.00 31.44  ? 31  ALA B CA  1 
ATOM   4396 C C   . ALA B 1 34  ? 57.436 169.355 27.127  1.00 32.30  ? 31  ALA B C   1 
ATOM   4397 O O   . ALA B 1 34  ? 57.841 170.434 26.684  1.00 43.86  ? 31  ALA B O   1 
ATOM   4398 C CB  . ALA B 1 34  ? 55.505 168.521 25.781  1.00 36.91  ? 31  ALA B CB  1 
ATOM   4399 N N   . PHE B 1 35  ? 58.244 168.410 27.600  1.00 28.71  ? 32  PHE B N   1 
ATOM   4400 C CA  . PHE B 1 35  ? 59.701 168.523 27.614  1.00 27.73  ? 32  PHE B CA  1 
ATOM   4401 C C   . PHE B 1 35  ? 60.243 167.305 26.872  1.00 30.18  ? 32  PHE B C   1 
ATOM   4402 O O   . PHE B 1 35  ? 60.498 166.258 27.471  1.00 32.11  ? 32  PHE B O   1 
ATOM   4403 C CB  . PHE B 1 35  ? 60.234 168.616 29.044  1.00 25.58  ? 32  PHE B CB  1 
ATOM   4404 C CG  . PHE B 1 35  ? 59.784 169.850 29.775  1.00 41.55  ? 32  PHE B CG  1 
ATOM   4405 C CD1 . PHE B 1 35  ? 58.538 169.900 30.379  1.00 40.25  ? 32  PHE B CD1 1 
ATOM   4406 C CD2 . PHE B 1 35  ? 60.605 170.963 29.853  1.00 45.42  ? 32  PHE B CD2 1 
ATOM   4407 C CE1 . PHE B 1 35  ? 58.119 171.034 31.048  1.00 38.82  ? 32  PHE B CE1 1 
ATOM   4408 C CE2 . PHE B 1 35  ? 60.192 172.101 30.521  1.00 43.61  ? 32  PHE B CE2 1 
ATOM   4409 C CZ  . PHE B 1 35  ? 58.947 172.136 31.118  1.00 44.94  ? 32  PHE B CZ  1 
ATOM   4410 N N   . LEU B 1 36  ? 60.416 167.450 25.561  1.00 34.02  ? 33  LEU B N   1 
ATOM   4411 C CA  . LEU B 1 36  ? 60.756 166.342 24.679  1.00 26.49  ? 33  LEU B CA  1 
ATOM   4412 C C   . LEU B 1 36  ? 62.247 166.353 24.371  1.00 35.59  ? 33  LEU B C   1 
ATOM   4413 O O   . LEU B 1 36  ? 62.796 167.384 23.973  1.00 38.09  ? 33  LEU B O   1 
ATOM   4414 C CB  . LEU B 1 36  ? 59.956 166.427 23.378  1.00 20.38  ? 33  LEU B CB  1 
ATOM   4415 C CG  . LEU B 1 36  ? 58.469 166.756 23.518  1.00 27.34  ? 33  LEU B CG  1 
ATOM   4416 C CD1 . LEU B 1 36  ? 57.819 166.897 22.149  1.00 25.09  ? 33  LEU B CD1 1 
ATOM   4417 C CD2 . LEU B 1 36  ? 57.761 165.696 24.345  1.00 31.31  ? 33  LEU B CD2 1 
ATOM   4418 N N   . GLY B 1 37  ? 62.894 165.204 24.545  1.00 31.44  ? 34  GLY B N   1 
ATOM   4419 C CA  . GLY B 1 37  ? 64.291 165.070 24.192  1.00 23.28  ? 34  GLY B CA  1 
ATOM   4420 C C   . GLY B 1 37  ? 65.274 165.354 25.303  1.00 32.16  ? 34  GLY B C   1 
ATOM   4421 O O   . GLY B 1 37  ? 66.361 165.878 25.033  1.00 40.91  ? 34  GLY B O   1 
ATOM   4422 N N   . ILE B 1 38  ? 64.932 165.024 26.544  1.00 32.79  ? 35  ILE B N   1 
ATOM   4423 C CA  . ILE B 1 38  ? 65.832 165.229 27.676  1.00 26.19  ? 35  ILE B CA  1 
ATOM   4424 C C   . ILE B 1 38  ? 66.895 164.139 27.666  1.00 31.35  ? 35  ILE B C   1 
ATOM   4425 O O   . ILE B 1 38  ? 66.559 162.948 27.742  1.00 34.95  ? 35  ILE B O   1 
ATOM   4426 C CB  . ILE B 1 38  ? 65.065 165.232 29.008  1.00 27.16  ? 35  ILE B CB  1 
ATOM   4427 C CG1 . ILE B 1 38  ? 63.942 166.270 28.981  1.00 29.09  ? 35  ILE B CG1 1 
ATOM   4428 C CG2 . ILE B 1 38  ? 66.015 165.496 30.167  1.00 29.81  ? 35  ILE B CG2 1 
ATOM   4429 C CD1 . ILE B 1 38  ? 63.044 166.223 30.198  1.00 22.99  ? 35  ILE B CD1 1 
ATOM   4430 N N   . PRO B 1 39  ? 68.179 164.485 27.570  1.00 37.59  ? 36  PRO B N   1 
ATOM   4431 C CA  . PRO B 1 39  ? 69.231 163.459 27.642  1.00 28.57  ? 36  PRO B CA  1 
ATOM   4432 C C   . PRO B 1 39  ? 69.348 162.908 29.055  1.00 36.50  ? 36  PRO B C   1 
ATOM   4433 O O   . PRO B 1 39  ? 69.543 163.659 30.013  1.00 36.29  ? 36  PRO B O   1 
ATOM   4434 C CB  . PRO B 1 39  ? 70.495 164.218 27.221  1.00 26.75  ? 36  PRO B CB  1 
ATOM   4435 C CG  . PRO B 1 39  ? 70.205 165.643 27.566  1.00 31.09  ? 36  PRO B CG  1 
ATOM   4436 C CD  . PRO B 1 39  ? 68.730 165.832 27.339  1.00 32.80  ? 36  PRO B CD  1 
ATOM   4437 N N   . PHE B 1 40  ? 69.218 161.588 29.184  1.00 32.10  ? 37  PHE B N   1 
ATOM   4438 C CA  . PHE B 1 40  ? 69.379 160.925 30.469  1.00 25.42  ? 37  PHE B CA  1 
ATOM   4439 C C   . PHE B 1 40  ? 70.590 160.006 30.513  1.00 23.79  ? 37  PHE B C   1 
ATOM   4440 O O   . PHE B 1 40  ? 70.837 159.378 31.547  1.00 28.04  ? 37  PHE B O   1 
ATOM   4441 C CB  . PHE B 1 40  ? 68.111 160.137 30.834  1.00 35.66  ? 37  PHE B CB  1 
ATOM   4442 C CG  . PHE B 1 40  ? 67.849 158.941 29.955  1.00 31.54  ? 37  PHE B CG  1 
ATOM   4443 C CD1 . PHE B 1 40  ? 68.364 157.695 30.281  1.00 24.40  ? 37  PHE B CD1 1 
ATOM   4444 C CD2 . PHE B 1 40  ? 67.066 159.058 28.819  1.00 30.66  ? 37  PHE B CD2 1 
ATOM   4445 C CE1 . PHE B 1 40  ? 68.119 156.595 29.481  1.00 31.69  ? 37  PHE B CE1 1 
ATOM   4446 C CE2 . PHE B 1 40  ? 66.814 157.959 28.017  1.00 35.36  ? 37  PHE B CE2 1 
ATOM   4447 C CZ  . PHE B 1 40  ? 67.342 156.727 28.349  1.00 30.34  ? 37  PHE B CZ  1 
ATOM   4448 N N   . ALA B 1 41  ? 71.351 159.911 29.427  1.00 25.83  ? 38  ALA B N   1 
ATOM   4449 C CA  . ALA B 1 41  ? 72.535 159.068 29.404  1.00 31.94  ? 38  ALA B CA  1 
ATOM   4450 C C   . ALA B 1 41  ? 73.542 159.641 28.421  1.00 31.67  ? 38  ALA B C   1 
ATOM   4451 O O   . ALA B 1 41  ? 73.186 160.362 27.484  1.00 27.24  ? 38  ALA B O   1 
ATOM   4452 C CB  . ALA B 1 41  ? 72.192 157.622 29.028  1.00 36.76  ? 38  ALA B CB  1 
ATOM   4453 N N   . GLU B 1 42  ? 74.809 159.318 28.652  1.00 27.98  ? 39  GLU B N   1 
ATOM   4454 C CA  . GLU B 1 42  ? 75.833 159.633 27.670  1.00 38.64  ? 39  GLU B CA  1 
ATOM   4455 C C   . GLU B 1 42  ? 75.544 158.873 26.378  1.00 38.67  ? 39  GLU B C   1 
ATOM   4456 O O   . GLU B 1 42  ? 75.091 157.723 26.425  1.00 44.60  ? 39  GLU B O   1 
ATOM   4457 C CB  . GLU B 1 42  ? 77.223 159.267 28.194  1.00 37.42  ? 39  GLU B CB  1 
ATOM   4458 C CG  . GLU B 1 42  ? 77.783 160.235 29.223  1.00 47.67  ? 39  GLU B CG  1 
ATOM   4459 C CD  . GLU B 1 42  ? 77.806 161.665 28.720  1.00 48.02  ? 39  GLU B CD  1 
ATOM   4460 O OE1 . GLU B 1 42  ? 77.106 162.514 29.311  1.00 47.24  ? 39  GLU B OE1 1 
ATOM   4461 O OE2 . GLU B 1 42  ? 78.514 161.938 27.728  1.00 51.92  ? 39  GLU B OE2 1 
ATOM   4462 N N   . PRO B 1 43  ? 75.767 159.484 25.219  1.00 43.24  ? 40  PRO B N   1 
ATOM   4463 C CA  . PRO B 1 43  ? 75.536 158.786 23.950  1.00 39.46  ? 40  PRO B CA  1 
ATOM   4464 C C   . PRO B 1 43  ? 76.375 157.525 23.862  1.00 38.62  ? 40  PRO B C   1 
ATOM   4465 O O   . PRO B 1 43  ? 77.614 157.590 23.850  1.00 43.14  ? 40  PRO B O   1 
ATOM   4466 C CB  . PRO B 1 43  ? 75.963 159.819 22.898  1.00 37.55  ? 40  PRO B CB  1 
ATOM   4467 C CG  . PRO B 1 43  ? 75.762 161.135 23.575  1.00 40.26  ? 40  PRO B CG  1 
ATOM   4468 C CD  . PRO B 1 43  ? 76.110 160.903 25.018  1.00 41.25  ? 40  PRO B CD  1 
ATOM   4469 N N   . PRO B 1 44  ? 75.684 156.257 23.802  1.00 43.79  ? 41  PRO B N   1 
ATOM   4470 C CA  . PRO B 1 44  ? 76.421 154.975 23.770  1.00 37.68  ? 41  PRO B CA  1 
ATOM   4471 C C   . PRO B 1 44  ? 77.032 154.699 22.402  1.00 36.24  ? 41  PRO B C   1 
ATOM   4472 O O   . PRO B 1 44  ? 76.630 153.796 21.659  1.00 41.79  ? 41  PRO B O   1 
ATOM   4473 C CB  . PRO B 1 44  ? 75.332 153.966 24.148  1.00 33.19  ? 41  PRO B CB  1 
ATOM   4474 C CG  . PRO B 1 44  ? 74.079 154.569 23.605  1.00 37.33  ? 41  PRO B CG  1 
ATOM   4475 C CD  . PRO B 1 44  ? 74.224 156.059 23.774  1.00 31.43  ? 41  PRO B CD  1 
ATOM   4476 N N   . MET B 1 45  ? 78.039 155.492 22.050  1.00 40.38  ? 42  MET B N   1 
ATOM   4477 C CA  . MET B 1 45  ? 78.680 155.408 20.749  1.00 36.71  ? 42  MET B CA  1 
ATOM   4478 C C   . MET B 1 45  ? 80.145 155.022 20.904  1.00 38.54  ? 42  MET B C   1 
ATOM   4479 O O   . MET B 1 45  ? 80.722 155.105 21.993  1.00 38.37  ? 42  MET B O   1 
ATOM   4480 C CB  . MET B 1 45  ? 78.572 156.737 19.990  1.00 39.10  ? 42  MET B CB  1 
ATOM   4481 C CG  . MET B 1 45  ? 77.149 157.232 19.797  1.00 34.52  ? 42  MET B CG  1 
ATOM   4482 S SD  . MET B 1 45  ? 77.091 158.699 18.754  1.00 61.21  ? 42  MET B SD  1 
ATOM   4483 C CE  . MET B 1 45  ? 77.941 158.097 17.297  1.00 50.71  ? 42  MET B CE  1 
ATOM   4484 N N   . GLY B 1 46  ? 80.741 154.602 19.790  1.00 31.63  ? 43  GLY B N   1 
ATOM   4485 C CA  . GLY B 1 46  ? 82.130 154.213 19.760  1.00 37.84  ? 43  GLY B CA  1 
ATOM   4486 C C   . GLY B 1 46  ? 82.418 153.038 20.670  1.00 43.65  ? 43  GLY B C   1 
ATOM   4487 O O   . GLY B 1 46  ? 81.817 151.966 20.551  1.00 40.78  ? 43  GLY B O   1 
ATOM   4488 N N   . PRO B 1 47  ? 83.349 153.224 21.611  1.00 39.80  ? 44  PRO B N   1 
ATOM   4489 C CA  . PRO B 1 47  ? 83.663 152.146 22.561  1.00 37.88  ? 44  PRO B CA  1 
ATOM   4490 C C   . PRO B 1 47  ? 82.535 151.837 23.529  1.00 38.22  ? 44  PRO B C   1 
ATOM   4491 O O   . PRO B 1 47  ? 82.626 150.837 24.253  1.00 47.22  ? 44  PRO B O   1 
ATOM   4492 C CB  . PRO B 1 47  ? 84.897 152.680 23.300  1.00 42.00  ? 44  PRO B CB  1 
ATOM   4493 C CG  . PRO B 1 47  ? 84.774 154.166 23.198  1.00 34.93  ? 44  PRO B CG  1 
ATOM   4494 C CD  . PRO B 1 47  ? 84.155 154.433 21.853  1.00 36.59  ? 44  PRO B CD  1 
ATOM   4495 N N   . ARG B 1 48  ? 81.485 152.653 23.568  1.00 42.95  ? 45  ARG B N   1 
ATOM   4496 C CA  . ARG B 1 48  ? 80.356 152.430 24.460  1.00 47.27  ? 45  ARG B CA  1 
ATOM   4497 C C   . ARG B 1 48  ? 79.245 151.607 23.821  1.00 45.24  ? 45  ARG B C   1 
ATOM   4498 O O   . ARG B 1 48  ? 78.244 151.325 24.488  1.00 36.63  ? 45  ARG B O   1 
ATOM   4499 C CB  . ARG B 1 48  ? 79.787 153.769 24.940  1.00 42.91  ? 45  ARG B CB  1 
ATOM   4500 C CG  . ARG B 1 48  ? 80.803 154.673 25.618  1.00 39.77  ? 45  ARG B CG  1 
ATOM   4501 C CD  . ARG B 1 48  ? 80.124 155.898 26.204  1.00 55.54  ? 45  ARG B CD  1 
ATOM   4502 N NE  . ARG B 1 48  ? 80.114 155.880 27.664  1.00 71.23  ? 45  ARG B NE  1 
ATOM   4503 C CZ  . ARG B 1 48  ? 80.824 156.708 28.424  1.00 73.66  ? 45  ARG B CZ  1 
ATOM   4504 N NH1 . ARG B 1 48  ? 81.595 157.629 27.863  1.00 65.34  ? 45  ARG B NH1 1 
ATOM   4505 N NH2 . ARG B 1 48  ? 80.757 156.622 29.746  1.00 71.21  ? 45  ARG B NH2 1 
ATOM   4506 N N   . ARG B 1 49  ? 79.385 151.228 22.552  1.00 39.27  ? 46  ARG B N   1 
ATOM   4507 C CA  . ARG B 1 49  ? 78.406 150.347 21.933  1.00 44.02  ? 46  ARG B CA  1 
ATOM   4508 C C   . ARG B 1 49  ? 78.409 148.997 22.638  1.00 30.42  ? 46  ARG B C   1 
ATOM   4509 O O   . ARG B 1 49  ? 79.468 148.450 22.956  1.00 35.87  ? 46  ARG B O   1 
ATOM   4510 C CB  . ARG B 1 49  ? 78.708 150.174 20.442  1.00 36.98  ? 46  ARG B CB  1 
ATOM   4511 C CG  . ARG B 1 49  ? 77.741 149.251 19.712  1.00 34.10  ? 46  ARG B CG  1 
ATOM   4512 C CD  . ARG B 1 49  ? 78.166 149.019 18.268  1.00 33.05  ? 46  ARG B CD  1 
ATOM   4513 N NE  . ARG B 1 49  ? 77.858 150.152 17.400  1.00 33.45  ? 46  ARG B NE  1 
ATOM   4514 C CZ  . ARG B 1 49  ? 78.173 150.207 16.109  1.00 30.27  ? 46  ARG B CZ  1 
ATOM   4515 N NH1 . ARG B 1 49  ? 78.810 149.195 15.536  1.00 29.87  ? 46  ARG B NH1 1 
ATOM   4516 N NH2 . ARG B 1 49  ? 77.855 151.275 15.390  1.00 27.53  ? 46  ARG B NH2 1 
ATOM   4517 N N   . PHE B 1 50  ? 77.208 148.477 22.900  1.00 34.70  ? 47  PHE B N   1 
ATOM   4518 C CA  . PHE B 1 50  ? 76.933 147.232 23.616  1.00 39.60  ? 47  PHE B CA  1 
ATOM   4519 C C   . PHE B 1 50  ? 77.182 147.343 25.116  1.00 35.70  ? 47  PHE B C   1 
ATOM   4520 O O   . PHE B 1 50  ? 77.009 146.348 25.830  1.00 40.32  ? 47  PHE B O   1 
ATOM   4521 C CB  . PHE B 1 50  ? 77.744 146.043 23.077  1.00 30.49  ? 47  PHE B CB  1 
ATOM   4522 C CG  . PHE B 1 50  ? 77.679 145.888 21.586  1.00 27.92  ? 47  PHE B CG  1 
ATOM   4523 C CD1 . PHE B 1 50  ? 76.461 145.873 20.928  1.00 33.34  ? 47  PHE B CD1 1 
ATOM   4524 C CD2 . PHE B 1 50  ? 78.840 145.764 20.841  1.00 29.44  ? 47  PHE B CD2 1 
ATOM   4525 C CE1 . PHE B 1 50  ? 76.402 145.730 19.554  1.00 37.60  ? 47  PHE B CE1 1 
ATOM   4526 C CE2 . PHE B 1 50  ? 78.789 145.623 19.468  1.00 40.90  ? 47  PHE B CE2 1 
ATOM   4527 C CZ  . PHE B 1 50  ? 77.568 145.604 18.823  1.00 30.58  ? 47  PHE B CZ  1 
ATOM   4528 N N   . LEU B 1 51  ? 77.574 148.509 25.620  1.00 38.06  ? 48  LEU B N   1 
ATOM   4529 C CA  . LEU B 1 51  ? 77.896 148.681 27.028  1.00 38.95  ? 48  LEU B CA  1 
ATOM   4530 C C   . LEU B 1 51  ? 76.711 149.250 27.793  1.00 34.37  ? 48  LEU B C   1 
ATOM   4531 O O   . LEU B 1 51  ? 75.833 149.897 27.214  1.00 34.00  ? 48  LEU B O   1 
ATOM   4532 C CB  . LEU B 1 51  ? 79.107 149.607 27.189  1.00 37.43  ? 48  LEU B CB  1 
ATOM   4533 C CG  . LEU B 1 51  ? 80.464 149.010 26.819  1.00 39.00  ? 48  LEU B CG  1 
ATOM   4534 C CD1 . LEU B 1 51  ? 81.590 149.932 27.260  1.00 32.52  ? 48  LEU B CD1 1 
ATOM   4535 C CD2 . LEU B 1 51  ? 80.626 147.627 27.430  1.00 34.96  ? 48  LEU B CD2 1 
ATOM   4536 N N   . PRO B 1 52  ? 76.651 149.014 29.103  1.00 33.86  ? 49  PRO B N   1 
ATOM   4537 C CA  . PRO B 1 52  ? 75.578 149.595 29.899  1.00 36.54  ? 49  PRO B CA  1 
ATOM   4538 C C   . PRO B 1 52  ? 75.611 151.115 29.815  1.00 35.29  ? 49  PRO B C   1 
ATOM   4539 O O   . PRO B 1 52  ? 76.679 151.714 29.603  1.00 32.34  ? 49  PRO B O   1 
ATOM   4540 C CB  . PRO B 1 52  ? 75.885 149.106 31.321  1.00 27.01  ? 49  PRO B CB  1 
ATOM   4541 C CG  . PRO B 1 52  ? 76.655 147.853 31.123  1.00 29.28  ? 49  PRO B CG  1 
ATOM   4542 C CD  . PRO B 1 52  ? 77.478 148.081 29.890  1.00 36.80  ? 49  PRO B CD  1 
ATOM   4543 N N   . PRO B 1 53  ? 74.464 151.764 29.975  1.00 29.34  ? 50  PRO B N   1 
ATOM   4544 C CA  . PRO B 1 53  ? 74.436 153.225 29.864  1.00 30.38  ? 50  PRO B CA  1 
ATOM   4545 C C   . PRO B 1 53  ? 75.143 153.887 31.033  1.00 40.52  ? 50  PRO B C   1 
ATOM   4546 O O   . PRO B 1 53  ? 75.213 153.347 32.140  1.00 38.78  ? 50  PRO B O   1 
ATOM   4547 C CB  . PRO B 1 53  ? 72.939 153.549 29.873  1.00 33.49  ? 50  PRO B CB  1 
ATOM   4548 C CG  . PRO B 1 53  ? 72.345 152.446 30.685  1.00 26.16  ? 50  PRO B CG  1 
ATOM   4549 C CD  . PRO B 1 53  ? 73.143 151.216 30.325  1.00 26.45  ? 50  PRO B CD  1 
ATOM   4550 N N   . GLU B 1 54  ? 75.680 155.074 30.768  1.00 47.25  ? 51  GLU B N   1 
ATOM   4551 C CA  . GLU B 1 54  ? 76.245 155.905 31.810  1.00 42.08  ? 51  GLU B CA  1 
ATOM   4552 C C   . GLU B 1 54  ? 75.453 157.202 31.913  1.00 38.45  ? 51  GLU B C   1 
ATOM   4553 O O   . GLU B 1 54  ? 75.003 157.730 30.891  1.00 35.53  ? 51  GLU B O   1 
ATOM   4554 C CB  . GLU B 1 54  ? 77.723 156.214 31.534  1.00 45.01  ? 51  GLU B CB  1 
ATOM   4555 C CG  . GLU B 1 54  ? 78.625 154.995 31.637  1.00 58.65  ? 51  GLU B CG  1 
ATOM   4556 C CD  . GLU B 1 54  ? 79.772 155.201 32.606  1.00 83.27  ? 51  GLU B CD  1 
ATOM   4557 O OE1 . GLU B 1 54  ? 80.890 155.520 32.149  1.00 93.79  ? 51  GLU B OE1 1 
ATOM   4558 O OE2 . GLU B 1 54  ? 79.551 155.053 33.826  1.00 74.47  ? 51  GLU B OE2 1 
ATOM   4559 N N   . PRO B 1 55  ? 75.254 157.726 33.122  1.00 43.95  ? 52  PRO B N   1 
ATOM   4560 C CA  . PRO B 1 55  ? 74.401 158.910 33.281  1.00 37.87  ? 52  PRO B CA  1 
ATOM   4561 C C   . PRO B 1 55  ? 74.927 160.101 32.496  1.00 37.71  ? 52  PRO B C   1 
ATOM   4562 O O   . PRO B 1 55  ? 76.135 160.275 32.317  1.00 38.89  ? 52  PRO B O   1 
ATOM   4563 C CB  . PRO B 1 55  ? 74.440 159.176 34.791  1.00 37.03  ? 52  PRO B CB  1 
ATOM   4564 C CG  . PRO B 1 55  ? 74.816 157.865 35.399  1.00 42.22  ? 52  PRO B CG  1 
ATOM   4565 C CD  . PRO B 1 55  ? 75.745 157.221 34.415  1.00 33.33  ? 52  PRO B CD  1 
ATOM   4566 N N   . LYS B 1 56  ? 73.994 160.921 32.018  1.00 32.48  ? 53  LYS B N   1 
ATOM   4567 C CA  . LYS B 1 56  ? 74.345 162.121 31.270  1.00 39.29  ? 53  LYS B CA  1 
ATOM   4568 C C   . LYS B 1 56  ? 75.068 163.105 32.182  1.00 42.07  ? 53  LYS B C   1 
ATOM   4569 O O   . LYS B 1 56  ? 74.524 163.523 33.209  1.00 37.74  ? 53  LYS B O   1 
ATOM   4570 C CB  . LYS B 1 56  ? 73.088 162.755 30.680  1.00 35.90  ? 53  LYS B CB  1 
ATOM   4571 C CG  . LYS B 1 56  ? 73.319 164.085 29.980  1.00 35.73  ? 53  LYS B CG  1 
ATOM   4572 C CD  . LYS B 1 56  ? 74.213 163.928 28.762  1.00 38.90  ? 53  LYS B CD  1 
ATOM   4573 C CE  . LYS B 1 56  ? 74.309 165.228 27.982  1.00 34.06  ? 53  LYS B CE  1 
ATOM   4574 N NZ  . LYS B 1 56  ? 75.197 165.095 26.796  1.00 51.07  ? 53  LYS B NZ  1 
ATOM   4575 N N   . GLN B 1 57  ? 76.296 163.462 31.813  1.00 43.89  ? 54  GLN B N   1 
ATOM   4576 C CA  . GLN B 1 57  ? 77.048 164.435 32.586  1.00 49.30  ? 54  GLN B CA  1 
ATOM   4577 C C   . GLN B 1 57  ? 76.339 165.789 32.550  1.00 42.51  ? 54  GLN B C   1 
ATOM   4578 O O   . GLN B 1 57  ? 75.698 166.136 31.552  1.00 35.47  ? 54  GLN B O   1 
ATOM   4579 C CB  . GLN B 1 57  ? 78.470 164.569 32.042  1.00 44.23  ? 54  GLN B CB  1 
ATOM   4580 C CG  . GLN B 1 57  ? 79.317 163.311 32.181  1.00 41.83  ? 54  GLN B CG  1 
ATOM   4581 C CD  . GLN B 1 57  ? 79.683 163.003 33.622  1.00 70.56  ? 54  GLN B CD  1 
ATOM   4582 O OE1 . GLN B 1 57  ? 78.872 162.476 34.384  1.00 75.36  ? 54  GLN B OE1 1 
ATOM   4583 N NE2 . GLN B 1 57  ? 80.914 163.329 34.001  1.00 77.80  ? 54  GLN B NE2 1 
ATOM   4584 N N   . PRO B 1 58  ? 76.425 166.567 33.630  1.00 49.56  ? 55  PRO B N   1 
ATOM   4585 C CA  . PRO B 1 58  ? 75.719 167.853 33.668  1.00 45.90  ? 55  PRO B CA  1 
ATOM   4586 C C   . PRO B 1 58  ? 76.195 168.788 32.567  1.00 40.98  ? 55  PRO B C   1 
ATOM   4587 O O   . PRO B 1 58  ? 77.354 168.755 32.147  1.00 32.56  ? 55  PRO B O   1 
ATOM   4588 C CB  . PRO B 1 58  ? 76.059 168.405 35.058  1.00 42.37  ? 55  PRO B CB  1 
ATOM   4589 C CG  . PRO B 1 58  ? 76.437 167.205 35.863  1.00 40.38  ? 55  PRO B CG  1 
ATOM   4590 C CD  . PRO B 1 58  ? 77.115 166.279 34.898  1.00 41.48  ? 55  PRO B CD  1 
ATOM   4591 N N   . TRP B 1 59  ? 75.278 169.628 32.100  1.00 41.72  ? 56  TRP B N   1 
ATOM   4592 C CA  . TRP B 1 59  ? 75.531 170.531 30.990  1.00 38.56  ? 56  TRP B CA  1 
ATOM   4593 C C   . TRP B 1 59  ? 75.343 171.976 31.429  1.00 47.71  ? 56  TRP B C   1 
ATOM   4594 O O   . TRP B 1 59  ? 74.619 172.272 32.385  1.00 37.58  ? 56  TRP B O   1 
ATOM   4595 C CB  . TRP B 1 59  ? 74.602 170.227 29.808  1.00 31.03  ? 56  TRP B CB  1 
ATOM   4596 C CG  . TRP B 1 59  ? 73.150 170.391 30.141  1.00 35.02  ? 56  TRP B CG  1 
ATOM   4597 C CD1 . TRP B 1 59  ? 72.409 171.533 30.037  1.00 37.83  ? 56  TRP B CD1 1 
ATOM   4598 C CD2 . TRP B 1 59  ? 72.263 169.381 30.637  1.00 32.15  ? 56  TRP B CD2 1 
ATOM   4599 N NE1 . TRP B 1 59  ? 71.115 171.296 30.436  1.00 34.29  ? 56  TRP B NE1 1 
ATOM   4600 C CE2 . TRP B 1 59  ? 70.999 169.982 30.808  1.00 37.67  ? 56  TRP B CE2 1 
ATOM   4601 C CE3 . TRP B 1 59  ? 72.414 168.027 30.953  1.00 34.87  ? 56  TRP B CE3 1 
ATOM   4602 C CZ2 . TRP B 1 59  ? 69.895 169.277 31.280  1.00 34.64  ? 56  TRP B CZ2 1 
ATOM   4603 C CZ3 . TRP B 1 59  ? 71.315 167.328 31.421  1.00 29.51  ? 56  TRP B CZ3 1 
ATOM   4604 C CH2 . TRP B 1 59  ? 70.072 167.954 31.580  1.00 32.58  ? 56  TRP B CH2 1 
ATOM   4605 N N   . SER B 1 60  ? 76.008 172.876 30.713  1.00 48.63  ? 57  SER B N   1 
ATOM   4606 C CA  . SER B 1 60  ? 75.836 174.308 30.893  1.00 48.77  ? 57  SER B CA  1 
ATOM   4607 C C   . SER B 1 60  ? 74.891 174.851 29.828  1.00 43.23  ? 57  SER B C   1 
ATOM   4608 O O   . SER B 1 60  ? 74.836 174.346 28.705  1.00 54.96  ? 57  SER B O   1 
ATOM   4609 C CB  . SER B 1 60  ? 77.180 175.036 30.823  1.00 51.23  ? 57  SER B CB  1 
ATOM   4610 O OG  . SER B 1 60  ? 77.824 174.800 29.584  1.00 67.61  ? 57  SER B OG  1 
ATOM   4611 N N   . GLY B 1 61  ? 74.143 175.883 30.196  1.00 43.90  ? 58  GLY B N   1 
ATOM   4612 C CA  . GLY B 1 61  ? 73.194 176.485 29.283  1.00 42.69  ? 58  GLY B CA  1 
ATOM   4613 C C   . GLY B 1 61  ? 71.802 175.898 29.421  1.00 44.83  ? 58  GLY B C   1 
ATOM   4614 O O   . GLY B 1 61  ? 71.441 175.276 30.424  1.00 51.57  ? 58  GLY B O   1 
ATOM   4615 N N   . VAL B 1 62  ? 71.006 176.107 28.376  1.00 45.46  ? 59  VAL B N   1 
ATOM   4616 C CA  . VAL B 1 62  ? 69.622 175.652 28.327  1.00 40.42  ? 59  VAL B CA  1 
ATOM   4617 C C   . VAL B 1 62  ? 69.503 174.655 27.183  1.00 40.75  ? 59  VAL B C   1 
ATOM   4618 O O   . VAL B 1 62  ? 69.531 175.042 26.007  1.00 45.44  ? 59  VAL B O   1 
ATOM   4619 C CB  . VAL B 1 62  ? 68.639 176.816 28.144  1.00 39.14  ? 59  VAL B CB  1 
ATOM   4620 C CG1 . VAL B 1 62  ? 67.204 176.311 28.185  1.00 38.20  ? 59  VAL B CG1 1 
ATOM   4621 C CG2 . VAL B 1 62  ? 68.868 177.878 29.209  1.00 43.27  ? 59  VAL B CG2 1 
ATOM   4622 N N   . VAL B 1 63  ? 69.377 173.372 27.523  1.00 39.68  ? 60  VAL B N   1 
ATOM   4623 C CA  . VAL B 1 63  ? 69.129 172.353 26.512  1.00 40.35  ? 60  VAL B CA  1 
ATOM   4624 C C   . VAL B 1 63  ? 67.729 172.544 25.946  1.00 36.96  ? 60  VAL B C   1 
ATOM   4625 O O   . VAL B 1 63  ? 66.750 172.666 26.694  1.00 35.14  ? 60  VAL B O   1 
ATOM   4626 C CB  . VAL B 1 63  ? 69.304 170.947 27.106  1.00 31.05  ? 60  VAL B CB  1 
ATOM   4627 C CG1 . VAL B 1 63  ? 68.575 169.915 26.257  1.00 41.32  ? 60  VAL B CG1 1 
ATOM   4628 C CG2 . VAL B 1 63  ? 70.777 170.597 27.206  1.00 23.49  ? 60  VAL B CG2 1 
ATOM   4629 N N   . ASP B 1 64  ? 67.628 172.582 24.620  1.00 34.43  ? 61  ASP B N   1 
ATOM   4630 C CA  . ASP B 1 64  ? 66.328 172.721 23.979  1.00 39.43  ? 61  ASP B CA  1 
ATOM   4631 C C   . ASP B 1 64  ? 65.566 171.406 24.081  1.00 40.97  ? 61  ASP B C   1 
ATOM   4632 O O   . ASP B 1 64  ? 66.041 170.365 23.614  1.00 31.91  ? 61  ASP B O   1 
ATOM   4633 C CB  . ASP B 1 64  ? 66.490 173.137 22.521  1.00 36.36  ? 61  ASP B CB  1 
ATOM   4634 C CG  . ASP B 1 64  ? 65.162 173.453 21.858  1.00 48.75  ? 61  ASP B CG  1 
ATOM   4635 O OD1 . ASP B 1 64  ? 64.784 174.644 21.819  1.00 43.71  ? 61  ASP B OD1 1 
ATOM   4636 O OD2 . ASP B 1 64  ? 64.493 172.511 21.384  1.00 41.06  ? 61  ASP B OD2 1 
ATOM   4637 N N   . ALA B 1 65  ? 64.388 171.453 24.698  1.00 41.75  ? 62  ALA B N   1 
ATOM   4638 C CA  . ALA B 1 65  ? 63.557 170.266 24.844  1.00 31.16  ? 62  ALA B CA  1 
ATOM   4639 C C   . ALA B 1 65  ? 62.198 170.488 24.196  1.00 32.68  ? 62  ALA B C   1 
ATOM   4640 O O   . ALA B 1 65  ? 61.158 170.242 24.816  1.00 31.89  ? 62  ALA B O   1 
ATOM   4641 C CB  . ALA B 1 65  ? 63.395 169.901 26.321  1.00 24.96  ? 62  ALA B CB  1 
ATOM   4642 N N   . THR B 1 66  ? 62.196 170.950 22.946  1.00 32.69  ? 63  THR B N   1 
ATOM   4643 C CA  . THR B 1 66  ? 60.969 171.299 22.244  1.00 37.52  ? 63  THR B CA  1 
ATOM   4644 C C   . THR B 1 66  ? 60.593 170.305 21.155  1.00 32.11  ? 63  THR B C   1 
ATOM   4645 O O   . THR B 1 66  ? 59.542 170.468 20.527  1.00 25.52  ? 63  THR B O   1 
ATOM   4646 C CB  . THR B 1 66  ? 61.091 172.702 21.634  1.00 34.49  ? 63  THR B CB  1 
ATOM   4647 O OG1 . THR B 1 66  ? 62.162 172.719 20.682  1.00 36.85  ? 63  THR B OG1 1 
ATOM   4648 C CG2 . THR B 1 66  ? 61.371 173.732 22.718  1.00 25.13  ? 63  THR B CG2 1 
ATOM   4649 N N   . THR B 1 67  ? 61.414 169.285 20.911  1.00 27.89  ? 64  THR B N   1 
ATOM   4650 C CA  . THR B 1 67  ? 61.121 168.308 19.873  1.00 35.35  ? 64  THR B CA  1 
ATOM   4651 C C   . THR B 1 67  ? 61.754 166.976 20.244  1.00 31.90  ? 64  THR B C   1 
ATOM   4652 O O   . THR B 1 67  ? 62.695 166.912 21.041  1.00 31.97  ? 64  THR B O   1 
ATOM   4653 C CB  . THR B 1 67  ? 61.621 168.772 18.498  1.00 36.47  ? 64  THR B CB  1 
ATOM   4654 O OG1 . THR B 1 67  ? 61.265 167.803 17.505  1.00 46.95  ? 64  THR B OG1 1 
ATOM   4655 C CG2 . THR B 1 67  ? 63.134 168.947 18.510  1.00 21.32  ? 64  THR B CG2 1 
ATOM   4656 N N   . PHE B 1 68  ? 61.222 165.909 19.654  1.00 28.42  ? 65  PHE B N   1 
ATOM   4657 C CA  . PHE B 1 68  ? 61.736 164.573 19.911  1.00 29.48  ? 65  PHE B CA  1 
ATOM   4658 C C   . PHE B 1 68  ? 63.151 164.422 19.364  1.00 25.56  ? 65  PHE B C   1 
ATOM   4659 O O   . PHE B 1 68  ? 63.514 165.008 18.341  1.00 26.11  ? 65  PHE B O   1 
ATOM   4660 C CB  . PHE B 1 68  ? 60.831 163.516 19.282  1.00 29.80  ? 65  PHE B CB  1 
ATOM   4661 C CG  . PHE B 1 68  ? 59.496 163.376 19.954  1.00 24.50  ? 65  PHE B CG  1 
ATOM   4662 C CD1 . PHE B 1 68  ? 59.397 162.816 21.217  1.00 27.40  ? 65  PHE B CD1 1 
ATOM   4663 C CD2 . PHE B 1 68  ? 58.337 163.782 19.313  1.00 22.28  ? 65  PHE B CD2 1 
ATOM   4664 C CE1 . PHE B 1 68  ? 58.170 162.678 21.835  1.00 22.70  ? 65  PHE B CE1 1 
ATOM   4665 C CE2 . PHE B 1 68  ? 57.106 163.647 19.926  1.00 28.80  ? 65  PHE B CE2 1 
ATOM   4666 C CZ  . PHE B 1 68  ? 57.022 163.093 21.189  1.00 25.38  ? 65  PHE B CZ  1 
ATOM   4667 N N   . GLN B 1 69  ? 63.950 163.619 20.058  1.00 18.90  ? 66  GLN B N   1 
ATOM   4668 C CA  . GLN B 1 69  ? 65.318 163.358 19.642  1.00 23.03  ? 66  GLN B CA  1 
ATOM   4669 C C   . GLN B 1 69  ? 65.352 162.167 18.685  1.00 25.34  ? 66  GLN B C   1 
ATOM   4670 O O   . GLN B 1 69  ? 64.317 161.677 18.224  1.00 26.34  ? 66  GLN B O   1 
ATOM   4671 C CB  . GLN B 1 69  ? 66.212 163.144 20.861  1.00 24.82  ? 66  GLN B CB  1 
ATOM   4672 C CG  . GLN B 1 69  ? 66.930 164.401 21.328  1.00 34.53  ? 66  GLN B CG  1 
ATOM   4673 C CD  . GLN B 1 69  ? 68.039 164.831 20.382  1.00 38.38  ? 66  GLN B CD  1 
ATOM   4674 O OE1 . GLN B 1 69  ? 68.354 164.137 19.415  1.00 36.39  ? 66  GLN B OE1 1 
ATOM   4675 N NE2 . GLN B 1 69  ? 68.640 165.982 20.662  1.00 29.93  ? 66  GLN B NE2 1 
ATOM   4676 N N   . SER B 1 70  ? 66.554 161.686 18.384  1.00 28.63  ? 67  SER B N   1 
ATOM   4677 C CA  . SER B 1 70  ? 66.728 160.677 17.351  1.00 32.17  ? 67  SER B CA  1 
ATOM   4678 C C   . SER B 1 70  ? 66.214 159.316 17.807  1.00 33.40  ? 67  SER B C   1 
ATOM   4679 O O   . SER B 1 70  ? 66.241 158.975 18.993  1.00 32.55  ? 67  SER B O   1 
ATOM   4680 C CB  . SER B 1 70  ? 68.202 160.570 16.959  1.00 25.93  ? 67  SER B CB  1 
ATOM   4681 O OG  . SER B 1 70  ? 68.687 161.807 16.469  1.00 36.26  ? 67  SER B OG  1 
ATOM   4682 N N   . VAL B 1 71  ? 65.745 158.535 16.839  1.00 28.31  ? 68  VAL B N   1 
ATOM   4683 C CA  . VAL B 1 71  ? 65.297 157.171 17.087  1.00 26.16  ? 68  VAL B CA  1 
ATOM   4684 C C   . VAL B 1 71  ? 66.504 156.245 17.083  1.00 28.95  ? 68  VAL B C   1 
ATOM   4685 O O   . VAL B 1 71  ? 67.415 156.392 16.259  1.00 28.46  ? 68  VAL B O   1 
ATOM   4686 C CB  . VAL B 1 71  ? 64.259 156.750 16.031  1.00 29.72  ? 68  VAL B CB  1 
ATOM   4687 C CG1 . VAL B 1 71  ? 63.841 155.303 16.233  1.00 32.88  ? 68  VAL B CG1 1 
ATOM   4688 C CG2 . VAL B 1 71  ? 63.047 157.669 16.082  1.00 23.78  ? 68  VAL B CG2 1 
ATOM   4689 N N   . CYS B 1 72  ? 66.526 155.295 18.017  1.00 24.18  ? 69  CYS B N   1 
ATOM   4690 C CA  . CYS B 1 72  ? 67.625 154.342 18.081  1.00 23.18  ? 69  CYS B CA  1 
ATOM   4691 C C   . CYS B 1 72  ? 67.674 153.503 16.810  1.00 26.45  ? 69  CYS B C   1 
ATOM   4692 O O   . CYS B 1 72  ? 66.639 153.188 16.216  1.00 26.41  ? 69  CYS B O   1 
ATOM   4693 C CB  . CYS B 1 72  ? 67.476 153.442 19.309  1.00 26.38  ? 69  CYS B CB  1 
ATOM   4694 S SG  . CYS B 1 72  ? 67.465 154.325 20.891  1.00 35.39  ? 69  CYS B SG  1 
ATOM   4695 N N   . TYR B 1 73  ? 68.889 153.151 16.389  1.00 26.74  ? 70  TYR B N   1 
ATOM   4696 C CA  . TYR B 1 73  ? 69.072 152.392 15.158  1.00 32.05  ? 70  TYR B CA  1 
ATOM   4697 C C   . TYR B 1 73  ? 68.280 151.092 15.205  1.00 29.95  ? 70  TYR B C   1 
ATOM   4698 O O   . TYR B 1 73  ? 68.390 150.317 16.160  1.00 30.03  ? 70  TYR B O   1 
ATOM   4699 C CB  . TYR B 1 73  ? 70.554 152.099 14.928  1.00 35.13  ? 70  TYR B CB  1 
ATOM   4700 C CG  . TYR B 1 73  ? 71.183 152.963 13.860  1.00 36.52  ? 70  TYR B CG  1 
ATOM   4701 C CD1 . TYR B 1 73  ? 71.951 154.070 14.195  1.00 35.40  ? 70  TYR B CD1 1 
ATOM   4702 C CD2 . TYR B 1 73  ? 71.002 152.674 12.512  1.00 29.43  ? 70  TYR B CD2 1 
ATOM   4703 C CE1 . TYR B 1 73  ? 72.527 154.862 13.219  1.00 34.05  ? 70  TYR B CE1 1 
ATOM   4704 C CE2 . TYR B 1 73  ? 71.572 153.461 11.530  1.00 34.91  ? 70  TYR B CE2 1 
ATOM   4705 C CZ  . TYR B 1 73  ? 72.333 154.553 11.889  1.00 33.06  ? 70  TYR B CZ  1 
ATOM   4706 O OH  . TYR B 1 73  ? 72.902 155.338 10.912  1.00 49.44  ? 70  TYR B OH  1 
ATOM   4707 N N   . GLN B 1 74  ? 67.480 150.857 14.169  1.00 26.20  ? 71  GLN B N   1 
ATOM   4708 C CA  . GLN B 1 74  ? 66.573 149.720 14.169  1.00 26.88  ? 71  GLN B CA  1 
ATOM   4709 C C   . GLN B 1 74  ? 66.163 149.398 12.740  1.00 31.81  ? 71  GLN B C   1 
ATOM   4710 O O   . GLN B 1 74  ? 66.269 150.231 11.836  1.00 26.02  ? 71  GLN B O   1 
ATOM   4711 C CB  . GLN B 1 74  ? 65.337 149.998 15.029  1.00 21.08  ? 71  GLN B CB  1 
ATOM   4712 C CG  . GLN B 1 74  ? 64.468 151.133 14.511  1.00 19.34  ? 71  GLN B CG  1 
ATOM   4713 C CD  . GLN B 1 74  ? 63.400 151.547 15.503  1.00 22.28  ? 71  GLN B CD  1 
ATOM   4714 O OE1 . GLN B 1 74  ? 62.206 151.503 15.204  1.00 23.82  ? 71  GLN B OE1 1 
ATOM   4715 N NE2 . GLN B 1 74  ? 63.825 151.960 16.690  1.00 26.35  ? 71  GLN B NE2 1 
ATOM   4716 N N   . TYR B 1 75  ? 65.691 148.168 12.556  1.00 28.84  ? 72  TYR B N   1 
ATOM   4717 C CA  . TYR B 1 75  ? 65.138 147.752 11.276  1.00 26.51  ? 72  TYR B CA  1 
ATOM   4718 C C   . TYR B 1 75  ? 63.870 148.540 10.967  1.00 27.94  ? 72  TYR B C   1 
ATOM   4719 O O   . TYR B 1 75  ? 63.100 148.900 11.861  1.00 32.32  ? 72  TYR B O   1 
ATOM   4720 C CB  . TYR B 1 75  ? 64.846 146.249 11.302  1.00 27.43  ? 72  TYR B CB  1 
ATOM   4721 C CG  . TYR B 1 75  ? 64.077 145.730 10.110  1.00 25.76  ? 72  TYR B CG  1 
ATOM   4722 C CD1 . TYR B 1 75  ? 64.731 145.379 8.936   1.00 29.39  ? 72  TYR B CD1 1 
ATOM   4723 C CD2 . TYR B 1 75  ? 62.697 145.574 10.164  1.00 27.59  ? 72  TYR B CD2 1 
ATOM   4724 C CE1 . TYR B 1 75  ? 64.031 144.898 7.847   1.00 35.21  ? 72  TYR B CE1 1 
ATOM   4725 C CE2 . TYR B 1 75  ? 61.990 145.095 9.079   1.00 33.56  ? 72  TYR B CE2 1 
ATOM   4726 C CZ  . TYR B 1 75  ? 62.662 144.757 7.924   1.00 36.19  ? 72  TYR B CZ  1 
ATOM   4727 O OH  . TYR B 1 75  ? 61.961 144.279 6.841   1.00 51.42  ? 72  TYR B OH  1 
ATOM   4728 N N   . VAL B 1 76  ? 63.659 148.815 9.682   1.00 21.21  ? 73  VAL B N   1 
ATOM   4729 C CA  . VAL B 1 76  ? 62.493 149.550 9.206   1.00 24.74  ? 73  VAL B CA  1 
ATOM   4730 C C   . VAL B 1 76  ? 61.608 148.590 8.424   1.00 35.25  ? 73  VAL B C   1 
ATOM   4731 O O   . VAL B 1 76  ? 62.084 147.896 7.517   1.00 40.30  ? 73  VAL B O   1 
ATOM   4732 C CB  . VAL B 1 76  ? 62.900 150.757 8.343   1.00 36.86  ? 73  VAL B CB  1 
ATOM   4733 C CG1 . VAL B 1 76  ? 61.670 151.430 7.755   1.00 30.63  ? 73  VAL B CG1 1 
ATOM   4734 C CG2 . VAL B 1 76  ? 63.710 151.748 9.169   1.00 27.38  ? 73  VAL B CG2 1 
ATOM   4735 N N   . ASP B 1 77  ? 60.324 148.552 8.774   1.00 39.89  ? 74  ASP B N   1 
ATOM   4736 C CA  . ASP B 1 77  ? 59.399 147.613 8.154   1.00 29.95  ? 74  ASP B CA  1 
ATOM   4737 C C   . ASP B 1 77  ? 59.149 147.988 6.699   1.00 36.18  ? 74  ASP B C   1 
ATOM   4738 O O   . ASP B 1 77  ? 58.843 149.143 6.387   1.00 35.80  ? 74  ASP B O   1 
ATOM   4739 C CB  . ASP B 1 77  ? 58.081 147.583 8.927   1.00 35.55  ? 74  ASP B CB  1 
ATOM   4740 C CG  . ASP B 1 77  ? 57.171 146.455 8.482   1.00 35.44  ? 74  ASP B CG  1 
ATOM   4741 O OD1 . ASP B 1 77  ? 56.464 146.622 7.466   1.00 32.30  ? 74  ASP B OD1 1 
ATOM   4742 O OD2 . ASP B 1 77  ? 57.162 145.402 9.152   1.00 33.71  ? 74  ASP B OD2 1 
ATOM   4743 N N   . THR B 1 78  ? 59.276 147.003 5.803   1.00 34.55  ? 75  THR B N   1 
ATOM   4744 C CA  . THR B 1 78  ? 59.074 147.223 4.375   1.00 40.94  ? 75  THR B CA  1 
ATOM   4745 C C   . THR B 1 78  ? 58.102 146.215 3.771   1.00 38.07  ? 75  THR B C   1 
ATOM   4746 O O   . THR B 1 78  ? 58.112 146.009 2.553   1.00 45.03  ? 75  THR B O   1 
ATOM   4747 C CB  . THR B 1 78  ? 60.407 147.172 3.622   1.00 41.89  ? 75  THR B CB  1 
ATOM   4748 O OG1 . THR B 1 78  ? 61.048 145.912 3.865   1.00 39.81  ? 75  THR B OG1 1 
ATOM   4749 C CG2 . THR B 1 78  ? 61.324 148.300 4.073   1.00 37.80  ? 75  THR B CG2 1 
ATOM   4750 N N   . LEU B 1 79  ? 57.261 145.582 4.594   1.00 37.73  ? 76  LEU B N   1 
ATOM   4751 C CA  . LEU B 1 79  ? 56.330 144.587 4.070   1.00 33.46  ? 76  LEU B CA  1 
ATOM   4752 C C   . LEU B 1 79  ? 55.270 145.231 3.185   1.00 38.07  ? 76  LEU B C   1 
ATOM   4753 O O   . LEU B 1 79  ? 54.937 144.699 2.119   1.00 38.45  ? 76  LEU B O   1 
ATOM   4754 C CB  . LEU B 1 79  ? 55.678 143.819 5.220   1.00 32.60  ? 76  LEU B CB  1 
ATOM   4755 C CG  . LEU B 1 79  ? 54.804 142.627 4.816   1.00 50.76  ? 76  LEU B CG  1 
ATOM   4756 C CD1 . LEU B 1 79  ? 55.624 141.594 4.059   1.00 34.83  ? 76  LEU B CD1 1 
ATOM   4757 C CD2 . LEU B 1 79  ? 54.137 141.997 6.029   1.00 38.86  ? 76  LEU B CD2 1 
ATOM   4758 N N   . TYR B 1 80  ? 54.729 146.373 3.605   1.00 36.53  ? 77  TYR B N   1 
ATOM   4759 C CA  . TYR B 1 80  ? 53.718 147.102 2.840   1.00 34.69  ? 77  TYR B CA  1 
ATOM   4760 C C   . TYR B 1 80  ? 54.124 148.567 2.774   1.00 36.02  ? 77  TYR B C   1 
ATOM   4761 O O   . TYR B 1 80  ? 53.716 149.376 3.620   1.00 34.04  ? 77  TYR B O   1 
ATOM   4762 C CB  . TYR B 1 80  ? 52.331 146.938 3.458   1.00 28.70  ? 77  TYR B CB  1 
ATOM   4763 C CG  . TYR B 1 80  ? 51.828 145.512 3.478   1.00 38.16  ? 77  TYR B CG  1 
ATOM   4764 C CD1 . TYR B 1 80  ? 51.443 144.875 2.306   1.00 33.48  ? 77  TYR B CD1 1 
ATOM   4765 C CD2 . TYR B 1 80  ? 51.726 144.808 4.671   1.00 32.75  ? 77  TYR B CD2 1 
ATOM   4766 C CE1 . TYR B 1 80  ? 50.978 143.572 2.320   1.00 33.11  ? 77  TYR B CE1 1 
ATOM   4767 C CE2 . TYR B 1 80  ? 51.262 143.506 4.694   1.00 43.49  ? 77  TYR B CE2 1 
ATOM   4768 C CZ  . TYR B 1 80  ? 50.890 142.893 3.517   1.00 41.96  ? 77  TYR B CZ  1 
ATOM   4769 O OH  . TYR B 1 80  ? 50.428 141.597 3.538   1.00 39.11  ? 77  TYR B OH  1 
ATOM   4770 N N   . PRO B 1 81  ? 54.932 148.946 1.784   1.00 35.75  ? 78  PRO B N   1 
ATOM   4771 C CA  . PRO B 1 81  ? 55.364 150.346 1.673   1.00 36.70  ? 78  PRO B CA  1 
ATOM   4772 C C   . PRO B 1 81  ? 54.181 151.291 1.499   1.00 37.41  ? 78  PRO B C   1 
ATOM   4773 O O   . PRO B 1 81  ? 53.270 151.037 0.707   1.00 39.23  ? 78  PRO B O   1 
ATOM   4774 C CB  . PRO B 1 81  ? 56.269 150.339 0.435   1.00 28.61  ? 78  PRO B CB  1 
ATOM   4775 C CG  . PRO B 1 81  ? 56.734 148.925 0.313   1.00 32.26  ? 78  PRO B CG  1 
ATOM   4776 C CD  . PRO B 1 81  ? 55.589 148.081 0.790   1.00 33.79  ? 78  PRO B CD  1 
ATOM   4777 N N   . GLY B 1 82  ? 54.205 152.388 2.256   1.00 30.67  ? 79  GLY B N   1 
ATOM   4778 C CA  . GLY B 1 82  ? 53.170 153.399 2.203   1.00 34.15  ? 79  GLY B CA  1 
ATOM   4779 C C   . GLY B 1 82  ? 51.877 153.048 2.906   1.00 39.77  ? 79  GLY B C   1 
ATOM   4780 O O   . GLY B 1 82  ? 50.906 153.808 2.794   1.00 40.47  ? 79  GLY B O   1 
ATOM   4781 N N   . PHE B 1 83  ? 51.827 151.930 3.625   1.00 35.52  ? 80  PHE B N   1 
ATOM   4782 C CA  . PHE B 1 83  ? 50.614 151.487 4.300   1.00 34.03  ? 80  PHE B CA  1 
ATOM   4783 C C   . PHE B 1 83  ? 50.571 152.049 5.716   1.00 35.62  ? 80  PHE B C   1 
ATOM   4784 O O   . PHE B 1 83  ? 51.543 151.926 6.467   1.00 32.89  ? 80  PHE B O   1 
ATOM   4785 C CB  . PHE B 1 83  ? 50.554 149.959 4.327   1.00 32.97  ? 80  PHE B CB  1 
ATOM   4786 C CG  . PHE B 1 83  ? 49.359 149.407 5.047   1.00 26.62  ? 80  PHE B CG  1 
ATOM   4787 C CD1 . PHE B 1 83  ? 48.076 149.758 4.660   1.00 32.23  ? 80  PHE B CD1 1 
ATOM   4788 C CD2 . PHE B 1 83  ? 49.518 148.519 6.099   1.00 26.13  ? 80  PHE B CD2 1 
ATOM   4789 C CE1 . PHE B 1 83  ? 46.974 149.246 5.318   1.00 25.14  ? 80  PHE B CE1 1 
ATOM   4790 C CE2 . PHE B 1 83  ? 48.419 148.000 6.758   1.00 35.67  ? 80  PHE B CE2 1 
ATOM   4791 C CZ  . PHE B 1 83  ? 47.146 148.366 6.368   1.00 34.70  ? 80  PHE B CZ  1 
ATOM   4792 N N   . GLU B 1 84  ? 49.438 152.656 6.079   1.00 29.14  ? 81  GLU B N   1 
ATOM   4793 C CA  . GLU B 1 84  ? 49.325 153.294 7.389   1.00 31.06  ? 81  GLU B CA  1 
ATOM   4794 C C   . GLU B 1 84  ? 49.506 152.288 8.519   1.00 31.63  ? 81  GLU B C   1 
ATOM   4795 O O   . GLU B 1 84  ? 50.109 152.606 9.551   1.00 37.10  ? 81  GLU B O   1 
ATOM   4796 C CB  . GLU B 1 84  ? 47.974 153.998 7.522   1.00 28.85  ? 81  GLU B CB  1 
ATOM   4797 C CG  . GLU B 1 84  ? 47.782 154.701 8.860   1.00 44.31  ? 81  GLU B CG  1 
ATOM   4798 C CD  . GLU B 1 84  ? 46.413 155.338 9.003   1.00 55.19  ? 81  GLU B CD  1 
ATOM   4799 O OE1 . GLU B 1 84  ? 45.399 154.620 8.873   1.00 44.98  ? 81  GLU B OE1 1 
ATOM   4800 O OE2 . GLU B 1 84  ? 46.352 156.563 9.242   1.00 69.70  ? 81  GLU B OE2 1 
ATOM   4801 N N   . GLY B 1 85  ? 48.997 151.067 8.341   1.00 31.02  ? 82  GLY B N   1 
ATOM   4802 C CA  . GLY B 1 85  ? 49.040 150.089 9.416   1.00 31.55  ? 82  GLY B CA  1 
ATOM   4803 C C   . GLY B 1 85  ? 50.444 149.680 9.813   1.00 22.45  ? 82  GLY B C   1 
ATOM   4804 O O   . GLY B 1 85  ? 50.674 149.266 10.952  1.00 23.09  ? 82  GLY B O   1 
ATOM   4805 N N   . THR B 1 86  ? 51.399 149.785 8.890   1.00 30.41  ? 83  THR B N   1 
ATOM   4806 C CA  . THR B 1 86  ? 52.791 149.461 9.184   1.00 28.93  ? 83  THR B CA  1 
ATOM   4807 C C   . THR B 1 86  ? 53.662 150.693 9.381   1.00 28.14  ? 83  THR B C   1 
ATOM   4808 O O   . THR B 1 86  ? 54.552 150.681 10.238  1.00 28.82  ? 83  THR B O   1 
ATOM   4809 C CB  . THR B 1 86  ? 53.389 148.594 8.069   1.00 28.58  ? 83  THR B CB  1 
ATOM   4810 O OG1 . THR B 1 86  ? 53.155 149.213 6.797   1.00 30.22  ? 83  THR B OG1 1 
ATOM   4811 C CG2 . THR B 1 86  ? 52.771 147.203 8.079   1.00 30.79  ? 83  THR B CG2 1 
ATOM   4812 N N   . GLU B 1 87  ? 53.426 151.763 8.614   1.00 29.53  ? 84  GLU B N   1 
ATOM   4813 C CA  . GLU B 1 87  ? 54.267 152.952 8.724   1.00 33.49  ? 84  GLU B CA  1 
ATOM   4814 C C   . GLU B 1 87  ? 54.121 153.631 10.080  1.00 29.84  ? 84  GLU B C   1 
ATOM   4815 O O   . GLU B 1 87  ? 55.048 154.315 10.528  1.00 30.63  ? 84  GLU B O   1 
ATOM   4816 C CB  . GLU B 1 87  ? 53.936 153.946 7.608   1.00 37.27  ? 84  GLU B CB  1 
ATOM   4817 C CG  . GLU B 1 87  ? 54.188 153.442 6.190   1.00 43.46  ? 84  GLU B CG  1 
ATOM   4818 C CD  . GLU B 1 87  ? 55.659 153.325 5.845   1.00 56.96  ? 84  GLU B CD  1 
ATOM   4819 O OE1 . GLU B 1 87  ? 55.973 152.704 4.806   1.00 44.16  ? 84  GLU B OE1 1 
ATOM   4820 O OE2 . GLU B 1 87  ? 56.500 153.854 6.602   1.00 57.96  ? 84  GLU B OE2 1 
ATOM   4821 N N   . MET B 1 88  ? 52.977 153.456 10.749  1.00 27.55  ? 85  MET B N   1 
ATOM   4822 C CA  . MET B 1 88  ? 52.744 154.137 12.019  1.00 23.11  ? 85  MET B CA  1 
ATOM   4823 C C   . MET B 1 88  ? 53.704 153.681 13.110  1.00 22.82  ? 85  MET B C   1 
ATOM   4824 O O   . MET B 1 88  ? 53.846 154.375 14.123  1.00 27.45  ? 85  MET B O   1 
ATOM   4825 C CB  . MET B 1 88  ? 51.299 153.923 12.477  1.00 24.03  ? 85  MET B CB  1 
ATOM   4826 C CG  . MET B 1 88  ? 50.917 152.465 12.674  1.00 30.44  ? 85  MET B CG  1 
ATOM   4827 S SD  . MET B 1 88  ? 49.208 152.260 13.213  1.00 28.05  ? 85  MET B SD  1 
ATOM   4828 C CE  . MET B 1 88  ? 49.282 152.944 14.868  1.00 30.06  ? 85  MET B CE  1 
ATOM   4829 N N   . TRP B 1 89  ? 54.362 152.538 12.931  1.00 23.28  ? 86  TRP B N   1 
ATOM   4830 C CA  . TRP B 1 89  ? 55.343 152.050 13.889  1.00 27.80  ? 86  TRP B CA  1 
ATOM   4831 C C   . TRP B 1 89  ? 56.779 152.326 13.461  1.00 28.78  ? 86  TRP B C   1 
ATOM   4832 O O   . TRP B 1 89  ? 57.693 152.163 14.277  1.00 20.19  ? 86  TRP B O   1 
ATOM   4833 C CB  . TRP B 1 89  ? 55.158 150.543 14.115  1.00 23.28  ? 86  TRP B CB  1 
ATOM   4834 C CG  . TRP B 1 89  ? 53.729 150.136 14.322  1.00 25.10  ? 86  TRP B CG  1 
ATOM   4835 C CD1 . TRP B 1 89  ? 52.900 149.559 13.404  1.00 36.58  ? 86  TRP B CD1 1 
ATOM   4836 C CD2 . TRP B 1 89  ? 52.958 150.279 15.522  1.00 34.86  ? 86  TRP B CD2 1 
ATOM   4837 N NE1 . TRP B 1 89  ? 51.663 149.331 13.958  1.00 30.57  ? 86  TRP B NE1 1 
ATOM   4838 C CE2 . TRP B 1 89  ? 51.672 149.764 15.257  1.00 37.64  ? 86  TRP B CE2 1 
ATOM   4839 C CE3 . TRP B 1 89  ? 53.230 150.791 16.795  1.00 32.88  ? 86  TRP B CE3 1 
ATOM   4840 C CZ2 . TRP B 1 89  ? 50.662 149.748 16.217  1.00 27.94  ? 86  TRP B CZ2 1 
ATOM   4841 C CZ3 . TRP B 1 89  ? 52.225 150.772 17.747  1.00 32.95  ? 86  TRP B CZ3 1 
ATOM   4842 C CH2 . TRP B 1 89  ? 50.958 150.255 17.453  1.00 25.40  ? 86  TRP B CH2 1 
ATOM   4843 N N   . ASN B 1 90  ? 56.997 152.741 12.214  1.00 27.15  ? 87  ASN B N   1 
ATOM   4844 C CA  . ASN B 1 90  ? 58.338 153.009 11.725  1.00 27.00  ? 87  ASN B CA  1 
ATOM   4845 C C   . ASN B 1 90  ? 58.898 154.284 12.354  1.00 29.20  ? 87  ASN B C   1 
ATOM   4846 O O   . ASN B 1 90  ? 58.143 155.137 12.825  1.00 22.99  ? 87  ASN B O   1 
ATOM   4847 C CB  . ASN B 1 90  ? 58.327 153.128 10.202  1.00 26.91  ? 87  ASN B CB  1 
ATOM   4848 C CG  . ASN B 1 90  ? 58.290 151.780 9.514   1.00 30.24  ? 87  ASN B CG  1 
ATOM   4849 O OD1 . ASN B 1 90  ? 58.736 150.775 10.069  1.00 29.99  ? 87  ASN B OD1 1 
ATOM   4850 N ND2 . ASN B 1 90  ? 57.761 151.750 8.297   1.00 32.49  ? 87  ASN B ND2 1 
ATOM   4851 N N   . PRO B 1 91  ? 60.224 154.429 12.383  1.00 25.71  ? 88  PRO B N   1 
ATOM   4852 C CA  . PRO B 1 91  ? 60.820 155.630 12.984  1.00 38.67  ? 88  PRO B CA  1 
ATOM   4853 C C   . PRO B 1 91  ? 60.378 156.896 12.263  1.00 28.97  ? 88  PRO B C   1 
ATOM   4854 O O   . PRO B 1 91  ? 60.390 156.967 11.032  1.00 24.69  ? 88  PRO B O   1 
ATOM   4855 C CB  . PRO B 1 91  ? 62.327 155.391 12.832  1.00 29.17  ? 88  PRO B CB  1 
ATOM   4856 C CG  . PRO B 1 91  ? 62.468 153.913 12.708  1.00 30.51  ? 88  PRO B CG  1 
ATOM   4857 C CD  . PRO B 1 91  ? 61.249 153.453 11.972  1.00 25.07  ? 88  PRO B CD  1 
ATOM   4858 N N   . ASN B 1 92  ? 59.977 157.898 13.045  1.00 31.59  ? 89  ASN B N   1 
ATOM   4859 C CA  . ASN B 1 92  ? 59.586 159.198 12.514  1.00 29.53  ? 89  ASN B CA  1 
ATOM   4860 C C   . ASN B 1 92  ? 60.623 160.275 12.802  1.00 26.93  ? 89  ASN B C   1 
ATOM   4861 O O   . ASN B 1 92  ? 60.343 161.464 12.613  1.00 32.59  ? 89  ASN B O   1 
ATOM   4862 C CB  . ASN B 1 92  ? 58.216 159.609 13.063  1.00 30.68  ? 89  ASN B CB  1 
ATOM   4863 C CG  . ASN B 1 92  ? 58.189 159.686 14.576  1.00 30.90  ? 89  ASN B CG  1 
ATOM   4864 O OD1 . ASN B 1 92  ? 59.077 159.171 15.254  1.00 27.75  ? 89  ASN B OD1 1 
ATOM   4865 N ND2 . ASN B 1 92  ? 57.156 160.325 15.114  1.00 24.34  ? 89  ASN B ND2 1 
ATOM   4866 N N   . ARG B 1 93  ? 61.809 159.887 13.265  1.00 27.79  ? 90  ARG B N   1 
ATOM   4867 C CA  . ARG B 1 93  ? 62.957 160.770 13.394  1.00 26.38  ? 90  ARG B CA  1 
ATOM   4868 C C   . ARG B 1 93  ? 64.167 160.072 12.786  1.00 32.02  ? 90  ARG B C   1 
ATOM   4869 O O   . ARG B 1 93  ? 64.115 158.890 12.436  1.00 33.97  ? 90  ARG B O   1 
ATOM   4870 C CB  . ARG B 1 93  ? 63.226 161.145 14.859  1.00 27.94  ? 90  ARG B CB  1 
ATOM   4871 C CG  . ARG B 1 93  ? 62.135 161.986 15.509  1.00 26.97  ? 90  ARG B CG  1 
ATOM   4872 C CD  . ARG B 1 93  ? 61.969 163.324 14.804  1.00 31.24  ? 90  ARG B CD  1 
ATOM   4873 N NE  . ARG B 1 93  ? 61.115 164.240 15.556  1.00 29.27  ? 90  ARG B NE  1 
ATOM   4874 C CZ  . ARG B 1 93  ? 59.791 164.286 15.452  1.00 36.51  ? 90  ARG B CZ  1 
ATOM   4875 N NH1 . ARG B 1 93  ? 59.159 163.462 14.627  1.00 32.09  ? 90  ARG B NH1 1 
ATOM   4876 N NH2 . ARG B 1 93  ? 59.096 165.153 16.176  1.00 38.66  ? 90  ARG B NH2 1 
ATOM   4877 N N   . GLU B 1 94  ? 65.263 160.813 12.655  1.00 32.68  ? 91  GLU B N   1 
ATOM   4878 C CA  . GLU B 1 94  ? 66.479 160.241 12.091  1.00 32.10  ? 91  GLU B CA  1 
ATOM   4879 C C   . GLU B 1 94  ? 67.033 159.154 13.004  1.00 37.67  ? 91  GLU B C   1 
ATOM   4880 O O   . GLU B 1 94  ? 66.940 159.243 14.232  1.00 36.34  ? 91  GLU B O   1 
ATOM   4881 C CB  . GLU B 1 94  ? 67.533 161.328 11.874  1.00 35.21  ? 91  GLU B CB  1 
ATOM   4882 C CG  . GLU B 1 94  ? 67.193 162.349 10.793  1.00 58.54  ? 91  GLU B CG  1 
ATOM   4883 C CD  . GLU B 1 94  ? 67.518 161.865 9.388   1.00 70.49  ? 91  GLU B CD  1 
ATOM   4884 O OE1 . GLU B 1 94  ? 67.296 160.672 9.091   1.00 68.56  ? 91  GLU B OE1 1 
ATOM   4885 O OE2 . GLU B 1 94  ? 68.003 162.684 8.579   1.00 74.81  ? 91  GLU B OE2 1 
ATOM   4886 N N   . LEU B 1 95  ? 67.606 158.119 12.396  1.00 29.20  ? 92  LEU B N   1 
ATOM   4887 C CA  . LEU B 1 95  ? 68.243 157.052 13.155  1.00 28.26  ? 92  LEU B CA  1 
ATOM   4888 C C   . LEU B 1 95  ? 69.620 157.495 13.632  1.00 23.08  ? 92  LEU B C   1 
ATOM   4889 O O   . LEU B 1 95  ? 70.354 158.174 12.909  1.00 36.73  ? 92  LEU B O   1 
ATOM   4890 C CB  . LEU B 1 95  ? 68.370 155.784 12.310  1.00 29.51  ? 92  LEU B CB  1 
ATOM   4891 C CG  . LEU B 1 95  ? 67.091 155.065 11.875  1.00 27.25  ? 92  LEU B CG  1 
ATOM   4892 C CD1 . LEU B 1 95  ? 67.435 153.746 11.197  1.00 17.12  ? 92  LEU B CD1 1 
ATOM   4893 C CD2 . LEU B 1 95  ? 66.160 154.840 13.056  1.00 29.96  ? 92  LEU B CD2 1 
ATOM   4894 N N   . SER B 1 96  ? 69.966 157.101 14.854  1.00 32.44  ? 93  SER B N   1 
ATOM   4895 C CA  . SER B 1 96  ? 71.259 157.428 15.440  1.00 28.52  ? 93  SER B CA  1 
ATOM   4896 C C   . SER B 1 96  ? 71.474 156.563 16.671  1.00 30.60  ? 93  SER B C   1 
ATOM   4897 O O   . SER B 1 96  ? 70.517 156.202 17.363  1.00 26.35  ? 93  SER B O   1 
ATOM   4898 C CB  . SER B 1 96  ? 71.351 158.912 15.817  1.00 23.38  ? 93  SER B CB  1 
ATOM   4899 O OG  . SER B 1 96  ? 72.487 159.162 16.628  1.00 25.98  ? 93  SER B OG  1 
ATOM   4900 N N   . GLU B 1 97  ? 72.741 156.230 16.932  1.00 24.76  ? 94  GLU B N   1 
ATOM   4901 C CA  . GLU B 1 97  ? 73.083 155.586 18.194  1.00 17.38  ? 94  GLU B CA  1 
ATOM   4902 C C   . GLU B 1 97  ? 72.989 156.556 19.364  1.00 32.35  ? 94  GLU B C   1 
ATOM   4903 O O   . GLU B 1 97  ? 72.812 156.118 20.506  1.00 35.64  ? 94  GLU B O   1 
ATOM   4904 C CB  . GLU B 1 97  ? 74.486 154.981 18.124  1.00 24.03  ? 94  GLU B CB  1 
ATOM   4905 C CG  . GLU B 1 97  ? 74.651 153.902 17.065  1.00 22.38  ? 94  GLU B CG  1 
ATOM   4906 C CD  . GLU B 1 97  ? 75.939 153.116 17.233  1.00 33.35  ? 94  GLU B CD  1 
ATOM   4907 O OE1 . GLU B 1 97  ? 76.104 152.456 18.281  1.00 28.30  ? 94  GLU B OE1 1 
ATOM   4908 O OE2 . GLU B 1 97  ? 76.790 153.165 16.321  1.00 35.98  ? 94  GLU B OE2 1 
ATOM   4909 N N   . ASP B 1 98  ? 73.106 157.859 19.102  1.00 30.66  ? 95  ASP B N   1 
ATOM   4910 C CA  . ASP B 1 98  ? 72.866 158.894 20.107  1.00 34.75  ? 95  ASP B CA  1 
ATOM   4911 C C   . ASP B 1 98  ? 71.357 159.104 20.196  1.00 30.93  ? 95  ASP B C   1 
ATOM   4912 O O   . ASP B 1 98  ? 70.778 160.014 19.598  1.00 30.87  ? 95  ASP B O   1 
ATOM   4913 C CB  . ASP B 1 98  ? 73.606 160.176 19.744  1.00 28.43  ? 95  ASP B CB  1 
ATOM   4914 C CG  . ASP B 1 98  ? 73.336 161.310 20.720  1.00 33.97  ? 95  ASP B CG  1 
ATOM   4915 O OD1 . ASP B 1 98  ? 73.591 162.477 20.356  1.00 46.33  ? 95  ASP B OD1 1 
ATOM   4916 O OD2 . ASP B 1 98  ? 72.871 161.040 21.847  1.00 36.54  ? 95  ASP B OD2 1 
ATOM   4917 N N   . CYS B 1 99  ? 70.709 158.228 20.966  1.00 31.65  ? 96  CYS B N   1 
ATOM   4918 C CA  . CYS B 1 99  ? 69.257 158.198 21.039  1.00 31.88  ? 96  CYS B CA  1 
ATOM   4919 C C   . CYS B 1 99  ? 68.710 158.115 22.456  1.00 24.22  ? 96  CYS B C   1 
ATOM   4920 O O   . CYS B 1 99  ? 67.486 158.139 22.626  1.00 30.98  ? 96  CYS B O   1 
ATOM   4921 C CB  . CYS B 1 99  ? 68.710 157.013 20.229  1.00 26.71  ? 96  CYS B CB  1 
ATOM   4922 S SG  . CYS B 1 99  ? 69.201 155.386 20.867  1.00 34.33  ? 96  CYS B SG  1 
ATOM   4923 N N   . LEU B 1 100 ? 69.567 158.022 23.474  1.00 26.32  ? 97  LEU B N   1 
ATOM   4924 C CA  . LEU B 1 100 ? 69.110 157.826 24.850  1.00 26.04  ? 97  LEU B CA  1 
ATOM   4925 C C   . LEU B 1 100 ? 68.579 159.149 25.395  1.00 27.99  ? 97  LEU B C   1 
ATOM   4926 O O   . LEU B 1 100 ? 69.250 159.887 26.121  1.00 32.36  ? 97  LEU B O   1 
ATOM   4927 C CB  . LEU B 1 100 ? 70.229 157.259 25.712  1.00 26.18  ? 97  LEU B CB  1 
ATOM   4928 C CG  . LEU B 1 100 ? 70.606 155.825 25.334  1.00 26.05  ? 97  LEU B CG  1 
ATOM   4929 C CD1 . LEU B 1 100 ? 71.595 155.229 26.321  1.00 25.77  ? 97  LEU B CD1 1 
ATOM   4930 C CD2 . LEU B 1 100 ? 69.356 154.960 25.230  1.00 18.16  ? 97  LEU B CD2 1 
ATOM   4931 N N   . TYR B 1 101 ? 67.333 159.441 25.034  1.00 22.77  ? 98  TYR B N   1 
ATOM   4932 C CA  . TYR B 1 101 ? 66.629 160.629 25.486  1.00 28.87  ? 98  TYR B CA  1 
ATOM   4933 C C   . TYR B 1 101 ? 65.247 160.225 25.977  1.00 31.23  ? 98  TYR B C   1 
ATOM   4934 O O   . TYR B 1 101 ? 64.703 159.197 25.562  1.00 32.98  ? 98  TYR B O   1 
ATOM   4935 C CB  . TYR B 1 101 ? 66.514 161.673 24.364  1.00 22.06  ? 98  TYR B CB  1 
ATOM   4936 C CG  . TYR B 1 101 ? 67.849 162.155 23.838  1.00 35.87  ? 98  TYR B CG  1 
ATOM   4937 C CD1 . TYR B 1 101 ? 68.403 163.345 24.288  1.00 36.59  ? 98  TYR B CD1 1 
ATOM   4938 C CD2 . TYR B 1 101 ? 68.554 161.420 22.893  1.00 33.90  ? 98  TYR B CD2 1 
ATOM   4939 C CE1 . TYR B 1 101 ? 69.622 163.790 23.813  1.00 29.76  ? 98  TYR B CE1 1 
ATOM   4940 C CE2 . TYR B 1 101 ? 69.774 161.856 22.413  1.00 37.99  ? 98  TYR B CE2 1 
ATOM   4941 C CZ  . TYR B 1 101 ? 70.303 163.042 22.876  1.00 40.26  ? 98  TYR B CZ  1 
ATOM   4942 O OH  . TYR B 1 101 ? 71.517 163.480 22.401  1.00 32.72  ? 98  TYR B OH  1 
ATOM   4943 N N   . LEU B 1 102 ? 64.684 161.033 26.872  1.00 27.32  ? 99  LEU B N   1 
ATOM   4944 C CA  . LEU B 1 102 ? 63.356 160.777 27.412  1.00 31.96  ? 99  LEU B CA  1 
ATOM   4945 C C   . LEU B 1 102 ? 62.507 162.036 27.310  1.00 31.20  ? 99  LEU B C   1 
ATOM   4946 O O   . LEU B 1 102 ? 63.007 163.137 27.062  1.00 34.25  ? 99  LEU B O   1 
ATOM   4947 C CB  . LEU B 1 102 ? 63.419 160.273 28.865  1.00 24.77  ? 99  LEU B CB  1 
ATOM   4948 C CG  . LEU B 1 102 ? 64.168 161.037 29.964  1.00 30.24  ? 99  LEU B CG  1 
ATOM   4949 C CD1 . LEU B 1 102 ? 63.375 162.229 30.484  1.00 24.46  ? 99  LEU B CD1 1 
ATOM   4950 C CD2 . LEU B 1 102 ? 64.506 160.092 31.107  1.00 25.70  ? 99  LEU B CD2 1 
ATOM   4951 N N   . ASN B 1 103 ? 61.203 161.860 27.513  1.00 28.22  ? 100 ASN B N   1 
ATOM   4952 C CA  . ASN B 1 103 ? 60.235 162.937 27.383  1.00 31.53  ? 100 ASN B CA  1 
ATOM   4953 C C   . ASN B 1 103 ? 59.352 162.988 28.621  1.00 32.46  ? 100 ASN B C   1 
ATOM   4954 O O   . ASN B 1 103 ? 59.073 161.961 29.246  1.00 29.19  ? 100 ASN B O   1 
ATOM   4955 C CB  . ASN B 1 103 ? 59.369 162.756 26.129  1.00 32.96  ? 100 ASN B CB  1 
ATOM   4956 C CG  . ASN B 1 103 ? 60.156 162.209 24.954  1.00 35.86  ? 100 ASN B CG  1 
ATOM   4957 O OD1 . ASN B 1 103 ? 60.848 162.949 24.256  1.00 38.77  ? 100 ASN B OD1 1 
ATOM   4958 N ND2 . ASN B 1 103 ? 60.055 160.903 24.732  1.00 31.60  ? 100 ASN B ND2 1 
ATOM   4959 N N   . VAL B 1 104 ? 58.916 164.197 28.971  1.00 31.64  ? 101 VAL B N   1 
ATOM   4960 C CA  . VAL B 1 104 ? 58.069 164.430 30.135  1.00 24.36  ? 101 VAL B CA  1 
ATOM   4961 C C   . VAL B 1 104 ? 56.913 165.331 29.725  1.00 28.65  ? 101 VAL B C   1 
ATOM   4962 O O   . VAL B 1 104 ? 57.130 166.414 29.170  1.00 33.66  ? 101 VAL B O   1 
ATOM   4963 C CB  . VAL B 1 104 ? 58.853 165.065 31.302  1.00 27.93  ? 101 VAL B CB  1 
ATOM   4964 C CG1 . VAL B 1 104 ? 57.921 165.360 32.469  1.00 31.74  ? 101 VAL B CG1 1 
ATOM   4965 C CG2 . VAL B 1 104 ? 59.991 164.157 31.743  1.00 23.00  ? 101 VAL B CG2 1 
ATOM   4966 N N   . TRP B 1 105 ? 55.690 164.879 29.990  1.00 33.41  ? 102 TRP B N   1 
ATOM   4967 C CA  . TRP B 1 105 ? 54.487 165.682 29.824  1.00 32.96  ? 102 TRP B CA  1 
ATOM   4968 C C   . TRP B 1 105 ? 53.939 166.049 31.197  1.00 40.61  ? 102 TRP B C   1 
ATOM   4969 O O   . TRP B 1 105 ? 53.909 165.211 32.106  1.00 35.85  ? 102 TRP B O   1 
ATOM   4970 C CB  . TRP B 1 105 ? 53.416 164.931 29.022  1.00 35.04  ? 102 TRP B CB  1 
ATOM   4971 C CG  . TRP B 1 105 ? 53.729 164.737 27.565  1.00 32.34  ? 102 TRP B CG  1 
ATOM   4972 C CD1 . TRP B 1 105 ? 53.342 165.539 26.529  1.00 32.69  ? 102 TRP B CD1 1 
ATOM   4973 C CD2 . TRP B 1 105 ? 54.474 163.661 26.982  1.00 27.99  ? 102 TRP B CD2 1 
ATOM   4974 N NE1 . TRP B 1 105 ? 53.808 165.033 25.339  1.00 30.15  ? 102 TRP B NE1 1 
ATOM   4975 C CE2 . TRP B 1 105 ? 54.506 163.880 25.590  1.00 27.11  ? 102 TRP B CE2 1 
ATOM   4976 C CE3 . TRP B 1 105 ? 55.121 162.536 27.502  1.00 34.75  ? 102 TRP B CE3 1 
ATOM   4977 C CZ2 . TRP B 1 105 ? 55.160 163.017 24.712  1.00 27.27  ? 102 TRP B CZ2 1 
ATOM   4978 C CZ3 . TRP B 1 105 ? 55.770 161.680 26.629  1.00 32.85  ? 102 TRP B CZ3 1 
ATOM   4979 C CH2 . TRP B 1 105 ? 55.784 161.925 25.250  1.00 32.65  ? 102 TRP B CH2 1 
ATOM   4980 N N   . THR B 1 106 ? 53.511 167.298 31.347  1.00 36.28  ? 103 THR B N   1 
ATOM   4981 C CA  . THR B 1 106 ? 52.974 167.787 32.607  1.00 39.64  ? 103 THR B CA  1 
ATOM   4982 C C   . THR B 1 106 ? 51.843 168.763 32.318  1.00 37.78  ? 103 THR B C   1 
ATOM   4983 O O   . THR B 1 106 ? 51.889 169.492 31.320  1.00 39.52  ? 103 THR B O   1 
ATOM   4984 C CB  . THR B 1 106 ? 54.063 168.458 33.465  1.00 38.45  ? 103 THR B CB  1 
ATOM   4985 O OG1 . THR B 1 106 ? 53.536 168.792 34.754  1.00 44.62  ? 103 THR B OG1 1 
ATOM   4986 C CG2 . THR B 1 106 ? 54.594 169.715 32.794  1.00 32.38  ? 103 THR B CG2 1 
ATOM   4987 N N   . PRO B 1 107 ? 50.807 168.779 33.152  1.00 42.43  ? 104 PRO B N   1 
ATOM   4988 C CA  . PRO B 1 107 ? 49.639 169.620 32.863  1.00 45.86  ? 104 PRO B CA  1 
ATOM   4989 C C   . PRO B 1 107 ? 49.946 171.100 33.029  1.00 48.47  ? 104 PRO B C   1 
ATOM   4990 O O   . PRO B 1 107 ? 50.913 171.501 33.680  1.00 38.66  ? 104 PRO B O   1 
ATOM   4991 C CB  . PRO B 1 107 ? 48.600 169.160 33.895  1.00 43.28  ? 104 PRO B CB  1 
ATOM   4992 C CG  . PRO B 1 107 ? 49.108 167.851 34.419  1.00 46.94  ? 104 PRO B CG  1 
ATOM   4993 C CD  . PRO B 1 107 ? 50.593 167.927 34.334  1.00 39.81  ? 104 PRO B CD  1 
ATOM   4994 N N   . TYR B 1 108 ? 49.092 171.918 32.418  1.00 49.16  ? 105 TYR B N   1 
ATOM   4995 C CA  . TYR B 1 108 ? 49.137 173.360 32.626  1.00 51.37  ? 105 TYR B CA  1 
ATOM   4996 C C   . TYR B 1 108 ? 47.851 173.840 33.297  1.00 53.88  ? 105 TYR B C   1 
ATOM   4997 O O   . TYR B 1 108 ? 46.754 173.542 32.823  1.00 53.75  ? 105 TYR B O   1 
ATOM   4998 C CB  . TYR B 1 108 ? 49.353 174.110 31.311  1.00 54.57  ? 105 TYR B CB  1 
ATOM   4999 C CG  . TYR B 1 108 ? 49.415 175.610 31.497  1.00 58.90  ? 105 TYR B CG  1 
ATOM   5000 C CD1 . TYR B 1 108 ? 50.593 176.231 31.893  1.00 62.05  ? 105 TYR B CD1 1 
ATOM   5001 C CD2 . TYR B 1 108 ? 48.293 176.403 31.291  1.00 64.14  ? 105 TYR B CD2 1 
ATOM   5002 C CE1 . TYR B 1 108 ? 50.653 177.600 32.073  1.00 74.41  ? 105 TYR B CE1 1 
ATOM   5003 C CE2 . TYR B 1 108 ? 48.344 177.773 31.468  1.00 72.28  ? 105 TYR B CE2 1 
ATOM   5004 C CZ  . TYR B 1 108 ? 49.526 178.366 31.859  1.00 82.81  ? 105 TYR B CZ  1 
ATOM   5005 O OH  . TYR B 1 108 ? 49.583 179.729 32.035  1.00 79.24  ? 105 TYR B OH  1 
ATOM   5006 N N   . PRO B 1 109 ? 47.981 174.588 34.405  1.00 56.94  ? 106 PRO B N   1 
ATOM   5007 C CA  . PRO B 1 109 ? 49.256 174.956 35.034  1.00 52.64  ? 106 PRO B CA  1 
ATOM   5008 C C   . PRO B 1 109 ? 49.931 173.779 35.735  1.00 43.39  ? 106 PRO B C   1 
ATOM   5009 O O   . PRO B 1 109 ? 49.258 172.802 36.062  1.00 42.78  ? 106 PRO B O   1 
ATOM   5010 C CB  . PRO B 1 109 ? 48.849 176.031 36.044  1.00 42.68  ? 106 PRO B CB  1 
ATOM   5011 C CG  . PRO B 1 109 ? 47.437 175.709 36.376  1.00 55.17  ? 106 PRO B CG  1 
ATOM   5012 C CD  . PRO B 1 109 ? 46.832 175.188 35.104  1.00 53.46  ? 106 PRO B CD  1 
