data_6O81
# 
_entry.id   6O81 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6O81         
WWPDB D_1000238721 
EMDB  EMD-0649     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
;Electron cryo-microscopy of the eukaryotic translation initiation factor 2B bound to translation initiation factor 2 from Homo sapiens
;
_pdbx_database_related.db_id          EMD-0649 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6O81 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nguyen, H.' 1 ? 
'Kenner, L.' 2 ? 
'Frost, A.'  3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            364 
_citation.language                  ? 
_citation.page_first                491 
_citation.page_last                 495 
_citation.title                     'eIF2B-catalyzed nucleotide exchange and phosphoregulation by the integrated stress response.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aaw2922 
_citation.pdbx_database_id_PubMed   31048491 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kenner, L.R.'       1  0000-0002-8004-9730 
primary 'Anand, A.A.'        2  0000-0002-2643-032X 
primary 'Nguyen, H.C.'       3  0000-0002-6142-8807 
primary 'Myasnikov, A.G.'    4  0000-0003-2607-7121 
primary 'Klose, C.J.'        5  0000-0002-6436-0457 
primary 'McGeever, L.A.'     6  ?                   
primary 'Tsai, J.C.'         7  0000-0001-5202-722X 
primary 'Miller-Vedam, L.E.' 8  0000-0002-2980-7479 
primary 'Walter, P.'         9  0000-0002-6849-708X 
primary 'Frost, A.'          10 0000-0003-2231-2577 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6O81 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6O81 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Translation initiation factor eIF-2B subunit epsilon'                                      80366.531 2 ? ? ? ? 
2 polymer     man 'Translation initiation factor eIF-2B subunit beta'                                         41008.578 2 ? ? ? ? 
3 polymer     man 'Translation initiation factor eIF-2B subunit delta'                                        57640.168 2 ? ? ? ? 
4 polymer     man 'Translation initiation factor eIF-2B subunit alpha'                                        33754.148 2 ? ? ? ? 
5 polymer     man 'Translation initiation factor eIF-2B subunit gamma'                                        50304.230 2 ? ? ? ? 
6 polymer     man 'Eukaryotic translation initiation factor 2 subunit 1'                                      36161.180 2 ? ? ? ? 
7 polymer     man 'Eukaryotic translation initiation factor 2 subunit 3'                                      51150.422 2 ? ? ? ? 
8 polymer     man 'Translation initiation factor eiF2 beta-subunit'                                           1209.482  2 ? ? ? ? 
9 non-polymer syn '2-(4-chloranylphenoxy)-~{N}-[4-[2-(4-chloranylphenoxy)ethanoylamino]cyclohexyl]ethanamide' 451.343   1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'eIF-2B GDP-GTP exchange factor subunit epsilon'                      
2 'S20I15,S20III15,eIF-2B GDP-GTP exchange factor subunit beta'         
3 'eIF-2B GDP-GTP exchange factor subunit delta'                        
4 'eIF-2B GDP-GTP exchange factor subunit alpha'                        
5 'eIF-2B GDP-GTP exchange factor subunit gamma'                        
6 'Eukaryotic translation initiation factor 2 subunit alpha,eIF-2alpha' 
7 'Eukaryotic translation initiation factor 2 subunit gamma X,eIF-2gX'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTL
EFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNIN
ITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYP
LTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGV
RVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGT
LQKGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAA
DHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
;
;MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTL
EFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNIN
ITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYP
LTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGV
RVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGT
LQKGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAA
DHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAGETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
;
A,B ? 
2 'polypeptide(L)' no no 
;MHHHHHHGGGSENLYFQSPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRR
EGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLVE
LEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIF
AVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEGDIL
EKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
;
;MHHHHHHGGGSENLYFQSPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRR
EGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLVE
LEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIF
AVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEGDIL
EKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
;
C,D ? 
3 'polypeptide(L)' no no 
;MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPES
GIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVK
KPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSELRAAIDRYVQEKIVLAAQAIS
RFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSK
VLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
;
;MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPES
GIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVK
KPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSELRAAIDRYVQEKIVLAAQAIS
RFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSK
VLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
;
E,F ? 
4 'polypeptide(L)' no no 
;MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
;
;MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
;
G,H ? 
5 'polypeptide(L)' no no 
;MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPD
DADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGV
DSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYM
EANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEE
GSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
;
;MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPD
DADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGV
DSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYM
EANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEE
GSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
;
I,J ? 
6 'polypeptide(L)' no no 
;MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEK
GYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDP
SILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED
;
;MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEK
GYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDP
SILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED
;
L,M ? 
7 'polypeptide(L)' no no 
;MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIK
LGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIA
GNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKASEGKLMCKPKFSKIVS
LFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSK
NEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
;
;MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIK
LGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIA
GNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKASEGKLMCKPKFSKIVS
LFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSK
NEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
;
S,T ? 
8 'polypeptide(L)' no no '(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)' XXXXXXXXXXXXXX d,e ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   PRO n 
1 5   VAL n 
1 6   VAL n 
1 7   ALA n 
1 8   PRO n 
1 9   PRO n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  VAL n 
1 14  SER n 
1 15  ARG n 
1 16  ALA n 
1 17  ASN n 
1 18  LYS n 
1 19  ARG n 
1 20  SER n 
1 21  GLY n 
1 22  ALA n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  SER n 
1 28  GLY n 
1 29  GLY n 
1 30  GLY n 
1 31  GLY n 
1 32  ALA n 
1 33  ARG n 
1 34  GLY n 
1 35  ALA n 
1 36  GLU n 
1 37  GLU n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  PRO n 
1 42  PRO n 
1 43  LEU n 
1 44  GLN n 
1 45  ALA n 
1 46  VAL n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  ASP n 
1 51  SER n 
1 52  PHE n 
1 53  ASP n 
1 54  ARG n 
1 55  ARG n 
1 56  PHE n 
1 57  PHE n 
1 58  PRO n 
1 59  ILE n 
1 60  SER n 
1 61  LYS n 
1 62  ASP n 
1 63  GLN n 
1 64  PRO n 
1 65  ARG n 
1 66  VAL n 
1 67  LEU n 
1 68  LEU n 
1 69  PRO n 
1 70  LEU n 
1 71  ALA n 
1 72  ASN n 
1 73  VAL n 
1 74  ALA n 
1 75  LEU n 
1 76  ILE n 
1 77  ASP n 
1 78  TYR n 
1 79  THR n 
1 80  LEU n 
1 81  GLU n 
1 82  PHE n 
1 83  LEU n 
1 84  THR n 
1 85  ALA n 
1 86  THR n 
1 87  GLY n 
1 88  VAL n 
1 89  GLN n 
1 90  GLU n 
1 91  THR n 
1 92  PHE n 
1 93  VAL n 
1 94  PHE n 
1 95  CYS n 
1 96  CYS n 
1 97  TRP n 
1 98  LYS n 
1 99  ALA n 
1 100 ALA n 
1 101 GLN n 
1 102 ILE n 
1 103 LYS n 
1 104 GLU n 
1 105 HIS n 
1 106 LEU n 
1 107 LEU n 
1 108 LYS n 
1 109 SER n 
1 110 LYS n 
1 111 TRP n 
1 112 CYS n 
1 113 ARG n 
1 114 PRO n 
1 115 THR n 
1 116 SER n 
1 117 LEU n 
1 118 ASN n 
1 119 VAL n 
1 120 VAL n 
1 121 ARG n 
1 122 ILE n 
1 123 ILE n 
1 124 THR n 
1 125 SER n 
1 126 GLU n 
1 127 LEU n 
1 128 TYR n 
1 129 ARG n 
1 130 SER n 
1 131 LEU n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 ARG n 
1 137 ASP n 
1 138 VAL n 
1 139 ASP n 
1 140 ALA n 
1 141 LYS n 
1 142 ALA n 
1 143 LEU n 
1 144 VAL n 
1 145 ARG n 
1 146 SER n 
1 147 ASP n 
1 148 PHE n 
1 149 LEU n 
1 150 LEU n 
1 151 VAL n 
1 152 TYR n 
1 153 GLY n 
1 154 ASP n 
1 155 VAL n 
1 156 ILE n 
1 157 SER n 
1 158 ASN n 
1 159 ILE n 
1 160 ASN n 
1 161 ILE n 
1 162 THR n 
1 163 ARG n 
1 164 ALA n 
1 165 LEU n 
1 166 GLU n 
1 167 GLU n 
1 168 HIS n 
1 169 ARG n 
1 170 LEU n 
1 171 ARG n 
1 172 ARG n 
1 173 LYS n 
1 174 LEU n 
1 175 GLU n 
1 176 LYS n 
1 177 ASN n 
1 178 VAL n 
1 179 SER n 
1 180 VAL n 
1 181 MET n 
1 182 THR n 
1 183 MET n 
1 184 ILE n 
1 185 PHE n 
1 186 LYS n 
1 187 GLU n 
1 188 SER n 
1 189 SER n 
1 190 PRO n 
1 191 SER n 
1 192 HIS n 
1 193 PRO n 
1 194 THR n 
1 195 ARG n 
1 196 CYS n 
1 197 HIS n 