ATOM   5013 N N   . ARG B 1 110 ? 51.242 173.879 35.935  1.00 38.18  ? 107 ARG B N   1 
ATOM   5014 C CA  . ARG B 1 110 ? 51.994 172.789 36.537  1.00 35.37  ? 107 ARG B CA  1 
ATOM   5015 C C   . ARG B 1 110 ? 51.391 172.424 37.891  1.00 47.40  ? 107 ARG B C   1 
ATOM   5016 O O   . ARG B 1 110 ? 51.020 173.314 38.666  1.00 53.72  ? 107 ARG B O   1 
ATOM   5017 C CB  . ARG B 1 110 ? 53.463 173.181 36.705  1.00 37.75  ? 107 ARG B CB  1 
ATOM   5018 C CG  . ARG B 1 110 ? 54.372 172.047 37.152  1.00 43.83  ? 107 ARG B CG  1 
ATOM   5019 C CD  . ARG B 1 110 ? 55.801 172.532 37.319  1.00 44.28  ? 107 ARG B CD  1 
ATOM   5020 N NE  . ARG B 1 110 ? 56.222 173.356 36.191  1.00 49.60  ? 107 ARG B NE  1 
ATOM   5021 C CZ  . ARG B 1 110 ? 57.418 173.925 36.084  1.00 53.62  ? 107 ARG B CZ  1 
ATOM   5022 N NH1 . ARG B 1 110 ? 58.323 173.756 37.038  1.00 53.86  ? 107 ARG B NH1 1 
ATOM   5023 N NH2 . ARG B 1 110 ? 57.707 174.662 35.020  1.00 55.63  ? 107 ARG B NH2 1 
ATOM   5024 N N   . PRO B 1 111 ? 51.255 171.136 38.198  1.00 55.77  ? 108 PRO B N   1 
ATOM   5025 C CA  . PRO B 1 111 ? 50.701 170.747 39.500  1.00 60.73  ? 108 PRO B CA  1 
ATOM   5026 C C   . PRO B 1 111 ? 51.598 171.207 40.639  1.00 57.74  ? 108 PRO B C   1 
ATOM   5027 O O   . PRO B 1 111 ? 52.818 171.028 40.605  1.00 54.14  ? 108 PRO B O   1 
ATOM   5028 C CB  . PRO B 1 111 ? 50.633 169.217 39.414  1.00 54.76  ? 108 PRO B CB  1 
ATOM   5029 C CG  . PRO B 1 111 ? 50.634 168.913 37.952  1.00 43.24  ? 108 PRO B CG  1 
ATOM   5030 C CD  . PRO B 1 111 ? 51.483 169.974 37.324  1.00 49.88  ? 108 PRO B CD  1 
ATOM   5031 N N   . THR B 1 112 ? 50.981 171.818 41.648  1.00 60.19  ? 109 THR B N   1 
ATOM   5032 C CA  . THR B 1 112 ? 51.705 172.239 42.840  1.00 60.94  ? 109 THR B CA  1 
ATOM   5033 C C   . THR B 1 112 ? 51.817 171.127 43.872  1.00 61.13  ? 109 THR B C   1 
ATOM   5034 O O   . THR B 1 112 ? 52.770 171.114 44.659  1.00 56.49  ? 109 THR B O   1 
ATOM   5035 C CB  . THR B 1 112 ? 51.026 173.459 43.467  1.00 53.80  ? 109 THR B CB  1 
ATOM   5036 O OG1 . THR B 1 112 ? 49.650 173.159 43.732  1.00 59.41  ? 109 THR B OG1 1 
ATOM   5037 C CG2 . THR B 1 112 ? 51.109 174.653 42.527  1.00 51.11  ? 109 THR B CG2 1 
ATOM   5038 N N   . SER B 1 113 ? 50.862 170.196 43.883  1.00 61.13  ? 110 SER B N   1 
ATOM   5039 C CA  . SER B 1 113 ? 50.883 169.003 44.718  1.00 64.23  ? 110 SER B CA  1 
ATOM   5040 C C   . SER B 1 113 ? 51.543 167.852 43.963  1.00 65.80  ? 110 SER B C   1 
ATOM   5041 O O   . SER B 1 113 ? 51.375 167.734 42.745  1.00 65.29  ? 110 SER B O   1 
ATOM   5042 C CB  . SER B 1 113 ? 49.467 168.602 45.122  1.00 53.48  ? 110 SER B CB  1 
ATOM   5043 O OG  . SER B 1 113 ? 48.757 169.702 45.663  1.00 74.79  ? 110 SER B OG  1 
ATOM   5044 N N   . PRO B 1 114 ? 52.307 167.009 44.657  1.00 61.59  ? 111 PRO B N   1 
ATOM   5045 C CA  . PRO B 1 114 ? 52.942 165.859 43.992  1.00 54.40  ? 111 PRO B CA  1 
ATOM   5046 C C   . PRO B 1 114 ? 51.909 164.968 43.318  1.00 53.51  ? 111 PRO B C   1 
ATOM   5047 O O   . PRO B 1 114 ? 50.975 164.472 43.955  1.00 57.67  ? 111 PRO B O   1 
ATOM   5048 C CB  . PRO B 1 114 ? 53.656 165.142 45.143  1.00 58.15  ? 111 PRO B CB  1 
ATOM   5049 C CG  . PRO B 1 114 ? 53.920 166.219 46.142  1.00 52.59  ? 111 PRO B CG  1 
ATOM   5050 C CD  . PRO B 1 114 ? 52.735 167.142 46.060  1.00 55.93  ? 111 PRO B CD  1 
ATOM   5051 N N   . THR B 1 115 ? 52.086 164.767 42.008  1.00 47.70  ? 112 THR B N   1 
ATOM   5052 C CA  . THR B 1 115 ? 51.157 164.074 41.129  1.00 51.51  ? 112 THR B CA  1 
ATOM   5053 C C   . THR B 1 115 ? 51.707 162.711 40.719  1.00 50.43  ? 112 THR B C   1 
ATOM   5054 O O   . THR B 1 115 ? 52.902 162.592 40.423  1.00 42.77  ? 112 THR B O   1 
ATOM   5055 C CB  . THR B 1 115 ? 50.887 164.918 39.874  1.00 52.32  ? 112 THR B CB  1 
ATOM   5056 O OG1 . THR B 1 115 ? 50.316 166.174 40.260  1.00 59.74  ? 112 THR B OG1 1 
ATOM   5057 C CG2 . THR B 1 115 ? 49.933 164.213 38.928  1.00 48.51  ? 112 THR B CG2 1 
ATOM   5058 N N   . PRO B 1 116 ? 50.873 161.668 40.709  1.00 54.18  ? 113 PRO B N   1 
ATOM   5059 C CA  . PRO B 1 116 ? 51.344 160.351 40.262  1.00 55.50  ? 113 PRO B CA  1 
ATOM   5060 C C   . PRO B 1 116 ? 51.854 160.387 38.829  1.00 45.81  ? 113 PRO B C   1 
ATOM   5061 O O   . PRO B 1 116 ? 51.379 161.159 37.992  1.00 33.95  ? 113 PRO B O   1 
ATOM   5062 C CB  . PRO B 1 116 ? 50.098 159.464 40.392  1.00 51.49  ? 113 PRO B CB  1 
ATOM   5063 C CG  . PRO B 1 116 ? 48.945 160.419 40.478  1.00 47.96  ? 113 PRO B CG  1 
ATOM   5064 C CD  . PRO B 1 116 ? 49.482 161.617 41.186  1.00 50.62  ? 113 PRO B CD  1 
ATOM   5065 N N   . VAL B 1 117 ? 52.832 159.527 38.552  1.00 36.39  ? 114 VAL B N   1 
ATOM   5066 C CA  . VAL B 1 117 ? 53.587 159.554 37.306  1.00 43.06  ? 114 VAL B CA  1 
ATOM   5067 C C   . VAL B 1 117 ? 53.348 158.258 36.545  1.00 39.92  ? 114 VAL B C   1 
ATOM   5068 O O   . VAL B 1 117 ? 53.484 157.166 37.108  1.00 41.37  ? 114 VAL B O   1 
ATOM   5069 C CB  . VAL B 1 117 ? 55.091 159.759 37.566  1.00 43.08  ? 114 VAL B CB  1 
ATOM   5070 C CG1 . VAL B 1 117 ? 55.856 159.801 36.254  1.00 39.00  ? 114 VAL B CG1 1 
ATOM   5071 C CG2 . VAL B 1 117 ? 55.321 161.029 38.370  1.00 40.15  ? 114 VAL B CG2 1 
ATOM   5072 N N   . LEU B 1 118 ? 52.999 158.384 35.268  1.00 44.10  ? 115 LEU B N   1 
ATOM   5073 C CA  . LEU B 1 118 ? 52.918 157.254 34.352  1.00 33.65  ? 115 LEU B CA  1 
ATOM   5074 C C   . LEU B 1 118 ? 54.178 157.221 33.498  1.00 39.54  ? 115 LEU B C   1 
ATOM   5075 O O   . LEU B 1 118 ? 54.595 158.252 32.961  1.00 40.49  ? 115 LEU B O   1 
ATOM   5076 C CB  . LEU B 1 118 ? 51.677 157.354 33.463  1.00 28.11  ? 115 LEU B CB  1 
ATOM   5077 C CG  . LEU B 1 118 ? 50.328 156.996 34.087  1.00 37.90  ? 115 LEU B CG  1 
ATOM   5078 C CD1 . LEU B 1 118 ? 49.190 157.444 33.187  1.00 31.37  ? 115 LEU B CD1 1 
ATOM   5079 C CD2 . LEU B 1 118 ? 50.246 155.501 34.343  1.00 35.94  ? 115 LEU B CD2 1 
ATOM   5080 N N   . VAL B 1 119 ? 54.786 156.043 33.381  1.00 31.63  ? 116 VAL B N   1 
ATOM   5081 C CA  . VAL B 1 119 ? 56.013 155.863 32.612  1.00 35.39  ? 116 VAL B CA  1 
ATOM   5082 C C   . VAL B 1 119 ? 55.741 154.845 31.514  1.00 35.30  ? 116 VAL B C   1 
ATOM   5083 O O   . VAL B 1 119 ? 55.433 153.681 31.802  1.00 37.51  ? 116 VAL B O   1 
ATOM   5084 C CB  . VAL B 1 119 ? 57.187 155.420 33.498  1.00 32.30  ? 116 VAL B CB  1 
ATOM   5085 C CG1 . VAL B 1 119 ? 58.421 155.178 32.647  1.00 25.11  ? 116 VAL B CG1 1 
ATOM   5086 C CG2 . VAL B 1 119 ? 57.471 156.469 34.560  1.00 35.03  ? 116 VAL B CG2 1 
ATOM   5087 N N   . TRP B 1 120 ? 55.867 155.278 30.263  1.00 29.83  ? 117 TRP B N   1 
ATOM   5088 C CA  . TRP B 1 120 ? 55.559 154.454 29.103  1.00 28.07  ? 117 TRP B CA  1 
ATOM   5089 C C   . TRP B 1 120 ? 56.820 153.799 28.557  1.00 30.26  ? 117 TRP B C   1 
ATOM   5090 O O   . TRP B 1 120 ? 57.872 154.438 28.452  1.00 35.26  ? 117 TRP B O   1 
ATOM   5091 C CB  . TRP B 1 120 ? 54.887 155.289 28.009  1.00 25.92  ? 117 TRP B CB  1 
ATOM   5092 C CG  . TRP B 1 120 ? 54.678 154.553 26.718  1.00 35.08  ? 117 TRP B CG  1 
ATOM   5093 C CD1 . TRP B 1 120 ? 55.368 154.729 25.553  1.00 36.64  ? 117 TRP B CD1 1 
ATOM   5094 C CD2 . TRP B 1 120 ? 53.715 153.524 26.460  1.00 41.21  ? 117 TRP B CD2 1 
ATOM   5095 N NE1 . TRP B 1 120 ? 54.893 153.876 24.587  1.00 37.68  ? 117 TRP B NE1 1 
ATOM   5096 C CE2 . TRP B 1 120 ? 53.878 153.124 25.119  1.00 31.24  ? 117 TRP B CE2 1 
ATOM   5097 C CE3 . TRP B 1 120 ? 52.731 152.902 27.233  1.00 28.69  ? 117 TRP B CE3 1 
ATOM   5098 C CZ2 . TRP B 1 120 ? 53.094 152.131 24.535  1.00 34.09  ? 117 TRP B CZ2 1 
ATOM   5099 C CZ3 . TRP B 1 120 ? 51.953 151.917 26.653  1.00 34.82  ? 117 TRP B CZ3 1 
ATOM   5100 C CH2 . TRP B 1 120 ? 52.139 151.541 25.317  1.00 34.63  ? 117 TRP B CH2 1 
ATOM   5101 N N   . ILE B 1 121 ? 56.708 152.518 28.216  1.00 26.78  ? 118 ILE B N   1 
ATOM   5102 C CA  . ILE B 1 121 ? 57.786 151.752 27.601  1.00 26.28  ? 118 ILE B CA  1 
ATOM   5103 C C   . ILE B 1 121 ? 57.226 151.152 26.320  1.00 32.61  ? 118 ILE B C   1 
ATOM   5104 O O   . ILE B 1 121 ? 56.374 150.256 26.371  1.00 31.65  ? 118 ILE B O   1 
ATOM   5105 C CB  . ILE B 1 121 ? 58.328 150.653 28.527  1.00 26.47  ? 118 ILE B CB  1 
ATOM   5106 C CG1 . ILE B 1 121 ? 58.729 151.241 29.882  1.00 27.40  ? 118 ILE B CG1 1 
ATOM   5107 C CG2 . ILE B 1 121 ? 59.514 149.952 27.882  1.00 19.33  ? 118 ILE B CG2 1 
ATOM   5108 C CD1 . ILE B 1 121 ? 59.208 150.206 30.878  1.00 28.22  ? 118 ILE B CD1 1 
ATOM   5109 N N   . TYR B 1 122 ? 57.693 151.644 25.175  1.00 28.98  ? 119 TYR B N   1 
ATOM   5110 C CA  . TYR B 1 122 ? 57.158 151.182 23.905  1.00 30.70  ? 119 TYR B CA  1 
ATOM   5111 C C   . TYR B 1 122 ? 57.568 149.737 23.632  1.00 29.56  ? 119 TYR B C   1 
ATOM   5112 O O   . TYR B 1 122 ? 58.555 149.224 24.170  1.00 21.90  ? 119 TYR B O   1 
ATOM   5113 C CB  . TYR B 1 122 ? 57.619 152.085 22.757  1.00 22.93  ? 119 TYR B CB  1 
ATOM   5114 C CG  . TYR B 1 122 ? 59.121 152.234 22.606  1.00 24.52  ? 119 TYR B CG  1 
ATOM   5115 C CD1 . TYR B 1 122 ? 59.888 151.231 22.023  1.00 25.30  ? 119 TYR B CD1 1 
ATOM   5116 C CD2 . TYR B 1 122 ? 59.765 153.392 23.019  1.00 22.79  ? 119 TYR B CD2 1 
ATOM   5117 C CE1 . TYR B 1 122 ? 61.255 151.371 21.876  1.00 28.61  ? 119 TYR B CE1 1 
ATOM   5118 C CE2 . TYR B 1 122 ? 61.131 153.542 22.875  1.00 19.65  ? 119 TYR B CE2 1 
ATOM   5119 C CZ  . TYR B 1 122 ? 61.871 152.529 22.303  1.00 25.78  ? 119 TYR B CZ  1 
ATOM   5120 O OH  . TYR B 1 122 ? 63.231 152.671 22.158  1.00 23.70  ? 119 TYR B OH  1 
ATOM   5121 N N   . GLY B 1 123 ? 56.785 149.079 22.779  1.00 29.65  ? 120 GLY B N   1 
ATOM   5122 C CA  . GLY B 1 123 ? 57.084 147.740 22.326  1.00 28.76  ? 120 GLY B CA  1 
ATOM   5123 C C   . GLY B 1 123 ? 57.763 147.735 20.969  1.00 35.99  ? 120 GLY B C   1 
ATOM   5124 O O   . GLY B 1 123 ? 58.194 148.764 20.444  1.00 32.08  ? 120 GLY B O   1 
ATOM   5125 N N   . GLY B 1 124 ? 57.853 146.540 20.394  1.00 34.49  ? 121 GLY B N   1 
ATOM   5126 C CA  . GLY B 1 124 ? 58.488 146.383 19.103  1.00 22.87  ? 121 GLY B CA  1 
ATOM   5127 C C   . GLY B 1 124 ? 59.453 145.217 19.053  1.00 33.42  ? 121 GLY B C   1 
ATOM   5128 O O   . GLY B 1 124 ? 60.497 145.298 18.400  1.00 30.84  ? 121 GLY B O   1 
ATOM   5129 N N   . GLY B 1 125 ? 59.115 144.135 19.753  1.00 35.85  ? 122 GLY B N   1 
ATOM   5130 C CA  . GLY B 1 125 ? 59.896 142.911 19.734  1.00 24.84  ? 122 GLY B CA  1 
ATOM   5131 C C   . GLY B 1 125 ? 61.361 143.076 20.085  1.00 25.49  ? 122 GLY B C   1 
ATOM   5132 O O   . GLY B 1 125 ? 62.195 142.264 19.671  1.00 29.69  ? 122 GLY B O   1 
ATOM   5133 N N   . PHE B 1 126 ? 61.687 144.124 20.840  1.00 27.50  ? 123 PHE B N   1 
ATOM   5134 C CA  . PHE B 1 126 ? 63.049 144.482 21.228  1.00 24.74  ? 123 PHE B CA  1 
ATOM   5135 C C   . PHE B 1 126 ? 63.951 144.768 20.032  1.00 25.53  ? 123 PHE B C   1 
ATOM   5136 O O   . PHE B 1 126 ? 65.177 144.837 20.189  1.00 31.80  ? 123 PHE B O   1 
ATOM   5137 C CB  . PHE B 1 126 ? 63.687 143.405 22.117  1.00 24.15  ? 123 PHE B CB  1 
ATOM   5138 C CG  . PHE B 1 126 ? 62.968 143.191 23.421  1.00 33.19  ? 123 PHE B CG  1 
ATOM   5139 C CD1 . PHE B 1 126 ? 63.145 144.069 24.478  1.00 23.26  ? 123 PHE B CD1 1 
ATOM   5140 C CD2 . PHE B 1 126 ? 62.120 142.108 23.592  1.00 28.09  ? 123 PHE B CD2 1 
ATOM   5141 C CE1 . PHE B 1 126 ? 62.487 143.876 25.679  1.00 27.74  ? 123 PHE B CE1 1 
ATOM   5142 C CE2 . PHE B 1 126 ? 61.459 141.908 24.791  1.00 28.02  ? 123 PHE B CE2 1 
ATOM   5143 C CZ  . PHE B 1 126 ? 61.643 142.793 25.835  1.00 29.63  ? 123 PHE B CZ  1 
ATOM   5144 N N   . TYR B 1 127 ? 63.380 144.943 18.837  1.00 23.12  ? 124 TYR B N   1 
ATOM   5145 C CA  . TYR B 1 127 ? 64.149 145.284 17.650  1.00 22.30  ? 124 TYR B CA  1 
ATOM   5146 C C   . TYR B 1 127 ? 63.747 146.611 17.027  1.00 26.67  ? 124 TYR B C   1 
ATOM   5147 O O   . TYR B 1 127 ? 64.411 147.053 16.081  1.00 30.32  ? 124 TYR B O   1 
ATOM   5148 C CB  . TYR B 1 127 ? 64.027 144.178 16.586  1.00 28.63  ? 124 TYR B CB  1 
ATOM   5149 C CG  . TYR B 1 127 ? 62.685 144.128 15.882  1.00 28.55  ? 124 TYR B CG  1 
ATOM   5150 C CD1 . TYR B 1 127 ? 62.460 144.852 14.716  1.00 32.52  ? 124 TYR B CD1 1 
ATOM   5151 C CD2 . TYR B 1 127 ? 61.649 143.348 16.375  1.00 25.52  ? 124 TYR B CD2 1 
ATOM   5152 C CE1 . TYR B 1 127 ? 61.239 144.811 14.072  1.00 30.41  ? 124 TYR B CE1 1 
ATOM   5153 C CE2 . TYR B 1 127 ? 60.424 143.300 15.736  1.00 28.14  ? 124 TYR B CE2 1 
ATOM   5154 C CZ  . TYR B 1 127 ? 60.225 144.032 14.585  1.00 29.19  ? 124 TYR B CZ  1 
ATOM   5155 O OH  . TYR B 1 127 ? 59.008 143.985 13.946  1.00 34.97  ? 124 TYR B OH  1 
ATOM   5156 N N   . SER B 1 128 ? 62.688 147.252 17.511  1.00 27.58  ? 125 SER B N   1 
ATOM   5157 C CA  . SER B 1 128 ? 62.199 148.493 16.925  1.00 23.90  ? 125 SER B CA  1 
ATOM   5158 C C   . SER B 1 128 ? 61.416 149.253 17.988  1.00 25.94  ? 125 SER B C   1 
ATOM   5159 O O   . SER B 1 128 ? 61.288 148.807 19.132  1.00 25.20  ? 125 SER B O   1 
ATOM   5160 C CB  . SER B 1 128 ? 61.341 148.218 15.686  1.00 27.43  ? 125 SER B CB  1 
ATOM   5161 O OG  . SER B 1 128 ? 60.180 147.478 16.024  1.00 27.82  ? 125 SER B OG  1 
ATOM   5162 N N   . GLY B 1 129 ? 60.889 150.403 17.599  1.00 23.68  ? 126 GLY B N   1 
ATOM   5163 C CA  . GLY B 1 129 ? 60.097 151.227 18.484  1.00 23.48  ? 126 GLY B CA  1 
ATOM   5164 C C   . GLY B 1 129 ? 60.774 152.556 18.784  1.00 28.93  ? 126 GLY B C   1 
ATOM   5165 O O   . GLY B 1 129 ? 61.991 152.721 18.652  1.00 25.76  ? 126 GLY B O   1 
ATOM   5166 N N   . ALA B 1 130 ? 59.954 153.517 19.203  1.00 24.53  ? 127 ALA B N   1 
ATOM   5167 C CA  . ALA B 1 130 ? 60.430 154.853 19.528  1.00 28.42  ? 127 ALA B CA  1 
ATOM   5168 C C   . ALA B 1 130 ? 59.355 155.574 20.326  1.00 24.80  ? 127 ALA B C   1 
ATOM   5169 O O   . ALA B 1 130 ? 58.159 155.359 20.116  1.00 26.97  ? 127 ALA B O   1 
ATOM   5170 C CB  . ALA B 1 130 ? 60.781 155.651 18.266  1.00 24.51  ? 127 ALA B CB  1 
ATOM   5171 N N   . SER B 1 131 ? 59.796 156.433 21.246  1.00 29.99  ? 128 SER B N   1 
ATOM   5172 C CA  . SER B 1 131 ? 58.872 157.225 22.047  1.00 28.13  ? 128 SER B CA  1 
ATOM   5173 C C   . SER B 1 131 ? 58.285 158.404 21.283  1.00 25.84  ? 128 SER B C   1 
ATOM   5174 O O   . SER B 1 131 ? 57.386 159.073 21.804  1.00 28.18  ? 128 SER B O   1 
ATOM   5175 C CB  . SER B 1 131 ? 59.570 157.733 23.313  1.00 23.72  ? 128 SER B CB  1 
ATOM   5176 O OG  . SER B 1 131 ? 60.688 158.544 22.993  1.00 36.57  ? 128 SER B OG  1 
ATOM   5177 N N   . SER B 1 132 ? 58.759 158.666 20.067  1.00 27.22  ? 129 SER B N   1 
ATOM   5178 C CA  . SER B 1 132 ? 58.325 159.813 19.281  1.00 28.19  ? 129 SER B CA  1 
ATOM   5179 C C   . SER B 1 132 ? 57.145 159.509 18.368  1.00 30.34  ? 129 SER B C   1 
ATOM   5180 O O   . SER B 1 132 ? 56.688 160.409 17.657  1.00 30.62  ? 129 SER B O   1 
ATOM   5181 C CB  . SER B 1 132 ? 59.492 160.341 18.442  1.00 29.63  ? 129 SER B CB  1 
ATOM   5182 O OG  . SER B 1 132 ? 60.045 159.316 17.635  1.00 27.42  ? 129 SER B OG  1 
ATOM   5183 N N   . LEU B 1 133 ? 56.648 158.274 18.368  1.00 22.83  ? 130 LEU B N   1 
ATOM   5184 C CA  . LEU B 1 133 ? 55.561 157.909 17.469  1.00 27.96  ? 130 LEU B CA  1 
ATOM   5185 C C   . LEU B 1 133 ? 54.301 158.700 17.800  1.00 26.96  ? 130 LEU B C   1 
ATOM   5186 O O   . LEU B 1 133 ? 54.018 158.991 18.965  1.00 24.54  ? 130 LEU B O   1 
ATOM   5187 C CB  . LEU B 1 133 ? 55.285 156.407 17.556  1.00 27.80  ? 130 LEU B CB  1 
ATOM   5188 C CG  . LEU B 1 133 ? 56.448 155.490 17.171  1.00 30.39  ? 130 LEU B CG  1 
ATOM   5189 C CD1 . LEU B 1 133 ? 56.019 154.030 17.200  1.00 23.03  ? 130 LEU B CD1 1 
ATOM   5190 C CD2 . LEU B 1 133 ? 57.001 155.863 15.804  1.00 22.57  ? 130 LEU B CD2 1 
ATOM   5191 N N   . ASP B 1 134 ? 53.545 159.054 16.754  1.00 26.55  ? 131 ASP B N   1 
ATOM   5192 C CA  . ASP B 1 134 ? 52.339 159.856 16.939  1.00 28.18  ? 131 ASP B CA  1 
ATOM   5193 C C   . ASP B 1 134 ? 51.342 159.176 17.867  1.00 35.86  ? 131 ASP B C   1 
ATOM   5194 O O   . ASP B 1 134 ? 50.633 159.853 18.620  1.00 32.93  ? 131 ASP B O   1 
ATOM   5195 C CB  . ASP B 1 134 ? 51.679 160.141 15.588  1.00 20.42  ? 131 ASP B CB  1 
ATOM   5196 C CG  . ASP B 1 134 ? 52.549 160.984 14.677  1.00 27.23  ? 131 ASP B CG  1 
ATOM   5197 O OD1 . ASP B 1 134 ? 53.544 161.560 15.166  1.00 26.33  ? 131 ASP B OD1 1 
ATOM   5198 O OD2 . ASP B 1 134 ? 52.230 161.078 13.473  1.00 33.26  ? 131 ASP B OD2 1 
ATOM   5199 N N   . VAL B 1 135 ? 51.274 157.843 17.832  1.00 35.72  ? 132 VAL B N   1 
ATOM   5200 C CA  . VAL B 1 135 ? 50.307 157.113 18.642  1.00 32.60  ? 132 VAL B CA  1 
ATOM   5201 C C   . VAL B 1 135 ? 50.680 157.085 20.118  1.00 26.69  ? 132 VAL B C   1 
ATOM   5202 O O   . VAL B 1 135 ? 49.880 156.631 20.943  1.00 31.35  ? 132 VAL B O   1 
ATOM   5203 C CB  . VAL B 1 135 ? 50.147 155.687 18.070  1.00 29.16  ? 132 VAL B CB  1 
ATOM   5204 C CG1 . VAL B 1 135 ? 51.338 154.821 18.442  1.00 24.13  ? 132 VAL B CG1 1 
ATOM   5205 C CG2 . VAL B 1 135 ? 48.830 155.057 18.514  1.00 33.18  ? 132 VAL B CG2 1 
ATOM   5206 N N   . TYR B 1 136 ? 51.867 157.574 20.479  1.00 30.06  ? 133 TYR B N   1 
ATOM   5207 C CA  . TYR B 1 136 ? 52.293 157.660 21.870  1.00 28.41  ? 133 TYR B CA  1 
ATOM   5208 C C   . TYR B 1 136 ? 52.211 159.082 22.418  1.00 26.08  ? 133 TYR B C   1 
ATOM   5209 O O   . TYR B 1 136 ? 52.795 159.369 23.469  1.00 34.40  ? 133 TYR B O   1 
ATOM   5210 C CB  . TYR B 1 136 ? 53.719 157.124 22.027  1.00 20.96  ? 133 TYR B CB  1 
ATOM   5211 C CG  . TYR B 1 136 ? 53.907 155.685 21.595  1.00 35.59  ? 133 TYR B CG  1 
ATOM   5212 C CD1 . TYR B 1 136 ? 52.852 154.783 21.620  1.00 28.83  ? 133 TYR B CD1 1 
ATOM   5213 C CD2 . TYR B 1 136 ? 55.147 155.230 21.164  1.00 34.14  ? 133 TYR B CD2 1 
ATOM   5214 C CE1 . TYR B 1 136 ? 53.026 153.468 21.225  1.00 30.60  ? 133 TYR B CE1 1 
ATOM   5215 C CE2 . TYR B 1 136 ? 55.331 153.919 20.768  1.00 27.29  ? 133 TYR B CE2 1 
ATOM   5216 C CZ  . TYR B 1 136 ? 54.268 153.043 20.800  1.00 33.19  ? 133 TYR B CZ  1 
ATOM   5217 O OH  . TYR B 1 136 ? 54.448 151.736 20.406  1.00 23.64  ? 133 TYR B OH  1 
ATOM   5218 N N   . ASP B 1 137 ? 51.504 159.975 21.726  1.00 30.74  ? 134 ASP B N   1 
ATOM   5219 C CA  . ASP B 1 137 ? 51.406 161.367 22.151  1.00 31.69  ? 134 ASP B CA  1 
ATOM   5220 C C   . ASP B 1 137 ? 50.719 161.461 23.508  1.00 31.17  ? 134 ASP B C   1 
ATOM   5221 O O   . ASP B 1 137 ? 49.569 161.041 23.663  1.00 34.32  ? 134 ASP B O   1 
ATOM   5222 C CB  . ASP B 1 137 ? 50.638 162.177 21.106  1.00 32.41  ? 134 ASP B CB  1 
ATOM   5223 C CG  . ASP B 1 137 ? 50.756 163.676 21.320  1.00 43.27  ? 134 ASP B CG  1 
ATOM   5224 O OD1 . ASP B 1 137 ? 51.345 164.096 22.339  1.00 41.42  ? 134 ASP B OD1 1 
ATOM   5225 O OD2 . ASP B 1 137 ? 50.252 164.436 20.467  1.00 44.48  ? 134 ASP B OD2 1 
ATOM   5226 N N   . GLY B 1 138 ? 51.422 162.024 24.484  1.00 34.34  ? 135 GLY B N   1 
ATOM   5227 C CA  . GLY B 1 138 ? 50.928 162.109 25.840  1.00 41.20  ? 135 GLY B CA  1 
ATOM   5228 C C   . GLY B 1 138 ? 50.152 163.360 26.188  1.00 38.41  ? 135 GLY B C   1 
ATOM   5229 O O   . GLY B 1 138 ? 49.834 163.563 27.365  1.00 35.90  ? 135 GLY B O   1 
ATOM   5230 N N   . ARG B 1 139 ? 49.819 164.201 25.206  1.00 34.14  ? 136 ARG B N   1 
ATOM   5231 C CA  . ARG B 1 139 ? 49.163 165.466 25.522  1.00 45.86  ? 136 ARG B CA  1 
ATOM   5232 C C   . ARG B 1 139 ? 47.709 165.268 25.936  1.00 47.00  ? 136 ARG B C   1 
ATOM   5233 O O   . ARG B 1 139 ? 47.185 166.053 26.734  1.00 52.78  ? 136 ARG B O   1 
ATOM   5234 C CB  . ARG B 1 139 ? 49.253 166.422 24.330  1.00 28.84  ? 136 ARG B CB  1 
ATOM   5235 C CG  . ARG B 1 139 ? 48.328 166.088 23.172  1.00 39.37  ? 136 ARG B CG  1 
ATOM   5236 C CD  . ARG B 1 139 ? 48.504 167.075 22.033  1.00 38.46  ? 136 ARG B CD  1 
ATOM   5237 N NE  . ARG B 1 139 ? 49.829 166.967 21.430  1.00 42.81  ? 136 ARG B NE  1 
ATOM   5238 C CZ  . ARG B 1 139 ? 50.290 167.780 20.486  1.00 42.69  ? 136 ARG B CZ  1 
ATOM   5239 N NH1 . ARG B 1 139 ? 49.534 168.772 20.035  1.00 37.13  ? 136 ARG B NH1 1 
ATOM   5240 N NH2 . ARG B 1 139 ? 51.508 167.603 19.995  1.00 48.22  ? 136 ARG B NH2 1 
ATOM   5241 N N   . PHE B 1 140 ? 47.044 164.232 25.419  1.00 35.38  ? 137 PHE B N   1 
ATOM   5242 C CA  . PHE B 1 140 ? 45.637 164.025 25.745  1.00 32.91  ? 137 PHE B CA  1 
ATOM   5243 C C   . PHE B 1 140 ? 45.471 163.312 27.082  1.00 35.60  ? 137 PHE B C   1 
ATOM   5244 O O   . PHE B 1 140 ? 44.553 163.628 27.846  1.00 41.13  ? 137 PHE B O   1 
ATOM   5245 C CB  . PHE B 1 140 ? 44.948 163.239 24.630  1.00 28.01  ? 137 PHE B CB  1 
ATOM   5246 C CG  . PHE B 1 140 ? 45.097 163.862 23.272  1.00 35.76  ? 137 PHE B CG  1 
ATOM   5247 C CD1 . PHE B 1 140 ? 46.052 163.398 22.384  1.00 39.39  ? 137 PHE B CD1 1 
ATOM   5248 C CD2 . PHE B 1 140 ? 44.287 164.918 22.887  1.00 33.62  ? 137 PHE B CD2 1 
ATOM   5249 C CE1 . PHE B 1 140 ? 46.195 163.971 21.134  1.00 33.68  ? 137 PHE B CE1 1 
ATOM   5250 C CE2 . PHE B 1 140 ? 44.425 165.495 21.638  1.00 39.62  ? 137 PHE B CE2 1 
ATOM   5251 C CZ  . PHE B 1 140 ? 45.380 165.021 20.761  1.00 38.88  ? 137 PHE B CZ  1 
ATOM   5252 N N   . LEU B 1 141 ? 46.349 162.352 27.378  1.00 39.17  ? 138 LEU B N   1 
ATOM   5253 C CA  . LEU B 1 141 ? 46.275 161.647 28.654  1.00 41.57  ? 138 LEU B CA  1 
ATOM   5254 C C   . LEU B 1 141 ? 46.607 162.573 29.817  1.00 44.25  ? 138 LEU B C   1 
ATOM   5255 O O   . LEU B 1 141 ? 46.002 162.473 30.891  1.00 45.98  ? 138 LEU B O   1 
ATOM   5256 C CB  . LEU B 1 141 ? 47.218 160.443 28.637  1.00 33.78  ? 138 LEU B CB  1 
ATOM   5257 C CG  . LEU B 1 141 ? 47.312 159.609 29.914  1.00 36.58  ? 138 LEU B CG  1 
ATOM   5258 C CD1 . LEU B 1 141 ? 45.960 159.007 30.260  1.00 46.70  ? 138 LEU B CD1 1 
ATOM   5259 C CD2 . LEU B 1 141 ? 48.365 158.524 29.764  1.00 34.52  ? 138 LEU B CD2 1 
ATOM   5260 N N   . VAL B 1 142 ? 47.560 163.484 29.620  1.00 46.42  ? 139 VAL B N   1 
ATOM   5261 C CA  . VAL B 1 142 ? 47.964 164.390 30.690  1.00 39.13  ? 139 VAL B CA  1 
ATOM   5262 C C   . VAL B 1 142 ? 46.937 165.501 30.882  1.00 43.27  ? 139 VAL B C   1 
ATOM   5263 O O   . VAL B 1 142 ? 46.672 165.926 32.010  1.00 44.29  ? 139 VAL B O   1 
ATOM   5264 C CB  . VAL B 1 142 ? 49.371 164.944 30.399  1.00 42.42  ? 139 VAL B CB  1 
ATOM   5265 C CG1 . VAL B 1 142 ? 49.645 166.196 31.215  1.00 46.80  ? 139 VAL B CG1 1 
ATOM   5266 C CG2 . VAL B 1 142 ? 50.416 163.884 30.697  1.00 29.30  ? 139 VAL B CG2 1 
ATOM   5267 N N   . GLN B 1 143 ? 46.333 165.983 29.795  1.00 38.24  ? 140 GLN B N   1 
ATOM   5268 C CA  . GLN B 1 143 ? 45.336 167.041 29.926  1.00 42.80  ? 140 GLN B CA  1 
ATOM   5269 C C   . GLN B 1 143 ? 44.064 166.514 30.579  1.00 48.20  ? 140 GLN B C   1 
ATOM   5270 O O   . GLN B 1 143 ? 43.493 167.161 31.464  1.00 56.09  ? 140 GLN B O   1 
ATOM   5271 C CB  . GLN B 1 143 ? 45.032 167.650 28.555  1.00 41.82  ? 140 GLN B CB  1 
ATOM   5272 C CG  . GLN B 1 143 ? 44.259 168.968 28.594  1.00 45.14  ? 140 GLN B CG  1 
ATOM   5273 C CD  . GLN B 1 143 ? 42.780 168.782 28.874  1.00 51.33  ? 140 GLN B CD  1 
ATOM   5274 O OE1 . GLN B 1 143 ? 42.191 167.765 28.510  1.00 53.29  ? 140 GLN B OE1 1 
ATOM   5275 N NE2 . GLN B 1 143 ? 42.176 169.760 29.538  1.00 52.12  ? 140 GLN B NE2 1 
ATOM   5276 N N   . ALA B 1 144 ? 43.604 165.337 30.155  1.00 51.72  ? 141 ALA B N   1 
ATOM   5277 C CA  . ALA B 1 144 ? 42.309 164.848 30.612  1.00 53.16  ? 141 ALA B CA  1 
ATOM   5278 C C   . ALA B 1 144 ? 42.366 164.327 32.042  1.00 41.05  ? 141 ALA B C   1 
ATOM   5279 O O   . ALA B 1 144 ? 41.366 164.400 32.765  1.00 39.12  ? 141 ALA B O   1 
ATOM   5280 C CB  . ALA B 1 144 ? 41.794 163.761 29.669  1.00 42.49  ? 141 ALA B CB  1 
ATOM   5281 N N   . GLU B 1 145 ? 43.516 163.810 32.471  1.00 37.17  ? 142 GLU B N   1 
ATOM   5282 C CA  . GLU B 1 145 ? 43.632 163.177 33.776  1.00 34.75  ? 142 GLU B CA  1 
ATOM   5283 C C   . GLU B 1 145 ? 44.635 163.854 34.700  1.00 43.32  ? 142 GLU B C   1 
ATOM   5284 O O   . GLU B 1 145 ? 44.770 163.429 35.854  1.00 42.54  ? 142 GLU B O   1 
ATOM   5285 C CB  . GLU B 1 145 ? 43.996 161.696 33.605  1.00 37.81  ? 142 GLU B CB  1 
ATOM   5286 C CG  . GLU B 1 145 ? 42.909 160.888 32.909  1.00 37.44  ? 142 GLU B CG  1 
ATOM   5287 C CD  . GLU B 1 145 ? 41.618 160.842 33.708  1.00 42.31  ? 142 GLU B CD  1 
ATOM   5288 O OE1 . GLU B 1 145 ? 41.689 160.785 34.954  1.00 47.97  ? 142 GLU B OE1 1 
ATOM   5289 O OE2 . GLU B 1 145 ? 40.531 160.868 33.091  1.00 46.37  ? 142 GLU B OE2 1 
ATOM   5290 N N   . ARG B 1 146 ? 45.336 164.887 34.230  1.00 49.58  ? 143 ARG B N   1 
ATOM   5291 C CA  . ARG B 1 146 ? 46.218 165.706 35.066  1.00 47.38  ? 143 ARG B CA  1 
ATOM   5292 C C   . ARG B 1 146 ? 47.250 164.859 35.806  1.00 41.94  ? 143 ARG B C   1 
ATOM   5293 O O   . ARG B 1 146 ? 47.554 165.092 36.978  1.00 49.98  ? 143 ARG B O   1 
ATOM   5294 C CB  . ARG B 1 146 ? 45.409 166.562 36.041  1.00 43.84  ? 143 ARG B CB  1 
ATOM   5295 C CG  . ARG B 1 146 ? 44.476 167.542 35.349  1.00 52.69  ? 143 ARG B CG  1 
ATOM   5296 C CD  . ARG B 1 146 ? 44.137 168.722 36.241  1.00 58.55  ? 143 ARG B CD  1 
ATOM   5297 N NE  . ARG B 1 146 ? 45.314 169.529 36.548  1.00 53.80  ? 143 ARG B NE  1 
ATOM   5298 C CZ  . ARG B 1 146 ? 45.771 170.510 35.775  1.00 57.47  ? 143 ARG B CZ  1 
ATOM   5299 N NH1 . ARG B 1 146 ? 45.151 170.808 34.641  1.00 52.25  ? 143 ARG B NH1 1 
ATOM   5300 N NH2 . ARG B 1 146 ? 46.849 171.193 36.135  1.00 54.46  ? 143 ARG B NH2 1 
ATOM   5301 N N   . THR B 1 147 ? 47.793 163.864 35.113  1.00 38.70  ? 144 THR B N   1 
ATOM   5302 C CA  . THR B 1 147 ? 48.916 163.092 35.613  1.00 41.93  ? 144 THR B CA  1 
ATOM   5303 C C   . THR B 1 147 ? 50.191 163.547 34.908  1.00 40.48  ? 144 THR B C   1 
ATOM   5304 O O   . THR B 1 147 ? 50.170 164.397 34.014  1.00 45.26  ? 144 THR B O   1 
ATOM   5305 C CB  . THR B 1 147 ? 48.682 161.591 35.415  1.00 46.39  ? 144 THR B CB  1 
ATOM   5306 O OG1 . THR B 1 147 ? 48.793 161.267 34.024  1.00 41.46  ? 144 THR B OG1 1 
ATOM   5307 C CG2 . THR B 1 147 ? 47.298 161.195 35.912  1.00 37.24  ? 144 THR B CG2 1 
ATOM   5308 N N   . VAL B 1 148 ? 51.319 162.978 35.319  1.00 37.69  ? 145 VAL B N   1 
ATOM   5309 C CA  . VAL B 1 148 ? 52.610 163.240 34.694  1.00 38.42  ? 145 VAL B CA  1 
ATOM   5310 C C   . VAL B 1 148 ? 53.004 161.998 33.909  1.00 42.12  ? 145 VAL B C   1 
ATOM   5311 O O   . VAL B 1 148 ? 53.098 160.902 34.474  1.00 40.83  ? 145 VAL B O   1 
ATOM   5312 C CB  . VAL B 1 148 ? 53.683 163.607 35.730  1.00 37.76  ? 145 VAL B CB  1 
ATOM   5313 C CG1 . VAL B 1 148 ? 55.048 163.699 35.066  1.00 36.37  ? 145 VAL B CG1 1 
ATOM   5314 C CG2 . VAL B 1 148 ? 53.332 164.920 36.413  1.00 41.54  ? 145 VAL B CG2 1 
ATOM   5315 N N   . LEU B 1 149 ? 53.225 162.164 32.608  1.00 39.98  ? 146 LEU B N   1 
ATOM   5316 C CA  . LEU B 1 149 ? 53.578 161.061 31.725  1.00 32.53  ? 146 LEU B CA  1 
ATOM   5317 C C   . LEU B 1 149 ? 55.035 161.190 31.305  1.00 32.88  ? 146 LEU B C   1 
ATOM   5318 O O   . LEU B 1 149 ? 55.466 162.256 30.854  1.00 40.41  ? 146 LEU B O   1 
ATOM   5319 C CB  . LEU B 1 149 ? 52.666 161.027 30.497  1.00 33.12  ? 146 LEU B CB  1 
ATOM   5320 C CG  . LEU B 1 149 ? 52.916 159.914 29.474  1.00 38.77  ? 146 LEU B CG  1 
ATOM   5321 C CD1 . LEU B 1 149 ? 53.047 158.564 30.155  1.00 32.58  ? 146 LEU B CD1 1 
ATOM   5322 C CD2 . LEU B 1 149 ? 51.794 159.877 28.455  1.00 36.64  ? 146 LEU B CD2 1 
ATOM   5323 N N   . VAL B 1 150 ? 55.787 160.104 31.462  1.00 32.14  ? 147 VAL B N   1 
ATOM   5324 C CA  . VAL B 1 150 ? 57.192 160.039 31.087  1.00 32.59  ? 147 VAL B CA  1 
ATOM   5325 C C   . VAL B 1 150 ? 57.375 158.872 30.127  1.00 38.63  ? 147 VAL B C   1 
ATOM   5326 O O   . VAL B 1 150 ? 56.744 157.822 30.286  1.00 37.23  ? 147 VAL B O   1 
ATOM   5327 C CB  . VAL B 1 150 ? 58.105 159.881 32.322  1.00 28.07  ? 147 VAL B CB  1 
ATOM   5328 C CG1 . VAL B 1 150 ? 59.573 159.924 31.920  1.00 26.19  ? 147 VAL B CG1 1 
ATOM   5329 C CG2 . VAL B 1 150 ? 57.800 160.955 33.355  1.00 30.69  ? 147 VAL B CG2 1 
ATOM   5330 N N   . SER B 1 151 ? 58.224 159.062 29.121  1.00 34.23  ? 148 SER B N   1 
ATOM   5331 C CA  . SER B 1 151 ? 58.563 157.988 28.200  1.00 32.98  ? 148 SER B CA  1 
ATOM   5332 C C   . SER B 1 151 ? 60.000 158.177 27.744  1.00 33.62  ? 148 SER B C   1 
ATOM   5333 O O   . SER B 1 151 ? 60.474 159.306 27.594  1.00 34.03  ? 148 SER B O   1 
ATOM   5334 C CB  . SER B 1 151 ? 57.621 157.949 26.992  1.00 30.23  ? 148 SER B CB  1 
ATOM   5335 O OG  . SER B 1 151 ? 57.760 159.113 26.196  1.00 25.47  ? 148 SER B OG  1 
ATOM   5336 N N   . MET B 1 152 ? 60.689 157.061 27.528  1.00 27.71  ? 149 MET B N   1 
ATOM   5337 C CA  . MET B 1 152 ? 62.098 157.082 27.175  1.00 30.41  ? 149 MET B CA  1 
ATOM   5338 C C   . MET B 1 152 ? 62.346 156.217 25.949  1.00 32.86  ? 149 MET B C   1 
ATOM   5339 O O   . MET B 1 152 ? 61.576 155.306 25.631  1.00 29.36  ? 149 MET B O   1 
ATOM   5340 C CB  . MET B 1 152 ? 62.978 156.594 28.337  1.00 28.26  ? 149 MET B CB  1 
ATOM   5341 C CG  . MET B 1 152 ? 63.157 155.079 28.401  1.00 30.03  ? 149 MET B CG  1 
ATOM   5342 S SD  . MET B 1 152 ? 61.637 154.175 28.753  1.00 32.13  ? 149 MET B SD  1 
ATOM   5343 C CE  . MET B 1 152 ? 61.331 154.675 30.444  1.00 26.41  ? 149 MET B CE  1 
ATOM   5344 N N   . ASN B 1 153 ? 63.435 156.530 25.254  1.00 28.71  ? 150 ASN B N   1 
ATOM   5345 C CA  . ASN B 1 153 ? 63.987 155.654 24.234  1.00 25.39  ? 150 ASN B CA  1 
ATOM   5346 C C   . ASN B 1 153 ? 64.984 154.704 24.880  1.00 30.51  ? 150 ASN B C   1 
ATOM   5347 O O   . ASN B 1 153 ? 65.734 155.091 25.781  1.00 35.68  ? 150 ASN B O   1 
ATOM   5348 C CB  . ASN B 1 153 ? 64.677 156.459 23.131  1.00 20.17  ? 150 ASN B CB  1 
ATOM   5349 C CG  . ASN B 1 153 ? 63.705 157.008 22.108  1.00 27.91  ? 150 ASN B CG  1 
ATOM   5350 O OD1 . ASN B 1 153 ? 62.490 156.893 22.262  1.00 34.60  ? 150 ASN B OD1 1 
ATOM   5351 N ND2 . ASN B 1 153 ? 64.239 157.615 21.053  1.00 28.64  ? 150 ASN B ND2 1 
ATOM   5352 N N   . TYR B 1 154 ? 64.982 153.456 24.425  1.00 24.98  ? 151 TYR B N   1 
ATOM   5353 C CA  . TYR B 1 154 ? 65.964 152.479 24.861  1.00 23.36  ? 151 TYR B CA  1 
ATOM   5354 C C   . TYR B 1 154 ? 66.503 151.741 23.645  1.00 26.63  ? 151 TYR B C   1 
ATOM   5355 O O   . TYR B 1 154 ? 65.805 151.573 22.641  1.00 27.58  ? 151 TYR B O   1 
ATOM   5356 C CB  . TYR B 1 154 ? 65.377 151.487 25.881  1.00 27.94  ? 151 TYR B CB  1 
ATOM   5357 C CG  . TYR B 1 154 ? 64.220 150.657 25.372  1.00 27.22  ? 151 TYR B CG  1 
ATOM   5358 C CD1 . TYR B 1 154 ? 62.911 151.105 25.498  1.00 24.70  ? 151 TYR B CD1 1 
ATOM   5359 C CD2 . TYR B 1 154 ? 64.435 149.419 24.781  1.00 21.75  ? 151 TYR B CD2 1 
ATOM   5360 C CE1 . TYR B 1 154 ? 61.851 150.347 25.041  1.00 25.21  ? 151 TYR B CE1 1 
ATOM   5361 C CE2 . TYR B 1 154 ? 63.382 148.655 24.319  1.00 31.48  ? 151 TYR B CE2 1 
ATOM   5362 C CZ  . TYR B 1 154 ? 62.093 149.123 24.451  1.00 28.81  ? 151 TYR B CZ  1 
ATOM   5363 O OH  . TYR B 1 154 ? 61.041 148.364 23.994  1.00 20.66  ? 151 TYR B OH  1 
ATOM   5364 N N   . ARG B 1 155 ? 67.760 151.315 23.744  1.00 25.55  ? 152 ARG B N   1 
ATOM   5365 C CA  . ARG B 1 155 ? 68.414 150.650 22.625  1.00 28.25  ? 152 ARG B CA  1 
ATOM   5366 C C   . ARG B 1 155 ? 67.723 149.332 22.305  1.00 35.00  ? 152 ARG B C   1 
ATOM   5367 O O   . ARG B 1 155 ? 67.443 148.527 23.198  1.00 29.90  ? 152 ARG B O   1 
ATOM   5368 C CB  . ARG B 1 155 ? 69.889 150.414 22.944  1.00 31.13  ? 152 ARG B CB  1 
ATOM   5369 C CG  . ARG B 1 155 ? 70.765 151.642 22.775  1.00 31.21  ? 152 ARG B CG  1 
ATOM   5370 C CD  . ARG B 1 155 ? 72.163 151.394 23.314  1.00 28.71  ? 152 ARG B CD  1 
ATOM   5371 N NE  . ARG B 1 155 ? 72.182 151.359 24.773  1.00 27.50  ? 152 ARG B NE  1 
ATOM   5372 C CZ  . ARG B 1 155 ? 73.252 151.055 25.500  1.00 32.21  ? 152 ARG B CZ  1 
ATOM   5373 N NH1 . ARG B 1 155 ? 74.397 150.750 24.904  1.00 27.05  ? 152 ARG B NH1 1 
ATOM   5374 N NH2 . ARG B 1 155 ? 73.176 151.051 26.824  1.00 30.06  ? 152 ARG B NH2 1 
ATOM   5375 N N   . VAL B 1 156 ? 67.445 149.118 21.021  1.00 30.03  ? 153 VAL B N   1 
ATOM   5376 C CA  . VAL B 1 156 ? 66.804 147.904 20.543  1.00 22.12  ? 153 VAL B CA  1 
ATOM   5377 C C   . VAL B 1 156 ? 67.770 147.181 19.611  1.00 28.73  ? 153 VAL B C   1 
ATOM   5378 O O   . VAL B 1 156 ? 68.826 147.701 19.245  1.00 26.54  ? 153 VAL B O   1 
ATOM   5379 C CB  . VAL B 1 156 ? 65.467 148.188 19.832  1.00 25.20  ? 153 VAL B CB  1 
ATOM   5380 C CG1 . VAL B 1 156 ? 64.443 148.721 20.821  1.00 18.24  ? 153 VAL B CG1 1 
ATOM   5381 C CG2 . VAL B 1 156 ? 65.675 149.172 18.691  1.00 18.99  ? 153 VAL B CG2 1 
ATOM   5382 N N   . GLY B 1 157 ? 67.390 145.964 19.230  1.00 29.28  ? 154 GLY B N   1 
ATOM   5383 C CA  . GLY B 1 157 ? 68.215 145.177 18.339  1.00 21.60  ? 154 GLY B CA  1 
ATOM   5384 C C   . GLY B 1 157 ? 69.544 144.812 18.972  1.00 19.88  ? 154 GLY B C   1 
ATOM   5385 O O   . GLY B 1 157 ? 69.678 144.694 20.195  1.00 26.34  ? 154 GLY B O   1 
ATOM   5386 N N   . ALA B 1 158 ? 70.554 144.637 18.115  1.00 22.97  ? 155 ALA B N   1 
ATOM   5387 C CA  . ALA B 1 158 ? 71.878 144.250 18.592  1.00 24.78  ? 155 ALA B CA  1 
ATOM   5388 C C   . ALA B 1 158 ? 72.457 145.295 19.537  1.00 32.47  ? 155 ALA B C   1 
ATOM   5389 O O   . ALA B 1 158 ? 73.118 144.953 20.524  1.00 25.65  ? 155 ALA B O   1 
ATOM   5390 C CB  . ALA B 1 158 ? 72.815 144.022 17.407  1.00 21.51  ? 155 ALA B CB  1 
ATOM   5391 N N   . PHE B 1 159 ? 72.211 146.576 19.257  1.00 32.35  ? 156 PHE B N   1 
ATOM   5392 C CA  . PHE B 1 159 ? 72.762 147.637 20.091  1.00 29.83  ? 156 PHE B CA  1 
ATOM   5393 C C   . PHE B 1 159 ? 72.218 147.597 21.511  1.00 28.22  ? 156 PHE B C   1 
ATOM   5394 O O   . PHE B 1 159 ? 72.836 148.168 22.416  1.00 35.95  ? 156 PHE B O   1 
ATOM   5395 C CB  . PHE B 1 159 ? 72.474 148.999 19.458  1.00 26.47  ? 156 PHE B CB  1 
ATOM   5396 C CG  . PHE B 1 159 ? 72.774 149.056 17.990  1.00 31.00  ? 156 PHE B CG  1 
ATOM   5397 C CD1 . PHE B 1 159 ? 71.775 148.837 17.056  1.00 27.12  ? 156 PHE B CD1 1 
ATOM   5398 C CD2 . PHE B 1 159 ? 74.057 149.319 17.542  1.00 27.88  ? 156 PHE B CD2 1 
ATOM   5399 C CE1 . PHE B 1 159 ? 72.049 148.884 15.704  1.00 24.47  ? 156 PHE B CE1 1 
ATOM   5400 C CE2 . PHE B 1 159 ? 74.336 149.368 16.191  1.00 24.39  ? 156 PHE B CE2 1 
ATOM   5401 C CZ  . PHE B 1 159 ? 73.331 149.149 15.272  1.00 25.98  ? 156 PHE B CZ  1 
ATOM   5402 N N   . GLY B 1 160 ? 71.088 146.933 21.730  1.00 35.42  ? 157 GLY B N   1 
ATOM   5403 C CA  . GLY B 1 160 ? 70.506 146.874 23.054  1.00 33.05  ? 157 GLY B CA  1 
ATOM   5404 C C   . GLY B 1 160 ? 70.534 145.501 23.692  1.00 36.61  ? 157 GLY B C   1 
ATOM   5405 O O   . GLY B 1 160 ? 70.489 145.390 24.921  1.00 33.20  ? 157 GLY B O   1 
ATOM   5406 N N   . PHE B 1 161 ? 70.607 144.441 22.882  1.00 29.30  ? 158 PHE B N   1 
ATOM   5407 C CA  . PHE B 1 161 ? 70.453 143.101 23.435  1.00 27.63  ? 158 PHE B CA  1 
ATOM   5408 C C   . PHE B 1 161 ? 71.371 142.054 22.811  1.00 31.04  ? 158 PHE B C   1 
ATOM   5409 O O   . PHE B 1 161 ? 71.179 140.860 23.074  1.00 31.79  ? 158 PHE B O   1 
ATOM   5410 C CB  . PHE B 1 161 ? 68.993 142.652 23.314  1.00 19.88  ? 158 PHE B CB  1 
ATOM   5411 C CG  . PHE B 1 161 ? 68.032 143.559 24.023  1.00 25.42  ? 158 PHE B CG  1 
ATOM   5412 C CD1 . PHE B 1 161 ? 67.343 144.539 23.329  1.00 21.98  ? 158 PHE B CD1 1 
ATOM   5413 C CD2 . PHE B 1 161 ? 67.840 143.451 25.390  1.00 24.67  ? 158 PHE B CD2 1 
ATOM   5414 C CE1 . PHE B 1 161 ? 66.466 145.383 23.982  1.00 21.91  ? 158 PHE B CE1 1 
ATOM   5415 C CE2 . PHE B 1 161 ? 66.965 144.292 26.050  1.00 31.45  ? 158 PHE B CE2 1 
ATOM   5416 C CZ  . PHE B 1 161 ? 66.278 145.260 25.345  1.00 30.24  ? 158 PHE B CZ  1 
ATOM   5417 N N   . LEU B 1 162 ? 72.354 142.445 22.004  1.00 33.41  ? 159 LEU B N   1 
ATOM   5418 C CA  . LEU B 1 162 ? 73.396 141.501 21.623  1.00 25.88  ? 159 LEU B CA  1 
ATOM   5419 C C   . LEU B 1 162 ? 74.187 141.119 22.866  1.00 33.06  ? 159 LEU B C   1 
ATOM   5420 O O   . LEU B 1 162 ? 74.609 141.989 23.635  1.00 38.32  ? 159 LEU B O   1 
ATOM   5421 C CB  . LEU B 1 162 ? 74.320 142.102 20.563  1.00 27.63  ? 159 LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 162 ? 75.459 141.206 20.063  1.00 25.72  ? 159 LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 162 ? 75.606 141.322 18.555  1.00 30.10  ? 159 LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 162 ? 76.775 141.544 20.750  1.00 31.78  ? 159 LEU B CD2 1 
ATOM   5425 N N   . ALA B 1 163 ? 74.380 139.820 23.070  1.00 34.36  ? 160 ALA B N   1 
ATOM   5426 C CA  . ALA B 1 163 ? 74.965 139.335 24.311  1.00 36.29  ? 160 ALA B CA  1 
ATOM   5427 C C   . ALA B 1 163 ? 75.953 138.215 24.036  1.00 40.75  ? 160 ALA B C   1 
ATOM   5428 O O   . ALA B 1 163 ? 75.609 137.218 23.394  1.00 46.22  ? 160 ALA B O   1 
ATOM   5429 C CB  . ALA B 1 163 ? 73.879 138.844 25.276  1.00 36.87  ? 160 ALA B CB  1 
ATOM   5430 N N   . LEU B 1 164 ? 77.182 138.395 24.517  1.00 41.75  ? 161 LEU B N   1 
ATOM   5431 C CA  . LEU B 1 164 ? 78.153 137.318 24.679  1.00 46.97  ? 161 LEU B CA  1 
ATOM   5432 C C   . LEU B 1 164 ? 78.265 137.074 26.177  1.00 50.32  ? 161 LEU B C   1 
ATOM   5433 O O   . LEU B 1 164 ? 79.091 137.705 26.853  1.00 51.08  ? 161 LEU B O   1 
ATOM   5434 C CB  . LEU B 1 164 ? 79.510 137.686 24.075  1.00 43.97  ? 161 LEU B CB  1 
ATOM   5435 C CG  . LEU B 1 164 ? 79.560 137.867 22.556  1.00 40.28  ? 161 LEU B CG  1 
ATOM   5436 C CD1 . LEU B 1 164 ? 80.911 138.413 22.128  1.00 46.79  ? 161 LEU B CD1 1 
ATOM   5437 C CD2 . LEU B 1 164 ? 79.265 136.556 21.843  1.00 35.35  ? 161 LEU B CD2 1 
ATOM   5438 N N   . PRO B 1 165 ? 77.444 136.188 26.746  1.00 46.94  ? 162 PRO B N   1 
ATOM   5439 C CA  . PRO B 1 165 ? 77.338 136.102 28.209  1.00 50.68  ? 162 PRO B CA  1 
ATOM   5440 C C   . PRO B 1 165 ? 78.674 135.799 28.871  1.00 48.96  ? 162 PRO B C   1 
ATOM   5441 O O   . PRO B 1 165 ? 79.458 134.976 28.393  1.00 50.05  ? 162 PRO B O   1 
ATOM   5442 C CB  . PRO B 1 165 ? 76.334 134.963 28.421  1.00 43.76  ? 162 PRO B CB  1 
ATOM   5443 C CG  . PRO B 1 165 ? 75.534 134.930 27.160  1.00 47.55  ? 162 PRO B CG  1 
ATOM   5444 C CD  . PRO B 1 165 ? 76.497 135.288 26.067  1.00 42.03  ? 162 PRO B CD  1 
ATOM   5445 N N   . GLY B 1 166 ? 78.925 136.483 29.985  1.00 56.06  ? 163 GLY B N   1 
ATOM   5446 C CA  . GLY B 1 166 ? 80.169 136.332 30.711  1.00 55.79  ? 163 GLY B CA  1 
ATOM   5447 C C   . GLY B 1 166 ? 81.123 137.487 30.491  1.00 56.93  ? 163 GLY B C   1 
ATOM   5448 O O   . GLY B 1 166 ? 81.703 138.014 31.445  1.00 64.72  ? 163 GLY B O   1 
ATOM   5449 N N   . SER B 1 167 ? 81.290 137.892 29.235  1.00 54.34  ? 164 SER B N   1 
ATOM   5450 C CA  . SER B 1 167 ? 82.216 138.964 28.907  1.00 59.83  ? 164 SER B CA  1 
ATOM   5451 C C   . SER B 1 167 ? 81.681 140.309 29.391  1.00 51.05  ? 164 SER B C   1 
ATOM   5452 O O   . SER B 1 167 ? 80.496 140.471 29.694  1.00 50.67  ? 164 SER B O   1 
ATOM   5453 C CB  . SER B 1 167 ? 82.468 139.014 27.399  1.00 49.18  ? 164 SER B CB  1 
ATOM   5454 O OG  . SER B 1 167 ? 81.275 139.306 26.690  1.00 55.49  ? 164 SER B OG  1 
ATOM   5455 N N   . ARG B 1 168 ? 82.585 141.286 29.463  1.00 49.53  ? 165 ARG B N   1 
ATOM   5456 C CA  . ARG B 1 168 ? 82.239 142.640 29.873  1.00 55.75  ? 165 ARG B CA  1 
ATOM   5457 C C   . ARG B 1 168 ? 82.031 143.588 28.700  1.00 45.37  ? 165 ARG B C   1 
ATOM   5458 O O   . ARG B 1 168 ? 81.522 144.695 28.904  1.00 39.84  ? 165 ARG B O   1 
ATOM   5459 C CB  . ARG B 1 168 ? 83.323 143.206 30.801  1.00 64.33  ? 165 ARG B CB  1 
ATOM   5460 C CG  . ARG B 1 168 ? 83.197 142.738 32.241  1.00 67.75  ? 165 ARG B CG  1 
ATOM   5461 C CD  . ARG B 1 168 ? 84.477 142.094 32.746  1.00 81.64  ? 165 ARG B CD  1 
ATOM   5462 N NE  . ARG B 1 168 ? 84.321 141.594 34.109  1.00 94.28  ? 165 ARG B NE  1 
ATOM   5463 C CZ  . ARG B 1 168 ? 85.297 141.041 34.821  1.00 98.56  ? 165 ARG B CZ  1 
ATOM   5464 N NH1 . ARG B 1 168 ? 86.510 140.914 34.301  1.00 99.79  ? 165 ARG B NH1 1 
ATOM   5465 N NH2 . ARG B 1 168 ? 85.061 140.615 36.054  1.00 87.23  ? 165 ARG B NH2 1 
ATOM   5466 N N   . GLU B 1 169 ? 82.401 143.183 27.484  1.00 51.83  ? 166 GLU B N   1 
ATOM   5467 C CA  . GLU B 1 169 ? 82.244 144.055 26.326  1.00 44.60  ? 166 GLU B CA  1 
ATOM   5468 C C   . GLU B 1 169 ? 80.826 144.019 25.770  1.00 51.51  ? 166 GLU B C   1 
ATOM   5469 O O   . GLU B 1 169 ? 80.338 145.036 25.264  1.00 49.44  ? 166 GLU B O   1 
ATOM   5470 C CB  . GLU B 1 169 ? 83.244 143.672 25.233  1.00 41.92  ? 166 GLU B CB  1 
ATOM   5471 C CG  . GLU B 1 169 ? 84.701 143.932 25.590  1.00 63.67  ? 166 GLU B CG  1 
ATOM   5472 C CD  . GLU B 1 169 ? 85.259 142.918 26.570  1.00 77.24  ? 166 GLU B CD  1 
ATOM   5473 O OE1 . GLU B 1 169 ? 84.703 141.802 26.653  1.00 70.90  ? 166 GLU B OE1 1 
ATOM   5474 O OE2 . GLU B 1 169 ? 86.251 143.238 27.258  1.00 83.79  ? 166 GLU B OE2 1 
ATOM   5475 N N   . ALA B 1 170 ? 80.159 142.870 25.847  1.00 42.23  ? 167 ALA B N   1 
ATOM   5476 C CA  . ALA B 1 170 ? 78.773 142.724 25.399  1.00 47.26  ? 167 ALA B CA  1 
ATOM   5477 C C   . ALA B 1 170 ? 78.023 141.865 26.407  1.00 49.10  ? 167 ALA B C   1 
ATOM   5478 O O   . ALA B 1 170 ? 77.717 140.695 26.151  1.00 47.39  ? 167 ALA B O   1 
ATOM   5479 C CB  . ALA B 1 170 ? 78.714 142.117 23.995  1.00 38.43  ? 167 ALA B CB  1 
ATOM   5480 N N   . PRO B 1 171 ? 77.708 142.424 27.579  1.00 44.17  ? 168 PRO B N   1 
ATOM   5481 C CA  . PRO B 1 171 ? 77.044 141.620 28.616  1.00 39.17  ? 168 PRO B CA  1 
ATOM   5482 C C   . PRO B 1 171 ? 75.583 141.336 28.325  1.00 37.18  ? 168 PRO B C   1 
ATOM   5483 O O   . PRO B 1 171 ? 75.025 140.398 28.909  1.00 51.83  ? 168 PRO B O   1 
ATOM   5484 C CB  . PRO B 1 171 ? 77.201 142.480 29.875  1.00 36.63  ? 168 PRO B CB  1 
ATOM   5485 C CG  . PRO B 1 171 ? 77.230 143.878 29.349  1.00 41.17  ? 168 PRO B CG  1 
ATOM   5486 C CD  . PRO B 1 171 ? 77.944 143.810 28.020  1.00 38.67  ? 168 PRO B CD  1 
ATOM   5487 N N   . GLY B 1 172 ? 74.946 142.109 27.451  1.00 46.39  ? 169 GLY B N   1 
ATOM   5488 C CA  . GLY B 1 172 ? 73.538 141.949 27.167  1.00 28.73  ? 169 GLY B CA  1 
ATOM   5489 C C   . GLY B 1 172 ? 72.659 142.736 28.123  1.00 35.55  ? 169 GLY B C   1 
ATOM   5490 O O   . GLY B 1 172 ? 73.098 143.256 29.152  1.00 40.15  ? 169 GLY B O   1 
ATOM   5491 N N   . ASN B 1 173 ? 71.383 142.829 27.754  1.00 33.26  ? 170 ASN B N   1 
ATOM   5492 C CA  . ASN B 1 173 ? 70.340 143.491 28.534  1.00 34.09  ? 170 ASN B CA  1 
ATOM   5493 C C   . ASN B 1 173 ? 70.600 144.979 28.744  1.00 40.03  ? 170 ASN B C   1 
ATOM   5494 O O   . ASN B 1 173 ? 69.955 145.597 29.600  1.00 37.41  ? 170 ASN B O   1 
ATOM   5495 C CB  . ASN B 1 173 ? 70.139 142.812 29.896  1.00 33.41  ? 170 ASN B CB  1 
ATOM   5496 C CG  . ASN B 1 173 ? 69.759 141.351 29.769  1.00 42.20  ? 170 ASN B CG  1 
ATOM   5497 O OD1 . ASN B 1 173 ? 68.968 140.977 28.907  1.00 32.07  ? 170 ASN B OD1 1 
ATOM   5498 N ND2 . ASN B 1 173 ? 70.326 140.515 30.631  1.00 38.60  ? 170 ASN B ND2 1 
ATOM   5499 N N   . VAL B 1 174 ? 71.526 145.578 27.989  1.00 33.76  ? 171 VAL B N   1 
ATOM   5500 C CA  . VAL B 1 174 ? 71.801 146.999 28.168  1.00 33.47  ? 171 VAL B CA  1 
ATOM   5501 C C   . VAL B 1 174 ? 70.602 147.851 27.777  1.00 32.20  ? 171 VAL B C   1 
ATOM   5502 O O   . VAL B 1 174 ? 70.464 148.978 28.266  1.00 30.47  ? 171 VAL B O   1 
ATOM   5503 C CB  . VAL B 1 174 ? 73.056 147.423 27.379  1.00 34.51  ? 171 VAL B CB  1 
ATOM   5504 C CG1 . VAL B 1 174 ? 74.245 146.555 27.764  1.00 32.72  ? 171 VAL B CG1 1 
ATOM   5505 C CG2 . VAL B 1 174 ? 72.804 147.363 25.882  1.00 35.34  ? 171 VAL B CG2 1 
ATOM   5506 N N   . GLY B 1 175 ? 69.722 147.339 26.914  1.00 28.25  ? 172 GLY B N   1 
ATOM   5507 C CA  . GLY B 1 175 ? 68.495 148.058 26.614  1.00 25.14  ? 172 GLY B CA  1 
ATOM   5508 C C   . GLY B 1 175 ? 67.554 148.108 27.802  1.00 34.77  ? 172 GLY B C   1 
ATOM   5509 O O   . GLY B 1 175 ? 66.855 149.103 28.011  1.00 37.50  ? 172 GLY B O   1 
ATOM   5510 N N   . LEU B 1 176 ? 67.517 147.032 28.593  1.00 30.71  ? 173 LEU B N   1 
ATOM   5511 C CA  . LEU B 1 176 ? 66.759 147.062 29.839  1.00 31.49  ? 173 LEU B CA  1 
ATOM   5512 C C   . LEU B 1 176 ? 67.397 148.014 30.840  1.00 34.86  ? 173 LEU B C   1 
ATOM   5513 O O   . LEU B 1 176 ? 66.694 148.674 31.615  1.00 28.24  ? 173 LEU B O   1 
ATOM   5514 C CB  . LEU B 1 176 ? 66.652 145.655 30.426  1.00 36.50  ? 173 LEU B CB  1 
ATOM   5515 C CG  . LEU B 1 176 ? 65.728 144.672 29.703  1.00 34.33  ? 173 LEU B CG  1 
ATOM   5516 C CD1 . LEU B 1 176 ? 65.875 143.275 30.285  1.00 26.19  ? 173 LEU B CD1 1 
ATOM   5517 C CD2 . LEU B 1 176 ? 64.284 145.140 29.788  1.00 26.27  ? 173 LEU B CD2 1 
ATOM   5518 N N   . LEU B 1 177 ? 68.730 148.102 30.834  1.00 29.76  ? 174 LEU B N   1 
ATOM   5519 C CA  . LEU B 1 177 ? 69.412 149.042 31.716  1.00 31.50  ? 174 LEU B CA  1 
ATOM   5520 C C   . LEU B 1 177 ? 69.157 150.486 31.298  1.00 38.59  ? 174 LEU B C   1 
ATOM   5521 O O   . LEU B 1 177 ? 69.128 151.379 32.153  1.00 36.80  ? 174 LEU B O   1 
ATOM   5522 C CB  . LEU B 1 177 ? 70.910 148.745 31.741  1.00 29.44  ? 174 LEU B CB  1 
ATOM   5523 C CG  . LEU B 1 177 ? 71.304 147.363 32.266  1.00 31.72  ? 174 LEU B CG  1 
ATOM   5524 C CD1 . LEU B 1 177 ? 72.814 147.181 32.233  1.00 22.31  ? 174 LEU B CD1 1 
ATOM   5525 C CD2 . LEU B 1 177 ? 70.767 147.152 33.674  1.00 25.38  ? 174 LEU B CD2 1 
ATOM   5526 N N   . ASP B 1 178 ? 68.976 150.734 29.997  1.00 28.63  ? 175 ASP B N   1 
ATOM   5527 C CA  . ASP B 1 178 ? 68.565 152.062 29.551  1.00 25.17  ? 175 ASP B CA  1 
ATOM   5528 C C   . ASP B 1 178 ? 67.241 152.461 30.187  1.00 25.72  ? 175 ASP B C   1 
ATOM   5529 O O   . ASP B 1 178 ? 67.077 153.601 30.639  1.00 36.44  ? 175 ASP B O   1 
ATOM   5530 C CB  . ASP B 1 178 ? 68.449 152.102 28.025  1.00 27.71  ? 175 ASP B CB  1 
ATOM   5531 C CG  . ASP B 1 178 ? 69.775 151.875 27.327  1.00 32.71  ? 175 ASP B CG  1 
ATOM   5532 O OD1 . ASP B 1 178 ? 70.827 151.950 27.993  1.00 27.28  ? 175 ASP B OD1 1 
ATOM   5533 O OD2 . ASP B 1 178 ? 69.765 151.630 26.101  1.00 29.35  ? 175 ASP B OD2 1 
ATOM   5534 N N   . GLN B 1 179 ? 66.283 151.531 30.229  1.00 32.67  ? 176 GLN B N   1 
ATOM   5535 C CA  . GLN B 1 179 ? 64.995 151.813 30.855  1.00 34.09  ? 176 GLN B CA  1 
ATOM   5536 C C   . GLN B 1 179 ? 65.151 152.055 32.350  1.00 31.07  ? 176 GLN B C   1 
ATOM   5537 O O   . GLN B 1 179 ? 64.503 152.945 32.914  1.00 33.39  ? 176 GLN B O   1 
ATOM   5538 C CB  . GLN B 1 179 ? 64.028 150.658 30.602  1.00 30.13  ? 176 GLN B CB  1 
ATOM   5539 C CG  . GLN B 1 179 ? 63.811 150.327 29.137  1.00 30.41  ? 176 GLN B CG  1 
ATOM   5540 C CD  . GLN B 1 179 ? 63.019 149.050 28.948  1.00 37.59  ? 176 GLN B CD  1 
ATOM   5541 O OE1 . GLN B 1 179 ? 62.579 148.432 29.918  1.00 31.09  ? 176 GLN B OE1 1 
ATOM   5542 N NE2 . GLN B 1 179 ? 62.837 148.643 27.697  1.00 25.39  ? 176 GLN B NE2 1 
ATOM   5543 N N   . ARG B 1 180 ? 66.002 151.265 33.010  1.00 34.22  ? 177 ARG B N   1 
ATOM   5544 C CA  . ARG B 1 180 ? 66.228 151.443 34.441  1.00 36.46  ? 177 ARG B CA  1 
ATOM   5545 C C   . ARG B 1 180 ? 66.825 152.813 34.736  1.00 33.64  ? 177 ARG B C   1 
ATOM   5546 O O   . ARG B 1 180 ? 66.388 153.507 35.662  1.00 30.58  ? 177 ARG B O   1 
ATOM   5547 C CB  . ARG B 1 180 ? 67.139 150.334 34.968  1.00 30.58  ? 177 ARG B CB  1 
ATOM   5548 C CG  . ARG B 1 180 ? 67.618 150.553 36.394  1.00 38.79  ? 177 ARG B CG  1 
ATOM   5549 C CD  . ARG B 1 180 ? 68.618 149.488 36.805  1.00 33.32  ? 177 ARG B CD  1 
ATOM   5550 N NE  . ARG B 1 180 ? 67.998 148.174 36.946  1.00 37.73  ? 177 ARG B NE  1 
ATOM   5551 C CZ  . ARG B 1 180 ? 68.676 147.045 37.117  1.00 41.68  ? 177 ARG B CZ  1 
ATOM   5552 N NH1 . ARG B 1 180 ? 70.002 147.068 37.162  1.00 35.06  ? 177 ARG B NH1 1 
ATOM   5553 N NH2 . ARG B 1 180 ? 68.031 145.893 37.240  1.00 41.91  ? 177 ARG B NH2 1 
ATOM   5554 N N   . LEU B 1 181 ? 67.831 153.217 33.956  1.00 32.94  ? 178 LEU B N   1 
ATOM   5555 C CA  . LEU B 1 181 ? 68.437 154.531 34.144  1.00 34.78  ? 178 LEU B CA  1 
ATOM   5556 C C   . LEU B 1 181 ? 67.403 155.638 33.995  1.00 31.95  ? 178 LEU B C   1 
ATOM   5557 O O   . LEU B 1 181 ? 67.415 156.617 34.752  1.00 38.35  ? 178 LEU B O   1 
ATOM   5558 C CB  . LEU B 1 181 ? 69.581 154.729 33.149  1.00 27.43  ? 178 LEU B CB  1 
ATOM   5559 C CG  . LEU B 1 181 ? 70.361 156.040 33.246  1.00 33.09  ? 178 LEU B CG  1 
ATOM   5560 C CD1 . LEU B 1 181 ? 70.955 156.207 34.634  1.00 35.35  ? 178 LEU B CD1 1 
ATOM   5561 C CD2 . LEU B 1 181 ? 71.450 156.083 32.191  1.00 27.64  ? 178 LEU B CD2 1 
ATOM   5562 N N   . ALA B 1 182 ? 66.493 155.497 33.028  1.00 30.36  ? 179 ALA B N   1 
ATOM   5563 C CA  . ALA B 1 182 ? 65.419 156.471 32.879  1.00 30.23  ? 179 ALA B CA  1 
ATOM   5564 C C   . ALA B 1 182 ? 64.478 156.448 34.075  1.00 37.11  ? 179 ALA B C   1 
ATOM   5565 O O   . ALA B 1 182 ? 63.885 157.477 34.417  1.00 35.77  ? 179 ALA B O   1 
ATOM   5566 C CB  . ALA B 1 182 ? 64.648 156.210 31.586  1.00 18.79  ? 179 ALA B CB  1 
ATOM   5567 N N   . LEU B 1 183 ? 64.326 155.289 34.720  1.00 39.38  ? 180 LEU B N   1 
ATOM   5568 C CA  . LEU B 1 183 ? 63.511 155.223 35.929  1.00 40.48  ? 180 LEU B CA  1 
ATOM   5569 C C   . LEU B 1 183 ? 64.228 155.868 37.108  1.00 38.03  ? 180 LEU B C   1 
ATOM   5570 O O   . LEU B 1 183 ? 63.591 156.505 37.956  1.00 38.43  ? 180 LEU B O   1 
ATOM   5571 C CB  . LEU B 1 183 ? 63.148 153.771 36.241  1.00 32.95  ? 180 LEU B CB  1 
ATOM   5572 C CG  . LEU B 1 183 ? 62.212 153.091 35.241  1.00 31.14  ? 180 LEU B CG  1 
ATOM   5573 C CD1 . LEU B 1 183 ? 61.925 151.660 35.662  1.00 36.27  ? 180 LEU B CD1 1 
ATOM   5574 C CD2 . LEU B 1 183 ? 60.920 153.881 35.094  1.00 35.70  ? 180 LEU B CD2 1 
ATOM   5575 N N   . GLN B 1 184 ? 65.553 155.712 37.181  1.00 29.68  ? 181 GLN B N   1 
ATOM   5576 C CA  . GLN B 1 184 ? 66.327 156.445 38.177  1.00 31.07  ? 181 GLN B CA  1 
ATOM   5577 C C   . GLN B 1 184 ? 66.241 157.946 37.934  1.00 43.07  ? 181 GLN B C   1 
ATOM   5578 O O   . GLN B 1 184 ? 66.200 158.736 38.885  1.00 43.46  ? 181 GLN B O   1 
ATOM   5579 C CB  . GLN B 1 184 ? 67.784 155.980 38.156  1.00 34.06  ? 181 GLN B CB  1 
ATOM   5580 C CG  . GLN B 1 184 ? 67.983 154.524 38.545  1.00 40.44  ? 181 GLN B CG  1 
ATOM   5581 C CD  . GLN B 1 184 ? 69.383 154.026 38.243  1.00 43.73  ? 181 GLN B CD  1 
ATOM   5582 O OE1 . GLN B 1 184 ? 70.122 154.646 37.478  1.00 46.94  ? 181 GLN B OE1 1 
ATOM   5583 N NE2 . GLN B 1 184 ? 69.756 152.902 38.844  1.00 35.98  ? 181 GLN B NE2 1 
ATOM   5584 N N   . TRP B 1 185 ? 66.209 158.355 36.663  1.00 42.63  ? 182 TRP B N   1 
ATOM   5585 C CA  . TRP B 1 185 ? 66.065 159.770 36.336  1.00 37.57  ? 182 TRP B CA  1 
ATOM   5586 C C   . TRP B 1 185 ? 64.723 160.307 36.812  1.00 38.00  ? 182 TRP B C   1 
ATOM   5587 O O   . TRP B 1 185 ? 64.629 161.451 37.273  1.00 37.10  ? 182 TRP B O   1 
ATOM   5588 C CB  . TRP B 1 185 ? 66.222 159.976 34.828  1.00 28.32  ? 182 TRP B CB  1 
ATOM   5589 C CG  . TRP B 1 185 ? 66.283 161.416 34.405  1.00 28.79  ? 182 TRP B CG  1 
ATOM   5590 C CD1 . TRP B 1 185 ? 67.409 162.155 34.177  1.00 30.64  ? 182 TRP B CD1 1 
ATOM   5591 C CD2 . TRP B 1 185 ? 65.174 162.290 34.153  1.00 29.68  ? 182 TRP B CD2 1 
ATOM   5592 N NE1 . TRP B 1 185 ? 67.070 163.432 33.801  1.00 31.50  ? 182 TRP B NE1 1 
ATOM   5593 C CE2 . TRP B 1 185 ? 65.704 163.541 33.779  1.00 31.32  ? 182 TRP B CE2 1 
ATOM   5594 C CE3 . TRP B 1 185 ? 63.785 162.136 34.208  1.00 24.99  ? 182 TRP B CE3 1 
ATOM   5595 C CZ2 . TRP B 1 185 ? 64.896 164.631 33.464  1.00 25.31  ? 182 TRP B CZ2 1 
ATOM   5596 C CZ3 . TRP B 1 185 ? 62.984 163.220 33.895  1.00 24.04  ? 182 TRP B CZ3 1 
ATOM   5597 C CH2 . TRP B 1 185 ? 63.541 164.450 33.527  1.00 27.95  ? 182 TRP B CH2 1 
ATOM   5598 N N   . VAL B 1 186 ? 63.669 159.494 36.705  1.00 38.35  ? 183 VAL B N   1 
ATOM   5599 C CA  . VAL B 1 186 ? 62.357 159.911 37.188  1.00 34.87  ? 183 VAL B CA  1 
ATOM   5600 C C   . VAL B 1 186 ? 62.379 160.095 38.701  1.00 41.88  ? 183 VAL B C   1 
ATOM   5601 O O   . VAL B 1 186 ? 61.777 161.035 39.233  1.00 34.32  ? 183 VAL B O   1 
ATOM   5602 C CB  . VAL B 1 186 ? 61.282 158.902 36.745  1.00 37.29  ? 183 VAL B CB  1 
ATOM   5603 C CG1 . VAL B 1 186 ? 59.952 159.206 37.414  1.00 27.58  ? 183 VAL B CG1 1 
ATOM   5604 C CG2 . VAL B 1 186 ? 61.128 158.925 35.232  1.00 23.96  ? 183 VAL B CG2 1 
ATOM   5605 N N   . GLN B 1 187 ? 63.085 159.217 39.418  1.00 27.99  ? 184 GLN B N   1 
ATOM   5606 C CA  . GLN B 1 187 ? 63.167 159.359 40.869  1.00 46.09  ? 184 GLN B CA  1 
ATOM   5607 C C   . GLN B 1 187 ? 63.854 160.660 41.263  1.00 40.41  ? 184 GLN B C   1 
ATOM   5608 O O   . GLN B 1 187 ? 63.467 161.302 42.247  1.00 38.80  ? 184 GLN B O   1 
ATOM   5609 C CB  . GLN B 1 187 ? 63.902 158.164 41.475  1.00 33.72  ? 184 GLN B CB  1 
ATOM   5610 C CG  . GLN B 1 187 ? 63.069 156.900 41.528  1.00 37.17  ? 184 GLN B CG  1 
ATOM   5611 C CD  . GLN B 1 187 ? 61.787 157.092 42.314  1.00 40.08  ? 184 GLN B CD  1 
ATOM   5612 O OE1 . GLN B 1 187 ? 61.786 157.705 43.381  1.00 52.17  ? 184 GLN B OE1 1 
ATOM   5613 N NE2 . GLN B 1 187 ? 60.685 156.577 41.783  1.00 47.64  ? 184 GLN B NE2 1 
ATOM   5614 N N   . GLU B 1 188 ? 64.863 161.075 40.501  1.00 38.15  ? 185 GLU B N   1 
ATOM   5615 C CA  . GLU B 1 188 ? 65.679 162.222 40.869  1.00 44.12  ? 185 GLU B CA  1 
ATOM   5616 C C   . GLU B 1 188 ? 65.195 163.538 40.272  1.00 38.23  ? 185 GLU B C   1 
ATOM   5617 O O   . GLU B 1 188 ? 65.669 164.597 40.698  1.00 45.85  ? 185 GLU B O   1 
ATOM   5618 C CB  . GLU B 1 188 ? 67.135 161.990 40.447  1.00 34.41  ? 185 GLU B CB  1 
ATOM   5619 C CG  . GLU B 1 188 ? 67.783 160.769 41.080  1.00 45.93  ? 185 GLU B CG  1 
ATOM   5620 C CD  . GLU B 1 188 ? 69.212 160.564 40.617  1.00 58.19  ? 185 GLU B CD  1 
ATOM   5621 O OE1 . GLU B 1 188 ? 69.810 159.523 40.966  1.00 59.94  ? 185 GLU B OE1 1 
ATOM   5622 O OE2 . GLU B 1 188 ? 69.741 161.445 39.906  1.00 59.04  ? 185 GLU B OE2 1 
ATOM   5623 N N   . ASN B 1 189 ? 64.272 163.512 39.307  1.00 32.80  ? 186 ASN B N   1 
ATOM   5624 C CA  . ASN B 1 189 ? 63.917 164.747 38.613  1.00 30.17  ? 186 ASN B CA  1 
ATOM   5625 C C   . ASN B 1 189 ? 62.435 164.944 38.328  1.00 32.59  ? 186 ASN B C   1 
ATOM   5626 O O   . ASN B 1 189 ? 62.062 166.056 37.943  1.00 40.76  ? 186 ASN B O   1 
ATOM   5627 C CB  . ASN B 1 189 ? 64.681 164.847 37.284  1.00 28.94  ? 186 ASN B CB  1 
ATOM   5628 C CG  . ASN B 1 189 ? 66.184 164.859 37.474  1.00 32.49  ? 186 ASN B CG  1 
ATOM   5629 O OD1 . ASN B 1 189 ? 66.770 165.886 37.817  1.00 42.81  ? 186 ASN B OD1 1 
ATOM   5630 N ND2 . ASN B 1 189 ? 66.817 163.713 37.251  1.00 33.06  ? 186 ASN B ND2 1 
ATOM   5631 N N   . VAL B 1 190 ? 61.574 163.935 38.491  1.00 31.14  ? 187 VAL B N   1 
ATOM   5632 C CA  . VAL B 1 190 ? 60.170 164.124 38.139  1.00 33.91  ? 187 VAL B CA  1 
ATOM   5633 C C   . VAL B 1 190 ? 59.476 165.095 39.086  1.00 37.31  ? 187 VAL B C   1 
ATOM   5634 O O   . VAL B 1 190 ? 58.413 165.630 38.748  1.00 36.10  ? 187 VAL B O   1 
ATOM   5635 C CB  . VAL B 1 190 ? 59.419 162.779 38.102  1.00 37.94  ? 187 VAL B CB  1 
ATOM   5636 C CG1 . VAL B 1 190 ? 58.938 162.387 39.494  1.00 35.20  ? 187 VAL B CG1 1 
ATOM   5637 C CG2 . VAL B 1 190 ? 58.257 162.844 37.121  1.00 29.36  ? 187 VAL B CG2 1 
ATOM   5638 N N   . ALA B 1 191 ? 60.050 165.343 40.267  1.00 36.51  ? 188 ALA B N   1 
ATOM   5639 C CA  . ALA B 1 191 ? 59.464 166.315 41.183  1.00 45.17  ? 188 ALA B CA  1 
ATOM   5640 C C   . ALA B 1 191 ? 59.512 167.725 40.611  1.00 40.35  ? 188 ALA B C   1 
ATOM   5641 O O   . ALA B 1 191 ? 58.604 168.525 40.863  1.00 38.80  ? 188 ALA B O   1 
ATOM   5642 C CB  . ALA B 1 191 ? 60.178 166.266 42.533  1.00 31.38  ? 188 ALA B CB  1 
ATOM   5643 N N   . ALA B 1 192 ? 60.553 168.043 39.837  1.00 37.54  ? 189 ALA B N   1 
ATOM   5644 C CA  . ALA B 1 192 ? 60.673 169.371 39.247  1.00 29.30  ? 189 ALA B CA  1 
ATOM   5645 C C   . ALA B 1 192 ? 59.553 169.670 38.260  1.00 42.64  ? 189 ALA B C   1 
ATOM   5646 O O   . ALA B 1 192 ? 59.310 170.842 37.951  1.00 36.86  ? 189 ALA B O   1 
ATOM   5647 C CB  . ALA B 1 192 ? 62.029 169.519 38.556  1.00 27.26  ? 189 ALA B CB  1 
ATOM   5648 N N   . PHE B 1 193 ? 58.869 168.642 37.759  1.00 43.64  ? 190 PHE B N   1 
ATOM   5649 C CA  . PHE B 1 193 ? 57.756 168.810 36.837  1.00 38.39  ? 190 PHE B CA  1 
ATOM   5650 C C   . PHE B 1 193 ? 56.404 168.685 37.527  1.00 41.64  ? 190 PHE B C   1 
ATOM   5651 O O   . PHE B 1 193 ? 55.372 168.671 36.849  1.00 38.81  ? 190 PHE B O   1 
ATOM   5652 C CB  . PHE B 1 193 ? 57.854 167.790 35.700  1.00 39.26  ? 190 PHE B CB  1 
ATOM   5653 C CG  . PHE B 1 193 ? 59.144 167.855 34.930  1.00 35.60  ? 190 PHE B CG  1 
ATOM   5654 C CD1 . PHE B 1 193 ? 60.263 167.161 35.365  1.00 26.36  ? 190 PHE B CD1 1 
ATOM   5655 C CD2 . PHE B 1 193 ? 59.236 168.602 33.767  1.00 31.93  ? 190 PHE B CD2 1 
ATOM   5656 C CE1 . PHE B 1 193 ? 61.449 167.217 34.659  1.00 27.68  ? 190 PHE B CE1 1 
ATOM   5657 C CE2 . PHE B 1 193 ? 60.420 168.661 33.057  1.00 32.57  ? 190 PHE B CE2 1 
ATOM   5658 C CZ  . PHE B 1 193 ? 61.528 167.967 33.504  1.00 30.37  ? 190 PHE B CZ  1 
ATOM   5659 N N   . GLY B 1 194 ? 56.387 168.593 38.854  1.00 42.70  ? 191 GLY B N   1 
ATOM   5660 C CA  . GLY B 1 194 ? 55.159 168.391 39.591  1.00 36.66  ? 191 GLY B CA  1 
ATOM   5661 C C   . GLY B 1 194 ? 54.772 166.947 39.810  1.00 48.22  ? 191 GLY B C   1 
ATOM   5662 O O   . GLY B 1 194 ? 53.648 166.686 40.255  1.00 43.16  ? 191 GLY B O   1 
ATOM   5663 N N   . GLY B 1 195 ? 55.663 166.003 39.521  1.00 42.92  ? 192 GLY B N   1 
ATOM   5664 C CA  . GLY B 1 195 ? 55.366 164.590 39.643  1.00 43.64  ? 192 GLY B CA  1 
ATOM   5665 C C   . GLY B 1 195 ? 55.826 164.008 40.967  1.00 47.14  ? 192 GLY B C   1 
ATOM   5666 O O   . GLY B 1 195 ? 56.835 164.425 41.531  1.00 46.16  ? 192 GLY B O   1 
ATOM   5667 N N   . ASP B 1 196 ? 55.069 163.025 41.455  1.00 43.54  ? 193 ASP B N   1 
ATOM   5668 C CA  . ASP B 1 196 ? 55.359 162.392 42.734  1.00 43.12  ? 193 ASP B CA  1 
ATOM   5669 C C   . ASP B 1 196 ? 56.198 161.144 42.498  1.00 42.83  ? 193 ASP B C   1 
ATOM   5670 O O   . ASP B 1 196 ? 55.680 160.159 41.950  1.00 43.27  ? 193 ASP B O   1 
ATOM   5671 C CB  . ASP B 1 196 ? 54.068 162.037 43.458  1.00 53.64  ? 193 ASP B CB  1 
ATOM   5672 C CG  . ASP B 1 196 ? 54.309 161.460 44.841  1.00 46.74  ? 193 ASP B CG  1 
ATOM   5673 O OD1 . ASP B 1 196 ? 53.352 160.915 45.430  1.00 56.65  ? 193 ASP B OD1 1 
ATOM   5674 O OD2 . ASP B 1 196 ? 55.450 161.547 45.341  1.00 50.36  ? 193 ASP B OD2 1 
ATOM   5675 N N   . PRO B 1 197 ? 57.475 161.127 42.892  1.00 36.37  ? 194 PRO B N   1 
ATOM   5676 C CA  . PRO B 1 197 ? 58.295 159.923 42.684  1.00 35.81  ? 194 PRO B CA  1 
ATOM   5677 C C   . PRO B 1 197 ? 57.907 158.748 43.569  1.00 45.02  ? 194 PRO B C   1 
ATOM   5678 O O   . PRO B 1 197 ? 58.477 157.662 43.401  1.00 43.78  ? 194 PRO B O   1 
ATOM   5679 C CB  . PRO B 1 197 ? 59.716 160.407 42.998  1.00 31.35  ? 194 PRO B CB  1 
ATOM   5680 C CG  . PRO B 1 197 ? 59.521 161.566 43.917  1.00 27.49  ? 194 PRO B CG  1 
ATOM   5681 C CD  . PRO B 1 197 ? 58.254 162.237 43.466  1.00 37.16  ? 194 PRO B CD  1 
ATOM   5682 N N   . THR B 1 198 ? 56.971 158.921 44.500  1.00 47.45  ? 195 THR B N   1 
ATOM   5683 C CA  . THR B 1 198 ? 56.497 157.824 45.332  1.00 56.36  ? 195 THR B CA  1 
ATOM   5684 C C   . THR B 1 198 ? 55.243 157.161 44.777  1.00 47.70  ? 195 THR B C   1 
ATOM   5685 O O   . THR B 1 198 ? 54.739 156.213 45.388  1.00 57.18  ? 195 THR B O   1 
ATOM   5686 C CB  . THR B 1 198 ? 56.231 158.309 46.762  1.00 47.73  ? 195 THR B CB  1 
ATOM   5687 O OG1 . THR B 1 198 ? 55.156 159.256 46.758  1.00 40.39  ? 195 THR B OG1 1 
ATOM   5688 C CG2 . THR B 1 198 ? 57.476 158.963 47.343  1.00 31.32  ? 195 THR B CG2 1 
ATOM   5689 N N   . SER B 1 199 ? 54.730 157.631 43.631  1.00 47.47  ? 196 SER B N   1 
ATOM   5690 C CA  . SER B 1 199 ? 53.560 157.050 42.981  1.00 43.31  ? 196 SER B CA  1 
ATOM   5691 C C   . SER B 1 199 ? 53.842 156.969 41.476  1.00 51.24  ? 196 SER B C   1 
ATOM   5692 O O   . SER B 1 199 ? 53.292 157.711 40.665  1.00 52.59  ? 196 SER B O   1 
ATOM   5693 C CB  . SER B 1 199 ? 52.295 157.861 43.273  1.00 38.47  ? 196 SER B CB  1 
ATOM   5694 O OG  . SER B 1 199 ? 51.157 157.272 42.666  1.00 49.53  ? 196 SER B OG  1 
ATOM   5695 N N   . VAL B 1 200 ? 54.722 156.046 41.096  1.00 40.37  ? 197 VAL B N   1 
ATOM   5696 C CA  . VAL B 1 200 ? 55.134 155.861 39.709  1.00 44.94  ? 197 VAL B CA  1 
ATOM   5697 C C   . VAL B 1 200 ? 54.538 154.553 39.207  1.00 38.11  ? 197 VAL B C   1 
ATOM   5698 O O   . VAL B 1 200 ? 54.769 153.490 39.796  1.00 37.37  ? 197 VAL B O   1 
ATOM   5699 C CB  . VAL B 1 200 ? 56.664 155.861 39.567  1.00 43.61  ? 197 VAL B CB  1 
ATOM   5700 C CG1 . VAL B 1 200 ? 57.058 155.701 38.109  1.00 41.22  ? 197 VAL B CG1 1 
ATOM   5701 C CG2 . VAL B 1 200 ? 57.254 157.137 40.150  1.00 43.74  ? 197 VAL B CG2 1 
ATOM   5702 N N   . THR B 1 201 ? 53.777 154.629 38.117  1.00 39.87  ? 198 THR B N   1 
ATOM   5703 C CA  . THR B 1 201 ? 53.122 153.470 37.523  1.00 35.24  ? 198 THR B CA  1 
ATOM   5704 C C   . THR B 1 201 ? 53.708 153.217 36.140  1.00 39.01  ? 198 THR B C   1 
ATOM   5705 O O   . THR B 1 201 ? 53.689 154.105 35.281  1.00 37.91  ? 198 THR B O   1 
ATOM   5706 C CB  . THR B 1 201 ? 51.611 153.678 37.428  1.00 39.80  ? 198 THR B CB  1 
ATOM   5707 O OG1 . THR B 1 201 ? 51.071 153.882 38.740  1.00 41.83  ? 198 THR B OG1 1 
ATOM   5708 C CG2 . THR B 1 201 ? 50.946 152.464 36.793  1.00 34.81  ? 198 THR B CG2 1 
ATOM   5709 N N   . LEU B 1 202 ? 54.222 152.009 35.930  1.00 39.05  ? 199 LEU B N   1 
ATOM   5710 C CA  . LEU B 1 202 ? 54.759 151.606 34.640  1.00 35.47  ? 199 LEU B CA  1 
ATOM   5711 C C   . LEU B 1 202 ? 53.653 151.022 33.772  1.00 38.17  ? 199 LEU B C   1 
ATOM   5712 O O   . LEU B 1 202 ? 52.791 150.285 34.257  1.00 41.05  ? 199 LEU B O   1 
ATOM   5713 C CB  . LEU B 1 202 ? 55.872 150.571 34.818  1.00 29.28  ? 199 LEU B CB  1 
ATOM   5714 C CG  . LEU B 1 202 ? 57.322 151.037 34.971  1.00 40.79  ? 199 LEU B CG  1 
ATOM   5715 C CD1 . LEU B 1 202 ? 57.450 152.140 36.006  1.00 49.37  ? 199 LEU B CD1 1 
ATOM   5716 C CD2 . LEU B 1 202 ? 58.214 149.856 35.334  1.00 31.78  ? 199 LEU B CD2 1 
ATOM   5717 N N   . PHE B 1 203 ? 53.680 151.357 32.484  1.00 37.34  ? 200 PHE B N   1 
ATOM   5718 C CA  . PHE B 1 203 ? 52.790 150.706 31.533  1.00 34.24  ? 200 PHE B CA  1 
ATOM   5719 C C   . PHE B 1 203 ? 53.480 150.599 30.182  1.00 39.86  ? 200 PHE B C   1 
ATOM   5720 O O   . PHE B 1 203 ? 54.048 151.576 29.686  1.00 43.00  ? 200 PHE B O   1 
ATOM   5721 C CB  . PHE B 1 203 ? 51.433 151.427 31.416  1.00 28.30  ? 200 PHE B CB  1 
ATOM   5722 C CG  . PHE B 1 203 ? 51.482 152.796 30.785  1.00 35.78  ? 200 PHE B CG  1 
ATOM   5723 C CD1 . PHE B 1 203 ? 50.521 153.157 29.854  1.00 32.18  ? 200 PHE B CD1 1 
ATOM   5724 C CD2 . PHE B 1 203 ? 52.429 153.737 31.154  1.00 34.26  ? 200 PHE B CD2 1 
ATOM   5725 C CE1 . PHE B 1 203 ? 50.524 154.409 29.276  1.00 35.79  ? 200 PHE B CE1 1 
ATOM   5726 C CE2 . PHE B 1 203 ? 52.438 154.993 30.577  1.00 29.83  ? 200 PHE B CE2 1 
ATOM   5727 C CZ  . PHE B 1 203 ? 51.485 155.329 29.637  1.00 28.33  ? 200 PHE B CZ  1 
ATOM   5728 N N   . GLY B 1 204 ? 53.452 149.391 29.613  1.00 39.31  ? 201 GLY B N   1 
ATOM   5729 C CA  . GLY B 1 204 ? 54.041 149.145 28.316  1.00 33.30  ? 201 GLY B CA  1 
ATOM   5730 C C   . GLY B 1 204 ? 53.222 148.130 27.545  1.00 39.42  ? 201 GLY B C   1 
ATOM   5731 O O   . GLY B 1 204 ? 52.330 147.475 28.091  1.00 36.67  ? 201 GLY B O   1 
ATOM   5732 N N   . GLU B 1 205 ? 53.544 148.007 26.261  1.00 34.48  ? 202 GLU B N   1 
ATOM   5733 C CA  . GLU B 1 205 ? 52.804 147.143 25.354  1.00 26.52  ? 202 GLU B CA  1 
ATOM   5734 C C   . GLU B 1 205 ? 53.768 146.208 24.637  1.00 34.53  ? 202 GLU B C   1 
ATOM   5735 O O   . GLU B 1 205 ? 54.887 146.603 24.296  1.00 33.73  ? 202 GLU B O   1 
ATOM   5736 C CB  . GLU B 1 205 ? 51.998 147.975 24.346  1.00 30.42  ? 202 GLU B CB  1 
ATOM   5737 C CG  . GLU B 1 205 ? 50.858 147.230 23.678  1.00 24.46  ? 202 GLU B CG  1 
ATOM   5738 C CD  . GLU B 1 205 ? 51.277 146.578 22.380  1.00 37.39  ? 202 GLU B CD  1 
ATOM   5739 O OE1 . GLU B 1 205 ? 52.434 146.785 21.963  1.00 36.53  ? 202 GLU B OE1 1 
ATOM   5740 O OE2 . GLU B 1 205 ? 50.451 145.864 21.776  1.00 43.39  ? 202 GLU B OE2 1 
HETATM 5741 N N   . SVX B 1 206 ? 53.324 144.968 24.419  1.00 33.59  ? 203 SVX B N   1 
HETATM 5742 C CA  . SVX B 1 206 ? 54.124 143.922 23.786  1.00 31.27  ? 203 SVX B CA  1 
HETATM 5743 C C   . SVX B 1 206 ? 55.483 143.769 24.458  1.00 26.78  ? 203 SVX B C   1 
HETATM 5744 C CB  . SVX B 1 206 ? 54.307 144.203 22.293  1.00 40.09  ? 203 SVX B CB  1 
HETATM 5745 O O   . SVX B 1 206 ? 55.564 143.392 25.632  1.00 33.71  ? 203 SVX B O   1 
HETATM 5746 O OG  . SVX B 1 206 ? 54.455 142.990 21.573  1.00 47.61  ? 203 SVX B OG  1 
HETATM 5747 P P1  . SVX B 1 206 ? 55.592 143.069 20.421  1.00 33.81  ? 203 SVX B P1  1 
HETATM 5748 C C4  . SVX B 1 206 ? 56.397 141.394 20.473  1.00 36.34  ? 203 SVX B C4  1 
HETATM 5749 C C2  . SVX B 1 206 ? 55.635 144.060 17.992  1.00 46.98  ? 203 SVX B C2  1 
HETATM 5750 O O6  . SVX B 1 206 ? 56.613 144.139 20.728  1.00 40.13  ? 203 SVX B O6  1 
HETATM 5751 O O5  . SVX B 1 206 ? 54.918 143.323 18.940  1.00 38.97  ? 203 SVX B O5  1 
HETATM 5752 C C1  . SVX B 1 206 ? 56.598 143.146 17.238  1.00 42.58  ? 203 SVX B C1  1 
ATOM   5753 N N   . ALA B 1 207 ? 56.558 144.055 23.716  1.00 32.75  ? 204 ALA B N   1 
ATOM   5754 C CA  . ALA B 1 207 ? 57.895 143.990 24.296  1.00 34.45  ? 204 ALA B CA  1 
ATOM   5755 C C   . ALA B 1 207 ? 58.064 145.002 25.420  1.00 31.09  ? 204 ALA B C   1 
ATOM   5756 O O   . ALA B 1 207 ? 58.876 144.792 26.328  1.00 30.26  ? 204 ALA B O   1 
ATOM   5757 C CB  . ALA B 1 207 ? 58.951 144.211 23.213  1.00 29.07  ? 204 ALA B CB  1 
ATOM   5758 N N   . GLY B 1 208 ? 57.313 146.104 25.374  1.00 30.07  ? 205 GLY B N   1 
ATOM   5759 C CA  . GLY B 1 208 ? 57.311 147.027 26.495  1.00 29.19  ? 205 GLY B CA  1 
ATOM   5760 C C   . GLY B 1 208 ? 56.652 146.434 27.725  1.00 36.24  ? 205 GLY B C   1 
ATOM   5761 O O   . GLY B 1 208 ? 57.131 146.619 28.847  1.00 34.14  ? 205 GLY B O   1 
ATOM   5762 N N   . ALA B 1 209 ? 55.542 145.715 27.533  1.00 32.73  ? 206 ALA B N   1 
ATOM   5763 C CA  . ALA B 1 209 ? 54.912 145.017 28.649  1.00 29.84  ? 206 ALA B CA  1 
ATOM   5764 C C   . ALA B 1 209 ? 55.840 143.953 29.218  1.00 27.04  ? 206 ALA B C   1 
ATOM   5765 O O   . ALA B 1 209 ? 55.914 143.771 30.438  1.00 31.72  ? 206 ALA B O   1 
ATOM   5766 C CB  . ALA B 1 209 ? 53.589 144.395 28.204  1.00 26.95  ? 206 ALA B CB  1 
ATOM   5767 N N   . ALA B 1 210 ? 56.558 143.240 28.346  1.00 29.86  ? 207 ALA B N   1 
ATOM   5768 C CA  . ALA B 1 210 ? 57.560 142.293 28.819  1.00 30.87  ? 207 ALA B CA  1 
ATOM   5769 C C   . ALA B 1 210 ? 58.668 142.998 29.588  1.00 35.37  ? 207 ALA B C   1 
ATOM   5770 O O   . ALA B 1 210 ? 59.209 142.440 30.550  1.00 32.73  ? 207 ALA B O   1 
ATOM   5771 C CB  . ALA B 1 210 ? 58.139 141.508 27.642  1.00 24.65  ? 207 ALA B CB  1 
ATOM   5772 N N   . SER B 1 211 ? 59.014 144.224 29.188  1.00 30.55  ? 208 SER B N   1 
ATOM   5773 C CA  . SER B 1 211 ? 60.011 144.994 29.925  1.00 32.78  ? 208 SER B CA  1 
ATOM   5774 C C   . SER B 1 211 ? 59.487 145.390 31.300  1.00 27.24  ? 208 SER B C   1 
ATOM   5775 O O   . SER B 1 211 ? 60.203 145.281 32.302  1.00 28.66  ? 208 SER B O   1 
ATOM   5776 C CB  . SER B 1 211 ? 60.416 146.230 29.124  1.00 28.18  ? 208 SER B CB  1 
ATOM   5777 O OG  . SER B 1 211 ? 61.072 145.867 27.923  1.00 26.57  ? 208 SER B OG  1 
ATOM   5778 N N   . VAL B 1 212 ? 58.238 145.860 31.362  1.00 22.30  ? 209 VAL B N   1 
ATOM   5779 C CA  . VAL B 1 212 ? 57.613 146.170 32.646  1.00 24.88  ? 209 VAL B CA  1 
ATOM   5780 C C   . VAL B 1 212 ? 57.619 144.942 33.548  1.00 36.94  ? 209 VAL B C   1 
ATOM   5781 O O   . VAL B 1 212 ? 57.848 145.042 34.760  1.00 35.25  ? 209 VAL B O   1 
ATOM   5782 C CB  . VAL B 1 212 ? 56.186 146.706 32.427  1.00 28.50  ? 209 VAL B CB  1 
ATOM   5783 C CG1 . VAL B 1 212 ? 55.480 146.918 33.759  1.00 30.08  ? 209 VAL B CG1 1 
ATOM   5784 C CG2 . VAL B 1 212 ? 56.219 147.997 31.626  1.00 26.41  ? 209 VAL B CG2 1 
ATOM   5785 N N   . GLY B 1 213 ? 57.383 143.764 32.968  1.00 31.97  ? 210 GLY B N   1 
ATOM   5786 C CA  . GLY B 1 213 ? 57.389 142.547 33.763  1.00 36.65  ? 210 GLY B CA  1 
ATOM   5787 C C   . GLY B 1 213 ? 58.771 142.176 34.265  1.00 33.56  ? 210 GLY B C   1 
ATOM   5788 O O   . GLY B 1 213 ? 58.920 141.683 35.386  1.00 41.77  ? 210 GLY B O   1 
ATOM   5789 N N   . MET B 1 214 ? 59.803 142.408 33.448  1.00 34.58  ? 211 MET B N   1 
ATOM   5790 C CA  . MET B 1 214 ? 61.158 142.058 33.862  1.00 34.40  ? 211 MET B CA  1 
ATOM   5791 C C   . MET B 1 214 ? 61.688 143.011 34.925  1.00 40.36  ? 211 MET B C   1 
ATOM   5792 O O   . MET B 1 214 ? 62.553 142.627 35.720  1.00 39.80  ? 211 MET B O   1 
ATOM   5793 C CB  . MET B 1 214 ? 62.096 142.037 32.656  1.00 32.25  ? 211 MET B CB  1 
ATOM   5794 C CG  . MET B 1 214 ? 61.766 140.958 31.643  1.00 37.45  ? 211 MET B CG  1 
ATOM   5795 S SD  . MET B 1 214 ? 62.963 140.843 30.304  1.00 48.02  ? 211 MET B SD  1 
ATOM   5796 C CE  . MET B 1 214 ? 62.056 139.828 29.140  1.00 43.11  ? 211 MET B CE  1 
ATOM   5797 N N   . HIS B 1 215 ? 61.195 144.251 34.954  1.00 32.55  ? 212 HIS B N   1 
ATOM   5798 C CA  . HIS B 1 215 ? 61.593 145.165 36.019  1.00 39.85  ? 212 HIS B CA  1 
ATOM   5799 C C   . HIS B 1 215 ? 61.007 144.743 37.359  1.00 43.87  ? 212 HIS B C   1 
ATOM   5800 O O   . HIS B 1 215 ? 61.620 144.985 38.406  1.00 45.17  ? 212 HIS B O   1 
ATOM   5801 C CB  . HIS B 1 215 ? 61.178 146.595 35.674  1.00 33.71  ? 212 HIS B CB  1 
ATOM   5802 C CG  . HIS B 1 215 ? 62.009 147.221 34.598  1.00 39.98  ? 212 HIS B CG  1 
ATOM   5803 N ND1 . HIS B 1 215 ? 63.384 147.278 34.660  1.00 44.41  ? 212 HIS B ND1 1 
ATOM   5804 C CD2 . HIS B 1 215 ? 61.660 147.820 33.435  1.00 32.32  ? 212 HIS B CD2 1 
ATOM   5805 C CE1 . HIS B 1 215 ? 63.847 147.883 33.581  1.00 37.10  ? 212 HIS B CE1 1 
ATOM   5806 N NE2 . HIS B 1 215 ? 62.821 148.222 32.821  1.00 42.69  ? 212 HIS B NE2 1 
ATOM   5807 N N   . LEU B 1 216 ? 59.828 144.116 37.348  1.00 36.10  ? 213 LEU B N   1 
ATOM   5808 C CA  . LEU B 1 216 ? 59.273 143.556 38.576  1.00 40.52  ? 213 LEU B CA  1 
ATOM   5809 C C   . LEU B 1 216 ? 60.167 142.453 39.126  1.00 32.75  ? 213 LEU B C   1 
ATOM   5810 O O   . LEU B 1 216 ? 60.341 142.331 40.344  1.00 38.66  ? 213 LEU B O   1 
ATOM   5811 C CB  . LEU B 1 216 ? 57.866 143.016 38.317  1.00 31.82  ? 213 LEU B CB  1 
ATOM   5812 C CG  . LEU B 1 216 ? 56.777 144.018 37.940  1.00 41.08  ? 213 LEU B CG  1 
ATOM   5813 C CD1 . LEU B 1 216 ? 55.615 143.309 37.263  1.00 32.04  ? 213 LEU B CD1 1 
ATOM   5814 C CD2 . LEU B 1 216 ? 56.300 144.748 39.179  1.00 39.98  ? 213 LEU B CD2 1 
ATOM   5815 N N   . LEU B 1 217 ? 60.744 141.644 38.243  1.00 39.35  ? 214 LEU B N   1 
ATOM   5816 C CA  . LEU B 1 217 ? 61.562 140.505 38.632  1.00 38.61  ? 214 LEU B CA  1 
ATOM   5817 C C   . LEU B 1 217 ? 63.025 140.865 38.851  1.00 40.63  ? 214 LEU B C   1 
ATOM   5818 O O   . LEU B 1 217 ? 63.835 139.968 39.110  1.00 44.70  ? 214 LEU B O   1 
ATOM   5819 C CB  . LEU B 1 217 ? 61.453 139.404 37.571  1.00 32.84  ? 214 LEU B CB  1 
ATOM   5820 C CG  . LEU B 1 217 ? 60.028 138.960 37.234  1.00 43.05  ? 214 LEU B CG  1 
ATOM   5821 C CD1 . LEU B 1 217 ? 60.030 137.983 36.069  1.00 37.29  ? 214 LEU B CD1 1 
ATOM   5822 C CD2 . LEU B 1 217 ? 59.353 138.347 38.453  1.00 40.29  ? 214 LEU B CD2 1 
ATOM   5823 N N   . SER B 1 218 ? 63.385 142.143 38.754  1.00 48.08  ? 215 SER B N   1 
ATOM   5824 C CA  . SER B 1 218 ? 64.753 142.590 38.990  1.00 52.39  ? 215 SER B CA  1 
ATOM   5825 C C   . SER B 1 218 ? 64.774 143.486 40.222  1.00 46.80  ? 215 SER B C   1 
ATOM   5826 O O   . SER B 1 218 ? 64.152 144.564 40.206  1.00 50.17  ? 215 SER B O   1 
ATOM   5827 C CB  . SER B 1 218 ? 65.310 143.333 37.772  1.00 44.37  ? 215 SER B CB  1 
ATOM   5828 O OG  . SER B 1 218 ? 66.716 143.490 37.869  1.00 47.23  ? 215 SER B OG  1 
ATOM   5829 N N   . PRO B 1 219 ? 65.451 143.090 41.297  1.00 50.19  ? 216 PRO B N   1 
ATOM   5830 C CA  . PRO B 1 219 ? 65.433 143.878 42.541  1.00 45.91  ? 216 PRO B CA  1 
ATOM   5831 C C   . PRO B 1 219 ? 65.911 145.309 42.345  1.00 42.94  ? 216 PRO B C   1 
ATOM   5832 O O   . PRO B 1 219 ? 65.280 146.235 42.878  1.00 41.30  ? 216 PRO B O   1 
ATOM   5833 C CB  . PRO B 1 219 ? 66.368 143.089 43.470  1.00 37.50  ? 216 PRO B CB  1 
ATOM   5834 C CG  . PRO B 1 219 ? 66.255 141.684 42.983  1.00 49.70  ? 216 PRO B CG  1 
ATOM   5835 C CD  . PRO B 1 219 ? 66.081 141.771 41.487  1.00 41.65  ? 216 PRO B CD  1 
ATOM   5836 N N   . PRO B 1 220 ? 67.013 145.557 41.616  1.00 41.07  ? 217 PRO B N   1 
ATOM   5837 C CA  . PRO B 1 220 ? 67.428 146.961 41.436  1.00 37.30  ? 217 PRO B CA  1 
ATOM   5838 C C   . PRO B 1 220 ? 66.379 147.818 40.754  1.00 41.08  ? 217 PRO B C   1 
ATOM   5839 O O   . PRO B 1 220 ? 66.304 149.023 41.022  1.00 43.07  ? 217 PRO B O   1 
ATOM   5840 C CB  . PRO B 1 220 ? 68.703 146.848 40.589  1.00 30.26  ? 217 PRO B CB  1 
ATOM   5841 C CG  . PRO B 1 220 ? 69.218 145.497 40.868  1.00 41.41  ? 217 PRO B CG  1 
ATOM   5842 C CD  . PRO B 1 220 ? 67.997 144.646 40.999  1.00 35.10  ? 217 PRO B CD  1 
ATOM   5843 N N   . SER B 1 221 ? 65.560 147.234 39.881  1.00 41.24  ? 218 SER B N   1 
ATOM   5844 C CA  . SER B 1 221 ? 64.513 148.003 39.218  1.00 41.11  ? 218 SER B CA  1 
ATOM   5845 C C   . SER B 1 221 ? 63.240 148.068 40.047  1.00 42.83  ? 218 SER B C   1 
ATOM   5846 O O   . SER B 1 221 ? 62.491 149.047 39.945  1.00 38.82  ? 218 SER B O   1 
ATOM   5847 C CB  . SER B 1 221 ? 64.205 147.402 37.846  1.00 35.71  ? 218 SER B CB  1 
ATOM   5848 O OG  . SER B 1 221 ? 65.376 147.303 37.054  1.00 39.47  ? 218 SER B OG  1 
ATOM   5849 N N   . ARG B 1 222 ? 62.985 147.047 40.870  1.00 50.87  ? 219 ARG B N   1 
ATOM   5850 C CA  . ARG B 1 222 ? 61.715 146.961 41.585  1.00 48.47  ? 219 ARG B CA  1 
ATOM   5851 C C   . ARG B 1 222 ? 61.527 148.140 42.532  1.00 44.89  ? 219 ARG B C   1 
ATOM   5852 O O   . ARG B 1 222 ? 60.404 148.623 42.721  1.00 44.77  ? 219 ARG B O   1 
ATOM   5853 C CB  . ARG B 1 222 ? 61.633 145.638 42.346  1.00 44.83  ? 219 ARG B CB  1 
ATOM   5854 C CG  . ARG B 1 222 ? 60.343 145.443 43.127  1.00 40.35  ? 219 ARG B CG  1 
ATOM   5855 C CD  . ARG B 1 222 ? 59.130 145.480 42.212  1.00 47.51  ? 219 ARG B CD  1 
ATOM   5856 N NE  . ARG B 1 222 ? 57.876 145.447 42.961  1.00 46.40  ? 219 ARG B NE  1 
ATOM   5857 C CZ  . ARG B 1 222 ? 57.226 146.530 43.376  1.00 50.89  ? 219 ARG B CZ  1 
ATOM   5858 N NH1 . ARG B 1 222 ? 57.711 147.736 43.115  1.00 46.67  ? 219 ARG B NH1 1 
ATOM   5859 N NH2 . ARG B 1 222 ? 56.091 146.408 44.050  1.00 52.02  ? 219 ARG B NH2 1 
ATOM   5860 N N   . GLY B 1 223 ? 62.613 148.624 43.127  1.00 46.35  ? 220 GLY B N   1 
ATOM   5861 C CA  . GLY B 1 223 ? 62.522 149.742 44.043  1.00 36.66  ? 220 GLY B CA  1 
ATOM   5862 C C   . GLY B 1 223 ? 62.278 151.088 43.397  1.00 44.12  ? 220 GLY B C   1 
ATOM   5863 O O   . GLY B 1 223 ? 62.121 152.079 44.116  1.00 52.68  ? 220 GLY B O   1 
ATOM   5864 N N   . LEU B 1 224 ? 62.232 151.152 42.067  1.00 38.63  ? 221 LEU B N   1 
ATOM   5865 C CA  . LEU B 1 224 ? 62.080 152.409 41.348  1.00 32.48  ? 221 LEU B CA  1 
ATOM   5866 C C   . LEU B 1 224 ? 60.642 152.701 40.944  1.00 41.03  ? 221 LEU B C   1 
ATOM   5867 O O   . LEU B 1 224 ? 60.391 153.727 40.304  1.00 40.17  ? 221 LEU B O   1 
ATOM   5868 C CB  . LEU B 1 224 ? 62.973 152.411 40.103  1.00 39.88  ? 221 LEU B CB  1 
ATOM   5869 C CG  . LEU B 1 224 ? 64.477 152.287 40.354  1.00 37.21  ? 221 LEU B CG  1 
ATOM   5870 C CD1 . LEU B 1 224 ? 65.228 152.159 39.040  1.00 40.60  ? 221 LEU B CD1 1 
ATOM   5871 C CD2 . LEU B 1 224 ? 64.990 153.475 41.156  1.00 24.79  ? 221 LEU B CD2 1 
ATOM   5872 N N   . PHE B 1 225 ? 59.695 151.836 41.298  1.00 42.07  ? 222 PHE B N   1 
ATOM   5873 C CA  . PHE B 1 225 ? 58.300 152.050 40.938  1.00 38.62  ? 222 PHE B CA  1 
ATOM   5874 C C   . PHE B 1 225 ? 57.422 151.249 41.889  1.00 38.35  ? 222 PHE B C   1 
ATOM   5875 O O   . PHE B 1 225 ? 57.910 150.482 42.722  1.00 41.85  ? 222 PHE B O   1 
ATOM   5876 C CB  . PHE B 1 225 ? 58.034 151.669 39.478  1.00 36.71  ? 222 PHE B CB  1 
ATOM   5877 C CG  . PHE B 1 225 ? 58.259 150.216 39.177  1.00 34.28  ? 222 PHE B CG  1 
ATOM   5878 C CD1 . PHE B 1 225 ? 59.536 149.729 38.948  1.00 35.15  ? 222 PHE B CD1 1 
ATOM   5879 C CD2 . PHE B 1 225 ? 57.192 149.338 39.109  1.00 37.15  ? 222 PHE B CD2 1 
ATOM   5880 C CE1 . PHE B 1 225 ? 59.742 148.393 38.667  1.00 37.72  ? 222 PHE B CE1 1 
ATOM   5881 C CE2 . PHE B 1 225 ? 57.392 148.004 38.828  1.00 36.77  ? 222 PHE B CE2 1 
ATOM   5882 C CZ  . PHE B 1 225 ? 58.669 147.529 38.607  1.00 37.86  ? 222 PHE B CZ  1 
ATOM   5883 N N   . HIS B 1 226 ? 56.110 151.431 41.745  1.00 36.04  ? 223 HIS B N   1 
ATOM   5884 C CA  . HIS B 1 226 ? 55.171 150.913 42.731  1.00 51.26  ? 223 HIS B CA  1 
ATOM   5885 C C   . HIS B 1 226 ? 54.040 150.118 42.092  1.00 45.33  ? 223 HIS B C   1 
ATOM   5886 O O   . HIS B 1 226 ? 53.456 149.239 42.734  1.00 50.74  ? 223 HIS B O   1 
ATOM   5887 C CB  . HIS B 1 226 ? 54.607 152.069 43.560  1.00 46.48  ? 223 HIS B CB  1 
ATOM   5888 C CG  . HIS B 1 226 ? 55.647 153.049 44.004  1.00 55.78  ? 223 HIS B CG  1 
ATOM   5889 N ND1 . HIS B 1 226 ? 56.159 154.018 43.170  1.00 58.92  ? 223 HIS B ND1 1 
ATOM   5890 C CD2 . HIS B 1 226 ? 56.285 153.196 45.189  1.00 57.49  ? 223 HIS B CD2 1 
ATOM   5891 C CE1 . HIS B 1 226 ? 57.063 154.726 43.823  1.00 52.33  ? 223 HIS B CE1 1 
ATOM   5892 N NE2 . HIS B 1 226 ? 57.157 154.249 45.051  1.00 58.61  ? 223 HIS B NE2 1 
ATOM   5893 N N   . ARG B 1 227 ? 53.717 150.418 40.837  1.00 38.79  ? 224 ARG B N   1 
ATOM   5894 C CA  . ARG B 1 227 ? 52.656 149.727 40.122  1.00 37.42  ? 224 ARG B CA  1 
ATOM   5895 C C   . ARG B 1 227 ? 53.136 149.357 38.727  1.00 43.29  ? 224 ARG B C   1 
ATOM   5896 O O   . ARG B 1 227 ? 54.141 149.876 38.234  1.00 41.81  ? 224 ARG B O   1 
ATOM   5897 C CB  . ARG B 1 227 ? 51.384 150.579 40.031  1.00 41.42  ? 224 ARG B CB  1 
ATOM   5898 C CG  . ARG B 1 227 ? 50.799 150.955 41.379  1.00 38.08  ? 224 ARG B CG  1 
ATOM   5899 C CD  . ARG B 1 227 ? 49.568 151.823 41.218  1.00 40.52  ? 224 ARG B CD  1 
ATOM   5900 N NE  . ARG B 1 227 ? 49.038 152.264 42.504  1.00 56.87  ? 224 ARG B NE  1 
ATOM   5901 C CZ  . ARG B 1 227 ? 49.420 153.374 43.126  1.00 61.98  ? 224 ARG B CZ  1 
ATOM   5902 N NH1 . ARG B 1 227 ? 50.338 154.160 42.581  1.00 61.24  ? 224 ARG B NH1 1 
ATOM   5903 N NH2 . ARG B 1 227 ? 48.883 153.698 44.295  1.00 63.39  ? 224 ARG B NH2 1 
ATOM   5904 N N   . ALA B 1 228 ? 52.399 148.451 38.089  1.00 41.60  ? 225 ALA B N   1 
ATOM   5905 C CA  . ALA B 1 228 ? 52.786 147.944 36.782  1.00 31.42  ? 225 ALA B CA  1 
ATOM   5906 C C   . ALA B 1 228 ? 51.544 147.671 35.950  1.00 34.49  ? 225 ALA B C   1 
ATOM   5907 O O   . ALA B 1 228 ? 50.542 147.166 36.461  1.00 39.36  ? 225 ALA B O   1 
ATOM   5908 C CB  . ALA B 1 228 ? 53.627 146.668 36.908  1.00 34.99  ? 225 ALA B CB  1 
ATOM   5909 N N   . VAL B 1 229 ? 51.618 148.017 34.667  1.00 41.06  ? 226 VAL B N   1 
ATOM   5910 C CA  . VAL B 1 229 ? 50.579 147.701 33.695  1.00 31.64  ? 226 VAL B CA  1 
ATOM   5911 C C   . VAL B 1 229 ? 51.238 146.989 32.523  1.00 36.71  ? 226 VAL B C   1 
ATOM   5912 O O   . VAL B 1 229 ? 52.232 147.478 31.976  1.00 37.78  ? 226 VAL B O   1 
ATOM   5913 C CB  . VAL B 1 229 ? 49.831 148.959 33.211  1.00 31.76  ? 226 VAL B CB  1 
ATOM   5914 C CG1 . VAL B 1 229 ? 48.723 148.580 32.238  1.00 31.15  ? 226 VAL B CG1 1 
ATOM   5915 C CG2 . VAL B 1 229 ? 49.275 149.745 34.387  1.00 36.63  ? 226 VAL B CG2 1 
ATOM   5916 N N   . LEU B 1 230 ? 50.691 145.836 32.145  1.00 38.75  ? 227 LEU B N   1 
ATOM   5917 C CA  . LEU B 1 230 ? 51.240 145.016 31.069  1.00 29.54  ? 227 LEU B CA  1 
ATOM   5918 C C   . LEU B 1 230 ? 50.151 144.804 30.026  1.00 32.60  ? 227 LEU B C   1 
ATOM   5919 O O   . LEU B 1 230 ? 49.159 144.115 30.288  1.00 35.93  ? 227 LEU B O   1 
ATOM   5920 C CB  . LEU B 1 230 ? 51.765 143.682 31.601  1.00 29.06  ? 227 LEU B CB  1 
ATOM   5921 C CG  . LEU B 1 230 ? 53.004 143.712 32.504  1.00 23.72  ? 227 LEU B CG  1 
ATOM   5922 C CD1 . LEU B 1 230 ? 52.650 144.051 33.947  1.00 29.34  ? 227 LEU B CD1 1 
ATOM   5923 C CD2 . LEU B 1 230 ? 53.755 142.391 32.430  1.00 24.32  ? 227 LEU B CD2 1 
ATOM   5924 N N   . GLN B 1 231 ? 50.338 145.392 28.847  1.00 33.46  ? 228 GLN B N   1 
ATOM   5925 C CA  . GLN B 1 231 ? 49.359 145.340 27.767  1.00 27.10  ? 228 GLN B CA  1 
ATOM   5926 C C   . GLN B 1 231 ? 49.883 144.414 26.677  1.00 36.75  ? 228 GLN B C   1 
ATOM   5927 O O   . GLN B 1 231 ? 50.879 144.728 26.016  1.00 30.84  ? 228 GLN B O   1 
ATOM   5928 C CB  . GLN B 1 231 ? 49.088 146.737 27.214  1.00 26.50  ? 228 GLN B CB  1 
ATOM   5929 C CG  . GLN B 1 231 ? 48.767 147.779 28.272  1.00 27.86  ? 228 GLN B CG  1 
ATOM   5930 C CD  . GLN B 1 231 ? 48.503 149.146 27.675  1.00 31.80  ? 228 GLN B CD  1 
ATOM   5931 O OE1 . GLN B 1 231 ? 48.335 150.131 28.395  1.00 34.57  ? 228 GLN B OE1 1 
ATOM   5932 N NE2 . GLN B 1 231 ? 48.464 149.214 26.349  1.00 24.63  ? 228 GLN B NE2 1 
ATOM   5933 N N   . SER B 1 232 ? 49.213 143.274 26.496  1.00 22.23  ? 229 SER B N   1 
ATOM   5934 C CA  . SER B 1 232 ? 49.512 142.339 25.409  1.00 21.26  ? 229 SER B CA  1 
ATOM   5935 C C   . SER B 1 232 ? 50.974 141.894 25.436  1.00 20.17  ? 229 SER B C   1 
ATOM   5936 O O   . SER B 1 232 ? 51.657 141.862 24.410  1.00 21.12  ? 229 SER B O   1 
ATOM   5937 C CB  . SER B 1 232 ? 49.154 142.948 24.051  1.00 20.84  ? 229 SER B CB  1 
ATOM   5938 O OG  . SER B 1 232 ? 47.792 143.338 24.008  1.00 26.55  ? 229 SER B OG  1 
ATOM   5939 N N   . GLY B 1 233 ? 51.454 141.547 26.622  1.00 15.56  ? 230 GLY B N   1 
ATOM   5940 C CA  . GLY B 1 233 ? 52.830 141.114 26.762  1.00 18.65  ? 230 GLY B CA  1 
ATOM   5941 C C   . GLY B 1 233 ? 53.116 140.694 28.186  1.00 18.21  ? 230 GLY B C   1 
ATOM   5942 O O   . GLY B 1 233 ? 52.461 141.137 29.135  1.00 26.05  ? 230 GLY B O   1 
ATOM   5943 N N   . ALA B 1 234 ? 54.118 139.827 28.316  1.00 20.49  ? 231 ALA B N   1 
ATOM   5944 C CA  . ALA B 1 234 ? 54.547 139.303 29.603  1.00 23.75  ? 231 ALA B CA  1 
ATOM   5945 C C   . ALA B 1 234 ? 56.009 138.909 29.492  1.00 26.40  ? 231 ALA B C   1 
ATOM   5946 O O   . ALA B 1 234 ? 56.474 138.571 28.397  1.00 28.55  ? 231 ALA B O   1 
ATOM   5947 C CB  . ALA B 1 234 ? 53.700 138.095 30.032  1.00 25.21  ? 231 ALA B CB  1 
ATOM   5948 N N   . PRO B 1 235 ? 56.762 138.946 30.596  1.00 27.31  ? 232 PRO B N   1 
ATOM   5949 C CA  . PRO B 1 235 ? 58.182 138.571 30.518  1.00 25.96  ? 232 PRO B CA  1 
ATOM   5950 C C   . PRO B 1 235 ? 58.412 137.082 30.330  1.00 34.52  ? 232 PRO B C   1 
ATOM   5951 O O   . PRO B 1 235 ? 59.528 136.690 29.966  1.00 32.86  ? 232 PRO B O   1 
ATOM   5952 C CB  . PRO B 1 235 ? 58.745 139.052 31.861  1.00 27.52  ? 232 PRO B CB  1 
ATOM   5953 C CG  . PRO B 1 235 ? 57.577 139.009 32.785  1.00 24.22  ? 232 PRO B CG  1 
ATOM   5954 C CD  . PRO B 1 235 ? 56.381 139.386 31.951  1.00 26.69  ? 232 PRO B CD  1 
ATOM   5955 N N   . ASN B 1 236 ? 57.403 136.243 30.557  1.00 34.86  ? 233 ASN B N   1 
ATOM   5956 C CA  . ASN B 1 236 ? 57.568 134.796 30.535  1.00 39.02  ? 233 ASN B CA  1 
ATOM   5957 C C   . ASN B 1 236 ? 57.191 134.171 29.197  1.00 37.13  ? 233 ASN B C   1 
ATOM   5958 O O   . ASN B 1 236 ? 57.128 132.941 29.096  1.00 48.66  ? 233 ASN B O   1 
ATOM   5959 C CB  . ASN B 1 236 ? 56.752 134.159 31.663  1.00 26.24  ? 233 ASN B CB  1 
ATOM   5960 C CG  . ASN B 1 236 ? 55.301 134.603 31.658  1.00 34.07  ? 233 ASN B CG  1 
ATOM   5961 O OD1 . ASN B 1 236 ? 54.988 135.741 32.009  1.00 36.49  ? 233 ASN B OD1 1 
ATOM   5962 N ND2 . ASN B 1 236 ? 54.406 133.701 31.271  1.00 32.81  ? 233 ASN B ND2 1 
ATOM   5963 N N   . GLY B 1 237 ? 56.949 134.981 28.170  1.00 44.94  ? 234 GLY B N   1 
ATOM   5964 C CA  . GLY B 1 237 ? 56.580 134.471 26.871  1.00 49.79  ? 234 GLY B CA  1 
ATOM   5965 C C   . GLY B 1 237 ? 57.712 133.718 26.203  1.00 48.58  ? 234 GLY B C   1 
ATOM   5966 O O   . GLY B 1 237 ? 58.878 133.823 26.597  1.00 54.63  ? 234 GLY B O   1 
ATOM   5967 N N   . PRO B 1 238 ? 57.387 132.933 25.171  1.00 38.16  ? 235 PRO B N   1 
ATOM   5968 C CA  . PRO B 1 238 ? 58.427 132.178 24.456  1.00 32.74  ? 235 PRO B CA  1 
ATOM   5969 C C   . PRO B 1 238 ? 59.299 133.031 23.550  1.00 31.63  ? 235 PRO B C   1 
ATOM   5970 O O   . PRO B 1 238 ? 60.208 132.493 22.908  1.00 33.38  ? 235 PRO B O   1 
ATOM   5971 C CB  . PRO B 1 238 ? 57.613 131.167 23.638  1.00 27.59  ? 235 PRO B CB  1 
ATOM   5972 C CG  . PRO B 1 238 ? 56.321 131.870 23.385  1.00 30.73  ? 235 PRO B CG  1 
ATOM   5973 C CD  . PRO B 1 238 ? 56.042 132.669 24.632  1.00 29.48  ? 235 PRO B CD  1 
ATOM   5974 N N   . TRP B 1 239 ? 59.051 134.339 23.478  1.00 31.93  ? 236 TRP B N   1 
ATOM   5975 C CA  . TRP B 1 239 ? 59.803 135.240 22.620  1.00 33.56  ? 236 TRP B CA  1 
ATOM   5976 C C   . TRP B 1 239 ? 60.567 136.315 23.376  1.00 32.22  ? 236 TRP B C   1 
ATOM   5977 O O   . TRP B 1 239 ? 61.469 136.927 22.793  1.00 34.36  ? 236 TRP B O   1 
ATOM   5978 C CB  . TRP B 1 239 ? 58.859 135.932 21.624  1.00 25.71  ? 236 TRP B CB  1 
ATOM   5979 C CG  . TRP B 1 239 ? 57.708 136.601 22.310  1.00 35.28  ? 236 TRP B CG  1 
ATOM   5980 C CD1 . TRP B 1 239 ? 56.477 136.065 22.557  1.00 29.51  ? 236 TRP B CD1 1 
ATOM   5981 C CD2 . TRP B 1 239 ? 57.688 137.923 22.861  1.00 32.65  ? 236 TRP B CD2 1 
ATOM   5982 N NE1 . TRP B 1 239 ? 55.689 136.975 23.219  1.00 30.32  ? 236 TRP B NE1 1 
ATOM   5983 C CE2 . TRP B 1 239 ? 56.409 138.124 23.418  1.00 35.26  ? 236 TRP B CE2 1 
ATOM   5984 C CE3 . TRP B 1 239 ? 58.624 138.960 22.931  1.00 29.81  ? 236 TRP B CE3 1 
ATOM   5985 C CZ2 . TRP B 1 239 ? 56.044 139.317 24.037  1.00 33.50  ? 236 TRP B CZ2 1 
ATOM   5986 C CZ3 . TRP B 1 239 ? 58.260 140.142 23.548  1.00 33.58  ? 236 TRP B CZ3 1 
ATOM   5987 C CH2 . TRP B 1 239 ? 56.981 140.312 24.092  1.00 30.16  ? 236 TRP B CH2 1 
ATOM   5988 N N   . ALA B 1 240 ? 60.239 136.561 24.646  1.00 32.81  ? 237 ALA B N   1 
ATOM   5989 C CA  . ALA B 1 240 ? 60.784 137.705 25.365  1.00 23.12  ? 237 ALA B CA  1 
ATOM   5990 C C   . ALA B 1 240 ? 62.180 137.460 25.917  1.00 32.85  ? 237 ALA B C   1 
ATOM   5991 O O   . ALA B 1 240 ? 62.881 138.427 26.232  1.00 39.98  ? 237 ALA B O   1 
ATOM   5992 C CB  . ALA B 1 240 ? 59.845 138.102 26.505  1.00 23.74  ? 237 ALA B CB  1 
ATOM   5993 N N   . THR B 1 241 ? 62.600 136.205 26.051  1.00 26.94  ? 238 THR B N   1 
ATOM   5994 C CA  . THR B 1 241 ? 63.913 135.882 26.587  1.00 27.65  ? 238 THR B CA  1 
ATOM   5995 C C   . THR B 1 241 ? 64.601 134.867 25.685  1.00 27.47  ? 238 THR B C   1 
ATOM   5996 O O   . THR B 1 241 ? 63.993 134.283 24.785  1.00 28.83  ? 238 THR B O   1 
ATOM   5997 C CB  . THR B 1 241 ? 63.825 135.339 28.020  1.00 30.86  ? 238 THR B CB  1 
ATOM   5998 O OG1 . THR B 1 241 ? 62.984 134.179 28.046  1.00 31.88  ? 238 THR B OG1 1 
ATOM   5999 C CG2 . THR B 1 241 ? 63.263 136.393 28.956  1.00 30.02  ? 238 THR B CG2 1 
ATOM   6000 N N   . VAL B 1 242 ? 65.893 134.663 25.943  1.00 26.73  ? 239 VAL B N   1 
ATOM   6001 C CA  . VAL B 1 242 ? 66.698 133.714 25.186  1.00 29.47  ? 239 VAL B CA  1 
ATOM   6002 C C   . VAL B 1 242 ? 67.804 133.197 26.097  1.00 35.96  ? 239 VAL B C   1 
ATOM   6003 O O   . VAL B 1 242 ? 68.233 133.878 27.033  1.00 40.35  ? 239 VAL B O   1 
ATOM   6004 C CB  . VAL B 1 242 ? 67.270 134.355 23.897  1.00 35.20  ? 239 VAL B CB  1 
ATOM   6005 C CG1 . VAL B 1 242 ? 68.450 135.268 24.215  1.00 31.41  ? 239 VAL B CG1 1 
ATOM   6006 C CG2 . VAL B 1 242 ? 67.656 133.286 22.887  1.00 44.86  ? 239 VAL B CG2 1 
ATOM   6007 N N   . GLY B 1 243 ? 68.254 131.969 25.825  1.00 40.70  ? 240 GLY B N   1 
ATOM   6008 C CA  . GLY B 1 243 ? 69.301 131.363 26.619  1.00 37.63  ? 240 GLY B CA  1 
ATOM   6009 C C   . GLY B 1 243 ? 70.679 131.906 26.288  1.00 43.09  ? 240 GLY B C   1 
ATOM   6010 O O   . GLY B 1 243 ? 70.898 132.550 25.262  1.00 43.52  ? 240 GLY B O   1 
ATOM   6011 N N   . MET B 1 244 ? 71.625 131.629 27.190  1.00 41.35  ? 241 MET B N   1 
ATOM   6012 C CA  . MET B 1 244 ? 72.986 132.125 27.008  1.00 47.69  ? 241 MET B CA  1 
ATOM   6013 C C   . MET B 1 244 ? 73.639 131.512 25.776  1.00 47.51  ? 241 MET B C   1 
ATOM   6014 O O   . MET B 1 244 ? 74.301 132.213 25.001  1.00 45.51  ? 241 MET B O   1 
ATOM   6015 C CB  . MET B 1 244 ? 73.825 131.838 28.254  1.00 46.47  ? 241 MET B CB  1 
ATOM   6016 C CG  . MET B 1 244 ? 73.305 132.490 29.522  1.00 53.85  ? 241 MET B CG  1 
ATOM   6017 S SD  . MET B 1 244 ? 74.510 132.466 30.864  1.00 78.17  ? 241 MET B SD  1 
ATOM   6018 C CE  . MET B 1 244 ? 74.930 130.726 30.916  1.00 60.30  ? 241 MET B CE  1 
ATOM   6019 N N   . GLY B 1 245 ? 73.463 130.205 25.577  1.00 49.01  ? 242 GLY B N   1 
ATOM   6020 C CA  . GLY B 1 245 ? 74.070 129.555 24.427  1.00 39.15  ? 242 GLY B CA  1 
ATOM   6021 C C   . GLY B 1 245 ? 73.503 130.045 23.108  1.00 40.73  ? 242 GLY B C   1 
ATOM   6022 O O   . GLY B 1 245 ? 74.239 130.225 22.134  1.00 41.55  ? 242 GLY B O   1 
ATOM   6023 N N   . GLU B 1 246 ? 72.189 130.272 23.057  1.00 42.40  ? 243 GLU B N   1 
ATOM   6024 C CA  . GLU B 1 246 ? 71.574 130.743 21.820  1.00 47.00  ? 243 GLU B CA  1 
ATOM   6025 C C   . GLU B 1 246 ? 71.904 132.207 21.560  1.00 40.18  ? 243 GLU B C   1 
ATOM   6026 O O   . GLU B 1 246 ? 72.114 132.605 20.407  1.00 35.38  ? 243 GLU B O   1 
ATOM   6027 C CB  . GLU B 1 246 ? 70.061 130.527 21.871  1.00 37.78  ? 243 GLU B CB  1 
ATOM   6028 C CG  . GLU B 1 246 ? 69.313 131.003 20.632  1.00 41.20  ? 243 GLU B CG  1 
ATOM   6029 C CD  . GLU B 1 246 ? 69.672 130.223 19.379  1.00 39.85  ? 243 GLU B CD  1 
ATOM   6030 O OE1 . GLU B 1 246 ? 70.264 129.128 19.494  1.00 53.78  ? 243 GLU B OE1 1 
ATOM   6031 O OE2 . GLU B 1 246 ? 69.357 130.708 18.273  1.00 44.89  ? 243 GLU B OE2 1 
ATOM   6032 N N   . ALA B 1 247 ? 71.957 133.024 22.615  1.00 40.28  ? 244 ALA B N   1 
ATOM   6033 C CA  . ALA B 1 247 ? 72.346 134.420 22.443  1.00 33.95  ? 244 ALA B CA  1 
ATOM   6034 C C   . ALA B 1 247 ? 73.782 134.540 21.950  1.00 38.31  ? 244 ALA B C   1 
ATOM   6035 O O   . ALA B 1 247 ? 74.098 135.450 21.175  1.00 41.00  ? 244 ALA B O   1 
ATOM   6036 C CB  . ALA B 1 247 ? 72.168 135.184 23.755  1.00 38.88  ? 244 ALA B CB  1 
ATOM   6037 N N   . ARG B 1 248 ? 74.661 133.634 22.384  1.00 31.68  ? 245 ARG B N   1 
ATOM   6038 C CA  . ARG B 1 248 ? 76.036 133.646 21.899  1.00 39.13  ? 245 ARG B CA  1 
ATOM   6039 C C   . ARG B 1 248 ? 76.109 133.219 20.438  1.00 39.94  ? 245 ARG B C   1 
ATOM   6040 O O   . ARG B 1 248 ? 76.894 133.777 19.661  1.00 42.90  ? 245 ARG B O   1 
ATOM   6041 C CB  . ARG B 1 248 ? 76.907 132.742 22.771  1.00 39.39  ? 245 ARG B CB  1 
ATOM   6042 C CG  . ARG B 1 248 ? 78.305 132.503 22.221  1.00 37.04  ? 245 ARG B CG  1 
ATOM   6043 C CD  . ARG B 1 248 ? 79.186 131.799 23.239  1.00 39.59  ? 245 ARG B CD  1 
ATOM   6044 N NE  . ARG B 1 248 ? 79.379 132.615 24.433  1.00 46.73  ? 245 ARG B NE  1 
ATOM   6045 C CZ  . ARG B 1 248 ? 80.374 133.483 24.592  1.00 50.79  ? 245 ARG B CZ  1 
ATOM   6046 N NH1 . ARG B 1 248 ? 81.273 133.648 23.631  1.00 40.55  ? 245 ARG B NH1 1 
ATOM   6047 N NH2 . ARG B 1 248 ? 80.470 134.185 25.713  1.00 46.94  ? 245 ARG B NH2 1 
ATOM   6048 N N   . ARG B 1 249 ? 75.296 132.236 20.044  1.00 41.09  ? 246 ARG B N   1 
ATOM   6049 C CA  . ARG B 1 249 ? 75.301 131.785 18.656  1.00 42.77  ? 246 ARG B CA  1 
ATOM   6050 C C   . ARG B 1 249 ? 74.798 132.875 17.718  1.00 39.51  ? 246 ARG B C   1 
ATOM   6051 O O   . ARG B 1 249 ? 75.348 133.065 16.626  1.00 41.91  ? 246 ARG B O   1 
ATOM   6052 C CB  . ARG B 1 249 ? 74.452 130.523 18.508  1.00 43.01  ? 246 ARG B CB  1 
ATOM   6053 C CG  . ARG B 1 249 ? 74.537 129.891 17.128  1.00 41.10  ? 246 ARG B CG  1 
ATOM   6054 C CD  . ARG B 1 249 ? 73.339 129.003 16.841  1.00 46.82  ? 246 ARG B CD  1 
ATOM   6055 N NE  . ARG B 1 249 ? 72.096 129.768 16.791  1.00 53.83  ? 246 ARG B NE  1 
ATOM   6056 C CZ  . ARG B 1 249 ? 71.682 130.452 15.729  1.00 50.19  ? 246 ARG B CZ  1 
ATOM   6057 N NH1 . ARG B 1 249 ? 72.414 130.472 14.623  1.00 47.88  ? 246 ARG B NH1 1 
ATOM   6058 N NH2 . ARG B 1 249 ? 70.537 131.120 15.772  1.00 45.10  ? 246 ARG B NH2 1 
ATOM   6059 N N   . ARG B 1 250 ? 73.752 133.600 18.124  1.00 36.42  ? 247 ARG B N   1 
ATOM   6060 C CA  . ARG B 1 250 ? 73.223 134.667 17.281  1.00 40.21  ? 247 ARG B CA  1 
ATOM   6061 C C   . ARG B 1 250 ? 74.206 135.825 17.172  1.00 34.54  ? 247 ARG B C   1 
ATOM   6062 O O   . ARG B 1 250 ? 74.381 136.397 16.090  1.00 40.76  ? 247 ARG B O   1 
ATOM   6063 C CB  . ARG B 1 250 ? 71.880 135.151 17.827  1.00 37.55  ? 247 ARG B CB  1 
ATOM   6064 C CG  . ARG B 1 250 ? 70.805 134.078 17.862  1.00 36.42  ? 247 ARG B CG  1 
ATOM   6065 C CD  . ARG B 1 250 ? 69.494 134.622 18.402  1.00 38.16  ? 247 ARG B CD  1 
ATOM   6066 N NE  . ARG B 1 250 ? 68.472 133.584 18.502  1.00 40.20  ? 247 ARG B NE  1 
ATOM   6067 C CZ  . ARG B 1 250 ? 67.218 133.805 18.882  1.00 42.80  ? 247 ARG B CZ  1 
ATOM   6068 N NH1 . ARG B 1 250 ? 66.825 135.031 19.198  1.00 35.54  ? 247 ARG B NH1 1 
ATOM   6069 N NH2 . ARG B 1 250 ? 66.355 132.800 18.945  1.00 46.75  ? 247 ARG B NH2 1 
ATOM   6070 N N   . ALA B 1 251 ? 74.857 136.185 18.281  1.00 35.99  ? 248 ALA B N   1 
ATOM   6071 C CA  . ALA B 1 251 ? 75.851 137.252 18.241  1.00 37.64  ? 248 ALA B CA  1 
ATOM   6072 C C   . ALA B 1 251 ? 77.051 136.857 17.391  1.00 34.50  ? 248 ALA B C   1 
ATOM   6073 O O   . ALA B 1 251 ? 77.618 137.693 16.677  1.00 41.01  ? 248 ALA B O   1 
ATOM   6074 C CB  . ALA B 1 251 ? 76.294 137.614 19.658  1.00 28.32  ? 248 ALA B CB  1 
ATOM   6075 N N   . THR B 1 252 ? 77.450 135.584 17.450  1.00 40.83  ? 249 THR B N   1 
ATOM   6076 C CA  . THR B 1 252 ? 78.595 135.131 16.668  1.00 39.26  ? 249 THR B CA  1 
ATOM   6077 C C   . THR B 1 252 ? 78.276 135.116 15.177  1.00 37.98  ? 249 THR B C   1 
ATOM   6078 O O   . THR B 1 252 ? 79.118 135.494 14.354  1.00 38.62  ? 249 THR B O   1 
ATOM   6079 C CB  . THR B 1 252 ? 79.038 133.745 17.138  1.00 34.00  ? 249 THR B CB  1 
ATOM   6080 O OG1 . THR B 1 252 ? 79.375 133.797 18.530  1.00 37.67  ? 249 THR B OG1 1 
ATOM   6081 C CG2 . THR B 1 252 ? 80.252 133.272 16.350  1.00 29.63  ? 249 THR B CG2 1 
ATOM   6082 N N   . GLN B 1 253 ? 77.064 134.691 14.809  1.00 35.06  ? 250 GLN B N   1 
ATOM   6083 C CA  . GLN B 1 253 ? 76.708 134.650 13.395  1.00 36.73  ? 250 GLN B CA  1 
ATOM   6084 C C   . GLN B 1 253 ? 76.533 136.053 12.827  1.00 38.12  ? 250 GLN B C   1 
ATOM   6085 O O   . GLN B 1 253 ? 76.876 136.303 11.666  1.00 37.38  ? 250 GLN B O   1 
ATOM   6086 C CB  . GLN B 1 253 ? 75.438 133.827 13.183  1.00 41.24  ? 250 GLN B CB  1 
ATOM   6087 C CG  . GLN B 1 253 ? 75.169 133.514 11.719  1.00 45.35  ? 250 GLN B CG  1 
ATOM   6088 C CD  . GLN B 1 253 ? 73.782 132.957 11.477  1.00 59.78  ? 250 GLN B CD  1 
ATOM   6089 O OE1 . GLN B 1 253 ? 72.970 132.858 12.397  1.00 66.37  ? 250 GLN B OE1 1 
ATOM   6090 N NE2 . GLN B 1 253 ? 73.501 132.593 10.231  1.00 62.37  ? 250 GLN B NE2 1 
ATOM   6091 N N   . LEU B 1 254 ? 75.991 136.980 13.623  1.00 39.65  ? 251 LEU B N   1 
ATOM   6092 C CA  . LEU B 1 254 ? 75.924 138.369 13.182  1.00 39.07  ? 251 LEU B CA  1 
ATOM   6093 C C   . LEU B 1 254 ? 77.317 138.919 12.911  1.00 37.37  ? 251 LEU B C   1 
ATOM   6094 O O   . LEU B 1 254 ? 77.535 139.619 11.915  1.00 37.29  ? 251 LEU B O   1 
ATOM   6095 C CB  . LEU B 1 254 ? 75.206 139.230 14.221  1.00 35.79  ? 251 LEU B CB  1 
ATOM   6096 C CG  . LEU B 1 254 ? 75.137 140.715 13.850  1.00 34.59  ? 251 LEU B CG  1 
ATOM   6097 C CD1 . LEU B 1 254 ? 74.245 140.923 12.634  1.00 26.21  ? 251 LEU B CD1 1 
ATOM   6098 C CD2 . LEU B 1 254 ? 74.667 141.565 15.020  1.00 38.89  ? 251 LEU B CD2 1 
ATOM   6099 N N   . ALA B 1 255 ? 78.273 138.608 13.790  1.00 35.77  ? 252 ALA B N   1 
ATOM   6100 C CA  . ALA B 1 255 ? 79.660 138.978 13.535  1.00 40.91  ? 252 ALA B CA  1 
ATOM   6101 C C   . ALA B 1 255 ? 80.163 138.350 12.242  1.00 36.60  ? 252 ALA B C   1 
ATOM   6102 O O   . ALA B 1 255 ? 80.844 139.009 11.446  1.00 41.06  ? 252 ALA B O   1 
ATOM   6103 C CB  . ALA B 1 255 ? 80.537 138.559 14.714  1.00 41.22  ? 252 ALA B CB  1 
ATOM   6104 N N   . HIS B 1 256 ? 79.832 137.077 12.011  1.00 36.65  ? 253 HIS B N   1 
ATOM   6105 C CA  . HIS B 1 256 ? 80.253 136.413 10.781  1.00 32.34  ? 253 HIS B CA  1 
ATOM   6106 C C   . HIS B 1 256 ? 79.648 137.082 9.554   1.00 36.81  ? 253 HIS B C   1 
ATOM   6107 O O   . HIS B 1 256 ? 80.334 137.277 8.543   1.00 42.88  ? 253 HIS B O   1 
ATOM   6108 C CB  . HIS B 1 256 ? 79.868 134.934 10.823  1.00 36.42  ? 253 HIS B CB  1 
ATOM   6109 C CG  . HIS B 1 256 ? 80.077 134.220 9.524   1.00 42.15  ? 253 HIS B CG  1 
ATOM   6110 N ND1 . HIS B 1 256 ? 81.317 133.791 9.102   1.00 36.71  ? 253 HIS B ND1 1 
ATOM   6111 C CD2 . HIS B 1 256 ? 79.205 133.869 8.549   1.00 38.37  ? 253 HIS B CD2 1 
ATOM   6112 C CE1 . HIS B 1 256 ? 81.199 133.202 7.925   1.00 40.84  ? 253 HIS B CE1 1 
ATOM   6113 N NE2 . HIS B 1 256 ? 79.928 133.236 7.567   1.00 35.05  ? 253 HIS B NE2 1 
ATOM   6114 N N   . LEU B 1 257 ? 78.365 137.444 9.625   1.00 32.86  ? 254 LEU B N   1 
ATOM   6115 C CA  . LEU B 1 257 ? 77.690 138.035 8.475   1.00 36.77  ? 254 LEU B CA  1 
ATOM   6116 C C   . LEU B 1 257 ? 78.247 139.404 8.103   1.00 39.13  ? 254 LEU B C   1 
ATOM   6117 O O   . LEU B 1 257 ? 78.080 139.831 6.955   1.00 40.95  ? 254 LEU B O   1 
ATOM   6118 C CB  . LEU B 1 257 ? 76.189 138.135 8.748   1.00 32.95  ? 254 LEU B CB  1 
ATOM   6119 C CG  . LEU B 1 257 ? 75.433 136.805 8.734   1.00 36.07  ? 254 LEU B CG  1 
ATOM   6120 C CD1 . LEU B 1 257 ? 74.026 136.980 9.274   1.00 35.44  ? 254 LEU B CD1 1 
ATOM   6121 C CD2 . LEU B 1 257 ? 75.401 136.219 7.328   1.00 29.34  ? 254 LEU B CD2 1 
ATOM   6122 N N   . VAL B 1 258 ? 78.901 140.099 9.033   1.00 39.18  ? 255 VAL B N   1 
ATOM   6123 C CA  . VAL B 1 258 ? 79.504 141.395 8.745   1.00 39.86  ? 255 VAL B CA  1 
ATOM   6124 C C   . VAL B 1 258 ? 81.021 141.297 8.607   1.00 38.68  ? 255 VAL B C   1 
ATOM   6125 O O   . VAL B 1 258 ? 81.695 142.325 8.471   1.00 41.55  ? 255 VAL B O   1 
ATOM   6126 C CB  . VAL B 1 258 ? 79.118 142.438 9.807   1.00 38.58  ? 255 VAL B CB  1 
ATOM   6127 C CG1 . VAL B 1 258 ? 77.608 142.635 9.833   1.00 36.25  ? 255 VAL B CG1 1 
ATOM   6128 C CG2 . VAL B 1 258 ? 79.634 142.025 11.176  1.00 39.09  ? 255 VAL B CG2 1 
ATOM   6129 N N   . GLY B 1 259 ? 81.573 140.087 8.637   1.00 42.54  ? 256 GLY B N   1 
ATOM   6130 C CA  . GLY B 1 259 ? 83.000 139.899 8.465   1.00 38.21  ? 256 GLY B CA  1 
ATOM   6131 C C   . GLY B 1 259 ? 83.813 139.881 9.738   1.00 45.16  ? 256 GLY B C   1 
ATOM   6132 O O   . GLY B 1 259 ? 85.004 140.209 9.696   1.00 46.33  ? 256 GLY B O   1 
ATOM   6133 N N   . CYS B 1 260 ? 83.216 139.513 10.867  1.00 36.97  ? 257 CYS B N   1 
ATOM   6134 C CA  . CYS B 1 260 ? 83.939 139.454 12.134  1.00 47.12  ? 257 CYS B CA  1 
ATOM   6135 C C   . CYS B 1 260 ? 83.986 138.027 12.674  1.00 54.35  ? 257 CYS B C   1 
ATOM   6136 O O   . CYS B 1 260 ? 82.955 137.363 12.769  1.00 58.09  ? 257 CYS B O   1 
ATOM   6137 C CB  . CYS B 1 260 ? 83.294 140.380 13.167  1.00 50.82  ? 257 CYS B CB  1 
ATOM   6138 S SG  . CYS B 1 260 ? 83.389 142.142 12.781  1.00 51.53  ? 257 CYS B SG  1 
ATOM   6139 N N   . PRO B 1 261 ? 85.188 137.546 13.025  1.00 66.16  ? 258 PRO B N   1 
ATOM   6140 C CA  . PRO B 1 261 ? 86.458 138.262 12.877  1.00 67.22  ? 258 PRO B CA  1 
ATOM   6141 C C   . PRO B 1 261 ? 87.003 138.148 11.457  1.00 73.93  ? 258 PRO B C   1 
ATOM   6142 O O   . PRO B 1 261 ? 86.547 137.278 10.712  1.00 73.24  ? 258 PRO B O   1 
ATOM   6143 C CB  . PRO B 1 261 ? 87.368 137.550 13.876  1.00 70.87  ? 258 PRO B CB  1 
ATOM   6144 C CG  . PRO B 1 261 ? 86.870 136.147 13.866  1.00 70.04  ? 258 PRO B CG  1 
ATOM   6145 C CD  . PRO B 1 261 ? 85.376 136.230 13.662  1.00 63.87  ? 258 PRO B CD  1 
ATOM   6146 N N   . PRO B 1 262 ? 87.948 139.011 11.085  1.00 75.66  ? 259 PRO B N   1 
ATOM   6147 C CA  . PRO B 1 262 ? 88.561 138.899 9.757   1.00 77.35  ? 259 PRO B CA  1 
ATOM   6148 C C   . PRO B 1 262 ? 89.222 137.542 9.566   1.00 91.87  ? 259 PRO B C   1 
ATOM   6149 O O   . PRO B 1 262 ? 89.514 136.820 10.522  1.00 99.99  ? 259 PRO B O   1 
ATOM   6150 C CB  . PRO B 1 262 ? 89.596 140.030 9.744   1.00 72.25  ? 259 PRO B CB  1 
ATOM   6151 C CG  . PRO B 1 262 ? 89.100 141.007 10.752  1.00 71.55  ? 259 PRO B CG  1 
ATOM   6152 C CD  . PRO B 1 262 ? 88.440 140.188 11.822  1.00 75.28  ? 259 PRO B CD  1 
ATOM   6153 N N   . GLY B 1 263 ? 89.448 137.198 8.301   1.00 93.12  ? 260 GLY B N   1 
ATOM   6154 C CA  . GLY B 1 263 ? 90.078 135.939 7.958   1.00 93.69  ? 260 GLY B CA  1 
ATOM   6155 C C   . GLY B 1 263 ? 91.425 135.762 8.626   1.00 98.63  ? 260 GLY B C   1 
ATOM   6156 O O   . GLY B 1 263 ? 92.352 136.542 8.388   1.00 101.48 ? 260 GLY B O   1 
ATOM   6157 N N   . GLY B 1 264 ? 91.539 134.748 9.477   1.00 99.53  ? 261 GLY B N   1 
ATOM   6158 C CA  . GLY B 1 264 ? 92.773 134.513 10.200  1.00 97.28  ? 261 GLY B CA  1 
ATOM   6159 C C   . GLY B 1 264 ? 92.917 135.313 11.476  1.00 99.30  ? 261 GLY B C   1 
ATOM   6160 O O   . GLY B 1 264 ? 94.017 135.788 11.785  1.00 99.51  ? 261 GLY B O   1 
ATOM   6161 N N   . THR B 1 265 ? 91.834 135.474 12.233  1.00 97.44  ? 262 THR B N   1 
ATOM   6162 C CA  . THR B 1 265 ? 91.841 136.234 13.474  1.00 98.19  ? 262 THR B CA  1 
ATOM   6163 C C   . THR B 1 265 ? 91.198 135.406 14.576  1.00 97.50  ? 262 THR B C   1 
ATOM   6164 O O   . THR B 1 265 ? 90.193 134.726 14.344  1.00 89.95  ? 262 THR B O   1 
ATOM   6165 C CB  . THR B 1 265 ? 91.095 137.572 13.311  1.00 95.38  ? 262 THR B CB  1 
ATOM   6166 O OG1 . THR B 1 265 ? 91.783 138.395 12.361  1.00 95.94  ? 262 THR B OG1 1 
ATOM   6167 C CG2 . THR B 1 265 ? 90.999 138.311 14.639  1.00 85.56  ? 262 THR B CG2 1 
ATOM   6168 N N   . GLY B 1 266 ? 91.791 135.450 15.768  1.00 102.14 ? 263 GLY B N   1 
ATOM   6169 C CA  . GLY B 1 266 ? 91.194 134.774 16.904  1.00 95.74  ? 263 GLY B CA  1 
ATOM   6170 C C   . GLY B 1 266 ? 89.807 135.308 17.208  1.00 93.37  ? 263 GLY B C   1 
ATOM   6171 O O   . GLY B 1 266 ? 89.518 136.494 17.033  1.00 84.35  ? 263 GLY B O   1 
ATOM   6172 N N   . GLY B 1 267 ? 88.937 134.415 17.670  1.00 94.13  ? 264 GLY B N   1 
ATOM   6173 C CA  . GLY B 1 267 ? 87.544 134.767 17.855  1.00 80.49  ? 264 GLY B CA  1 
ATOM   6174 C C   . GLY B 1 267 ? 87.053 134.751 19.287  1.00 78.98  ? 264 GLY B C   1 
ATOM   6175 O O   . GLY B 1 267 ? 85.942 134.283 19.555  1.00 74.38  ? 264 GLY B O   1 
ATOM   6176 N N   . ASN B 1 268 ? 87.857 135.257 20.219  1.00 70.07  ? 265 ASN B N   1 
ATOM   6177 C CA  . ASN B 1 268 ? 87.375 135.395 21.583  1.00 64.13  ? 265 ASN B CA  1 
ATOM   6178 C C   . ASN B 1 268 ? 86.407 136.576 21.673  1.00 60.17  ? 265 ASN B C   1 
ATOM   6179 O O   . ASN B 1 268 ? 86.206 137.326 20.713  1.00 57.71  ? 265 ASN B O   1 
ATOM   6180 C CB  . ASN B 1 268 ? 88.544 135.550 22.561  1.00 59.62  ? 265 ASN B CB  1 
ATOM   6181 C CG  . ASN B 1 268 ? 89.418 136.756 22.261  1.00 69.20  ? 265 ASN B CG  1 
ATOM   6182 O OD1 . ASN B 1 268 ? 88.930 137.875 22.112  1.00 68.44  ? 265 ASN B OD1 1 
ATOM   6183 N ND2 . ASN B 1 268 ? 90.724 136.529 22.177  1.00 68.30  ? 265 ASN B ND2 1 
ATOM   6184 N N   . ASP B 1 269 ? 85.804 136.737 22.853  1.00 57.03  ? 266 ASP B N   1 
ATOM   6185 C CA  . ASP B 1 269 ? 84.746 137.731 23.009  1.00 53.82  ? 266 ASP B CA  1 
ATOM   6186 C C   . ASP B 1 269 ? 85.269 139.149 22.806  1.00 55.04  ? 266 ASP B C   1 
ATOM   6187 O O   . ASP B 1 269 ? 84.588 139.987 22.202  1.00 57.39  ? 266 ASP B O   1 
ATOM   6188 C CB  . ASP B 1 269 ? 84.091 137.589 24.382  1.00 52.25  ? 266 ASP B CB  1 
ATOM   6189 C CG  . ASP B 1 269 ? 83.303 136.302 24.520  1.00 53.00  ? 266 ASP B CG  1 
ATOM   6190 O OD1 . ASP B 1 269 ? 82.910 135.731 23.480  1.00 55.95  ? 266 ASP B OD1 1 
ATOM   6191 O OD2 . ASP B 1 269 ? 83.074 135.862 25.665  1.00 58.13  ? 266 ASP B OD2 1 
ATOM   6192 N N   . THR B 1 270 ? 86.476 139.438 23.298  1.00 58.90  ? 267 THR B N   1 
ATOM   6193 C CA  . THR B 1 270 ? 87.020 140.788 23.169  1.00 62.74  ? 267 THR B CA  1 
ATOM   6194 C C   . THR B 1 270 ? 87.311 141.130 21.711  1.00 52.60  ? 267 THR B C   1 
ATOM   6195 O O   . THR B 1 270 ? 86.963 142.218 21.238  1.00 45.01  ? 267 THR B O   1 
ATOM   6196 C CB  . THR B 1 270 ? 88.284 140.934 24.018  1.00 57.27  ? 267 THR B CB  1 
ATOM   6197 O OG1 . THR B 1 270 ? 89.132 139.796 23.823  1.00 71.65  ? 267 THR B OG1 1 
ATOM   6198 C CG2 . THR B 1 270 ? 87.929 141.054 25.491  1.00 45.82  ? 267 THR B CG2 1 
ATOM   6199 N N   . GLU B 1 271 ? 87.951 140.212 20.982  1.00 52.30  ? 268 GLU B N   1 
ATOM   6200 C CA  . GLU B 1 271 ? 88.238 140.463 19.573  1.00 60.85  ? 268 GLU B CA  1 
ATOM   6201 C C   . GLU B 1 271 ? 86.963 140.523 18.742  1.00 57.65  ? 268 GLU B C   1 
ATOM   6202 O O   . GLU B 1 271 ? 86.918 141.229 17.728  1.00 49.21  ? 268 GLU B O   1 
ATOM   6203 C CB  . GLU B 1 271 ? 89.176 139.388 19.024  1.00 57.68  ? 268 GLU B CB  1 
ATOM   6204 C CG  . GLU B 1 271 ? 90.498 139.272 19.766  1.00 72.95  ? 268 GLU B CG  1 
ATOM   6205 C CD  . GLU B 1 271 ? 91.369 138.147 19.239  1.00 87.92  ? 268 GLU B CD  1 
ATOM   6206 O OE1 . GLU B 1 271 ? 92.155 138.390 18.300  1.00 88.14  ? 268 GLU B OE1 1 
ATOM   6207 O OE2 . GLU B 1 271 ? 91.261 137.016 19.760  1.00 81.63  ? 268 GLU B OE2 1 
ATOM   6208 N N   . LEU B 1 272 ? 85.920 139.800 19.155  1.00 56.69  ? 269 LEU B N   1 
ATOM   6209 C CA  . LEU B 1 272 ? 84.680 139.787 18.386  1.00 50.55  ? 269 LEU B CA  1 
ATOM   6210 C C   . LEU B 1 272 ? 83.915 141.095 18.548  1.00 50.01  ? 269 LEU B C   1 
ATOM   6211 O O   . LEU B 1 272 ? 83.419 141.656 17.565  1.00 50.83  ? 269 LEU B O   1 
ATOM   6212 C CB  . LEU B 1 272 ? 83.816 138.600 18.810  1.00 48.22  ? 269 LEU B CB  1 
ATOM   6213 C CG  . LEU B 1 272 ? 82.834 138.065 17.767  1.00 56.50  ? 269 LEU B CG  1 
ATOM   6214 C CD1 . LEU B 1 272 ? 83.590 137.564 16.549  1.00 46.24  ? 269 LEU B CD1 1 
ATOM   6215 C CD2 . LEU B 1 272 ? 81.971 136.959 18.354  1.00 36.17  ? 269 LEU B CD2 1 
ATOM   6216 N N   . VAL B 1 273 ? 83.810 141.597 19.781  1.00 45.09  ? 270 VAL B N   1 
ATOM   6217 C CA  . VAL B 1 273 ? 83.087 142.844 20.017  1.00 43.45  ? 270 VAL B CA  1 
ATOM   6218 C C   . VAL B 1 273 ? 83.851 144.025 19.432  1.00 43.12  ? 270 VAL B C   1 
ATOM   6219 O O   . VAL B 1 273 ? 83.252 144.953 18.873  1.00 49.69  ? 270 VAL B O   1 
ATOM   6220 C CB  . VAL B 1 273 ? 82.819 143.030 21.522  1.00 47.05  ? 270 VAL B CB  1 
ATOM   6221 C CG1 . VAL B 1 273 ? 82.157 144.374 21.783  1.00 46.49  ? 270 VAL B CG1 1 
ATOM   6222 C CG2 . VAL B 1 273 ? 81.951 141.901 22.049  1.00 41.22  ? 270 VAL B CG2 1 
ATOM   6223 N N   . ALA B 1 274 ? 85.182 144.014 19.551  1.00 45.51  ? 271 ALA B N   1 
ATOM   6224 C CA  . ALA B 1 274 ? 85.985 145.096 18.991  1.00 41.12  ? 271 ALA B CA  1 
ATOM   6225 C C   . ALA B 1 274 ? 85.786 145.207 17.485  1.00 49.82  ? 271 ALA B C   1 
ATOM   6226 O O   . ALA B 1 274 ? 85.719 146.315 16.939  1.00 48.90  ? 271 ALA B O   1 
ATOM   6227 C CB  . ALA B 1 274 ? 87.461 144.882 19.324  1.00 41.24  ? 271 ALA B CB  1 
ATOM   6228 N N   . CYS B 1 275 ? 85.685 144.067 16.796  1.00 46.39  ? 272 CYS B N   1 
ATOM   6229 C CA  . CYS B 1 275 ? 85.402 144.091 15.365  1.00 37.27  ? 272 CYS B CA  1 
ATOM   6230 C C   . CYS B 1 275 ? 83.986 144.584 15.093  1.00 44.13  ? 272 CYS B C   1 
ATOM   6231 O O   . CYS B 1 275 ? 83.749 145.301 14.113  1.00 45.50  ? 272 CYS B O   1 
ATOM   6232 C CB  . CYS B 1 275 ? 85.614 142.699 14.770  1.00 42.05  ? 272 CYS B CB  1 
ATOM   6233 S SG  . CYS B 1 275 ? 85.364 142.579 12.983  1.00 62.21  ? 272 CYS B SG  1 
ATOM   6234 N N   . LEU B 1 276 ? 83.031 144.211 15.950  1.00 40.64  ? 273 LEU B N   1 
ATOM   6235 C CA  . LEU B 1 276 ? 81.659 144.676 15.780  1.00 38.95  ? 273 LEU B CA  1 
ATOM   6236 C C   . LEU B 1 276 ? 81.540 146.179 16.000  1.00 42.82  ? 273 LEU B C   1 
ATOM   6237 O O   . LEU B 1 276 ? 80.685 146.827 15.386  1.00 36.79  ? 273 LEU B O   1 
ATOM   6238 C CB  . LEU B 1 276 ? 80.726 143.930 16.736  1.00 37.78  ? 273 LEU B CB  1 
ATOM   6239 C CG  . LEU B 1 276 ? 80.325 142.506 16.348  1.00 48.94  ? 273 LEU B CG  1 
ATOM   6240 C CD1 . LEU B 1 276 ? 79.478 141.875 17.442  1.00 39.01  ? 273 LEU B CD1 1 
ATOM   6241 C CD2 . LEU B 1 276 ? 79.577 142.510 15.025  1.00 34.35  ? 273 LEU B CD2 1 
ATOM   6242 N N   . ARG B 1 277 ? 82.382 146.749 16.864  1.00 41.31  ? 274 ARG B N   1 
ATOM   6243 C CA  . ARG B 1 277 ? 82.322 148.178 17.144  1.00 41.21  ? 274 ARG B CA  1 
ATOM   6244 C C   . ARG B 1 277 ? 82.837 149.033 15.995  1.00 36.23  ? 274 ARG B C   1 
ATOM   6245 O O   . ARG B 1 277 ? 82.593 150.244 15.992  1.00 44.97  ? 274 ARG B O   1 
ATOM   6246 C CB  . ARG B 1 277 ? 83.107 148.493 18.417  1.00 43.02  ? 274 ARG B CB  1 
ATOM   6247 C CG  . ARG B 1 277 ? 82.315 148.257 19.689  1.00 37.70  ? 274 ARG B CG  1 