1 198 GLU n 
1 199 ASP n 
1 200 ASN n 
1 201 VAL n 
1 202 VAL n 
1 203 VAL n 
1 204 ALA n 
1 205 VAL n 
1 206 ASP n 
1 207 SER n 
1 208 THR n 
1 209 THR n 
1 210 ASN n 
1 211 ARG n 
1 212 VAL n 
1 213 LEU n 
1 214 HIS n 
1 215 PHE n 
1 216 GLN n 
1 217 LYS n 
1 218 THR n 
1 219 GLN n 
1 220 GLY n 
1 221 LEU n 
1 222 ARG n 
1 223 ARG n 
1 224 PHE n 
1 225 ALA n 
1 226 PHE n 
1 227 PRO n 
1 228 LEU n 
1 229 SER n 
1 230 LEU n 
1 231 PHE n 
1 232 GLN n 
1 233 GLY n 
1 234 SER n 
1 235 SER n 
1 236 ASP n 
1 237 GLY n 
1 238 VAL n 
1 239 GLU n 
1 240 VAL n 
1 241 ARG n 
1 242 TYR n 
1 243 ASP n 
1 244 LEU n 
1 245 LEU n 
1 246 ASP n 
1 247 CYS n 
1 248 HIS n 
1 249 ILE n 
1 250 SER n 
1 251 ILE n 
1 252 CYS n 
1 253 SER n 
1 254 PRO n 
1 255 GLN n 
1 256 VAL n 
1 257 ALA n 
1 258 GLN n 
1 259 LEU n 
1 260 PHE n 
1 261 THR n 
1 262 ASP n 
1 263 ASN n 
1 264 PHE n 
1 265 ASP n 
1 266 TYR n 
1 267 GLN n 
1 268 THR n 
1 269 ARG n 
1 270 ASP n 
1 271 ASP n 
1 272 PHE n 
1 273 VAL n 
1 274 ARG n 
1 275 GLY n 
1 276 LEU n 
1 277 LEU n 
1 278 VAL n 
1 279 ASN n 
1 280 GLU n 
1 281 GLU n 
1 282 ILE n 
1 283 LEU n 
1 284 GLY n 
1 285 ASN n 
1 286 GLN n 
1 287 ILE n 
1 288 HIS n 
1 289 MET n 
1 290 HIS n 
1 291 VAL n 
1 292 THR n 
1 293 ALA n 
1 294 LYS n 
1 295 GLU n 
1 296 TYR n 
1 297 GLY n 
1 298 ALA n 
1 299 ARG n 
1 300 VAL n 
1 301 SER n 
1 302 ASN n 
1 303 LEU n 
1 304 HIS n 
1 305 MET n 
1 306 TYR n 
1 307 SER n 
1 308 ALA n 
1 309 VAL n 
1 310 CYS n 
1 311 ALA n 
1 312 ASP n 
1 313 VAL n 
1 314 ILE n 
1 315 ARG n 
1 316 ARG n 
1 317 TRP n 
1 318 VAL n 
1 319 TYR n 
1 320 PRO n 
1 321 LEU n 
1 322 THR n 
1 323 PRO n 
1 324 GLU n 
1 325 ALA n 
1 326 ASN n 
1 327 PHE n 
1 328 THR n 
1 329 ASP n 
1 330 SER n 
1 331 THR n 
1 332 THR n 
1 333 GLN n 
1 334 SER n 
1 335 CYS n 
1 336 THR n 
1 337 HIS n 
1 338 SER n 
1 339 ARG n 
1 340 HIS n 
1 341 ASN n 
1 342 ILE n 
1 343 TYR n 
1 344 ARG n 
1 345 GLY n 
1 346 PRO n 
1 347 GLU n 
1 348 VAL n 
1 349 SER n 
1 350 LEU n 
1 351 GLY n 
1 352 HIS n 
1 353 GLY n 
1 354 SER n 
1 355 ILE n 
1 356 LEU n 
1 357 GLU n 
1 358 GLU n 
1 359 ASN n 
1 360 VAL n 
1 361 LEU n 
1 362 LEU n 
1 363 GLY n 
1 364 SER n 
1 365 GLY n 
1 366 THR n 
1 367 VAL n 
1 368 ILE n 
1 369 GLY n 
1 370 SER n 
1 371 ASN n 
1 372 CYS n 
1 373 PHE n 
1 374 ILE n 
1 375 THR n 
1 376 ASN n 
1 377 SER n 
1 378 VAL n 
1 379 ILE n 
1 380 GLY n 
1 381 PRO n 
1 382 GLY n 
1 383 CYS n 
1 384 HIS n 
1 385 ILE n 
1 386 GLY n 
1 387 ASP n 
1 388 ASN n 
1 389 VAL n 
1 390 VAL n 
1 391 LEU n 
1 392 ASP n 
1 393 GLN n 
1 394 THR n 
1 395 TYR n 
1 396 LEU n 
1 397 TRP n 
1 398 GLN n 
1 399 GLY n 
1 400 VAL n 
1 401 ARG n 
1 402 VAL n 
1 403 ALA n 
1 404 ALA n 
1 405 GLY n 
1 406 ALA n 
1 407 GLN n 
1 408 ILE n 
1 409 HIS n 
1 410 GLN n 
1 411 SER n 
1 412 LEU n 
1 413 LEU n 
1 414 CYS n 
1 415 ASP n 
1 416 ASN n 
1 417 ALA n 
1 418 GLU n 
1 419 VAL n 
1 420 LYS n 
1 421 GLU n 
1 422 ARG n 
1 423 VAL n 
1 424 THR n 
1 425 LEU n 
1 426 LYS n 
1 427 PRO n 
1 428 ARG n 
1 429 SER n 
1 430 VAL n 
1 431 LEU n 
1 432 THR n 
1 433 SER n 
1 434 GLN n 
1 435 VAL n 
1 436 VAL n 
1 437 VAL n 
1 438 GLY n 
1 439 PRO n 
1 440 ASN n 
1 441 ILE n 
1 442 THR n 
1 443 LEU n 
1 444 PRO n 
1 445 GLU n 
1 446 GLY n 
1 447 SER n 
1 448 VAL n 
1 449 ILE n 
1 450 SER n 
1 451 LEU n 
1 452 HIS n 
1 453 PRO n 
1 454 PRO n 
1 455 ASP n 
1 456 ALA n 
1 457 GLU n 
1 458 GLU n 
1 459 ASP n 
1 460 GLU n 
1 461 ASP n 
1 462 ASP n 
1 463 GLY n 
1 464 GLU n 
1 465 PHE n 
1 466 SER n 
1 467 ASP n 
1 468 ASP n 
1 469 SER n 
1 470 GLY n 
1 471 ALA n 
1 472 ASP n 
1 473 GLN n 
1 474 GLU n 
1 475 LYS n 
1 476 ASP n 
1 477 LYS n 
1 478 VAL n 
1 479 LYS n 
1 480 MET n 
1 481 LYS n 
1 482 GLY n 
1 483 TYR n 
1 484 ASN n 
1 485 PRO n 
1 486 ALA n 
1 487 GLU n 
1 488 VAL n 
1 489 GLY n 
1 490 ALA n 
1 491 ALA n 
1 492 GLY n 
1 493 LYS n 
1 494 GLY n 
1 495 TYR n 
1 496 LEU n 
1 497 TRP n 
1 498 LYS n 
1 499 ALA n 
1 500 ALA n 
1 501 GLY n 
1 502 MET n 
1 503 ASN n 
1 504 MET n 
1 505 GLU n 
1 506 GLU n 
1 507 GLU n 
1 508 GLU n 
1 509 GLU n 
1 510 LEU n 
1 511 GLN n 
1 512 GLN n 
1 513 ASN n 
1 514 LEU n 
1 515 TRP n 
1 516 GLY n 
1 517 LEU n 
1 518 LYS n 
1 519 ILE n 
1 520 ASN n 
1 521 MET n 
1 522 GLU n 
1 523 GLU n 
1 524 GLU n 
1 525 SER n 
1 526 GLU n 
1 527 SER n 
1 528 GLU n 
1 529 SER n 
1 530 GLU n 
1 531 GLN n 
1 532 SER n 
1 533 MET n 
1 534 ASP n 
1 535 SER n 
1 536 GLU n 
1 537 GLU n 
1 538 PRO n 
1 539 ASP n 
1 540 SER n 
1 541 ARG n 
1 542 GLY n 
1 543 GLY n 
1 544 SER n 
1 545 PRO n 
1 546 GLN n 
1 547 MET n 
1 548 ASP n 
1 549 ASP n 
1 550 ILE n 
1 551 LYS n 
1 552 VAL n 
1 553 PHE n 
1 554 GLN n 
1 555 ASN n 
1 556 GLU n 
1 557 VAL n 
1 558 LEU n 
1 559 GLY n 
1 560 THR n 
1 561 LEU n 
1 562 GLN n 
1 563 LYS n 
1 564 GLY n 
1 565 LYS n 
1 566 GLU n 
1 567 GLU n 
1 568 ASN n 
1 569 ILE n 
1 570 SER n 
1 571 CYS n 
1 572 ASP n 
1 573 ASN n 
1 574 LEU n 
1 575 VAL n 
1 576 LEU n 
1 577 GLU n 
1 578 ILE n 
1 579 ASN n 
1 580 SER n 
1 581 LEU n 
1 582 LYS n 
1 583 TYR n 
1 584 ALA n 
1 585 TYR n 