ATOM   6248 C CD  . ARG B 1 277 ? 83.211 148.173 20.909  1.00 41.20  ? 274 ARG B CD  1 
ATOM   6249 N NE  . ARG B 1 277 ? 82.428 148.058 22.135  1.00 52.19  ? 274 ARG B NE  1 
ATOM   6250 C CZ  . ARG B 1 277 ? 82.866 147.486 23.251  1.00 49.24  ? 274 ARG B CZ  1 
ATOM   6251 N NH1 . ARG B 1 277 ? 84.083 146.961 23.296  1.00 50.61  ? 274 ARG B NH1 1 
ATOM   6252 N NH2 . ARG B 1 277 ? 82.083 147.426 24.319  1.00 47.62  ? 274 ARG B NH2 1 
ATOM   6253 N N   . THR B 1 278 ? 83.535 148.442 15.027  1.00 33.22  ? 275 THR B N   1 
ATOM   6254 C CA  . THR B 1 278 ? 84.051 149.198 13.894  1.00 38.38  ? 275 THR B CA  1 
ATOM   6255 C C   . THR B 1 278 ? 83.072 149.272 12.731  1.00 35.32  ? 275 THR B C   1 
ATOM   6256 O O   . THR B 1 278 ? 83.260 150.102 11.834  1.00 44.12  ? 275 THR B O   1 
ATOM   6257 C CB  . THR B 1 278 ? 85.366 148.584 13.400  1.00 38.80  ? 275 THR B CB  1 
ATOM   6258 O OG1 . THR B 1 278 ? 85.115 147.279 12.867  1.00 41.33  ? 275 THR B OG1 1 
ATOM   6259 C CG2 . THR B 1 278 ? 86.364 148.476 14.543  1.00 33.12  ? 275 THR B CG2 1 
ATOM   6260 N N   . ARG B 1 279 ? 82.042 148.433 12.724  1.00 36.19  ? 276 ARG B N   1 
ATOM   6261 C CA  . ARG B 1 279 ? 81.096 148.408 11.618  1.00 36.13  ? 276 ARG B CA  1 
ATOM   6262 C C   . ARG B 1 279 ? 80.078 149.537 11.764  1.00 38.09  ? 276 ARG B C   1 
ATOM   6263 O O   . ARG B 1 279 ? 79.646 149.843 12.879  1.00 35.62  ? 276 ARG B O   1 
ATOM   6264 C CB  . ARG B 1 279 ? 80.369 147.066 11.563  1.00 32.86  ? 276 ARG B CB  1 
ATOM   6265 C CG  . ARG B 1 279 ? 81.276 145.870 11.319  1.00 37.15  ? 276 ARG B CG  1 
ATOM   6266 C CD  . ARG B 1 279 ? 81.858 145.893 9.916   1.00 41.15  ? 276 ARG B CD  1 
ATOM   6267 N NE  . ARG B 1 279 ? 82.689 144.724 9.649   1.00 46.98  ? 276 ARG B NE  1 
ATOM   6268 C CZ  . ARG B 1 279 ? 83.995 144.665 9.887   1.00 51.77  ? 276 ARG B CZ  1 
ATOM   6269 N NH1 . ARG B 1 279 ? 84.625 145.713 10.399  1.00 54.85  ? 276 ARG B NH1 1 
ATOM   6270 N NH2 . ARG B 1 279 ? 84.672 143.558 9.613   1.00 58.93  ? 276 ARG B NH2 1 
ATOM   6271 N N   . PRO B 1 280 ? 79.690 150.176 10.660  1.00 36.04  ? 277 PRO B N   1 
ATOM   6272 C CA  . PRO B 1 280 ? 78.595 151.149 10.722  1.00 39.23  ? 277 PRO B CA  1 
ATOM   6273 C C   . PRO B 1 280 ? 77.327 150.504 11.259  1.00 36.81  ? 277 PRO B C   1 
ATOM   6274 O O   . PRO B 1 280 ? 77.061 149.322 11.033  1.00 35.53  ? 277 PRO B O   1 
ATOM   6275 C CB  . PRO B 1 280 ? 78.427 151.592 9.264   1.00 30.80  ? 277 PRO B CB  1 
ATOM   6276 C CG  . PRO B 1 280 ? 79.757 151.331 8.638   1.00 28.60  ? 277 PRO B CG  1 
ATOM   6277 C CD  . PRO B 1 280 ? 80.297 150.106 9.320   1.00 28.08  ? 277 PRO B CD  1 
ATOM   6278 N N   . ALA B 1 281 ? 76.543 151.304 11.986  1.00 32.36  ? 278 ALA B N   1 
ATOM   6279 C CA  . ALA B 1 281 ? 75.355 150.779 12.651  1.00 34.77  ? 278 ALA B CA  1 
ATOM   6280 C C   . ALA B 1 281 ? 74.377 150.173 11.653  1.00 32.10  ? 278 ALA B C   1 
ATOM   6281 O O   . ALA B 1 281 ? 73.729 149.161 11.945  1.00 29.51  ? 278 ALA B O   1 
ATOM   6282 C CB  . ALA B 1 281 ? 74.679 151.884 13.462  1.00 25.43  ? 278 ALA B CB  1 
ATOM   6283 N N   . GLN B 1 282 ? 74.262 150.773 10.466  1.00 32.29  ? 279 GLN B N   1 
ATOM   6284 C CA  . GLN B 1 282 ? 73.330 150.256 9.469   1.00 29.97  ? 279 GLN B CA  1 
ATOM   6285 C C   . GLN B 1 282 ? 73.753 148.883 8.959   1.00 30.68  ? 279 GLN B C   1 
ATOM   6286 O O   . GLN B 1 282 ? 72.898 148.082 8.565   1.00 31.41  ? 279 GLN B O   1 
ATOM   6287 C CB  . GLN B 1 282 ? 73.205 151.244 8.308   1.00 29.91  ? 279 GLN B CB  1 
ATOM   6288 C CG  . GLN B 1 282 ? 72.094 150.911 7.325   1.00 24.03  ? 279 GLN B CG  1 
ATOM   6289 C CD  . GLN B 1 282 ? 70.719 150.951 7.965   1.00 31.53  ? 279 GLN B CD  1 
ATOM   6290 O OE1 . GLN B 1 282 ? 70.329 151.953 8.565   1.00 31.50  ? 279 GLN B OE1 1 
ATOM   6291 N NE2 . GLN B 1 282 ? 69.978 149.855 7.845   1.00 25.93  ? 279 GLN B NE2 1 
ATOM   6292 N N   . VAL B 1 283 ? 75.055 148.590 8.965   1.00 32.63  ? 280 VAL B N   1 
ATOM   6293 C CA  . VAL B 1 283 ? 75.525 147.288 8.501   1.00 30.57  ? 280 VAL B CA  1 
ATOM   6294 C C   . VAL B 1 283 ? 75.055 146.183 9.440   1.00 34.35  ? 280 VAL B C   1 
ATOM   6295 O O   . VAL B 1 283 ? 74.630 145.110 8.993   1.00 37.51  ? 280 VAL B O   1 
ATOM   6296 C CB  . VAL B 1 283 ? 77.057 147.294 8.349   1.00 30.17  ? 280 VAL B CB  1 
ATOM   6297 C CG1 . VAL B 1 283 ? 77.565 145.902 8.005   1.00 29.52  ? 280 VAL B CG1 1 
ATOM   6298 C CG2 . VAL B 1 283 ? 77.479 148.296 7.284   1.00 22.82  ? 280 VAL B CG2 1 
ATOM   6299 N N   . LEU B 1 284 ? 75.119 146.423 10.753  1.00 35.11  ? 281 LEU B N   1 
ATOM   6300 C CA  . LEU B 1 284 ? 74.629 145.433 11.707  1.00 25.69  ? 281 LEU B CA  1 
ATOM   6301 C C   . LEU B 1 284 ? 73.126 145.230 11.566  1.00 39.18  ? 281 LEU B C   1 
ATOM   6302 O O   . LEU B 1 284 ? 72.632 144.100 11.665  1.00 33.50  ? 281 LEU B O   1 
ATOM   6303 C CB  . LEU B 1 284 ? 74.978 145.852 13.135  1.00 23.24  ? 281 LEU B CB  1 
ATOM   6304 C CG  . LEU B 1 284 ? 76.457 145.999 13.497  1.00 35.17  ? 281 LEU B CG  1 
ATOM   6305 C CD1 . LEU B 1 284 ? 76.614 146.245 14.992  1.00 26.61  ? 281 LEU B CD1 1 
ATOM   6306 C CD2 . LEU B 1 284 ? 77.246 144.774 13.064  1.00 21.83  ? 281 LEU B CD2 1 
ATOM   6307 N N   . VAL B 1 285 ? 72.382 146.315 11.334  1.00 29.62  ? 282 VAL B N   1 
ATOM   6308 C CA  . VAL B 1 285 ? 70.933 146.213 11.188  1.00 33.68  ? 282 VAL B CA  1 
ATOM   6309 C C   . VAL B 1 285 ? 70.576 145.400 9.949   1.00 32.84  ? 282 VAL B C   1 
ATOM   6310 O O   . VAL B 1 285 ? 69.630 144.603 9.961   1.00 35.49  ? 282 VAL B O   1 
ATOM   6311 C CB  . VAL B 1 285 ? 70.300 147.617 11.145  1.00 31.49  ? 282 VAL B CB  1 
ATOM   6312 C CG1 . VAL B 1 285 ? 68.803 147.526 10.890  1.00 33.58  ? 282 VAL B CG1 1 
ATOM   6313 C CG2 . VAL B 1 285 ? 70.577 148.367 12.439  1.00 30.45  ? 282 VAL B CG2 1 
ATOM   6314 N N   . ASN B 1 286 ? 71.338 145.575 8.867   1.00 28.83  ? 283 ASN B N   1 
ATOM   6315 C CA  . ASN B 1 286 ? 71.031 144.925 7.597   1.00 24.79  ? 283 ASN B CA  1 
ATOM   6316 C C   . ASN B 1 286 ? 71.180 143.409 7.640   1.00 33.44  ? 283 ASN B C   1 
ATOM   6317 O O   . ASN B 1 286 ? 70.828 142.747 6.658   1.00 33.40  ? 283 ASN B O   1 
ATOM   6318 C CB  . ASN B 1 286 ? 71.921 145.500 6.493   1.00 30.67  ? 283 ASN B CB  1 
ATOM   6319 C CG  . ASN B 1 286 ? 71.520 146.906 6.097   1.00 32.71  ? 283 ASN B CG  1 
ATOM   6320 O OD1 . ASN B 1 286 ? 70.577 147.474 6.650   1.00 30.91  ? 283 ASN B OD1 1 
ATOM   6321 N ND2 . ASN B 1 286 ? 72.238 147.480 5.140   1.00 34.26  ? 283 ASN B ND2 1 
ATOM   6322 N N   . HIS B 1 287 ? 71.688 142.842 8.737   1.00 36.48  ? 284 HIS B N   1 
ATOM   6323 C CA  . HIS B 1 287 ? 71.821 141.395 8.867   1.00 38.03  ? 284 HIS B CA  1 
ATOM   6324 C C   . HIS B 1 287 ? 71.171 140.880 10.146  1.00 43.06  ? 284 HIS B C   1 
ATOM   6325 O O   . HIS B 1 287 ? 71.536 139.804 10.630  1.00 42.55  ? 284 HIS B O   1 
ATOM   6326 C CB  . HIS B 1 287 ? 73.293 140.979 8.823   1.00 33.06  ? 284 HIS B CB  1 
ATOM   6327 C CG  . HIS B 1 287 ? 73.992 141.368 7.558   1.00 38.49  ? 284 HIS B CG  1 
ATOM   6328 N ND1 . HIS B 1 287 ? 73.845 140.666 6.381   1.00 37.13  ? 284 HIS B ND1 1 
ATOM   6329 C CD2 . HIS B 1 287 ? 74.841 142.386 7.285   1.00 31.44  ? 284 HIS B CD2 1 
ATOM   6330 C CE1 . HIS B 1 287 ? 74.573 141.235 5.437   1.00 31.73  ? 284 HIS B CE1 1 
ATOM   6331 N NE2 . HIS B 1 287 ? 75.188 142.281 5.960   1.00 32.54  ? 284 HIS B NE2 1 
ATOM   6332 N N   . GLU B 1 288 ? 70.207 141.622 10.694  1.00 38.69  ? 285 GLU B N   1 
ATOM   6333 C CA  . GLU B 1 288 ? 69.646 141.272 11.994  1.00 40.55  ? 285 GLU B CA  1 
ATOM   6334 C C   . GLU B 1 288 ? 68.763 140.033 11.904  1.00 44.91  ? 285 GLU B C   1 
ATOM   6335 O O   . GLU B 1 288 ? 68.875 139.119 12.729  1.00 42.97  ? 285 GLU B O   1 
ATOM   6336 C CB  . GLU B 1 288 ? 68.860 142.456 12.554  1.00 34.56  ? 285 GLU B CB  1 
ATOM   6337 C CG  . GLU B 1 288 ? 68.471 142.309 14.012  1.00 45.82  ? 285 GLU B CG  1 
ATOM   6338 C CD  . GLU B 1 288 ? 67.688 143.499 14.524  1.00 43.86  ? 285 GLU B CD  1 
ATOM   6339 O OE1 . GLU B 1 288 ? 66.473 143.575 14.248  1.00 43.18  ? 285 GLU B OE1 1 
ATOM   6340 O OE2 . GLU B 1 288 ? 68.292 144.365 15.191  1.00 52.79  ? 285 GLU B OE2 1 
ATOM   6341 N N   . TRP B 1 289 ? 67.877 139.982 10.910  1.00 40.99  ? 286 TRP B N   1 
ATOM   6342 C CA  . TRP B 1 289 ? 66.947 138.867 10.789  1.00 52.99  ? 286 TRP B CA  1 
ATOM   6343 C C   . TRP B 1 289 ? 67.596 137.601 10.245  1.00 51.92  ? 286 TRP B C   1 
ATOM   6344 O O   . TRP B 1 289 ? 66.946 136.550 10.234  1.00 61.52  ? 286 TRP B O   1 
ATOM   6345 C CB  . TRP B 1 289 ? 65.764 139.266 9.902   1.00 49.45  ? 286 TRP B CB  1 
ATOM   6346 C CG  . TRP B 1 289 ? 64.952 140.379 10.488  1.00 56.99  ? 286 TRP B CG  1 
ATOM   6347 C CD1 . TRP B 1 289 ? 64.990 141.697 10.135  1.00 52.01  ? 286 TRP B CD1 1 
ATOM   6348 C CD2 . TRP B 1 289 ? 63.993 140.275 11.547  1.00 58.72  ? 286 TRP B CD2 1 
ATOM   6349 N NE1 . TRP B 1 289 ? 64.109 142.418 10.904  1.00 45.08  ? 286 TRP B NE1 1 
ATOM   6350 C CE2 . TRP B 1 289 ? 63.485 141.569 11.779  1.00 48.18  ? 286 TRP B CE2 1 
ATOM   6351 C CE3 . TRP B 1 289 ? 63.513 139.213 12.320  1.00 56.04  ? 286 TRP B CE3 1 
ATOM   6352 C CZ2 . TRP B 1 289 ? 62.521 141.830 12.752  1.00 42.66  ? 286 TRP B CZ2 1 
ATOM   6353 C CZ3 . TRP B 1 289 ? 62.553 139.472 13.283  1.00 49.28  ? 286 TRP B CZ3 1 
ATOM   6354 C CH2 . TRP B 1 289 ? 62.070 140.771 13.493  1.00 45.44  ? 286 TRP B CH2 1 
ATOM   6355 N N   . HIS B 1 290 ? 68.853 137.667 9.812   1.00 48.21  ? 287 HIS B N   1 
ATOM   6356 C CA  . HIS B 1 290 ? 69.546 136.519 9.245   1.00 48.57  ? 287 HIS B CA  1 
ATOM   6357 C C   . HIS B 1 290 ? 70.203 135.635 10.301  1.00 47.80  ? 287 HIS B C   1 
ATOM   6358 O O   . HIS B 1 290 ? 71.004 134.764 9.947   1.00 60.09  ? 287 HIS B O   1 
ATOM   6359 C CB  . HIS B 1 290 ? 70.603 136.986 8.239   1.00 52.90  ? 287 HIS B CB  1 
ATOM   6360 C CG  . HIS B 1 290 ? 70.040 137.732 7.071   1.00 67.90  ? 287 HIS B CG  1 
ATOM   6361 N ND1 . HIS B 1 290 ? 70.815 138.525 6.252   1.00 61.01  ? 287 HIS B ND1 1 
ATOM   6362 C CD2 . HIS B 1 290 ? 68.780 137.804 6.580   1.00 69.35  ? 287 HIS B CD2 1 
ATOM   6363 C CE1 . HIS B 1 290 ? 70.057 139.055 5.309   1.00 76.32  ? 287 HIS B CE1 1 
ATOM   6364 N NE2 . HIS B 1 290 ? 68.818 138.633 5.485   1.00 86.02  ? 287 HIS B NE2 1 
ATOM   6365 N N   . VAL B 1 291 ? 69.892 135.836 11.581  1.00 42.45  ? 288 VAL B N   1 
ATOM   6366 C CA  . VAL B 1 291 ? 70.452 135.026 12.655  1.00 47.23  ? 288 VAL B CA  1 
ATOM   6367 C C   . VAL B 1 291 ? 69.399 134.208 13.384  1.00 43.89  ? 288 VAL B C   1 
ATOM   6368 O O   . VAL B 1 291 ? 69.749 133.432 14.280  1.00 45.50  ? 288 VAL B O   1 
ATOM   6369 C CB  . VAL B 1 291 ? 71.245 135.887 13.660  1.00 37.71  ? 288 VAL B CB  1 
ATOM   6370 C CG1 . VAL B 1 291 ? 72.301 136.715 12.940  1.00 48.70  ? 288 VAL B CG1 1 
ATOM   6371 C CG2 . VAL B 1 291 ? 70.309 136.774 14.459  1.00 38.26  ? 288 VAL B CG2 1 
ATOM   6372 N N   . LEU B 1 292 ? 68.123 134.356 13.037  1.00 47.32  ? 289 LEU B N   1 
ATOM   6373 C CA  . LEU B 1 292 ? 67.095 133.526 13.646  1.00 47.53  ? 289 LEU B CA  1 
ATOM   6374 C C   . LEU B 1 292 ? 67.299 132.068 13.240  1.00 59.32  ? 289 LEU B C   1 
ATOM   6375 O O   . LEU B 1 292 ? 67.707 131.790 12.107  1.00 47.92  ? 289 LEU B O   1 
ATOM   6376 C CB  . LEU B 1 292 ? 65.700 133.997 13.234  1.00 47.67  ? 289 LEU B CB  1 
ATOM   6377 C CG  . LEU B 1 292 ? 65.186 135.266 13.916  1.00 47.11  ? 289 LEU B CG  1 
ATOM   6378 C CD1 . LEU B 1 292 ? 63.796 135.619 13.411  1.00 40.43  ? 289 LEU B CD1 1 
ATOM   6379 C CD2 . LEU B 1 292 ? 65.183 135.098 15.428  1.00 41.66  ? 289 LEU B CD2 1 
ATOM   6380 N N   . PRO B 1 293 ? 67.031 131.117 14.139  1.00 71.72  ? 290 PRO B N   1 
ATOM   6381 C CA  . PRO B 1 293 ? 67.332 129.711 13.816  1.00 67.56  ? 290 PRO B CA  1 
ATOM   6382 C C   . PRO B 1 293 ? 66.509 129.150 12.667  1.00 74.01  ? 290 PRO B C   1 
ATOM   6383 O O   . PRO B 1 293 ? 67.037 128.363 11.872  1.00 90.65  ? 290 PRO B O   1 
ATOM   6384 C CB  . PRO B 1 293 ? 67.044 128.981 15.138  1.00 57.56  ? 290 PRO B CB  1 
ATOM   6385 C CG  . PRO B 1 293 ? 66.132 129.889 15.894  1.00 62.68  ? 290 PRO B CG  1 
ATOM   6386 C CD  . PRO B 1 293 ? 66.540 131.279 15.518  1.00 60.62  ? 290 PRO B CD  1 
ATOM   6387 N N   . GLN B 1 294 ? 65.238 129.532 12.543  1.00 72.37  ? 291 GLN B N   1 
ATOM   6388 C CA  . GLN B 1 294 ? 64.383 128.969 11.508  1.00 81.84  ? 291 GLN B CA  1 
ATOM   6389 C C   . GLN B 1 294 ? 63.294 129.963 11.127  1.00 74.50  ? 291 GLN B C   1 
ATOM   6390 O O   . GLN B 1 294 ? 63.081 130.978 11.795  1.00 69.21  ? 291 GLN B O   1 
ATOM   6391 C CB  . GLN B 1 294 ? 63.762 127.642 11.961  1.00 85.47  ? 291 GLN B CB  1 
ATOM   6392 C CG  . GLN B 1 294 ? 64.589 126.420 11.599  1.00 105.72 ? 291 GLN B CG  1 
ATOM   6393 C CD  . GLN B 1 294 ? 64.225 125.198 12.418  1.00 116.06 ? 291 GLN B CD  1 
ATOM   6394 O OE1 . GLN B 1 294 ? 63.326 125.244 13.258  1.00 118.69 ? 291 GLN B OE1 1 
ATOM   6395 N NE2 . GLN B 1 294 ? 64.929 124.097 12.181  1.00 109.38 ? 291 GLN B NE2 1 
ATOM   6396 N N   . GLU B 1 295 ? 62.611 129.649 10.025  1.00 68.82  ? 292 GLU B N   1 
ATOM   6397 C CA  . GLU B 1 295 ? 61.460 130.427 9.583   1.00 61.27  ? 292 GLU B CA  1 
ATOM   6398 C C   . GLU B 1 295 ? 60.384 130.436 10.660  1.00 58.63  ? 292 GLU B C   1 
ATOM   6399 O O   . GLU B 1 295 ? 59.974 129.381 11.153  1.00 57.92  ? 292 GLU B O   1 
ATOM   6400 C CB  . GLU B 1 295 ? 60.905 129.836 8.286   1.00 59.60  ? 292 GLU B CB  1 
ATOM   6401 C CG  . GLU B 1 295 ? 59.554 130.385 7.858   1.00 70.60  ? 292 GLU B CG  1 
ATOM   6402 C CD  . GLU B 1 295 ? 58.900 129.530 6.788   1.00 76.16  ? 292 GLU B CD  1 
ATOM   6403 O OE1 . GLU B 1 295 ? 59.218 128.323 6.716   1.00 73.74  ? 292 GLU B OE1 1 
ATOM   6404 O OE2 . GLU B 1 295 ? 58.074 130.061 6.017   1.00 72.05  ? 292 GLU B OE2 1 
ATOM   6405 N N   . SER B 1 296 ? 59.923 131.630 11.023  1.00 62.50  ? 293 SER B N   1 
ATOM   6406 C CA  . SER B 1 296 ? 58.979 131.757 12.124  1.00 54.69  ? 293 SER B CA  1 
ATOM   6407 C C   . SER B 1 296 ? 58.360 133.146 12.106  1.00 50.70  ? 293 SER B C   1 
ATOM   6408 O O   . SER B 1 296 ? 58.872 134.069 11.466  1.00 53.05  ? 293 SER B O   1 
ATOM   6409 C CB  . SER B 1 296 ? 59.659 131.504 13.474  1.00 49.98  ? 293 SER B CB  1 
ATOM   6410 O OG  . SER B 1 296 ? 60.650 132.483 13.733  1.00 50.02  ? 293 SER B OG  1 
ATOM   6411 N N   . VAL B 1 297 ? 57.244 133.272 12.819  1.00 41.75  ? 294 VAL B N   1 
ATOM   6412 C CA  . VAL B 1 297 ? 56.658 134.559 13.158  1.00 37.04  ? 294 VAL B CA  1 
ATOM   6413 C C   . VAL B 1 297 ? 56.719 134.710 14.672  1.00 34.65  ? 294 VAL B C   1 
ATOM   6414 O O   . VAL B 1 297 ? 56.806 133.729 15.415  1.00 43.56  ? 294 VAL B O   1 
ATOM   6415 C CB  . VAL B 1 297 ? 55.208 134.709 12.651  1.00 35.24  ? 294 VAL B CB  1 
ATOM   6416 C CG1 . VAL B 1 297 ? 55.165 134.644 11.132  1.00 33.48  ? 294 VAL B CG1 1 
ATOM   6417 C CG2 . VAL B 1 297 ? 54.316 133.640 13.264  1.00 27.46  ? 294 VAL B CG2 1 
ATOM   6418 N N   . PHE B 1 298 ? 56.690 135.965 15.122  1.00 47.29  ? 295 PHE B N   1 
ATOM   6419 C CA  . PHE B 1 298 ? 56.696 136.298 16.548  1.00 43.95  ? 295 PHE B CA  1 
ATOM   6420 C C   . PHE B 1 298 ? 57.969 135.801 17.232  1.00 35.13  ? 295 PHE B C   1 
ATOM   6421 O O   . PHE B 1 298 ? 57.950 135.368 18.385  1.00 34.47  ? 295 PHE B O   1 
ATOM   6422 C CB  . PHE B 1 298 ? 55.446 135.752 17.243  1.00 30.35  ? 295 PHE B CB  1 
ATOM   6423 C CG  . PHE B 1 298 ? 54.855 136.688 18.257  1.00 34.05  ? 295 PHE B CG  1 
ATOM   6424 C CD1 . PHE B 1 298 ? 55.653 137.294 19.214  1.00 32.11  ? 295 PHE B CD1 1 
ATOM   6425 C CD2 . PHE B 1 298 ? 53.500 136.970 18.246  1.00 30.71  ? 295 PHE B CD2 1 
ATOM   6426 C CE1 . PHE B 1 298 ? 55.106 138.155 20.145  1.00 35.32  ? 295 PHE B CE1 1 
ATOM   6427 C CE2 . PHE B 1 298 ? 52.949 137.830 19.174  1.00 28.02  ? 295 PHE B CE2 1 
ATOM   6428 C CZ  . PHE B 1 298 ? 53.753 138.425 20.123  1.00 30.10  ? 295 PHE B CZ  1 
ATOM   6429 N N   . ARG B 1 299 ? 59.086 135.861 16.510  1.00 29.96  ? 296 ARG B N   1 
ATOM   6430 C CA  . ARG B 1 299 ? 60.402 135.544 17.047  1.00 31.99  ? 296 ARG B CA  1 
ATOM   6431 C C   . ARG B 1 299 ? 61.378 136.631 16.624  1.00 36.68  ? 296 ARG B C   1 
ATOM   6432 O O   . ARG B 1 299 ? 61.346 137.093 15.479  1.00 34.77  ? 296 ARG B O   1 
ATOM   6433 C CB  . ARG B 1 299 ? 60.895 134.173 16.570  1.00 22.31  ? 296 ARG B CB  1 
ATOM   6434 C CG  . ARG B 1 299 ? 60.099 132.998 17.117  1.00 37.03  ? 296 ARG B CG  1 
ATOM   6435 C CD  . ARG B 1 299 ? 60.150 132.949 18.637  1.00 32.89  ? 296 ARG B CD  1 
ATOM   6436 N NE  . ARG B 1 299 ? 59.463 131.776 19.169  1.00 37.26  ? 296 ARG B NE  1 
ATOM   6437 C CZ  . ARG B 1 299 ? 58.187 131.760 19.539  1.00 39.21  ? 296 ARG B CZ  1 
ATOM   6438 N NH1 . ARG B 1 299 ? 57.450 132.858 19.439  1.00 29.18  ? 296 ARG B NH1 1 
ATOM   6439 N NH2 . ARG B 1 299 ? 57.646 130.645 20.012  1.00 41.75  ? 296 ARG B NH2 1 
ATOM   6440 N N   . PHE B 1 300 ? 62.244 137.037 17.550  1.00 26.53  ? 297 PHE B N   1 
ATOM   6441 C CA  . PHE B 1 300 ? 63.109 138.188 17.344  1.00 29.97  ? 297 PHE B CA  1 
ATOM   6442 C C   . PHE B 1 300 ? 64.544 137.835 17.707  1.00 32.24  ? 297 PHE B C   1 
ATOM   6443 O O   . PHE B 1 300 ? 64.798 137.035 18.613  1.00 42.90  ? 297 PHE B O   1 
ATOM   6444 C CB  . PHE B 1 300 ? 62.610 139.383 18.158  1.00 27.54  ? 297 PHE B CB  1 
ATOM   6445 C CG  . PHE B 1 300 ? 61.120 139.564 18.091  1.00 26.33  ? 297 PHE B CG  1 
ATOM   6446 C CD1 . PHE B 1 300 ? 60.523 140.075 16.951  1.00 28.32  ? 297 PHE B CD1 1 
ATOM   6447 C CD2 . PHE B 1 300 ? 60.315 139.195 19.155  1.00 26.04  ? 297 PHE B CD2 1 
ATOM   6448 C CE1 . PHE B 1 300 ? 59.151 140.230 16.878  1.00 24.65  ? 297 PHE B CE1 1 
ATOM   6449 C CE2 . PHE B 1 300 ? 58.942 139.347 19.088  1.00 22.97  ? 297 PHE B CE2 1 
ATOM   6450 C CZ  . PHE B 1 300 ? 58.360 139.866 17.948  1.00 27.05  ? 297 PHE B CZ  1 
ATOM   6451 N N   . SER B 1 301 ? 65.482 138.455 16.987  1.00 32.32  ? 298 SER B N   1 
ATOM   6452 C CA  . SER B 1 301 ? 66.877 138.026 17.035  1.00 29.03  ? 298 SER B CA  1 
ATOM   6453 C C   . SER B 1 301 ? 67.514 138.326 18.385  1.00 32.85  ? 298 SER B C   1 
ATOM   6454 O O   . SER B 1 301 ? 68.078 137.432 19.028  1.00 37.12  ? 298 SER B O   1 
ATOM   6455 C CB  . SER B 1 301 ? 67.663 138.698 15.909  1.00 31.48  ? 298 SER B CB  1 
ATOM   6456 O OG  . SER B 1 301 ? 67.149 138.330 14.641  1.00 46.73  ? 298 SER B OG  1 
ATOM   6457 N N   . PHE B 1 302 ? 67.446 139.577 18.831  1.00 32.10  ? 299 PHE B N   1 
ATOM   6458 C CA  . PHE B 1 302 ? 68.142 140.015 20.036  1.00 31.49  ? 299 PHE B CA  1 
ATOM   6459 C C   . PHE B 1 302 ? 67.114 140.461 21.066  1.00 27.64  ? 299 PHE B C   1 
ATOM   6460 O O   . PHE B 1 302 ? 66.466 141.500 20.900  1.00 25.97  ? 299 PHE B O   1 
ATOM   6461 C CB  . PHE B 1 302 ? 69.139 141.124 19.707  1.00 27.78  ? 299 PHE B CB  1 
ATOM   6462 C CG  . PHE B 1 302 ? 70.163 140.719 18.685  1.00 31.45  ? 299 PHE B CG  1 
ATOM   6463 C CD1 . PHE B 1 302 ? 71.222 139.897 19.037  1.00 24.77  ? 299 PHE B CD1 1 
ATOM   6464 C CD2 . PHE B 1 302 ? 70.058 141.142 17.370  1.00 30.46  ? 299 PHE B CD2 1 
ATOM   6465 C CE1 . PHE B 1 302 ? 72.162 139.513 18.100  1.00 27.29  ? 299 PHE B CE1 1 
ATOM   6466 C CE2 . PHE B 1 302 ? 70.997 140.762 16.428  1.00 32.18  ? 299 PHE B CE2 1 
ATOM   6467 C CZ  . PHE B 1 302 ? 72.050 139.946 16.793  1.00 19.21  ? 299 PHE B CZ  1 
ATOM   6468 N N   . VAL B 1 303 ? 66.969 139.668 22.123  1.00 24.94  ? 300 VAL B N   1 
ATOM   6469 C CA  . VAL B 1 303 ? 65.991 139.899 23.183  1.00 23.93  ? 300 VAL B CA  1 
ATOM   6470 C C   . VAL B 1 303 ? 66.726 139.811 24.518  1.00 28.59  ? 300 VAL B C   1 
ATOM   6471 O O   . VAL B 1 303 ? 67.910 139.445 24.535  1.00 28.34  ? 300 VAL B O   1 
ATOM   6472 C CB  . VAL B 1 303 ? 64.836 138.889 23.094  1.00 32.65  ? 300 VAL B CB  1 
ATOM   6473 C CG1 . VAL B 1 303 ? 64.013 139.132 21.838  1.00 23.62  ? 300 VAL B CG1 1 
ATOM   6474 C CG2 . VAL B 1 303 ? 65.374 137.468 23.116  1.00 24.32  ? 300 VAL B CG2 1 
ATOM   6475 N N   . PRO B 1 304 ? 66.096 140.158 25.643  1.00 22.64  ? 301 PRO B N   1 
ATOM   6476 C CA  . PRO B 1 304 ? 66.762 139.983 26.940  1.00 26.23  ? 301 PRO B CA  1 
ATOM   6477 C C   . PRO B 1 304 ? 67.248 138.554 27.144  1.00 32.06  ? 301 PRO B C   1 
ATOM   6478 O O   . PRO B 1 304 ? 66.550 137.588 26.832  1.00 34.45  ? 301 PRO B O   1 
ATOM   6479 C CB  . PRO B 1 304 ? 65.671 140.358 27.946  1.00 31.21  ? 301 PRO B CB  1 
ATOM   6480 C CG  . PRO B 1 304 ? 64.847 141.357 27.223  1.00 31.87  ? 301 PRO B CG  1 
ATOM   6481 C CD  . PRO B 1 304 ? 64.851 140.939 25.775  1.00 27.54  ? 301 PRO B CD  1 
ATOM   6482 N N   . VAL B 1 305 ? 68.463 138.427 27.671  1.00 28.71  ? 302 VAL B N   1 
ATOM   6483 C CA  . VAL B 1 305 ? 69.097 137.132 27.893  1.00 35.19  ? 302 VAL B CA  1 
ATOM   6484 C C   . VAL B 1 305 ? 69.000 136.782 29.372  1.00 43.70  ? 302 VAL B C   1 
ATOM   6485 O O   . VAL B 1 305 ? 69.077 137.661 30.241  1.00 38.88  ? 302 VAL B O   1 
ATOM   6486 C CB  . VAL B 1 305 ? 70.563 137.141 27.410  1.00 29.07  ? 302 VAL B CB  1 
ATOM   6487 C CG1 . VAL B 1 305 ? 71.404 138.117 28.227  1.00 34.62  ? 302 VAL B CG1 1 
ATOM   6488 C CG2 . VAL B 1 305 ? 71.157 135.738 27.449  1.00 45.01  ? 302 VAL B CG2 1 
ATOM   6489 N N   . VAL B 1 306 ? 68.807 135.497 29.660  1.00 42.88  ? 303 VAL B N   1 
ATOM   6490 C CA  . VAL B 1 306 ? 68.774 134.997 31.031  1.00 48.76  ? 303 VAL B CA  1 
ATOM   6491 C C   . VAL B 1 306 ? 70.219 134.713 31.427  1.00 46.61  ? 303 VAL B C   1 
ATOM   6492 O O   . VAL B 1 306 ? 70.785 133.679 31.069  1.00 53.37  ? 303 VAL B O   1 
ATOM   6493 C CB  . VAL B 1 306 ? 67.889 133.758 31.164  1.00 48.58  ? 303 VAL B CB  1 
ATOM   6494 C CG1 . VAL B 1 306 ? 67.833 133.301 32.614  1.00 40.89  ? 303 VAL B CG1 1 
ATOM   6495 C CG2 . VAL B 1 306 ? 66.492 134.051 30.637  1.00 45.28  ? 303 VAL B CG2 1 
ATOM   6496 N N   . ASP B 1 307 ? 70.817 135.637 32.178  1.00 43.41  ? 304 ASP B N   1 
ATOM   6497 C CA  . ASP B 1 307 ? 72.247 135.618 32.446  1.00 55.42  ? 304 ASP B CA  1 
ATOM   6498 C C   . ASP B 1 307 ? 72.615 135.398 33.904  1.00 59.73  ? 304 ASP B C   1 
ATOM   6499 O O   . ASP B 1 307 ? 73.756 135.011 34.177  1.00 55.54  ? 304 ASP B O   1 
ATOM   6500 C CB  . ASP B 1 307 ? 72.886 136.936 31.982  1.00 54.60  ? 304 ASP B CB  1 
ATOM   6501 C CG  . ASP B 1 307 ? 72.181 138.153 32.551  1.00 58.96  ? 304 ASP B CG  1 
ATOM   6502 O OD1 . ASP B 1 307 ? 71.051 138.000 33.063  1.00 55.77  ? 304 ASP B OD1 1 
ATOM   6503 O OD2 . ASP B 1 307 ? 72.748 139.263 32.480  1.00 65.73  ? 304 ASP B OD2 1 
ATOM   6504 N N   . GLY B 1 308 ? 71.698 135.626 34.841  1.00 59.91  ? 305 GLY B N   1 
ATOM   6505 C CA  . GLY B 1 308 ? 72.034 135.623 36.247  1.00 59.35  ? 305 GLY B CA  1 
ATOM   6506 C C   . GLY B 1 308 ? 72.371 136.984 36.812  1.00 64.17  ? 305 GLY B C   1 
ATOM   6507 O O   . GLY B 1 308 ? 72.589 137.098 38.025  1.00 70.15  ? 305 GLY B O   1 
ATOM   6508 N N   . ASP B 1 309 ? 72.418 138.019 35.973  1.00 64.22  ? 306 ASP B N   1 
ATOM   6509 C CA  . ASP B 1 309 ? 72.718 139.375 36.415  1.00 50.95  ? 306 ASP B CA  1 
ATOM   6510 C C   . ASP B 1 309 ? 71.431 140.182 36.545  1.00 54.42  ? 306 ASP B C   1 
ATOM   6511 O O   . ASP B 1 309 ? 70.910 140.353 37.652  1.00 58.63  ? 306 ASP B O   1 
ATOM   6512 C CB  . ASP B 1 309 ? 73.683 140.050 35.436  1.00 60.69  ? 306 ASP B CB  1 
ATOM   6513 C CG  . ASP B 1 309 ? 74.348 141.282 36.021  1.00 67.85  ? 306 ASP B CG  1 
ATOM   6514 O OD1 . ASP B 1 309 ? 73.857 141.808 37.042  1.00 66.24  ? 306 ASP B OD1 1 
ATOM   6515 O OD2 . ASP B 1 309 ? 75.367 141.729 35.453  1.00 73.63  ? 306 ASP B OD2 1 
ATOM   6516 N N   . PHE B 1 310 ? 70.916 140.685 35.419  1.00 54.81  ? 307 PHE B N   1 
ATOM   6517 C CA  . PHE B 1 310 ? 69.651 141.414 35.449  1.00 45.05  ? 307 PHE B CA  1 
ATOM   6518 C C   . PHE B 1 310 ? 68.505 140.501 35.863  1.00 43.79  ? 307 PHE B C   1 
ATOM   6519 O O   . PHE B 1 310 ? 67.618 140.910 36.622  1.00 45.18  ? 307 PHE B O   1 
ATOM   6520 C CB  . PHE B 1 310 ? 69.373 142.042 34.082  1.00 37.53  ? 307 PHE B CB  1 
ATOM   6521 C CG  . PHE B 1 310 ? 68.225 143.016 34.081  1.00 36.19  ? 307 PHE B CG  1 
ATOM   6522 C CD1 . PHE B 1 310 ? 66.918 142.572 33.954  1.00 38.07  ? 307 PHE B CD1 1 
ATOM   6523 C CD2 . PHE B 1 310 ? 68.454 144.377 34.197  1.00 33.28  ? 307 PHE B CD2 1 
ATOM   6524 C CE1 . PHE B 1 310 ? 65.863 143.465 33.952  1.00 37.98  ? 307 PHE B CE1 1 
ATOM   6525 C CE2 . PHE B 1 310 ? 67.402 145.275 34.192  1.00 37.55  ? 307 PHE B CE2 1 
ATOM   6526 C CZ  . PHE B 1 310 ? 66.105 144.818 34.071  1.00 32.21  ? 307 PHE B CZ  1 
ATOM   6527 N N   . LEU B 1 311 ? 68.503 139.265 35.371  1.00 53.49  ? 308 LEU B N   1 
ATOM   6528 C CA  . LEU B 1 311 ? 67.524 138.251 35.749  1.00 46.77  ? 308 LEU B CA  1 
ATOM   6529 C C   . LEU B 1 311 ? 68.281 137.099 36.395  1.00 50.96  ? 308 LEU B C   1 
ATOM   6530 O O   . LEU B 1 311 ? 68.978 136.347 35.705  1.00 50.76  ? 308 LEU B O   1 
ATOM   6531 C CB  . LEU B 1 311 ? 66.725 137.777 34.536  1.00 49.34  ? 308 LEU B CB  1 
ATOM   6532 C CG  . LEU B 1 311 ? 65.861 138.826 33.833  1.00 43.34  ? 308 LEU B CG  1 
ATOM   6533 C CD1 . LEU B 1 311 ? 65.318 138.282 32.522  1.00 46.29  ? 308 LEU B CD1 1 
ATOM   6534 C CD2 . LEU B 1 311 ? 64.725 139.277 34.739  1.00 45.02  ? 308 LEU B CD2 1 
ATOM   6535 N N   . SER B 1 312 ? 68.150 136.965 37.718  1.00 52.76  ? 309 SER B N   1 
ATOM   6536 C CA  . SER B 1 312 ? 68.872 135.915 38.431  1.00 50.38  ? 309 SER B CA  1 
ATOM   6537 C C   . SER B 1 312 ? 68.450 134.528 37.967  1.00 53.19  ? 309 SER B C   1 
ATOM   6538 O O   . SER B 1 312 ? 69.232 133.575 38.065  1.00 53.16  ? 309 SER B O   1 
ATOM   6539 C CB  . SER B 1 312 ? 68.658 136.060 39.938  1.00 44.99  ? 309 SER B CB  1 
ATOM   6540 O OG  . SER B 1 312 ? 67.284 135.955 40.269  1.00 52.08  ? 309 SER B OG  1 
ATOM   6541 N N   . ASP B 1 313 ? 67.226 134.395 37.462  1.00 51.49  ? 310 ASP B N   1 
ATOM   6542 C CA  . ASP B 1 313 ? 66.736 133.138 36.921  1.00 57.89  ? 310 ASP B CA  1 
ATOM   6543 C C   . ASP B 1 313 ? 65.786 133.462 35.774  1.00 45.93  ? 310 ASP B C   1 
ATOM   6544 O O   . ASP B 1 313 ? 65.563 134.630 35.442  1.00 48.35  ? 310 ASP B O   1 
ATOM   6545 C CB  . ASP B 1 313 ? 66.057 132.300 38.010  1.00 54.90  ? 310 ASP B CB  1 
ATOM   6546 C CG  . ASP B 1 313 ? 66.090 130.813 37.712  1.00 59.70  ? 310 ASP B CG  1 
ATOM   6547 O OD1 . ASP B 1 313 ? 66.201 130.445 36.524  1.00 63.57  ? 310 ASP B OD1 1 
ATOM   6548 O OD2 . ASP B 1 313 ? 66.004 130.013 38.667  1.00 60.34  ? 310 ASP B OD2 1 
ATOM   6549 N N   . THR B 1 314 ? 65.229 132.419 35.164  1.00 44.15  ? 311 THR B N   1 
ATOM   6550 C CA  . THR B 1 314 ? 64.263 132.622 34.096  1.00 48.72  ? 311 THR B CA  1 
ATOM   6551 C C   . THR B 1 314 ? 63.049 133.380 34.633  1.00 42.35  ? 311 THR B C   1 
ATOM   6552 O O   . THR B 1 314 ? 62.740 133.305 35.826  1.00 46.32  ? 311 THR B O   1 
ATOM   6553 C CB  . THR B 1 314 ? 63.819 131.286 33.502  1.00 39.47  ? 311 THR B CB  1 
ATOM   6554 O OG1 . THR B 1 314 ? 63.053 130.560 34.472  1.00 41.98  ? 311 THR B OG1 1 
ATOM   6555 C CG2 . THR B 1 314 ? 65.025 130.456 33.090  1.00 37.71  ? 311 THR B CG2 1 
ATOM   6556 N N   . PRO B 1 315 ? 62.356 134.139 33.777  1.00 43.32  ? 312 PRO B N   1 
ATOM   6557 C CA  . PRO B 1 315 ? 61.155 134.848 34.251  1.00 44.44  ? 312 PRO B CA  1 
ATOM   6558 C C   . PRO B 1 315 ? 60.117 133.931 34.872  1.00 42.14  ? 312 PRO B C   1 
ATOM   6559 O O   . PRO B 1 315 ? 59.514 134.295 35.888  1.00 50.20  ? 312 PRO B O   1 
ATOM   6560 C CB  . PRO B 1 315 ? 60.631 135.527 32.979  1.00 33.07  ? 312 PRO B CB  1 
ATOM   6561 C CG  . PRO B 1 315 ? 61.844 135.722 32.146  1.00 34.36  ? 312 PRO B CG  1 
ATOM   6562 C CD  . PRO B 1 315 ? 62.708 134.516 32.397  1.00 38.95  ? 312 PRO B CD  1 
ATOM   6563 N N   . GLU B 1 316 ? 59.898 132.743 34.301  1.00 50.02  ? 313 GLU B N   1 
ATOM   6564 C CA  . GLU B 1 316 ? 58.916 131.829 34.877  1.00 54.91  ? 313 GLU B CA  1 
ATOM   6565 C C   . GLU B 1 316 ? 59.339 131.371 36.267  1.00 50.54  ? 313 GLU B C   1 
ATOM   6566 O O   . GLU B 1 316 ? 58.504 131.264 37.173  1.00 47.75  ? 313 GLU B O   1 
ATOM   6567 C CB  . GLU B 1 316 ? 58.705 130.623 33.961  1.00 43.24  ? 313 GLU B CB  1 
ATOM   6568 C CG  . GLU B 1 316 ? 57.439 129.844 34.286  1.00 65.12  ? 313 GLU B CG  1 
ATOM   6569 C CD  . GLU B 1 316 ? 57.562 128.361 33.997  1.00 79.74  ? 313 GLU B CD  1 
ATOM   6570 O OE1 . GLU B 1 316 ? 58.560 127.954 33.366  1.00 63.10  ? 313 GLU B OE1 1 
ATOM   6571 O OE2 . GLU B 1 316 ? 56.660 127.602 34.409  1.00 81.66  ? 313 GLU B OE2 1 
ATOM   6572 N N   . ALA B 1 317 ? 60.632 131.098 36.456  1.00 42.32  ? 314 ALA B N   1 
ATOM   6573 C CA  . ALA B 1 317 ? 61.113 130.687 37.771  1.00 40.44  ? 314 ALA B CA  1 
ATOM   6574 C C   . ALA B 1 317 ? 60.957 131.808 38.789  1.00 52.86  ? 314 ALA B C   1 
ATOM   6575 O O   . ALA B 1 317 ? 60.556 131.567 39.934  1.00 51.76  ? 314 ALA B O   1 
ATOM   6576 C CB  . ALA B 1 317 ? 62.573 130.241 37.682  1.00 39.53  ? 314 ALA B CB  1 
ATOM   6577 N N   . LEU B 1 318 ? 61.266 133.045 38.389  1.00 53.60  ? 315 LEU B N   1 
ATOM   6578 C CA  . LEU B 1 318 ? 61.132 134.172 39.305  1.00 43.38  ? 315 LEU B CA  1 
ATOM   6579 C C   . LEU B 1 318 ? 59.671 134.484 39.607  1.00 41.43  ? 315 LEU B C   1 
ATOM   6580 O O   . LEU B 1 318 ? 59.351 134.923 40.717  1.00 50.40  ? 315 LEU B O   1 
ATOM   6581 C CB  . LEU B 1 318 ? 61.831 135.403 38.726  1.00 37.74  ? 315 LEU B CB  1 
ATOM   6582 C CG  . LEU B 1 318 ? 63.333 135.280 38.459  1.00 47.52  ? 315 LEU B CG  1 
ATOM   6583 C CD1 . LEU B 1 318 ? 63.868 136.558 37.831  1.00 46.06  ? 315 LEU B CD1 1 
ATOM   6584 C CD2 . LEU B 1 318 ? 64.087 134.951 39.739  1.00 36.49  ? 315 LEU B CD2 1 
ATOM   6585 N N   . ILE B 1 319 ? 58.777 134.268 38.640  1.00 46.40  ? 316 ILE B N   1 
ATOM   6586 C CA  . ILE B 1 319 ? 57.356 134.513 38.871  1.00 49.64  ? 316 ILE B CA  1 
ATOM   6587 C C   . ILE B 1 319 ? 56.796 133.510 39.872  1.00 55.24  ? 316 ILE B C   1 
ATOM   6588 O O   . ILE B 1 319 ? 56.015 133.871 40.762  1.00 60.65  ? 316 ILE B O   1 
ATOM   6589 C CB  . ILE B 1 319 ? 56.586 134.479 37.538  1.00 45.28  ? 316 ILE B CB  1 
ATOM   6590 C CG1 . ILE B 1 319 ? 56.908 135.717 36.698  1.00 48.06  ? 316 ILE B CG1 1 
ATOM   6591 C CG2 . ILE B 1 319 ? 55.088 134.391 37.779  1.00 39.13  ? 316 ILE B CG2 1 
ATOM   6592 C CD1 . ILE B 1 319 ? 56.472 135.599 35.253  1.00 28.95  ? 316 ILE B CD1 1 
ATOM   6593 N N   . ASN B 1 320 ? 57.190 132.240 39.752  1.00 47.71  ? 317 ASN B N   1 
ATOM   6594 C CA  . ASN B 1 320 ? 56.666 131.214 40.648  1.00 46.78  ? 317 ASN B CA  1 
ATOM   6595 C C   . ASN B 1 320 ? 57.129 131.436 42.084  1.00 49.66  ? 317 ASN B C   1 
ATOM   6596 O O   . ASN B 1 320 ? 56.340 131.291 43.025  1.00 49.20  ? 317 ASN B O   1 
ATOM   6597 C CB  . ASN B 1 320 ? 57.083 129.826 40.159  1.00 42.84  ? 317 ASN B CB  1 
ATOM   6598 C CG  . ASN B 1 320 ? 56.505 129.489 38.798  1.00 39.20  ? 317 ASN B CG  1 
ATOM   6599 O OD1 . ASN B 1 320 ? 55.432 129.969 38.430  1.00 47.74  ? 317 ASN B OD1 1 
ATOM   6600 N ND2 . ASN B 1 320 ? 57.214 128.658 38.043  1.00 40.69  ? 317 ASN B ND2 1 
ATOM   6601 N N   . ALA B 1 321 ? 58.398 131.792 42.273  1.00 44.50  ? 318 ALA B N   1 
ATOM   6602 C CA  . ALA B 1 321 ? 58.970 131.967 43.601  1.00 45.74  ? 318 ALA B CA  1 
ATOM   6603 C C   . ALA B 1 321 ? 58.881 133.402 44.107  1.00 48.72  ? 318 ALA B C   1 
ATOM   6604 O O   . ALA B 1 321 ? 59.539 133.738 45.096  1.00 64.97  ? 318 ALA B O   1 
ATOM   6605 C CB  . ALA B 1 321 ? 60.430 131.507 43.607  1.00 38.58  ? 318 ALA B CB  1 
ATOM   6606 N N   . GLY B 1 322 ? 58.080 134.247 43.463  1.00 53.40  ? 319 GLY B N   1 
ATOM   6607 C CA  . GLY B 1 322 ? 58.027 135.656 43.812  1.00 48.95  ? 319 GLY B CA  1 
ATOM   6608 C C   . GLY B 1 322 ? 56.932 135.968 44.820  1.00 55.65  ? 319 GLY B C   1 
ATOM   6609 O O   . GLY B 1 322 ? 55.847 135.390 44.784  1.00 56.51  ? 319 GLY B O   1 
ATOM   6610 N N   . ASP B 1 323 ? 57.240 136.897 45.723  1.00 52.59  ? 320 ASP B N   1 
ATOM   6611 C CA  . ASP B 1 323 ? 56.288 137.425 46.695  1.00 46.44  ? 320 ASP B CA  1 
ATOM   6612 C C   . ASP B 1 323 ? 55.909 138.832 46.249  1.00 46.82  ? 320 ASP B C   1 
ATOM   6613 O O   . ASP B 1 323 ? 56.747 139.740 46.265  1.00 53.78  ? 320 ASP B O   1 
ATOM   6614 C CB  . ASP B 1 323 ? 56.885 137.429 48.101  1.00 53.14  ? 320 ASP B CB  1 
ATOM   6615 C CG  . ASP B 1 323 ? 55.970 138.078 49.124  1.00 58.03  ? 320 ASP B CG  1 
ATOM   6616 O OD1 . ASP B 1 323 ? 56.483 138.591 50.140  1.00 65.99  ? 320 ASP B OD1 1 
ATOM   6617 O OD2 . ASP B 1 323 ? 54.738 138.075 48.914  1.00 57.49  ? 320 ASP B OD2 1 
ATOM   6618 N N   . PHE B 1 324 ? 54.649 139.011 45.857  1.00 46.79  ? 321 PHE B N   1 
ATOM   6619 C CA  . PHE B 1 324 ? 54.185 140.253 45.252  1.00 39.76  ? 321 PHE B CA  1 
ATOM   6620 C C   . PHE B 1 324 ? 53.181 140.992 46.134  1.00 50.06  ? 321 PHE B C   1 
ATOM   6621 O O   . PHE B 1 324 ? 52.291 141.678 45.626  1.00 48.13  ? 321 PHE B O   1 
ATOM   6622 C CB  . PHE B 1 324 ? 53.581 139.975 43.877  1.00 42.35  ? 321 PHE B CB  1 
ATOM   6623 C CG  . PHE B 1 324 ? 54.503 139.232 42.953  1.00 40.12  ? 321 PHE B CG  1 
ATOM   6624 C CD1 . PHE B 1 324 ? 55.489 139.905 42.251  1.00 46.92  ? 321 PHE B CD1 1 
ATOM   6625 C CD2 . PHE B 1 324 ? 54.385 137.862 42.787  1.00 46.80  ? 321 PHE B CD2 1 
ATOM   6626 C CE1 . PHE B 1 324 ? 56.341 139.226 41.401  1.00 53.48  ? 321 PHE B CE1 1 
ATOM   6627 C CE2 . PHE B 1 324 ? 55.233 137.177 41.937  1.00 49.43  ? 321 PHE B CE2 1 
ATOM   6628 C CZ  . PHE B 1 324 ? 56.212 137.860 41.244  1.00 54.45  ? 321 PHE B CZ  1 
ATOM   6629 N N   . HIS B 1 325 ? 53.313 140.868 47.452  1.00 58.64  ? 322 HIS B N   1 
ATOM   6630 C CA  . HIS B 1 325 ? 52.441 141.604 48.356  1.00 54.74  ? 322 HIS B CA  1 
ATOM   6631 C C   . HIS B 1 325 ? 52.743 143.097 48.290  1.00 51.10  ? 322 HIS B C   1 
ATOM   6632 O O   . HIS B 1 325 ? 53.904 143.512 48.233  1.00 43.78  ? 322 HIS B O   1 
ATOM   6633 C CB  . HIS B 1 325 ? 52.600 141.095 49.788  1.00 58.63  ? 322 HIS B CB  1 
ATOM   6634 C CG  . HIS B 1 325 ? 51.890 139.804 50.052  1.00 56.05  ? 322 HIS B CG  1 
ATOM   6635 N ND1 . HIS B 1 325 ? 52.474 138.574 49.833  1.00 60.63  ? 322 HIS B ND1 1 
ATOM   6636 C CD2 . HIS B 1 325 ? 50.642 139.551 50.512  1.00 48.34  ? 322 HIS B CD2 1 
ATOM   6637 C CE1 . HIS B 1 325 ? 51.616 137.620 50.150  1.00 52.57  ? 322 HIS B CE1 1 
ATOM   6638 N NE2 . HIS B 1 325 ? 50.497 138.186 50.564  1.00 50.24  ? 322 HIS B NE2 1 
ATOM   6639 N N   . GLY B 1 326 ? 51.686 143.904 48.296  1.00 47.16  ? 323 GLY B N   1 
ATOM   6640 C CA  . GLY B 1 326 ? 51.818 145.342 48.191  1.00 47.29  ? 323 GLY B CA  1 
ATOM   6641 C C   . GLY B 1 326 ? 51.923 145.879 46.782  1.00 58.71  ? 323 GLY B C   1 
ATOM   6642 O O   . GLY B 1 326 ? 52.269 147.053 46.610  1.00 60.20  ? 323 GLY B O   1 
ATOM   6643 N N   . LEU B 1 327 ? 51.632 145.063 45.772  1.00 58.98  ? 324 LEU B N   1 
ATOM   6644 C CA  . LEU B 1 327 ? 51.755 145.449 44.375  1.00 47.57  ? 324 LEU B CA  1 
ATOM   6645 C C   . LEU B 1 327 ? 50.407 145.323 43.680  1.00 48.81  ? 324 LEU B C   1 
ATOM   6646 O O   . LEU B 1 327 ? 49.689 144.337 43.870  1.00 51.96  ? 324 LEU B O   1 
ATOM   6647 C CB  . LEU B 1 327 ? 52.798 144.580 43.660  1.00 49.37  ? 324 LEU B CB  1 
ATOM   6648 C CG  . LEU B 1 327 ? 52.832 144.614 42.130  1.00 51.67  ? 324 LEU B CG  1 
ATOM   6649 C CD1 . LEU B 1 327 ? 53.176 146.004 41.618  1.00 48.36  ? 324 LEU B CD1 1 
ATOM   6650 C CD2 . LEU B 1 327 ? 53.816 143.582 41.599  1.00 42.20  ? 324 LEU B CD2 1 
ATOM   6651 N N   . GLN B 1 328 ? 50.066 146.329 42.879  1.00 43.62  ? 325 GLN B N   1 
ATOM   6652 C CA  . GLN B 1 328 ? 48.863 146.318 42.058  1.00 45.67  ? 325 GLN B CA  1 
ATOM   6653 C C   . GLN B 1 328 ? 49.270 146.246 40.593  1.00 49.24  ? 325 GLN B C   1 
ATOM   6654 O O   . GLN B 1 328 ? 50.115 147.026 40.142  1.00 43.12  ? 325 GLN B O   1 
ATOM   6655 C CB  . GLN B 1 328 ? 48.002 147.559 42.309  1.00 46.41  ? 325 GLN B CB  1 
ATOM   6656 C CG  . GLN B 1 328 ? 47.617 147.778 43.763  1.00 48.98  ? 325 GLN B CG  1 
ATOM   6657 C CD  . GLN B 1 328 ? 48.712 148.464 44.557  1.00 51.73  ? 325 GLN B CD  1 
ATOM   6658 O OE1 . GLN B 1 328 ? 49.165 149.551 44.199  1.00 53.92  ? 325 GLN B OE1 1 
ATOM   6659 N NE2 . GLN B 1 328 ? 49.150 147.825 45.636  1.00 55.70  ? 325 GLN B NE2 1 
ATOM   6660 N N   . VAL B 1 329 ? 48.674 145.309 39.858  1.00 46.31  ? 326 VAL B N   1 
ATOM   6661 C CA  . VAL B 1 329 ? 49.014 145.067 38.462  1.00 36.86  ? 326 VAL B CA  1 
ATOM   6662 C C   . VAL B 1 329 ? 47.747 145.136 37.623  1.00 41.75  ? 326 VAL B C   1 
ATOM   6663 O O   . VAL B 1 329 ? 46.691 144.637 38.030  1.00 47.03  ? 326 VAL B O   1 
ATOM   6664 C CB  . VAL B 1 329 ? 49.714 143.703 38.273  1.00 41.24  ? 326 VAL B CB  1 
ATOM   6665 C CG1 . VAL B 1 329 ? 50.174 143.535 36.833  1.00 39.52  ? 326 VAL B CG1 1 
ATOM   6666 C CG2 . VAL B 1 329 ? 50.888 143.564 39.227  1.00 43.51  ? 326 VAL B CG2 1 
ATOM   6667 N N   . LEU B 1 330 ? 47.853 145.758 36.450  1.00 41.46  ? 327 LEU B N   1 
ATOM   6668 C CA  . LEU B 1 330 ? 46.779 145.801 35.462  1.00 34.86  ? 327 LEU B CA  1 
ATOM   6669 C C   . LEU B 1 330 ? 47.279 145.108 34.201  1.00 37.47  ? 327 LEU B C   1 
ATOM   6670 O O   . LEU B 1 330 ? 48.178 145.617 33.523  1.00 41.16  ? 327 LEU B O   1 
ATOM   6671 C CB  . LEU B 1 330 ? 46.355 147.241 35.170  1.00 31.67  ? 327 LEU B CB  1 
ATOM   6672 C CG  . LEU B 1 330 ? 45.310 147.451 34.072  1.00 41.59  ? 327 LEU B CG  1 
ATOM   6673 C CD1 . LEU B 1 330 ? 44.006 146.750 34.419  1.00 44.88  ? 327 LEU B CD1 1 
ATOM   6674 C CD2 . LEU B 1 330 ? 45.076 148.935 33.832  1.00 40.74  ? 327 LEU B CD2 1 
ATOM   6675 N N   . VAL B 1 331 ? 46.709 143.945 33.892  1.00 36.40  ? 328 VAL B N   1 
ATOM   6676 C CA  . VAL B 1 331 ? 47.097 143.174 32.720  1.00 25.00  ? 328 VAL B CA  1 
ATOM   6677 C C   . VAL B 1 331 ? 45.899 143.061 31.788  1.00 32.51  ? 328 VAL B C   1 
ATOM   6678 O O   . VAL B 1 331 ? 44.753 143.299 32.174  1.00 33.58  ? 328 VAL B O   1 
ATOM   6679 C CB  . VAL B 1 331 ? 47.629 141.775 33.090  1.00 35.00  ? 328 VAL B CB  1 
ATOM   6680 C CG1 . VAL B 1 331 ? 48.960 141.888 33.814  1.00 27.29  ? 328 VAL B CG1 1 
ATOM   6681 C CG2 . VAL B 1 331 ? 46.612 141.029 33.941  1.00 34.35  ? 328 VAL B CG2 1 
ATOM   6682 N N   . GLY B 1 332 ? 46.179 142.692 30.545  1.00 31.65  ? 329 GLY B N   1 
ATOM   6683 C CA  . GLY B 1 332 ? 45.120 142.522 29.570  1.00 26.55  ? 329 GLY B CA  1 
ATOM   6684 C C   . GLY B 1 332 ? 45.685 142.220 28.203  1.00 33.90  ? 329 GLY B C   1 
ATOM   6685 O O   . GLY B 1 332 ? 46.899 142.240 27.978  1.00 28.44  ? 329 GLY B O   1 
ATOM   6686 N N   . VAL B 1 333 ? 44.765 141.932 27.281  1.00 26.67  ? 330 VAL B N   1 
ATOM   6687 C CA  . VAL B 1 333 ? 45.085 141.575 25.904  1.00 27.11  ? 330 VAL B CA  1 
ATOM   6688 C C   . VAL B 1 333 ? 44.033 142.193 24.991  1.00 26.02  ? 330 VAL B C   1 
ATOM   6689 O O   . VAL B 1 333 ? 43.008 142.707 25.442  1.00 33.35  ? 330 VAL B O   1 
ATOM   6690 C CB  . VAL B 1 333 ? 45.138 140.046 25.692  1.00 36.00  ? 330 VAL B CB  1 
ATOM   6691 C CG1 . VAL B 1 333 ? 46.307 139.431 26.448  1.00 28.04  ? 330 VAL B CG1 1 
ATOM   6692 C CG2 . VAL B 1 333 ? 43.824 139.408 26.122  1.00 29.57  ? 330 VAL B CG2 1 
ATOM   6693 N N   . VAL B 1 334 ? 44.299 142.138 23.691  1.00 26.01  ? 331 VAL B N   1 
ATOM   6694 C CA  . VAL B 1 334 ? 43.322 142.520 22.691  1.00 25.56  ? 331 VAL B CA  1 
ATOM   6695 C C   . VAL B 1 334 ? 42.596 141.266 22.219  1.00 23.28  ? 331 VAL B C   1 
ATOM   6696 O O   . VAL B 1 334 ? 42.974 140.143 22.542  1.00 31.60  ? 331 VAL B O   1 
ATOM   6697 C CB  . VAL B 1 334 ? 43.964 143.286 21.507  1.00 29.99  ? 331 VAL B CB  1 
ATOM   6698 C CG1 . VAL B 1 334 ? 44.772 144.472 22.013  1.00 26.77  ? 331 VAL B CG1 1 
ATOM   6699 C CG2 . VAL B 1 334 ? 44.821 142.356 20.664  1.00 24.99  ? 331 VAL B CG2 1 
ATOM   6700 N N   . LYS B 1 335 ? 41.536 141.460 21.433  1.00 24.91  ? 332 LYS B N   1 
ATOM   6701 C CA  . LYS B 1 335 ? 40.671 140.341 21.071  1.00 33.28  ? 332 LYS B CA  1 
ATOM   6702 C C   . LYS B 1 335 ? 41.370 139.370 20.125  1.00 34.95  ? 332 LYS B C   1 
ATOM   6703 O O   . LYS B 1 335 ? 41.200 138.151 20.247  1.00 37.31  ? 332 LYS B O   1 
ATOM   6704 C CB  . LYS B 1 335 ? 39.378 140.867 20.448  1.00 41.91  ? 332 LYS B CB  1 
ATOM   6705 C CG  . LYS B 1 335 ? 38.340 139.797 20.152  1.00 33.89  ? 332 LYS B CG  1 
ATOM   6706 C CD  . LYS B 1 335 ? 37.036 140.421 19.677  1.00 36.17  ? 332 LYS B CD  1 
ATOM   6707 C CE  . LYS B 1 335 ? 36.045 139.360 19.227  1.00 41.87  ? 332 LYS B CE  1 
ATOM   6708 N NZ  . LYS B 1 335 ? 36.561 138.589 18.061  1.00 55.14  ? 332 LYS B NZ  1 
ATOM   6709 N N   . ASP B 1 336 ? 42.162 139.882 19.184  1.00 34.82  ? 333 ASP B N   1 
ATOM   6710 C CA  . ASP B 1 336 ? 42.813 139.063 18.160  1.00 33.69  ? 333 ASP B CA  1 
ATOM   6711 C C   . ASP B 1 336 ? 44.315 139.330 18.205  1.00 31.67  ? 333 ASP B C   1 
ATOM   6712 O O   . ASP B 1 336 ? 44.848 140.104 17.407  1.00 35.03  ? 333 ASP B O   1 
ATOM   6713 C CB  . ASP B 1 336 ? 42.226 139.363 16.784  1.00 31.31  ? 333 ASP B CB  1 
ATOM   6714 C CG  . ASP B 1 336 ? 40.721 139.196 16.745  1.00 37.34  ? 333 ASP B CG  1 
ATOM   6715 O OD1 . ASP B 1 336 ? 40.256 138.050 16.570  1.00 46.72  ? 333 ASP B OD1 1 
ATOM   6716 O OD2 . ASP B 1 336 ? 40.004 140.208 16.887  1.00 37.52  ? 333 ASP B OD2 1 
ATOM   6717 N N   . GLU B 1 337 ? 45.001 138.661 19.134  1.00 29.22  ? 334 GLU B N   1 
ATOM   6718 C CA  . GLU B 1 337 ? 46.419 138.930 19.353  1.00 31.56  ? 334 GLU B CA  1 
ATOM   6719 C C   . GLU B 1 337 ? 47.292 138.423 18.210  1.00 35.15  ? 334 GLU B C   1 
ATOM   6720 O O   . GLU B 1 337 ? 48.373 138.973 17.974  1.00 29.22  ? 334 GLU B O   1 
ATOM   6721 C CB  . GLU B 1 337 ? 46.872 138.301 20.671  1.00 33.04  ? 334 GLU B CB  1 
ATOM   6722 C CG  . GLU B 1 337 ? 46.386 139.024 21.915  1.00 37.17  ? 334 GLU B CG  1 
ATOM   6723 C CD  . GLU B 1 337 ? 47.145 140.312 22.174  1.00 41.18  ? 334 GLU B CD  1 
ATOM   6724 O OE1 . GLU B 1 337 ? 46.675 141.124 22.997  1.00 35.16  ? 334 GLU B OE1 1 
ATOM   6725 O OE2 . GLU B 1 337 ? 48.214 140.509 21.558  1.00 29.54  ? 334 GLU B OE2 1 
ATOM   6726 N N   . GLY B 1 338 ? 46.855 137.390 17.494  1.00 33.36  ? 335 GLY B N   1 
ATOM   6727 C CA  . GLY B 1 338 ? 47.730 136.733 16.541  1.00 24.11  ? 335 GLY B CA  1 
ATOM   6728 C C   . GLY B 1 338 ? 47.573 137.126 15.085  1.00 27.98  ? 335 GLY B C   1 
ATOM   6729 O O   . GLY B 1 338 ? 48.452 136.830 14.270  1.00 35.09  ? 335 GLY B O   1 
ATOM   6730 N N   . SER B 1 339 ? 46.474 137.803 14.742  1.00 22.41  ? 336 SER B N   1 
ATOM   6731 C CA  . SER B 1 339 ? 46.154 138.036 13.335  1.00 29.04  ? 336 SER B CA  1 
ATOM   6732 C C   . SER B 1 339 ? 47.173 138.940 12.645  1.00 35.52  ? 336 SER B C   1 
ATOM   6733 O O   . SER B 1 339 ? 47.469 138.740 11.462  1.00 37.40  ? 336 SER B O   1 
ATOM   6734 C CB  . SER B 1 339 ? 44.751 138.631 13.209  1.00 32.02  ? 336 SER B CB  1 
ATOM   6735 O OG  . SER B 1 339 ? 44.662 139.879 13.873  1.00 32.21  ? 336 SER B OG  1 
ATOM   6736 N N   . TYR B 1 340 ? 47.716 139.930 13.357  1.00 34.69  ? 337 TYR B N   1 
ATOM   6737 C CA  . TYR B 1 340 ? 48.640 140.877 12.736  1.00 34.70  ? 337 TYR B CA  1 
ATOM   6738 C C   . TYR B 1 340 ? 49.954 140.215 12.339  1.00 39.57  ? 337 TYR B C   1 
ATOM   6739 O O   . TYR B 1 340 ? 50.569 140.612 11.342  1.00 40.08  ? 337 TYR B O   1 
ATOM   6740 C CB  . TYR B 1 340 ? 48.877 142.050 13.691  1.00 44.98  ? 337 TYR B CB  1 
ATOM   6741 C CG  . TYR B 1 340 ? 50.099 142.902 13.443  1.00 34.69  ? 337 TYR B CG  1 
ATOM   6742 C CD1 . TYR B 1 340 ? 50.028 144.035 12.646  1.00 50.94  ? 337 TYR B CD1 1 
ATOM   6743 C CD2 . TYR B 1 340 ? 51.311 142.603 14.049  1.00 41.31  ? 337 TYR B CD2 1 
ATOM   6744 C CE1 . TYR B 1 340 ? 51.137 144.828 12.436  1.00 46.57  ? 337 TYR B CE1 1 
ATOM   6745 C CE2 . TYR B 1 340 ? 52.424 143.388 13.842  1.00 49.29  ? 337 TYR B CE2 1 
ATOM   6746 C CZ  . TYR B 1 340 ? 52.332 144.500 13.034  1.00 60.62  ? 337 TYR B CZ  1 
ATOM   6747 O OH  . TYR B 1 340 ? 53.441 145.288 12.826  1.00 66.25  ? 337 TYR B OH  1 
ATOM   6748 N N   . PHE B 1 341 ? 50.395 139.207 13.088  1.00 33.69  ? 338 PHE B N   1 
ATOM   6749 C CA  . PHE B 1 341 ? 51.671 138.559 12.814  1.00 35.22  ? 338 PHE B CA  1 
ATOM   6750 C C   . PHE B 1 341 ? 51.584 137.504 11.719  1.00 35.94  ? 338 PHE B C   1 
ATOM   6751 O O   . PHE B 1 341 ? 52.625 137.012 11.274  1.00 30.72  ? 338 PHE B O   1 
ATOM   6752 C CB  . PHE B 1 341 ? 52.217 137.926 14.097  1.00 33.74  ? 338 PHE B CB  1 
ATOM   6753 C CG  . PHE B 1 341 ? 52.369 138.899 15.232  1.00 45.95  ? 338 PHE B CG  1 
ATOM   6754 C CD1 . PHE B 1 341 ? 51.316 139.144 16.099  1.00 40.61  ? 338 PHE B CD1 1 
ATOM   6755 C CD2 . PHE B 1 341 ? 53.562 139.574 15.429  1.00 47.38  ? 338 PHE B CD2 1 
ATOM   6756 C CE1 . PHE B 1 341 ? 51.450 140.044 17.140  1.00 43.54  ? 338 PHE B CE1 1 
ATOM   6757 C CE2 . PHE B 1 341 ? 53.704 140.473 16.469  1.00 46.75  ? 338 PHE B CE2 1 
ATOM   6758 C CZ  . PHE B 1 341 ? 52.647 140.708 17.326  1.00 45.92  ? 338 PHE B CZ  1 
ATOM   6759 N N   . LEU B 1 342 ? 50.377 137.155 11.268  1.00 32.53  ? 339 LEU B N   1 
ATOM   6760 C CA  . LEU B 1 342 ? 50.240 136.080 10.292  1.00 37.17  ? 339 LEU B CA  1 
ATOM   6761 C C   . LEU B 1 342 ? 50.667 136.518 8.896   1.00 36.82  ? 339 LEU B C   1 
ATOM   6762 O O   . LEU B 1 342 ? 51.086 135.681 8.090   1.00 31.07  ? 339 LEU B O   1 
ATOM   6763 C CB  . LEU B 1 342 ? 48.802 135.564 10.280  1.00 28.68  ? 339 LEU B CB  1 
ATOM   6764 C CG  . LEU B 1 342 ? 48.369 134.901 11.590  1.00 35.16  ? 339 LEU B CG  1 
ATOM   6765 C CD1 . LEU B 1 342 ? 46.973 134.313 11.477  1.00 23.87  ? 339 LEU B CD1 1 
ATOM   6766 C CD2 . LEU B 1 342 ? 49.373 133.833 11.993  1.00 26.78  ? 339 LEU B CD2 1 
ATOM   6767 N N   . VAL B 1 343 ? 50.575 137.817 8.589   1.00 32.55  ? 340 VAL B N   1 
ATOM   6768 C CA  . VAL B 1 343 ? 51.024 138.308 7.286   1.00 31.01  ? 340 VAL B CA  1 
ATOM   6769 C C   . VAL B 1 343 ? 52.535 138.418 7.189   1.00 31.48  ? 340 VAL B C   1 
ATOM   6770 O O   . VAL B 1 343 ? 53.048 138.840 6.145   1.00 36.16  ? 340 VAL B O   1 
ATOM   6771 C CB  . VAL B 1 343 ? 50.407 139.680 6.951   1.00 32.83  ? 340 VAL B CB  1 
ATOM   6772 C CG1 . VAL B 1 343 ? 48.908 139.549 6.735   1.00 35.55  ? 340 VAL B CG1 1 
ATOM   6773 C CG2 . VAL B 1 343 ? 50.711 140.684 8.051   1.00 29.65  ? 340 VAL B CG2 1 
ATOM   6774 N N   . TYR B 1 344 ? 53.268 138.046 8.240   1.00 29.90  ? 341 TYR B N   1 
ATOM   6775 C CA  . TYR B 1 344 ? 54.723 138.124 8.257   1.00 34.58  ? 341 TYR B CA  1 
ATOM   6776 C C   . TYR B 1 344 ? 55.387 136.759 8.100   1.00 37.18  ? 341 TYR B C   1 
ATOM   6777 O O   . TYR B 1 344 ? 56.489 136.546 8.616   1.00 50.60  ? 341 TYR B O   1 
ATOM   6778 C CB  . TYR B 1 344 ? 55.204 138.795 9.544   1.00 38.84  ? 341 TYR B CB  1 
ATOM   6779 C CG  . TYR B 1 344 ? 55.054 140.299 9.551   1.00 33.13  ? 341 TYR B CG  1 
ATOM   6780 C CD1 . TYR B 1 344 ? 56.033 141.114 9.002   1.00 36.66  ? 341 TYR B CD1 1 
ATOM   6781 C CD2 . TYR B 1 344 ? 53.937 140.904 10.112  1.00 37.85  ? 341 TYR B CD2 1 
ATOM   6782 C CE1 . TYR B 1 344 ? 55.907 142.489 9.010   1.00 37.82  ? 341 TYR B CE1 1 
ATOM   6783 C CE2 . TYR B 1 344 ? 53.800 142.280 10.122  1.00 42.49  ? 341 TYR B CE2 1 
ATOM   6784 C CZ  . TYR B 1 344 ? 54.788 143.067 9.569   1.00 35.81  ? 341 TYR B CZ  1 
ATOM   6785 O OH  . TYR B 1 344 ? 54.660 144.437 9.575   1.00 43.40  ? 341 TYR B OH  1 
ATOM   6786 N N   . GLY B 1 345 ? 54.744 135.825 7.400   1.00 36.06  ? 342 GLY B N   1 
ATOM   6787 C CA  . GLY B 1 345 ? 55.381 134.548 7.143   1.00 44.89  ? 342 GLY B CA  1 
ATOM   6788 C C   . GLY B 1 345 ? 54.462 133.349 7.026   1.00 42.86  ? 342 GLY B C   1 
ATOM   6789 O O   . GLY B 1 345 ? 54.845 132.332 6.440   1.00 47.91  ? 342 GLY B O   1 
ATOM   6790 N N   . ALA B 1 346 ? 53.261 133.440 7.581   1.00 36.43  ? 343 ALA B N   1 
ATOM   6791 C CA  . ALA B 1 346 ? 52.335 132.315 7.516   1.00 38.08  ? 343 ALA B CA  1 
ATOM   6792 C C   . ALA B 1 346 ? 51.851 132.129 6.082   1.00 40.45  ? 343 ALA B C   1 
ATOM   6793 O O   . ALA B 1 346 ? 51.422 133.101 5.447   1.00 38.87  ? 343 ALA B O   1 
ATOM   6794 C CB  . ALA B 1 346 ? 51.153 132.530 8.457   1.00 33.44  ? 343 ALA B CB  1 
ATOM   6795 N N   . PRO B 1 347 ? 51.910 130.915 5.536   1.00 39.07  ? 344 PRO B N   1 
ATOM   6796 C CA  . PRO B 1 347 ? 51.557 130.722 4.123   1.00 36.86  ? 344 PRO B CA  1 
ATOM   6797 C C   . PRO B 1 347 ? 50.086 131.005 3.861   1.00 32.57  ? 344 PRO B C   1 
ATOM   6798 O O   . PRO B 1 347 ? 49.217 130.700 4.681   1.00 35.37  ? 344 PRO B O   1 
ATOM   6799 C CB  . PRO B 1 347 ? 51.893 129.247 3.869   1.00 31.45  ? 344 PRO B CB  1 
ATOM   6800 C CG  . PRO B 1 347 ? 52.830 128.862 4.974   1.00 39.12  ? 344 PRO B CG  1 
ATOM   6801 C CD  . PRO B 1 347 ? 52.411 129.677 6.156   1.00 32.22  ? 344 PRO B CD  1 
ATOM   6802 N N   . GLY B 1 348 ? 49.817 131.596 2.698   1.00 33.12  ? 345 GLY B N   1 
ATOM   6803 C CA  . GLY B 1 348 ? 48.464 131.883 2.271   1.00 24.63  ? 345 GLY B CA  1 
ATOM   6804 C C   . GLY B 1 348 ? 47.856 133.148 2.837   1.00 33.28  ? 345 GLY B C   1 
ATOM   6805 O O   . GLY B 1 348 ? 46.724 133.485 2.469   1.00 26.70  ? 345 GLY B O   1 
ATOM   6806 N N   . PHE B 1 349 ? 48.563 133.861 3.707   1.00 35.85  ? 346 PHE B N   1 
ATOM   6807 C CA  . PHE B 1 349 ? 48.030 135.051 4.352   1.00 42.81  ? 346 PHE B CA  1 
ATOM   6808 C C   . PHE B 1 349 ? 48.460 136.308 3.609   1.00 32.01  ? 346 PHE B C   1 
ATOM   6809 O O   . PHE B 1 349 ? 49.604 136.424 3.161   1.00 41.76  ? 346 PHE B O   1 
ATOM   6810 C CB  . PHE B 1 349 ? 48.475 135.128 5.813   1.00 37.69  ? 346 PHE B CB  1 
ATOM   6811 C CG  . PHE B 1 349 ? 47.653 134.277 6.737   1.00 31.89  ? 346 PHE B CG  1 
ATOM   6812 C CD1 . PHE B 1 349 ? 46.517 134.789 7.341   1.00 38.25  ? 346 PHE B CD1 1 
ATOM   6813 C CD2 . PHE B 1 349 ? 48.008 132.964 6.992   1.00 33.18  ? 346 PHE B CD2 1 
ATOM   6814 C CE1 . PHE B 1 349 ? 45.753 134.008 8.187   1.00 34.36  ? 346 PHE B CE1 1 
ATOM   6815 C CE2 . PHE B 1 349 ? 47.251 132.178 7.839   1.00 32.69  ? 346 PHE B CE2 1 
ATOM   6816 C CZ  . PHE B 1 349 ? 46.121 132.700 8.436   1.00 37.21  ? 346 PHE B CZ  1 
ATOM   6817 N N   . SER B 1 350 ? 47.526 137.247 3.487   1.00 39.78  ? 347 SER B N   1 
ATOM   6818 C CA  . SER B 1 350 ? 47.756 138.521 2.825   1.00 34.02  ? 347 SER B CA  1 
ATOM   6819 C C   . SER B 1 350 ? 46.773 139.530 3.394   1.00 32.59  ? 347 SER B C   1 
ATOM   6820 O O   . SER B 1 350 ? 45.593 139.217 3.576   1.00 39.66  ? 347 SER B O   1 
ATOM   6821 C CB  . SER B 1 350 ? 47.584 138.407 1.306   1.00 26.46  ? 347 SER B CB  1 
ATOM   6822 O OG  . SER B 1 350 ? 47.459 139.685 0.707   1.00 34.72  ? 347 SER B OG  1 
ATOM   6823 N N   . LYS B 1 351 ? 47.262 140.737 3.681   1.00 32.25  ? 348 LYS B N   1 
ATOM   6824 C CA  . LYS B 1 351 ? 46.375 141.771 4.198   1.00 33.59  ? 348 LYS B CA  1 
ATOM   6825 C C   . LYS B 1 351 ? 45.410 142.291 3.142   1.00 29.71  ? 348 LYS B C   1 
ATOM   6826 O O   . LYS B 1 351 ? 44.447 142.981 3.495   1.00 28.58  ? 348 LYS B O   1 
ATOM   6827 C CB  . LYS B 1 351 ? 47.187 142.935 4.769   1.00 30.75  ? 348 LYS B CB  1 
ATOM   6828 C CG  . LYS B 1 351 ? 47.534 144.015 3.755   1.00 32.20  ? 348 LYS B CG  1 
ATOM   6829 C CD  . LYS B 1 351 ? 48.148 145.230 4.431   1.00 30.48  ? 348 LYS B CD  1 
ATOM   6830 C CE  . LYS B 1 351 ? 48.377 146.356 3.436   1.00 27.31  ? 348 LYS B CE  1 
ATOM   6831 N NZ  . LYS B 1 351 ? 47.106 146.804 2.804   1.00 28.01  ? 348 LYS B NZ  1 
ATOM   6832 N N   . ASP B 1 352 ? 45.631 141.970 1.869   1.00 31.04  ? 349 ASP B N   1 
ATOM   6833 C CA  . ASP B 1 352 ? 44.842 142.512 0.773   1.00 30.04  ? 349 ASP B CA  1 
ATOM   6834 C C   . ASP B 1 352 ? 43.829 141.518 0.213   1.00 35.05  ? 349 ASP B C   1 
ATOM   6835 O O   . ASP B 1 352 ? 43.164 141.825 -0.781  1.00 32.99  ? 349 ASP B O   1 
ATOM   6836 C CB  . ASP B 1 352 ? 45.768 143.012 -0.336  1.00 28.03  ? 349 ASP B CB  1 
ATOM   6837 C CG  . ASP B 1 352 ? 46.653 144.158 0.122   1.00 30.43  ? 349 ASP B CG  1 
ATOM   6838 O OD1 . ASP B 1 352 ? 46.131 145.091 0.766   1.00 27.62  ? 349 ASP B OD1 1 
ATOM   6839 O OD2 . ASP B 1 352 ? 47.871 144.119 -0.150  1.00 26.92  ? 349 ASP B OD2 1 
ATOM   6840 N N   . ASN B 1 353 ? 43.703 140.336 0.817   1.00 31.88  ? 350 ASN B N   1 
ATOM   6841 C CA  . ASN B 1 353 ? 42.570 139.464 0.527   1.00 32.87  ? 350 ASN B CA  1 
ATOM   6842 C C   . ASN B 1 353 ? 41.993 138.927 1.832   1.00 36.50  ? 350 ASN B C   1 
ATOM   6843 O O   . ASN B 1 353 ? 42.330 139.424 2.912   1.00 35.51  ? 350 ASN B O   1 
ATOM   6844 C CB  . ASN B 1 353 ? 42.962 138.326 -0.432  1.00 25.32  ? 350 ASN B CB  1 
ATOM   6845 C CG  . ASN B 1 353 ? 44.061 137.422 0.115   1.00 29.98  ? 350 ASN B CG  1 
ATOM   6846 O OD1 . ASN B 1 353 ? 44.200 137.233 1.323   1.00 35.38  ? 350 ASN B OD1 1 
ATOM   6847 N ND2 . ASN B 1 353 ? 44.841 136.844 -0.791  1.00 33.89  ? 350 ASN B ND2 1 
ATOM   6848 N N   . GLU B 1 354 ? 41.126 137.921 1.749   1.00 37.96  ? 351 GLU B N   1 
ATOM   6849 C CA  . GLU B 1 354 ? 40.446 137.389 2.923   1.00 35.50  ? 351 GLU B CA  1 
ATOM   6850 C C   . GLU B 1 354 ? 41.276 136.362 3.684   1.00 29.85  ? 351 GLU B C   1 
ATOM   6851 O O   . GLU B 1 354 ? 40.856 135.932 4.763   1.00 37.73  ? 351 GLU B O   1 
ATOM   6852 C CB  . GLU B 1 354 ? 39.103 136.774 2.519   1.00 37.72  ? 351 GLU B CB  1 
ATOM   6853 C CG  . GLU B 1 354 ? 38.207 137.700 1.701   1.00 43.05  ? 351 GLU B CG  1 
ATOM   6854 C CD  . GLU B 1 354 ? 37.724 138.911 2.483   1.00 56.74  ? 351 GLU B CD  1 
ATOM   6855 O OE1 . GLU B 1 354 ? 37.805 138.900 3.730   1.00 62.63  ? 351 GLU B OE1 1 
ATOM   6856 O OE2 . GLU B 1 354 ? 37.258 139.880 1.845   1.00 80.71  ? 351 GLU B OE2 1 
ATOM   6857 N N   . SER B 1 355 ? 42.436 135.968 3.153   1.00 31.15  ? 352 SER B N   1 
ATOM   6858 C CA  . SER B 1 355 ? 43.318 134.994 3.801   1.00 34.21  ? 352 SER B CA  1 
ATOM   6859 C C   . SER B 1 355 ? 42.572 133.704 4.133   1.00 32.24  ? 352 SER B C   1 
ATOM   6860 O O   . SER B 1 355 ? 42.739 133.118 5.206   1.00 30.16  ? 352 SER B O   1 
ATOM   6861 C CB  . SER B 1 355 ? 43.971 135.586 5.051   1.00 31.69  ? 352 SER B CB  1 
ATOM   6862 O OG  . SER B 1 355 ? 44.959 136.539 4.704   1.00 40.19  ? 352 SER B OG  1 
ATOM   6863 N N   . LEU B 1 356 ? 41.731 133.261 3.199   1.00 36.79  ? 353 LEU B N   1 
ATOM   6864 C CA  . LEU B 1 356 ? 40.997 132.004 3.335   1.00 37.97  ? 353 LEU B CA  1 