1 586 ASN n 
1 587 ILE n 
1 588 SER n 
1 589 LEU n 
1 590 LYS n 
1 591 GLU n 
1 592 VAL n 
1 593 MET n 
1 594 GLN n 
1 595 VAL n 
1 596 LEU n 
1 597 SER n 
1 598 HIS n 
1 599 VAL n 
1 600 VAL n 
1 601 LEU n 
1 602 GLU n 
1 603 PHE n 
1 604 PRO n 
1 605 LEU n 
1 606 GLN n 
1 607 GLN n 
1 608 MET n 
1 609 ASP n 
1 610 SER n 
1 611 PRO n 
1 612 LEU n 
1 613 ASP n 
1 614 SER n 
1 615 SER n 
1 616 ARG n 
1 617 TYR n 
1 618 CYS n 
1 619 ALA n 
1 620 LEU n 
1 621 LEU n 
1 622 LEU n 
1 623 PRO n 
1 624 LEU n 
1 625 LEU n 
1 626 LYS n 
1 627 ALA n 
1 628 TRP n 
1 629 SER n 
1 630 PRO n 
1 631 VAL n 
1 632 PHE n 
1 633 ARG n 
1 634 ASN n 
1 635 TYR n 
1 636 ILE n 
1 637 LYS n 
1 638 ARG n 
1 639 ALA n 
1 640 ALA n 
1 641 ASP n 
1 642 HIS n 
1 643 LEU n 
1 644 GLU n 
1 645 ALA n 
1 646 LEU n 
1 647 ALA n 
1 648 ALA n 
1 649 ILE n 
1 650 GLU n 
1 651 ASP n 
1 652 PHE n 
1 653 PHE n 
1 654 LEU n 
1 655 GLU n 
1 656 HIS n 
1 657 GLU n 
1 658 ALA n 
1 659 LEU n 
1 660 GLY n 
1 661 ILE n 
1 662 SER n 
1 663 MET n 
1 664 ALA n 
1 665 LYS n 
1 666 VAL n 
1 667 LEU n 
1 668 MET n 
1 669 ALA n 
1 670 PHE n 
1 671 TYR n 
1 672 GLN n 
1 673 LEU n 
1 674 GLU n 
1 675 ILE n 
1 676 LEU n 
1 677 ALA n 
1 678 GLY n 
1 679 GLU n 
1 680 THR n 
1 681 ILE n 
1 682 LEU n 
1 683 SER n 
1 684 TRP n 
1 685 PHE n 
1 686 SER n 
1 687 GLN n 
1 688 ARG n 
1 689 ASP n 
1 690 THR n 
1 691 THR n 
1 692 ASP n 
1 693 LYS n 
1 694 GLY n 
1 695 GLN n 
1 696 GLN n 
1 697 LEU n 
1 698 ARG n 
1 699 LYS n 
1 700 ASN n 
1 701 GLN n 
1 702 GLN n 
1 703 LEU n 
1 704 GLN n 
1 705 ARG n 
1 706 PHE n 
1 707 ILE n 
1 708 GLN n 
1 709 TRP n 
1 710 LEU n 
1 711 LYS n 
1 712 GLU n 
1 713 ALA n 
1 714 GLU n 
1 715 GLU n 
1 716 GLU n 
1 717 SER n 
1 718 SER n 
1 719 GLU n 
1 720 ASP n 
1 721 ASP n 
2 1   MET n 
2 2   HIS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  SER n 
2 12  GLU n 
2 13  ASN n 
2 14  LEU n 
2 15  TYR n 
2 16  PHE n 
2 17  GLN n 
2 18  SER n 
2 19  PRO n 
2 20  GLY n 
2 21  SER n 
2 22  ALA n 
2 23  ALA n 
2 24  LYS n 
2 25  GLY n 
2 26  SER n 
2 27  GLU n 
2 28  LEU n 
2 29  SER n 
2 30  GLU n 
2 31  ARG n 
2 32  ILE n 
2 33  GLU n 
2 34  SER n 
2 35  PHE n 
2 36  VAL n 
2 37  GLU n 
2 38  THR n 
2 39  LEU n 
2 40  LYS n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  GLY n 
2 45  PRO n 
2 46  ARG n 
2 47  SER n 
2 48  SER n 
2 49  GLU n 
2 50  GLU n 
2 51  MET n 
2 52  ALA n 
2 53  ARG n 
2 54  GLU n 
2 55  THR n 
2 56  LEU n 
2 57  GLY n 
2 58  LEU n 
2 59  LEU n 
2 60  ARG n 
2 61  GLN n 
2 62  ILE n 
2 63  ILE n 
2 64  THR n 
2 65  ASP n 
2 66  HIS n 
2 67  ARG n 
2 68  TRP n 
2 69  SER n 
2 70  ASN n 
2 71  ALA n 
2 72  GLY n 
2 73  GLU n 
2 74  LEU n 
2 75  MET n 
2 76  GLU n 
2 77  LEU n 
2 78  ILE n 
2 79  ARG n 
2 80  ARG n 
2 81  GLU n 
2 82  GLY n 
2 83  ARG n 
2 84  ARG n 
2 85  MET n 
2 86  THR n 
2 87  ALA n 
2 88  ALA n 
2 89  GLN n 
2 90  PRO n 
2 91  SER n 
2 92  GLU n 
2 93  THR n 
2 94  THR n 
2 95  VAL n 
2 96  GLY n 
2 97  ASN n 
2 98  MET n 
2 99  VAL n 
2 100 ARG n 
2 101 ARG n 
2 102 VAL n 
2 103 LEU n 
2 104 LYS n 
2 105 ILE n 
2 106 ILE n 
2 107 ARG n 
2 108 GLU n 
2 109 GLU n 
2 110 TYR n 
2 111 GLY n 
2 112 ARG n 
2 113 LEU n 
2 114 HIS n 
2 115 GLY n 
2 116 ARG n 
2 117 SER n 
2 118 ASP n 
2 119 GLU n 
2 120 SER n 
2 121 ASP n 
2 122 GLN n 
2 123 GLN n 
2 124 GLU n 
2 125 SER n 
2 126 LEU n 
2 127 HIS n 
2 128 LYS n 
2 129 LEU n 
2 130 LEU n 
2 131 THR n 
2 132 SER n 
2 133 GLY n 
2 134 GLY n 
2 135 LEU n 
2 136 ASN n 
2 137 GLU n 
2 138 ASP n 
2 139 PHE n 
2 140 SER n 
2 141 PHE n 
2 142 HIS n 
2 143 TYR n 
2 144 ALA n 
2 145 GLN n 
2 146 LEU n 
2 147 GLN n 
2 148 SER n 
2 149 ASN n 
2 150 ILE n 
2 151 ILE n 
2 152 GLU n 
2 153 ALA n 
2 154 ILE n 
2 155 ASN n 
2 156 GLU n 
2 157 LEU n 
2 158 LEU n 
2 159 VAL n 
2 160 GLU n 
2 161 LEU n 
2 162 GLU n 
2 163 GLY n 
2 164 THR n 
2 165 MET n 
2 166 GLU n 
2 167 ASN n 
2 168 ILE n 
2 169 ALA n 
2 170 ALA n 
2 171 GLN n 
2 172 ALA n 
2 173 LEU n 
2 174 GLU n 
2 175 HIS n 
2 176 ILE n 
2 177 HIS n 
2 178 SER n 
2 179 ASN n 
2 180 GLU n 
2 181 VAL n 
2 182 ILE n 
2 183 MET n 
2 184 THR n 
2 185 ILE n 
2 186 GLY n 
2 187 PHE n 
2 188 SER n 
2 189 ARG n 
2 190 THR n 
2 191 VAL n 
2 192 GLU n 
2 193 ALA n 
2 194 PHE n 
2 195 LEU n 
2 196 LYS n 
2 197 GLU n 
2 198 ALA n 
2 199 ALA n 
2 200 ARG n 
2 201 LYS n 
2 202 ARG n 
2 203 LYS n 
2 204 PHE n 
2 205 HIS n 
2 206 VAL n 
2 207 ILE n 
2 208 VAL n 
2 209 ALA n 
2 210 GLU n 
2 211 CYS n 
2 212 ALA n 
2 213 PRO n 
2 214 PHE n 
2 215 CYS n 
2 216 GLN n 
2 217 GLY n 
2 218 HIS n 
2 219 GLU n 
2 220 MET n 
2 221 ALA n 
2 222 VAL n 
2 223 ASN n 
2 224 LEU n 
2 225 SER n 
2 226 LYS n 
2 227 ALA n 
2 228 GLY n 
2 229 ILE n 
2 230 GLU n 
2 231 THR n 
2 232 THR n 
2 233 VAL n 
2 234 MET n 
2 235 THR n 
2 236 ASP n 
2 237 ALA n 
2 238 ALA n 
2 239 ILE n 
2 240 PHE n 
2 241 ALA n 
2 242 VAL n 
2 243 MET n 
2 244 SER n 
2 245 ARG n 
2 246 VAL n 
2 247 ASN n 
2 248 LYS n 
2 249 VAL n 
2 250 ILE n 
2 251 ILE n 
2 252 GLY n 
2 253 THR n 
2 254 LYS n 
2 255 THR n 
2 256 ILE n 
2 257 LEU n 