ATOM   6865 C C   . LEU B 1 356 ? 41.962 130.862 3.034   1.00 29.78  ? 353 LEU B C   1 
ATOM   6866 O O   . LEU B 1 356 ? 42.043 130.342 1.918   1.00 34.68  ? 353 LEU B O   1 
ATOM   6867 C CB  . LEU B 1 356 ? 39.788 131.988 2.408   1.00 30.92  ? 353 LEU B CB  1 
ATOM   6868 C CG  . LEU B 1 356 ? 38.781 133.122 2.609   1.00 36.10  ? 353 LEU B CG  1 
ATOM   6869 C CD1 . LEU B 1 356 ? 37.829 133.206 1.428   1.00 40.19  ? 353 LEU B CD1 1 
ATOM   6870 C CD2 . LEU B 1 356 ? 38.012 132.934 3.906   1.00 21.23  ? 353 LEU B CD2 1 
ATOM   6871 N N   . ILE B 1 357 ? 42.714 130.469 4.060   1.00 29.69  ? 354 ILE B N   1 
ATOM   6872 C CA  . ILE B 1 357 ? 43.772 129.484 3.878   1.00 39.67  ? 354 ILE B CA  1 
ATOM   6873 C C   . ILE B 1 357 ? 43.177 128.083 3.780   1.00 41.04  ? 354 ILE B C   1 
ATOM   6874 O O   . ILE B 1 357 ? 42.056 127.815 4.218   1.00 37.26  ? 354 ILE B O   1 
ATOM   6875 C CB  . ILE B 1 357 ? 44.809 129.570 5.012   1.00 32.10  ? 354 ILE B CB  1 
ATOM   6876 C CG1 . ILE B 1 357 ? 44.144 129.303 6.364   1.00 29.18  ? 354 ILE B CG1 1 
ATOM   6877 C CG2 . ILE B 1 357 ? 45.493 130.927 5.003   1.00 37.16  ? 354 ILE B CG2 1 
ATOM   6878 C CD1 . ILE B 1 357 ? 45.116 129.244 7.520   1.00 27.87  ? 354 ILE B CD1 1 
ATOM   6879 N N   . SER B 1 358 ? 43.952 127.178 3.192   1.00 42.92  ? 355 SER B N   1 
ATOM   6880 C CA  . SER B 1 358 ? 43.561 125.784 3.064   1.00 34.10  ? 355 SER B CA  1 
ATOM   6881 C C   . SER B 1 358 ? 44.018 124.988 4.284   1.00 43.58  ? 355 SER B C   1 
ATOM   6882 O O   . SER B 1 358 ? 44.738 125.485 5.153   1.00 40.60  ? 355 SER B O   1 
ATOM   6883 C CB  . SER B 1 358 ? 44.143 125.182 1.784   1.00 25.79  ? 355 SER B CB  1 
ATOM   6884 O OG  . SER B 1 358 ? 45.561 125.198 1.808   1.00 31.59  ? 355 SER B OG  1 
ATOM   6885 N N   . ARG B 1 359 ? 43.581 123.727 4.341   1.00 41.28  ? 356 ARG B N   1 
ATOM   6886 C CA  . ARG B 1 359 ? 43.987 122.851 5.435   1.00 30.06  ? 356 ARG B CA  1 
ATOM   6887 C C   . ARG B 1 359 ? 45.493 122.622 5.426   1.00 33.95  ? 356 ARG B C   1 
ATOM   6888 O O   . ARG B 1 359 ? 46.128 122.579 6.486   1.00 39.64  ? 356 ARG B O   1 
ATOM   6889 C CB  . ARG B 1 359 ? 43.241 121.520 5.342   1.00 42.65  ? 356 ARG B CB  1 
ATOM   6890 C CG  . ARG B 1 359 ? 43.602 120.519 6.430   1.00 41.83  ? 356 ARG B CG  1 
ATOM   6891 C CD  . ARG B 1 359 ? 43.064 120.950 7.783   1.00 42.15  ? 356 ARG B CD  1 
ATOM   6892 N NE  . ARG B 1 359 ? 43.428 120.010 8.840   1.00 40.84  ? 356 ARG B NE  1 
ATOM   6893 C CZ  . ARG B 1 359 ? 43.066 120.139 10.112  1.00 39.12  ? 356 ARG B CZ  1 
ATOM   6894 N NH1 . ARG B 1 359 ? 42.325 121.172 10.488  1.00 36.62  ? 356 ARG B NH1 1 
ATOM   6895 N NH2 . ARG B 1 359 ? 43.443 119.237 11.007  1.00 37.43  ? 356 ARG B NH2 1 
ATOM   6896 N N   . ALA B 1 360 ? 46.082 122.478 4.237   1.00 33.48  ? 357 ALA B N   1 
ATOM   6897 C CA  . ALA B 1 360 ? 47.526 122.287 4.145   1.00 36.50  ? 357 ALA B CA  1 
ATOM   6898 C C   . ALA B 1 360 ? 48.278 123.534 4.593   1.00 38.33  ? 357 ALA B C   1 
ATOM   6899 O O   . ALA B 1 360 ? 49.307 123.435 5.271   1.00 39.26  ? 357 ALA B O   1 
ATOM   6900 C CB  . ALA B 1 360 ? 47.917 121.908 2.717   1.00 23.03  ? 357 ALA B CB  1 
ATOM   6901 N N   . GLU B 1 361 ? 47.780 124.717 4.223   1.00 38.39  ? 358 GLU B N   1 
ATOM   6902 C CA  . GLU B 1 361 ? 48.415 125.954 4.663   1.00 43.63  ? 358 GLU B CA  1 
ATOM   6903 C C   . GLU B 1 361 ? 48.287 126.146 6.168   1.00 38.44  ? 358 GLU B C   1 
ATOM   6904 O O   . GLU B 1 361 ? 49.198 126.692 6.801   1.00 32.00  ? 358 GLU B O   1 
ATOM   6905 C CB  . GLU B 1 361 ? 47.816 127.146 3.917   1.00 34.88  ? 358 GLU B CB  1 
ATOM   6906 C CG  . GLU B 1 361 ? 48.180 127.190 2.441   1.00 33.33  ? 358 GLU B CG  1 
ATOM   6907 C CD  . GLU B 1 361 ? 47.381 128.221 1.670   1.00 31.00  ? 358 GLU B CD  1 
ATOM   6908 O OE1 . GLU B 1 361 ? 46.243 128.522 2.082   1.00 39.05  ? 358 GLU B OE1 1 
ATOM   6909 O OE2 . GLU B 1 361 ? 47.892 128.731 0.651   1.00 45.76  ? 358 GLU B OE2 1 
ATOM   6910 N N   . PHE B 1 362 ? 47.172 125.706 6.757   1.00 37.21  ? 359 PHE B N   1 
ATOM   6911 C CA  . PHE B 1 362 ? 47.038 125.756 8.209   1.00 38.39  ? 359 PHE B CA  1 
ATOM   6912 C C   . PHE B 1 362 ? 48.067 124.860 8.883   1.00 35.60  ? 359 PHE B C   1 
ATOM   6913 O O   . PHE B 1 362 ? 48.700 125.259 9.867   1.00 38.51  ? 359 PHE B O   1 
ATOM   6914 C CB  . PHE B 1 362 ? 45.621 125.354 8.623   1.00 29.89  ? 359 PHE B CB  1 
ATOM   6915 C CG  . PHE B 1 362 ? 45.440 125.209 10.110  1.00 34.56  ? 359 PHE B CG  1 
ATOM   6916 C CD1 . PHE B 1 362 ? 45.234 126.323 10.907  1.00 32.88  ? 359 PHE B CD1 1 
ATOM   6917 C CD2 . PHE B 1 362 ? 45.469 123.959 10.708  1.00 32.33  ? 359 PHE B CD2 1 
ATOM   6918 C CE1 . PHE B 1 362 ? 45.065 126.193 12.275  1.00 37.26  ? 359 PHE B CE1 1 
ATOM   6919 C CE2 . PHE B 1 362 ? 45.302 123.822 12.075  1.00 32.57  ? 359 PHE B CE2 1 
ATOM   6920 C CZ  . PHE B 1 362 ? 45.099 124.941 12.858  1.00 38.17  ? 359 PHE B CZ  1 
ATOM   6921 N N   . LEU B 1 363 ? 48.252 123.644 8.362   1.00 40.78  ? 360 LEU B N   1 
ATOM   6922 C CA  . LEU B 1 363 ? 49.226 122.727 8.946   1.00 44.58  ? 360 LEU B CA  1 
ATOM   6923 C C   . LEU B 1 363 ? 50.644 123.267 8.805   1.00 37.73  ? 360 LEU B C   1 
ATOM   6924 O O   . LEU B 1 363 ? 51.474 123.094 9.706   1.00 42.79  ? 360 LEU B O   1 
ATOM   6925 C CB  . LEU B 1 363 ? 49.103 121.351 8.292   1.00 43.56  ? 360 LEU B CB  1 
ATOM   6926 C CG  . LEU B 1 363 ? 47.763 120.639 8.498   1.00 41.66  ? 360 LEU B CG  1 
ATOM   6927 C CD1 . LEU B 1 363 ? 47.664 119.400 7.623   1.00 35.60  ? 360 LEU B CD1 1 
ATOM   6928 C CD2 . LEU B 1 363 ? 47.566 120.281 9.963   1.00 45.64  ? 360 LEU B CD2 1 
ATOM   6929 N N   . ALA B 1 364 ? 50.941 123.926 7.684   1.00 36.76  ? 361 ALA B N   1 
ATOM   6930 C CA  . ALA B 1 364 ? 52.259 124.525 7.511   1.00 40.39  ? 361 ALA B CA  1 
ATOM   6931 C C   . ALA B 1 364 ? 52.418 125.765 8.381   1.00 37.74  ? 361 ALA B C   1 
ATOM   6932 O O   . ALA B 1 364 ? 53.512 126.040 8.889   1.00 36.79  ? 361 ALA B O   1 
ATOM   6933 C CB  . ALA B 1 364 ? 52.496 124.865 6.040   1.00 25.40  ? 361 ALA B CB  1 
ATOM   6934 N N   . GLY B 1 365 ? 51.336 126.526 8.565   1.00 35.98  ? 362 GLY B N   1 
ATOM   6935 C CA  . GLY B 1 365 ? 51.411 127.723 9.383   1.00 35.75  ? 362 GLY B CA  1 
ATOM   6936 C C   . GLY B 1 365 ? 51.650 127.435 10.851  1.00 35.87  ? 362 GLY B C   1 
ATOM   6937 O O   . GLY B 1 365 ? 52.259 128.249 11.553  1.00 34.81  ? 362 GLY B O   1 
ATOM   6938 N N   . VAL B 1 366 ? 51.181 126.283 11.336  1.00 36.68  ? 363 VAL B N   1 
ATOM   6939 C CA  . VAL B 1 366 ? 51.395 125.922 12.735  1.00 29.29  ? 363 VAL B CA  1 
ATOM   6940 C C   . VAL B 1 366 ? 52.882 125.749 13.020  1.00 32.97  ? 363 VAL B C   1 
ATOM   6941 O O   . VAL B 1 366 ? 53.374 126.129 14.090  1.00 36.37  ? 363 VAL B O   1 
ATOM   6942 C CB  . VAL B 1 366 ? 50.595 124.654 13.088  1.00 31.47  ? 363 VAL B CB  1 
ATOM   6943 C CG1 . VAL B 1 366 ? 50.955 124.161 14.481  1.00 28.30  ? 363 VAL B CG1 1 
ATOM   6944 C CG2 . VAL B 1 366 ? 49.102 124.927 12.994  1.00 25.93  ? 363 VAL B CG2 1 
ATOM   6945 N N   . ARG B 1 367 ? 53.624 125.186 12.064  1.00 27.70  ? 364 ARG B N   1 
ATOM   6946 C CA  . ARG B 1 367 ? 55.062 125.025 12.253  1.00 39.10  ? 364 ARG B CA  1 
ATOM   6947 C C   . ARG B 1 367 ? 55.784 126.366 12.215  1.00 41.75  ? 364 ARG B C   1 
ATOM   6948 O O   . ARG B 1 367 ? 56.859 126.506 12.809  1.00 38.88  ? 364 ARG B O   1 
ATOM   6949 C CB  . ARG B 1 367 ? 55.635 124.081 11.194  1.00 30.60  ? 364 ARG B CB  1 
ATOM   6950 C CG  . ARG B 1 367 ? 54.881 122.766 11.055  1.00 40.82  ? 364 ARG B CG  1 
ATOM   6951 C CD  . ARG B 1 367 ? 54.631 122.113 12.407  1.00 44.75  ? 364 ARG B CD  1 
ATOM   6952 N NE  . ARG B 1 367 ? 55.864 121.692 13.065  1.00 52.46  ? 364 ARG B NE  1 
ATOM   6953 C CZ  . ARG B 1 367 ? 56.331 120.448 13.050  1.00 55.68  ? 364 ARG B CZ  1 
ATOM   6954 N NH1 . ARG B 1 367 ? 55.665 119.496 12.409  1.00 50.35  ? 364 ARG B NH1 1 
ATOM   6955 N NH2 . ARG B 1 367 ? 57.461 120.152 13.677  1.00 57.48  ? 364 ARG B NH2 1 
ATOM   6956 N N   . VAL B 1 368 ? 55.215 127.356 11.526  1.00 29.96  ? 365 VAL B N   1 
ATOM   6957 C CA  . VAL B 1 368 ? 55.796 128.694 11.528  1.00 38.02  ? 365 VAL B CA  1 
ATOM   6958 C C   . VAL B 1 368 ? 55.418 129.440 12.802  1.00 39.82  ? 365 VAL B C   1 
ATOM   6959 O O   . VAL B 1 368 ? 56.248 130.139 13.394  1.00 42.55  ? 365 VAL B O   1 
ATOM   6960 C CB  . VAL B 1 368 ? 55.360 129.461 10.266  1.00 43.03  ? 365 VAL B CB  1 
ATOM   6961 C CG1 . VAL B 1 368 ? 55.849 130.901 10.317  1.00 34.89  ? 365 VAL B CG1 1 
ATOM   6962 C CG2 . VAL B 1 368 ? 55.874 128.762 9.016   1.00 37.65  ? 365 VAL B CG2 1 
ATOM   6963 N N   . GLY B 1 369 ? 54.168 129.296 13.248  1.00 33.94  ? 366 GLY B N   1 
ATOM   6964 C CA  . GLY B 1 369 ? 53.740 129.972 14.460  1.00 26.23  ? 366 GLY B CA  1 
ATOM   6965 C C   . GLY B 1 369 ? 54.287 129.343 15.725  1.00 39.16  ? 366 GLY B C   1 
ATOM   6966 O O   . GLY B 1 369 ? 54.447 130.026 16.741  1.00 45.62  ? 366 GLY B O   1 
ATOM   6967 N N   . VAL B 1 370 ? 54.573 128.045 15.690  1.00 35.65  ? 367 VAL B N   1 
ATOM   6968 C CA  . VAL B 1 370 ? 55.138 127.340 16.839  1.00 39.18  ? 367 VAL B CA  1 
ATOM   6969 C C   . VAL B 1 370 ? 56.433 126.665 16.402  1.00 41.52  ? 367 VAL B C   1 
ATOM   6970 O O   . VAL B 1 370 ? 56.437 125.458 16.120  1.00 47.06  ? 367 VAL B O   1 
ATOM   6971 C CB  . VAL B 1 370 ? 54.145 126.318 17.417  1.00 35.67  ? 367 VAL B CB  1 
ATOM   6972 C CG1 . VAL B 1 370 ? 54.616 125.828 18.777  1.00 28.78  ? 367 VAL B CG1 1 
ATOM   6973 C CG2 . VAL B 1 370 ? 52.752 126.919 17.518  1.00 35.33  ? 367 VAL B CG2 1 
ATOM   6974 N N   . PRO B 1 371 ? 57.544 127.389 16.325  1.00 44.86  ? 368 PRO B N   1 
ATOM   6975 C CA  . PRO B 1 371 ? 58.796 126.780 15.871  1.00 37.10  ? 368 PRO B CA  1 
ATOM   6976 C C   . PRO B 1 371 ? 59.486 125.991 16.974  1.00 42.12  ? 368 PRO B C   1 
ATOM   6977 O O   . PRO B 1 371 ? 59.245 126.184 18.168  1.00 52.84  ? 368 PRO B O   1 
ATOM   6978 C CB  . PRO B 1 371 ? 59.639 127.989 15.453  1.00 44.47  ? 368 PRO B CB  1 
ATOM   6979 C CG  . PRO B 1 371 ? 59.159 129.084 16.343  1.00 39.91  ? 368 PRO B CG  1 
ATOM   6980 C CD  . PRO B 1 371 ? 57.686 128.837 16.563  1.00 40.87  ? 368 PRO B CD  1 
ATOM   6981 N N   . GLN B 1 372 ? 60.360 125.083 16.537  1.00 45.75  ? 369 GLN B N   1 
ATOM   6982 C CA  . GLN B 1 372 ? 61.188 124.265 17.427  1.00 65.32  ? 369 GLN B CA  1 
ATOM   6983 C C   . GLN B 1 372 ? 60.338 123.398 18.356  1.00 57.04  ? 369 GLN B C   1 
ATOM   6984 O O   . GLN B 1 372 ? 60.569 123.331 19.565  1.00 58.93  ? 369 GLN B O   1 
ATOM   6985 C CB  . GLN B 1 372 ? 62.160 125.130 18.232  1.00 76.01  ? 369 GLN B CB  1 
ATOM   6986 C CG  . GLN B 1 372 ? 63.562 125.195 17.654  1.00 92.77  ? 369 GLN B CG  1 
ATOM   6987 C CD  . GLN B 1 372 ? 64.619 125.334 18.731  1.00 104.50 ? 369 GLN B CD  1 
ATOM   6988 O OE1 . GLN B 1 372 ? 64.376 125.021 19.896  1.00 102.22 ? 369 GLN B OE1 1 
ATOM   6989 N NE2 . GLN B 1 372 ? 65.800 125.807 18.348  1.00 87.43  ? 369 GLN B NE2 1 
ATOM   6990 N N   . VAL B 1 373 ? 59.349 122.722 17.780  1.00 55.61  ? 370 VAL B N   1 
ATOM   6991 C CA  . VAL B 1 373 ? 58.558 121.740 18.508  1.00 53.91  ? 370 VAL B CA  1 
ATOM   6992 C C   . VAL B 1 373 ? 58.546 120.444 17.712  1.00 54.43  ? 370 VAL B C   1 
ATOM   6993 O O   . VAL B 1 373 ? 58.582 120.449 16.477  1.00 55.20  ? 370 VAL B O   1 
ATOM   6994 C CB  . VAL B 1 373 ? 57.117 122.224 18.787  1.00 45.87  ? 370 VAL B CB  1 
ATOM   6995 C CG1 . VAL B 1 373 ? 57.131 123.406 19.746  1.00 48.38  ? 370 VAL B CG1 1 
ATOM   6996 C CG2 . VAL B 1 373 ? 56.404 122.580 17.491  1.00 49.33  ? 370 VAL B CG2 1 
ATOM   6997 N N   . SER B 1 374 ? 58.511 119.327 18.433  1.00 57.79  ? 371 SER B N   1 
ATOM   6998 C CA  . SER B 1 374 ? 58.469 118.023 17.794  1.00 46.37  ? 371 SER B CA  1 
ATOM   6999 C C   . SER B 1 374 ? 57.204 117.883 16.953  1.00 53.94  ? 371 SER B C   1 
ATOM   7000 O O   . SER B 1 374 ? 56.204 118.576 17.162  1.00 49.70  ? 371 SER B O   1 
ATOM   7001 C CB  . SER B 1 374 ? 58.529 116.913 18.844  1.00 57.89  ? 371 SER B CB  1 
ATOM   7002 O OG  . SER B 1 374 ? 57.493 117.063 19.800  1.00 52.33  ? 371 SER B OG  1 
ATOM   7003 N N   . ASP B 1 375 ? 57.263 116.973 15.977  1.00 58.73  ? 372 ASP B N   1 
ATOM   7004 C CA  . ASP B 1 375 ? 56.092 116.708 15.149  1.00 49.92  ? 372 ASP B CA  1 
ATOM   7005 C C   . ASP B 1 375 ? 54.914 116.236 15.989  1.00 49.21  ? 372 ASP B C   1 
ATOM   7006 O O   . ASP B 1 375 ? 53.758 116.502 15.643  1.00 56.30  ? 372 ASP B O   1 
ATOM   7007 C CB  . ASP B 1 375 ? 56.428 115.677 14.071  1.00 60.28  ? 372 ASP B CB  1 
ATOM   7008 C CG  . ASP B 1 375 ? 57.503 116.161 13.118  1.00 72.30  ? 372 ASP B CG  1 
ATOM   7009 O OD1 . ASP B 1 375 ? 57.671 117.392 12.983  1.00 67.01  ? 372 ASP B OD1 1 
ATOM   7010 O OD2 . ASP B 1 375 ? 58.177 115.310 12.500  1.00 78.83  ? 372 ASP B OD2 1 
ATOM   7011 N N   . LEU B 1 376 ? 55.186 115.541 17.097  1.00 43.38  ? 373 LEU B N   1 
ATOM   7012 C CA  . LEU B 1 376 ? 54.118 115.162 18.015  1.00 45.18  ? 373 LEU B CA  1 
ATOM   7013 C C   . LEU B 1 376 ? 53.511 116.387 18.687  1.00 50.45  ? 373 LEU B C   1 
ATOM   7014 O O   . LEU B 1 376 ? 52.290 116.461 18.871  1.00 50.49  ? 373 LEU B O   1 
ATOM   7015 C CB  . LEU B 1 376 ? 54.648 114.184 19.063  1.00 52.01  ? 373 LEU B CB  1 
ATOM   7016 C CG  . LEU B 1 376 ? 53.657 113.743 20.142  1.00 47.85  ? 373 LEU B CG  1 
ATOM   7017 C CD1 . LEU B 1 376 ? 52.507 112.955 19.532  1.00 49.58  ? 373 LEU B CD1 1 
ATOM   7018 C CD2 . LEU B 1 376 ? 54.359 112.931 21.220  1.00 46.13  ? 373 LEU B CD2 1 
ATOM   7019 N N   . ALA B 1 377 ? 54.349 117.358 19.063  1.00 40.34  ? 374 ALA B N   1 
ATOM   7020 C CA  . ALA B 1 377 ? 53.836 118.584 19.665  1.00 38.05  ? 374 ALA B CA  1 
ATOM   7021 C C   . ALA B 1 377 ? 52.967 119.356 18.682  1.00 34.41  ? 374 ALA B C   1 
ATOM   7022 O O   . ALA B 1 377 ? 51.939 119.927 19.064  1.00 32.28  ? 374 ALA B O   1 
ATOM   7023 C CB  . ALA B 1 377 ? 54.992 119.453 20.159  1.00 40.76  ? 374 ALA B CB  1 
ATOM   7024 N N   . ALA B 1 378 ? 53.365 119.382 17.408  1.00 34.83  ? 375 ALA B N   1 
ATOM   7025 C CA  . ALA B 1 378 ? 52.549 120.036 16.392  1.00 34.07  ? 375 ALA B CA  1 
ATOM   7026 C C   . ALA B 1 378 ? 51.206 119.334 16.232  1.00 49.26  ? 375 ALA B C   1 
ATOM   7027 O O   . ALA B 1 378 ? 50.176 119.989 16.035  1.00 48.00  ? 375 ALA B O   1 
ATOM   7028 C CB  . ALA B 1 378 ? 53.298 120.075 15.061  1.00 34.94  ? 375 ALA B CB  1 
ATOM   7029 N N   . GLU B 1 379 ? 51.199 118.000 16.314  1.00 44.55  ? 376 GLU B N   1 
ATOM   7030 C CA  . GLU B 1 379 ? 49.945 117.258 16.236  1.00 42.56  ? 376 GLU B CA  1 
ATOM   7031 C C   . GLU B 1 379 ? 48.994 117.663 17.355  1.00 42.22  ? 376 GLU B C   1 
ATOM   7032 O O   . GLU B 1 379 ? 47.787 117.809 17.132  1.00 46.64  ? 376 GLU B O   1 
ATOM   7033 C CB  . GLU B 1 379 ? 50.219 115.754 16.289  1.00 52.64  ? 376 GLU B CB  1 
ATOM   7034 C CG  . GLU B 1 379 ? 50.920 115.189 15.062  1.00 58.34  ? 376 GLU B CG  1 
ATOM   7035 C CD  . GLU B 1 379 ? 49.971 114.914 13.910  1.00 74.89  ? 376 GLU B CD  1 
ATOM   7036 O OE1 . GLU B 1 379 ? 48.766 115.221 14.037  1.00 75.66  ? 376 GLU B OE1 1 
ATOM   7037 O OE2 . GLU B 1 379 ? 50.430 114.382 12.878  1.00 76.97  ? 376 GLU B OE2 1 
ATOM   7038 N N   . ALA B 1 380 ? 49.522 117.849 18.568  1.00 37.97  ? 377 ALA B N   1 
ATOM   7039 C CA  . ALA B 1 380 ? 48.677 118.247 19.689  1.00 34.93  ? 377 ALA B CA  1 
ATOM   7040 C C   . ALA B 1 380 ? 48.116 119.648 19.488  1.00 41.04  ? 377 ALA B C   1 
ATOM   7041 O O   . ALA B 1 380 ? 46.980 119.931 19.889  1.00 42.93  ? 377 ALA B O   1 
ATOM   7042 C CB  . ALA B 1 380 ? 49.464 118.164 20.996  1.00 37.87  ? 377 ALA B CB  1 
ATOM   7043 N N   . VAL B 1 381 ? 48.897 120.540 18.874  1.00 41.12  ? 378 VAL B N   1 
ATOM   7044 C CA  . VAL B 1 381 ? 48.404 121.884 18.594  1.00 35.87  ? 378 VAL B CA  1 
ATOM   7045 C C   . VAL B 1 381 ? 47.277 121.837 17.570  1.00 35.39  ? 378 VAL B C   1 
ATOM   7046 O O   . VAL B 1 381 ? 46.251 122.510 17.726  1.00 33.09  ? 378 VAL B O   1 
ATOM   7047 C CB  . VAL B 1 381 ? 49.557 122.790 18.126  1.00 36.45  ? 378 VAL B CB  1 
ATOM   7048 C CG1 . VAL B 1 381 ? 49.028 124.165 17.753  1.00 29.93  ? 378 VAL B CG1 1 
ATOM   7049 C CG2 . VAL B 1 381 ? 50.618 122.901 19.209  1.00 30.26  ? 378 VAL B CG2 1 
ATOM   7050 N N   . VAL B 1 382 ? 47.446 121.040 16.513  1.00 36.79  ? 379 VAL B N   1 
ATOM   7051 C CA  . VAL B 1 382 ? 46.404 120.925 15.497  1.00 38.12  ? 379 VAL B CA  1 
ATOM   7052 C C   . VAL B 1 382 ? 45.148 120.296 16.088  1.00 44.91  ? 379 VAL B C   1 
ATOM   7053 O O   . VAL B 1 382 ? 44.025 120.682 15.746  1.00 45.25  ? 379 VAL B O   1 
ATOM   7054 C CB  . VAL B 1 382 ? 46.927 120.130 14.286  1.00 37.42  ? 379 VAL B CB  1 
ATOM   7055 C CG1 . VAL B 1 382 ? 45.846 119.994 13.227  1.00 49.42  ? 379 VAL B CG1 1 
ATOM   7056 C CG2 . VAL B 1 382 ? 48.162 120.800 13.701  1.00 42.01  ? 379 VAL B CG2 1 
ATOM   7057 N N   . LEU B 1 383 ? 45.315 119.331 16.996  1.00 41.75  ? 380 LEU B N   1 
ATOM   7058 C CA  . LEU B 1 383 ? 44.161 118.685 17.617  1.00 38.46  ? 380 LEU B CA  1 
ATOM   7059 C C   . LEU B 1 383 ? 43.338 119.680 18.428  1.00 44.27  ? 380 LEU B C   1 
ATOM   7060 O O   . LEU B 1 383 ? 42.102 119.669 18.368  1.00 49.08  ? 380 LEU B O   1 
ATOM   7061 C CB  . LEU B 1 383 ? 44.634 117.518 18.491  1.00 53.24  ? 380 LEU B CB  1 
ATOM   7062 C CG  . LEU B 1 383 ? 43.717 116.737 19.449  1.00 55.71  ? 380 LEU B CG  1 
ATOM   7063 C CD1 . LEU B 1 383 ? 43.653 117.381 20.836  1.00 51.11  ? 380 LEU B CD1 1 
ATOM   7064 C CD2 . LEU B 1 383 ? 42.319 116.504 18.875  1.00 43.48  ? 380 LEU B CD2 1 
ATOM   7065 N N   A HIS B 1 384 ? 44.003 120.555 19.184  0.51 44.00  ? 381 HIS B N   1 
ATOM   7066 N N   B HIS B 1 384 ? 44.004 120.551 19.188  0.49 44.00  ? 381 HIS B N   1 
ATOM   7067 C CA  A HIS B 1 384 ? 43.275 121.480 20.045  0.51 40.91  ? 381 HIS B CA  1 
ATOM   7068 C CA  B HIS B 1 384 ? 43.298 121.488 20.056  0.49 40.90  ? 381 HIS B CA  1 
ATOM   7069 C C   A HIS B 1 384 ? 42.611 122.599 19.252  0.51 36.65  ? 381 HIS B C   1 
ATOM   7070 C C   B HIS B 1 384 ? 42.656 122.636 19.287  0.49 36.34  ? 381 HIS B C   1 
ATOM   7071 O O   A HIS B 1 384 ? 41.565 123.110 19.666  0.51 40.16  ? 381 HIS B O   1 
ATOM   7072 O O   B HIS B 1 384 ? 41.666 123.208 19.757  0.49 40.18  ? 381 HIS B O   1 
ATOM   7073 C CB  A HIS B 1 384 ? 44.214 122.071 21.096  0.51 36.37  ? 381 HIS B CB  1 
ATOM   7074 C CB  B HIS B 1 384 ? 44.253 122.047 21.113  0.49 36.66  ? 381 HIS B CB  1 
ATOM   7075 C CG  A HIS B 1 384 ? 43.531 122.989 22.059  0.51 35.08  ? 381 HIS B CG  1 
ATOM   7076 C CG  B HIS B 1 384 ? 44.091 121.420 22.462  0.49 39.32  ? 381 HIS B CG  1 
ATOM   7077 N ND1 A HIS B 1 384 ? 43.033 122.560 23.270  0.51 35.82  ? 381 HIS B ND1 1 
ATOM   7078 N ND1 B HIS B 1 384 ? 44.388 120.098 22.709  0.49 39.53  ? 381 HIS B ND1 1 
ATOM   7079 C CD2 A HIS B 1 384 ? 43.249 124.312 21.984  0.51 37.73  ? 381 HIS B CD2 1 
ATOM   7080 C CD2 B HIS B 1 384 ? 43.653 121.933 23.635  0.49 36.40  ? 381 HIS B CD2 1 
ATOM   7081 C CE1 A HIS B 1 384 ? 42.481 123.579 23.903  0.51 40.08  ? 381 HIS B CE1 1 
ATOM   7082 C CE1 B HIS B 1 384 ? 44.144 119.824 23.978  0.49 37.41  ? 381 HIS B CE1 1 
ATOM   7083 N NE2 A HIS B 1 384 ? 42.597 124.653 23.144  0.51 40.18  ? 381 HIS B NE2 1 
ATOM   7084 N NE2 B HIS B 1 384 ? 43.696 120.921 24.562  0.49 38.47  ? 381 HIS B NE2 1 
ATOM   7085 N N   . TYR B 1 385 ? 43.193 122.992 18.120  1.00 33.45  ? 382 TYR B N   1 
ATOM   7086 C CA  . TYR B 1 385 ? 42.716 124.147 17.370  1.00 38.18  ? 382 TYR B CA  1 
ATOM   7087 C C   . TYR B 1 385 ? 41.991 123.783 16.080  1.00 36.73  ? 382 TYR B C   1 
ATOM   7088 O O   . TYR B 1 385 ? 41.710 124.673 15.271  1.00 43.88  ? 382 TYR B O   1 
ATOM   7089 C CB  . TYR B 1 385 ? 43.881 125.094 17.075  1.00 29.94  ? 382 TYR B CB  1 
ATOM   7090 C CG  . TYR B 1 385 ? 44.342 125.845 18.300  1.00 31.68  ? 382 TYR B CG  1 
ATOM   7091 C CD1 . TYR B 1 385 ? 43.772 127.063 18.644  1.00 35.16  ? 382 TYR B CD1 1 
ATOM   7092 C CD2 . TYR B 1 385 ? 45.334 125.329 19.123  1.00 26.56  ? 382 TYR B CD2 1 
ATOM   7093 C CE1 . TYR B 1 385 ? 44.181 127.751 19.767  1.00 26.61  ? 382 TYR B CE1 1 
ATOM   7094 C CE2 . TYR B 1 385 ? 45.751 126.011 20.250  1.00 33.33  ? 382 TYR B CE2 1 
ATOM   7095 C CZ  . TYR B 1 385 ? 45.171 127.222 20.567  1.00 29.38  ? 382 TYR B CZ  1 
ATOM   7096 O OH  . TYR B 1 385 ? 45.578 127.909 21.686  1.00 39.18  ? 382 TYR B OH  1 
ATOM   7097 N N   . THR B 1 386 ? 41.667 122.511 15.871  1.00 43.39  ? 383 THR B N   1 
ATOM   7098 C CA  . THR B 1 386 ? 40.854 122.097 14.736  1.00 36.80  ? 383 THR B CA  1 
ATOM   7099 C C   . THR B 1 386 ? 39.413 121.909 15.187  1.00 40.14  ? 383 THR B C   1 
ATOM   7100 O O   . THR B 1 386 ? 39.152 121.214 16.174  1.00 43.84  ? 383 THR B O   1 
ATOM   7101 C CB  . THR B 1 386 ? 41.374 120.798 14.114  1.00 39.86  ? 383 THR B CB  1 
ATOM   7102 O OG1 . THR B 1 386 ? 42.668 121.021 13.539  1.00 37.71  ? 383 THR B OG1 1 
ATOM   7103 C CG2 . THR B 1 386 ? 40.419 120.302 13.033  1.00 37.18  ? 383 THR B CG2 1 
ATOM   7104 N N   . ASP B 1 387 ? 38.485 122.543 14.475  1.00 44.36  ? 384 ASP B N   1 
ATOM   7105 C CA  . ASP B 1 387 ? 37.064 122.244 14.622  1.00 34.99  ? 384 ASP B CA  1 
ATOM   7106 C C   . ASP B 1 387 ? 36.793 121.002 13.787  1.00 46.07  ? 384 ASP B C   1 
ATOM   7107 O O   . ASP B 1 387 ? 36.644 121.079 12.567  1.00 42.21  ? 384 ASP B O   1 
ATOM   7108 C CB  . ASP B 1 387 ? 36.210 123.425 14.173  1.00 41.02  ? 384 ASP B CB  1 
ATOM   7109 C CG  . ASP B 1 387 ? 34.739 123.259 14.528  1.00 47.85  ? 384 ASP B CG  1 
ATOM   7110 O OD1 . ASP B 1 387 ? 34.079 124.284 14.799  1.00 49.78  ? 384 ASP B OD1 1 
ATOM   7111 O OD2 . ASP B 1 387 ? 34.238 122.115 14.536  1.00 46.22  ? 384 ASP B OD2 1 
ATOM   7112 N N   . TRP B 1 388 ? 36.737 119.844 14.440  1.00 51.43  ? 385 TRP B N   1 
ATOM   7113 C CA  . TRP B 1 388 ? 36.624 118.590 13.706  1.00 50.71  ? 385 TRP B CA  1 
ATOM   7114 C C   . TRP B 1 388 ? 35.251 118.378 13.088  1.00 38.39  ? 385 TRP B C   1 
ATOM   7115 O O   . TRP B 1 388 ? 35.062 117.386 12.375  1.00 44.63  ? 385 TRP B O   1 
ATOM   7116 C CB  . TRP B 1 388 ? 36.993 117.426 14.624  1.00 43.22  ? 385 TRP B CB  1 
ATOM   7117 C CG  . TRP B 1 388 ? 38.429 117.486 15.023  1.00 41.82  ? 385 TRP B CG  1 
ATOM   7118 C CD1 . TRP B 1 388 ? 38.937 117.955 16.199  1.00 45.71  ? 385 TRP B CD1 1 
ATOM   7119 C CD2 . TRP B 1 388 ? 39.553 117.100 14.225  1.00 36.01  ? 385 TRP B CD2 1 
ATOM   7120 N NE1 . TRP B 1 388 ? 40.308 117.866 16.190  1.00 39.90  ? 385 TRP B NE1 1 
ATOM   7121 C CE2 . TRP B 1 388 ? 40.711 117.345 14.988  1.00 34.44  ? 385 TRP B CE2 1 
ATOM   7122 C CE3 . TRP B 1 388 ? 39.692 116.562 12.941  1.00 30.85  ? 385 TRP B CE3 1 
ATOM   7123 C CZ2 . TRP B 1 388 ? 41.991 117.070 14.512  1.00 40.60  ? 385 TRP B CZ2 1 
ATOM   7124 C CZ3 . TRP B 1 388 ? 40.963 116.290 12.469  1.00 31.38  ? 385 TRP B CZ3 1 
ATOM   7125 C CH2 . TRP B 1 388 ? 42.096 116.545 13.253  1.00 43.28  ? 385 TRP B CH2 1 
ATOM   7126 N N   . LEU B 1 389 ? 34.298 119.276 13.332  1.00 43.09  ? 386 LEU B N   1 
ATOM   7127 C CA  . LEU B 1 389 ? 33.051 119.282 12.583  1.00 42.52  ? 386 LEU B CA  1 
ATOM   7128 C C   . LEU B 1 389 ? 33.155 120.091 11.297  1.00 50.15  ? 386 LEU B C   1 
ATOM   7129 O O   . LEU B 1 389 ? 32.338 119.899 10.389  1.00 58.05  ? 386 LEU B O   1 
ATOM   7130 C CB  . LEU B 1 389 ? 31.915 119.829 13.454  1.00 40.69  ? 386 LEU B CB  1 
ATOM   7131 C CG  . LEU B 1 389 ? 30.488 119.454 13.050  1.00 58.84  ? 386 LEU B CG  1 
ATOM   7132 C CD1 . LEU B 1 389 ? 30.370 117.952 12.841  1.00 51.01  ? 386 LEU B CD1 1 
ATOM   7133 C CD2 . LEU B 1 389 ? 29.498 119.924 14.104  1.00 50.35  ? 386 LEU B CD2 1 
ATOM   7134 N N   . HIS B 1 390 ? 34.140 120.988 11.203  1.00 48.15  ? 387 HIS B N   1 
ATOM   7135 C CA  . HIS B 1 390 ? 34.429 121.730 9.973   1.00 44.02  ? 387 HIS B CA  1 
ATOM   7136 C C   . HIS B 1 390 ? 35.941 121.829 9.802   1.00 51.02  ? 387 HIS B C   1 
ATOM   7137 O O   . HIS B 1 390 ? 36.517 122.920 9.826   1.00 48.86  ? 387 HIS B O   1 
ATOM   7138 C CB  . HIS B 1 390 ? 33.789 123.118 10.010  1.00 40.87  ? 387 HIS B CB  1 
ATOM   7139 C CG  . HIS B 1 390 ? 32.368 123.120 10.481  1.00 49.46  ? 387 HIS B CG  1 
ATOM   7140 N ND1 . HIS B 1 390 ? 31.312 122.778 9.665   1.00 55.08  ? 387 HIS B ND1 1 
ATOM   7141 C CD2 . HIS B 1 390 ? 31.829 123.430 11.684  1.00 48.98  ? 387 HIS B CD2 1 
ATOM   7142 C CE1 . HIS B 1 390 ? 30.183 122.873 10.346  1.00 54.10  ? 387 HIS B CE1 1 
ATOM   7143 N NE2 . HIS B 1 390 ? 30.470 123.267 11.574  1.00 61.87  ? 387 HIS B NE2 1 
ATOM   7144 N N   . PRO B 1 391 ? 36.621 120.692 9.621   1.00 50.72  ? 388 PRO B N   1 
ATOM   7145 C CA  . PRO B 1 391 ? 38.092 120.698 9.674   1.00 43.51  ? 388 PRO B CA  1 
ATOM   7146 C C   . PRO B 1 391 ? 38.757 121.355 8.477   1.00 44.50  ? 388 PRO B C   1 
ATOM   7147 O O   . PRO B 1 391 ? 39.976 121.567 8.514   1.00 48.84  ? 388 PRO B O   1 
ATOM   7148 C CB  . PRO B 1 391 ? 38.441 119.208 9.747   1.00 47.72  ? 388 PRO B CB  1 
ATOM   7149 C CG  . PRO B 1 391 ? 37.332 118.546 9.003   1.00 40.00  ? 388 PRO B CG  1 
ATOM   7150 C CD  . PRO B 1 391 ? 36.089 119.357 9.290   1.00 47.07  ? 388 PRO B CD  1 
ATOM   7151 N N   . GLU B 1 392 ? 38.010 121.685 7.425   1.00 53.69  ? 389 GLU B N   1 
ATOM   7152 C CA  . GLU B 1 392 ? 38.584 122.263 6.219   1.00 49.29  ? 389 GLU B CA  1 
ATOM   7153 C C   . GLU B 1 392 ? 38.043 123.648 5.898   1.00 42.01  ? 389 GLU B C   1 
ATOM   7154 O O   . GLU B 1 392 ? 38.438 124.225 4.878   1.00 43.09  ? 389 GLU B O   1 
ATOM   7155 C CB  . GLU B 1 392 ? 38.342 121.336 5.019   1.00 43.34  ? 389 GLU B CB  1 
ATOM   7156 C CG  . GLU B 1 392 ? 38.666 119.870 5.274   1.00 56.82  ? 389 GLU B CG  1 
ATOM   7157 C CD  . GLU B 1 392 ? 40.090 119.506 4.903   1.00 63.39  ? 389 GLU B CD  1 
ATOM   7158 O OE1 . GLU B 1 392 ? 40.666 118.609 5.556   1.00 70.60  ? 389 GLU B OE1 1 
ATOM   7159 O OE2 . GLU B 1 392 ? 40.632 120.112 3.955   1.00 64.27  ? 389 GLU B OE2 1 
ATOM   7160 N N   . ASP B 1 393 ? 37.154 124.193 6.722   1.00 39.70  ? 390 ASP B N   1 
ATOM   7161 C CA  . ASP B 1 393 ? 36.580 125.508 6.465   1.00 44.30  ? 390 ASP B CA  1 
ATOM   7162 C C   . ASP B 1 393 ? 37.679 126.565 6.475   1.00 42.17  ? 390 ASP B C   1 
ATOM   7163 O O   . ASP B 1 393 ? 38.336 126.752 7.510   1.00 41.95  ? 390 ASP B O   1 
ATOM   7164 C CB  . ASP B 1 393 ? 35.512 125.841 7.505   1.00 31.64  ? 390 ASP B CB  1 
ATOM   7165 C CG  . ASP B 1 393 ? 34.830 127.170 7.238   1.00 38.44  ? 390 ASP B CG  1 
ATOM   7166 O OD1 . ASP B 1 393 ? 34.779 127.592 6.064   1.00 54.95  ? 390 ASP B OD1 1 
ATOM   7167 O OD2 . ASP B 1 393 ? 34.340 127.793 8.203   1.00 49.16  ? 390 ASP B OD2 1 
ATOM   7168 N N   . PRO B 1 394 ? 37.917 127.264 5.360   1.00 44.28  ? 391 PRO B N   1 
ATOM   7169 C CA  . PRO B 1 394 ? 39.028 128.231 5.330   1.00 40.14  ? 391 PRO B CA  1 
ATOM   7170 C C   . PRO B 1 394 ? 38.902 129.335 6.364   1.00 33.31  ? 391 PRO B C   1 
ATOM   7171 O O   . PRO B 1 394 ? 39.909 129.728 6.967   1.00 33.18  ? 391 PRO B O   1 
ATOM   7172 C CB  . PRO B 1 394 ? 38.965 128.785 3.899   1.00 47.18  ? 391 PRO B CB  1 
ATOM   7173 C CG  . PRO B 1 394 ? 38.267 127.726 3.112   1.00 47.54  ? 391 PRO B CG  1 
ATOM   7174 C CD  . PRO B 1 394 ? 37.260 127.133 4.049   1.00 40.22  ? 391 PRO B CD  1 
ATOM   7175 N N   . ALA B 1 395 ? 37.691 129.845 6.588   1.00 35.00  ? 392 ALA B N   1 
ATOM   7176 C CA  . ALA B 1 395 ? 37.510 130.922 7.556   1.00 32.98  ? 392 ALA B CA  1 
ATOM   7177 C C   . ALA B 1 395 ? 37.891 130.467 8.960   1.00 42.41  ? 392 ALA B C   1 
ATOM   7178 O O   . ALA B 1 395 ? 38.632 131.158 9.667   1.00 43.94  ? 392 ALA B O   1 
ATOM   7179 C CB  . ALA B 1 395 ? 36.066 131.423 7.519   1.00 37.26  ? 392 ALA B CB  1 
ATOM   7180 N N   . ARG B 1 396 ? 37.405 129.293 9.373   1.00 42.27  ? 393 ARG B N   1 
ATOM   7181 C CA  . ARG B 1 396 ? 37.699 128.800 10.716  1.00 34.07  ? 393 ARG B CA  1 
ATOM   7182 C C   . ARG B 1 396 ? 39.184 128.508 10.895  1.00 32.26  ? 393 ARG B C   1 
ATOM   7183 O O   . ARG B 1 396 ? 39.748 128.774 11.964  1.00 37.19  ? 393 ARG B O   1 
ATOM   7184 C CB  . ARG B 1 396 ? 36.870 127.551 11.010  1.00 35.78  ? 393 ARG B CB  1 
ATOM   7185 C CG  . ARG B 1 396 ? 35.402 127.824 11.279  1.00 38.86  ? 393 ARG B CG  1 
ATOM   7186 C CD  . ARG B 1 396 ? 34.650 126.526 11.509  1.00 49.50  ? 393 ARG B CD  1 
ATOM   7187 N NE  . ARG B 1 396 ? 33.287 126.754 11.977  1.00 44.48  ? 393 ARG B NE  1 
ATOM   7188 C CZ  . ARG B 1 396 ? 32.219 126.761 11.188  1.00 48.18  ? 393 ARG B CZ  1 
ATOM   7189 N NH1 . ARG B 1 396 ? 32.355 126.550 9.886   1.00 51.24  ? 393 ARG B NH1 1 
ATOM   7190 N NH2 . ARG B 1 396 ? 31.015 126.975 11.699  1.00 37.72  ? 393 ARG B NH2 1 
ATOM   7191 N N   . LEU B 1 397 ? 39.833 127.953 9.867   1.00 31.52  ? 394 LEU B N   1 
ATOM   7192 C CA  . LEU B 1 397 ? 41.270 127.705 9.951   1.00 35.65  ? 394 LEU B CA  1 
ATOM   7193 C C   . LEU B 1 397 ? 42.053 129.005 10.083  1.00 38.98  ? 394 LEU B C   1 
ATOM   7194 O O   . LEU B 1 397 ? 43.116 129.029 10.716  1.00 38.91  ? 394 LEU B O   1 
ATOM   7195 C CB  . LEU B 1 397 ? 41.741 126.925 8.723   1.00 31.93  ? 394 LEU B CB  1 
ATOM   7196 C CG  . LEU B 1 397 ? 41.182 125.509 8.581   1.00 39.16  ? 394 LEU B CG  1 
ATOM   7197 C CD1 . LEU B 1 397 ? 41.571 124.908 7.241   1.00 35.64  ? 394 LEU B CD1 1 
ATOM   7198 C CD2 . LEU B 1 397 ? 41.665 124.633 9.726   1.00 30.70  ? 394 LEU B CD2 1 
ATOM   7199 N N   . ARG B 1 398 ? 41.543 130.088 9.494   1.00 33.51  ? 395 ARG B N   1 
ATOM   7200 C CA  . ARG B 1 398 ? 42.186 131.391 9.628   1.00 37.08  ? 395 ARG B CA  1 
ATOM   7201 C C   . ARG B 1 398 ? 42.128 131.888 11.066  1.00 38.47  ? 395 ARG B C   1 
ATOM   7202 O O   . ARG B 1 398 ? 43.144 132.322 11.625  1.00 32.24  ? 395 ARG B O   1 
ATOM   7203 C CB  . ARG B 1 398 ? 41.524 132.387 8.677   1.00 33.34  ? 395 ARG B CB  1 
ATOM   7204 C CG  . ARG B 1 398 ? 42.126 133.778 8.680   1.00 35.56  ? 395 ARG B CG  1 
ATOM   7205 C CD  . ARG B 1 398 ? 41.222 134.728 7.918   1.00 29.84  ? 395 ARG B CD  1 
ATOM   7206 N NE  . ARG B 1 398 ? 39.914 134.838 8.558   1.00 30.79  ? 395 ARG B NE  1 
ATOM   7207 C CZ  . ARG B 1 398 ? 38.805 135.231 7.940   1.00 30.29  ? 395 ARG B CZ  1 
ATOM   7208 N NH1 . ARG B 1 398 ? 38.834 135.545 6.652   1.00 27.71  ? 395 ARG B NH1 1 
ATOM   7209 N NH2 . ARG B 1 398 ? 37.662 135.301 8.610   1.00 31.85  ? 395 ARG B NH2 1 
ATOM   7210 N N   . GLU B 1 399 ? 40.945 131.832 11.686  1.00 37.18  ? 396 GLU B N   1 
ATOM   7211 C CA  . GLU B 1 399 ? 40.826 132.251 13.078  1.00 33.09  ? 396 GLU B CA  1 
ATOM   7212 C C   . GLU B 1 399 ? 41.544 131.291 14.017  1.00 34.88  ? 396 GLU B C   1 
ATOM   7213 O O   . GLU B 1 399 ? 41.935 131.683 15.122  1.00 40.51  ? 396 GLU B O   1 
ATOM   7214 C CB  . GLU B 1 399 ? 39.354 132.363 13.483  1.00 28.43  ? 396 GLU B CB  1 
ATOM   7215 C CG  . GLU B 1 399 ? 38.397 132.625 12.336  1.00 45.99  ? 396 GLU B CG  1 
ATOM   7216 C CD  . GLU B 1 399 ? 38.275 134.093 11.966  1.00 63.81  ? 396 GLU B CD  1 
ATOM   7217 O OE1 . GLU B 1 399 ? 37.144 134.530 11.671  1.00 54.56  ? 396 GLU B OE1 1 
ATOM   7218 O OE2 . GLU B 1 399 ? 39.298 134.810 11.967  1.00 60.43  ? 396 GLU B OE2 1 
ATOM   7219 N N   . ALA B 1 400 ? 41.727 130.038 13.602  1.00 29.44  ? 397 ALA B N   1 
ATOM   7220 C CA  . ALA B 1 400 ? 42.387 129.062 14.461  1.00 35.22  ? 397 ALA B CA  1 
ATOM   7221 C C   . ALA B 1 400 ? 43.883 129.334 14.555  1.00 33.81  ? 397 ALA B C   1 
ATOM   7222 O O   . ALA B 1 400 ? 44.447 129.377 15.654  1.00 34.15  ? 397 ALA B O   1 
ATOM   7223 C CB  . ALA B 1 400 ? 42.127 127.644 13.947  1.00 31.41  ? 397 ALA B CB  1 
ATOM   7224 N N   . LEU B 1 401 ? 44.544 129.517 13.408  1.00 29.72  ? 398 LEU B N   1 
ATOM   7225 C CA  . LEU B 1 401 ? 45.966 129.844 13.427  1.00 37.32  ? 398 LEU B CA  1 
ATOM   7226 C C   . LEU B 1 401 ? 46.216 131.185 14.102  1.00 34.34  ? 398 LEU B C   1 
ATOM   7227 O O   . LEU B 1 401 ? 47.250 131.369 14.753  1.00 36.08  ? 398 LEU B O   1 
ATOM   7228 C CB  . LEU B 1 401 ? 46.529 129.849 12.006  1.00 34.53  ? 398 LEU B CB  1 
ATOM   7229 C CG  . LEU B 1 401 ? 48.051 129.984 11.898  1.00 31.46  ? 398 LEU B CG  1 
ATOM   7230 C CD1 . LEU B 1 401 ? 48.744 128.833 12.613  1.00 32.04  ? 398 LEU B CD1 1 
ATOM   7231 C CD2 . LEU B 1 401 ? 48.490 130.057 10.445  1.00 28.06  ? 398 LEU B CD2 1 
ATOM   7232 N N   . SER B 1 402 ? 45.284 132.132 13.957  1.00 26.14  ? 399 SER B N   1 
ATOM   7233 C CA  . SER B 1 402 ? 45.378 133.380 14.706  1.00 37.52  ? 399 SER B CA  1 
ATOM   7234 C C   . SER B 1 402 ? 45.313 133.123 16.205  1.00 36.54  ? 399 SER B C   1 
ATOM   7235 O O   . SER B 1 402 ? 46.011 133.778 16.987  1.00 33.57  ? 399 SER B O   1 
ATOM   7236 C CB  . SER B 1 402 ? 44.265 134.335 14.274  1.00 30.86  ? 399 SER B CB  1 
ATOM   7237 O OG  . SER B 1 402 ? 44.193 135.459 15.133  1.00 31.99  ? 399 SER B OG  1 
ATOM   7238 N N   . ASP B 1 403 ? 44.479 132.167 16.624  1.00 34.82  ? 400 ASP B N   1 
ATOM   7239 C CA  . ASP B 1 403 ? 44.433 131.798 18.034  1.00 31.92  ? 400 ASP B CA  1 
ATOM   7240 C C   . ASP B 1 403 ? 45.699 131.059 18.451  1.00 33.93  ? 400 ASP B C   1 
ATOM   7241 O O   . ASP B 1 403 ? 46.180 131.234 19.576  1.00 30.04  ? 400 ASP B O   1 
ATOM   7242 C CB  . ASP B 1 403 ? 43.196 130.945 18.318  1.00 37.65  ? 400 ASP B CB  1 
ATOM   7243 C CG  . ASP B 1 403 ? 41.907 131.738 18.230  1.00 36.57  ? 400 ASP B CG  1 
ATOM   7244 O OD1 . ASP B 1 403 ? 41.932 132.954 18.515  1.00 44.74  ? 400 ASP B OD1 1 
ATOM   7245 O OD2 . ASP B 1 403 ? 40.867 131.142 17.879  1.00 37.11  ? 400 ASP B OD2 1 
ATOM   7246 N N   . VAL B 1 404 ? 46.251 130.231 17.560  1.00 32.36  ? 401 VAL B N   1 
ATOM   7247 C CA  . VAL B 1 404 ? 47.477 129.502 17.879  1.00 33.65  ? 401 VAL B CA  1 
ATOM   7248 C C   . VAL B 1 404 ? 48.604 130.476 18.198  1.00 35.98  ? 401 VAL B C   1 
ATOM   7249 O O   . VAL B 1 404 ? 49.300 130.340 19.211  1.00 34.56  ? 401 VAL B O   1 
ATOM   7250 C CB  . VAL B 1 404 ? 47.862 128.560 16.723  1.00 31.23  ? 401 VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 404 ? 49.243 127.970 16.958  1.00 21.98  ? 401 VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 404 ? 46.834 127.456 16.573  1.00 25.25  ? 401 VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 405 ? 48.792 131.480 17.342  1.00 29.56  ? 402 VAL B N   1 
ATOM   7254 C CA  . VAL B 1 405 ? 49.863 132.447 17.556  1.00 30.66  ? 402 VAL B CA  1 
ATOM   7255 C C   . VAL B 1 405 ? 49.533 133.362 18.729  1.00 30.57  ? 402 VAL B C   1 
ATOM   7256 O O   . VAL B 1 405 ? 50.408 133.699 19.536  1.00 28.36  ? 402 VAL B O   1 
ATOM   7257 C CB  . VAL B 1 405 ? 50.120 133.242 16.263  1.00 36.07  ? 402 VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 405 ? 51.209 134.281 16.480  1.00 32.30  ? 402 VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 405 ? 50.495 132.297 15.132  1.00 29.60  ? 402 VAL B CG2 1 
ATOM   7260 N N   . GLY B 1 406 ? 48.268 133.768 18.852  1.00 29.12  ? 403 GLY B N   1 
ATOM   7261 C CA  . GLY B 1 406 ? 47.898 134.696 19.908  1.00 20.56  ? 403 GLY B CA  1 
ATOM   7262 C C   . GLY B 1 406 ? 47.945 134.074 21.292  1.00 33.19  ? 403 GLY B C   1 
ATOM   7263 O O   . GLY B 1 406 ? 48.356 134.722 22.259  1.00 30.60  ? 403 GLY B O   1 
ATOM   7264 N N   . ASP B 1 407 ? 47.520 132.813 21.410  1.00 31.50  ? 404 ASP B N   1 
ATOM   7265 C CA  . ASP B 1 407 ? 47.548 132.148 22.709  1.00 30.96  ? 404 ASP B CA  1 
ATOM   7266 C C   . ASP B 1 407 ? 48.965 131.751 23.104  1.00 28.43  ? 404 ASP B C   1 
ATOM   7267 O O   . ASP B 1 407 ? 49.368 131.947 24.256  1.00 33.18  ? 404 ASP B O   1 
ATOM   7268 C CB  . ASP B 1 407 ? 46.642 130.916 22.695  1.00 30.64  ? 404 ASP B CB  1 
ATOM   7269 C CG  . ASP B 1 407 ? 45.201 131.254 22.372  1.00 37.82  ? 404 ASP B CG  1 
ATOM   7270 O OD1 . ASP B 1 407 ? 44.810 132.427 22.548  1.00 37.67  ? 404 ASP B OD1 1 
ATOM   7271 O OD2 . ASP B 1 407 ? 44.459 130.346 21.940  1.00 43.30  ? 404 ASP B OD2 1 
ATOM   7272 N N   . HIS B 1 408 ? 49.731 131.199 22.161  1.00 29.60  ? 405 HIS B N   1 
ATOM   7273 C CA  . HIS B 1 408 ? 51.082 130.738 22.467  1.00 31.47  ? 405 HIS B CA  1 
ATOM   7274 C C   . HIS B 1 408 ? 51.997 131.886 22.871  1.00 36.45  ? 405 HIS B C   1 
ATOM   7275 O O   . HIS B 1 408 ? 52.889 131.702 23.708  1.00 30.36  ? 405 HIS B O   1 
ATOM   7276 C CB  . HIS B 1 408 ? 51.657 129.997 21.258  1.00 29.32  ? 405 HIS B CB  1 
ATOM   7277 C CG  . HIS B 1 408 ? 53.096 129.611 21.406  1.00 25.67  ? 405 HIS B CG  1 
ATOM   7278 N ND1 . HIS B 1 408 ? 53.582 128.956 22.516  1.00 30.45  ? 405 HIS B ND1 1 
ATOM   7279 C CD2 . HIS B 1 408 ? 54.153 129.780 20.576  1.00 32.75  ? 405 HIS B CD2 1 
ATOM   7280 C CE1 . HIS B 1 408 ? 54.877 128.741 22.367  1.00 38.21  ? 405 HIS B CE1 1 
ATOM   7281 N NE2 . HIS B 1 408 ? 55.248 129.231 21.198  1.00 31.69  ? 405 HIS B NE2 1 
ATOM   7282 N N   . ASN B 1 409 ? 51.788 133.074 22.307  1.00 36.11  ? 406 ASN B N   1 
ATOM   7283 C CA  . ASN B 1 409 ? 52.721 134.179 22.487  1.00 34.43  ? 406 ASN B CA  1 
ATOM   7284 C C   . ASN B 1 409 ? 52.247 135.238 23.471  1.00 28.06  ? 406 ASN B C   1 
ATOM   7285 O O   . ASN B 1 409 ? 53.081 135.844 24.150  1.00 30.30  ? 406 ASN B O   1 
ATOM   7286 C CB  . ASN B 1 409 ? 53.008 134.847 21.138  1.00 26.26  ? 406 ASN B CB  1 
ATOM   7287 C CG  . ASN B 1 409 ? 53.889 133.997 20.247  1.00 31.66  ? 406 ASN B CG  1 
ATOM   7288 O OD1 . ASN B 1 409 ? 54.955 133.541 20.662  1.00 29.56  ? 406 ASN B OD1 1 
ATOM   7289 N ND2 . ASN B 1 409 ? 53.444 133.769 19.017  1.00 24.83  ? 406 ASN B ND2 1 
ATOM   7290 N N   . VAL B 1 410 ? 50.941 135.485 23.573  1.00 27.32  ? 407 VAL B N   1 
ATOM   7291 C CA  . VAL B 1 410 ? 50.461 136.605 24.376  1.00 26.85  ? 407 VAL B CA  1 
ATOM   7292 C C   . VAL B 1 410 ? 49.475 136.151 25.447  1.00 32.95  ? 407 VAL B C   1 
ATOM   7293 O O   . VAL B 1 410 ? 49.742 136.293 26.645  1.00 29.41  ? 407 VAL B O   1 
ATOM   7294 C CB  . VAL B 1 410 ? 49.822 137.687 23.486  1.00 38.06  ? 407 VAL B CB  1 
ATOM   7295 C CG1 . VAL B 1 410 ? 49.388 138.869 24.334  1.00 31.18  ? 407 VAL B CG1 1 
ATOM   7296 C CG2 . VAL B 1 410 ? 50.793 138.134 22.403  1.00 25.35  ? 407 VAL B CG2 1 
ATOM   7297 N N   . VAL B 1 411 ? 48.331 135.606 25.022  1.00 31.98  ? 408 VAL B N   1 
ATOM   7298 C CA  . VAL B 1 411 ? 47.198 135.428 25.931  1.00 33.48  ? 408 VAL B CA  1 
ATOM   7299 C C   . VAL B 1 411 ? 47.551 134.485 27.076  1.00 34.60  ? 408 VAL B C   1 
ATOM   7300 O O   . VAL B 1 411 ? 47.215 134.745 28.239  1.00 39.72  ? 408 VAL B O   1 
ATOM   7301 C CB  . VAL B 1 411 ? 45.964 134.933 25.155  1.00 34.08  ? 408 VAL B CB  1 
ATOM   7302 C CG1 . VAL B 1 411 ? 44.787 134.732 26.100  1.00 35.85  ? 408 VAL B CG1 1 
ATOM   7303 C CG2 . VAL B 1 411 ? 45.607 135.916 24.053  1.00 33.21  ? 408 VAL B CG2 1 
ATOM   7304 N N   . CYS B 1 412 ? 48.229 133.385 26.777  1.00 28.99  ? 409 CYS B N   1 
ATOM   7305 C CA  . CYS B 1 412 ? 48.492 132.393 27.813  1.00 34.24  ? 409 CYS B CA  1 
ATOM   7306 C C   . CYS B 1 412 ? 49.699 132.751 28.679  1.00 36.71  ? 409 CYS B C   1 
ATOM   7307 O O   . CYS B 1 412 ? 49.663 132.499 29.891  1.00 43.24  ? 409 CYS B O   1 
ATOM   7308 C CB  . CYS B 1 412 ? 48.659 131.007 27.187  1.00 32.63  ? 409 CYS B CB  1 
ATOM   7309 S SG  . CYS B 1 412 ? 47.140 130.428 26.402  1.00 35.25  ? 409 CYS B SG  1 
ATOM   7310 N N   . PRO B 1 413 ? 50.782 133.317 28.130  1.00 42.31  ? 410 PRO B N   1 
ATOM   7311 C CA  . PRO B 1 413 ? 51.820 133.862 29.022  1.00 33.03  ? 410 PRO B CA  1 
ATOM   7312 C C   . PRO B 1 413 ? 51.301 134.946 29.950  1.00 32.69  ? 410 PRO B C   1 
ATOM   7313 O O   . PRO B 1 413 ? 51.803 135.081 31.073  1.00 32.66  ? 410 PRO B O   1 
ATOM   7314 C CB  . PRO B 1 413 ? 52.870 134.408 28.045  1.00 30.36  ? 410 PRO B CB  1 
ATOM   7315 C CG  . PRO B 1 413 ? 52.718 133.570 26.841  1.00 31.66  ? 410 PRO B CG  1 
ATOM   7316 C CD  . PRO B 1 413 ? 51.244 133.291 26.728  1.00 34.30  ? 410 PRO B CD  1 
ATOM   7317 N N   . VAL B 1 414 ? 50.307 135.723 29.515  1.00 29.24  ? 411 VAL B N   1 
ATOM   7318 C CA  . VAL B 1 414 ? 49.743 136.760 30.374  1.00 33.54  ? 411 VAL B CA  1 
ATOM   7319 C C   . VAL B 1 414 ? 48.869 136.137 31.457  1.00 37.17  ? 411 VAL B C   1 
ATOM   7320 O O   . VAL B 1 414 ? 48.968 136.494 32.637  1.00 34.85  ? 411 VAL B O   1 
ATOM   7321 C CB  . VAL B 1 414 ? 48.960 137.785 29.534  1.00 30.07  ? 411 VAL B CB  1 
ATOM   7322 C CG1 . VAL B 1 414 ? 48.068 138.633 30.425  1.00 25.02  ? 411 VAL B CG1 1 
ATOM   7323 C CG2 . VAL B 1 414 ? 49.920 138.668 28.753  1.00 32.10  ? 411 VAL B CG2 1 
ATOM   7324 N N   . ALA B 1 415 ? 47.999 135.199 31.072  1.00 33.12  ? 412 ALA B N   1 
ATOM   7325 C CA  . ALA B 1 415 ? 47.142 134.536 32.052  1.00 33.48  ? 412 ALA B CA  1 
ATOM   7326 C C   . ALA B 1 415 ? 47.968 133.776 33.081  1.00 33.89  ? 412 ALA B C   1 
ATOM   7327 O O   . ALA B 1 415 ? 47.656 133.798 34.278  1.00 27.15  ? 412 ALA B O   1 
ATOM   7328 C CB  . ALA B 1 415 ? 46.165 133.596 31.347  1.00 34.70  ? 412 ALA B CB  1 
ATOM   7329 N N   . GLN B 1 416 ? 49.024 133.094 32.631  1.00 27.50  ? 413 GLN B N   1 
ATOM   7330 C CA  . GLN B 1 416 ? 49.949 132.443 33.555  1.00 27.78  ? 413 GLN B CA  1 
ATOM   7331 C C   . GLN B 1 416 ? 50.521 133.447 34.547  1.00 45.03  ? 413 GLN B C   1 
ATOM   7332 O O   . GLN B 1 416 ? 50.574 133.188 35.755  1.00 38.57  ? 413 GLN B O   1 
ATOM   7333 C CB  . GLN B 1 416 ? 51.072 131.765 32.769  1.00 40.71  ? 413 GLN B CB  1 
ATOM   7334 C CG  . GLN B 1 416 ? 52.204 131.220 33.626  1.00 42.24  ? 413 GLN B CG  1 
ATOM   7335 C CD  . GLN B 1 416 ? 52.018 129.758 33.978  1.00 54.65  ? 413 GLN B CD  1 
ATOM   7336 O OE1 . GLN B 1 416 ? 52.359 128.873 33.194  1.00 61.92  ? 413 GLN B OE1 1 
ATOM   7337 N NE2 . GLN B 1 416 ? 51.477 129.498 35.162  1.00 59.52  ? 413 GLN B NE2 1 
ATOM   7338 N N   . LEU B 1 417 ? 50.952 134.608 34.048  1.00 47.14  ? 414 LEU B N   1 
ATOM   7339 C CA  . LEU B 1 417 ? 51.506 135.638 34.919  1.00 35.13  ? 414 LEU B CA  1 
ATOM   7340 C C   . LEU B 1 417 ? 50.438 136.226 35.834  1.00 31.46  ? 414 LEU B C   1 
ATOM   7341 O O   . LEU B 1 417 ? 50.675 136.409 37.033  1.00 29.42  ? 414 LEU B O   1 
ATOM   7342 C CB  . LEU B 1 417 ? 52.154 136.736 34.077  1.00 34.89  ? 414 LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 417 ? 52.544 138.026 34.799  1.00 32.10  ? 414 LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 417 ? 53.647 137.773 35.816  1.00 32.49  ? 414 LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 417 ? 52.963 139.089 33.798  1.00 41.54  ? 414 LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 418 ? 49.257 136.523 35.287  1.00 33.89  ? 415 ALA B N   1 
ATOM   7347 C CA  . ALA B 1 418 ? 48.207 137.154 36.082  1.00 30.32  ? 415 ALA B CA  1 
ATOM   7348 C C   . ALA B 1 418 ? 47.755 136.253 37.224  1.00 41.82  ? 415 ALA B C   1 
ATOM   7349 O O   . ALA B 1 418 ? 47.506 136.728 38.338  1.00 41.01  ? 415 ALA B O   1 
ATOM   7350 C CB  . ALA B 1 418 ? 47.023 137.524 35.189  1.00 29.54  ? 415 ALA B CB  1 
ATOM   7351 N N   . GLY B 1 419 ? 47.644 134.948 36.967  1.00 44.97  ? 416 GLY B N   1 
ATOM   7352 C CA  . GLY B 1 419 ? 47.227 134.035 38.018  1.00 34.81  ? 416 GLY B CA  1 
ATOM   7353 C C   . GLY B 1 419 ? 48.255 133.906 39.125  1.00 40.64  ? 416 GLY B C   1 
ATOM   7354 O O   . GLY B 1 419 ? 47.907 133.900 40.310  1.00 42.23  ? 416 GLY B O   1 
ATOM   7355 N N   . ARG B 1 420 ? 49.536 133.805 38.759  1.00 36.41  ? 417 ARG B N   1 
ATOM   7356 C CA  . ARG B 1 420 ? 50.582 133.661 39.767  1.00 37.62  ? 417 ARG B CA  1 
ATOM   7357 C C   . ARG B 1 420 ? 50.734 134.929 40.599  1.00 45.87  ? 417 ARG B C   1 
ATOM   7358 O O   . ARG B 1 420 ? 51.024 134.857 41.799  1.00 50.02  ? 417 ARG B O   1 
ATOM   7359 C CB  . ARG B 1 420 ? 51.908 133.294 39.102  1.00 37.40  ? 417 ARG B CB  1 
ATOM   7360 C CG  . ARG B 1 420 ? 52.012 131.841 38.666  1.00 46.84  ? 417 ARG B CG  1 
ATOM   7361 C CD  . ARG B 1 420 ? 51.555 130.904 39.773  1.00 59.13  ? 417 ARG B CD  1 
ATOM   7362 N NE  . ARG B 1 420 ? 52.231 129.610 39.719  1.00 63.51  ? 417 ARG B NE  1 
ATOM   7363 C CZ  . ARG B 1 420 ? 53.198 129.240 40.553  1.00 57.32  ? 417 ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 1 420 ? 53.598 130.064 41.512  1.00 48.36  ? 417 ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 1 420 ? 53.761 128.045 40.434  1.00 53.36  ? 417 ARG B NH2 1 
ATOM   7366 N N   . LEU B 1 421 ? 50.545 136.098 39.982  1.00 49.39  ? 418 LEU B N   1 
ATOM   7367 C CA  . LEU B 1 421 ? 50.641 137.351 40.725  1.00 51.07  ? 418 LEU B CA  1 
ATOM   7368 C C   . LEU B 1 421 ? 49.534 137.458 41.767  1.00 42.35  ? 418 LEU B C   1 
ATOM   7369 O O   . LEU B 1 421 ? 49.789 137.804 42.926  1.00 47.34  ? 418 LEU B O   1 
ATOM   7370 C CB  . LEU B 1 421 ? 50.587 138.542 39.766  1.00 41.68  ? 418 LEU B CB  1 
ATOM   7371 C CG  . LEU B 1 421 ? 51.806 138.816 38.885  1.00 40.12  ? 418 LEU B CG  1 
ATOM   7372 C CD1 . LEU B 1 421 ? 51.533 139.990 37.958  1.00 34.41  ? 418 LEU B CD1 1 
ATOM   7373 C CD2 . LEU B 1 421 ? 53.039 139.078 39.731  1.00 43.28  ? 418 LEU B CD2 1 
ATOM   7374 N N   . ALA B 1 422 ? 48.294 137.161 41.369  1.00 36.74  ? 419 ALA B N   1 
ATOM   7375 C CA  . ALA B 1 422 ? 47.168 137.291 42.290  1.00 40.37  ? 419 ALA B CA  1 
ATOM   7376 C C   . ALA B 1 422 ? 47.255 136.279 43.424  1.00 40.94  ? 419 ALA B C   1 
ATOM   7377 O O   . ALA B 1 422 ? 46.903 136.589 44.568  1.00 52.83  ? 419 ALA B O   1 
ATOM   7378 C CB  . ALA B 1 422 ? 45.850 137.137 41.532  1.00 37.09  ? 419 ALA B CB  1 
ATOM   7379 N N   . ALA B 1 423 ? 47.723 135.069 43.131  1.00 45.42  ? 420 ALA B N   1 
ATOM   7380 C CA  . ALA B 1 423 ? 47.819 134.022 44.140  1.00 49.87  ? 420 ALA B CA  1 
ATOM   7381 C C   . ALA B 1 423 ? 49.033 134.172 45.047  1.00 48.96  ? 420 ALA B C   1 
ATOM   7382 O O   . ALA B 1 423 ? 49.214 133.346 45.948  1.00 56.96  ? 420 ALA B O   1 
ATOM   7383 C CB  . ALA B 1 423 ? 47.851 132.647 43.467  1.00 34.45  ? 420 ALA B CB  1 
ATOM   7384 N N   . GLN B 1 424 ? 49.865 135.195 44.844  1.00 47.57  ? 421 GLN B N   1 
ATOM   7385 C CA  . GLN B 1 424 ? 51.094 135.340 45.614  1.00 44.72  ? 421 GLN B CA  1 
ATOM   7386 C C   . GLN B 1 424 ? 51.264 136.756 46.155  1.00 40.80  ? 421 GLN B C   1 
ATOM   7387 O O   . GLN B 1 424 ? 52.388 137.199 46.402  1.00 53.56  ? 421 GLN B O   1 
ATOM   7388 C CB  . GLN B 1 424 ? 52.307 134.925 44.780  1.00 47.20  ? 421 GLN B CB  1 
ATOM   7389 C CG  . GLN B 1 424 ? 52.374 133.422 44.529  1.00 48.36  ? 421 GLN B CG  1 
ATOM   7390 C CD  . GLN B 1 424 ? 53.304 133.048 43.392  1.00 50.34  ? 421 GLN B CD  1 
ATOM   7391 O OE1 . GLN B 1 424 ? 53.097 132.042 42.712  1.00 53.50  ? 421 GLN B OE1 1 
ATOM   7392 N NE2 . GLN B 1 424 ? 54.337 133.853 43.180  1.00 49.83  ? 421 GLN B NE2 1 
ATOM   7393 N N   . GLY B 1 425 ? 50.160 137.477 46.348  1.00 42.97  ? 422 GLY B N   1 
ATOM   7394 C CA  . GLY B 1 425 ? 50.154 138.716 47.105  1.00 51.02  ? 422 GLY B CA  1 
ATOM   7395 C C   . GLY B 1 425 ? 49.714 139.947 46.339  1.00 50.17  ? 422 GLY B C   1 
ATOM   7396 O O   . GLY B 1 425 ? 49.337 140.946 46.968  1.00 47.85  ? 422 GLY B O   1 
ATOM   7397 N N   . ALA B 1 426 ? 49.747 139.925 45.010  1.00 43.22  ? 423 ALA B N   1 
ATOM   7398 C CA  . ALA B 1 426 ? 49.436 141.111 44.224  1.00 41.43  ? 423 ALA B CA  1 
ATOM   7399 C C   . ALA B 1 426 ? 47.947 141.189 43.916  1.00 32.54  ? 423 ALA B C   1 
ATOM   7400 O O   . ALA B 1 426 ? 47.298 140.171 43.661  1.00 48.06  ? 423 ALA B O   1 
ATOM   7401 C CB  . ALA B 1 426 ? 50.234 141.120 42.919  1.00 35.36  ? 423 ALA B CB  1 
ATOM   7402 N N   . ARG B 1 427 ? 47.407 142.405 43.949  1.00 36.74  ? 424 ARG B N   1 
ATOM   7403 C CA  . ARG B 1 427 ? 46.057 142.663 43.465  1.00 39.18  ? 424 ARG B CA  1 
ATOM   7404 C C   . ARG B 1 427 ? 46.130 142.904 41.962  1.00 48.39  ? 424 ARG B C   1 
ATOM   7405 O O   . ARG B 1 427 ? 46.852 143.798 41.507  1.00 46.58  ? 424 ARG B O   1 
ATOM   7406 C CB  . ARG B 1 427 ? 45.425 143.859 44.175  1.00 37.64  ? 424 ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 427 ? 43.972 144.090 43.783  1.00 50.36  ? 424 ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 427 ? 43.495 145.491 44.135  1.00 66.28  ? 424 ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 427 ? 42.715 145.530 45.368  1.00 76.06  ? 424 ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 427 ? 43.167 146.002 46.525  1.00 85.63  ? 424 ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 427 ? 44.401 146.481 46.610  1.00 72.66  ? 424 ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 427 ? 42.385 146.000 47.595  1.00 93.50  ? 424 ARG B NH2 1 
ATOM   7413 N N   . VAL B 1 428 ? 45.391 142.108 41.196  1.00 44.19  ? 425 VAL B N   1 
ATOM   7414 C CA  . VAL B 1 428 ? 45.495 142.093 39.742  1.00 33.20  ? 425 VAL B CA  1 
ATOM   7415 C C   . VAL B 1 428 ? 44.141 142.439 39.138  1.00 42.73  ? 425 VAL B C   1 
ATOM   7416 O O   . VAL B 1 428 ? 43.100 141.975 39.615  1.00 45.20  ? 425 VAL B O   1 
ATOM   7417 C CB  . VAL B 1 428 ? 45.987 140.722 39.231  1.00 38.13  ? 425 VAL B CB  1 
ATOM   7418 C CG1 . VAL B 1 428 ? 46.114 140.726 37.715  1.00 36.51  ? 425 VAL B CG1 1 
ATOM   7419 C CG2 . VAL B 1 428 ? 47.314 140.360 39.880  1.00 34.04  ? 425 VAL B CG2 1 
ATOM   7420 N N   . TYR B 1 429 ? 44.162 143.262 38.093  1.00 39.88  ? 426 TYR B N   1 
ATOM   7421 C CA  . TYR B 1 429 ? 42.991 143.549 37.277  1.00 37.47  ? 426 TYR B CA  1 
ATOM   7422 C C   . TYR B 1 429 ? 43.279 143.136 35.841  1.00 39.48  ? 426 TYR B C   1 
ATOM   7423 O O   . TYR B 1 429 ? 44.365 143.400 35.316  1.00 40.70  ? 426 TYR B O   1 
ATOM   7424 C CB  . TYR B 1 429 ? 42.616 145.033 37.333  1.00 36.69  ? 426 TYR B CB  1 
ATOM   7425 C CG  . TYR B 1 429 ? 42.202 145.515 38.705  1.00 41.53  ? 426 TYR B CG  1 
ATOM   7426 C CD1 . TYR B 1 429 ? 40.869 145.512 39.091  1.00 47.54  ? 426 TYR B CD1 1 
ATOM   7427 C CD2 . TYR B 1 429 ? 43.146 145.978 39.612  1.00 36.86  ? 426 TYR B CD2 1 
ATOM   7428 C CE1 . TYR B 1 429 ? 40.486 145.955 40.344  1.00 48.60  ? 426 TYR B CE1 1 
ATOM   7429 C CE2 . TYR B 1 429 ? 42.774 146.423 40.865  1.00 42.19  ? 426 TYR B CE2 1 
ATOM   7430 C CZ  . TYR B 1 429 ? 41.444 146.409 41.227  1.00 46.07  ? 426 TYR B CZ  1 
ATOM   7431 O OH  . TYR B 1 429 ? 41.068 146.851 42.474  1.00 43.88  ? 426 TYR B OH  1 
ATOM   7432 N N   . ALA B 1 430 ? 42.305 142.486 35.209  1.00 42.88  ? 427 ALA B N   1 
ATOM   7433 C CA  . ALA B 1 430 ? 42.465 141.961 33.862  1.00 32.38  ? 427 ALA B CA  1 
ATOM   7434 C C   . ALA B 1 430 ? 41.384 142.517 32.945  1.00 35.61  ? 427 ALA B C   1 
ATOM   7435 O O   . ALA B 1 430 ? 40.268 142.815 33.382  1.00 36.63  ? 427 ALA B O   1 
ATOM   7436 C CB  . ALA B 1 430 ? 42.419 140.428 33.854  1.00 34.74  ? 427 ALA B CB  1 
ATOM   7437 N N   . TYR B 1 431 ? 41.727 142.651 31.664  1.00 27.66  ? 428 TYR B N   1 
ATOM   7438 C CA  . TYR B 1 431 ? 40.806 143.175 30.668  1.00 33.67  ? 428 TYR B CA  1 
ATOM   7439 C C   . TYR B 1 431 ? 41.015 142.452 29.345  1.00 32.16  ? 428 TYR B C   1 
ATOM   7440 O O   . TYR B 1 431 ? 42.026 141.780 29.129  1.00 29.97  ? 428 TYR B O   1 
ATOM   7441 C CB  . TYR B 1 431 ? 40.983 144.690 30.465  1.00 33.00  ? 428 TYR B CB  1 
ATOM   7442 C CG  . TYR B 1 431 ? 42.300 145.094 29.827  1.00 38.65  ? 428 TYR B CG  1 
ATOM   7443 C CD1 . TYR B 1 431 ? 42.463 145.079 28.444  1.00 35.38  ? 428 TYR B CD1 1 
ATOM   7444 C CD2 . TYR B 1 431 ? 43.373 145.505 30.606  1.00 39.30  ? 428 TYR B CD2 1 
ATOM   7445 C CE1 . TYR B 1 431 ? 43.660 145.444 27.861  1.00 38.68  ? 428 TYR B CE1 1 
ATOM   7446 C CE2 . TYR B 1 431 ? 44.574 145.877 30.030  1.00 27.90  ? 428 TYR B CE2 1 
ATOM   7447 C CZ  . TYR B 1 431 ? 44.712 145.844 28.658  1.00 35.50  ? 428 TYR B CZ  1 
ATOM   7448 O OH  . TYR B 1 431 ? 45.904 146.211 28.080  1.00 32.86  ? 428 TYR B OH  1 
ATOM   7449 N N   . VAL B 1 432 ? 40.039 142.608 28.455  1.00 32.17  ? 429 VAL B N   1 
ATOM   7450 C CA  . VAL B 1 432 ? 40.150 142.194 27.061  1.00 29.26  ? 429 VAL B CA  1 
ATOM   7451 C C   . VAL B 1 432 ? 39.611 143.328 26.201  1.00 36.25  ? 429 VAL B C   1 
ATOM   7452 O O   . VAL B 1 432 ? 38.437 143.696 26.321  1.00 30.66  ? 429 VAL B O   1 
ATOM   7453 C CB  . VAL B 1 432 ? 39.393 140.887 26.769  1.00 36.10  ? 429 VAL B CB  1 
ATOM   7454 C CG1 . VAL B 1 432 ? 39.314 140.650 25.270  1.00 30.22  ? 429 VAL B CG1 1 
ATOM   7455 C CG2 . VAL B 1 432 ? 40.081 139.720 27.442  1.00 34.02  ? 429 VAL B CG2 1 
ATOM   7456 N N   . PHE B 1 433 ? 40.466 143.883 25.346  1.00 31.76  ? 430 PHE B N   1 
ATOM   7457 C CA  . PHE B 1 433 ? 40.078 144.990 24.482  1.00 31.34  ? 430 PHE B CA  1 
ATOM   7458 C C   . PHE B 1 433 ? 39.409 144.439 23.229  1.00 32.94  ? 430 PHE B C   1 
ATOM   7459 O O   . PHE B 1 433 ? 40.032 143.695 22.462  1.00 28.66  ? 430 PHE B O   1 
ATOM   7460 C CB  . PHE B 1 433 ? 41.303 145.830 24.127  1.00 37.37  ? 430 PHE B CB  1 
ATOM   7461 C CG  . PHE B 1 433 ? 40.971 147.172 23.549  1.00 31.45  ? 430 PHE B CG  1 
ATOM   7462 C CD1 . PHE B 1 433 ? 40.727 148.254 24.377  1.00 31.91  ? 430 PHE B CD1 1 
ATOM   7463 C CD2 . PHE B 1 433 ? 40.908 147.356 22.179  1.00 25.52  ? 430 PHE B CD2 1 
ATOM   7464 C CE1 . PHE B 1 433 ? 40.423 149.492 23.850  1.00 34.25  ? 430 PHE B CE1 1 
ATOM   7465 C CE2 . PHE B 1 433 ? 40.605 148.593 21.646  1.00 41.48  ? 430 PHE B CE2 1 
ATOM   7466 C CZ  . PHE B 1 433 ? 40.362 149.662 22.483  1.00 30.08  ? 430 PHE B CZ  1 
ATOM   7467 N N   . GLU B 1 434 ? 38.143 144.802 23.015  1.00 35.63  ? 431 GLU B N   1 
ATOM   7468 C CA  . GLU B 1 434 ? 37.338 144.200 21.958  1.00 32.65  ? 431 GLU B CA  1 
ATOM   7469 C C   . GLU B 1 434 ? 36.767 145.209 20.970  1.00 36.62  ? 431 GLU B C   1 
ATOM   7470 O O   . GLU B 1 434 ? 35.946 144.829 20.127  1.00 39.90  ? 431 GLU B O   1 
ATOM   7471 C CB  . GLU B 1 434 ? 36.192 143.383 22.563  1.00 37.44  ? 431 GLU B CB  1 
ATOM   7472 C CG  . GLU B 1 434 ? 36.628 142.333 23.563  1.00 41.96  ? 431 GLU B CG  1 
ATOM   7473 C CD  . GLU B 1 434 ? 35.522 141.349 23.883  1.00 44.84  ? 431 GLU B CD  1 
ATOM   7474 O OE1 . GLU B 1 434 ? 35.791 140.129 23.876  1.00 50.88  ? 431 GLU B OE1 1 
ATOM   7475 O OE2 . GLU B 1 434 ? 34.382 141.795 24.130  1.00 50.85  ? 431 GLU B OE2 1 
ATOM   7476 N N   . HIS B 1 435 ? 37.160 146.477 21.044  1.00 33.39  ? 432 HIS B N   1 
ATOM   7477 C CA  . HIS B 1 435 ? 36.676 147.483 20.107  1.00 33.96  ? 432 HIS B CA  1 
ATOM   7478 C C   . HIS B 1 435 ? 37.679 147.642 18.973  1.00 36.02  ? 432 HIS B C   1 
ATOM   7479 O O   . HIS B 1 435 ? 38.863 147.900 19.215  1.00 33.56  ? 432 HIS B O   1 