2 258 ALA n 
2 259 ASN n 
2 260 GLY n 
2 261 ALA n 
2 262 LEU n 
2 263 ARG n 
2 264 ALA n 
2 265 VAL n 
2 266 THR n 
2 267 GLY n 
2 268 THR n 
2 269 HIS n 
2 270 THR n 
2 271 LEU n 
2 272 ALA n 
2 273 LEU n 
2 274 ALA n 
2 275 ALA n 
2 276 LYS n 
2 277 HIS n 
2 278 HIS n 
2 279 SER n 
2 280 THR n 
2 281 PRO n 
2 282 LEU n 
2 283 ILE n 
2 284 VAL n 
2 285 CYS n 
2 286 ALA n 
2 287 PRO n 
2 288 MET n 
2 289 PHE n 
2 290 LYS n 
2 291 LEU n 
2 292 SER n 
2 293 PRO n 
2 294 GLN n 
2 295 PHE n 
2 296 PRO n 
2 297 ASN n 
2 298 GLU n 
2 299 GLU n 
2 300 ASP n 
2 301 SER n 
2 302 PHE n 
2 303 HIS n 
2 304 LYS n 
2 305 PHE n 
2 306 VAL n 
2 307 ALA n 
2 308 PRO n 
2 309 GLU n 
2 310 GLU n 
2 311 VAL n 
2 312 LEU n 
2 313 PRO n 
2 314 PHE n 
2 315 THR n 
2 316 GLU n 
2 317 GLY n 
2 318 ASP n 
2 319 ILE n 
2 320 LEU n 
2 321 GLU n 
2 322 LYS n 
2 323 VAL n 
2 324 SER n 
2 325 VAL n 
2 326 HIS n 
2 327 CYS n 
2 328 PRO n 
2 329 VAL n 
2 330 PHE n 
2 331 ASP n 
2 332 TYR n 
2 333 VAL n 
2 334 PRO n 
2 335 PRO n 
2 336 GLU n 
2 337 LEU n 
2 338 ILE n 
2 339 THR n 
2 340 LEU n 
2 341 PHE n 
2 342 ILE n 
2 343 SER n 
2 344 ASN n 
2 345 ILE n 
2 346 GLY n 
2 347 GLY n 
2 348 ASN n 
2 349 ALA n 
2 350 PRO n 
2 351 SER n 
2 352 TYR n 
2 353 ILE n 
2 354 TYR n 
2 355 ARG n 
2 356 LEU n 
2 357 MET n 
2 358 SER n 
2 359 GLU n 
2 360 LEU n 
2 361 TYR n 
2 362 HIS n 
2 363 PRO n 
2 364 ASP n 
2 365 ASP n 
2 366 HIS n 
2 367 VAL n 
2 368 LEU n 
3 1   MET n 
3 2   ALA n 
3 3   ALA n 
3 4   VAL n 
3 5   ALA n 
3 6   VAL n 
3 7   ALA n 
3 8   VAL n 
3 9   ARG n 
3 10  GLU n 
3 11  ASP n 
3 12  SER n 
3 13  GLY n 
3 14  SER n 
3 15  GLY n 
3 16  MET n 
3 17  LYS n 
3 18  ALA n 
3 19  GLU n 
3 20  LEU n 
3 21  PRO n 
3 22  PRO n 
3 23  GLY n 
3 24  PRO n 
3 25  GLY n 
3 26  ALA n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  GLU n 
3 31  MET n 
3 32  THR n 
3 33  LYS n 
3 34  GLU n 
3 35  GLU n 
3 36  LYS n 
3 37  LEU n 
3 38  GLN n 
3 39  LEU n 
3 40  ARG n 
3 41  LYS n 
3 42  GLU n 
3 43  LYS n 
3 44  LYS n 
3 45  GLN n 
3 46  GLN n 
3 47  LYS n 
3 48  LYS n 
3 49  LYS n 
3 50  ARG n 
3 51  LYS n 
3 52  GLU n 
3 53  GLU n 
3 54  LYS n 
3 55  GLY n 
3 56  ALA n 
3 57  GLU n 
3 58  PRO n 
3 59  GLU n 
3 60  THR n 
3 61  GLY n 
3 62  SER n 
3 63  ALA n 
3 64  VAL n 
3 65  SER n 
3 66  ALA n 
3 67  ALA n 
3 68  GLN n 
3 69  CYS n 
3 70  GLN n 
3 71  VAL n 
3 72  GLY n 
3 73  PRO n 
3 74  THR n 
3 75  ARG n 
3 76  GLU n 
3 77  LEU n 
3 78  PRO n 
3 79  GLU n 
3 80  SER n 
3 81  GLY n 
3 82  ILE n 
3 83  GLN n 
3 84  LEU n 
3 85  GLY n 
3 86  THR n 
3 87  PRO n 
3 88  ARG n 
3 89  GLU n 
3 90  LYS n 
3 91  VAL n 
3 92  PRO n 
3 93  ALA n 
3 94  GLY n 
3 95  ARG n 
3 96  SER n 
3 97  LYS n 
3 98  ALA n 
3 99  GLU n 
3 100 LEU n 
3 101 ARG n 
3 102 ALA n 
3 103 GLU n 
3 104 ARG n 
3 105 ARG n 
3 106 ALA n 
3 107 LYS n 
3 108 GLN n 
3 109 GLU n 
3 110 ALA n 
3 111 GLU n 
3 112 ARG n 
3 113 ALA n 
3 114 LEU n 
3 115 LYS n 
3 116 GLN n 
3 117 ALA n 
3 118 ARG n 
3 119 LYS n 
3 120 GLY n 
3 121 GLU n 
3 122 GLN n 
3 123 GLY n 
3 124 GLY n 
3 125 PRO n 
3 126 PRO n 
3 127 PRO n 
3 128 LYS n 
3 129 ALA n 
3 130 SER n 
3 131 PRO n 
3 132 SER n 
3 133 THR n 
3 134 ALA n 
3 135 GLY n 
3 136 GLU n 
3 137 THR n 
3 138 PRO n 
3 139 SER n 
3 140 GLY n 
3 141 VAL n 
3 142 LYS n 
3 143 ARG n 
3 144 LEU n 
3 145 PRO n 
3 146 GLU n 
3 147 TYR n 
3 148 PRO n 
3 149 GLN n 
3 150 VAL n 
3 151 ASP n 
3 152 ASP n 
3 153 LEU n 
3 154 LEU n 
3 155 LEU n 
3 156 ARG n 
3 157 ARG n 
3 158 LEU n 
3 159 VAL n 
3 160 LYS n 
3 161 LYS n 
3 162 PRO n 
3 163 GLU n 
3 164 ARG n 
3 165 GLN n 
3 166 GLN n 
3 167 VAL n 
3 168 PRO n 
3 169 THR n 
3 170 ARG n 
3 171 LYS n 
3 172 ASP n 
3 173 TYR n 
3 174 GLY n 
3 175 SER n 
3 176 LYS n 
3 177 VAL n 
3 178 SER n 
3 179 LEU n 
3 180 PHE n 
3 181 SER n 
3 182 HIS n 
3 183 LEU n 
3 184 PRO n 
3 185 GLN n 
3 186 TYR n 
3 187 SER n 
3 188 ARG n 
3 189 GLN n 
3 190 ASN n 
3 191 SER n 
3 192 LEU n 
3 193 THR n 
3 194 GLN n 
3 195 PHE n 
3 196 MET n 
3 197 SER n 
3 198 ILE n 
3 199 PRO n 
3 200 SER n 
3 201 SER n 
3 202 VAL n 
3 203 ILE n 
3 204 HIS n 
3 205 PRO n 
3 206 ALA n 
3 207 MET n 
3 208 VAL n 
3 209 ARG n 
3 210 LEU n 
3 211 GLY n 
3 212 LEU n 
3 213 GLN n 
3 214 TYR n 
3 215 SER n 
3 216 GLN n 
3 217 GLY n 
3 218 LEU n 
3 219 VAL n 
3 220 SER n 
3 221 GLY n 
3 222 SER n 
3 223 ASN n 
3 224 ALA n 
3 225 ARG n 
3 226 CYS n 
3 227 ILE n 
3 228 ALA n 
3 229 LEU n 
3 230 LEU n 
3 231 ARG n 
3 232 ALA n 
3 233 LEU n 
3 234 GLN n 
3 235 GLN n 
3 236 VAL n 
3 237 ILE n 
3 238 GLN n 
3 239 ASP n 
3 240 TYR n 
3 241 THR n 
3 242 THR n 
3 243 PRO n 
3 244 PRO n 
3 245 ASN n 
3 246 GLU n 
3 247 GLU n 
3 248 LEU n 
3 249 SER n 
3 250 ARG n 
3 251 ASP n 
3 252 LEU n 
3 253 VAL n 
3 254 ASN n 
3 255 LYS n 
3 256 LEU n 
3 257 LYS n 
3 258 PRO n 
3 259 TYR n 
3 260 MET n 
3 261 SER n 
3 262 PHE n 
3 263 LEU n 
3 264 THR n 
3 265 GLN n 
3 266 CYS n 
3 267 ARG n 
3 268 PRO n 
3 269 LEU n 
3 270 SER n 
3 271 ALA n 
3 272 SER n 
3 273 MET n 
3 274 HIS n 
3 275 ASN n 
3 276 ALA n 
3 277 ILE n 
3 278 LYS n 
3 279 PHE n 
3 280 LEU n 
3 281 ASN n 
3 282 LYS n 
3 283 GLU n 
3 284 ILE n 
3 285 THR n 
3 286 SER n 
3 287 VAL n 
3 288 GLY n 
3 289 SER n 
3 290 SER n 
3 291 LYS n 
3 292 ARG n 
3 293 GLU n 
3 294 GLU n 
3 295 GLU n 
3 296 ALA n 
3 297 LYS n 
3 298 SER n 
3 299 GLU n 
3 300 LEU n 
3 301 ARG n 
3 302 ALA n 
3 303 ALA n 
3 304 ILE n 
3 305 ASP n 
3 306 ARG n 
3 307 TYR n 
3 308 VAL n 
3 309 GLN n 
3 310 GLU n 
3 311 LYS n 
3 312 ILE n 
3 313 VAL n 
3 314 LEU n 
3 315 ALA n 
3 316 ALA n 
3 317 GLN n 
3 318 ALA n 
3 319 ILE n 
3 320 SER n 
3 321 ARG n 
3 322 PHE n 
3 323 ALA n 
3 324 TYR n 
3 325 GLN n 
3 326 LYS n 
3 327 ILE n 
3 328 SER n 
3 329 ASN n 
3 330 GLY n 
3 331 ASP n 
3 332 VAL n 
3 333 ILE n 
3 334 LEU n 
3 335 VAL n 
3 336 TYR n 
3 337 GLY n 
3 338 CYS n 
3 339 SER n 
3 340 SER n 
3 341 LEU n 
3 342 VAL n 
3 343 SER n 
3 344 ARG n 
3 345 ILE n 
3 346 LEU n 
3 347 GLN n 
3 348 GLU n 
3 349 ALA n 
3 350 TRP n 
3 351 THR n 
3 352 GLU n 
3 353 GLY n 
3 354 ARG n 
3 355 ARG n 
3 356 PHE n 
3 357 ARG n 
3 358 VAL n 
3 359 VAL n 
3 360 VAL n 
3 361 VAL n 
3 362 ASP n 
3 363 SER n 
3 364 ARG n 
3 365 PRO n 
3 366 TRP n 
3 367 LEU n 
3 368 GLU n 
3 369 GLY n 
3 370 ARG n 
3 371 HIS n 
3 372 THR n 
3 373 LEU n 
3 374 ARG n 
3 375 SER n 
3 376 LEU n 
3 377 VAL n 
3 378 HIS n 
3 379 ALA n 
3 380 GLY n 
3 381 VAL n 
3 382 PRO n 
3 383 ALA n 
3 384 SER n 
3 385 TYR n 
3 386 LEU n 
3 387 LEU n 
3 388 ILE n 
3 389 PRO n 
3 390 ALA n 
3 391 ALA n 
3 392 SER n 
3 393 TYR n 
3 394 VAL n 
3 395 LEU n 
3 396 PRO n 
3 397 GLU n 
3 398 VAL n 
3 399 SER n 
3 400 LYS n 
3 401 VAL n 
3 402 LEU n 
3 403 LEU n 
3 404 GLY n 
3 405 ALA n 
3 406 HIS n 
3 407 ALA n 
3 408 LEU n 
3 409 LEU n 
3 410 ALA n 
3 411 ASN n 
3 412 GLY n 
3 413 SER n 
3 414 VAL n 
3 415 MET n 
3 416 SER n 
3 417 ARG n 
3 418 VAL n 
3 419 GLY n 
3 420 THR n 
3 421 ALA n 
3 422 GLN n 
3 423 LEU n 
3 424 ALA n 
3 425 LEU n 
3 426 VAL n 
3 427 ALA n 
3 428 ARG n 
3 429 ALA n 
3 430 HIS n 
3 431 ASN n 
3 432 VAL n 
3 433 PRO n 
3 434 VAL n 
3 435 LEU n 
3 436 VAL n 
3 437 CYS n 
3 438 CYS n 
3 439 GLU n 
3 440 THR n 
3 441 TYR n 
3 442 LYS n 
3 443 PHE n 
3 444 CYS n 
3 445 GLU n 
3 446 ARG n 
3 447 VAL n 
3 448 GLN n 
3 449 THR n 
3 450 ASP n 
3 451 ALA n 
3 452 PHE n 
3 453 VAL n 
3 454 SER n 
3 455 ASN n 
3 456 GLU n 
3 457 LEU n 
3 458 ASP n 
3 459 ASP n 
3 460 PRO n 
3 461 ASP n 
3 462 ASP n 
3 463 LEU n 
3 464 GLN n 
3 465 CYS n 
3 466 LYS n 
3 467 ARG n 
3 468 GLY n 
3 469 GLU n 
3 470 HIS n 
3 471 VAL n 
3 472 ALA n 
3 473 LEU n 
3 474 ALA n 
3 475 ASN n 
3 476 TRP n 
3 477 GLN n 
3 478 ASN n 
3 479 HIS n 
3 480 ALA n 
3 481 SER n 
3 482 LEU n 
3 483 ARG n 
3 484 LEU n 
3 485 LEU n 
3 486 ASN n 
3 487 LEU n 
3 488 VAL n 
3 489 TYR n 
3 490 ASP n 
3 491 VAL n 
3 492 THR n 
3 493 PRO n 
3 494 PRO n 
3 495 GLU n 
3 496 LEU n 
3 497 VAL n 
3 498 ASP n 
3 499 LEU n 
3 500 VAL n 
3 501 ILE n 
3 502 THR n 
3 503 GLU n 
3 504 LEU n 
3 505 GLY n 
3 506 MET n 
3 507 ILE n 
3 508 PRO n 
3 509 CYS n 
3 510 SER n 
3 511 SER n 
3 512 VAL n 
3 513 PRO n 
3 514 VAL n 
3 515 VAL n 
3 516 LEU n 
3 517 ARG n 
3 518 VAL n 
3 519 LYS n 
3 520 SER n 
3 521 SER n 
3 522 ASP n 
3 523 GLN n 
4 1   MET n 
4 2   ASP n 
4 3   ASP n 
4 4   LYS n 
4 5   GLU n 
4 6   LEU n 
4 7   ILE n 
4 8   GLU n 
4 9   TYR n 
4 10  PHE n 
4 11  LYS n 
4 12  SER n 
4 13  GLN n 
4 14  MET n 
4 15  LYS n 
4 16  GLU n 
4 17  ASP n 
4 18  PRO n 
4 19  ASP n 
4 20  MET n 
4 21  ALA n 
4 22  SER n 
4 23  ALA n 
4 24  VAL n 
4 25  ALA n 
4 26  ALA n 
4 27  ILE n 
4 28  ARG n 
4 29  THR n 
4 30  LEU n 
4 31  LEU n 
4 32  GLU n 
4 33  PHE n 
4 34  LEU n 
4 35  LYS n 
4 36  ARG n 
4 37  ASP n 
4 38  LYS n 
4 39  GLY n 
4 40  GLU n 
4 41  THR n 
4 42  ILE n 
4 43  GLN n 
4 44  GLY n 
4 45  LEU n 
4 46  ARG n 
4 47  ALA n 
4 48  ASN n 
4 49  LEU n 
4 50  THR n 
4 51  SER n 
4 52  ALA n 
4 53  ILE n 
4 54  GLU n 
4 55  THR n 
4 56  LEU n 
4 57  CYS n 
4 58  GLY n 
4 59  VAL n 
4 60  ASP n 
4 61  SER n 
4 62  SER n 
4 63  VAL n 
4 64  ALA n 
4 65  VAL n 
4 66  SER n 
4 67  SER n 
4 68  GLY n 
4 69  GLY n 
4 70  GLU n 
4 71  LEU n 
4 72  PHE n 
4 73  LEU n 
4 74  ARG n 
4 75  PHE n 
4 76  ILE n 
4 77  SER n 
4 78  LEU n 
4 79  ALA n 
4 80  SER n 
4 81  LEU n 
4 82  GLU n 
4 83  TYR n 
4 84  SER n 
4 85  ASP n 
4 86  TYR n 
4 87  SER n 
4 88  LYS n 
4 89  CYS n 
4 90  LYS n 
4 91  LYS n 
4 92  ILE n 
4 93  MET n 
4 94  ILE n 
4 95  GLU n 
4 96  ARG n 
4 97  GLY n 
4 98  GLU n 
4 99  LEU n 
4 100 PHE n 
4 101 LEU n 
4 102 ARG n 
4 103 ARG n 
4 104 ILE n 
4 105 SER n 
4 106 LEU n 
4 107 SER n 
4 108 ARG n 
4 109 ASN n 
4 110 LYS n 
4 111 ILE n 
4 112 ALA n 
4 113 ASP n 
4 114 LEU n 
4 115 CYS n 
4 116 HIS n 
4 117 THR n 
4 118 PHE n 
4 119 ILE n 
4 120 LYS n 
4 121 ASP n 
4 122 GLY n 
4 123 ALA n 
4 124 THR n 
4 125 ILE n 
4 126 LEU n 
4 127 THR n 
4 128 HIS n 
4 129 ALA n 
4 130 TYR n 
4 131 SER n 
4 132 ARG n 
4 133 VAL n 
4 134 VAL n 
4 135 LEU n 
4 136 ARG n 
4 137 VAL n 
4 138 LEU n 
4 139 GLU n 
4 140 ALA n 
4 141 ALA n 