ATOM   7480 C CB  . HIS B 1 435 ? 36.441 148.829 20.790  1.00 37.12  ? 432 HIS B CB  1 
ATOM   7481 C CG  . HIS B 1 435 ? 36.043 149.916 19.840  1.00 34.62  ? 432 HIS B CG  1 
ATOM   7482 N ND1 . HIS B 1 435 ? 34.842 149.908 19.162  1.00 37.58  ? 432 HIS B ND1 1 
ATOM   7483 C CD2 . HIS B 1 435 ? 36.694 151.033 19.437  1.00 33.58  ? 432 HIS B CD2 1 
ATOM   7484 C CE1 . HIS B 1 435 ? 34.766 150.978 18.392  1.00 26.17  ? 432 HIS B CE1 1 
ATOM   7485 N NE2 . HIS B 1 435 ? 35.877 151.677 18.539  1.00 33.55  ? 432 HIS B NE2 1 
ATOM   7486 N N   . ARG B 1 436 ? 37.203 147.488 17.742  1.00 31.93  ? 433 ARG B N   1 
ATOM   7487 C CA  . ARG B 1 436 ? 38.016 147.727 16.557  1.00 36.93  ? 433 ARG B CA  1 
ATOM   7488 C C   . ARG B 1 436 ? 37.812 149.170 16.111  1.00 40.13  ? 433 ARG B C   1 
ATOM   7489 O O   . ARG B 1 436 ? 36.675 149.597 15.880  1.00 35.46  ? 433 ARG B O   1 
ATOM   7490 C CB  . ARG B 1 436 ? 37.645 146.752 15.441  1.00 34.73  ? 433 ARG B CB  1 
ATOM   7491 C CG  . ARG B 1 436 ? 38.254 147.088 14.090  1.00 36.32  ? 433 ARG B CG  1 
ATOM   7492 C CD  . ARG B 1 436 ? 37.760 146.132 13.016  1.00 32.48  ? 433 ARG B CD  1 
ATOM   7493 N NE  . ARG B 1 436 ? 38.166 146.548 11.677  1.00 24.03  ? 433 ARG B NE  1 
ATOM   7494 C CZ  . ARG B 1 436 ? 39.247 146.099 11.048  1.00 38.83  ? 433 ARG B CZ  1 
ATOM   7495 N NH1 . ARG B 1 436 ? 40.040 145.212 11.635  1.00 29.15  ? 433 ARG B NH1 1 
ATOM   7496 N NH2 . ARG B 1 436 ? 39.534 146.535 9.829   1.00 30.96  ? 433 ARG B NH2 1 
ATOM   7497 N N   . ALA B 1 437 ? 38.911 149.915 16.000  1.00 32.86  ? 434 ALA B N   1 
ATOM   7498 C CA  . ALA B 1 437 ? 38.829 151.327 15.650  1.00 38.70  ? 434 ALA B CA  1 
ATOM   7499 C C   . ALA B 1 437 ? 38.155 151.514 14.297  1.00 35.71  ? 434 ALA B C   1 
ATOM   7500 O O   . ALA B 1 437 ? 38.381 150.746 13.357  1.00 42.51  ? 434 ALA B O   1 
ATOM   7501 C CB  . ALA B 1 437 ? 40.225 151.949 15.636  1.00 30.85  ? 434 ALA B CB  1 
ATOM   7502 N N   . SER B 1 438 ? 37.316 152.549 14.205  1.00 30.32  ? 435 SER B N   1 
ATOM   7503 C CA  . SER B 1 438 ? 36.602 152.835 12.966  1.00 30.88  ? 435 SER B CA  1 
ATOM   7504 C C   . SER B 1 438 ? 37.533 153.289 11.850  1.00 36.02  ? 435 SER B C   1 
ATOM   7505 O O   . SER B 1 438 ? 37.149 153.229 10.678  1.00 37.69  ? 435 SER B O   1 
ATOM   7506 C CB  . SER B 1 438 ? 35.531 153.899 13.213  1.00 36.43  ? 435 SER B CB  1 
ATOM   7507 O OG  . SER B 1 438 ? 36.112 155.122 13.634  1.00 44.37  ? 435 SER B OG  1 
ATOM   7508 N N   . THR B 1 439 ? 38.739 153.742 12.186  1.00 39.24  ? 436 THR B N   1 
ATOM   7509 C CA  . THR B 1 439 ? 39.710 154.208 11.207  1.00 41.57  ? 436 THR B CA  1 
ATOM   7510 C C   . THR B 1 439 ? 40.795 153.179 10.923  1.00 43.77  ? 436 THR B C   1 
ATOM   7511 O O   . THR B 1 439 ? 41.786 153.504 10.261  1.00 37.56  ? 436 THR B O   1 
ATOM   7512 C CB  . THR B 1 439 ? 40.348 155.515 11.683  1.00 38.90  ? 436 THR B CB  1 
ATOM   7513 O OG1 . THR B 1 439 ? 40.961 155.308 12.962  1.00 37.74  ? 436 THR B OG1 1 
ATOM   7514 C CG2 . THR B 1 439 ? 39.296 156.606 11.803  1.00 36.20  ? 436 THR B CG2 1 
ATOM   7515 N N   . LEU B 1 440 ? 40.625 151.948 11.400  1.00 32.72  ? 437 LEU B N   1 
ATOM   7516 C CA  . LEU B 1 440 ? 41.666 150.937 11.278  1.00 39.59  ? 437 LEU B CA  1 
ATOM   7517 C C   . LEU B 1 440 ? 41.887 150.564 9.817   1.00 36.12  ? 437 LEU B C   1 
ATOM   7518 O O   . LEU B 1 440 ? 40.940 150.240 9.095   1.00 37.28  ? 437 LEU B O   1 
ATOM   7519 C CB  . LEU B 1 440 ? 41.291 149.703 12.094  1.00 38.67  ? 437 LEU B CB  1 
ATOM   7520 C CG  . LEU B 1 440 ? 42.384 148.654 12.277  1.00 38.97  ? 437 LEU B CG  1 
ATOM   7521 C CD1 . LEU B 1 440 ? 43.677 149.315 12.715  1.00 37.99  ? 437 LEU B CD1 1 
ATOM   7522 C CD2 . LEU B 1 440 ? 41.937 147.625 13.295  1.00 47.49  ? 437 LEU B CD2 1 
ATOM   7523 N N   . SER B 1 441 ? 43.149 150.606 9.385   1.00 32.05  ? 438 SER B N   1 
ATOM   7524 C CA  . SER B 1 441 ? 43.498 150.348 7.995   1.00 30.73  ? 438 SER B CA  1 
ATOM   7525 C C   . SER B 1 441 ? 43.774 148.879 7.703   1.00 27.46  ? 438 SER B C   1 
ATOM   7526 O O   . SER B 1 441 ? 43.770 148.486 6.531   1.00 28.85  ? 438 SER B O   1 
ATOM   7527 C CB  . SER B 1 441 ? 44.721 151.182 7.597   1.00 25.15  ? 438 SER B CB  1 
ATOM   7528 O OG  . SER B 1 441 ? 45.814 150.930 8.462   1.00 34.79  ? 438 SER B OG  1 
ATOM   7529 N N   . TRP B 1 442 ? 44.017 148.066 8.728   1.00 30.56  ? 439 TRP B N   1 
ATOM   7530 C CA  . TRP B 1 442 ? 44.207 146.640 8.517   1.00 32.16  ? 439 TRP B CA  1 
ATOM   7531 C C   . TRP B 1 442 ? 42.897 145.998 8.056   1.00 27.57  ? 439 TRP B C   1 
ATOM   7532 O O   . TRP B 1 442 ? 41.813 146.522 8.330   1.00 25.32  ? 439 TRP B O   1 
ATOM   7533 C CB  . TRP B 1 442 ? 44.701 145.971 9.799   1.00 24.58  ? 439 TRP B CB  1 
ATOM   7534 C CG  . TRP B 1 442 ? 46.131 146.281 10.120  1.00 31.08  ? 439 TRP B CG  1 
ATOM   7535 C CD1 . TRP B 1 442 ? 46.589 147.131 11.084  1.00 26.95  ? 439 TRP B CD1 1 
ATOM   7536 C CD2 . TRP B 1 442 ? 47.292 145.747 9.470   1.00 30.84  ? 439 TRP B CD2 1 
ATOM   7537 N NE1 . TRP B 1 442 ? 47.964 147.157 11.077  1.00 22.11  ? 439 TRP B NE1 1 
ATOM   7538 C CE2 . TRP B 1 442 ? 48.419 146.316 10.096  1.00 34.84  ? 439 TRP B CE2 1 
ATOM   7539 C CE3 . TRP B 1 442 ? 47.488 144.844 8.421   1.00 32.54  ? 439 TRP B CE3 1 
ATOM   7540 C CZ2 . TRP B 1 442 ? 49.722 146.013 9.705   1.00 33.50  ? 439 TRP B CZ2 1 
ATOM   7541 C CZ3 . TRP B 1 442 ? 48.782 144.542 8.037   1.00 24.15  ? 439 TRP B CZ3 1 
ATOM   7542 C CH2 . TRP B 1 442 ? 49.882 145.124 8.678   1.00 33.22  ? 439 TRP B CH2 1 
ATOM   7543 N N   . PRO B 1 443 ? 42.968 144.870 7.346   1.00 32.90  ? 440 PRO B N   1 
ATOM   7544 C CA  . PRO B 1 443 ? 41.744 144.253 6.824   1.00 33.50  ? 440 PRO B CA  1 
ATOM   7545 C C   . PRO B 1 443 ? 40.798 143.830 7.939   1.00 37.64  ? 440 PRO B C   1 
ATOM   7546 O O   . PRO B 1 443 ? 41.181 143.681 9.101   1.00 31.96  ? 440 PRO B O   1 
ATOM   7547 C CB  . PRO B 1 443 ? 42.260 143.040 6.041   1.00 24.62  ? 440 PRO B CB  1 
ATOM   7548 C CG  . PRO B 1 443 ? 43.599 142.752 6.631   1.00 31.84  ? 440 PRO B CG  1 
ATOM   7549 C CD  . PRO B 1 443 ? 44.166 144.097 6.975   1.00 34.67  ? 440 PRO B CD  1 
ATOM   7550 N N   . LEU B 1 444 ? 39.534 143.633 7.557   1.00 38.48  ? 441 LEU B N   1 
ATOM   7551 C CA  . LEU B 1 444 ? 38.499 143.334 8.541   1.00 38.25  ? 441 LEU B CA  1 
ATOM   7552 C C   . LEU B 1 444 ? 38.727 141.988 9.217   1.00 31.93  ? 441 LEU B C   1 
ATOM   7553 O O   . LEU B 1 444 ? 38.389 141.825 10.395  1.00 37.14  ? 441 LEU B O   1 
ATOM   7554 C CB  . LEU B 1 444 ? 37.121 143.374 7.876   1.00 35.45  ? 441 LEU B CB  1 
ATOM   7555 C CG  . LEU B 1 444 ? 35.901 143.248 8.790   1.00 40.82  ? 441 LEU B CG  1 
ATOM   7556 C CD1 . LEU B 1 444 ? 35.955 144.286 9.899   1.00 41.47  ? 441 LEU B CD1 1 
ATOM   7557 C CD2 . LEU B 1 444 ? 34.615 143.387 7.988   1.00 43.33  ? 441 LEU B CD2 1 
ATOM   7558 N N   . TRP B 1 445 ? 39.307 141.019 8.503   1.00 33.21  ? 442 TRP B N   1 
ATOM   7559 C CA  . TRP B 1 445 ? 39.467 139.684 9.072   1.00 34.78  ? 442 TRP B CA  1 
ATOM   7560 C C   . TRP B 1 445 ? 40.472 139.639 10.215  1.00 41.76  ? 442 TRP B C   1 
ATOM   7561 O O   . TRP B 1 445 ? 40.520 138.631 10.929  1.00 45.60  ? 442 TRP B O   1 
ATOM   7562 C CB  . TRP B 1 445 ? 39.866 138.675 7.987   1.00 25.06  ? 442 TRP B CB  1 
ATOM   7563 C CG  . TRP B 1 445 ? 41.211 138.900 7.344   1.00 33.68  ? 442 TRP B CG  1 
ATOM   7564 C CD1 . TRP B 1 445 ? 41.453 139.507 6.146   1.00 40.16  ? 442 TRP B CD1 1 
ATOM   7565 C CD2 . TRP B 1 445 ? 42.491 138.493 7.852   1.00 29.44  ? 442 TRP B CD2 1 
ATOM   7566 N NE1 . TRP B 1 445 ? 42.801 139.515 5.881   1.00 32.11  ? 442 TRP B NE1 1 
ATOM   7567 C CE2 . TRP B 1 445 ? 43.461 138.899 6.912   1.00 25.70  ? 442 TRP B CE2 1 
ATOM   7568 C CE3 . TRP B 1 445 ? 42.912 137.832 9.011   1.00 30.63  ? 442 TRP B CE3 1 
ATOM   7569 C CZ2 . TRP B 1 445 ? 44.823 138.667 7.096   1.00 24.78  ? 442 TRP B CZ2 1 
ATOM   7570 C CZ3 . TRP B 1 445 ? 44.266 137.603 9.192   1.00 24.21  ? 442 TRP B CZ3 1 
ATOM   7571 C CH2 . TRP B 1 445 ? 45.205 138.019 8.239   1.00 31.81  ? 442 TRP B CH2 1 
ATOM   7572 N N   . MET B 1 446 ? 41.270 140.691 10.410  1.00 37.27  ? 443 MET B N   1 
ATOM   7573 C CA  . MET B 1 446 ? 42.179 140.739 11.548  1.00 36.53  ? 443 MET B CA  1 
ATOM   7574 C C   . MET B 1 446 ? 41.484 141.113 12.849  1.00 36.31  ? 443 MET B C   1 
ATOM   7575 O O   . MET B 1 446 ? 42.094 140.976 13.916  1.00 34.26  ? 443 MET B O   1 
ATOM   7576 C CB  . MET B 1 446 ? 43.325 141.719 11.276  1.00 33.03  ? 443 MET B CB  1 
ATOM   7577 C CG  . MET B 1 446 ? 44.419 141.166 10.376  1.00 33.86  ? 443 MET B CG  1 
ATOM   7578 S SD  . MET B 1 446 ? 45.772 142.335 10.146  1.00 40.84  ? 443 MET B SD  1 
ATOM   7579 C CE  . MET B 1 446 ? 46.936 141.336 9.222   1.00 29.61  ? 443 MET B CE  1 
ATOM   7580 N N   . GLY B 1 447 ? 40.241 141.575 12.788  1.00 34.57  ? 444 GLY B N   1 
ATOM   7581 C CA  . GLY B 1 447 ? 39.500 141.835 14.014  1.00 35.11  ? 444 GLY B CA  1 
ATOM   7582 C C   . GLY B 1 447 ? 40.103 143.010 14.757  1.00 36.92  ? 444 GLY B C   1 
ATOM   7583 O O   . GLY B 1 447 ? 40.249 144.111 14.213  1.00 40.07  ? 444 GLY B O   1 
ATOM   7584 N N   . VAL B 1 448 ? 40.450 142.780 16.019  1.00 34.72  ? 445 VAL B N   1 
ATOM   7585 C CA  . VAL B 1 448 ? 41.142 143.765 16.845  1.00 31.78  ? 445 VAL B CA  1 
ATOM   7586 C C   . VAL B 1 448 ? 42.603 143.341 16.942  1.00 24.84  ? 445 VAL B C   1 
ATOM   7587 O O   . VAL B 1 448 ? 42.963 142.557 17.833  1.00 29.95  ? 445 VAL B O   1 
ATOM   7588 C CB  . VAL B 1 448 ? 40.499 143.885 18.235  1.00 30.48  ? 445 VAL B CB  1 
ATOM   7589 C CG1 . VAL B 1 448 ? 41.085 145.069 18.994  1.00 27.86  ? 445 VAL B CG1 1 
ATOM   7590 C CG2 . VAL B 1 448 ? 38.987 144.010 18.112  1.00 30.24  ? 445 VAL B CG2 1 
ATOM   7591 N N   . PRO B 1 449 ? 43.471 143.823 16.057  1.00 36.47  ? 446 PRO B N   1 
ATOM   7592 C CA  . PRO B 1 449 ? 44.841 143.306 16.001  1.00 28.15  ? 446 PRO B CA  1 
ATOM   7593 C C   . PRO B 1 449 ? 45.663 143.753 17.200  1.00 25.93  ? 446 PRO B C   1 
ATOM   7594 O O   . PRO B 1 449 ? 45.287 144.638 17.970  1.00 29.14  ? 446 PRO B O   1 
ATOM   7595 C CB  . PRO B 1 449 ? 45.398 143.895 14.699  1.00 25.94  ? 446 PRO B CB  1 
ATOM   7596 C CG  . PRO B 1 449 ? 44.198 144.414 13.948  1.00 32.16  ? 446 PRO B CG  1 
ATOM   7597 C CD  . PRO B 1 449 ? 43.219 144.813 15.001  1.00 29.38  ? 446 PRO B CD  1 
ATOM   7598 N N   . HIS B 1 450 ? 46.820 143.113 17.335  1.00 36.77  ? 447 HIS B N   1 
ATOM   7599 C CA  . HIS B 1 450 ? 47.751 143.419 18.411  1.00 33.37  ? 447 HIS B CA  1 
ATOM   7600 C C   . HIS B 1 450 ? 48.288 144.837 18.267  1.00 38.51  ? 447 HIS B C   1 
ATOM   7601 O O   . HIS B 1 450 ? 48.835 145.202 17.221  1.00 39.26  ? 447 HIS B O   1 
ATOM   7602 C CB  . HIS B 1 450 ? 48.895 142.405 18.394  1.00 32.81  ? 447 HIS B CB  1 
ATOM   7603 C CG  . HIS B 1 450 ? 50.044 142.768 19.280  1.00 37.33  ? 447 HIS B CG  1 
ATOM   7604 N ND1 . HIS B 1 450 ? 50.120 142.375 20.599  1.00 36.90  ? 447 HIS B ND1 1 
ATOM   7605 C CD2 . HIS B 1 450 ? 51.170 143.477 19.033  1.00 41.18  ? 447 HIS B CD2 1 
ATOM   7606 C CE1 . HIS B 1 450 ? 51.241 142.831 21.128  1.00 45.02  ? 447 HIS B CE1 1 
ATOM   7607 N NE2 . HIS B 1 450 ? 51.896 143.503 20.199  1.00 50.09  ? 447 HIS B NE2 1 
ATOM   7608 N N   . GLY B 1 451 ? 48.123 145.638 19.318  1.00 38.57  ? 448 GLY B N   1 
ATOM   7609 C CA  . GLY B 1 451 ? 48.682 146.973 19.368  1.00 32.95  ? 448 GLY B CA  1 
ATOM   7610 C C   . GLY B 1 451 ? 47.718 148.103 19.083  1.00 35.29  ? 448 GLY B C   1 
ATOM   7611 O O   . GLY B 1 451 ? 48.136 149.266 19.115  1.00 33.52  ? 448 GLY B O   1 
ATOM   7612 N N   . TYR B 1 452 ? 46.447 147.810 18.815  1.00 23.55  ? 449 TYR B N   1 
ATOM   7613 C CA  . TYR B 1 452 ? 45.492 148.836 18.419  1.00 25.00  ? 449 TYR B CA  1 
ATOM   7614 C C   . TYR B 1 452 ? 44.501 149.168 19.529  1.00 26.82  ? 449 TYR B C   1 
ATOM   7615 O O   . TYR B 1 452 ? 43.386 149.625 19.267  1.00 29.32  ? 449 TYR B O   1 
ATOM   7616 C CB  . TYR B 1 452 ? 44.789 148.427 17.129  1.00 20.41  ? 449 TYR B CB  1 
ATOM   7617 C CG  . TYR B 1 452 ? 45.746 148.530 15.970  1.00 37.17  ? 449 TYR B CG  1 
ATOM   7618 C CD1 . TYR B 1 452 ? 45.970 149.748 15.343  1.00 32.45  ? 449 TYR B CD1 1 
ATOM   7619 C CD2 . TYR B 1 452 ? 46.477 147.429 15.545  1.00 24.17  ? 449 TYR B CD2 1 
ATOM   7620 C CE1 . TYR B 1 452 ? 46.865 149.860 14.301  1.00 30.19  ? 449 TYR B CE1 1 
ATOM   7621 C CE2 . TYR B 1 452 ? 47.376 147.531 14.503  1.00 30.27  ? 449 TYR B CE2 1 
ATOM   7622 C CZ  . TYR B 1 452 ? 47.566 148.750 13.884  1.00 30.37  ? 449 TYR B CZ  1 
ATOM   7623 O OH  . TYR B 1 452 ? 48.461 148.858 12.845  1.00 39.79  ? 449 TYR B OH  1 
ATOM   7624 N N   . GLU B 1 453 ? 44.912 148.948 20.776  1.00 27.31  ? 450 GLU B N   1 
ATOM   7625 C CA  . GLU B 1 453 ? 44.297 149.582 21.930  1.00 34.66  ? 450 GLU B CA  1 
ATOM   7626 C C   . GLU B 1 453 ? 45.094 150.787 22.410  1.00 39.73  ? 450 GLU B C   1 
ATOM   7627 O O   . GLU B 1 453 ? 44.583 151.570 23.218  1.00 39.93  ? 450 GLU B O   1 
ATOM   7628 C CB  . GLU B 1 453 ? 44.153 148.577 23.080  1.00 24.54  ? 450 GLU B CB  1 
ATOM   7629 C CG  . GLU B 1 453 ? 45.360 148.494 24.013  1.00 21.94  ? 450 GLU B CG  1 
ATOM   7630 C CD  . GLU B 1 453 ? 46.551 147.769 23.405  1.00 28.01  ? 450 GLU B CD  1 
ATOM   7631 O OE1 . GLU B 1 453 ? 46.506 147.424 22.205  1.00 32.11  ? 450 GLU B OE1 1 
ATOM   7632 O OE2 . GLU B 1 453 ? 47.537 147.538 24.137  1.00 32.83  ? 450 GLU B OE2 1 
ATOM   7633 N N   . ILE B 1 454 ? 46.326 150.954 21.918  1.00 26.27  ? 451 ILE B N   1 
ATOM   7634 C CA  . ILE B 1 454 ? 47.204 152.020 22.394  1.00 36.55  ? 451 ILE B CA  1 
ATOM   7635 C C   . ILE B 1 454 ? 46.616 153.388 22.076  1.00 36.15  ? 451 ILE B C   1 
ATOM   7636 O O   . ILE B 1 454 ? 46.618 154.291 22.923  1.00 34.73  ? 451 ILE B O   1 
ATOM   7637 C CB  . ILE B 1 454 ? 48.612 151.860 21.789  1.00 28.17  ? 451 ILE B CB  1 
ATOM   7638 C CG1 . ILE B 1 454 ? 49.228 150.521 22.200  1.00 30.26  ? 451 ILE B CG1 1 
ATOM   7639 C CG2 . ILE B 1 454 ? 49.509 153.016 22.203  1.00 30.73  ? 451 ILE B CG2 1 
ATOM   7640 C CD1 . ILE B 1 454 ? 50.572 150.251 21.554  1.00 30.47  ? 451 ILE B CD1 1 
ATOM   7641 N N   . GLU B 1 455 ? 46.105 153.566 20.854  1.00 30.40  ? 452 GLU B N   1 
ATOM   7642 C CA  . GLU B 1 455 ? 45.575 154.863 20.449  1.00 34.75  ? 452 GLU B CA  1 
ATOM   7643 C C   . GLU B 1 455 ? 44.401 155.309 21.310  1.00 39.37  ? 452 GLU B C   1 
ATOM   7644 O O   . GLU B 1 455 ? 44.155 156.514 21.426  1.00 41.89  ? 452 GLU B O   1 
ATOM   7645 C CB  . GLU B 1 455 ? 45.161 154.826 18.975  1.00 31.82  ? 452 GLU B CB  1 
ATOM   7646 C CG  . GLU B 1 455 ? 44.299 153.637 18.592  1.00 30.64  ? 452 GLU B CG  1 
ATOM   7647 C CD  . GLU B 1 455 ? 44.242 153.424 17.091  1.00 35.10  ? 452 GLU B CD  1 
ATOM   7648 O OE1 . GLU B 1 455 ? 43.426 154.090 16.421  1.00 33.53  ? 452 GLU B OE1 1 
ATOM   7649 O OE2 . GLU B 1 455 ? 45.028 152.599 16.581  1.00 33.05  ? 452 GLU B OE2 1 
ATOM   7650 N N   . PHE B 1 456 ? 43.676 154.373 21.924  1.00 34.73  ? 453 PHE B N   1 
ATOM   7651 C CA  . PHE B 1 456 ? 42.591 154.755 22.820  1.00 33.65  ? 453 PHE B CA  1 
ATOM   7652 C C   . PHE B 1 456 ? 43.092 155.042 24.229  1.00 30.83  ? 453 PHE B C   1 
ATOM   7653 O O   . PHE B 1 456 ? 42.499 155.864 24.936  1.00 39.22  ? 453 PHE B O   1 
ATOM   7654 C CB  . PHE B 1 456 ? 41.522 153.661 22.842  1.00 31.58  ? 453 PHE B CB  1 
ATOM   7655 C CG  . PHE B 1 456 ? 40.785 153.513 21.542  1.00 23.20  ? 453 PHE B CG  1 
ATOM   7656 C CD1 . PHE B 1 456 ? 41.221 152.619 20.578  1.00 28.55  ? 453 PHE B CD1 1 
ATOM   7657 C CD2 . PHE B 1 456 ? 39.660 154.276 21.280  1.00 22.50  ? 453 PHE B CD2 1 
ATOM   7658 C CE1 . PHE B 1 456 ? 40.545 152.485 19.379  1.00 31.05  ? 453 PHE B CE1 1 
ATOM   7659 C CE2 . PHE B 1 456 ? 38.979 154.147 20.084  1.00 37.86  ? 453 PHE B CE2 1 
ATOM   7660 C CZ  . PHE B 1 456 ? 39.423 153.250 19.132  1.00 30.77  ? 453 PHE B CZ  1 
ATOM   7661 N N   . ILE B 1 457 ? 44.174 154.385 24.651  1.00 33.77  ? 454 ILE B N   1 
ATOM   7662 C CA  . ILE B 1 457 ? 44.738 154.654 25.970  1.00 27.81  ? 454 ILE B CA  1 
ATOM   7663 C C   . ILE B 1 457 ? 45.347 156.050 26.016  1.00 35.95  ? 454 ILE B C   1 
ATOM   7664 O O   . ILE B 1 457 ? 45.273 156.743 27.038  1.00 40.51  ? 454 ILE B O   1 
ATOM   7665 C CB  . ILE B 1 457 ? 45.770 153.572 26.340  1.00 35.96  ? 454 ILE B CB  1 
ATOM   7666 C CG1 . ILE B 1 457 ? 45.121 152.186 26.333  1.00 34.15  ? 454 ILE B CG1 1 
ATOM   7667 C CG2 . ILE B 1 457 ? 46.388 153.858 27.702  1.00 30.42  ? 454 ILE B CG2 1 
ATOM   7668 C CD1 . ILE B 1 457 ? 44.023 152.022 27.360  1.00 34.61  ? 454 ILE B CD1 1 
ATOM   7669 N N   . PHE B 1 458 ? 45.948 156.491 24.913  1.00 31.69  ? 455 PHE B N   1 
ATOM   7670 C CA  . PHE B 1 458 ? 46.585 157.799 24.844  1.00 33.17  ? 455 PHE B CA  1 
ATOM   7671 C C   . PHE B 1 458 ? 45.641 158.898 24.368  1.00 33.17  ? 455 PHE B C   1 
ATOM   7672 O O   . PHE B 1 458 ? 46.090 160.027 24.146  1.00 39.62  ? 455 PHE B O   1 
ATOM   7673 C CB  . PHE B 1 458 ? 47.816 157.737 23.936  1.00 30.14  ? 455 PHE B CB  1 
ATOM   7674 C CG  . PHE B 1 458 ? 49.013 157.101 24.584  1.00 27.09  ? 455 PHE B CG  1 
ATOM   7675 C CD1 . PHE B 1 458 ? 49.209 155.731 24.522  1.00 26.67  ? 455 PHE B CD1 1 
ATOM   7676 C CD2 . PHE B 1 458 ? 49.942 157.875 25.259  1.00 20.22  ? 455 PHE B CD2 1 
ATOM   7677 C CE1 . PHE B 1 458 ? 50.311 155.146 25.120  1.00 29.08  ? 455 PHE B CE1 1 
ATOM   7678 C CE2 . PHE B 1 458 ? 51.044 157.296 25.860  1.00 25.91  ? 455 PHE B CE2 1 
ATOM   7679 C CZ  . PHE B 1 458 ? 51.229 155.930 25.790  1.00 29.26  ? 455 PHE B CZ  1 
ATOM   7680 N N   . GLY B 1 459 ? 44.354 158.600 24.209  1.00 28.74  ? 456 GLY B N   1 
ATOM   7681 C CA  . GLY B 1 459 ? 43.391 159.622 23.838  1.00 37.13  ? 456 GLY B CA  1 
ATOM   7682 C C   . GLY B 1 459 ? 43.550 160.174 22.440  1.00 36.64  ? 456 GLY B C   1 
ATOM   7683 O O   . GLY B 1 459 ? 43.171 161.323 22.189  1.00 45.63  ? 456 GLY B O   1 
ATOM   7684 N N   . ILE B 1 460 ? 44.104 159.383 21.517  1.00 33.39  ? 457 ILE B N   1 
ATOM   7685 C CA  . ILE B 1 460 ? 44.263 159.847 20.135  1.00 29.48  ? 457 ILE B CA  1 
ATOM   7686 C C   . ILE B 1 460 ? 42.934 160.225 19.492  1.00 32.40  ? 457 ILE B C   1 
ATOM   7687 O O   . ILE B 1 460 ? 42.910 161.180 18.701  1.00 38.63  ? 457 ILE B O   1 
ATOM   7688 C CB  . ILE B 1 460 ? 45.055 158.819 19.319  1.00 30.08  ? 457 ILE B CB  1 
ATOM   7689 C CG1 . ILE B 1 460 ? 46.383 158.502 20.013  1.00 29.46  ? 457 ILE B CG1 1 
ATOM   7690 C CG2 . ILE B 1 460 ? 45.305 159.323 17.903  1.00 29.89  ? 457 ILE B CG2 1 
ATOM   7691 C CD1 . ILE B 1 460 ? 47.240 159.724 20.270  1.00 31.77  ? 457 ILE B CD1 1 
ATOM   7692 N N   . PRO B 1 461 ? 41.811 159.543 19.753  1.00 38.99  ? 458 PRO B N   1 
ATOM   7693 C CA  . PRO B 1 461 ? 40.535 160.008 19.178  1.00 36.62  ? 458 PRO B CA  1 
ATOM   7694 C C   . PRO B 1 461 ? 40.199 161.463 19.487  1.00 46.24  ? 458 PRO B C   1 
ATOM   7695 O O   . PRO B 1 461 ? 39.432 162.073 18.731  1.00 42.75  ? 458 PRO B O   1 
ATOM   7696 C CB  . PRO B 1 461 ? 39.506 159.052 19.799  1.00 36.50  ? 458 PRO B CB  1 
ATOM   7697 C CG  . PRO B 1 461 ? 40.254 157.802 19.999  1.00 34.68  ? 458 PRO B CG  1 
ATOM   7698 C CD  . PRO B 1 461 ? 41.660 158.205 20.362  1.00 34.67  ? 458 PRO B CD  1 
ATOM   7699 N N   . LEU B 1 462 ? 40.748 162.043 20.558  1.00 40.29  ? 459 LEU B N   1 
ATOM   7700 C CA  . LEU B 1 462 ? 40.475 163.440 20.875  1.00 40.93  ? 459 LEU B CA  1 
ATOM   7701 C C   . LEU B 1 462 ? 41.182 164.411 19.938  1.00 44.73  ? 459 LEU B C   1 
ATOM   7702 O O   . LEU B 1 462 ? 40.864 165.604 19.963  1.00 47.13  ? 459 LEU B O   1 
ATOM   7703 C CB  . LEU B 1 462 ? 40.872 163.741 22.321  1.00 34.97  ? 459 LEU B CB  1 
ATOM   7704 C CG  . LEU B 1 462 ? 40.117 162.950 23.390  1.00 46.37  ? 459 LEU B CG  1 
ATOM   7705 C CD1 . LEU B 1 462 ? 40.642 163.277 24.778  1.00 44.67  ? 459 LEU B CD1 1 
ATOM   7706 C CD2 . LEU B 1 462 ? 38.625 163.225 23.299  1.00 41.21  ? 459 LEU B CD2 1 
ATOM   7707 N N   . ASP B 1 463 ? 42.122 163.937 19.129  1.00 44.18  ? 460 ASP B N   1 
ATOM   7708 C CA  . ASP B 1 463 ? 42.812 164.788 18.168  1.00 44.47  ? 460 ASP B CA  1 
ATOM   7709 C C   . ASP B 1 463 ? 41.813 165.314 17.143  1.00 47.86  ? 460 ASP B C   1 
ATOM   7710 O O   . ASP B 1 463 ? 41.158 164.512 16.459  1.00 43.33  ? 460 ASP B O   1 
ATOM   7711 C CB  . ASP B 1 463 ? 43.930 164.001 17.483  1.00 43.14  ? 460 ASP B CB  1 
ATOM   7712 C CG  . ASP B 1 463 ? 44.879 164.884 16.684  1.00 47.37  ? 460 ASP B CG  1 
ATOM   7713 O OD1 . ASP B 1 463 ? 44.426 165.871 16.066  1.00 46.30  ? 460 ASP B OD1 1 
ATOM   7714 O OD2 . ASP B 1 463 ? 46.091 164.581 16.667  1.00 57.74  ? 460 ASP B OD2 1 
ATOM   7715 N N   . PRO B 1 464 ? 41.662 166.635 17.002  1.00 50.70  ? 461 PRO B N   1 
ATOM   7716 C CA  . PRO B 1 464 ? 40.658 167.164 16.064  1.00 46.76  ? 461 PRO B CA  1 
ATOM   7717 C C   . PRO B 1 464 ? 40.939 166.829 14.609  1.00 54.87  ? 461 PRO B C   1 
ATOM   7718 O O   . PRO B 1 464 ? 39.997 166.807 13.808  1.00 51.98  ? 461 PRO B O   1 
ATOM   7719 C CB  . PRO B 1 464 ? 40.715 168.681 16.301  1.00 47.76  ? 461 PRO B CB  1 
ATOM   7720 C CG  . PRO B 1 464 ? 41.390 168.849 17.627  1.00 53.84  ? 461 PRO B CG  1 
ATOM   7721 C CD  . PRO B 1 464 ? 42.345 167.705 17.745  1.00 53.58  ? 461 PRO B CD  1 
ATOM   7722 N N   . SER B 1 465 ? 42.194 166.570 14.241  1.00 51.63  ? 462 SER B N   1 
ATOM   7723 C CA  . SER B 1 465 ? 42.561 166.276 12.862  1.00 53.70  ? 462 SER B CA  1 
ATOM   7724 C C   . SER B 1 465 ? 42.352 164.811 12.485  1.00 50.83  ? 462 SER B C   1 
ATOM   7725 O O   . SER B 1 465 ? 42.873 164.370 11.452  1.00 57.37  ? 462 SER B O   1 
ATOM   7726 C CB  . SER B 1 465 ? 44.016 166.679 12.607  1.00 47.92  ? 462 SER B CB  1 
ATOM   7727 O OG  . SER B 1 465 ? 44.896 166.003 13.487  1.00 65.97  ? 462 SER B OG  1 
ATOM   7728 N N   . ARG B 1 466 ? 41.610 164.052 13.286  1.00 47.92  ? 463 ARG B N   1 
ATOM   7729 C CA  . ARG B 1 466 ? 41.338 162.651 13.012  1.00 48.93  ? 463 ARG B CA  1 
ATOM   7730 C C   . ARG B 1 466 ? 39.839 162.444 12.831  1.00 47.92  ? 463 ARG B C   1 
ATOM   7731 O O   . ARG B 1 466 ? 39.023 163.281 13.225  1.00 53.35  ? 463 ARG B O   1 
ATOM   7732 C CB  . ARG B 1 466 ? 41.864 161.752 14.137  1.00 50.19  ? 463 ARG B CB  1 
ATOM   7733 C CG  . ARG B 1 466 ? 43.268 162.107 14.596  1.00 41.50  ? 463 ARG B CG  1 
ATOM   7734 C CD  . ARG B 1 466 ? 44.283 161.034 14.243  1.00 44.00  ? 463 ARG B CD  1 
ATOM   7735 N NE  . ARG B 1 466 ? 45.600 161.349 14.792  1.00 57.24  ? 463 ARG B NE  1 
ATOM   7736 C CZ  . ARG B 1 466 ? 46.651 160.538 14.736  1.00 61.66  ? 463 ARG B CZ  1 
ATOM   7737 N NH1 . ARG B 1 466 ? 46.545 159.351 14.155  1.00 56.69  ? 463 ARG B NH1 1 
ATOM   7738 N NH2 . ARG B 1 466 ? 47.808 160.913 15.265  1.00 61.46  ? 463 ARG B NH2 1 
ATOM   7739 N N   . ASN B 1 467 ? 39.486 161.308 12.236  1.00 48.73  ? 464 ASN B N   1 
ATOM   7740 C CA  . ASN B 1 467 ? 38.108 161.002 11.866  1.00 49.45  ? 464 ASN B CA  1 
ATOM   7741 C C   . ASN B 1 467 ? 37.505 159.919 12.759  1.00 41.87  ? 464 ASN B C   1 
ATOM   7742 O O   . ASN B 1 467 ? 36.852 158.989 12.281  1.00 55.97  ? 464 ASN B O   1 
ATOM   7743 C CB  . ASN B 1 467 ? 38.030 160.591 10.397  1.00 48.67  ? 464 ASN B CB  1 
ATOM   7744 C CG  . ASN B 1 467 ? 36.622 160.679 9.841   1.00 59.53  ? 464 ASN B CG  1 
ATOM   7745 O OD1 . ASN B 1 467 ? 35.768 161.372 10.393  1.00 66.07  ? 464 ASN B OD1 1 
ATOM   7746 N ND2 . ASN B 1 467 ? 36.374 159.974 8.743   1.00 56.51  ? 464 ASN B ND2 1 
ATOM   7747 N N   . TYR B 1 468 ? 37.716 160.025 14.068  1.00 40.40  ? 465 TYR B N   1 
ATOM   7748 C CA  . TYR B 1 468 ? 37.089 159.103 15.002  1.00 42.88  ? 465 TYR B CA  1 
ATOM   7749 C C   . TYR B 1 468 ? 35.631 159.492 15.237  1.00 44.95  ? 465 TYR B C   1 
ATOM   7750 O O   . TYR B 1 468 ? 35.214 160.628 14.994  1.00 50.00  ? 465 TYR B O   1 
ATOM   7751 C CB  . TYR B 1 468 ? 37.842 159.080 16.333  1.00 32.83  ? 465 TYR B CB  1 
ATOM   7752 C CG  . TYR B 1 468 ? 39.170 158.354 16.294  1.00 41.47  ? 465 TYR B CG  1 
ATOM   7753 C CD1 . TYR B 1 468 ? 40.328 159.004 15.889  1.00 33.40  ? 465 TYR B CD1 1 
ATOM   7754 C CD2 . TYR B 1 468 ? 39.267 157.021 16.675  1.00 37.36  ? 465 TYR B CD2 1 
ATOM   7755 C CE1 . TYR B 1 468 ? 41.545 158.348 15.861  1.00 32.90  ? 465 TYR B CE1 1 
ATOM   7756 C CE2 . TYR B 1 468 ? 40.479 156.355 16.649  1.00 34.52  ? 465 TYR B CE2 1 
ATOM   7757 C CZ  . TYR B 1 468 ? 41.614 157.023 16.240  1.00 45.06  ? 465 TYR B CZ  1 
ATOM   7758 O OH  . TYR B 1 468 ? 42.822 156.363 16.212  1.00 35.53  ? 465 TYR B OH  1 
ATOM   7759 N N   . THR B 1 469 ? 34.851 158.527 15.719  1.00 41.85  ? 466 THR B N   1 
ATOM   7760 C CA  . THR B 1 469 ? 33.444 158.770 15.993  1.00 43.50  ? 466 THR B CA  1 
ATOM   7761 C C   . THR B 1 469 ? 33.268 159.413 17.367  1.00 42.99  ? 466 THR B C   1 
ATOM   7762 O O   . THR B 1 469 ? 34.192 159.474 18.183  1.00 36.94  ? 466 THR B O   1 
ATOM   7763 C CB  . THR B 1 469 ? 32.642 157.470 15.920  1.00 36.65  ? 466 THR B CB  1 
ATOM   7764 O OG1 . THR B 1 469 ? 33.003 156.621 17.016  1.00 48.44  ? 466 THR B OG1 1 
ATOM   7765 C CG2 . THR B 1 469 ? 32.916 156.746 14.611  1.00 39.99  ? 466 THR B CG2 1 
ATOM   7766 N N   . ALA B 1 470 ? 32.049 159.897 17.618  1.00 42.21  ? 467 ALA B N   1 
ATOM   7767 C CA  . ALA B 1 470 ? 31.748 160.513 18.906  1.00 37.93  ? 467 ALA B CA  1 
ATOM   7768 C C   . ALA B 1 470 ? 31.793 159.489 20.033  1.00 43.28  ? 467 ALA B C   1 
ATOM   7769 O O   . ALA B 1 470 ? 32.243 159.799 21.142  1.00 45.61  ? 467 ALA B O   1 
ATOM   7770 C CB  . ALA B 1 470 ? 30.383 161.197 18.855  1.00 44.89  ? 467 ALA B CB  1 
ATOM   7771 N N   . GLU B 1 471 ? 31.330 158.264 19.770  1.00 49.08  ? 468 GLU B N   1 
ATOM   7772 C CA  . GLU B 1 471 ? 31.372 157.229 20.797  1.00 41.10  ? 468 GLU B CA  1 
ATOM   7773 C C   . GLU B 1 471 ? 32.802 156.806 21.105  1.00 37.96  ? 468 GLU B C   1 
ATOM   7774 O O   . GLU B 1 471 ? 33.102 156.426 22.242  1.00 36.65  ? 468 GLU B O   1 
ATOM   7775 C CB  . GLU B 1 471 ? 30.545 156.017 20.366  1.00 48.57  ? 468 GLU B CB  1 
ATOM   7776 C CG  . GLU B 1 471 ? 29.143 156.358 19.894  1.00 60.49  ? 468 GLU B CG  1 
ATOM   7777 C CD  . GLU B 1 471 ? 29.048 156.467 18.385  1.00 76.12  ? 468 GLU B CD  1 
ATOM   7778 O OE1 . GLU B 1 471 ? 29.285 155.449 17.700  1.00 83.58  ? 468 GLU B OE1 1 
ATOM   7779 O OE2 . GLU B 1 471 ? 28.746 157.570 17.883  1.00 71.62  ? 468 GLU B OE2 1 
ATOM   7780 N N   . GLU B 1 472 ? 33.693 156.865 20.112  1.00 41.44  ? 469 GLU B N   1 
ATOM   7781 C CA  . GLU B 1 472 ? 35.088 156.518 20.354  1.00 42.47  ? 469 GLU B CA  1 
ATOM   7782 C C   . GLU B 1 472 ? 35.794 157.581 21.186  1.00 43.97  ? 469 GLU B C   1 
ATOM   7783 O O   . GLU B 1 472 ? 36.762 157.271 21.891  1.00 40.70  ? 469 GLU B O   1 
ATOM   7784 C CB  . GLU B 1 472 ? 35.812 156.302 19.024  1.00 39.73  ? 469 GLU B CB  1 
ATOM   7785 C CG  . GLU B 1 472 ? 35.452 154.991 18.339  1.00 45.27  ? 469 GLU B CG  1 
ATOM   7786 C CD  . GLU B 1 472 ? 36.026 154.878 16.940  1.00 44.58  ? 469 GLU B CD  1 
ATOM   7787 O OE1 . GLU B 1 472 ? 36.003 155.886 16.202  1.00 43.64  ? 469 GLU B OE1 1 
ATOM   7788 O OE2 . GLU B 1 472 ? 36.502 153.781 16.578  1.00 40.49  ? 469 GLU B OE2 1 
ATOM   7789 N N   . LYS B 1 473 ? 35.329 158.831 21.124  1.00 41.86  ? 470 LYS B N   1 
ATOM   7790 C CA  . LYS B 1 473 ? 35.900 159.870 21.974  1.00 48.52  ? 470 LYS B CA  1 
ATOM   7791 C C   . LYS B 1 473 ? 35.498 159.672 23.430  1.00 44.55  ? 470 LYS B C   1 
ATOM   7792 O O   . LYS B 1 473 ? 36.329 159.817 24.335  1.00 47.04  ? 470 LYS B O   1 
ATOM   7793 C CB  . LYS B 1 473 ? 35.472 161.251 21.477  1.00 43.05  ? 470 LYS B CB  1 
ATOM   7794 C CG  . LYS B 1 473 ? 36.098 161.650 20.149  1.00 50.26  ? 470 LYS B CG  1 
ATOM   7795 C CD  . LYS B 1 473 ? 35.543 162.971 19.644  1.00 50.56  ? 470 LYS B CD  1 
ATOM   7796 C CE  . LYS B 1 473 ? 36.163 163.351 18.309  1.00 46.80  ? 470 LYS B CE  1 
ATOM   7797 N NZ  . LYS B 1 473 ? 35.540 164.572 17.729  1.00 56.15  ? 470 LYS B NZ  1 
ATOM   7798 N N   . ILE B 1 474 ? 34.228 159.341 23.677  1.00 43.47  ? 471 ILE B N   1 
ATOM   7799 C CA  . ILE B 1 474 ? 33.792 159.035 25.036  1.00 43.40  ? 471 ILE B CA  1 
ATOM   7800 C C   . ILE B 1 474 ? 34.458 157.757 25.532  1.00 45.54  ? 471 ILE B C   1 
ATOM   7801 O O   . ILE B 1 474 ? 34.859 157.660 26.698  1.00 44.65  ? 471 ILE B O   1 
ATOM   7802 C CB  . ILE B 1 474 ? 32.256 158.933 25.093  1.00 49.84  ? 471 ILE B CB  1 
ATOM   7803 C CG1 . ILE B 1 474 ? 31.616 160.247 24.642  1.00 40.16  ? 471 ILE B CG1 1 
ATOM   7804 C CG2 . ILE B 1 474 ? 31.792 158.562 26.495  1.00 48.32  ? 471 ILE B CG2 1 
ATOM   7805 C CD1 . ILE B 1 474 ? 30.102 160.210 24.604  1.00 41.80  ? 471 ILE B CD1 1 
ATOM   7806 N N   . PHE B 1 475 ? 34.594 156.762 24.652  1.00 44.64  ? 472 PHE B N   1 
ATOM   7807 C CA  . PHE B 1 475 ? 35.238 155.509 25.033  1.00 38.09  ? 472 PHE B CA  1 
ATOM   7808 C C   . PHE B 1 475 ? 36.704 155.725 25.386  1.00 37.06  ? 472 PHE B C   1 
ATOM   7809 O O   . PHE B 1 475 ? 37.225 155.100 26.317  1.00 40.70  ? 472 PHE B O   1 
ATOM   7810 C CB  . PHE B 1 475 ? 35.093 154.492 23.900  1.00 41.87  ? 472 PHE B CB  1 
ATOM   7811 C CG  . PHE B 1 475 ? 35.847 153.213 24.125  1.00 38.67  ? 472 PHE B CG  1 
ATOM   7812 C CD1 . PHE B 1 475 ? 35.633 152.454 25.263  1.00 37.42  ? 472 PHE B CD1 1 
ATOM   7813 C CD2 . PHE B 1 475 ? 36.752 152.756 23.182  1.00 34.13  ? 472 PHE B CD2 1 
ATOM   7814 C CE1 . PHE B 1 475 ? 36.323 151.273 25.465  1.00 40.21  ? 472 PHE B CE1 1 
ATOM   7815 C CE2 . PHE B 1 475 ? 37.442 151.575 23.376  1.00 39.12  ? 472 PHE B CE2 1 
ATOM   7816 C CZ  . PHE B 1 475 ? 37.225 150.832 24.519  1.00 40.03  ? 472 PHE B CZ  1 
ATOM   7817 N N   . ALA B 1 476 ? 37.386 156.610 24.654  1.00 35.66  ? 473 ALA B N   1 
ATOM   7818 C CA  . ALA B 1 476 ? 38.785 156.893 24.955  1.00 35.87  ? 473 ALA B CA  1 
ATOM   7819 C C   . ALA B 1 476 ? 38.932 157.579 26.308  1.00 41.37  ? 473 ALA B C   1 
ATOM   7820 O O   . ALA B 1 476 ? 39.905 157.336 27.031  1.00 36.55  ? 473 ALA B O   1 
ATOM   7821 C CB  . ALA B 1 476 ? 39.398 157.750 23.848  1.00 37.27  ? 473 ALA B CB  1 
ATOM   7822 N N   . GLN B 1 477 ? 37.975 158.438 26.667  1.00 42.32  ? 474 GLN B N   1 
ATOM   7823 C CA  . GLN B 1 477 ? 38.028 159.100 27.966  1.00 43.11  ? 474 GLN B CA  1 
ATOM   7824 C C   . GLN B 1 477 ? 37.777 158.121 29.105  1.00 39.80  ? 474 GLN B C   1 
ATOM   7825 O O   . GLN B 1 477 ? 38.346 158.278 30.192  1.00 44.73  ? 474 GLN B O   1 
ATOM   7826 C CB  . GLN B 1 477 ? 37.021 160.250 28.006  1.00 35.98  ? 474 GLN B CB  1 
ATOM   7827 C CG  . GLN B 1 477 ? 37.388 161.408 27.088  1.00 36.40  ? 474 GLN B CG  1 
ATOM   7828 C CD  . GLN B 1 477 ? 36.218 162.328 26.803  1.00 47.56  ? 474 GLN B CD  1 
ATOM   7829 O OE1 . GLN B 1 477 ? 35.059 161.921 26.876  1.00 57.06  ? 474 GLN B OE1 1 
ATOM   7830 N NE2 . GLN B 1 477 ? 36.518 163.579 26.472  1.00 56.55  ? 474 GLN B NE2 1 
ATOM   7831 N N   . ARG B 1 478 ? 36.935 157.110 28.877  1.00 37.81  ? 475 ARG B N   1 
ATOM   7832 C CA  . ARG B 1 478 ? 36.738 156.064 29.876  1.00 41.61  ? 475 ARG B CA  1 
ATOM   7833 C C   . ARG B 1 478 ? 38.042 155.335 30.167  1.00 40.73  ? 475 ARG B C   1 
ATOM   7834 O O   . ARG B 1 478 ? 38.388 155.093 31.330  1.00 40.64  ? 475 ARG B O   1 
ATOM   7835 C CB  . ARG B 1 478 ? 35.678 155.072 29.399  1.00 45.98  ? 475 ARG B CB  1 
ATOM   7836 C CG  . ARG B 1 478 ? 34.243 155.548 29.493  1.00 41.96  ? 475 ARG B CG  1 
ATOM   7837 C CD  . ARG B 1 478 ? 33.320 154.435 29.032  1.00 46.51  ? 475 ARG B CD  1 
ATOM   7838 N NE  . ARG B 1 478 ? 33.678 153.167 29.663  1.00 45.71  ? 475 ARG B NE  1 
ATOM   7839 C CZ  . ARG B 1 478 ? 33.429 151.971 29.140  1.00 43.18  ? 475 ARG B CZ  1 
ATOM   7840 N NH1 . ARG B 1 478 ? 32.822 151.872 27.964  1.00 37.54  ? 475 ARG B NH1 1 
ATOM   7841 N NH2 . ARG B 1 478 ? 33.794 150.873 29.788  1.00 43.81  ? 475 ARG B NH2 1 
ATOM   7842 N N   . LEU B 1 479 ? 38.780 154.974 29.114  1.00 37.17  ? 476 LEU B N   1 
ATOM   7843 C CA  . LEU B 1 479 ? 40.008 154.207 29.293  1.00 43.46  ? 476 LEU B CA  1 
ATOM   7844 C C   . LEU B 1 479 ? 41.092 155.038 29.968  1.00 36.03  ? 476 LEU B C   1 
ATOM   7845 O O   . LEU B 1 479 ? 41.820 154.532 30.831  1.00 37.53  ? 476 LEU B O   1 
ATOM   7846 C CB  . LEU B 1 479 ? 40.495 153.681 27.945  1.00 39.89  ? 476 LEU B CB  1 
ATOM   7847 C CG  . LEU B 1 479 ? 39.528 152.739 27.228  1.00 36.05  ? 476 LEU B CG  1 
ATOM   7848 C CD1 . LEU B 1 479 ? 40.106 152.315 25.894  1.00 44.64  ? 476 LEU B CD1 1 
ATOM   7849 C CD2 . LEU B 1 479 ? 39.213 151.526 28.093  1.00 38.37  ? 476 LEU B CD2 1 
ATOM   7850 N N   . MET B 1 480 ? 41.221 156.311 29.584  1.00 34.24  ? 477 MET B N   1 
ATOM   7851 C CA  . MET B 1 480 ? 42.171 157.186 30.263  1.00 36.37  ? 477 MET B CA  1 
ATOM   7852 C C   . MET B 1 480 ? 41.822 157.328 31.739  1.00 39.65  ? 477 MET B C   1 
ATOM   7853 O O   . MET B 1 480 ? 42.714 157.412 32.591  1.00 25.33  ? 477 MET B O   1 
ATOM   7854 C CB  . MET B 1 480 ? 42.210 158.555 29.582  1.00 40.50  ? 477 MET B CB  1 
ATOM   7855 C CG  . MET B 1 480 ? 42.801 158.530 28.182  1.00 37.49  ? 477 MET B CG  1 
ATOM   7856 S SD  . MET B 1 480 ? 43.048 160.173 27.480  1.00 40.29  ? 477 MET B SD  1 
ATOM   7857 C CE  . MET B 1 480 ? 41.359 160.761 27.390  1.00 36.16  ? 477 MET B CE  1 
ATOM   7858 N N   . ARG B 1 481 ? 40.526 157.343 32.061  1.00 38.11  ? 478 ARG B N   1 
ATOM   7859 C CA  . ARG B 1 481 ? 40.113 157.373 33.459  1.00 38.86  ? 478 ARG B CA  1 
ATOM   7860 C C   . ARG B 1 481 ? 40.469 156.070 34.165  1.00 44.28  ? 478 ARG B C   1 
ATOM   7861 O O   . ARG B 1 481 ? 40.929 156.087 35.313  1.00 40.79  ? 478 ARG B O   1 
ATOM   7862 C CB  . ARG B 1 481 ? 38.613 157.647 33.555  1.00 44.02  ? 478 ARG B CB  1 
ATOM   7863 C CG  . ARG B 1 481 ? 38.091 157.771 34.976  1.00 48.31  ? 478 ARG B CG  1 
ATOM   7864 C CD  . ARG B 1 481 ? 38.753 158.926 35.710  1.00 55.59  ? 478 ARG B CD  1 
ATOM   7865 N NE  . ARG B 1 481 ? 38.579 160.197 35.012  1.00 65.10  ? 478 ARG B NE  1 
ATOM   7866 C CZ  . ARG B 1 481 ? 37.501 160.968 35.117  1.00 60.41  ? 478 ARG B CZ  1 
ATOM   7867 N NH1 . ARG B 1 481 ? 36.489 160.596 35.890  1.00 60.21  ? 478 ARG B NH1 1 
ATOM   7868 N NH2 . ARG B 1 481 ? 37.431 162.109 34.445  1.00 62.24  ? 478 ARG B NH2 1 
ATOM   7869 N N   . TYR B 1 482 ? 40.264 154.933 33.495  1.00 36.80  ? 479 TYR B N   1 
ATOM   7870 C CA  . TYR B 1 482 ? 40.653 153.647 34.068  1.00 35.31  ? 479 TYR B CA  1 
ATOM   7871 C C   . TYR B 1 482 ? 42.146 153.610 34.366  1.00 33.72  ? 479 TYR B C   1 
ATOM   7872 O O   . TYR B 1 482 ? 42.564 153.237 35.469  1.00 35.58  ? 479 TYR B O   1 
ATOM   7873 C CB  . TYR B 1 482 ? 40.279 152.510 33.115  1.00 42.77  ? 479 TYR B CB  1 
ATOM   7874 C CG  . TYR B 1 482 ? 38.798 152.222 32.999  1.00 40.33  ? 479 TYR B CG  1 
ATOM   7875 C CD1 . TYR B 1 482 ? 37.960 152.306 34.103  1.00 41.98  ? 479 TYR B CD1 1 
ATOM   7876 C CD2 . TYR B 1 482 ? 38.242 151.853 31.781  1.00 43.53  ? 479 TYR B CD2 1 
ATOM   7877 C CE1 . TYR B 1 482 ? 36.606 152.035 33.993  1.00 34.94  ? 479 TYR B CE1 1 
ATOM   7878 C CE2 . TYR B 1 482 ? 36.894 151.582 31.662  1.00 48.38  ? 479 TYR B CE2 1 
ATOM   7879 C CZ  . TYR B 1 482 ? 36.081 151.674 32.769  1.00 43.10  ? 479 TYR B CZ  1 
ATOM   7880 O OH  . TYR B 1 482 ? 34.736 151.404 32.650  1.00 45.76  ? 479 TYR B OH  1 
ATOM   7881 N N   . TRP B 1 483 ? 42.968 153.996 33.388  1.00 32.19  ? 480 TRP B N   1 
ATOM   7882 C CA  . TRP B 1 483 ? 44.415 153.944 33.568  1.00 36.39  ? 480 TRP B CA  1 
ATOM   7883 C C   . TRP B 1 483 ? 44.887 154.957 34.605  1.00 34.26  ? 480 TRP B C   1 
ATOM   7884 O O   . TRP B 1 483 ? 45.822 154.683 35.366  1.00 34.58  ? 480 TRP B O   1 
ATOM   7885 C CB  . TRP B 1 483 ? 45.115 154.174 32.228  1.00 31.14  ? 480 TRP B CB  1 
ATOM   7886 C CG  . TRP B 1 483 ? 45.559 152.907 31.551  1.00 37.67  ? 480 TRP B CG  1 
ATOM   7887 C CD1 . TRP B 1 483 ? 46.843 152.535 31.276  1.00 34.75  ? 480 TRP B CD1 1 
ATOM   7888 C CD2 . TRP B 1 483 ? 44.723 151.842 31.077  1.00 36.11  ? 480 TRP B CD2 1 
ATOM   7889 N NE1 . TRP B 1 483 ? 46.858 151.310 30.654  1.00 30.01  ? 480 TRP B NE1 1 
ATOM   7890 C CE2 . TRP B 1 483 ? 45.570 150.863 30.521  1.00 29.62  ? 480 TRP B CE2 1 
ATOM   7891 C CE3 . TRP B 1 483 ? 43.341 151.624 31.067  1.00 35.87  ? 480 TRP B CE3 1 
ATOM   7892 C CZ2 . TRP B 1 483 ? 45.081 149.684 29.961  1.00 29.46  ? 480 TRP B CZ2 1 
ATOM   7893 C CZ3 . TRP B 1 483 ? 42.858 150.453 30.510  1.00 37.61  ? 480 TRP B CZ3 1 
ATOM   7894 C CH2 . TRP B 1 483 ? 43.726 149.498 29.965  1.00 31.34  ? 480 TRP B CH2 1 
ATOM   7895 N N   . ALA B 1 484 ? 44.253 156.132 34.655  1.00 35.67  ? 481 ALA B N   1 
ATOM   7896 C CA  . ALA B 1 484 ? 44.661 157.142 35.627  1.00 38.79  ? 481 ALA B CA  1 
ATOM   7897 C C   . ALA B 1 484 ? 44.247 156.754 37.040  1.00 41.28  ? 481 ALA B C   1 
ATOM   7898 O O   . ALA B 1 484 ? 45.020 156.936 37.988  1.00 42.14  ? 481 ALA B O   1 
ATOM   7899 C CB  . ALA B 1 484 ? 44.077 158.502 35.257  1.00 35.20  ? 481 ALA B CB  1 
ATOM   7900 N N   . ASN B 1 485 ? 43.027 156.234 37.202  1.00 45.72  ? 482 ASN B N   1 
ATOM   7901 C CA  . ASN B 1 485 ? 42.595 155.762 38.515  1.00 37.01  ? 482 ASN B CA  1 
ATOM   7902 C C   . ASN B 1 485 ? 43.540 154.696 39.050  1.00 41.48  ? 482 ASN B C   1 
ATOM   7903 O O   . ASN B 1 485 ? 43.866 154.685 40.243  1.00 44.39  ? 482 ASN B O   1 
ATOM   7904 C CB  . ASN B 1 485 ? 41.167 155.219 38.445  1.00 40.88  ? 482 ASN B CB  1 
ATOM   7905 C CG  . ASN B 1 485 ? 40.133 156.311 38.252  1.00 43.50  ? 482 ASN B CG  1 
ATOM   7906 O OD1 . ASN B 1 485 ? 40.383 157.480 38.544  1.00 52.90  ? 482 ASN B OD1 1 
ATOM   7907 N ND2 . ASN B 1 485 ? 38.958 155.931 37.765  1.00 40.73  ? 482 ASN B ND2 1 
ATOM   7908 N N   . PHE B 1 486 ? 43.998 153.793 38.179  1.00 34.25  ? 483 PHE B N   1 
ATOM   7909 C CA  . PHE B 1 486 ? 44.949 152.775 38.609  1.00 41.48  ? 483 PHE B CA  1 
ATOM   7910 C C   . PHE B 1 486 ? 46.289 153.397 38.983  1.00 40.72  ? 483 PHE B C   1 
ATOM   7911 O O   . PHE B 1 486 ? 46.943 152.950 39.931  1.00 41.86  ? 483 PHE B O   1 
ATOM   7912 C CB  . PHE B 1 486 ? 45.131 151.726 37.513  1.00 34.27  ? 483 PHE B CB  1 
ATOM   7913 C CG  . PHE B 1 486 ? 46.102 150.639 37.874  1.00 32.97  ? 483 PHE B CG  1 
ATOM   7914 C CD1 . PHE B 1 486 ? 45.707 149.579 38.674  1.00 26.69  ? 483 PHE B CD1 1 
ATOM   7915 C CD2 . PHE B 1 486 ? 47.409 150.676 37.416  1.00 27.79  ? 483 PHE B CD2 1 
ATOM   7916 C CE1 . PHE B 1 486 ? 46.597 148.577 39.011  1.00 37.38  ? 483 PHE B CE1 1 
ATOM   7917 C CE2 . PHE B 1 486 ? 48.304 149.677 37.751  1.00 38.01  ? 483 PHE B CE2 1 
ATOM   7918 C CZ  . PHE B 1 486 ? 47.897 148.626 38.548  1.00 33.23  ? 483 PHE B CZ  1 
ATOM   7919 N N   . ALA B 1 487 ? 46.716 154.425 38.248  1.00 44.80  ? 484 ALA B N   1 
ATOM   7920 C CA  . ALA B 1 487 ? 47.978 155.082 38.574  1.00 42.42  ? 484 ALA B CA  1 
ATOM   7921 C C   . ALA B 1 487 ? 47.887 155.822 39.902  1.00 39.11  ? 484 ALA B C   1 
ATOM   7922 O O   . ALA B 1 487 ? 48.855 155.851 40.671  1.00 45.57  ? 484 ALA B O   1 
ATOM   7923 C CB  . ALA B 1 487 ? 48.378 156.038 37.452  1.00 42.06  ? 484 ALA B CB  1 
ATOM   7924 N N   . ARG B 1 488 ? 46.730 156.419 40.192  1.00 33.14  ? 485 ARG B N   1 
ATOM   7925 C CA  . ARG B 1 488 ? 46.567 157.175 41.428  1.00 42.96  ? 485 ARG B CA  1 
ATOM   7926 C C   . ARG B 1 488 ? 46.362 156.252 42.625  1.00 45.57  ? 485 ARG B C   1 
ATOM   7927 O O   . ARG B 1 488 ? 47.113 156.312 43.605  1.00 42.86  ? 485 ARG B O   1 
ATOM   7928 C CB  . ARG B 1 488 ? 45.395 158.154 41.294  1.00 36.84  ? 485 ARG B CB  1 
ATOM   7929 C CG  . ARG B 1 488 ? 45.624 159.270 40.283  1.00 37.27  ? 485 ARG B CG  1 
ATOM   7930 C CD  . ARG B 1 488 ? 44.502 160.297 40.308  1.00 26.41  ? 485 ARG B CD  1 
ATOM   7931 N NE  . ARG B 1 488 ? 43.330 159.854 39.557  1.00 43.51  ? 485 ARG B NE  1 
ATOM   7932 C CZ  . ARG B 1 488 ? 43.084 160.190 38.295  1.00 40.80  ? 485 ARG B CZ  1 
ATOM   7933 N NH1 . ARG B 1 488 ? 43.926 160.977 37.639  1.00 45.07  ? 485 ARG B NH1 1 
ATOM   7934 N NH2 . ARG B 1 488 ? 41.993 159.742 37.688  1.00 41.64  ? 485 ARG B NH2 1 
ATOM   7935 N N   . THR B 1 489 ? 45.354 155.382 42.558  1.00 44.28  ? 486 THR B N   1 
ATOM   7936 C CA  . THR B 1 489 ? 44.928 154.602 43.711  1.00 39.58  ? 486 THR B CA  1 
ATOM   7937 C C   . THR B 1 489 ? 45.284 153.125 43.634  1.00 43.26  ? 486 THR B C   1 
ATOM   7938 O O   . THR B 1 489 ? 45.157 152.426 44.646  1.00 42.20  ? 486 THR B O   1 
ATOM   7939 C CB  . THR B 1 489 ? 43.409 154.729 43.899  1.00 46.12  ? 486 THR B CB  1 
ATOM   7940 O OG1 . THR B 1 489 ? 42.739 154.047 42.830  1.00 38.40  ? 486 THR B OG1 1 
ATOM   7941 C CG2 . THR B 1 489 ? 42.994 156.191 43.893  1.00 34.41  ? 486 THR B CG2 1 
ATOM   7942 N N   . GLY B 1 490 ? 45.723 152.629 42.481  1.00 45.60  ? 487 GLY B N   1 
ATOM   7943 C CA  . GLY B 1 490 ? 45.901 151.202 42.309  1.00 31.55  ? 487 GLY B CA  1 
ATOM   7944 C C   . GLY B 1 490 ? 44.629 150.449 42.000  1.00 39.17  ? 487 GLY B C   1 
ATOM   7945 O O   . GLY B 1 490 ? 44.633 149.213 42.027  1.00 38.22  ? 487 GLY B O   1 
ATOM   7946 N N   . ASP B 1 491 ? 43.543 151.159 41.706  1.00 34.79  ? 488 ASP B N   1 
ATOM   7947 C CA  . ASP B 1 491 ? 42.235 150.580 41.440  1.00 40.48  ? 488 ASP B CA  1 
ATOM   7948 C C   . ASP B 1 491 ? 41.610 151.309 40.256  1.00 40.98  ? 488 ASP B C   1 
ATOM   7949 O O   . ASP B 1 491 ? 41.360 152.519 40.336  1.00 49.81  ? 488 ASP B O   1 
ATOM   7950 C CB  . ASP B 1 491 ? 41.346 150.685 42.683  1.00 44.19  ? 488 ASP B CB  1 
ATOM   7951 C CG  . ASP B 1 491 ? 40.081 149.851 42.581  1.00 49.12  ? 488 ASP B CG  1 
ATOM   7952 O OD1 . ASP B 1 491 ? 39.550 149.685 41.463  1.00 47.46  ? 488 ASP B OD1 1 
ATOM   7953 O OD2 . ASP B 1 491 ? 39.611 149.362 43.630  1.00 60.28  ? 488 ASP B OD2 1 
ATOM   7954 N N   . PRO B 1 492 ? 41.346 150.619 39.143  1.00 47.01  ? 489 PRO B N   1 
ATOM   7955 C CA  . PRO B 1 492 ? 40.742 151.301 37.988  1.00 38.93  ? 489 PRO B CA  1 
ATOM   7956 C C   . PRO B 1 492 ? 39.316 151.762 38.231  1.00 48.33  ? 489 PRO B C   1 
ATOM   7957 O O   . PRO B 1 492 ? 38.818 152.599 37.468  1.00 43.83  ? 489 PRO B O   1 
ATOM   7958 C CB  . PRO B 1 492 ? 40.805 150.240 36.881  1.00 38.20  ? 489 PRO B CB  1 
ATOM   7959 C CG  . PRO B 1 492 ? 40.820 148.939 37.614  1.00 43.04  ? 489 PRO B CG  1 
ATOM   7960 C CD  . PRO B 1 492 ? 41.599 149.192 38.876  1.00 41.22  ? 489 PRO B CD  1 
ATOM   7961 N N   . ASN B 1 493 ? 38.647 151.250 39.260  1.00 52.61  ? 490 ASN B N   1 
ATOM   7962 C CA  . ASN B 1 493 ? 37.278 151.654 39.539  1.00 54.01  ? 490 ASN B CA  1 
ATOM   7963 C C   . ASN B 1 493 ? 37.231 153.083 40.066  1.00 55.57  ? 490 ASN B C   1 
ATOM   7964 O O   . ASN B 1 493 ? 38.178 153.576 40.687  1.00 51.81  ? 490 ASN B O   1 
ATOM   7965 C CB  . ASN B 1 493 ? 36.634 150.706 40.550  1.00 54.30  ? 490 ASN B CB  1 
ATOM   7966 C CG  . ASN B 1 493 ? 36.522 149.289 40.029  1.00 45.41  ? 490 ASN B CG  1 
ATOM   7967 O OD1 . ASN B 1 493 ? 35.579 148.954 39.314  1.00 61.23  ? 490 ASN B OD1 1 
ATOM   7968 N ND2 . ASN B 1 493 ? 37.485 148.448 40.386  1.00 45.84  ? 490 ASN B ND2 1 
ATOM   7969 N N   . GLU B 1 494 ? 36.113 153.745 39.812  1.00 59.01  ? 491 GLU B N   1 
ATOM   7970 C CA  . GLU B 1 494 ? 35.930 155.121 40.255  1.00 83.30  ? 491 GLU B CA  1 
ATOM   7971 C C   . GLU B 1 494 ? 35.755 155.154 41.767  1.00 91.68  ? 491 GLU B C   1 
ATOM   7972 O O   . GLU B 1 494 ? 34.806 154.551 42.285  1.00 90.63  ? 491 GLU B O   1 
ATOM   7973 C CB  . GLU B 1 494 ? 34.718 155.736 39.565  1.00 82.15  ? 491 GLU B CB  1 
ATOM   7974 C CG  . GLU B 1 494 ? 34.869 157.209 39.241  1.00 80.00  ? 491 GLU B CG  1 
ATOM   7975 C CD  . GLU B 1 494 ? 35.647 157.439 37.963  1.00 75.10  ? 491 GLU B CD  1 
ATOM   7976 O OE1 . GLU B 1 494 ? 35.196 156.965 36.898  1.00 67.04  ? 491 GLU B OE1 1 
ATOM   7977 O OE2 . GLU B 1 494 ? 36.715 158.083 38.024  1.00 74.53  ? 491 GLU B OE2 1 
ATOM   7978 N N   . PRO B 1 495 ? 36.632 155.834 42.512  1.00 87.57  ? 492 PRO B N   1 
ATOM   7979 C CA  . PRO B 1 495 ? 36.492 155.846 43.977  1.00 96.22  ? 492 PRO B CA  1 
ATOM   7980 C C   . PRO B 1 495 ? 35.264 156.593 44.469  1.00 108.32 ? 492 PRO B C   1 
ATOM   7981 O O   . PRO B 1 495 ? 34.803 156.319 45.584  1.00 103.81 ? 492 PRO B O   1 
ATOM   7982 C CB  . PRO B 1 495 ? 37.785 156.527 44.447  1.00 88.50  ? 492 PRO B CB  1 
ATOM   7983 C CG  . PRO B 1 495 ? 38.208 157.366 43.286  1.00 75.08  ? 492 PRO B CG  1 
ATOM   7984 C CD  . PRO B 1 495 ? 37.803 156.604 42.057  1.00 71.37  ? 492 PRO B CD  1 
ATOM   7985 N N   . ARG B 1 496 ? 34.718 157.520 43.680  1.00 107.75 ? 493 ARG B N   1 
ATOM   7986 C CA  . ARG B 1 496 ? 33.540 158.288 44.063  1.00 112.39 ? 493 ARG B CA  1 
ATOM   7987 C C   . ARG B 1 496 ? 32.274 157.796 43.370  1.00 109.58 ? 493 ARG B C   1 
ATOM   7988 O O   . ARG B 1 496 ? 31.360 158.590 43.124  1.00 114.94 ? 493 ARG B O   1 
ATOM   7989 C CB  . ARG B 1 496 ? 33.741 159.771 43.751  1.00 114.94 ? 493 ARG B CB  1 
ATOM   7990 C CG  . ARG B 1 496 ? 35.040 160.385 44.238  1.00 114.13 ? 493 ARG B CG  1 
ATOM   7991 C CD  . ARG B 1 496 ? 35.190 161.783 43.651  1.00 117.19 ? 493 ARG B CD  1 
ATOM   7992 N NE  . ARG B 1 496 ? 36.419 162.450 44.070  1.00 127.92 ? 493 ARG B NE  1 
ATOM   7993 C CZ  . ARG B 1 496 ? 36.822 163.627 43.600  1.00 129.11 ? 493 ARG B CZ  1 
ATOM   7994 N NH1 . ARG B 1 496 ? 36.095 164.264 42.692  1.00 132.14 ? 493 ARG B NH1 1 
ATOM   7995 N NH2 . ARG B 1 496 ? 37.952 164.166 44.034  1.00 116.02 ? 493 ARG B NH2 1 
ATOM   7996 N N   . ASP B 1 497 ? 32.193 156.507 43.044  1.00 104.12 ? 494 ASP B N   1 
ATOM   7997 C CA  . ASP B 1 497 ? 31.093 156.111 42.175  1.00 111.48 ? 494 ASP B CA  1 
ATOM   7998 C C   . ASP B 1 497 ? 30.672 154.657 42.350  1.00 115.99 ? 494 ASP B C   1 
ATOM   7999 O O   . ASP B 1 497 ? 31.472 153.741 42.118  1.00 109.67 ? 494 ASP B O   1 
ATOM   8000 C CB  . ASP B 1 497 ? 31.480 156.357 40.717  1.00 105.96 ? 494 ASP B CB  1 
ATOM   8001 C CG  . ASP B 1 497 ? 30.348 156.938 39.904  1.00 110.94 ? 494 ASP B CG  1 
ATOM   8002 O OD1 . ASP B 1 497 ? 29.180 156.762 40.302  1.00 114.75 ? 494 ASP B OD1 1 
ATOM   8003 O OD2 . ASP B 1 497 ? 30.629 157.574 38.865  1.00 103.62 ? 494 ASP B OD2 1 
ATOM   8004 N N   . PRO B 1 498 ? 29.431 154.406 42.766  1.00 123.79 ? 495 PRO B N   1 
ATOM   8005 C CA  . PRO B 1 498 ? 28.820 153.077 42.586  1.00 117.81 ? 495 PRO B CA  1 
ATOM   8006 C C   . PRO B 1 498 ? 27.894 152.972 41.378  1.00 115.14 ? 495 PRO B C   1 
ATOM   8007 O O   . PRO B 1 498 ? 27.262 151.923 41.212  1.00 111.87 ? 495 PRO B O   1 
ATOM   8008 C CB  . PRO B 1 498 ? 28.021 152.922 43.884  1.00 108.36 ? 495 PRO B CB  1 
ATOM   8009 C CG  . PRO B 1 498 ? 27.555 154.314 44.175  1.00 107.80 ? 495 PRO B CG  1 
ATOM   8010 C CD  . PRO B 1 498 ? 28.635 155.254 43.672  1.00 112.55 ? 495 PRO B CD  1 
ATOM   8011 N N   . LYS B 1 499 ? 27.799 154.018 40.551  1.00 115.08 ? 496 LYS B N   1 
ATOM   8012 C CA  . LYS B 1 499 ? 26.892 153.988 39.406  1.00 116.53 ? 496 LYS B CA  1 
ATOM   8013 C C   . LYS B 1 499 ? 27.408 153.058 38.316  1.00 112.99 ? 496 LYS B C   1 
ATOM   8014 O O   . LYS B 1 499 ? 26.672 152.197 37.820  1.00 106.59 ? 496 LYS B O   1 
ATOM   8015 C CB  . LYS B 1 499 ? 26.700 155.400 38.847  1.00 115.61 ? 496 LYS B CB  1 
ATOM   8016 C CG  . LYS B 1 499 ? 25.972 156.369 39.763  1.00 112.00 ? 496 LYS B CG  1 
ATOM   8017 C CD  . LYS B 1 499 ? 25.769 157.708 39.066  1.00 106.85 ? 496 LYS B CD  1 
ATOM   8018 C CE  . LYS B 1 499 ? 24.916 158.654 39.895  1.00 107.94 ? 496 LYS B CE  1 
ATOM   8019 N NZ  . LYS B 1 499 ? 24.642 159.928 39.172  1.00 105.38 ? 496 LYS B NZ  1 
ATOM   8020 N N   . ALA B 1 500 ? 28.668 153.225 37.922  1.00 116.81 ? 497 ALA B N   1 
ATOM   8021 C CA  . ALA B 1 500 ? 29.221 152.469 36.814  1.00 98.05  ? 497 ALA B CA  1 
ATOM   8022 C C   . ALA B 1 500 ? 29.436 151.009 37.207  1.00 91.41  ? 497 ALA B C   1 
ATOM   8023 O O   . ALA B 1 500 ? 29.585 150.688 38.389  1.00 92.19  ? 497 ALA B O   1 
ATOM   8024 C CB  . ALA B 1 500 ? 30.539 153.091 36.359  1.00 93.60  ? 497 ALA B CB  1 
ATOM   8025 N N   . PRO B 1 501 ? 29.439 150.102 36.229  1.00 85.46  ? 498 PRO B N   1 
ATOM   8026 C CA  . PRO B 1 501 ? 29.770 148.704 36.528  1.00 84.46  ? 498 PRO B CA  1 
ATOM   8027 C C   . PRO B 1 501 ? 31.181 148.588 37.083  1.00 68.90  ? 498 PRO B C   1 
ATOM   8028 O O   . PRO B 1 501 ? 32.122 149.201 36.575  1.00 72.86  ? 498 PRO B O   1 
ATOM   8029 C CB  . PRO B 1 501 ? 29.638 148.008 35.168  1.00 80.33  ? 498 PRO B CB  1 
ATOM   8030 C CG  . PRO B 1 501 ? 28.724 148.886 34.380  1.00 78.26  ? 498 PRO B CG  1 
ATOM   8031 C CD  . PRO B 1 501 ? 29.031 150.285 34.825  1.00 72.61  ? 498 PRO B CD  1 
ATOM   8032 N N   . GLN B 1 502 ? 31.320 147.794 38.139  1.00 56.32  ? 499 GLN B N   1 
ATOM   8033 C CA  . GLN B 1 502 ? 32.591 147.687 38.836  1.00 63.15  ? 499 GLN B CA  1 
ATOM   8034 C C   . GLN B 1 502 ? 33.518 146.694 38.144  1.00 59.07  ? 499 GLN B C   1 
ATOM   8035 O O   . GLN B 1 502 ? 33.078 145.725 37.519  1.00 51.01  ? 499 GLN B O   1 
ATOM   8036 C CB  . GLN B 1 502 ? 32.370 147.273 40.291  1.00 65.68  ? 499 GLN B CB  1 
ATOM   8037 C CG  . GLN B 1 502 ? 31.707 148.346 41.143  1.00 71.06  ? 499 GLN B CG  1 
ATOM   8038 C CD  . GLN B 1 502 ? 32.614 149.536 41.394  1.00 73.73  ? 499 GLN B CD  1 
ATOM   8039 O OE1 . GLN B 1 502 ? 33.751 149.381 41.841  1.00 65.75  ? 499 GLN B OE1 1 
ATOM   8040 N NE2 . GLN B 1 502 ? 32.116 150.733 41.103  1.00 69.31  ? 499 GLN B NE2 1 
ATOM   8041 N N   . TRP B 1 503 ? 34.821 146.954 38.265  1.00 54.36  ? 500 TRP B N   1 
ATOM   8042 C CA  . TRP B 1 503 ? 35.872 146.117 37.706  1.00 48.68  ? 500 TRP B CA  1 
ATOM   8043 C C   . TRP B 1 503 ? 36.406 145.215 38.811  1.00 48.63  ? 500 TRP B C   1 
ATOM   8044 O O   . TRP B 1 503 ? 37.213 145.668 39.637  1.00 42.08  ? 500 TRP B O   1 
ATOM   8045 C CB  . TRP B 1 503 ? 36.990 146.989 37.125  1.00 49.89  ? 500 TRP B CB  1 
ATOM   8046 C CG  . TRP B 1 503 ? 38.035 146.267 36.315  1.00 44.80  ? 500 TRP B CG  1 
ATOM   8047 C CD1 . TRP B 1 503 ? 38.427 144.965 36.439  1.00 42.13  ? 500 TRP B CD1 1 
ATOM   8048 C CD2 . TRP B 1 503 ? 38.820 146.822 35.252  1.00 50.04  ? 500 TRP B CD2 1 
ATOM   8049 N NE1 . TRP B 1 503 ? 39.408 144.676 35.522  1.00 42.65  ? 500 TRP B NE1 1 
ATOM   8050 C CE2 . TRP B 1 503 ? 39.668 145.800 34.781  1.00 46.01  ? 500 TRP B CE2 1 
ATOM   8051 C CE3 . TRP B 1 503 ? 38.889 148.084 34.654  1.00 47.40  ? 500 TRP B CE3 1 
ATOM   8052 C CZ2 . TRP B 1 503 ? 40.570 146.000 33.739  1.00 49.29  ? 500 TRP B CZ2 1 
ATOM   8053 C CZ3 . TRP B 1 503 ? 39.786 148.282 33.621  1.00 43.80  ? 500 TRP B CZ3 1 
ATOM   8054 C CH2 . TRP B 1 503 ? 40.615 147.245 33.174  1.00 49.42  ? 500 TRP B CH2 1 
ATOM   8055 N N   . PRO B 1 504 ? 35.997 143.951 38.878  1.00 40.20  ? 501 PRO B N   1 
ATOM   8056 C CA  . PRO B 1 504 ? 36.435 143.086 39.976  1.00 38.78  ? 501 PRO B CA  1 
ATOM   8057 C C   . PRO B 1 504 ? 37.867 142.631 39.772  1.00 38.38  ? 501 PRO B C   1 
ATOM   8058 O O   . PRO B 1 504 ? 38.311 142.441 38.630  1.00 48.73  ? 501 PRO B O   1 
ATOM   8059 C CB  . PRO B 1 504 ? 35.457 141.906 39.900  1.00 40.88  ? 501 PRO B CB  1 
ATOM   8060 C CG  . PRO B 1 504 ? 35.103 141.828 38.456  1.00 43.72  ? 501 PRO B CG  1 
ATOM   8061 C CD  . PRO B 1 504 ? 35.098 143.250 37.945  1.00 39.29  ? 501 PRO B CD  1 
ATOM   8062 N N   . PRO B 1 505 ? 38.623 142.449 40.854  1.00 39.06  ? 502 PRO B N   1 
ATOM   8063 C CA  . PRO B 1 505 ? 40.006 141.981 40.714  1.00 38.19  ? 502 PRO B CA  1 
ATOM   8064 C C   . PRO B 1 505 ? 40.070 140.594 40.094  1.00 42.99  ? 502 PRO B C   1 
ATOM   8065 O O   . PRO B 1 505 ? 39.146 139.785 40.220  1.00 49.91  ? 502 PRO B O   1 
ATOM   8066 C CB  . PRO B 1 505 ? 40.527 141.970 42.158  1.00 25.95  ? 502 PRO B CB  1 
ATOM   8067 C CG  . PRO B 1 505 ? 39.635 142.918 42.893  1.00 43.27  ? 502 PRO B CG  1 
ATOM   8068 C CD  . PRO B 1 505 ? 38.288 142.781 42.249  1.00 37.37  ? 502 PRO B CD  1 
ATOM   8069 N N   . TYR B 1 506 ? 41.178 140.331 39.407  1.00 47.84  ? 503 TYR B N   1 
ATOM   8070 C CA  . TYR B 1 506 ? 41.450 139.023 38.830  1.00 44.33  ? 503 TYR B CA  1 
ATOM   8071 C C   . TYR B 1 506 ? 42.098 138.138 39.887  1.00 50.48  ? 503 TYR B C   1 
ATOM   8072 O O   . TYR B 1 506 ? 43.105 138.519 40.492  1.00 47.01  ? 503 TYR B O   1 
ATOM   8073 C CB  . TYR B 1 506 ? 42.358 139.156 37.605  1.00 45.96  ? 503 TYR B CB  1 
ATOM   8074 C CG  . TYR B 1 506 ? 42.731 137.846 36.939  1.00 35.84  ? 503 TYR B CG  1 
ATOM   8075 C CD1 . TYR B 1 506 ? 43.843 137.124 37.355  1.00 33.06  ? 503 TYR B CD1 1 
ATOM   8076 C CD2 . TYR B 1 506 ? 41.981 137.341 35.884  1.00 30.33  ? 503 TYR B CD2 1 
ATOM   8077 C CE1 . TYR B 1 506 ? 44.189 135.931 36.749  1.00 35.23  ? 503 TYR B CE1 1 
ATOM   8078 C CE2 . TYR B 1 506 ? 42.322 136.149 35.269  1.00 28.29  ? 503 TYR B CE2 1 
ATOM   8079 C CZ  . TYR B 1 506 ? 43.427 135.449 35.707  1.00 33.06  ? 503 TYR B CZ  1 
ATOM   8080 O OH  . TYR B 1 506 ? 43.772 134.262 35.102  1.00 38.99  ? 503 TYR B OH  1 
ATOM   8081 N N   . THR B 1 507 ? 41.513 136.966 40.112  1.00 45.90  ? 504 THR B N   1 
ATOM   8082 C CA  . THR B 1 507 ? 42.014 136.010 41.087  1.00 48.83  ? 504 THR B CA  1 
ATOM   8083 C C   . THR B 1 507 ? 42.358 134.699 40.392  1.00 44.97  ? 504 THR B C   1 
ATOM   8084 O O   . THR B 1 507 ? 41.862 134.399 39.304  1.00 50.45  ? 504 THR B O   1 
ATOM   8085 C CB  . THR B 1 507 ? 40.990 135.758 42.204  1.00 42.71  ? 504 THR B CB  1 
ATOM   8086 O OG1 . THR B 1 507 ? 39.738 135.360 41.628  1.00 44.35  ? 504 THR B OG1 1 
ATOM   8087 C CG2 . THR B 1 507 ? 40.786 137.016 43.036  1.00 34.52  ? 504 THR B CG2 1 
ATOM   8088 N N   . ALA B 1 508 ? 43.226 133.916 41.037  1.00 40.50  ? 505 ALA B N   1 
ATOM   8089 C CA  . ALA B 1 508 ? 43.613 132.626 40.480  1.00 42.57  ? 505 ALA B CA  1 
ATOM   8090 C C   . ALA B 1 508 ? 42.446 131.650 40.411  1.00 58.58  ? 505 ALA B C   1 
ATOM   8091 O O   . ALA B 1 508 ? 42.494 130.702 39.619  1.00 58.85  ? 505 ALA B O   1 
ATOM   8092 C CB  . ALA B 1 508 ? 44.752 132.018 41.300  1.00 49.67  ? 505 ALA B CB  1 
ATOM   8093 N N   . GLY B 1 509 ? 41.403 131.861 41.210  1.00 48.72  ? 506 GLY B N   1 
ATOM   8094 C CA  . GLY B 1 509 ? 40.259 130.972 41.218  1.00 40.66  ? 506 GLY B CA  1 
ATOM   8095 C C   . GLY B 1 509 ? 39.130 131.419 40.313  1.00 41.23  ? 506 GLY B C   1 
ATOM   8096 O O   . GLY B 1 509 ? 38.764 130.709 39.371  1.00 49.67  ? 506 GLY B O   1 
ATOM   8097 N N   . ALA B 1 510 ? 38.565 132.598 40.588  1.00 37.40  ? 507 ALA B N   1 