4 142 VAL n 
4 143 ALA n 
4 144 ALA n 
4 145 LYS n 
4 146 LYS n 
4 147 ARG n 
4 148 PHE n 
4 149 SER n 
4 150 VAL n 
4 151 TYR n 
4 152 VAL n 
4 153 THR n 
4 154 GLU n 
4 155 SER n 
4 156 GLN n 
4 157 PRO n 
4 158 ASP n 
4 159 LEU n 
4 160 SER n 
4 161 GLY n 
4 162 LYS n 
4 163 LYS n 
4 164 MET n 
4 165 ALA n 
4 166 LYS n 
4 167 ALA n 
4 168 LEU n 
4 169 CYS n 
4 170 HIS n 
4 171 LEU n 
4 172 ASN n 
4 173 VAL n 
4 174 PRO n 
4 175 VAL n 
4 176 THR n 
4 177 VAL n 
4 178 VAL n 
4 179 LEU n 
4 180 ASP n 
4 181 ALA n 
4 182 ALA n 
4 183 VAL n 
4 184 GLY n 
4 185 TYR n 
4 186 ILE n 
4 187 MET n 
4 188 GLU n 
4 189 LYS n 
4 190 ALA n 
4 191 ASP n 
4 192 LEU n 
4 193 VAL n 
4 194 ILE n 
4 195 VAL n 
4 196 GLY n 
4 197 ALA n 
4 198 GLU n 
4 199 GLY n 
4 200 VAL n 
4 201 VAL n 
4 202 GLU n 
4 203 ASN n 
4 204 GLY n 
4 205 GLY n 
4 206 ILE n 
4 207 ILE n 
4 208 ASN n 
4 209 LYS n 
4 210 ILE n 
4 211 GLY n 
4 212 THR n 
4 213 ASN n 
4 214 GLN n 
4 215 MET n 
4 216 ALA n 
4 217 VAL n 
4 218 CYS n 
4 219 ALA n 
4 220 LYS n 
4 221 ALA n 
4 222 GLN n 
4 223 ASN n 
4 224 LYS n 
4 225 PRO n 
4 226 PHE n 
4 227 TYR n 
4 228 VAL n 
4 229 VAL n 
4 230 ALA n 
4 231 GLU n 
4 232 SER n 
4 233 PHE n 
4 234 LYS n 
4 235 PHE n 
4 236 VAL n 
4 237 ARG n 
4 238 LEU n 
4 239 PHE n 
4 240 PRO n 
4 241 LEU n 
4 242 ASN n 
4 243 GLN n 
4 244 GLN n 
4 245 ASP n 
4 246 VAL n 
4 247 PRO n 
4 248 ASP n 
4 249 LYS n 
4 250 PHE n 
4 251 LYS n 
4 252 TYR n 
4 253 LYS n 
4 254 ALA n 
4 255 ASP n 
4 256 THR n 
4 257 LEU n 
4 258 LYS n 
4 259 VAL n 
4 260 ALA n 
4 261 GLN n 
4 262 THR n 
4 263 GLY n 
4 264 GLN n 
4 265 ASP n 
4 266 LEU n 
4 267 LYS n 
4 268 GLU n 
4 269 GLU n 
4 270 HIS n 
4 271 PRO n 
4 272 TRP n 
4 273 VAL n 
4 274 ASP n 
4 275 TYR n 
4 276 THR n 
4 277 ALA n 
4 278 PRO n 
4 279 SER n 
4 280 LEU n 
4 281 ILE n 
4 282 THR n 
4 283 LEU n 
4 284 LEU n 
4 285 PHE n 
4 286 THR n 
4 287 ASP n 
4 288 LEU n 
4 289 GLY n 
4 290 VAL n 
4 291 LEU n 
4 292 THR n 
4 293 PRO n 
4 294 SER n 
4 295 ALA n 
4 296 VAL n 
4 297 SER n 
4 298 ASP n 
4 299 GLU n 
4 300 LEU n 
4 301 ILE n 
4 302 LYS n 
4 303 LEU n 
4 304 TYR n 
4 305 LEU n 
5 1   MET n 
5 2   GLU n 
5 3   PHE n 
5 4   GLN n 
5 5   ALA n 
5 6   VAL n 
5 7   VAL n 
5 8   MET n 
5 9   ALA n 
5 10  VAL n 
5 11  GLY n 
5 12  GLY n 
5 13  GLY n 
5 14  SER n 
5 15  ARG n 
5 16  MET n 
5 17  THR n 
5 18  ASP n 
5 19  LEU n 
5 20  THR n 
5 21  SER n 
5 22  SER n 
5 23  ILE n 
5 24  PRO n 
5 25  LYS n 
5 26  PRO n 
5 27  LEU n 
5 28  LEU n 
5 29  PRO n 
5 30  VAL n 
5 31  GLY n 
5 32  ASN n 
5 33  LYS n 
5 34  PRO n 
5 35  LEU n 
5 36  ILE n 
5 37  TRP n 
5 38  TYR n 
5 39  PRO n 
5 40  LEU n 
5 41  ASN n 
5 42  LEU n 
5 43  LEU n 
5 44  GLU n 
5 45  ARG n 
5 46  VAL n 
5 47  GLY n 
5 48  PHE n 
5 49  GLU n 
5 50  GLU n 
5 51  VAL n 
5 52  ILE n 
5 53  VAL n 
5 54  VAL n 
5 55  THR n 
5 56  THR n 
5 57  ARG n 
5 58  ASP n 
5 59  VAL n 
5 60  GLN n 
5 61  LYS n 
5 62  ALA n 
5 63  LEU n 
5 64  CYS n 
5 65  ALA n 
5 66  GLU n 
5 67  PHE n 
5 68  LYS n 
5 69  MET n 
5 70  LYS n 
5 71  MET n 
5 72  LYS n 
5 73  PRO n 
5 74  ASP n 
5 75  ILE n 
5 76  VAL n 
5 77  CYS n 
5 78  ILE n 
5 79  PRO n 
5 80  ASP n 
5 81  ASP n 
5 82  ALA n 
5 83  ASP n 
5 84  MET n 
5 85  GLY n 
5 86  THR n 
5 87  ALA n 
5 88  ASP n 
5 89  SER n 
5 90  LEU n 
5 91  ARG n 
5 92  TYR n 
5 93  ILE n 
5 94  TYR n 
5 95  PRO n 
5 96  LYS n 
5 97  LEU n 
5 98  LYS n 
5 99  THR n 
5 100 ASP n 
5 101 VAL n 
5 102 LEU n 
5 103 VAL n 
5 104 LEU n 
5 105 SER n 
5 106 CYS n 
5 107 ASP n 
5 108 LEU n 
5 109 ILE n 
5 110 THR n 
5 111 ASP n 
5 112 VAL n 
5 113 ALA n 
5 114 LEU n 
5 115 HIS n 
5 116 GLU n 
5 117 VAL n 
5 118 VAL n 
5 119 ASP n 
5 120 LEU n 
5 121 PHE n 
5 122 ARG n 
5 123 ALA n 
5 124 TYR n 
5 125 ASP n 
5 126 ALA n 
5 127 SER n 
5 128 LEU n 
5 129 ALA n 
5 130 MET n 
5 131 LEU n 
5 132 MET n 
5 133 ARG n 
5 134 LYS n 
5 135 GLY n 
5 136 GLN n 
5 137 ASP n 
5 138 SER n 
5 139 ILE n 
5 140 GLU n 
5 141 PRO n 
5 142 VAL n 
5 143 PRO n 
5 144 GLY n 
5 145 GLN n 
5 146 LYS n 
5 147 GLY n 
5 148 LYS n 
5 149 LYS n 
5 150 LYS n 
5 151 ALA n 
5 152 VAL n 
5 153 GLU n 
5 154 GLN n 
5 155 ARG n 
5 156 ASP n 
5 157 PHE n 
5 158 ILE n 
5 159 GLY n 
5 160 VAL n 
5 161 ASP n 
5 162 SER n 
5 163 THR n 
5 164 GLY n 
5 165 LYS n 
5 166 ARG n 
5 167 LEU n 
5 168 LEU n 
5 169 PHE n 
5 170 MET n 
5 171 ALA n 
5 172 ASN n 
5 173 GLU n 
5 174 ALA n 
5 175 ASP n 
5 176 LEU n 
5 177 ASP n 
5 178 GLU n 
5 179 GLU n 
5 180 LEU n 
5 181 VAL n 
5 182 ILE n 
5 183 LYS n 
5 184 GLY n 
5 185 SER n 
5 186 ILE n 
5 187 LEU n 
5 188 GLN n 
5 189 LYS n 
5 190 HIS n 
5 191 PRO n 
5 192 ARG n 
5 193 ILE n 
5 194 ARG n 
5 195 PHE n 
5 196 HIS n 
5 197 THR n 
5 198 GLY n 
5 199 LEU n 
5 200 VAL n 
5 201 ASP n 
5 202 ALA n 
5 203 HIS n 
5 204 LEU n 
5 205 TYR n 
5 206 CYS n 
5 207 LEU n 
5 208 LYS n 
5 209 LYS n 
5 210 TYR n 
5 211 ILE n 
5 212 VAL n 
5 213 ASP n 
5 214 PHE n 
5 215 LEU n 
5 216 MET n 
5 217 GLU n 
5 218 ASN n 
5 219 GLY n 
5 220 SER n 
5 221 ILE n 
5 222 THR n 
5 223 SER n 
5 224 ILE n 
5 225 ARG n 