ATOM   8098 C CA  . ALA B 1 510 ? 37.449 133.085 39.784  1.00 38.17  ? 507 ALA B CA  1 
ATOM   8099 C C   . ALA B 1 510 ? 37.901 133.533 38.400  1.00 43.02  ? 507 ALA B C   1 
ATOM   8100 O O   . ALA B 1 510 ? 37.154 133.374 37.428  1.00 42.38  ? 507 ALA B O   1 
ATOM   8101 C CB  . ALA B 1 510 ? 36.737 134.227 40.508  1.00 31.14  ? 507 ALA B CB  1 
ATOM   8102 N N   . GLN B 1 511 ? 39.109 134.093 38.294  1.00 46.20  ? 508 GLN B N   1 
ATOM   8103 C CA  . GLN B 1 511 ? 39.691 134.508 37.015  1.00 42.97  ? 508 GLN B CA  1 
ATOM   8104 C C   . GLN B 1 511 ? 38.776 135.487 36.279  1.00 39.95  ? 508 GLN B C   1 
ATOM   8105 O O   . GLN B 1 511 ? 38.465 135.318 35.098  1.00 42.44  ? 508 GLN B O   1 
ATOM   8106 C CB  . GLN B 1 511 ? 40.013 133.294 36.140  1.00 40.54  ? 508 GLN B CB  1 
ATOM   8107 C CG  . GLN B 1 511 ? 40.887 132.254 36.820  1.00 43.85  ? 508 GLN B CG  1 
ATOM   8108 C CD  . GLN B 1 511 ? 41.180 131.068 35.925  1.00 49.22  ? 508 GLN B CD  1 
ATOM   8109 O OE1 . GLN B 1 511 ? 41.121 131.172 34.700  1.00 56.12  ? 508 GLN B OE1 1 
ATOM   8110 N NE2 . GLN B 1 511 ? 41.492 129.930 36.533  1.00 53.12  ? 508 GLN B NE2 1 
ATOM   8111 N N   . GLN B 1 512 ? 38.346 136.523 36.992  1.00 34.80  ? 509 GLN B N   1 
ATOM   8112 C CA  . GLN B 1 512 ? 37.423 137.504 36.441  1.00 44.81  ? 509 GLN B CA  1 
ATOM   8113 C C   . GLN B 1 512 ? 38.174 138.596 35.691  1.00 45.89  ? 509 GLN B C   1 
ATOM   8114 O O   . GLN B 1 512 ? 39.219 139.075 36.141  1.00 41.94  ? 509 GLN B O   1 
ATOM   8115 C CB  . GLN B 1 512 ? 36.573 138.130 37.546  1.00 43.83  ? 509 GLN B CB  1 
ATOM   8116 C CG  . GLN B 1 512 ? 35.616 137.162 38.217  1.00 44.32  ? 509 GLN B CG  1 
ATOM   8117 C CD  . GLN B 1 512 ? 34.840 137.807 39.345  1.00 39.58  ? 509 GLN B CD  1 
ATOM   8118 O OE1 . GLN B 1 512 ? 33.711 138.259 39.157  1.00 39.70  ? 509 GLN B OE1 1 
ATOM   8119 N NE2 . GLN B 1 512 ? 35.445 137.857 40.526  1.00 39.68  ? 509 GLN B NE2 1 
ATOM   8120 N N   . TYR B 1 513 ? 37.627 138.982 34.541  1.00 38.21  ? 510 TYR B N   1 
ATOM   8121 C CA  . TYR B 1 513 ? 38.130 140.105 33.766  1.00 40.46  ? 510 TYR B CA  1 
ATOM   8122 C C   . TYR B 1 513 ? 36.939 140.846 33.178  1.00 42.95  ? 510 TYR B C   1 
ATOM   8123 O O   . TYR B 1 513 ? 35.794 140.396 33.269  1.00 43.13  ? 510 TYR B O   1 
ATOM   8124 C CB  . TYR B 1 513 ? 39.093 139.648 32.661  1.00 40.38  ? 510 TYR B CB  1 
ATOM   8125 C CG  . TYR B 1 513 ? 38.450 138.810 31.579  1.00 42.79  ? 510 TYR B CG  1 
ATOM   8126 C CD1 . TYR B 1 513 ? 38.328 137.434 31.719  1.00 38.47  ? 510 TYR B CD1 1 
ATOM   8127 C CD2 . TYR B 1 513 ? 37.974 139.395 30.411  1.00 45.64  ? 510 TYR B CD2 1 
ATOM   8128 C CE1 . TYR B 1 513 ? 37.743 136.665 30.731  1.00 41.89  ? 510 TYR B CE1 1 
ATOM   8129 C CE2 . TYR B 1 513 ? 37.387 138.634 29.419  1.00 39.69  ? 510 TYR B CE2 1 
ATOM   8130 C CZ  . TYR B 1 513 ? 37.277 137.270 29.583  1.00 39.73  ? 510 TYR B CZ  1 
ATOM   8131 O OH  . TYR B 1 513 ? 36.694 136.510 28.597  1.00 45.24  ? 510 TYR B OH  1 
ATOM   8132 N N   . VAL B 1 514 ? 37.214 141.995 32.569  1.00 39.54  ? 511 VAL B N   1 
ATOM   8133 C CA  . VAL B 1 514 ? 36.172 142.805 31.955  1.00 36.35  ? 511 VAL B CA  1 
ATOM   8134 C C   . VAL B 1 514 ? 36.488 142.980 30.477  1.00 30.59  ? 511 VAL B C   1 
ATOM   8135 O O   . VAL B 1 514 ? 37.647 142.923 30.055  1.00 33.34  ? 511 VAL B O   1 
ATOM   8136 C CB  . VAL B 1 514 ? 36.017 144.179 32.646  1.00 45.85  ? 511 VAL B CB  1 
ATOM   8137 C CG1 . VAL B 1 514 ? 35.711 143.999 34.126  1.00 43.02  ? 511 VAL B CG1 1 
ATOM   8138 C CG2 . VAL B 1 514 ? 37.267 145.020 32.448  1.00 43.85  ? 511 VAL B CG2 1 
ATOM   8139 N N   . SER B 1 515 ? 35.440 143.183 29.687  1.00 38.47  ? 512 SER B N   1 
ATOM   8140 C CA  . SER B 1 515 ? 35.573 143.467 28.266  1.00 41.97  ? 512 SER B CA  1 
ATOM   8141 C C   . SER B 1 515 ? 35.539 144.974 28.058  1.00 41.22  ? 512 SER B C   1 
ATOM   8142 O O   . SER B 1 515 ? 34.647 145.657 28.571  1.00 40.18  ? 512 SER B O   1 
ATOM   8143 C CB  . SER B 1 515 ? 34.460 142.792 27.463  1.00 45.52  ? 512 SER B CB  1 
ATOM   8144 O OG  . SER B 1 515 ? 33.185 143.280 27.845  1.00 53.87  ? 512 SER B OG  1 
ATOM   8145 N N   . LEU B 1 516 ? 36.513 145.489 27.312  1.00 43.95  ? 513 LEU B N   1 
ATOM   8146 C CA  . LEU B 1 516 ? 36.632 146.919 27.051  1.00 34.18  ? 513 LEU B CA  1 
ATOM   8147 C C   . LEU B 1 516 ? 36.169 147.198 25.626  1.00 31.52  ? 513 LEU B C   1 
ATOM   8148 O O   . LEU B 1 516 ? 36.854 146.841 24.662  1.00 34.62  ? 513 LEU B O   1 
ATOM   8149 C CB  . LEU B 1 516 ? 38.067 147.392 27.267  1.00 29.61  ? 513 LEU B CB  1 
ATOM   8150 C CG  . LEU B 1 516 ? 38.603 147.309 28.697  1.00 40.06  ? 513 LEU B CG  1 
ATOM   8151 C CD1 . LEU B 1 516 ? 40.055 147.755 28.751  1.00 20.57  ? 513 LEU B CD1 1 
ATOM   8152 C CD2 . LEU B 1 516 ? 37.751 148.147 29.636  1.00 35.98  ? 513 LEU B CD2 1 
ATOM   8153 N N   . ASP B 1 517 ? 35.007 147.829 25.497  1.00 33.87  ? 514 ASP B N   1 
ATOM   8154 C CA  . ASP B 1 517 ? 34.489 148.261 24.204  1.00 30.46  ? 514 ASP B CA  1 
ATOM   8155 C C   . ASP B 1 517 ? 33.526 149.420 24.446  1.00 35.24  ? 514 ASP B C   1 
ATOM   8156 O O   . ASP B 1 517 ? 33.477 149.989 25.542  1.00 34.24  ? 514 ASP B O   1 
ATOM   8157 C CB  . ASP B 1 517 ? 33.836 147.095 23.450  1.00 37.13  ? 514 ASP B CB  1 
ATOM   8158 C CG  . ASP B 1 517 ? 32.856 146.309 24.308  1.00 46.36  ? 514 ASP B CG  1 
ATOM   8159 O OD1 . ASP B 1 517 ? 32.239 146.896 25.221  1.00 52.62  ? 514 ASP B OD1 1 
ATOM   8160 O OD2 . ASP B 1 517 ? 32.698 145.095 24.060  1.00 54.50  ? 514 ASP B OD2 1 
ATOM   8161 N N   . LEU B 1 518 ? 32.753 149.771 23.415  1.00 30.32  ? 515 LEU B N   1 
ATOM   8162 C CA  . LEU B 1 518 ? 31.829 150.896 23.527  1.00 34.92  ? 515 LEU B CA  1 
ATOM   8163 C C   . LEU B 1 518 ? 30.723 150.622 24.538  1.00 44.86  ? 515 LEU B C   1 
ATOM   8164 O O   . LEU B 1 518 ? 30.161 151.563 25.110  1.00 52.38  ? 515 LEU B O   1 
ATOM   8165 C CB  . LEU B 1 518 ? 31.229 151.218 22.159  1.00 32.08  ? 515 LEU B CB  1 
ATOM   8166 C CG  . LEU B 1 518 ? 32.234 151.470 21.033  1.00 39.64  ? 515 LEU B CG  1 
ATOM   8167 C CD1 . LEU B 1 518 ? 31.519 151.839 19.744  1.00 25.90  ? 515 LEU B CD1 1 
ATOM   8168 C CD2 . LEU B 1 518 ? 33.223 152.552 21.432  1.00 33.79  ? 515 LEU B CD2 1 
ATOM   8169 N N   . ARG B 1 519 ? 30.399 149.356 24.770  1.00 53.65  ? 516 ARG B N   1 
ATOM   8170 C CA  . ARG B 1 519 ? 29.390 148.981 25.744  1.00 45.85  ? 516 ARG B CA  1 
ATOM   8171 C C   . ARG B 1 519 ? 29.938 149.115 27.162  1.00 46.20  ? 516 ARG B C   1 
ATOM   8172 O O   . ARG B 1 519 ? 31.155 149.111 27.370  1.00 55.22  ? 516 ARG B O   1 
ATOM   8173 C CB  . ARG B 1 519 ? 28.932 147.549 25.488  1.00 46.86  ? 516 ARG B CB  1 
ATOM   8174 C CG  . ARG B 1 519 ? 28.192 147.363 24.174  1.00 49.07  ? 516 ARG B CG  1 
ATOM   8175 C CD  . ARG B 1 519 ? 28.355 145.951 23.624  1.00 64.73  ? 516 ARG B CD  1 
ATOM   8176 N NE  . ARG B 1 519 ? 28.133 144.922 24.637  1.00 72.35  ? 516 ARG B NE  1 
ATOM   8177 C CZ  . ARG B 1 519 ? 29.103 144.213 25.206  1.00 74.34  ? 516 ARG B CZ  1 
ATOM   8178 N NH1 . ARG B 1 519 ? 30.366 144.420 24.859  1.00 67.06  ? 516 ARG B NH1 1 
ATOM   8179 N NH2 . ARG B 1 519 ? 28.812 143.297 26.120  1.00 72.37  ? 516 ARG B NH2 1 
ATOM   8180 N N   . PRO B 1 520 ? 29.060 149.248 28.156  1.00 48.26  ? 517 PRO B N   1 
ATOM   8181 C CA  . PRO B 1 520 ? 29.522 149.268 29.549  1.00 35.60  ? 517 PRO B CA  1 
ATOM   8182 C C   . PRO B 1 520 ? 30.260 147.988 29.913  1.00 41.25  ? 517 PRO B C   1 
ATOM   8183 O O   . PRO B 1 520 ? 30.178 146.970 29.221  1.00 50.29  ? 517 PRO B O   1 
ATOM   8184 C CB  . PRO B 1 520 ? 28.225 149.413 30.353  1.00 42.53  ? 517 PRO B CB  1 
ATOM   8185 C CG  . PRO B 1 520 ? 27.280 150.081 29.413  1.00 43.92  ? 517 PRO B CG  1 
ATOM   8186 C CD  . PRO B 1 520 ? 27.620 149.546 28.050  1.00 47.46  ? 517 PRO B CD  1 
ATOM   8187 N N   . LEU B 1 521 ? 30.990 148.056 31.026  1.00 39.86  ? 518 LEU B N   1 
ATOM   8188 C CA  . LEU B 1 521 ? 31.819 146.937 31.457  1.00 47.42  ? 518 LEU B CA  1 
ATOM   8189 C C   . LEU B 1 521 ? 30.993 145.667 31.615  1.00 48.16  ? 518 LEU B C   1 
ATOM   8190 O O   . LEU B 1 521 ? 29.867 145.692 32.120  1.00 50.46  ? 518 LEU B O   1 
ATOM   8191 C CB  . LEU B 1 521 ? 32.517 147.268 32.777  1.00 48.50  ? 518 LEU B CB  1 
ATOM   8192 C CG  . LEU B 1 521 ? 33.706 148.228 32.721  1.00 51.13  ? 518 LEU B CG  1 
ATOM   8193 C CD1 . LEU B 1 521 ? 34.318 148.395 34.103  1.00 52.31  ? 518 LEU B CD1 1 
ATOM   8194 C CD2 . LEU B 1 521 ? 34.744 147.733 31.728  1.00 42.89  ? 518 LEU B CD2 1 
ATOM   8195 N N   . GLU B 1 522 ? 31.564 144.550 31.170  1.00 53.57  ? 519 GLU B N   1 
ATOM   8196 C CA  . GLU B 1 522 ? 30.937 143.239 31.278  1.00 49.27  ? 519 GLU B CA  1 
ATOM   8197 C C   . GLU B 1 522 ? 31.941 142.286 31.907  1.00 44.84  ? 519 GLU B C   1 
ATOM   8198 O O   . GLU B 1 522 ? 33.056 142.135 31.399  1.00 50.46  ? 519 GLU B O   1 
ATOM   8199 C CB  . GLU B 1 522 ? 30.490 142.724 29.907  1.00 53.07  ? 519 GLU B CB  1 
ATOM   8200 C CG  . GLU B 1 522 ? 29.689 141.435 29.957  1.00 57.97  ? 519 GLU B CG  1 
ATOM   8201 C CD  . GLU B 1 522 ? 29.366 140.900 28.576  1.00 68.65  ? 519 GLU B CD  1 
ATOM   8202 O OE1 . GLU B 1 522 ? 30.038 139.945 28.133  1.00 69.04  ? 519 GLU B OE1 1 
ATOM   8203 O OE2 . GLU B 1 522 ? 28.447 141.444 27.927  1.00 76.77  ? 519 GLU B OE2 1 
ATOM   8204 N N   . VAL B 1 523 ? 31.550 141.651 33.006  1.00 43.99  ? 520 VAL B N   1 
ATOM   8205 C CA  . VAL B 1 523 ? 32.444 140.745 33.716  1.00 45.61  ? 520 VAL B CA  1 
ATOM   8206 C C   . VAL B 1 523 ? 32.387 139.371 33.062  1.00 41.62  ? 520 VAL B C   1 
ATOM   8207 O O   . VAL B 1 523 ? 31.303 138.847 32.782  1.00 49.75  ? 520 VAL B O   1 
ATOM   8208 C CB  . VAL B 1 523 ? 32.073 140.667 35.205  1.00 36.25  ? 520 VAL B CB  1 
ATOM   8209 C CG1 . VAL B 1 523 ? 33.099 139.837 35.963  1.00 32.90  ? 520 VAL B CG1 1 
ATOM   8210 C CG2 . VAL B 1 523 ? 31.967 142.063 35.798  1.00 34.94  ? 520 VAL B CG2 1 
ATOM   8211 N N   . ARG B 1 524 ? 33.557 138.791 32.809  1.00 41.98  ? 521 ARG B N   1 
ATOM   8212 C CA  . ARG B 1 524 ? 33.679 137.447 32.269  1.00 38.50  ? 521 ARG B CA  1 
ATOM   8213 C C   . ARG B 1 524 ? 34.680 136.669 33.111  1.00 40.72  ? 521 ARG B C   1 
ATOM   8214 O O   . ARG B 1 524 ? 35.326 137.215 34.009  1.00 46.77  ? 521 ARG B O   1 
ATOM   8215 C CB  . ARG B 1 524 ? 34.107 137.469 30.796  1.00 37.47  ? 521 ARG B CB  1 
ATOM   8216 C CG  . ARG B 1 524 ? 33.121 138.179 29.887  1.00 40.66  ? 521 ARG B CG  1 
ATOM   8217 C CD  . ARG B 1 524 ? 33.667 138.319 28.480  1.00 44.86  ? 521 ARG B CD  1 
ATOM   8218 N NE  . ARG B 1 524 ? 32.801 139.151 27.651  1.00 51.06  ? 521 ARG B NE  1 
ATOM   8219 C CZ  . ARG B 1 524 ? 33.108 139.556 26.424  1.00 43.26  ? 521 ARG B CZ  1 
ATOM   8220 N NH1 . ARG B 1 524 ? 34.264 139.205 25.879  1.00 40.32  ? 521 ARG B NH1 1 
ATOM   8221 N NH2 . ARG B 1 524 ? 32.259 140.313 25.742  1.00 47.85  ? 521 ARG B NH2 1 
ATOM   8222 N N   . ARG B 1 525 ? 34.809 135.378 32.816  1.00 34.43  ? 522 ARG B N   1 
ATOM   8223 C CA  . ARG B 1 525 ? 35.639 134.485 33.612  1.00 43.54  ? 522 ARG B CA  1 
ATOM   8224 C C   . ARG B 1 525 ? 36.514 133.637 32.702  1.00 42.43  ? 522 ARG B C   1 
ATOM   8225 O O   . ARG B 1 525 ? 36.033 133.087 31.706  1.00 44.27  ? 522 ARG B O   1 
ATOM   8226 C CB  . ARG B 1 525 ? 34.779 133.589 34.507  1.00 47.57  ? 522 ARG B CB  1 
ATOM   8227 C CG  . ARG B 1 525 ? 34.046 134.344 35.601  1.00 49.27  ? 522 ARG B CG  1 
ATOM   8228 C CD  . ARG B 1 525 ? 33.501 133.389 36.641  1.00 55.88  ? 522 ARG B CD  1 
ATOM   8229 N NE  . ARG B 1 525 ? 34.390 132.245 36.817  1.00 62.60  ? 522 ARG B NE  1 
ATOM   8230 C CZ  . ARG B 1 525 ? 34.426 131.484 37.904  1.00 62.51  ? 522 ARG B CZ  1 
ATOM   8231 N NH1 . ARG B 1 525 ? 33.627 131.751 38.928  1.00 68.84  ? 522 ARG B NH1 1 
ATOM   8232 N NH2 . ARG B 1 525 ? 35.268 130.462 37.971  1.00 55.14  ? 522 ARG B NH2 1 
ATOM   8233 N N   . GLY B 1 526 ? 37.793 133.531 33.052  1.00 44.89  ? 523 GLY B N   1 
ATOM   8234 C CA  . GLY B 1 526 ? 38.722 132.708 32.305  1.00 36.93  ? 523 GLY B CA  1 
ATOM   8235 C C   . GLY B 1 526 ? 39.284 133.386 31.073  1.00 42.27  ? 523 GLY B C   1 
ATOM   8236 O O   . GLY B 1 526 ? 38.549 133.679 30.126  1.00 39.11  ? 523 GLY B O   1 
ATOM   8237 N N   . LEU B 1 527 ? 40.593 133.645 31.078  1.00 44.54  ? 524 LEU B N   1 
ATOM   8238 C CA  . LEU B 1 527 ? 41.281 134.192 29.909  1.00 40.08  ? 524 LEU B CA  1 
ATOM   8239 C C   . LEU B 1 527 ? 41.710 133.028 29.024  1.00 42.88  ? 524 LEU B C   1 
ATOM   8240 O O   . LEU B 1 527 ? 42.873 132.618 28.994  1.00 45.62  ? 524 LEU B O   1 
ATOM   8241 C CB  . LEU B 1 527 ? 42.465 135.052 30.332  1.00 36.24  ? 524 LEU B CB  1 
ATOM   8242 C CG  . LEU B 1 527 ? 42.145 136.511 30.655  1.00 45.67  ? 524 LEU B CG  1 
ATOM   8243 C CD1 . LEU B 1 527 ? 43.378 137.238 31.161  1.00 46.77  ? 524 LEU B CD1 1 
ATOM   8244 C CD2 . LEU B 1 527 ? 41.592 137.193 29.422  1.00 44.77  ? 524 LEU B CD2 1 
ATOM   8245 N N   . ARG B 1 528 ? 40.737 132.491 28.289  1.00 39.93  ? 525 ARG B N   1 
ATOM   8246 C CA  . ARG B 1 528 ? 40.931 131.320 27.435  1.00 41.73  ? 525 ARG B CA  1 
ATOM   8247 C C   . ARG B 1 528 ? 41.524 130.166 28.243  1.00 39.22  ? 525 ARG B C   1 
ATOM   8248 O O   . ARG B 1 528 ? 42.600 129.643 27.951  1.00 45.85  ? 525 ARG B O   1 
ATOM   8249 C CB  . ARG B 1 528 ? 41.799 131.670 26.223  1.00 38.57  ? 525 ARG B CB  1 
ATOM   8250 C CG  . ARG B 1 528 ? 41.317 132.903 25.475  1.00 38.57  ? 525 ARG B CG  1 
ATOM   8251 C CD  . ARG B 1 528 ? 42.050 133.093 24.160  1.00 43.29  ? 525 ARG B CD  1 
ATOM   8252 N NE  . ARG B 1 528 ? 41.443 134.147 23.352  1.00 50.34  ? 525 ARG B NE  1 
ATOM   8253 C CZ  . ARG B 1 528 ? 41.639 134.298 22.046  1.00 60.48  ? 525 ARG B CZ  1 
ATOM   8254 N NH1 . ARG B 1 528 ? 42.425 133.455 21.389  1.00 51.28  ? 525 ARG B NH1 1 
ATOM   8255 N NH2 . ARG B 1 528 ? 41.043 135.287 21.395  1.00 45.36  ? 525 ARG B NH2 1 
ATOM   8256 N N   . ALA B 1 529 ? 40.781 129.779 29.284  1.00 39.07  ? 526 ALA B N   1 
ATOM   8257 C CA  . ALA B 1 529 ? 41.298 128.829 30.264  1.00 36.98  ? 526 ALA B CA  1 
ATOM   8258 C C   . ALA B 1 529 ? 41.566 127.464 29.641  1.00 45.56  ? 526 ALA B C   1 
ATOM   8259 O O   . ALA B 1 529 ? 42.596 126.839 29.923  1.00 44.91  ? 526 ALA B O   1 
ATOM   8260 C CB  . ALA B 1 529 ? 40.321 128.703 31.433  1.00 40.36  ? 526 ALA B CB  1 
ATOM   8261 N N   . GLN B 1 530 ? 40.654 126.983 28.793  1.00 39.67  ? 527 GLN B N   1 
ATOM   8262 C CA  . GLN B 1 530 ? 40.839 125.665 28.194  1.00 39.93  ? 527 GLN B CA  1 
ATOM   8263 C C   . GLN B 1 530 ? 42.031 125.648 27.245  1.00 47.72  ? 527 GLN B C   1 
ATOM   8264 O O   . GLN B 1 530 ? 42.809 124.687 27.236  1.00 47.62  ? 527 GLN B O   1 
ATOM   8265 C CB  . GLN B 1 530 ? 39.566 125.231 27.467  1.00 40.54  ? 527 GLN B CB  1 
ATOM   8266 C CG  . GLN B 1 530 ? 38.345 125.117 28.367  1.00 44.78  ? 527 GLN B CG  1 
ATOM   8267 C CD  . GLN B 1 530 ? 38.556 124.158 29.524  1.00 45.45  ? 527 GLN B CD  1 
ATOM   8268 O OE1 . GLN B 1 530 ? 38.160 124.438 30.656  1.00 55.61  ? 527 GLN B OE1 1 
ATOM   8269 N NE2 . GLN B 1 530 ? 39.177 123.017 29.245  1.00 37.73  ? 527 GLN B NE2 1 
ATOM   8270 N N   . ALA B 1 531 ? 42.195 126.704 26.445  1.00 37.93  ? 528 ALA B N   1 
ATOM   8271 C CA  . ALA B 1 531 ? 43.318 126.756 25.515  1.00 34.01  ? 528 ALA B CA  1 
ATOM   8272 C C   . ALA B 1 531 ? 44.640 126.934 26.251  1.00 39.53  ? 528 ALA B C   1 
ATOM   8273 O O   . ALA B 1 531 ? 45.647 126.315 25.888  1.00 40.53  ? 528 ALA B O   1 
ATOM   8274 C CB  . ALA B 1 531 ? 43.113 127.883 24.503  1.00 39.03  ? 528 ALA B CB  1 
ATOM   8275 N N   . CYS B 1 532 ? 44.657 127.769 27.291  1.00 31.85  ? 529 CYS B N   1 
ATOM   8276 C CA  . CYS B 1 532 ? 45.896 128.044 28.007  1.00 31.92  ? 529 CYS B CA  1 
ATOM   8277 C C   . CYS B 1 532 ? 46.337 126.890 28.894  1.00 38.38  ? 529 CYS B C   1 
ATOM   8278 O O   . CYS B 1 532 ? 47.526 126.798 29.217  1.00 34.46  ? 529 CYS B O   1 
ATOM   8279 C CB  . CYS B 1 532 ? 45.748 129.320 28.834  1.00 40.41  ? 529 CYS B CB  1 
ATOM   8280 S SG  . CYS B 1 532 ? 45.715 130.799 27.804  1.00 44.93  ? 529 CYS B SG  1 
ATOM   8281 N N   . ALA B 1 533 ? 45.419 126.008 29.294  1.00 37.96  ? 530 ALA B N   1 
ATOM   8282 C CA  . ALA B 1 533 ? 45.836 124.796 29.988  1.00 38.64  ? 530 ALA B CA  1 
ATOM   8283 C C   . ALA B 1 533 ? 46.631 123.879 29.070  1.00 37.80  ? 530 ALA B C   1 
ATOM   8284 O O   . ALA B 1 533 ? 47.471 123.106 29.542  1.00 35.75  ? 530 ALA B O   1 
ATOM   8285 C CB  . ALA B 1 533 ? 44.622 124.061 30.552  1.00 34.51  ? 530 ALA B CB  1 
ATOM   8286 N N   . PHE B 1 534 ? 46.379 123.947 27.761  1.00 35.29  ? 531 PHE B N   1 
ATOM   8287 C CA  . PHE B 1 534 ? 47.171 123.169 26.815  1.00 37.60  ? 531 PHE B CA  1 
ATOM   8288 C C   . PHE B 1 534 ? 48.600 123.692 26.742  1.00 42.23  ? 531 PHE B C   1 
ATOM   8289 O O   . PHE B 1 534 ? 49.560 122.913 26.762  1.00 45.82  ? 531 PHE B O   1 
ATOM   8290 C CB  . PHE B 1 534 ? 46.511 123.196 25.435  1.00 28.17  ? 531 PHE B CB  1 
ATOM   8291 C CG  . PHE B 1 534 ? 47.390 122.679 24.330  1.00 42.02  ? 531 PHE B CG  1 
ATOM   8292 C CD1 . PHE B 1 534 ? 47.550 121.318 24.134  1.00 43.56  ? 531 PHE B CD1 1 
ATOM   8293 C CD2 . PHE B 1 534 ? 48.049 123.557 23.483  1.00 41.05  ? 531 PHE B CD2 1 
ATOM   8294 C CE1 . PHE B 1 534 ? 48.356 120.840 23.117  1.00 42.02  ? 531 PHE B CE1 1 
ATOM   8295 C CE2 . PHE B 1 534 ? 48.856 123.085 22.464  1.00 40.48  ? 531 PHE B CE2 1 
ATOM   8296 C CZ  . PHE B 1 534 ? 49.010 121.724 22.281  1.00 40.19  ? 531 PHE B CZ  1 
ATOM   8297 N N   . TRP B 1 535 ? 48.761 125.016 26.664  1.00 35.86  ? 532 TRP B N   1 
ATOM   8298 C CA  . TRP B 1 535 ? 50.095 125.593 26.546  1.00 36.16  ? 532 TRP B CA  1 
ATOM   8299 C C   . TRP B 1 535 ? 50.832 125.598 27.880  1.00 32.97  ? 532 TRP B C   1 
ATOM   8300 O O   . TRP B 1 535 ? 52.032 125.306 27.928  1.00 37.68  ? 532 TRP B O   1 
ATOM   8301 C CB  . TRP B 1 535 ? 50.012 127.016 25.991  1.00 32.75  ? 532 TRP B CB  1 
ATOM   8302 C CG  . TRP B 1 535 ? 49.409 127.112 24.623  1.00 26.91  ? 532 TRP B CG  1 
ATOM   8303 C CD1 . TRP B 1 535 ? 48.135 127.490 24.315  1.00 26.23  ? 532 TRP B CD1 1 
ATOM   8304 C CD2 . TRP B 1 535 ? 50.057 126.833 23.375  1.00 16.92  ? 532 TRP B CD2 1 
ATOM   8305 N NE1 . TRP B 1 535 ? 47.949 127.462 22.954  1.00 30.40  ? 532 TRP B NE1 1 
ATOM   8306 C CE2 . TRP B 1 535 ? 49.114 127.061 22.354  1.00 23.32  ? 532 TRP B CE2 1 
ATOM   8307 C CE3 . TRP B 1 535 ? 51.343 126.412 23.023  1.00 20.78  ? 532 TRP B CE3 1 
ATOM   8308 C CZ2 . TRP B 1 535 ? 49.414 126.881 21.006  1.00 22.44  ? 532 TRP B CZ2 1 
ATOM   8309 C CZ3 . TRP B 1 535 ? 51.639 126.234 21.682  1.00 19.42  ? 532 TRP B CZ3 1 
ATOM   8310 C CH2 . TRP B 1 535 ? 50.679 126.468 20.691  1.00 21.64  ? 532 TRP B CH2 1 
ATOM   8311 N N   . ASN B 1 536 ? 50.139 125.927 28.970  1.00 29.98  ? 533 ASN B N   1 
ATOM   8312 C CA  . ASN B 1 536 ? 50.802 126.112 30.255  1.00 39.04  ? 533 ASN B CA  1 
ATOM   8313 C C   . ASN B 1 536 ? 50.979 124.818 31.037  1.00 41.26  ? 533 ASN B C   1 
ATOM   8314 O O   . ASN B 1 536 ? 51.933 124.705 31.815  1.00 50.65  ? 533 ASN B O   1 
ATOM   8315 C CB  . ASN B 1 536 ? 50.025 127.117 31.112  1.00 34.39  ? 533 ASN B CB  1 
ATOM   8316 C CG  . ASN B 1 536 ? 49.920 128.482 30.458  1.00 44.77  ? 533 ASN B CG  1 
ATOM   8317 O OD1 . ASN B 1 536 ? 50.751 128.850 29.627  1.00 39.81  ? 533 ASN B OD1 1 
ATOM   8318 N ND2 . ASN B 1 536 ? 48.896 129.241 30.832  1.00 41.72  ? 533 ASN B ND2 1 
ATOM   8319 N N   . ARG B 1 537 ? 50.094 123.839 30.858  1.00 42.74  ? 534 ARG B N   1 
ATOM   8320 C CA  . ARG B 1 537 ? 50.141 122.607 31.634  1.00 44.95  ? 534 ARG B CA  1 
ATOM   8321 C C   . ARG B 1 537 ? 50.560 121.394 30.818  1.00 44.56  ? 534 ARG B C   1 
ATOM   8322 O O   . ARG B 1 537 ? 51.493 120.685 31.205  1.00 54.16  ? 534 ARG B O   1 
ATOM   8323 C CB  . ARG B 1 537 ? 48.774 122.338 32.284  1.00 40.53  ? 534 ARG B CB  1 
ATOM   8324 C CG  . ARG B 1 537 ? 48.291 123.439 33.212  1.00 43.73  ? 534 ARG B CG  1 
ATOM   8325 C CD  . ARG B 1 537 ? 46.908 123.117 33.756  1.00 43.50  ? 534 ARG B CD  1 
ATOM   8326 N NE  . ARG B 1 537 ? 46.390 124.180 34.612  1.00 52.50  ? 534 ARG B NE  1 
ATOM   8327 C CZ  . ARG B 1 537 ? 46.552 124.224 35.931  1.00 48.26  ? 534 ARG B CZ  1 
ATOM   8328 N NH1 . ARG B 1 537 ? 47.221 123.262 36.551  1.00 40.94  ? 534 ARG B NH1 1 
ATOM   8329 N NH2 . ARG B 1 537 ? 46.044 125.231 36.629  1.00 46.20  ? 534 ARG B NH2 1 
ATOM   8330 N N   . PHE B 1 538 ? 49.897 121.132 29.691  1.00 44.67  ? 535 PHE B N   1 
ATOM   8331 C CA  . PHE B 1 538 ? 50.103 119.861 29.003  1.00 45.96  ? 535 PHE B CA  1 
ATOM   8332 C C   . PHE B 1 538 ? 51.350 119.874 28.127  1.00 46.11  ? 535 PHE B C   1 
ATOM   8333 O O   . PHE B 1 538 ? 52.165 118.947 28.190  1.00 49.06  ? 535 PHE B O   1 
ATOM   8334 C CB  . PHE B 1 538 ? 48.876 119.506 28.165  1.00 42.75  ? 535 PHE B CB  1 
ATOM   8335 C CG  . PHE B 1 538 ? 49.044 118.249 27.362  1.00 50.83  ? 535 PHE B CG  1 
ATOM   8336 C CD1 . PHE B 1 538 ? 49.244 117.033 27.994  1.00 41.63  ? 535 PHE B CD1 1 
ATOM   8337 C CD2 . PHE B 1 538 ? 49.006 118.281 25.978  1.00 48.62  ? 535 PHE B CD2 1 
ATOM   8338 C CE1 . PHE B 1 538 ? 49.404 115.872 27.262  1.00 47.93  ? 535 PHE B CE1 1 
ATOM   8339 C CE2 . PHE B 1 538 ? 49.163 117.123 25.240  1.00 49.92  ? 535 PHE B CE2 1 
ATOM   8340 C CZ  . PHE B 1 538 ? 49.363 115.918 25.884  1.00 50.58  ? 535 PHE B CZ  1 
ATOM   8341 N N   . LEU B 1 539 ? 51.506 120.901 27.292  1.00 45.99  ? 536 LEU B N   1 
ATOM   8342 C CA  . LEU B 1 539 ? 52.606 120.904 26.330  1.00 45.64  ? 536 LEU B CA  1 
ATOM   8343 C C   . LEU B 1 539 ? 53.984 120.795 26.977  1.00 48.26  ? 536 LEU B C   1 
ATOM   8344 O O   . LEU B 1 539 ? 54.838 120.090 26.413  1.00 53.46  ? 536 LEU B O   1 
ATOM   8345 C CB  . LEU B 1 539 ? 52.513 122.149 25.436  1.00 40.35  ? 536 LEU B CB  1 
ATOM   8346 C CG  . LEU B 1 539 ? 52.846 121.936 23.953  1.00 42.02  ? 536 LEU B CG  1 
ATOM   8347 C CD1 . LEU B 1 539 ? 52.378 123.114 23.124  1.00 33.63  ? 536 LEU B CD1 1 
ATOM   8348 C CD2 . LEU B 1 539 ? 54.332 121.701 23.728  1.00 60.62  ? 536 LEU B CD2 1 
ATOM   8349 N N   . PRO B 1 540 ? 54.279 121.442 28.113  1.00 52.30  ? 537 PRO B N   1 
ATOM   8350 C CA  . PRO B 1 540 ? 55.567 121.168 28.773  1.00 49.80  ? 537 PRO B CA  1 
ATOM   8351 C C   . PRO B 1 540 ? 55.763 119.705 29.131  1.00 59.21  ? 537 PRO B C   1 
ATOM   8352 O O   . PRO B 1 540 ? 56.897 119.212 29.074  1.00 62.41  ? 537 PRO B O   1 
ATOM   8353 C CB  . PRO B 1 540 ? 55.513 122.057 30.022  1.00 45.96  ? 537 PRO B CB  1 
ATOM   8354 C CG  . PRO B 1 540 ? 54.642 123.185 29.625  1.00 41.03  ? 537 PRO B CG  1 
ATOM   8355 C CD  . PRO B 1 540 ? 53.586 122.583 28.741  1.00 39.79  ? 537 PRO B CD  1 
ATOM   8356 N N   . LYS B 1 541 ? 54.694 118.992 29.497  1.00 64.06  ? 538 LYS B N   1 
ATOM   8357 C CA  . LYS B 1 541 ? 54.820 117.557 29.730  1.00 63.21  ? 538 LYS B CA  1 
ATOM   8358 C C   . LYS B 1 541 ? 55.120 116.807 28.440  1.00 62.21  ? 538 LYS B C   1 
ATOM   8359 O O   . LYS B 1 541 ? 55.815 115.784 28.466  1.00 65.77  ? 538 LYS B O   1 
ATOM   8360 C CB  . LYS B 1 541 ? 53.546 117.003 30.369  1.00 59.23  ? 538 LYS B CB  1 
ATOM   8361 C CG  . LYS B 1 541 ? 53.259 117.520 31.767  1.00 66.06  ? 538 LYS B CG  1 
ATOM   8362 C CD  . LYS B 1 541 ? 52.535 116.465 32.588  1.00 71.56  ? 538 LYS B CD  1 
ATOM   8363 C CE  . LYS B 1 541 ? 53.407 115.229 32.757  1.00 76.94  ? 538 LYS B CE  1 
ATOM   8364 N NZ  . LYS B 1 541 ? 52.730 114.143 33.516  1.00 72.61  ? 538 LYS B NZ  1 
ATOM   8365 N N   . LEU B 1 542 ? 54.611 117.297 27.307  1.00 60.04  ? 539 LEU B N   1 
ATOM   8366 C CA  . LEU B 1 542 ? 54.824 116.613 26.037  1.00 63.80  ? 539 LEU B CA  1 
ATOM   8367 C C   . LEU B 1 542 ? 56.254 116.786 25.540  1.00 69.51  ? 539 LEU B C   1 
ATOM   8368 O O   . LEU B 1 542 ? 56.797 115.882 24.894  1.00 80.45  ? 539 LEU B O   1 
ATOM   8369 C CB  . LEU B 1 542 ? 53.823 117.128 24.999  1.00 56.45  ? 539 LEU B CB  1 
ATOM   8370 C CG  . LEU B 1 542 ? 53.511 116.273 23.767  1.00 53.09  ? 539 LEU B CG  1 
ATOM   8371 C CD1 . LEU B 1 542 ? 52.113 116.585 23.258  1.00 45.90  ? 539 LEU B CD1 1 
ATOM   8372 C CD2 . LEU B 1 542 ? 54.531 116.494 22.661  1.00 62.82  ? 539 LEU B CD2 1 
ATOM   8373 N N   . LEU B 1 543 ? 56.878 117.929 25.830  1.00 70.20  ? 540 LEU B N   1 
ATOM   8374 C CA  . LEU B 1 543 ? 58.244 118.165 25.379  1.00 73.13  ? 540 LEU B CA  1 
ATOM   8375 C C   . LEU B 1 543 ? 59.269 117.457 26.256  1.00 75.24  ? 540 LEU B C   1 
ATOM   8376 O O   . LEU B 1 543 ? 60.334 117.069 25.763  1.00 85.31  ? 540 LEU B O   1 
ATOM   8377 C CB  . LEU B 1 543 ? 58.531 119.666 25.338  1.00 65.19  ? 540 LEU B CB  1 
ATOM   8378 C CG  . LEU B 1 543 ? 57.727 120.464 24.310  1.00 68.91  ? 540 LEU B CG  1 
ATOM   8379 C CD1 . LEU B 1 543 ? 57.984 121.955 24.459  1.00 54.49  ? 540 LEU B CD1 1 
ATOM   8380 C CD2 . LEU B 1 543 ? 58.052 120.001 22.897  1.00 65.55  ? 540 LEU B CD2 1 
ATOM   8381 N N   . SER B 1 544 ? 58.974 117.283 27.547  1.00 74.39  ? 541 SER B N   1 
ATOM   8382 C CA  . SER B 1 544 ? 59.893 116.560 28.420  1.00 79.96  ? 541 SER B CA  1 
ATOM   8383 C C   . SER B 1 544 ? 59.984 115.092 28.025  1.00 86.87  ? 541 SER B C   1 
ATOM   8384 O O   . SER B 1 544 ? 61.071 114.503 28.046  1.00 85.33  ? 541 SER B O   1 
ATOM   8385 C CB  . SER B 1 544 ? 59.457 116.702 29.878  1.00 73.03  ? 541 SER B CB  1 
ATOM   8386 O OG  . SER B 1 544 ? 59.495 118.057 30.288  1.00 69.17  ? 541 SER B OG  1 
ATOM   8387 N N   . ALA B 1 545 ? 58.855 114.485 27.664  1.00 87.46  ? 542 ALA B N   1 
ATOM   8388 C CA  . ALA B 1 545 ? 58.844 113.125 27.146  1.00 82.32  ? 542 ALA B CA  1 
ATOM   8389 C C   . ALA B 1 545 ? 59.161 113.061 25.658  1.00 86.43  ? 542 ALA B C   1 
ATOM   8390 O O   . ALA B 1 545 ? 59.114 111.970 25.080  1.00 86.23  ? 542 ALA B O   1 
ATOM   8391 C CB  . ALA B 1 545 ? 57.486 112.470 27.414  1.00 72.74  ? 542 ALA B CB  1 
ATOM   8392 N N   . THR B 1 546 ? 59.476 114.198 25.039  1.00 93.70  ? 543 THR B N   1 
ATOM   8393 C CA  . THR B 1 546 ? 59.804 114.279 23.617  1.00 101.07 ? 543 THR B CA  1 
ATOM   8394 C C   . THR B 1 546 ? 58.719 113.659 22.741  1.00 93.13  ? 543 THR B C   1 
ATOM   8395 O O   . THR B 1 546 ? 57.825 114.355 22.260  1.00 87.33  ? 543 THR B O   1 
ATOM   8396 C CB  . THR B 1 546 ? 61.150 113.599 23.307  1.00 97.98  ? 543 THR B CB  1 
ATOM   8397 O OG1 . THR B 1 546 ? 62.194 114.241 24.050  1.00 87.00  ? 543 THR B OG1 1 
ATOM   8398 C CG2 . THR B 1 546 ? 61.461 113.691 21.822  1.00 92.65  ? 543 THR B CG2 1 
HETATM 8399 C CAI . LND C 2 .   ? 62.846 141.162 -4.218  1.00 59.37  ? 601 LND A CAI 1 
HETATM 8400 C CAF . LND C 2 .   ? 62.041 141.223 -3.111  1.00 66.45  ? 601 LND A CAF 1 
HETATM 8401 C CAQ . LND C 2 .   ? 61.850 140.081 -2.343  1.00 70.23  ? 601 LND A CAQ 1 
HETATM 8402 C CAP . LND C 2 .   ? 60.966 140.163 -1.134  1.00 78.48  ? 601 LND A CAP 1 
HETATM 8403 O OAB . LND C 2 .   ? 61.179 139.436 -0.164  1.00 87.13  ? 601 LND A OAB 1 
HETATM 8404 N NAA . LND C 2 .   ? 59.975 141.048 -1.194  1.00 74.89  ? 601 LND A NAA 1 
HETATM 8405 C CAG . LND C 2 .   ? 62.484 138.904 -2.722  1.00 79.38  ? 601 LND A CAG 1 
HETATM 8406 C CAJ . LND C 2 .   ? 63.278 138.899 -3.839  1.00 70.47  ? 601 LND A CAJ 1 
HETATM 8407 N NAT . LND C 2 .   ? 63.446 140.014 -4.563  1.00 62.70  ? 601 LND A NAT 1 
HETATM 8408 C CAM . LND C 2 .   ? 64.310 139.977 -5.764  1.00 67.74  ? 601 LND A CAM 1 
HETATM 8409 C CAK . LND C 2 .   ? 65.289 141.140 -5.786  1.00 56.32  ? 601 LND A CAK 1 
HETATM 8410 C CAL . LND C 2 .   ? 65.725 141.491 -7.210  1.00 47.16  ? 601 LND A CAL 1 
HETATM 8411 N NAS . LND C 2 .   ? 66.657 140.516 -7.770  1.00 66.29  ? 601 LND A NAS 1 
HETATM 8412 C CAH . LND C 2 .   ? 66.409 139.170 -7.826  1.00 60.63  ? 601 LND A CAH 1 
HETATM 8413 C CAE . LND C 2 .   ? 67.509 138.603 -8.413  1.00 54.71  ? 601 LND A CAE 1 
HETATM 8414 N NAO . LND C 2 .   ? 68.429 139.570 -8.720  1.00 65.65  ? 601 LND A NAO 1 
HETATM 8415 C CAR . LND C 2 .   ? 67.894 140.721 -8.323  1.00 56.33  ? 601 LND A CAR 1 
HETATM 8416 C CAD . LND C 2 .   ? 68.495 142.035 -8.437  1.00 57.28  ? 601 LND A CAD 1 
HETATM 8417 N NAN . LND C 2 .   ? 68.056 142.888 -9.285  1.00 67.14  ? 601 LND A NAN 1 
HETATM 8418 O OAC . LND C 2 .   ? 68.712 144.113 -9.302  1.00 74.87  ? 601 LND A OAC 1 
HETATM 8419 C C1  . GOL D 3 .   ? 70.336 147.575 -14.065 1.00 52.36  ? 602 GOL A C1  1 
HETATM 8420 O O1  . GOL D 3 .   ? 70.907 146.480 -14.747 1.00 48.74  ? 602 GOL A O1  1 
HETATM 8421 C C2  . GOL D 3 .   ? 70.651 147.465 -12.578 1.00 57.70  ? 602 GOL A C2  1 
HETATM 8422 O O2  . GOL D 3 .   ? 71.652 146.494 -12.368 1.00 47.89  ? 602 GOL A O2  1 
HETATM 8423 C C3  . GOL D 3 .   ? 69.389 147.081 -11.817 1.00 43.56  ? 602 GOL A C3  1 
HETATM 8424 O O3  . GOL D 3 .   ? 69.728 146.644 -10.520 1.00 53.27  ? 602 GOL A O3  1 
HETATM 8425 C C1  . GOL E 3 .   ? 78.374 152.435 -7.071  1.00 33.20  ? 603 GOL A C1  1 
HETATM 8426 O O1  . GOL E 3 .   ? 79.269 152.300 -5.991  1.00 34.20  ? 603 GOL A O1  1 
HETATM 8427 C C2  . GOL E 3 .   ? 78.986 153.332 -8.141  1.00 39.59  ? 603 GOL A C2  1 
HETATM 8428 O O2  . GOL E 3 .   ? 78.527 152.930 -9.412  1.00 33.17  ? 603 GOL A O2  1 
HETATM 8429 C C3  . GOL E 3 .   ? 80.504 153.220 -8.090  1.00 34.66  ? 603 GOL A C3  1 
HETATM 8430 O O3  . GOL E 3 .   ? 81.076 154.026 -9.095  1.00 41.62  ? 603 GOL A O3  1 
HETATM 8431 C C1  . GOL F 3 .   ? 42.737 154.928 -10.054 1.00 55.47  ? 604 GOL A C1  1 
HETATM 8432 O O1  . GOL F 3 .   ? 42.333 155.088 -11.396 1.00 60.81  ? 604 GOL A O1  1 
HETATM 8433 C C2  . GOL F 3 .   ? 42.704 153.449 -9.690  1.00 57.03  ? 604 GOL A C2  1 
HETATM 8434 O O2  . GOL F 3 .   ? 41.384 153.079 -9.360  1.00 61.27  ? 604 GOL A O2  1 
HETATM 8435 C C3  . GOL F 3 .   ? 43.620 153.186 -8.500  1.00 50.35  ? 604 GOL A C3  1 
HETATM 8436 O O3  . GOL F 3 .   ? 43.117 153.853 -7.364  1.00 58.47  ? 604 GOL A O3  1 
HETATM 8437 C C1  . GOL G 3 .   ? 52.938 157.639 -33.581 1.00 56.49  ? 605 GOL A C1  1 
HETATM 8438 O O1  . GOL G 3 .   ? 51.688 157.040 -33.319 1.00 63.93  ? 605 GOL A O1  1 
HETATM 8439 C C2  . GOL G 3 .   ? 53.104 158.878 -32.710 1.00 57.85  ? 605 GOL A C2  1 
HETATM 8440 O O2  . GOL G 3 .   ? 52.771 160.027 -33.455 1.00 66.07  ? 605 GOL A O2  1 
HETATM 8441 C C3  . GOL G 3 .   ? 54.553 158.976 -32.245 1.00 49.27  ? 605 GOL A C3  1 
HETATM 8442 O O3  . GOL G 3 .   ? 54.744 160.189 -31.553 1.00 46.86  ? 605 GOL A O3  1 
HETATM 8443 C C1  . GOL H 3 .   ? 87.788 139.068 -9.080  1.00 58.03  ? 606 GOL A C1  1 
HETATM 8444 O O1  . GOL H 3 .   ? 88.583 138.873 -7.933  1.00 67.69  ? 606 GOL A O1  1 
HETATM 8445 C C2  . GOL H 3 .   ? 86.498 138.269 -8.947  1.00 56.83  ? 606 GOL A C2  1 
HETATM 8446 O O2  . GOL H 3 .   ? 86.386 137.784 -7.627  1.00 60.11  ? 606 GOL A O2  1 
HETATM 8447 C C3  . GOL H 3 .   ? 86.521 137.092 -9.914  1.00 58.30  ? 606 GOL A C3  1 
HETATM 8448 O O3  . GOL H 3 .   ? 86.583 137.573 -11.238 1.00 57.81  ? 606 GOL A O3  1 
HETATM 8449 C CAI . LND I 2 .   ? 61.423 141.242 8.893   1.00 63.25  ? 601 LND B CAI 1 
HETATM 8450 C CAF . LND I 2 .   ? 62.136 141.185 7.725   1.00 72.41  ? 601 LND B CAF 1 
HETATM 8451 C CAQ . LND I 2 .   ? 62.487 139.947 7.199   1.00 75.69  ? 601 LND B CAQ 1 
HETATM 8452 C CAP . LND I 2 .   ? 63.268 139.900 5.919   1.00 75.91  ? 601 LND B CAP 1 
HETATM 8453 O OAB . LND I 2 .   ? 63.084 138.985 5.118   1.00 83.68  ? 601 LND B OAB 1 
HETATM 8454 N NAA . LND I 2 .   ? 64.138 140.888 5.730   1.00 75.54  ? 601 LND B NAA 1 
HETATM 8455 C CAG . LND I 2 .   ? 62.101 138.797 7.877   1.00 74.77  ? 601 LND B CAG 1 
HETATM 8456 C CAJ . LND I 2 .   ? 61.388 138.912 9.042   1.00 64.53  ? 601 LND B CAJ 1 
HETATM 8457 N NAT . LND I 2 .   ? 61.063 140.118 9.528   1.00 64.48  ? 601 LND B NAT 1 
HETATM 8458 C CAM . LND I 2 .   ? 60.293 140.208 10.788  1.00 67.44  ? 601 LND B CAM 1 
HETATM 8459 C CAK . LND I 2 .   ? 59.029 141.034 10.614  1.00 58.23  ? 601 LND B CAK 1 
HETATM 8460 C CAL . LND I 2 .   ? 58.382 141.379 11.957  1.00 51.01  ? 601 LND B CAL 1 
HETATM 8461 N NAS . LND I 2 .   ? 57.657 140.253 12.539  1.00 65.59  ? 601 LND B NAS 1 
HETATM 8462 C CAH . LND I 2 .   ? 57.873 138.946 12.191  1.00 59.30  ? 601 LND B CAH 1 
HETATM 8463 C CAE . LND I 2 .   ? 57.009 138.201 12.949  1.00 55.56  ? 601 LND B CAE 1 
HETATM 8464 N NAO . LND I 2 .   ? 56.265 139.021 13.756  1.00 61.51  ? 601 LND B NAO 1 
HETATM 8465 C CAR . LND I 2 .   ? 56.674 140.259 13.492  1.00 57.91  ? 601 LND B CAR 1 
HETATM 8466 C CAD . LND I 2 .   ? 56.177 141.477 14.102  1.00 58.17  ? 601 LND B CAD 1 
HETATM 8467 N NAN . LND I 2 .   ? 55.866 142.491 13.386  1.00 65.49  ? 601 LND B NAN 1 
HETATM 8468 O OAC . LND I 2 .   ? 55.403 143.602 14.082  1.00 65.10  ? 601 LND B OAC 1 
HETATM 8469 C C1  . GOL J 3 .   ? 54.557 147.303 16.807  1.00 46.82  ? 602 GOL B C1  1 
HETATM 8470 O O1  . GOL J 3 .   ? 54.513 146.546 15.619  1.00 52.94  ? 602 GOL B O1  1 
HETATM 8471 C C2  . GOL J 3 .   ? 53.211 147.221 17.519  1.00 57.09  ? 602 GOL B C2  1 
HETATM 8472 O O2  . GOL J 3 .   ? 52.395 146.260 16.888  1.00 50.02  ? 602 GOL B O2  1 
HETATM 8473 C C3  . GOL J 3 .   ? 53.440 146.818 18.970  1.00 51.46  ? 602 GOL B C3  1 
HETATM 8474 O O3  . GOL J 3 .   ? 54.315 147.738 19.583  1.00 55.38  ? 602 GOL B O3  1 
HETATM 8475 C C1  . GOL K 3 .   ? 45.911 152.317 11.867  1.00 34.21  ? 603 GOL B C1  1 
HETATM 8476 O O1  . GOL K 3 .   ? 45.256 152.536 10.638  1.00 38.68  ? 603 GOL B O1  1 
HETATM 8477 C C2  . GOL K 3 .   ? 45.507 153.395 12.866  1.00 38.95  ? 603 GOL B C2  1 
HETATM 8478 O O2  . GOL K 3 .   ? 45.646 152.902 14.180  1.00 33.59  ? 603 GOL B O2  1 
HETATM 8479 C C3  . GOL K 3 .   ? 44.062 153.813 12.616  1.00 36.80  ? 603 GOL B C3  1 
HETATM 8480 O O3  . GOL K 3 .   ? 43.273 153.496 13.742  1.00 38.51  ? 603 GOL B O3  1 
HETATM 8481 C C1  . GOL L 3 .   ? 81.199 153.157 13.609  1.00 47.16  ? 604 GOL B C1  1 
HETATM 8482 O O1  . GOL L 3 .   ? 81.208 153.458 12.232  1.00 59.08  ? 604 GOL B O1  1 
HETATM 8483 C C2  . GOL L 3 .   ? 82.444 153.744 14.262  1.00 66.32  ? 604 GOL B C2  1 
HETATM 8484 O O2  . GOL L 3 .   ? 83.429 152.742 14.378  1.00 62.08  ? 604 GOL B O2  1 
HETATM 8485 C C3  . GOL L 3 .   ? 82.092 154.275 15.647  1.00 52.42  ? 604 GOL B C3  1 
HETATM 8486 O O3  . GOL L 3 .   ? 81.149 155.316 15.525  1.00 56.25  ? 604 GOL B O3  1 
HETATM 8487 C C1  . GOL M 3 .   ? 71.154 157.685 38.104  1.00 53.87  ? 605 GOL B C1  1 
HETATM 8488 O O1  . GOL M 3 .   ? 72.352 157.149 38.622  1.00 64.28  ? 605 GOL B O1  1 
HETATM 8489 C C2  . GOL M 3 .   ? 71.311 159.189 37.923  1.00 60.03  ? 605 GOL B C2  1 
HETATM 8490 O O2  . GOL M 3 .   ? 72.678 159.531 37.981  1.00 73.04  ? 605 GOL B O2  1 
HETATM 8491 C C3  . GOL M 3 .   ? 70.739 159.610 36.574  1.00 53.79  ? 605 GOL B C3  1 
HETATM 8492 O O3  . GOL M 3 .   ? 69.333 159.529 36.613  1.00 50.49  ? 605 GOL B O3  1 
HETATM 8493 C C1  . GOL N 3 .   ? 38.189 137.329 14.191  1.00 53.00  ? 606 GOL B C1  1 
HETATM 8494 O O1  . GOL N 3 .   ? 37.685 137.249 15.506  1.00 63.12  ? 606 GOL B O1  1 
HETATM 8495 C C2  . GOL N 3 .   ? 37.635 138.576 13.513  1.00 58.66  ? 606 GOL B C2  1 
HETATM 8496 O O2  . GOL N 3 .   ? 36.400 138.917 14.101  1.00 64.72  ? 606 GOL B O2  1 
HETATM 8497 C C3  . GOL N 3 .   ? 37.429 138.302 12.027  1.00 56.38  ? 606 GOL B C3  1 
HETATM 8498 O O3  . GOL N 3 .   ? 36.421 137.331 11.855  1.00 62.88  ? 606 GOL B O3  1 
HETATM 8499 O O   . HOH O 4 .   ? 69.817 132.281 -12.321 1.00 40.02  ? 701 HOH A O   1 
HETATM 8500 O O   . HOH O 4 .   ? 80.412 119.961 -18.697 1.00 46.22  ? 702 HOH A O   1 
HETATM 8501 O O   . HOH O 4 .   ? 72.683 121.271 -6.416  1.00 34.97  ? 703 HOH A O   1 
HETATM 8502 O O   . HOH O 4 .   ? 69.632 162.244 -12.387 1.00 21.88  ? 704 HOH A O   1 
HETATM 8503 O O   . HOH O 4 .   ? 76.651 161.046 -20.726 1.00 39.17  ? 705 HOH A O   1 
HETATM 8504 O O   . HOH O 4 .   ? 86.843 140.126 -11.944 1.00 51.33  ? 706 HOH A O   1 
HETATM 8505 O O   . HOH O 4 .   ? 68.291 156.298 -7.512  1.00 28.96  ? 707 HOH A O   1 
HETATM 8506 O O   . HOH O 4 .   ? 58.010 146.469 -9.998  1.00 25.67  ? 708 HOH A O   1 
HETATM 8507 O O   . HOH O 4 .   ? 51.826 174.389 -27.754 1.00 42.42  ? 709 HOH A O   1 
HETATM 8508 O O   . HOH O 4 .   ? 68.808 147.942 -0.844  1.00 32.89  ? 710 HOH A O   1 
HETATM 8509 O O   . HOH O 4 .   ? 54.286 144.945 -10.369 1.00 28.56  ? 711 HOH A O   1 
HETATM 8510 O O   . HOH O 4 .   ? 79.141 132.192 -30.729 1.00 35.17  ? 712 HOH A O   1 
HETATM 8511 O O   . HOH O 4 .   ? 76.316 145.506 -17.170 1.00 28.10  ? 713 HOH A O   1 
HETATM 8512 O O   . HOH O 4 .   ? 63.856 134.648 -23.616 1.00 42.44  ? 714 HOH A O   1 
HETATM 8513 O O   . HOH O 4 .   ? 83.629 148.985 -13.047 1.00 27.49  ? 715 HOH A O   1 
HETATM 8514 O O   . HOH O 4 .   ? 48.553 144.116 -20.811 1.00 34.14  ? 716 HOH A O   1 
HETATM 8515 O O   . HOH O 4 .   ? 83.107 136.592 -7.971  1.00 44.51  ? 717 HOH A O   1 
HETATM 8516 O O   . HOH O 4 .   ? 46.201 159.397 -28.614 1.00 46.82  ? 718 HOH A O   1 
HETATM 8517 O O   . HOH O 4 .   ? 67.617 151.125 -14.770 1.00 26.38  ? 719 HOH A O   1 
HETATM 8518 O O   . HOH O 4 .   ? 82.239 132.626 -28.248 1.00 42.19  ? 720 HOH A O   1 
HETATM 8519 O O   . HOH O 4 .   ? 90.955 148.283 -23.315 1.00 43.12  ? 721 HOH A O   1 
HETATM 8520 O O   . HOH O 4 .   ? 49.495 149.643 -17.508 1.00 29.52  ? 722 HOH A O   1 
HETATM 8521 O O   . HOH O 4 .   ? 66.591 147.931 -10.558 1.00 35.79  ? 723 HOH A O   1 
HETATM 8522 O O   . HOH O 4 .   ? 92.745 145.203 -22.764 1.00 49.04  ? 724 HOH A O   1 
HETATM 8523 O O   . HOH O 4 .   ? 82.633 136.229 -10.241 1.00 38.07  ? 725 HOH A O   1 
HETATM 8524 O O   . HOH O 4 .   ? 52.894 161.068 -20.810 1.00 25.16  ? 726 HOH A O   1 
HETATM 8525 O O   . HOH O 4 .   ? 73.643 150.201 4.001   1.00 40.35  ? 727 HOH A O   1 
HETATM 8526 O O   . HOH O 4 .   ? 89.897 129.878 -0.183  1.00 44.67  ? 728 HOH A O   1 
HETATM 8527 O O   . HOH O 4 .   ? 53.156 160.225 -29.498 1.00 36.14  ? 729 HOH A O   1 
HETATM 8528 O O   . HOH O 4 .   ? 52.168 159.384 -18.785 1.00 30.24  ? 730 HOH A O   1 
HETATM 8529 O O   . HOH O 4 .   ? 70.171 149.598 -17.350 1.00 34.88  ? 731 HOH A O   1 
HETATM 8530 O O   . HOH O 4 .   ? 63.946 179.439 -20.610 1.00 42.87  ? 732 HOH A O   1 
HETATM 8531 O O   . HOH O 4 .   ? 71.147 173.155 -28.275 1.00 35.38  ? 733 HOH A O   1 
HETATM 8532 O O   . HOH O 4 .   ? 57.904 142.079 -12.679 1.00 29.28  ? 734 HOH A O   1 
HETATM 8533 O O   . HOH O 4 .   ? 68.458 172.967 -28.910 1.00 47.43  ? 735 HOH A O   1 
HETATM 8534 O O   . HOH O 4 .   ? 43.546 151.179 -12.927 1.00 28.64  ? 736 HOH A O   1 
HETATM 8535 O O   . HOH O 4 .   ? 77.031 140.798 -11.247 1.00 29.89  ? 737 HOH A O   1 
HETATM 8536 O O   . HOH O 4 .   ? 80.935 136.937 -16.249 1.00 32.65  ? 738 HOH A O   1 
HETATM 8537 O O   . HOH O 4 .   ? 66.109 127.593 -15.434 1.00 41.29  ? 739 HOH A O   1 
HETATM 8538 O O   . HOH O 4 .   ? 61.982 136.092 -15.224 1.00 30.96  ? 740 HOH A O   1 
HETATM 8539 O O   . HOH O 4 .   ? 59.750 141.671 -14.272 1.00 27.94  ? 741 HOH A O   1 
HETATM 8540 O O   . HOH O 4 .   ? 68.637 148.237 -6.398  1.00 30.13  ? 742 HOH A O   1 
HETATM 8541 O O   . HOH O 4 .   ? 63.388 150.278 -8.152  1.00 32.57  ? 743 HOH A O   1 
HETATM 8542 O O   . HOH O 4 .   ? 85.672 162.255 -11.252 1.00 44.05  ? 744 HOH A O   1 
HETATM 8543 O O   . HOH O 4 .   ? 79.573 134.890 -15.643 1.00 33.76  ? 745 HOH A O   1 
HETATM 8544 O O   . HOH O 4 .   ? 85.870 136.997 -35.192 1.00 41.40  ? 746 HOH A O   1 
HETATM 8545 O O   . HOH O 4 .   ? 67.501 150.268 -0.074  1.00 41.84  ? 747 HOH A O   1 
HETATM 8546 O O   . HOH O 4 .   ? 84.387 141.649 -31.844 1.00 41.65  ? 748 HOH A O   1 
HETATM 8547 O O   . HOH O 4 .   ? 78.154 145.058 -20.610 1.00 22.34  ? 749 HOH A O   1 
HETATM 8548 O O   . HOH O 4 .   ? 44.977 153.603 -12.462 1.00 38.57  ? 750 HOH A O   1 
HETATM 8549 O O   . HOH O 4 .   ? 49.688 152.115 -15.705 1.00 28.40  ? 751 HOH A O   1 
HETATM 8550 O O   . HOH O 4 .   ? 63.535 155.968 -33.849 1.00 35.66  ? 752 HOH A O   1 
HETATM 8551 O O   . HOH O 4 .   ? 61.476 162.172 -17.928 1.00 29.42  ? 753 HOH A O   1 
HETATM 8552 O O   . HOH O 4 .   ? 44.313 158.225 -19.784 1.00 44.29  ? 754 HOH A O   1 
HETATM 8553 O O   . HOH O 4 .   ? 64.205 153.402 -10.547 1.00 26.87  ? 755 HOH A O   1 
HETATM 8554 O O   . HOH O 4 .   ? 55.304 150.845 -13.984 1.00 31.89  ? 756 HOH A O   1 
HETATM 8555 O O   . HOH O 4 .   ? 53.489 152.877 -13.450 1.00 32.73  ? 757 HOH A O   1 
HETATM 8556 O O   . HOH O 4 .   ? 54.479 138.353 -18.120 1.00 29.44  ? 758 HOH A O   1 
HETATM 8557 O O   . HOH O 4 .   ? 75.099 129.565 -2.342  1.00 27.64  ? 759 HOH A O   1 
HETATM 8558 O O   . HOH O 4 .   ? 48.098 155.719 -23.148 1.00 28.78  ? 760 HOH A O   1 
HETATM 8559 O O   . HOH O 4 .   ? 78.647 116.217 -10.793 1.00 48.96  ? 761 HOH A O   1 
HETATM 8560 O O   . HOH O 4 .   ? 74.982 146.450 4.862   1.00 26.03  ? 762 HOH A O   1 
HETATM 8561 O O   . HOH O 4 .   ? 68.341 158.325 -19.423 1.00 36.79  ? 763 HOH A O   1 
HETATM 8562 O O   . HOH O 4 .   ? 51.345 138.224 -16.314 1.00 37.63  ? 764 HOH A O   1 
HETATM 8563 O O   . HOH O 4 .   ? 54.654 164.391 -27.935 1.00 29.26  ? 765 HOH A O   1 
HETATM 8564 O O   . HOH O 4 .   ? 55.369 166.000 -30.225 1.00 35.00  ? 766 HOH A O   1 
HETATM 8565 O O   . HOH O 4 .   ? 77.422 151.697 -13.630 1.00 34.13  ? 767 HOH A O   1 
HETATM 8566 O O   . HOH O 4 .   ? 53.885 140.844 -20.879 1.00 28.19  ? 768 HOH A O   1 
HETATM 8567 O O   . HOH O 4 .   ? 54.779 162.829 -32.706 1.00 47.34  ? 769 HOH A O   1 
HETATM 8568 O O   . HOH O 4 .   ? 49.599 164.263 -17.737 1.00 31.46  ? 770 HOH A O   1 
HETATM 8569 O O   . HOH O 4 .   ? 70.824 165.621 -15.290 1.00 47.73  ? 771 HOH A O   1 
HETATM 8570 O O   . HOH O 4 .   ? 69.892 158.254 -9.402  1.00 35.27  ? 772 HOH A O   1 
HETATM 8571 O O   . HOH O 4 .   ? 60.265 133.666 -15.172 1.00 31.33  ? 773 HOH A O   1 
HETATM 8572 O O   . HOH O 4 .   ? 60.407 154.481 -14.956 1.00 29.50  ? 774 HOH A O   1 
HETATM 8573 O O   . HOH O 4 .   ? 63.357 146.981 -16.690 1.00 22.86  ? 775 HOH A O   1 
HETATM 8574 O O   . HOH O 4 .   ? 55.776 147.508 -10.923 1.00 25.11  ? 776 HOH A O   1 
HETATM 8575 O O   . HOH O 4 .   ? 51.183 163.514 -19.968 1.00 33.55  ? 777 HOH A O   1 
HETATM 8576 O O   . HOH O 4 .   ? 47.449 131.004 -10.350 1.00 39.46  ? 778 HOH A O   1 
HETATM 8577 O O   . HOH O 4 .   ? 49.626 157.157 -10.279 1.00 28.46  ? 779 HOH A O   1 
HETATM 8578 O O   . HOH O 4 .   ? 56.504 146.776 -2.497  1.00 28.07  ? 780 HOH A O   1 
HETATM 8579 O O   . HOH O 4 .   ? 59.769 140.621 -10.260 1.00 37.82  ? 781 HOH A O   1 
HETATM 8580 O O   . HOH O 4 .   ? 71.561 135.607 -0.050  1.00 33.85  ? 782 HOH A O   1 
HETATM 8581 O O   . HOH O 4 .   ? 57.182 150.713 -4.284  1.00 22.23  ? 783 HOH A O   1 
HETATM 8582 O O   . HOH O 4 .   ? 47.630 155.619 -9.740  1.00 28.46  ? 784 HOH A O   1 
HETATM 8583 O O   . HOH O 4 .   ? 61.862 158.996 -14.288 1.00 32.24  ? 785 HOH A O   1 
HETATM 8584 O O   . HOH O 4 .   ? 65.791 154.636 -20.850 1.00 28.87  ? 786 HOH A O   1 
HETATM 8585 O O   . HOH O 4 .   ? 71.966 130.787 -23.152 1.00 39.40  ? 787 HOH A O   1 
HETATM 8586 O O   . HOH O 4 .   ? 80.226 135.607 -13.361 1.00 33.46  ? 788 HOH A O   1 
HETATM 8587 O O   . HOH O 4 .   ? 52.008 153.231 -15.584 1.00 24.14  ? 789 HOH A O   1 
HETATM 8588 O O   . HOH O 4 .   ? 67.115 150.647 -12.046 1.00 26.46  ? 790 HOH A O   1 
HETATM 8589 O O   . HOH O 4 .   ? 59.944 148.858 -1.053  1.00 34.32  ? 791 HOH A O   1 
HETATM 8590 O O   . HOH O 4 .   ? 76.215 148.971 3.976   1.00 33.78  ? 792 HOH A O   1 
HETATM 8591 O O   . HOH O 4 .   ? 53.423 162.730 -13.367 1.00 35.33  ? 793 HOH A O   1 
HETATM 8592 O O   . HOH O 4 .   ? 71.213 129.254 -20.716 1.00 35.54  ? 794 HOH A O   1 
HETATM 8593 O O   . HOH O 4 .   ? 72.267 156.777 -10.275 1.00 28.46  ? 795 HOH A O   1 
HETATM 8594 O O   . HOH O 4 .   ? 49.015 153.578 -4.888  1.00 40.14  ? 796 HOH A O   1 
HETATM 8595 O O   . HOH O 4 .   ? 69.105 161.755 -7.884  1.00 41.14  ? 797 HOH A O   1 
HETATM 8596 O O   . HOH O 4 .   ? 36.806 144.128 -4.731  1.00 43.33  ? 798 HOH A O   1 
HETATM 8597 O O   . HOH O 4 .   ? 63.376 154.980 -3.933  1.00 29.66  ? 799 HOH A O   1 
HETATM 8598 O O   . HOH O 4 .   ? 89.436 121.621 -1.680  1.00 43.98  ? 800 HOH A O   1 
HETATM 8599 O O   . HOH O 4 .   ? 53.881 136.831 -16.100 1.00 28.55  ? 801 HOH A O   1 
HETATM 8600 O O   . HOH O 4 .   ? 77.226 153.408 0.682   1.00 33.61  ? 802 HOH A O   1 
HETATM 8601 O O   . HOH O 4 .   ? 58.424 148.421 -2.788  1.00 31.06  ? 803 HOH A O   1 
HETATM 8602 O O   . HOH O 4 .   ? 46.820 154.281 -7.195  1.00 49.76  ? 804 HOH A O   1 
HETATM 8603 O O   . HOH O 4 .   ? 53.100 163.311 -29.122 1.00 39.60  ? 805 HOH A O   1 
HETATM 8604 O O   . HOH O 4 .   ? 84.812 128.447 -20.764 1.00 34.28  ? 806 HOH A O   1 
HETATM 8605 O O   . HOH O 4 .   ? 51.692 167.019 -20.614 1.00 47.42  ? 807 HOH A O   1 
HETATM 8606 O O   . HOH O 4 .   ? 66.110 148.564 -7.969  1.00 34.58  ? 808 HOH A O   1 
HETATM 8607 O O   . HOH O 4 .   ? 64.033 132.027 -25.842 1.00 33.27  ? 809 HOH A O   1 
HETATM 8608 O O   . HOH O 4 .   ? 49.772 168.570 -21.192 1.00 46.57  ? 810 HOH A O   1 
HETATM 8609 O O   . HOH O 4 .   ? 52.890 167.180 -18.627 1.00 41.93  ? 811 HOH A O   1 
HETATM 8610 O O   . HOH O 4 .   ? 57.645 153.157 -2.791  1.00 31.57  ? 812 HOH A O   1 
HETATM 8611 O O   . HOH O 4 .   ? 51.429 172.943 -19.057 1.00 38.23  ? 813 HOH A O   1 
HETATM 8612 O O   . HOH O 4 .   ? 60.265 150.949 0.191   1.00 26.15  ? 814 HOH A O   1 
HETATM 8613 O O   . HOH P 4 .   ? 70.549 145.054 15.265  1.00 31.64  ? 701 HOH B O   1 
HETATM 8614 O O   . HOH P 4 .   ? 72.460 174.173 32.247  1.00 39.42  ? 702 HOH B O   1 
HETATM 8615 O O   . HOH P 4 .   ? 48.165 145.335 22.048  1.00 32.25  ? 703 HOH B O   1 
HETATM 8616 O O   . HOH P 4 .   ? 34.401 126.628 14.594  1.00 45.42  ? 704 HOH B O   1 
HETATM 8617 O O   . HOH P 4 .   ? 54.721 162.203 17.180  1.00 26.39  ? 705 HOH B O   1 
HETATM 8618 O O   . HOH P 4 .   ? 75.983 156.000 27.902  1.00 35.00  ? 706 HOH B O   1 
HETATM 8619 O O   . HOH P 4 .   ? 55.529 147.940 5.618   1.00 27.85  ? 707 HOH B O   1 
HETATM 8620 O O   . HOH P 4 .   ? 66.473 146.555 14.836  1.00 25.16  ? 708 HOH B O   1 
HETATM 8621 O O   . HOH P 4 .   ? 72.257 159.458 23.629  1.00 32.43  ? 709 HOH B O   1 
HETATM 8622 O O   . HOH P 4 .   ? 71.368 161.082 25.706  1.00 24.23  ? 710 HOH B O   1 
HETATM 8623 O O   . HOH P 4 .   ? 69.894 180.992 30.317  1.00 35.11  ? 711 HOH B O   1 
HETATM 8624 O O   . HOH P 4 .   ? 33.360 148.315 28.191  1.00 40.45  ? 712 HOH B O   1 
HETATM 8625 O O   . HOH P 4 .   ? 64.803 141.716 19.061  1.00 28.49  ? 713 HOH B O   1 
HETATM 8626 O O   . HOH P 4 .   ? 60.524 134.447 28.384  1.00 43.04  ? 714 HOH B O   1 
HETATM 8627 O O   . HOH P 4 .   ? 41.173 136.371 12.511  1.00 43.80  ? 715 HOH B O   1 
HETATM 8628 O O   . HOH P 4 .   ? 57.811 148.121 15.504  1.00 36.71  ? 716 HOH B O   1 
HETATM 8629 O O   . HOH P 4 .   ? 45.145 157.275 14.374  1.00 38.07  ? 717 HOH B O   1 
HETATM 8630 O O   . HOH P 4 .   ? 69.114 162.700 37.819  1.00 43.37  ? 718 HOH B O   1 
HETATM 8631 O O   . HOH P 4 .   ? 54.739 172.440 45.497  1.00 48.26  ? 719 HOH B O   1 
HETATM 8632 O O   . HOH P 4 .   ? 47.002 124.863 -0.230  1.00 31.45  ? 720 HOH B O   1 
HETATM 8633 O O   . HOH P 4 .   ? 51.131 161.827 44.663  1.00 43.08  ? 721 HOH B O   1 
HETATM 8634 O O   . HOH P 4 .   ? 69.590 138.468 22.927  1.00 31.19  ? 722 HOH B O   1 
HETATM 8635 O O   . HOH P 4 .   ? 47.871 161.414 25.580  1.00 34.88  ? 723 HOH B O   1 
HETATM 8636 O O   . HOH P 4 .   ? 56.779 151.008 19.599  1.00 23.26  ? 724 HOH B O   1 
HETATM 8637 O O   . HOH P 4 .   ? 41.750 136.238 14.922  1.00 39.82  ? 725 HOH B O   1 
HETATM 8638 O O   . HOH P 4 .   ? 52.974 173.265 32.922  1.00 36.13  ? 726 HOH B O   1 
HETATM 8639 O O   . HOH P 4 .   ? 55.788 173.088 33.666  1.00 47.50  ? 727 HOH B O   1 
HETATM 8640 O O   . HOH P 4 .   ? 42.398 132.696 33.046  1.00 43.18  ? 728 HOH B O   1 
HETATM 8641 O O   . HOH P 4 .   ? 55.984 158.594 24.363  1.00 37.22  ? 729 HOH B O   1 
HETATM 8642 O O   . HOH P 4 .   ? 74.803 149.879 22.307  1.00 32.71  ? 730 HOH B O   1 
HETATM 8643 O O   . HOH P 4 .   ? 56.945 150.278 4.856   1.00 36.98  ? 731 HOH B O   1 
HETATM 8644 O O   . HOH P 4 .   ? 44.578 134.650 20.506  1.00 41.63  ? 732 HOH B O   1 
HETATM 8645 O O   . HOH P 4 .   ? 54.949 160.358 21.031  1.00 32.79  ? 733 HOH B O   1 
HETATM 8646 O O   . HOH P 4 .   ? 61.046 150.229 12.880  1.00 33.63  ? 734 HOH B O   1 
HETATM 8647 O O   . HOH P 4 .   ? 62.243 136.089 20.029  1.00 28.33  ? 735 HOH B O   1 
HETATM 8648 O O   . HOH P 4 .   ? 43.685 131.296 31.166  1.00 42.34  ? 736 HOH B O   1 
HETATM 8649 O O   . HOH P 4 .   ? 31.526 145.462 27.475  1.00 51.30  ? 737 HOH B O   1 
HETATM 8650 O O   . HOH P 4 .   ? 67.777 158.057 9.397   1.00 37.86  ? 738 HOH B O   1 
HETATM 8651 O O   . HOH P 4 .   ? 45.303 132.111 35.557  1.00 37.93  ? 739 HOH B O   1 
HETATM 8652 O O   . HOH P 4 .   ? 80.933 151.171 17.885  1.00 31.32  ? 740 HOH B O   1 
HETATM 8653 O O   . HOH P 4 .   ? 74.620 152.322 20.530  1.00 28.57  ? 741 HOH B O   1 
HETATM 8654 O O   . HOH P 4 .   ? 38.318 137.001 39.994  1.00 38.95  ? 742 HOH B O   1 
HETATM 8655 O O   . HOH P 4 .   ? 46.836 151.703 18.402  1.00 35.79  ? 743 HOH B O   1 
HETATM 8656 O O   . HOH P 4 .   ? 62.962 162.188 22.726  1.00 28.15  ? 744 HOH B O   1 
HETATM 8657 O O   . HOH P 4 .   ? 50.649 150.305 0.686   1.00 37.98  ? 745 HOH B O   1 
HETATM 8658 O O   . HOH P 4 .   ? 49.381 129.602 7.167   1.00 30.39  ? 746 HOH B O   1 
HETATM 8659 O O   . HOH P 4 .   ? 54.492 158.243 14.326  1.00 30.44  ? 747 HOH B O   1 
HETATM 8660 O O   . HOH P 4 .   ? 44.304 135.527 18.220  1.00 33.95  ? 748 HOH B O   1 
HETATM 8661 O O   . HOH P 4 .   ? 40.061 141.739 36.628  1.00 41.16  ? 749 HOH B O   1 
HETATM 8662 O O   . HOH P 4 .   ? 60.163 153.348 15.305  1.00 33.27  ? 750 HOH B O   1 
HETATM 8663 O O   . HOH P 4 .   ? 58.936 154.525 25.792  1.00 28.09  ? 751 HOH B O   1 
HETATM 8664 O O   . HOH P 4 .   ? 40.964 149.006 17.795  1.00 29.88  ? 752 HOH B O   1 
HETATM 8665 O O   . HOH P 4 .   ? 69.183 150.792 18.779  1.00 31.74  ? 753 HOH B O   1 
HETATM 8666 O O   . HOH P 4 .   ? 67.982 146.865 7.434   1.00 31.86  ? 754 HOH B O   1 
HETATM 8667 O O   . HOH P 4 .   ? 47.589 140.800 15.994  1.00 33.60  ? 755 HOH B O   1 
HETATM 8668 O O   . HOH P 4 .   ? 73.202 138.159 21.176  1.00 38.03  ? 756 HOH B O   1 
HETATM 8669 O O   . HOH P 4 .   ? 46.070 145.120 25.522  1.00 28.41  ? 757 HOH B O   1 
HETATM 8670 O O   . HOH P 4 .   ? 66.803 141.900 17.425  1.00 31.41  ? 758 HOH B O   1 
HETATM 8671 O O   . HOH P 4 .   ? 71.798 142.976 14.091  1.00 41.19  ? 759 HOH B O   1 
HETATM 8672 O O   . HOH P 4 .   ? 54.086 149.575 22.218  1.00 33.39  ? 760 HOH B O   1 
HETATM 8673 O O   . HOH P 4 .   ? 38.718 162.200 16.023  1.00 46.52  ? 761 HOH B O   1 
HETATM 8674 O O   . HOH P 4 .   ? 49.411 146.467 -0.090  1.00 28.94  ? 762 HOH B O   1 
HETATM 8675 O O   . HOH P 4 .   ? 70.994 152.820 18.230  1.00 30.07  ? 763 HOH B O   1 
HETATM 8676 O O   . HOH P 4 .   ? 76.944 152.890 27.054  1.00 34.08  ? 764 HOH B O   1 
HETATM 8677 O O   . HOH P 4 .   ? 61.087 146.931 21.544  1.00 19.56  ? 765 HOH B O   1 
HETATM 8678 O O   . HOH P 4 .   ? 43.492 136.834 21.287  1.00 34.02  ? 766 HOH B O   1 
HETATM 8679 O O   . HOH P 4 .   ? 63.391 144.256 4.380   1.00 42.69  ? 767 HOH B O   1 
HETATM 8680 O O   . HOH P 4 .   ? 68.634 147.497 15.788  1.00 25.29  ? 768 HOH B O   1 
HETATM 8681 O O   . HOH P 4 .   ? 62.618 158.986 19.141  1.00 31.96  ? 769 HOH B O   1 
HETATM 8682 O O   . HOH P 4 .   ? 52.724 135.620 5.007   1.00 31.32  ? 770 HOH B O   1 
HETATM 8683 O O   . HOH P 4 .   ? 64.048 154.370 19.792  1.00 22.71  ? 771 HOH B O   1 
HETATM 8684 O O   . HOH P 4 .   ? 51.811 120.604 11.163  1.00 38.55  ? 772 HOH B O   1 
HETATM 8685 O O   . HOH P 4 .   ? 35.331 121.553 6.303   1.00 39.13  ? 773 HOH B O   1 
HETATM 8686 O O   . HOH P 4 .   ? 38.852 141.249 5.628   1.00 35.98  ? 774 HOH B O   1 
HETATM 8687 O O   . HOH P 4 .   ? 47.393 153.475 4.157   1.00 28.83  ? 775 HOH B O   1 
HETATM 8688 O O   . HOH P 4 .   ? 55.753 148.222 11.276  1.00 34.30  ? 776 HOH B O   1 
HETATM 8689 O O   . HOH P 4 .   ? 50.223 172.169 19.684  1.00 33.98  ? 777 HOH B O   1 
HETATM 8690 O O   . HOH P 4 .   ? 53.191 129.358 25.457  1.00 35.33  ? 778 HOH B O   1 
HETATM 8691 O O   . HOH P 4 .   ? 72.239 153.231 20.335  1.00 30.80  ? 779 HOH B O   1 
HETATM 8692 O O   . HOH P 4 .   ? 68.156 167.581 23.095  1.00 36.70  ? 780 HOH B O   1 
HETATM 8693 O O   . HOH P 4 .   ? 52.463 130.590 27.968  1.00 42.19  ? 781 HOH B O   1 
HETATM 8694 O O   . HOH P 4 .   ? 71.114 162.610 18.230  1.00 34.91  ? 782 HOH B O   1 
HETATM 8695 O O   . HOH P 4 .   ? 52.260 156.646 15.165  1.00 28.68  ? 783 HOH B O   1 
HETATM 8696 O O   . HOH P 4 .   ? 63.346 158.790 9.575   1.00 38.44  ? 784 HOH B O   1 
HETATM 8697 O O   . HOH P 4 .   ? 38.555 144.659 4.954   1.00 33.79  ? 785 HOH B O   1 
HETATM 8698 O O   . HOH P 4 .   ? 57.253 150.814 16.899  1.00 33.10  ? 786 HOH B O   1 
HETATM 8699 O O   . HOH P 4 .   ? 64.729 140.602 15.049  1.00 38.11  ? 787 HOH B O   1 
HETATM 8700 O O   . HOH P 4 .   ? 60.939 155.050 8.799   1.00 28.53  ? 788 HOH B O   1 
HETATM 8701 O O   . HOH P 4 .   ? 65.320 163.794 12.954  1.00 35.48  ? 789 HOH B O   1 
HETATM 8702 O O   . HOH P 4 .   ? 67.253 150.576 9.025   1.00 27.13  ? 790 HOH B O   1 
HETATM 8703 O O   . HOH P 4 .   ? 41.396 130.745 22.224  1.00 42.39  ? 791 HOH B O   1 
HETATM 8704 O O   . HOH P 4 .   ? 73.395 163.295 24.788  1.00 44.40  ? 792 HOH B O   1 
HETATM 8705 O O   . HOH P 4 .   ? 76.614 155.607 14.511  1.00 31.10  ? 793 HOH B O   1 
HETATM 8706 O O   . HOH P 4 .   ? 58.303 127.533 20.735  1.00 43.96  ? 794 HOH B O   1 
HETATM 8707 O O   . HOH P 4 .   ? 48.600 165.553 18.110  1.00 40.59  ? 795 HOH B O   1 
HETATM 8708 O O   . HOH P 4 .   ? 64.705 148.636 6.101   1.00 35.59  ? 796 HOH B O   1 
HETATM 8709 O O   . HOH P 4 .   ? 74.634 164.519 22.410  1.00 40.99  ? 797 HOH B O   1 
HETATM 8710 O O   . HOH P 4 .   ? 74.762 157.366 14.898  1.00 27.83  ? 798 HOH B O   1 
HETATM 8711 O O   . HOH P 4 .   ? 75.337 153.599 9.760   1.00 35.49  ? 799 HOH B O   1 
HETATM 8712 O O   . HOH P 4 .   ? 77.628 154.184 12.607  1.00 43.26  ? 800 HOH B O   1 
HETATM 8713 O O   . HOH P 4 .   ? 66.222 148.507 7.882   1.00 28.05  ? 801 HOH B O   1 
HETATM 8714 O O   . HOH P 4 .   ? 45.633 115.668 15.836  1.00 45.61  ? 802 HOH B O   1 
HETATM 8715 O O   . HOH P 4 .   ? 48.088 149.272 0.795   1.00 37.96  ? 803 HOH B O   1 
HETATM 8716 O O   . HOH P 4 .   ? 70.528 137.076 21.261  1.00 36.87  ? 804 HOH B O   1 
HETATM 8717 O O   . HOH P 4 .   ? 56.118 176.908 23.226  1.00 31.14  ? 805 HOH B O   1 
HETATM 8718 O O   . HOH P 4 .   ? 39.389 128.463 25.563  1.00 35.18  ? 806 HOH B O   1 
HETATM 8719 O O   . HOH P 4 .   ? 47.495 156.064 13.464  1.00 34.72  ? 807 HOH B O   1 
HETATM 8720 O O   . HOH P 4 .   ? 60.236 132.023 30.582  1.00 34.66  ? 808 HOH B O   1 
HETATM 8721 O O   . HOH P 4 .   ? 58.155 148.502 12.792  1.00 30.68  ? 809 HOH B O   1 
HETATM 8722 O O   . HOH P 4 .   ? 39.970 147.701 5.444   1.00 46.78  ? 810 HOH B O   1 
HETATM 8723 O O   . HOH P 4 .   ? 71.467 167.074 24.005  1.00 37.08  ? 811 HOH B O   1 
HETATM 8724 O O   . HOH P 4 .   ? 66.707 153.093 7.464   1.00 35.29  ? 812 HOH B O   1 
HETATM 8725 O O   . HOH P 4 .   ? 49.622 156.403 14.125  1.00 39.20  ? 813 HOH B O   1 
HETATM 8726 O O   . HOH P 4 .   ? 55.723 167.280 18.709  1.00 39.69  ? 814 HOH B O   1 
HETATM 8727 O O   . HOH P 4 .   ? 64.375 150.528 4.684   1.00 32.28  ? 815 HOH B O   1 
HETATM 8728 O O   . HOH P 4 .   ? 64.710 152.815 5.613   1.00 37.01  ? 816 HOH B O   1 
HETATM 8729 O O   . HOH P 4 .   ? 59.113 152.958 -0.844  1.00 34.14  ? 817 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   LEU 3   0   ?   ?   ?   A . n 
A 1 4   GLU 4   1   ?   ?   ?   A . n 
A 1 5   GLY 5   2   ?   ?   ?   A . n 
A 1 6   ARG 6   3   ?   ?   ?   A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   ALA 9   6   6   ALA ALA A . n 
A 1 10  GLU 10  7   7   GLU GLU A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  LEU 12  9   9   LEU LEU A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  THR 14  11  11  THR THR A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ARG 16  13  13  ARG ARG A . n 
A 1 17  GLY 17  14  14  GLY GLY A . n 
A 1 18  GLY 18  15  15  GLY GLY A . n 
A 1 19  ARG 19  16  16  ARG ARG A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  GLY 22  19  19  GLY GLY A . n 
A 1 23  ILE 23  20  20  ILE ILE A . n 
A 1 24  ARG 24  21  21  ARG ARG A . n 
A 1 25  LEU 25  22  22  LEU LEU A . n 
A 1 26  LYS 26  23  23  LYS LYS A . n 
A 1 27  THR 27  24  24  THR THR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  GLY 29  26  26  GLY GLY A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  PRO 31  28  28  PRO PRO A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  SER 33  30  30  SER SER A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  GLY 37  34  34  GLY GLY A . n 
A 1 38  ILE 38  35  35  ILE ILE A . n 
A 1 39  PRO 39  36  36  PRO PRO A . n 
A 1 40  PHE 40  37  37  PHE PHE A . n 
A 1 41  ALA 41  38  38  ALA ALA A . n 
A 1 42  GLU 42  39  39  GLU GLU A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  PRO 44  41  41  PRO PRO A . n 
A 1 45  MET 45  42  42  MET MET A . n 
A 1 46  GLY 46  43  43  GLY GLY A . n 
A 1 47  PRO 47  44  44  PRO PRO A . n 
A 1 48  ARG 48  45  45  ARG ARG A . n 
A 1 49  ARG 49  46  46  ARG ARG A . n 
A 1 50  PHE 50  47  47  PHE PHE A . n 
A 1 51  LEU 51  48  48  LEU LEU A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLU 54  51  51  GLU GLU A . n 
A 1 55  PRO 55  52  52  PRO PRO A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  GLN 57  54  54  GLN GLN A . n 
A 1 58  PRO 58  55  55  PRO PRO A . n 
A 1 59  TRP 59  56  56  TRP TRP A . n 
A 1 60  SER 60  57  57  SER SER A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  VAL 63  60  60  VAL VAL A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  ALA 65  62  62  ALA ALA A . n 
A 1 66  THR 66  63  63  THR THR A . n 
A 1 67  THR 67  64  64  THR THR A . n 
A 1 68  PHE 68  65  65  PHE PHE A . n 
A 1 69  GLN 69  66  66  GLN GLN A . n 
A 1 70  SER 70  67  67  SER SER A . n 
A 1 71  VAL 71  68  68  VAL VAL A . n 
A 1 72  CYS 72  69  69  CYS CYS A . n 
A 1 73  TYR 73  70  70  TYR TYR A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  TYR 75  72  72  TYR TYR A . n 
A 1 76  VAL 76  73  73  VAL VAL A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  PRO 81  78  78  PRO PRO A . n 
A 1 82  GLY 82  79  79  GLY GLY A . n 
A 1 83  PHE 83  80  80  PHE PHE A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  GLY 85  82  82  GLY GLY A . n 
A 1 86  THR 86  83  83  THR THR A . n 
A 1 87  GLU 87  84  84  GLU GLU A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  TRP 89  86  86  TRP TRP A . n 
A 1 90  ASN 90  87  87  ASN ASN A . n 
A 1 91  PRO 91  88  88  PRO PRO A . n 
A 1 92  ASN 92  89  89  ASN ASN A . n 
A 1 93  ARG 93  90  90  ARG ARG A . n 
A 1 94  GLU 94  91  91  GLU GLU A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  SER 96  93  93  SER SER A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ASP 98  95  95  ASP ASP A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 LEU 100 97  97  LEU LEU A . n 
A 1 101 TYR 101 98  98  TYR TYR A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ASN 103 100 100 ASN ASN A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 TRP 105 102 102 TRP TRP A . n 
A 1 106 THR 106 103 103 THR THR A . n 
A 1 107 PRO 107 104 104 PRO PRO A . n 
A 1 108 TYR 108 105 105 TYR TYR A . n 
A 1 109 PRO 109 106 106 PRO PRO A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 PRO 111 108 108 PRO PRO A . n 
A 1 112 THR 112 109 109 THR THR A . n 
A 1 113 SER 113 110 110 SER SER A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 THR 115 112 112 THR THR A . n 
A 1 116 PRO 116 113 113 PRO PRO A . n 
A 1 117 VAL 117 114 114 VAL VAL A . n 
A 1 118 LEU 118 115 115 LEU LEU A . n 
A 1 119 VAL 119 116 116 VAL VAL A . n 
A 1 120 TRP 120 117 117 TRP TRP A . n 
A 1 121 ILE 121 118 118 ILE ILE A . n 
A 1 122 TYR 122 119 119 TYR TYR A . n 
A 1 123 GLY 123 120 120 GLY GLY A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 GLY 125 122 122 GLY GLY A . n 
A 1 126 PHE 126 123 123 PHE PHE A . n 
A 1 127 TYR 127 124 124 TYR TYR A . n 
A 1 128 SER 128 125 125 SER SER A . n 
A 1 129 GLY 129 126 126 GLY GLY A . n 
A 1 130 ALA 130 127 127 ALA ALA A . n 
A 1 131 SER 131 128 128 SER SER A . n 
A 1 132 SER 132 129 129 SER SER A . n 
A 1 133 LEU 133 130 130 LEU LEU A . n 
A 1 134 ASP 134 131 131 ASP ASP A . n 
A 1 135 VAL 135 132 132 VAL VAL A . n 
A 1 136 TYR 136 133 133 TYR TYR A . n 
A 1 137 ASP 137 134 134 ASP ASP A . n 
A 1 138 GLY 138 135 135 GLY GLY A . n 
A 1 139 ARG 139 136 136 ARG ARG A . n 
A 1 140 PHE 140 137 137 PHE PHE A . n 
A 1 141 LEU 141 138 138 LEU LEU A . n 
A 1 142 VAL 142 139 139 VAL VAL A . n 
A 1 143 GLN 143 140 140 GLN GLN A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 GLU 145 142 142 GLU GLU A . n 
A 1 146 ARG 146 143 143 ARG ARG A . n 
A 1 147 THR 147 144 144 THR THR A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 LEU 149 146 146 LEU LEU A . n 
A 1 150 VAL 150 147 147 VAL VAL A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 ASN 153 150 150 ASN ASN A . n 
A 1 154 TYR 154 151 151 TYR TYR A . n 
A 1 155 ARG 155 152 152 ARG ARG A . n 
A 1 156 VAL 156 153 153 VAL VAL A . n 
A 1 157 GLY 157 154 154 GLY GLY A . n 
A 1 158 ALA 158 155 155 ALA ALA A . n 
A 1 159 PHE 159 156 156 PHE PHE A . n 
A 1 160 GLY 160 157 157 GLY GLY A . n 
A 1 161 PHE 161 158 158 PHE PHE A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 LEU 164 161 161 LEU LEU A . n 
A 1 165 PRO 165 162 162 PRO PRO A . n 
A 1 166 GLY 166 163 163 GLY GLY A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ARG 168 165 165 ARG ARG A . n 
A 1 169 GLU 169 166 166 GLU GLU A . n 
A 1 170 ALA 170 167 167 ALA ALA A . n 
A 1 171 PRO 171 168 168 PRO PRO A . n 
A 1 172 GLY 172 169 169 GLY GLY A . n 
A 1 173 ASN 173 170 170 ASN ASN A . n 
A 1 174 VAL 174 171 171 VAL VAL A . n 
A 1 175 GLY 175 172 172 GLY GLY A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 LEU 177 174 174 LEU LEU A . n 
A 1 178 ASP 178 175 175 ASP ASP A . n 
A 1 179 GLN 179 176 176 GLN GLN A . n 
A 1 180 ARG 180 177 177 ARG ARG A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 ALA 182 179 179 ALA ALA A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 GLN 184 181 181 GLN GLN A . n 
A 1 185 TRP 185 182 182 TRP TRP A . n 
A 1 186 VAL 186 183 183 VAL VAL A . n 
A 1 187 GLN 187 184 184 GLN GLN A . n 
A 1 188 GLU 188 185 185 GLU GLU A . n 
A 1 189 ASN 189 186 186 ASN ASN A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 GLY 194 191 191 GLY GLY A . n 
A 1 195 GLY 195 192 192 GLY GLY A . n 
A 1 196 ASP 196 193 193 ASP ASP A . n 
A 1 197 PRO 197 194 194 PRO PRO A . n 
A 1 198 THR 198 195 195 THR THR A . n 
A 1 199 SER 199 196 196 SER SER A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 THR 201 198 198 THR THR A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 PHE 203 200 200 PHE PHE A . n 
A 1 204 GLY 204 201 201 GLY GLY A . n 
A 1 205 GLU 205 202 202 GLU GLU A . n 
A 1 206 SVX 206 203 203 SVX SVX A . n 
A 1 207 ALA 207 204 204 ALA ALA A . n 
A 1 208 GLY 208 205 205 GLY GLY A . n 
A 1 209 ALA 209 206 206 ALA ALA A . n 
A 1 210 ALA 210 207 207 ALA ALA A . n 
A 1 211 SER 211 208 208 SER SER A . n 
A 1 212 VAL 212 209 209 VAL VAL A . n 
A 1 213 GLY 213 210 210 GLY GLY A . n 
A 1 214 MET 214 211 211 MET MET A . n 
A 1 215 HIS 215 212 212 HIS HIS A . n 
A 1 216 LEU 216 213 213 LEU LEU A . n 
A 1 217 LEU 217 214 214 LEU LEU A . n 
A 1 218 SER 218 215 215 SER SER A . n 
A 1 219 PRO 219 216 216 PRO PRO A . n 
A 1 220 PRO 220 217 217 PRO PRO A . n 
A 1 221 SER 221 218 218 SER SER A . n 
A 1 222 ARG 222 219 219 ARG ARG A . n 
A 1 223 GLY 223 220 220 GLY GLY A . n 
A 1 224 LEU 224 221 221 LEU LEU A . n 
A 1 225 PHE 225 222 222 PHE PHE A . n 
A 1 226 HIS 226 223 223 HIS HIS A . n 
A 1 227 ARG 227 224 224 ARG ARG A . n 
A 1 228 ALA 228 225 225 ALA ALA A . n 
A 1 229 VAL 229 226 226 VAL VAL A . n 
A 1 230 LEU 230 227 227 LEU LEU A . n 
A 1 231 GLN 231 228 228 GLN GLN A . n 
A 1 232 SER 232 229 229 SER SER A . n 
A 1 233 GLY 233 230 230 GLY GLY A . n 
A 1 234 ALA 234 231 231 ALA ALA A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 GLY 237 234 234 GLY GLY A . n 
A 1 238 PRO 238 235 235 PRO PRO A . n 
A 1 239 TRP 239 236 236 TRP TRP A . n 
A 1 240 ALA 240 237 237 ALA ALA A . n 
A 1 241 THR 241 238 238 THR THR A . n 
A 1 242 VAL 242 239 239 VAL VAL A . n 
A 1 243 GLY 243 240 240 GLY GLY A . n 
A 1 244 MET 244 241 241 MET MET A . n 
A 1 245 GLY 245 242 242 GLY GLY A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 ALA 247 244 244 ALA ALA A . n 
A 1 248 ARG 248 245 245 ARG ARG A . n 
A 1 249 ARG 249 246 246 ARG ARG A . n 
A 1 250 ARG 250 247 247 ARG ARG A . n 
A 1 251 ALA 251 248 248 ALA ALA A . n 
A 1 252 THR 252 249 249 THR THR A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 HIS 256 253 253 HIS HIS A . n 
A 1 257 LEU 257 254 254 LEU LEU A . n 
A 1 258 VAL 258 255 255 VAL VAL A . n 
A 1 259 GLY 259 256 256 GLY GLY A . n 
A 1 260 CYS 260 257 257 CYS CYS A . n 
A 1 261 PRO 261 258 258 PRO PRO A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 GLY 264 261 261 GLY GLY A . n 
A 1 265 THR 265 262 262 THR THR A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 GLY 267 264 264 GLY GLY A . n 
A 1 268 ASN 268 265 265 ASN ASN A . n 
A 1 269 ASP 269 266 266 ASP ASP A . n 
A 1 270 THR 270 267 267 THR THR A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 VAL 273 270 270 VAL VAL A . n 
A 1 274 ALA 274 271 271 ALA ALA A . n 
A 1 275 CYS 275 272 272 CYS CYS A . n 
A 1 276 LEU 276 273 273 LEU LEU A . n 
A 1 277 ARG 277 274 274 ARG ARG A . n 
A 1 278 THR 278 275 275 THR THR A . n 
A 1 279 ARG 279 276 276 ARG ARG A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 ALA 281 278 278 ALA ALA A . n 
A 1 282 GLN 282 279 279 GLN GLN A . n 
A 1 283 VAL 283 280 280 VAL VAL A . n 
A 1 284 LEU 284 281 281 LEU LEU A . n 
A 1 285 VAL 285 282 282 VAL VAL A . n 
A 1 286 ASN 286 283 283 ASN ASN A . n 
A 1 287 HIS 287 284 284 HIS HIS A . n 
A 1 288 GLU 288 285 285 GLU GLU A . n 
A 1 289 TRP 289 286 286 TRP TRP A . n 
A 1 290 HIS 290 287 287 HIS HIS A . n 
A 1 291 VAL 291 288 288 VAL VAL A . n 
A 1 292 LEU 292 289 289 LEU LEU A . n 
A 1 293 PRO 293 290 290 PRO PRO A . n 
A 1 294 GLN 294 291 291 GLN GLN A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 VAL 297 294 294 VAL VAL A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 ARG 299 296 296 ARG ARG A . n 
A 1 300 PHE 300 297 297 PHE PHE A . n 
A 1 301 SER 301 298 298 SER SER A . n 
A 1 302 PHE 302 299 299 PHE PHE A . n 
A 1 303 VAL 303 300 300 VAL VAL A . n 
A 1 304 PRO 304 301 301 PRO PRO A . n 
A 1 305 VAL 305 302 302 VAL VAL A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 ASP 307 304 304 ASP ASP A . n 
A 1 308 GLY 308 305 305 GLY GLY A . n 
A 1 309 ASP 309 306 306 ASP ASP A . n 
A 1 310 PHE 310 307 307 PHE PHE A . n 
A 1 311 LEU 311 308 308 LEU LEU A . n 
A 1 312 SER 312 309 309 SER SER A . n 
A 1 313 ASP 313 310 310 ASP ASP A . n 
A 1 314 THR 314 311 311 THR THR A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 GLU 316 313 313 GLU GLU A . n 
A 1 317 ALA 317 314 314 ALA ALA A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 ILE 319 316 316 ILE ILE A . n 
A 1 320 ASN 320 317 317 ASN ASN A . n 
A 1 321 ALA 321 318 318 ALA ALA A . n 
A 1 322 GLY 322 319 319 GLY GLY A . n 
A 1 323 ASP 323 320 320 ASP ASP A . n 
A 1 324 PHE 324 321 321 PHE PHE A . n 
A 1 325 HIS 325 322 322 HIS HIS A . n 
A 1 326 GLY 326 323 323 GLY GLY A . n 
A 1 327 LEU 327 324 324 LEU LEU A . n 
A 1 328 GLN 328 325 325 GLN GLN A . n 
A 1 329 VAL 329 326 326 VAL VAL A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 VAL 331 328 328 VAL VAL A . n 
A 1 332 GLY 332 329 329 GLY GLY A . n 
A 1 333 VAL 333 330 330 VAL VAL A . n 
A 1 334 VAL 334 331 331 VAL VAL A . n 
A 1 335 LYS 335 332 332 LYS LYS A . n 
A 1 336 ASP 336 333 333 ASP ASP A . n 
A 1 337 GLU 337 334 334 GLU GLU A . n 
A 1 338 GLY 338 335 335 GLY GLY A . n 
A 1 339 SER 339 336 336 SER SER A . n 
A 1 340 TYR 340 337 337 TYR TYR A . n 
A 1 341 PHE 341 338 338 PHE PHE A . n 
A 1 342 LEU 342 339 339 LEU LEU A . n 
A 1 343 VAL 343 340 340 VAL VAL A . n 
A 1 344 TYR 344 341 341 TYR TYR A . n 
A 1 345 GLY 345 342 342 GLY GLY A . n 
A 1 346 ALA 346 343 343 ALA ALA A . n 
A 1 347 PRO 347 344 344 PRO PRO A . n 
A 1 348 GLY 348 345 345 GLY GLY A . n 
A 1 349 PHE 349 346 346 PHE PHE A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 LYS 351 348 348 LYS LYS A . n 
A 1 352 ASP 352 349 349 ASP ASP A . n 
A 1 353 ASN 353 350 350 ASN ASN A . n 
A 1 354 GLU 354 351 351 GLU GLU A . n 
A 1 355 SER 355 352 352 SER SER A . n 
A 1 356 LEU 356 353 353 LEU LEU A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 SER 358 355 355 SER SER A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ALA 360 357 357 ALA ALA A . n 
A 1 361 GLU 361 358 358 GLU GLU A . n 
A 1 362 PHE 362 359 359 PHE PHE A . n 
A 1 363 LEU 363 360 360 LEU LEU A . n 
A 1 364 ALA 364 361 361 ALA ALA A . n 
A 1 365 GLY 365 362 362 GLY GLY A . n 
A 1 366 VAL 366 363 363 VAL VAL A . n 
A 1 367 ARG 367 364 364 ARG ARG A . n 
A 1 368 VAL 368 365 365 VAL VAL A . n 
A 1 369 GLY 369 366 366 GLY GLY A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 PRO 371 368 368 PRO PRO A . n 
A 1 372 GLN 372 369 369 GLN GLN A . n 
A 1 373 VAL 373 370 370 VAL VAL A . n 
A 1 374 SER 374 371 371 SER SER A . n 
A 1 375 ASP 375 372 372 ASP ASP A . n 
A 1 376 LEU 376 373 373 LEU LEU A . n 
A 1 377 ALA 377 374 374 ALA ALA A . n 
A 1 378 ALA 378 375 375 ALA ALA A . n 
A 1 379 GLU 379 376 376 GLU GLU A . n 
A 1 380 ALA 380 377 377 ALA ALA A . n 
A 1 381 VAL 381 378 378 VAL VAL A . n 
A 1 382 VAL 382 379 379 VAL VAL A . n 
A 1 383 LEU 383 380 380 LEU LEU A . n 
A 1 384 HIS 384 381 381 HIS HIS A . n 
A 1 385 TYR 385 382 382 TYR TYR A . n 
A 1 386 THR 386 383 383 THR THR A . n 
A 1 387 ASP 387 384 384 ASP ASP A . n 
A 1 388 TRP 388 385 385 TRP TRP A . n 
A 1 389 LEU 389 386 386 LEU LEU A . n 
A 1 390 HIS 390 387 387 HIS HIS A . n 
A 1 391 PRO 391 388 388 PRO PRO A . n 
A 1 392 GLU 392 389 389 GLU GLU A . n 
A 1 393 ASP 393 390 390 ASP ASP A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 ARG 396 393 393 ARG ARG A . n 
A 1 397 LEU 397 394 394 LEU LEU A . n 
A 1 398 ARG 398 395 395 ARG ARG A . n 
A 1 399 GLU 399 396 396 GLU GLU A . n 
A 1 400 ALA 400 397 397 ALA ALA A . n 
A 1 401 LEU 401 398 398 LEU LEU A . n 
A 1 402 SER 402 399 399 SER SER A . n 
A 1 403 ASP 403 400 400 ASP ASP A . n 
A 1 404 VAL 404 401 401 VAL VAL A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 GLY 406 403 403 GLY GLY A . n 
A 1 407 ASP 407 404 404 ASP ASP A . n 
A 1 408 HIS 408 405 405 HIS HIS A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 VAL 410 407 407 VAL VAL A . n 
A 1 411 VAL 411 408 408 VAL VAL A . n 
A 1 412 CYS 412 409 409 CYS CYS A . n 
A 1 413 PRO 413 410 410 PRO PRO A . n 
A 1 414 VAL 414 411 411 VAL VAL A . n 
A 1 415 ALA 415 412 412 ALA ALA A . n 
A 1 416 GLN 416 413 413 GLN GLN A . n 
A 1 417 LEU 417 414 414 LEU LEU A . n 
A 1 418 ALA 418 415 415 ALA ALA A . n 
A 1 419 GLY 419 416 416 GLY GLY A . n 
A 1 420 ARG 420 417 417 ARG ARG A . n 
A 1 421 LEU 421 418 418 LEU LEU A . n 
A 1 422 ALA 422 419 419 ALA ALA A . n 
A 1 423 ALA 423 420 420 ALA ALA A . n 
A 1 424 GLN 424 421 421 GLN GLN A . n 
A 1 425 GLY 425 422 422 GLY GLY A . n 
A 1 426 ALA 426 423 423 ALA ALA A . n 
A 1 427 ARG 427 424 424 ARG ARG A . n 
A 1 428 VAL 428 425 425 VAL VAL A . n 
A 1 429 TYR 429 426 426 TYR TYR A . n 
A 1 430 ALA 430 427 427 ALA ALA A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 VAL 432 429 429 VAL VAL A . n 
A 1 433 PHE 433 430 430 PHE PHE A . n 
A 1 434 GLU 434 431 431 GLU GLU A . n 
A 1 435 HIS 435 432 432 HIS HIS A . n 
A 1 436 ARG 436 433 433 ARG ARG A . n 
A 1 437 ALA 437 434 434 ALA ALA A . n 
A 1 438 SER 438 435 435 SER SER A . n 
A 1 439 THR 439 436 436 THR THR A . n 
A 1 440 LEU 440 437 437 LEU LEU A . n 
A 1 441 SER 441 438 438 SER SER A . n 
A 1 442 TRP 442 439 439 TRP TRP A . n 
A 1 443 PRO 443 440 440 PRO PRO A . n 
A 1 444 LEU 444 441 441 LEU LEU A . n 
A 1 445 TRP 445 442 442 TRP TRP A . n 
A 1 446 MET 446 443 443 MET MET A . n 
A 1 447 GLY 447 444 444 GLY GLY A . n 
A 1 448 VAL 448 445 445 VAL VAL A . n 
A 1 449 PRO 449 446 446 PRO PRO A . n 
A 1 450 HIS 450 447 447 HIS HIS A . n 
A 1 451 GLY 451 448 448 GLY GLY A . n 
A 1 452 TYR 452 449 449 TYR TYR A . n 
A 1 453 GLU 453 450 450 GLU GLU A . n 
A 1 454 ILE 454 451 451 ILE ILE A . n 
A 1 455 GLU 455 452 452 GLU GLU A . n 
A 1 456 PHE 456 453 453 PHE PHE A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PHE 458 455 455 PHE PHE A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 ILE 460 457 457 ILE ILE A . n 
A 1 461 PRO 461 458 458 PRO PRO A . n 
A 1 462 LEU 462 459 459 LEU LEU A . n 
A 1 463 ASP 463 460 460 ASP ASP A . n 
A 1 464 PRO 464 461 461 PRO PRO A . n 
A 1 465 SER 465 462 462 SER SER A . n 
A 1 466 ARG 466 463 463 ARG ARG A . n 
A 1 467 ASN 467 464 464 ASN ASN A . n 
A 1 468 TYR 468 465 465 TYR TYR A . n 
A 1 469 THR 469 466 466 THR THR A . n 
A 1 470 ALA 470 467 467 ALA ALA A . n 
A 1 471 GLU 471 468 468 GLU GLU A . n 
A 1 472 GLU 472 469 469 GLU GLU A . n 
A 1 473 LYS 473 470 470 LYS LYS A . n 
A 1 474 ILE 474 471 471 ILE ILE A . n 
A 1 475 PHE 475 472 472 PHE PHE A . n 
A 1 476 ALA 476 473 473 ALA ALA A . n 
A 1 477 GLN 477 474 474 GLN GLN A . n 
A 1 478 ARG 478 475 475 ARG ARG A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 MET 480 477 477 MET MET A . n 
A 1 481 ARG 481 478 478 ARG ARG A . n 
A 1 482 TYR 482 479 479 TYR TYR A . n 
A 1 483 TRP 483 480 480 TRP TRP A . n 
A 1 484 ALA 484 481 481 ALA ALA A . n 
A 1 485 ASN 485 482 482 ASN ASN A . n 
A 1 486 PHE 486 483 483 PHE PHE A . n 
A 1 487 ALA 487 484 484 ALA ALA A . n 
A 1 488 ARG 488 485 485 ARG ARG A . n 
A 1 489 THR 489 486 486 THR THR A . n 
A 1 490 GLY 490 487 487 GLY GLY A . n 
A 1 491 ASP 491 488 488 ASP ASP A . n 
A 1 492 PRO 492 489 489 PRO PRO A . n 
A 1 493 ASN 493 490 490 ASN ASN A . n 
A 1 494 GLU 494 491 491 GLU GLU A . n 
A 1 495 PRO 495 492 492 PRO PRO A . n 
A 1 496 ARG 496 493 493 ARG ARG A . n 
A 1 497 ASP 497 494 494 ASP ASP A . n 
A 1 498 PRO 498 495 495 PRO PRO A . n 
A 1 499 LYS 499 496 496 LYS LYS A . n 
A 1 500 ALA 500 497 497 ALA ALA A . n 
A 1 501 PRO 501 498 498 PRO PRO A . n 
A 1 502 GLN 502 499 499 GLN GLN A . n 
A 1 503 TRP 503 500 500 TRP TRP A . n 
A 1 504 PRO 504 501 501 PRO PRO A . n 
A 1 505 PRO 505 502 502 PRO PRO A . n 
A 1 506 TYR 506 503 503 TYR TYR A . n 
A 1 507 THR 507 504 504 THR THR A . n 
A 1 508 ALA 508 505 505 ALA ALA A . n 
A 1 509 GLY 509 506 506 GLY GLY A . n 
A 1 510 ALA 510 507 507 ALA ALA A . n 
A 1 511 GLN 511 508 508 GLN GLN A . n 
A 1 512 GLN 512 509 509 GLN GLN A . n 
A 1 513 TYR 513 510 510 TYR TYR A . n 
A 1 514 VAL 514 511 511 VAL VAL A . n 
A 1 515 SER 515 512 512 SER SER A . n 
A 1 516 LEU 516 513 513 LEU LEU A . n 
A 1 517 ASP 517 514 514 ASP ASP A . n 
A 1 518 LEU 518 515 515 LEU LEU A . n 
A 1 519 ARG 519 516 516 ARG ARG A . n 
A 1 520 PRO 520 517 517 PRO PRO A . n 
A 1 521 LEU 521 518 518 LEU LEU A . n 
A 1 522 GLU 522 519 519 GLU GLU A . n 
A 1 523 VAL 523 520 520 VAL VAL A . n 
A 1 524 ARG 524 521 521 ARG ARG A . n 
A 1 525 ARG 525 522 522 ARG ARG A . n 
A 1 526 GLY 526 523 523 GLY GLY A . n 
A 1 527 LEU 527 524 524 LEU LEU A . n 
A 1 528 ARG 528 525 525 ARG ARG A . n 
A 1 529 ALA 529 526 526 ALA ALA A . n 
A 1 530 GLN 530 527 527 GLN GLN A . n 
A 1 531 ALA 531 528 528 ALA ALA A . n 
A 1 532 CYS 532 529 529 CYS CYS A . n 
A 1 533 ALA 533 530 530 ALA ALA A . n 
A 1 534 PHE 534 531 531 PHE PHE A . n 
A 1 535 TRP 535 532 532 TRP TRP A . n 
A 1 536 ASN 536 533 533 ASN ASN A . n 
A 1 537 ARG 537 534 534 ARG ARG A . n 
A 1 538 PHE 538 535 535 PHE PHE A . n 
A 1 539 LEU 539 536 536 LEU LEU A . n 
A 1 540 PRO 540 537 537 PRO PRO A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 LEU 542 539 539 LEU LEU A . n 
A 1 543 LEU 543 540 540 LEU LEU A . n 
A 1 544 SER 544 541 541 SER SER A . n 
A 1 545 ALA 545 542 542 ALA ALA A . n 
A 1 546 THR 546 543 543 THR THR A . n 
A 1 547 ASP 547 544 ?   ?   ?   A . n 
A 1 548 THR 548 545 ?   ?   ?   A . n 
A 1 549 LEU 549 546 ?   ?   ?   A . n 
A 1 550 ASP 550 547 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   LEU 3   0   ?   ?   ?   B . n 
B 1 4   GLU 4   1   ?   ?   ?   B . n 
B 1 5   GLY 5   2   ?   ?   ?   B . n 
B 1 6   ARG 6   3   ?   ?   ?   B . n 
B 1 7   GLU 7   4   4   GLU GLU B . n 
B 1 8   ASP 8   5   5   ASP ASP B . n 
B 1 9   ALA 9   6   6   ALA ALA B . n 
B 1 10  GLU 10  7   7   GLU GLU B . n 
B 1 11  LEU 11  8   8   LEU LEU B . n 
B 1 12  LEU 12  9   9   LEU LEU B . n 
B 1 13  VAL 13  10  10  VAL VAL B . n 
B 1 14  THR 14  11  11  THR THR B . n 
B 1 15  VAL 15  12  12  VAL VAL B . n 
B 1 16  ARG 16  13  13  ARG ARG B . n 
B 1 17  GLY 17  14  14  GLY GLY B . n 
B 1 18  GLY 18  15  15  GLY GLY B . n 
B 1 19  ARG 19  16  16  ARG ARG B . n 
B 1 20  LEU 20  17  17  LEU LEU B . n 
B 1 21  ARG 21  18  18  ARG ARG B . n 
B 1 22  GLY 22  19  19  GLY GLY B . n 
B 1 23  ILE 23  20  20  ILE ILE B . n 
B 1 24  ARG 24  21  21  ARG ARG B . n 
B 1 25  LEU 25  22  22  LEU LEU B . n 
B 1 26  LYS 26  23  23  LYS LYS B . n 
B 1 27  THR 27  24  24  THR THR B . n 
B 1 28  PRO 28  25  25  PRO PRO B . n 
B 1 29  GLY 29  26  26  GLY GLY B . n 
B 1 30  GLY 30  27  27  GLY GLY B . n 
B 1 31  PRO 31  28  28  PRO PRO B . n 
B 1 32  VAL 32  29  29  VAL VAL B . n 
B 1 33  SER 33  30  30  SER SER B . n 
B 1 34  ALA 34  31  31  ALA ALA B . n 
B 1 35  PHE 35  32  32  PHE PHE B . n 
B 1 36  LEU 36  33  33  LEU LEU B . n 
B 1 37  GLY 37  34  34  GLY GLY B . n 
B 1 38  ILE 38  35  35  ILE ILE B . n 
B 1 39  PRO 39  36  36  PRO PRO B . n 
B 1 40  PHE 40  37  37  PHE PHE B . n 
B 1 41  ALA 41  38  38  ALA ALA B . n 
B 1 42  GLU 42  39  39  GLU GLU B . n 
B 1 43  PRO 43  40  40  PRO PRO B . n 
B 1 44  PRO 44  41  41  PRO PRO B . n 
B 1 45  MET 45  42  42  MET MET B . n 
B 1 46  GLY 46  43  43  GLY GLY B . n 
B 1 47  PRO 47  44  44  PRO PRO B . n 
B 1 48  ARG 48  45  45  ARG ARG B . n 
B 1 49  ARG 49  46  46  ARG ARG B . n 
B 1 50  PHE 50  47  47  PHE PHE B . n 
B 1 51  LEU 51  48  48  LEU LEU B . n 
B 1 52  PRO 52  49  49  PRO PRO B . n 
B 1 53  PRO 53  50  50  PRO PRO B . n 
B 1 54  GLU 54  51  51  GLU GLU B . n 
B 1 55  PRO 55  52  52  PRO PRO B . n 
B 1 56  LYS 56  53  53  LYS LYS B . n 
B 1 57  GLN 57  54  54  GLN GLN B . n 
B 1 58  PRO 58  55  55  PRO PRO B . n 
B 1 59  TRP 59  56  56  TRP TRP B . n 
B 1 60  SER 60  57  57  SER SER B . n 
B 1 61  GLY 61  58  58  GLY GLY B . n 
B 1 62  VAL 62  59  59  VAL VAL B . n 
B 1 63  VAL 63  60  60  VAL VAL B . n 
B 1 64  ASP 64  61  61  ASP ASP B . n 
B 1 65  ALA 65  62  62  ALA ALA B . n 
B 1 66  THR 66  63  63  THR THR B . n 
B 1 67  THR 67  64  64  THR THR B . n 
B 1 68  PHE 68  65  65  PHE PHE B . n 
B 1 69  GLN 69  66  66  GLN GLN B . n 
B 1 70  SER 70  67  67  SER SER B . n 
B 1 71  VAL 71  68  68  VAL VAL B . n 
B 1 72  CYS 72  69  69  CYS CYS B . n 
B 1 73  TYR 73  70  70  TYR TYR B . n 
B 1 74  GLN 74  71  71  GLN GLN B . n 
B 1 75  TYR 75  72  72  TYR TYR B . n 
B 1 76  VAL 76  73  73  VAL VAL B . n 
B 1 77  ASP 77  74  74  ASP ASP B . n 
B 1 78  THR 78  75  75  THR THR B . n 
B 1 79  LEU 79  76  76  LEU LEU B . n 
B 1 80  TYR 80  77  77  TYR TYR B . n 
B 1 81  PRO 81  78  78  PRO PRO B . n 
B 1 82  GLY 82  79  79  GLY GLY B . n 
B 1 83  PHE 83  80  80  PHE PHE B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  GLY 85  82  82  GLY GLY B . n 
B 1 86  THR 86  83  83  THR THR B . n 
B 1 87  GLU 87  84  84  GLU GLU B . n 
B 1 88  MET 88  85  85  MET MET B . n 
B 1 89  TRP 89  86  86  TRP TRP B . n 
B 1 90  ASN 90  87  87  ASN ASN B . n 
B 1 91  PRO 91  88  88  PRO PRO B . n 
B 1 92  ASN 92  89  89  ASN ASN B . n 
B 1 93  ARG 93  90  90  ARG ARG B . n 
B 1 94  GLU 94  91  91  GLU GLU B . n 
B 1 95  LEU 95  92  92  LEU LEU B . n 
B 1 96  SER 96  93  93  SER SER B . n 
B 1 97  GLU 97  94  94  GLU GLU B . n 
B 1 98  ASP 98  95  95  ASP ASP B . n 
B 1 99  CYS 99  96  96  CYS CYS B . n 
B 1 100 LEU 100 97  97  LEU LEU B . n 
B 1 101 TYR 101 98  98  TYR TYR B . n 
B 1 102 LEU 102 99  99  LEU LEU B . n 
B 1 103 ASN 103 100 100 ASN ASN B . n 
B 1 104 VAL 104 101 101 VAL VAL B . n 
B 1 105 TRP 105 102 102 TRP TRP B . n 
B 1 106 THR 106 103 103 THR THR B . n 
B 1 107 PRO 107 104 104 PRO PRO B . n 
B 1 108 TYR 108 105 105 TYR TYR B . n 
B 1 109 PRO 109 106 106 PRO PRO B . n 
B 1 110 ARG 110 107 107 ARG ARG B . n 
B 1 111 PRO 111 108 108 PRO PRO B . n 
B 1 112 THR 112 109 109 THR THR B . n 
B 1 113 SER 113 110 110 SER SER B . n 
B 1 114 PRO 114 111 111 PRO PRO B . n 
B 1 115 THR 115 112 112 THR THR B . n 
B 1 116 PRO 116 113 113 PRO PRO B . n 
B 1 117 VAL 117 114 114 VAL VAL B . n 
B 1 118 LEU 118 115 115 LEU LEU B . n 
B 1 119 VAL 119 116 116 VAL VAL B . n 
B 1 120 TRP 120 117 117 TRP TRP B . n 
B 1 121 ILE 121 118 118 ILE ILE B . n 
B 1 122 TYR 122 119 119 TYR TYR B . n 
B 1 123 GLY 123 120 120 GLY GLY B . n 
B 1 124 GLY 124 121 121 GLY GLY B . n 
B 1 125 GLY 125 122 122 GLY GLY B . n 
B 1 126 PHE 126 123 123 PHE PHE B . n 
B 1 127 TYR 127 124 124 TYR TYR B . n 
B 1 128 SER 128 125 125 SER SER B . n 
B 1 129 GLY 129 126 126 GLY GLY B . n 
B 1 130 ALA 130 127 127 ALA ALA B . n 
B 1 131 SER 131 128 128 SER SER B . n 
B 1 132 SER 132 129 129 SER SER B . n 
B 1 133 LEU 133 130 130 LEU LEU B . n 
B 1 134 ASP 134 131 131 ASP ASP B . n 
B 1 135 VAL 135 132 132 VAL VAL B . n 
B 1 136 TYR 136 133 133 TYR TYR B . n 
B 1 137 ASP 137 134 134 ASP ASP B . n 
B 1 138 GLY 138 135 135 GLY GLY B . n 
B 1 139 ARG 139 136 136 ARG ARG B . n 
B 1 140 PHE 140 137 137 PHE PHE B . n 
B 1 141 LEU 141 138 138 LEU LEU B . n 
B 1 142 VAL 142 139 139 VAL VAL B . n 
B 1 143 GLN 143 140 140 GLN GLN B . n 
B 1 144 ALA 144 141 141 ALA ALA B . n 
B 1 145 GLU 145 142 142 GLU GLU B . n 
B 1 146 ARG 146 143 143 ARG ARG B . n 
B 1 147 THR 147 144 144 THR THR B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 LEU 149 146 146 LEU LEU B . n 
B 1 150 VAL 150 147 147 VAL VAL B . n 
B 1 151 SER 151 148 148 SER SER B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 ASN 153 150 150 ASN ASN B . n 
B 1 154 TYR 154 151 151 TYR TYR B . n 
B 1 155 ARG 155 152 152 ARG ARG B . n 
B 1 156 VAL 156 153 153 VAL VAL B . n 
B 1 157 GLY 157 154 154 GLY GLY B . n 
B 1 158 ALA 158 155 155 ALA ALA B . n 
B 1 159 PHE 159 156 156 PHE PHE B . n 
B 1 160 GLY 160 157 157 GLY GLY B . n 
B 1 161 PHE 161 158 158 PHE PHE B . n 
B 1 162 LEU 162 159 159 LEU LEU B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 LEU 164 161 161 LEU LEU B . n 
B 1 165 PRO 165 162 162 PRO PRO B . n 
B 1 166 GLY 166 163 163 GLY GLY B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ARG 168 165 165 ARG ARG B . n 
B 1 169 GLU 169 166 166 GLU GLU B . n 
B 1 170 ALA 170 167 167 ALA ALA B . n 
B 1 171 PRO 171 168 168 PRO PRO B . n 
B 1 172 GLY 172 169 169 GLY GLY B . n 
B 1 173 ASN 173 170 170 ASN ASN B . n 
B 1 174 VAL 174 171 171 VAL VAL B . n 
B 1 175 GLY 175 172 172 GLY GLY B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 LEU 177 174 174 LEU LEU B . n 
B 1 178 ASP 178 175 175 ASP ASP B . n 
B 1 179 GLN 179 176 176 GLN GLN B . n 
B 1 180 ARG 180 177 177 ARG ARG B . n 
B 1 181 LEU 181 178 178 LEU LEU B . n 
B 1 182 ALA 182 179 179 ALA ALA B . n 
B 1 183 LEU 183 180 180 LEU LEU B . n 
B 1 184 GLN 184 181 181 GLN GLN B . n 
B 1 185 TRP 185 182 182 TRP TRP B . n 
B 1 186 VAL 186 183 183 VAL VAL B . n 
B 1 187 GLN 187 184 184 GLN GLN B . n 
B 1 188 GLU 188 185 185 GLU GLU B . n 
B 1 189 ASN 189 186 186 ASN ASN B . n 
B 1 190 VAL 190 187 187 VAL VAL B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 GLY 194 191 191 GLY GLY B . n 
B 1 195 GLY 195 192 192 GLY GLY B . n 
B 1 196 ASP 196 193 193 ASP ASP B . n 
B 1 197 PRO 197 194 194 PRO PRO B . n 
B 1 198 THR 198 195 195 THR THR B . n 
B 1 199 SER 199 196 196 SER SER B . n 
B 1 200 VAL 200 197 197 VAL VAL B . n 
B 1 201 THR 201 198 198 THR THR B . n 
B 1 202 LEU 202 199 199 LEU LEU B . n 
B 1 203 PHE 203 200 200 PHE PHE B . n 
B 1 204 GLY 204 201 201 GLY GLY B . n 
B 1 205 GLU 205 202 202 GLU GLU B . n 
B 1 206 SVX 206 203 203 SVX SVX B . n 
B 1 207 ALA 207 204 204 ALA ALA B . n 
B 1 208 GLY 208 205 205 GLY GLY B . n 
B 1 209 ALA 209 206 206 ALA ALA B . n 
B 1 210 ALA 210 207 207 ALA ALA B . n 
B 1 211 SER 211 208 208 SER SER B . n 
B 1 212 VAL 212 209 209 VAL VAL B . n 
B 1 213 GLY 213 210 210 GLY GLY B . n 
B 1 214 MET 214 211 211 MET MET B . n 
B 1 215 HIS 215 212 212 HIS HIS B . n 
B 1 216 LEU 216 213 213 LEU LEU B . n 
B 1 217 LEU 217 214 214 LEU LEU B . n 
B 1 218 SER 218 215 215 SER SER B . n 
B 1 219 PRO 219 216 216 PRO PRO B . n 
B 1 220 PRO 220 217 217 PRO PRO B . n 
B 1 221 SER 221 218 218 SER SER B . n 
B 1 222 ARG 222 219 219 ARG ARG B . n 
B 1 223 GLY 223 220 220 GLY GLY B . n 
B 1 224 LEU 224 221 221 LEU LEU B . n 
B 1 225 PHE 225 222 222 PHE PHE B . n 
B 1 226 HIS 226 223 223 HIS HIS B . n 
B 1 227 ARG 227 224 224 ARG ARG B . n 
B 1 228 ALA 228 225 225 ALA ALA B . n 
B 1 229 VAL 229 226 226 VAL VAL B . n 
B 1 230 LEU 230 227 227 LEU LEU B . n 
B 1 231 GLN 231 228 228 GLN GLN B . n 
B 1 232 SER 232 229 229 SER SER B . n 
B 1 233 GLY 233 230 230 GLY GLY B . n 
B 1 234 ALA 234 231 231 ALA ALA B . n 
B 1 235 PRO 235 232 232 PRO PRO B . n 
B 1 236 ASN 236 233 233 ASN ASN B . n 
B 1 237 GLY 237 234 234 GLY GLY B . n 
B 1 238 PRO 238 235 235 PRO PRO B . n 
B 1 239 TRP 239 236 236 TRP TRP B . n 
B 1 240 ALA 240 237 237 ALA ALA B . n 
B 1 241 THR 241 238 238 THR THR B . n 
B 1 242 VAL 242 239 239 VAL VAL B . n 
B 1 243 GLY 243 240 240 GLY GLY B . n 
B 1 244 MET 244 241 241 MET MET B . n 
B 1 245 GLY 245 242 242 GLY GLY B . n 
B 1 246 GLU 246 243 243 GLU GLU B . n 
B 1 247 ALA 247 244 244 ALA ALA B . n 
B 1 248 ARG 248 245 245 ARG ARG B . n 
B 1 249 ARG 249 246 246 ARG ARG B . n 
B 1 250 ARG 250 247 247 ARG ARG B . n 
B 1 251 ALA 251 248 248 ALA ALA B . n 
B 1 252 THR 252 249 249 THR THR B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 HIS 256 253 253 HIS HIS B . n 
B 1 257 LEU 257 254 254 LEU LEU B . n 
B 1 258 VAL 258 255 255 VAL VAL B . n 
B 1 259 GLY 259 256 256 GLY GLY B . n 
B 1 260 CYS 260 257 257 CYS CYS B . n 
B 1 261 PRO 261 258 258 PRO PRO B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 GLY 263 260 260 GLY GLY B . n 
B 1 264 GLY 264 261 261 GLY GLY B . n 
B 1 265 THR 265 262 262 THR THR B . n 
B 1 266 GLY 266 263 263 GLY GLY B . n 
B 1 267 GLY 267 264 264 GLY GLY B . n 
B 1 268 ASN 268 265 265 ASN ASN B . n 
B 1 269 ASP 269 266 266 ASP ASP B . n 
B 1 270 THR 270 267 267 THR THR B . n 
B 1 271 GLU 271 268 268 GLU GLU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 VAL 273 270 270 VAL VAL B . n 
B 1 274 ALA 274 271 271 ALA ALA B . n 
B 1 275 CYS 275 272 272 CYS CYS B . n 
B 1 276 LEU 276 273 273 LEU LEU B . n 
B 1 277 ARG 277 274 274 ARG ARG B . n 
B 1 278 THR 278 275 275 THR THR B . n 
B 1 279 ARG 279 276 276 ARG ARG B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 ALA 281 278 278 ALA ALA B . n 
B 1 282 GLN 282 279 279 GLN GLN B . n 
B 1 283 VAL 283 280 280 VAL VAL B . n 
B 1 284 LEU 284 281 281 LEU LEU B . n 
B 1 285 VAL 285 282 282 VAL VAL B . n 
B 1 286 ASN 286 283 283 ASN ASN B . n 
B 1 287 HIS 287 284 284 HIS HIS B . n 
B 1 288 GLU 288 285 285 GLU GLU B . n 
B 1 289 TRP 289 286 286 TRP TRP B . n 
B 1 290 HIS 290 287 287 HIS HIS B . n 
B 1 291 VAL 291 288 288 VAL VAL B . n 
B 1 292 LEU 292 289 289 LEU LEU B . n 
B 1 293 PRO 293 290 290 PRO PRO B . n 
B 1 294 GLN 294 291 291 GLN GLN B . n 
B 1 295 GLU 295 292 292 GLU GLU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 VAL 297 294 294 VAL VAL B . n 
B 1 298 PHE 298 295 295 PHE PHE B . n 
B 1 299 ARG 299 296 296 ARG ARG B . n 
B 1 300 PHE 300 297 297 PHE PHE B . n 
B 1 301 SER 301 298 298 SER SER B . n 
B 1 302 PHE 302 299 299 PHE PHE B . n 
B 1 303 VAL 303 300 300 VAL VAL B . n 
B 1 304 PRO 304 301 301 PRO PRO B . n 
B 1 305 VAL 305 302 302 VAL VAL B . n 
B 1 306 VAL 306 303 303 VAL VAL B . n 
B 1 307 ASP 307 304 304 ASP ASP B . n 
B 1 308 GLY 308 305 305 GLY GLY B . n 
B 1 309 ASP 309 306 306 ASP ASP B . n 
B 1 310 PHE 310 307 307 PHE PHE B . n 
B 1 311 LEU 311 308 308 LEU LEU B . n 
B 1 312 SER 312 309 309 SER SER B . n 
B 1 313 ASP 313 310 310 ASP ASP B . n 
B 1 314 THR 314 311 311 THR THR B . n 
B 1 315 PRO 315 312 312 PRO PRO B . n 
B 1 316 GLU 316 313 313 GLU GLU B . n 
B 1 317 ALA 317 314 314 ALA ALA B . n 
B 1 318 LEU 318 315 315 LEU LEU B . n 
B 1 319 ILE 319 316 316 ILE ILE B . n 
B 1 320 ASN 320 317 317 ASN ASN B . n 
B 1 321 ALA 321 318 318 ALA ALA B . n 
B 1 322 GLY 322 319 319 GLY GLY B . n 
B 1 323 ASP 323 320 320 ASP ASP B . n 
B 1 324 PHE 324 321 321 PHE PHE B . n 
B 1 325 HIS 325 322 322 HIS HIS B . n 
B 1 326 GLY 326 323 323 GLY GLY B . n 
B 1 327 LEU 327 324 324 LEU LEU B . n 
B 1 328 GLN 328 325 325 GLN GLN B . n 
B 1 329 VAL 329 326 326 VAL VAL B . n 
B 1 330 LEU 330 327 327 LEU LEU B . n 
B 1 331 VAL 331 328 328 VAL VAL B . n 
B 1 332 GLY 332 329 329 GLY GLY B . n 
B 1 333 VAL 333 330 330 VAL VAL B . n 
B 1 334 VAL 334 331 331 VAL VAL B . n 
B 1 335 LYS 335 332 332 LYS LYS B . n 
B 1 336 ASP 336 333 333 ASP ASP B . n 
B 1 337 GLU 337 334 334 GLU GLU B . n 
B 1 338 GLY 338 335 335 GLY GLY B . n 
B 1 339 SER 339 336 336 SER SER B . n 
B 1 340 TYR 340 337 337 TYR TYR B . n 
B 1 341 PHE 341 338 338 PHE PHE B . n 
B 1 342 LEU 342 339 339 LEU LEU B . n 
B 1 343 VAL 343 340 340 VAL VAL B . n 
B 1 344 TYR 344 341 341 TYR TYR B . n 
B 1 345 GLY 345 342 342 GLY GLY B . n 
B 1 346 ALA 346 343 343 ALA ALA B . n 
B 1 347 PRO 347 344 344 PRO PRO B . n 
B 1 348 GLY 348 345 345 GLY GLY B . n 
B 1 349 PHE 349 346 346 PHE PHE B . n 
B 1 350 SER 350 347 347 SER SER B . n 
B 1 351 LYS 351 348 348 LYS LYS B . n 
B 1 352 ASP 352 349 349 ASP ASP B . n 
B 1 353 ASN 353 350 350 ASN ASN B . n 
B 1 354 GLU 354 351 351 GLU GLU B . n 
B 1 355 SER 355 352 352 SER SER B . n 
B 1 356 LEU 356 353 353 LEU LEU B . n 
B 1 357 ILE 357 354 354 ILE ILE B . n 
B 1 358 SER 358 355 355 SER SER B . n 
B 1 359 ARG 359 356 356 ARG ARG B . n 
B 1 360 ALA 360 357 357 ALA ALA B . n 
B 1 361 GLU 361 358 358 GLU GLU B . n 
B 1 362 PHE 362 359 359 PHE PHE B . n 
B 1 363 LEU 363 360 360 LEU LEU B . n 
B 1 364 ALA 364 361 361 ALA ALA B . n 
B 1 365 GLY 365 362 362 GLY GLY B . n 
B 1 366 VAL 366 363 363 VAL VAL B . n 
B 1 367 ARG 367 364 364 ARG ARG B . n 
B 1 368 VAL 368 365 365 VAL VAL B . n 
B 1 369 GLY 369 366 366 GLY GLY B . n 
B 1 370 VAL 370 367 367 VAL VAL B . n 
B 1 371 PRO 371 368 368 PRO PRO B . n 
B 1 372 GLN 372 369 369 GLN GLN B . n 
B 1 373 VAL 373 370 370 VAL VAL B . n 
B 1 374 SER 374 371 371 SER SER B . n 
B 1 375 ASP 375 372 372 ASP ASP B . n 
B 1 376 LEU 376 373 373 LEU LEU B . n 
B 1 377 ALA 377 374 374 ALA ALA B . n 
B 1 378 ALA 378 375 375 ALA ALA B . n 
B 1 379 GLU 379 376 376 GLU GLU B . n 
B 1 380 ALA 380 377 377 ALA ALA B . n 
B 1 381 VAL 381 378 378 VAL VAL B . n 
B 1 382 VAL 382 379 379 VAL VAL B . n 
B 1 383 LEU 383 380 380 LEU LEU B . n 
B 1 384 HIS 384 381 381 HIS HIS B . n 
B 1 385 TYR 385 382 382 TYR TYR B . n 
B 1 386 THR 386 383 383 THR THR B . n 
B 1 387 ASP 387 384 384 ASP ASP B . n 
B 1 388 TRP 388 385 385 TRP TRP B . n 
B 1 389 LEU 389 386 386 LEU LEU B . n 
B 1 390 HIS 390 387 387 HIS HIS B . n 
B 1 391 PRO 391 388 388 PRO PRO B . n 
B 1 392 GLU 392 389 389 GLU GLU B . n 
B 1 393 ASP 393 390 390 ASP ASP B . n 
B 1 394 PRO 394 391 391 PRO PRO B . n 
B 1 395 ALA 395 392 392 ALA ALA B . n 
B 1 396 ARG 396 393 393 ARG ARG B . n 
B 1 397 LEU 397 394 394 LEU LEU B . n 
B 1 398 ARG 398 395 395 ARG ARG B . n 
B 1 399 GLU 399 396 396 GLU GLU B . n 
B 1 400 ALA 400 397 397 ALA ALA B . n 
B 1 401 LEU 401 398 398 LEU LEU B . n 
B 1 402 SER 402 399 399 SER SER B . n 
B 1 403 ASP 403 400 400 ASP ASP B . n 
B 1 404 VAL 404 401 401 VAL VAL B . n 
B 1 405 VAL 405 402 402 VAL VAL B . n 
B 1 406 GLY 406 403 403 GLY GLY B . n 
B 1 407 ASP 407 404 404 ASP ASP B . n 
B 1 408 HIS 408 405 405 HIS HIS B . n 
B 1 409 ASN 409 406 406 ASN ASN B . n 
B 1 410 VAL 410 407 407 VAL VAL B . n 
B 1 411 VAL 411 408 408 VAL VAL B . n 
B 1 412 CYS 412 409 409 CYS CYS B . n 
B 1 413 PRO 413 410 410 PRO PRO B . n 
B 1 414 VAL 414 411 411 VAL VAL B . n 
B 1 415 ALA 415 412 412 ALA ALA B . n 
B 1 416 GLN 416 413 413 GLN GLN B . n 
B 1 417 LEU 417 414 414 LEU LEU B . n 
B 1 418 ALA 418 415 415 ALA ALA B . n 
B 1 419 GLY 419 416 416 GLY GLY B . n 
B 1 420 ARG 420 417 417 ARG ARG B . n 
B 1 421 LEU 421 418 418 LEU LEU B . n 
B 1 422 ALA 422 419 419 ALA ALA B . n 
B 1 423 ALA 423 420 420 ALA ALA B . n 
B 1 424 GLN 424 421 421 GLN GLN B . n 
B 1 425 GLY 425 422 422 GLY GLY B . n 
B 1 426 ALA 426 423 423 ALA ALA B . n 
B 1 427 ARG 427 424 424 ARG ARG B . n 
B 1 428 VAL 428 425 425 VAL VAL B . n 
B 1 429 TYR 429 426 426 TYR TYR B . n 
B 1 430 ALA 430 427 427 ALA ALA B . n 
B 1 431 TYR 431 428 428 TYR TYR B . n 
B 1 432 VAL 432 429 429 VAL VAL B . n 
B 1 433 PHE 433 430 430 PHE PHE B . n 
B 1 434 GLU 434 431 431 GLU GLU B . n 
B 1 435 HIS 435 432 432 HIS HIS B . n 
B 1 436 ARG 436 433 433 ARG ARG B . n 
B 1 437 ALA 437 434 434 ALA ALA B . n 
B 1 438 SER 438 435 435 SER SER B . n 
B 1 439 THR 439 436 436 THR THR B . n 
B 1 440 LEU 440 437 437 LEU LEU B . n 
B 1 441 SER 441 438 438 SER SER B . n 
B 1 442 TRP 442 439 439 TRP TRP B . n 
B 1 443 PRO 443 440 440 PRO PRO B . n 
B 1 444 LEU 444 441 441 LEU LEU B . n 
B 1 445 TRP 445 442 442 TRP TRP B . n 
B 1 446 MET 446 443 443 MET MET B . n 
B 1 447 GLY 447 444 444 GLY GLY B . n 
B 1 448 VAL 448 445 445 VAL VAL B . n 
B 1 449 PRO 449 446 446 PRO PRO B . n 
B 1 450 HIS 450 447 447 HIS HIS B . n 
B 1 451 GLY 451 448 448 GLY GLY B . n 
B 1 452 TYR 452 449 449 TYR TYR B . n 
B 1 453 GLU 453 450 450 GLU GLU B . n 
B 1 454 ILE 454 451 451 ILE ILE B . n 
B 1 455 GLU 455 452 452 GLU GLU B . n 
B 1 456 PHE 456 453 453 PHE PHE B . n 
B 1 457 ILE 457 454 454 ILE ILE B . n 
B 1 458 PHE 458 455 455 PHE PHE B . n 
B 1 459 GLY 459 456 456 GLY GLY B . n 
B 1 460 ILE 460 457 457 ILE ILE B . n 
B 1 461 PRO 461 458 458 PRO PRO B . n 
B 1 462 LEU 462 459 459 LEU LEU B . n 
B 1 463 ASP 463 460 460 ASP ASP B . n 
B 1 464 PRO 464 461 461 PRO PRO B . n 
B 1 465 SER 465 462 462 SER SER B . n 
B 1 466 ARG 466 463 463 ARG ARG B . n 
B 1 467 ASN 467 464 464 ASN ASN B . n 
B 1 468 TYR 468 465 465 TYR TYR B . n 
B 1 469 THR 469 466 466 THR THR B . n 
B 1 470 ALA 470 467 467 ALA ALA B . n 
B 1 471 GLU 471 468 468 GLU GLU B . n 
B 1 472 GLU 472 469 469 GLU GLU B . n 
B 1 473 LYS 473 470 470 LYS LYS B . n 
B 1 474 ILE 474 471 471 ILE ILE B . n 
B 1 475 PHE 475 472 472 PHE PHE B . n 
B 1 476 ALA 476 473 473 ALA ALA B . n 
B 1 477 GLN 477 474 474 GLN GLN B . n 
B 1 478 ARG 478 475 475 ARG ARG B . n 
B 1 479 LEU 479 476 476 LEU LEU B . n 
B 1 480 MET 480 477 477 MET MET B . n 
B 1 481 ARG 481 478 478 ARG ARG B . n 
B 1 482 TYR 482 479 479 TYR TYR B . n 
B 1 483 TRP 483 480 480 TRP TRP B . n 
B 1 484 ALA 484 481 481 ALA ALA B . n 
B 1 485 ASN 485 482 482 ASN ASN B . n 
B 1 486 PHE 486 483 483 PHE PHE B . n 
B 1 487 ALA 487 484 484 ALA ALA B . n 
B 1 488 ARG 488 485 485 ARG ARG B . n 
B 1 489 THR 489 486 486 THR THR B . n 
B 1 490 GLY 490 487 487 GLY GLY B . n 
B 1 491 ASP 491 488 488 ASP ASP B . n 
B 1 492 PRO 492 489 489 PRO PRO B . n 
B 1 493 ASN 493 490 490 ASN ASN B . n 
B 1 494 GLU 494 491 491 GLU GLU B . n 
B 1 495 PRO 495 492 492 PRO PRO B . n 
B 1 496 ARG 496 493 493 ARG ARG B . n 
B 1 497 ASP 497 494 494 ASP ASP B . n 
B 1 498 PRO 498 495 495 PRO PRO B . n 
B 1 499 LYS 499 496 496 LYS LYS B . n 
B 1 500 ALA 500 497 497 ALA ALA B . n 
B 1 501 PRO 501 498 498 PRO PRO B . n 
B 1 502 GLN 502 499 499 GLN GLN B . n 
B 1 503 TRP 503 500 500 TRP TRP B . n 
B 1 504 PRO 504 501 501 PRO PRO B . n 
B 1 505 PRO 505 502 502 PRO PRO B . n 
B 1 506 TYR 506 503 503 TYR TYR B . n 
B 1 507 THR 507 504 504 THR THR B . n 
B 1 508 ALA 508 505 505 ALA ALA B . n 
B 1 509 GLY 509 506 506 GLY GLY B . n 
B 1 510 ALA 510 507 507 ALA ALA B . n 
B 1 511 GLN 511 508 508 GLN GLN B . n 
B 1 512 GLN 512 509 509 GLN GLN B . n 
B 1 513 TYR 513 510 510 TYR TYR B . n 
B 1 514 VAL 514 511 511 VAL VAL B . n 
B 1 515 SER 515 512 512 SER SER B . n 
B 1 516 LEU 516 513 513 LEU LEU B . n 
B 1 517 ASP 517 514 514 ASP ASP B . n 
B 1 518 LEU 518 515 515 LEU LEU B . n 
B 1 519 ARG 519 516 516 ARG ARG B . n 
B 1 520 PRO 520 517 517 PRO PRO B . n 
B 1 521 LEU 521 518 518 LEU LEU B . n 
B 1 522 GLU 522 519 519 GLU GLU B . n 
B 1 523 VAL 523 520 520 VAL VAL B . n 
B 1 524 ARG 524 521 521 ARG ARG B . n 
B 1 525 ARG 525 522 522 ARG ARG B . n 
B 1 526 GLY 526 523 523 GLY GLY B . n 
B 1 527 LEU 527 524 524 LEU LEU B . n 
B 1 528 ARG 528 525 525 ARG ARG B . n 
B 1 529 ALA 529 526 526 ALA ALA B . n 
B 1 530 GLN 530 527 527 GLN GLN B . n 
B 1 531 ALA 531 528 528 ALA ALA B . n 
B 1 532 CYS 532 529 529 CYS CYS B . n 
B 1 533 ALA 533 530 530 ALA ALA B . n 
B 1 534 PHE 534 531 531 PHE PHE B . n 
B 1 535 TRP 535 532 532 TRP TRP B . n 
B 1 536 ASN 536 533 533 ASN ASN B . n 
B 1 537 ARG 537 534 534 ARG ARG B . n 
B 1 538 PHE 538 535 535 PHE PHE B . n 
B 1 539 LEU 539 536 536 LEU LEU B . n 
B 1 540 PRO 540 537 537 PRO PRO B . n 
B 1 541 LYS 541 538 538 LYS LYS B . n 
B 1 542 LEU 542 539 539 LEU LEU B . n 
B 1 543 LEU 543 540 540 LEU LEU B . n 
B 1 544 SER 544 541 541 SER SER B . n 
B 1 545 ALA 545 542 542 ALA ALA B . n 
B 1 546 THR 546 543 543 THR THR B . n 
B 1 547 ASP 547 544 ?   ?   ?   B . n 
B 1 548 THR 548 545 ?   ?   ?   B . n 
B 1 549 LEU 549 546 ?   ?   ?   B . n 
B 1 550 ASP 550 547 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 LND 1   601 2   LND DRG A . 
D 3 GOL 1   602 662 GOL GOL A . 
E 3 GOL 1   603 663 GOL GOL A . 
F 3 GOL 1   604 667 GOL GOL A . 
G 3 GOL 1   605 668 GOL GOL A . 
H 3 GOL 1   606 671 GOL GOL A . 
I 2 LND 1   601 3   LND DRG B . 
J 3 GOL 1   602 664 GOL GOL B . 
K 3 GOL 1   603 665 GOL GOL B . 
L 3 GOL 1   604 669 GOL GOL B . 
M 3 GOL 1   605 670 GOL GOL B . 
N 3 GOL 1   606 672 GOL GOL B . 
O 4 HOH 1   701 182 HOH HOH A . 
O 4 HOH 2   702 131 HOH HOH A . 
O 4 HOH 3   703 191 HOH HOH A . 
O 4 HOH 4   704 4   HOH HOH A . 
O 4 HOH 5   705 2   HOH HOH A . 
O 4 HOH 6   706 215 HOH HOH A . 
O 4 HOH 7   707 161 HOH HOH A . 
O 4 HOH 8   708 8   HOH HOH A . 
O 4 HOH 9   709 63  HOH HOH A . 
O 4 HOH 10  710 77  HOH HOH A . 
O 4 HOH 11  711 17  HOH HOH A . 
O 4 HOH 12  712 109 HOH HOH A . 
O 4 HOH 13  713 19  HOH HOH A . 
O 4 HOH 14  714 143 HOH HOH A . 
O 4 HOH 15  715 118 HOH HOH A . 
O 4 HOH 16  716 38  HOH HOH A . 
O 4 HOH 17  717 124 HOH HOH A . 
O 4 HOH 18  718 52  HOH HOH A . 
O 4 HOH 19  719 12  HOH HOH A . 
O 4 HOH 20  720 61  HOH HOH A . 
O 4 HOH 21  721 117 HOH HOH A . 
O 4 HOH 22  722 81  HOH HOH A . 
O 4 HOH 23  723 125 HOH HOH A . 
O 4 HOH 24  724 164 HOH HOH A . 
O 4 HOH 25  725 71  HOH HOH A . 
O 4 HOH 26  726 96  HOH HOH A . 
O 4 HOH 27  727 179 HOH HOH A . 
O 4 HOH 28  728 220 HOH HOH A . 
O 4 HOH 29  729 203 HOH HOH A . 
O 4 HOH 30  730 89  HOH HOH A . 
O 4 HOH 31  731 29  HOH HOH A . 
O 4 HOH 32  732 122 HOH HOH A . 
O 4 HOH 33  733 36  HOH HOH A . 
O 4 HOH 34  734 33  HOH HOH A . 
O 4 HOH 35  735 150 HOH HOH A . 
O 4 HOH 36  736 82  HOH HOH A . 
O 4 HOH 37  737 5   HOH HOH A . 
O 4 HOH 38  738 60  HOH HOH A . 
O 4 HOH 39  739 154 HOH HOH A . 
O 4 HOH 40  740 6   HOH HOH A . 
O 4 HOH 41  741 92  HOH HOH A . 
O 4 HOH 42  742 165 HOH HOH A . 
O 4 HOH 43  743 22  HOH HOH A . 
O 4 HOH 44  744 216 HOH HOH A . 
O 4 HOH 45  745 93  HOH HOH A . 
O 4 HOH 46  746 78  HOH HOH A . 
O 4 HOH 47  747 157 HOH HOH A . 
O 4 HOH 48  748 163 HOH HOH A . 
O 4 HOH 49  749 51  HOH HOH A . 
O 4 HOH 50  750 116 HOH HOH A . 
O 4 HOH 51  751 59  HOH HOH A . 
O 4 HOH 52  752 202 HOH HOH A . 
O 4 HOH 53  753 153 HOH HOH A . 
O 4 HOH 54  754 211 HOH HOH A . 
O 4 HOH 55  755 44  HOH HOH A . 
O 4 HOH 56  756 16  HOH HOH A . 
O 4 HOH 57  757 176 HOH HOH A . 
O 4 HOH 58  758 95  HOH HOH A . 
O 4 HOH 59  759 75  HOH HOH A . 
O 4 HOH 60  760 145 HOH HOH A . 
O 4 HOH 61  761 225 HOH HOH A . 
O 4 HOH 62  762 42  HOH HOH A . 
O 4 HOH 63  763 160 HOH HOH A . 
O 4 HOH 64  764 141 HOH HOH A . 
O 4 HOH 65  765 205 HOH HOH A . 
O 4 HOH 66  766 188 HOH HOH A . 
O 4 HOH 67  767 18  HOH HOH A . 
O 4 HOH 68  768 134 HOH HOH A . 
O 4 HOH 69  769 190 HOH HOH A . 
O 4 HOH 70  770 115 HOH HOH A . 
O 4 HOH 71  771 74  HOH HOH A . 
O 4 HOH 72  772 70  HOH HOH A . 
O 4 HOH 73  773 72  HOH HOH A . 
O 4 HOH 74  774 21  HOH HOH A . 
O 4 HOH 75  775 9   HOH HOH A . 
O 4 HOH 76  776 98  HOH HOH A . 
O 4 HOH 77  777 175 HOH HOH A . 
O 4 HOH 78  778 231 HOH HOH A . 
O 4 HOH 79  779 133 HOH HOH A . 
O 4 HOH 80  780 152 HOH HOH A . 
O 4 HOH 81  781 128 HOH HOH A . 
O 4 HOH 82  782 200 HOH HOH A . 
O 4 HOH 83  783 45  HOH HOH A . 
O 4 HOH 84  784 180 HOH HOH A . 
O 4 HOH 85  785 219 HOH HOH A . 
O 4 HOH 86  786 79  HOH HOH A . 
O 4 HOH 87  787 172 HOH HOH A . 
O 4 HOH 88  788 31  HOH HOH A . 
O 4 HOH 89  789 106 HOH HOH A . 
O 4 HOH 90  790 47  HOH HOH A . 
O 4 HOH 91  791 239 HOH HOH A . 
O 4 HOH 92  792 136 HOH HOH A . 
O 4 HOH 93  793 88  HOH HOH A . 
O 4 HOH 94  794 146 HOH HOH A . 
O 4 HOH 95  795 108 HOH HOH A . 
O 4 HOH 96  796 158 HOH HOH A . 
O 4 HOH 97  797 68  HOH HOH A . 
O 4 HOH 98  798 170 HOH HOH A . 
O 4 HOH 99  799 48  HOH HOH A . 
O 4 HOH 100 800 43  HOH HOH A . 
O 4 HOH 101 801 40  HOH HOH A . 
O 4 HOH 102 802 192 HOH HOH A . 
O 4 HOH 103 803 181 HOH HOH A . 
O 4 HOH 104 804 27  HOH HOH A . 
O 4 HOH 105 805 223 HOH HOH A . 
O 4 HOH 106 806 121 HOH HOH A . 
O 4 HOH 107 807 236 HOH HOH A . 
O 4 HOH 108 808 208 HOH HOH A . 
O 4 HOH 109 809 234 HOH HOH A . 
O 4 HOH 110 810 76  HOH HOH A . 
O 4 HOH 111 811 233 HOH HOH A . 
O 4 HOH 112 812 168 HOH HOH A . 
O 4 HOH 113 813 241 HOH HOH A . 
O 4 HOH 114 814 237 HOH HOH A . 
P 4 HOH 1   701 94  HOH HOH B . 
P 4 HOH 2   702 156 HOH HOH B . 
P 4 HOH 3   703 103 HOH HOH B . 
P 4 HOH 4   704 230 HOH HOH B . 
P 4 HOH 5   705 56  HOH HOH B . 
P 4 HOH 6   706 194 HOH HOH B . 
P 4 HOH 7   707 102 HOH HOH B . 
P 4 HOH 8   708 26  HOH HOH B . 
P 4 HOH 9   709 127 HOH HOH B . 
P 4 HOH 10  710 39  HOH HOH B . 
P 4 HOH 11  711 218 HOH HOH B . 
P 4 HOH 12  712 11  HOH HOH B . 
P 4 HOH 13  713 97  HOH HOH B . 
P 4 HOH 14  714 24  HOH HOH B . 
P 4 HOH 15  715 177 HOH HOH B . 
P 4 HOH 16  716 187 HOH HOH B . 
P 4 HOH 17  717 224 HOH HOH B . 
P 4 HOH 18  718 166 HOH HOH B . 
P 4 HOH 19  719 169 HOH HOH B . 
P 4 HOH 20  720 155 HOH HOH B . 
P 4 HOH 21  721 196 HOH HOH B . 
P 4 HOH 22  722 135 HOH HOH B . 
P 4 HOH 23  723 10  HOH HOH B . 
P 4 HOH 24  724 35  HOH HOH B . 
P 4 HOH 25  725 20  HOH HOH B . 
P 4 HOH 26  726 90  HOH HOH B . 
P 4 HOH 27  727 111 HOH HOH B . 
P 4 HOH 28  728 34  HOH HOH B . 
P 4 HOH 29  729 50  HOH HOH B . 
P 4 HOH 30  730 99  HOH HOH B . 
P 4 HOH 31  731 185 HOH HOH B . 
P 4 HOH 32  732 183 HOH HOH B . 
P 4 HOH 33  733 210 HOH HOH B . 
P 4 HOH 34  734 7   HOH HOH B . 
P 4 HOH 35  735 73  HOH HOH B . 
P 4 HOH 36  736 130 HOH HOH B . 
P 4 HOH 37  737 184 HOH HOH B . 
P 4 HOH 38  738 137 HOH HOH B . 
P 4 HOH 39  739 67  HOH HOH B . 
P 4 HOH 40  740 120 HOH HOH B . 
P 4 HOH 41  741 140 HOH HOH B . 
P 4 HOH 42  742 30  HOH HOH B . 
P 4 HOH 43  743 15  HOH HOH B . 
P 4 HOH 44  744 113 HOH HOH B . 
P 4 HOH 45  745 23  HOH HOH B . 
P 4 HOH 46  746 101 HOH HOH B . 
P 4 HOH 47  747 58  HOH HOH B . 
P 4 HOH 48  748 110 HOH HOH B . 
P 4 HOH 49  749 207 HOH HOH B . 
P 4 HOH 50  750 84  HOH HOH B . 
P 4 HOH 51  751 189 HOH HOH B . 
P 4 HOH 52  752 32  HOH HOH B . 
P 4 HOH 53  753 28  HOH HOH B . 
P 4 HOH 54  754 174 HOH HOH B . 
P 4 HOH 55  755 1   HOH HOH B . 
P 4 HOH 56  756 83  HOH HOH B . 
P 4 HOH 57  757 37  HOH HOH B . 
P 4 HOH 58  758 53  HOH HOH B . 
P 4 HOH 59  759 201 HOH HOH B . 
P 4 HOH 60  760 69  HOH HOH B . 
P 4 HOH 61  761 25  HOH HOH B . 
P 4 HOH 62  762 55  HOH HOH B . 
P 4 HOH 63  763 85  HOH HOH B . 
P 4 HOH 64  764 91  HOH HOH B . 
P 4 HOH 65  765 3   HOH HOH B . 
P 4 HOH 66  766 204 HOH HOH B . 
P 4 HOH 67  767 199 HOH HOH B . 
P 4 HOH 68  768 65  HOH HOH B . 
P 4 HOH 69  769 126 HOH HOH B . 
P 4 HOH 70  770 132 HOH HOH B . 
P 4 HOH 71  771 114 HOH HOH B . 
P 4 HOH 72  772 167 HOH HOH B . 
P 4 HOH 73  773 197 HOH HOH B . 
P 4 HOH 74  774 147 HOH HOH B . 
P 4 HOH 75  775 148 HOH HOH B . 
P 4 HOH 76  776 214 HOH HOH B . 
P 4 HOH 77  777 232 HOH HOH B . 
P 4 HOH 78  778 227 HOH HOH B . 
P 4 HOH 79  779 171 HOH HOH B . 
P 4 HOH 80  780 64  HOH HOH B . 
P 4 HOH 81  781 240 HOH HOH B . 
P 4 HOH 82  782 123 HOH HOH B . 
P 4 HOH 83  783 105 HOH HOH B . 
P 4 HOH 84  784 193 HOH HOH B . 
P 4 HOH 85  785 49  HOH HOH B . 
P 4 HOH 86  786 104 HOH HOH B . 
P 4 HOH 87  787 142 HOH HOH B . 
P 4 HOH 88  788 195 HOH HOH B . 
P 4 HOH 89  789 151 HOH HOH B . 
P 4 HOH 90  790 62  HOH HOH B . 
P 4 HOH 91  791 186 HOH HOH B . 
P 4 HOH 92  792 198 HOH HOH B . 
P 4 HOH 93  793 173 HOH HOH B . 
P 4 HOH 94  794 14  HOH HOH B . 
P 4 HOH 95  795 66  HOH HOH B . 
P 4 HOH 96  796 206 HOH HOH B . 
P 4 HOH 97  797 46  HOH HOH B . 
P 4 HOH 98  798 144 HOH HOH B . 
P 4 HOH 99  799 139 HOH HOH B . 
P 4 HOH 100 800 87  HOH HOH B . 
P 4 HOH 101 801 159 HOH HOH B . 
P 4 HOH 102 802 57  HOH HOH B . 
P 4 HOH 103 803 119 HOH HOH B . 
P 4 HOH 104 804 178 HOH HOH B . 
P 4 HOH 105 805 149 HOH HOH B . 
P 4 HOH 106 806 80  HOH HOH B . 
P 4 HOH 107 807 162 HOH HOH B . 
P 4 HOH 108 808 235 HOH HOH B . 
P 4 HOH 109 809 209 HOH HOH B . 
P 4 HOH 110 810 228 HOH HOH B . 
P 4 HOH 111 811 86  HOH HOH B . 
P 4 HOH 112 812 238 HOH HOH B . 
P 4 HOH 113 813 221 HOH HOH B . 
P 4 HOH 114 814 226 HOH HOH B . 
P 4 HOH 115 815 217 HOH HOH B . 
P 4 HOH 116 816 229 HOH HOH B . 
P 4 HOH 117 817 222 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SVX 206 A SVX 203 ? SER 'modified residue' 
2 B SVX 206 B SVX 203 ? SER 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,O 
1 2 B,I,J,K,L,M,N,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4570  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  38080 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 3_674 -x+y+1,-x+2,z-1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
-0.5000000000 0.0000000000 215.4238191914 0.0000000000 0.0000000000 1.0000000000 -43.1013333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-05-29 
2 'Structure model' 1 1 2019-06-12 
3 'Structure model' 1 2 2019-07-17 
4 'Structure model' 1 3 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Data collection'            
4 3 'Structure model' 'Database references'        
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 3 'Structure model' citation           
4 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_DOI'           
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
3 2 'Structure model' '_citation.title'                          
4 2 'Structure model' '_citation_author.identifier_ORCID'        
5 3 'Structure model' '_citation.journal_volume'                 
6 3 'Structure model' '_citation.page_first'                     
7 3 'Structure model' '_citation.page_last'                      
8 3 'Structure model' '_citation.title'                          
9 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                    4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SVX A 203 ? ? 52.02   -114.40 
2 1 ASP A 306 ? ? -101.40 -79.07  
3 1 VAL A 407 ? ? -126.01 -62.96  
4 1 ASN A 464 ? ? -106.79 53.57   
5 1 PHE B 158 ? ? -141.69 10.53   
6 1 SVX B 203 ? ? 51.70   -115.80 
7 1 ASP B 306 ? ? -100.33 -80.33  
8 1 VAL B 407 ? ? -123.70 -63.19  
9 1 ASN B 464 ? ? -108.41 44.76   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       817 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.83 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A PRO -1  ? A PRO 2   
3  1 Y 1 A LEU 0   ? A LEU 3   
4  1 Y 1 A GLU 1   ? A GLU 4   
5  1 Y 1 A GLY 2   ? A GLY 5   
6  1 Y 1 A ARG 3   ? A ARG 6   
7  1 Y 1 A ASP 544 ? A ASP 547 
8  1 Y 1 A THR 545 ? A THR 548 
9  1 Y 1 A LEU 546 ? A LEU 549 
10 1 Y 1 A ASP 547 ? A ASP 550 
11 1 Y 1 B GLY -2  ? B GLY 1   
12 1 Y 1 B PRO -1  ? B PRO 2   
13 1 Y 1 B LEU 0   ? B LEU 3   
14 1 Y 1 B GLU 1   ? B GLU 4   
15 1 Y 1 B GLY 2   ? B GLY 5   
16 1 Y 1 B ARG 3   ? B ARG 6   
17 1 Y 1 B ASP 544 ? B ASP 547 
18 1 Y 1 B THR 545 ? B THR 548 
19 1 Y 1 B LEU 546 ? B LEU 549 
20 1 Y 1 B ASP 547 ? B ASP 550 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           1U01NS083451 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-carbamoyl-1-(3-{2-[(E)-(hydroxyimino)methyl]-1H-imidazol-1-yl}propyl)pyridin-1-ium' LND 
3 GLYCEROL                                                                               GOL 
4 water                                                                                  HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#