5 226 SER n 
5 227 GLU n 
5 228 LEU n 
5 229 ILE n 
5 230 PRO n 
5 231 TYR n 
5 232 LEU n 
5 233 VAL n 
5 234 ARG n 
5 235 LYS n 
5 236 GLN n 
5 237 PHE n 
5 238 SER n 
5 239 SER n 
5 240 ALA n 
5 241 SER n 
5 242 SER n 
5 243 GLN n 
5 244 GLN n 
5 245 GLY n 
5 246 GLN n 
5 247 GLU n 
5 248 GLU n 
5 249 LYS n 
5 250 GLU n 
5 251 GLU n 
5 252 ASP n 
5 253 LEU n 
5 254 LYS n 
5 255 LYS n 
5 256 LYS n 
5 257 GLU n 
5 258 LEU n 
5 259 LYS n 
5 260 SER n 
5 261 LEU n 
5 262 ASP n 
5 263 ILE n 
5 264 TYR n 
5 265 SER n 
5 266 PHE n 
5 267 ILE n 
5 268 LYS n 
5 269 GLU n 
5 270 ALA n 
5 271 ASN n 
5 272 THR n 
5 273 LEU n 
5 274 ASN n 
5 275 LEU n 
5 276 ALA n 
5 277 PRO n 
5 278 TYR n 
5 279 ASP n 
5 280 ALA n 
5 281 CYS n 
5 282 TRP n 
5 283 ASN n 
5 284 ALA n 
5 285 CYS n 
5 286 ARG n 
5 287 GLY n 
5 288 ASP n 
5 289 ARG n 
5 290 TRP n 
5 291 GLU n 
5 292 ASP n 
5 293 LEU n 
5 294 SER n 
5 295 ARG n 
5 296 SER n 
5 297 GLN n 
5 298 VAL n 
5 299 ARG n 
5 300 CYS n 
5 301 TYR n 
5 302 VAL n 
5 303 HIS n 
5 304 ILE n 
5 305 MET n 
5 306 LYS n 
5 307 GLU n 
5 308 GLY n 
5 309 LEU n 
5 310 CYS n 
5 311 SER n 
5 312 ARG n 
5 313 VAL n 
5 314 SER n 
5 315 THR n 
5 316 LEU n 
5 317 GLY n 
5 318 LEU n 
5 319 TYR n 
5 320 MET n 
5 321 GLU n 
5 322 ALA n 
5 323 ASN n 
5 324 ARG n 
5 325 GLN n 
5 326 VAL n 
5 327 PRO n 
5 328 LYS n 
5 329 LEU n 
5 330 LEU n 
5 331 SER n 
5 332 ALA n 
5 333 LEU n 
5 334 CYS n 
5 335 PRO n 
5 336 GLU n 
5 337 GLU n 
5 338 PRO n 
5 339 PRO n 
5 340 VAL n 
5 341 HIS n 
5 342 SER n 
5 343 SER n 
5 344 ALA n 
5 345 GLN n 
5 346 ILE n 
5 347 VAL n 
5 348 SER n 
5 349 LYS n 
5 350 HIS n 
5 351 LEU n 
5 352 VAL n 
5 353 GLY n 
5 354 VAL n 
5 355 ASP n 
5 356 SER n 
5 357 LEU n 
5 358 ILE n 
5 359 GLY n 
5 360 PRO n 
5 361 GLU n 
5 362 THR n 
5 363 GLN n 
5 364 ILE n 
5 365 GLY n 
5 366 GLU n 
5 367 LYS n 
5 368 SER n 
5 369 SER n 
5 370 ILE n 
5 371 LYS n 
5 372 ARG n 
5 373 SER n 
5 374 VAL n 
5 375 ILE n 
5 376 GLY n 
5 377 SER n 
5 378 SER n 
5 379 CYS n 
5 380 LEU n 
5 381 ILE n 
5 382 LYS n 
5 383 ASP n 
5 384 ARG n 
5 385 VAL n 
5 386 THR n 
5 387 ILE n 
5 388 THR n 
5 389 ASN n 
5 390 CYS n 
5 391 LEU n 
5 392 LEU n 
5 393 MET n 
5 394 ASN n 
5 395 SER n 
5 396 VAL n 
5 397 THR n 
5 398 VAL n 
5 399 GLU n 
5 400 GLU n 
5 401 GLY n 
5 402 SER n 
5 403 ASN n 
5 404 ILE n 
5 405 GLN n 
5 406 GLY n 
5 407 SER n 
5 408 VAL n 
5 409 ILE n 
5 410 CYS n 
5 411 ASN n 
5 412 ASN n 
5 413 ALA n 
5 414 VAL n 
5 415 ILE n 
5 416 GLU n 
5 417 LYS n 
5 418 GLY n 
5 419 ALA n 
5 420 ASP n 
5 421 ILE n 
5 422 LYS n 
5 423 ASP n 
5 424 CYS n 
5 425 LEU n 
5 426 ILE n 
5 427 GLY n 
5 428 SER n 
5 429 GLY n 
5 430 GLN n 
5 431 ARG n 
5 432 ILE n 
5 433 GLU n 
5 434 ALA n 
5 435 LYS n 
5 436 ALA n 
5 437 LYS n 
5 438 ARG n 
5 439 VAL n 
5 440 ASN n 
5 441 GLU n 
5 442 VAL n 
5 443 ILE n 
5 444 VAL n 
5 445 GLY n 
5 446 ASN n 
5 447 ASP n 
5 448 GLN n 
5 449 LEU n 
5 450 MET n 
5 451 GLU n 
5 452 ILE n 
6 1   MET n 
6 2   PRO n 
6 3   GLY n 
6 4   LEU n 
6 5   SER n 
6 6   CYS n 
6 7   ARG n 
6 8   PHE n 
6 9   TYR n 
6 10  GLN n 
6 11  HIS n 
6 12  LYS n 
6 13  PHE n 
6 14  PRO n 
6 15  GLU n 
6 16  VAL n 
6 17  GLU n 
6 18  ASP n 
6 19  VAL n 
6 20  VAL n 
6 21  MET n 
6 22  VAL n 
6 23  ASN n 
6 24  VAL n 
6 25  ARG n 
6 26  SER n 
6 27  ILE n 
6 28  ALA n 
6 29  GLU n 
6 30  MET n 
6 31  GLY n 
6 32  ALA n 
6 33  TYR n 
6 34  VAL n 
6 35  SER n 
6 36  LEU n 
6 37  LEU n 
6 38  GLU n 
6 39  TYR n 
6 40  ASN n 
6 41  ASN n 
6 42  ILE n 
6 43  GLU n 
6 44  GLY n 
6 45  MET n 
6 46  ILE n 
6 47  LEU n 
6 48  LEU n 
6 49  SER n 
6 50  GLU n 
6 51  LEU n 
6 52  SER n 
6 53  ARG n 
6 54  ARG n 
6 55  ARG n 
6 56  ILE n 
6 57  ARG n 
6 58  SER n 
6 59  ILE n 
6 60  ASN n 
6 61  LYS n 
6 62  LEU n 
6 63  ILE n 
6 64  ARG n 
6 65  ILE n 
6 66  GLY n 
6 67  ARG n 
6 68  ASN n 
6 69  GLU n 
6 70  CYS n 
6 71  VAL n 
6 72  VAL n 
6 73  VAL n 
6 74  ILE n 
6 75  ARG n 
6 76  VAL n 
6 77  ASP n 
6 78  LYS n 
6 79  GLU n 
6 80  LYS n 
6 81  GLY n 
6 82  TYR n 
6 83  ILE n 
6 84  ASP n 
6 85  LEU n 
6 86  SER n 
6 87  LYS n 
6 88  ARG n 
6 89  ARG n 
6 90  VAL n 
6 91  SER n 
6 92  PRO n 
6 93  GLU n 
6 94  GLU n 
6 95  ALA n 
6 96  ILE n 
6 97  LYS n 
6 98  CYS n 
6 99  GLU n 
6 100 ASP n 
6 101 LYS n 
6 102 PHE n 
6 103 THR n 
6 104 LYS n 
6 105 SER n 
6 106 LYS n 
6 107 THR n 
6 108 VAL n 
6 109 TYR n 
6 110 SER n 
6 111 ILE n 
6 112 LEU n 
6 113 ARG n 
6 114 HIS n 
6 115 VAL n 
6 116 ALA n 
6 117 GLU n 
6 118 VAL n 
6 119 LEU n 
6 120 GLU n 
6 121 TYR n 
6 122 THR n 
6 123 LYS n 
6 124 ASP n 
6 125 GLU n 
6 126 GLN n 
6 127 LEU n 
6 128 GLU n 
6 129 SER n 
6 130 LEU n 
6 131 PHE n 
6 132 GLN n 
6 133 ARG n 
6 134 THR n 
6 135 ALA n 
6 136 TRP n 
6 137 VAL n 
6 138 PHE n 
6 139 ASP n 
6 140 ASP n 
6 141 LYS n 
6 142 TYR n 
6 143 LYS n 
6 144 ARG n 
6 145 PRO n 
6 146 GLY n 
6 147 TYR n 
6 148 GLY n 
6 149 ALA n 
6 150 TYR n 
6 151 ASP n 
6 152 ALA n 
6 153 PHE n 
6 154 LYS n 
6 155 HIS n 
6 156 ALA n 
6 157 VAL n 
6 158 SER n 
6 159 ASP n 
6 160 PRO n 
6 161 SER n 
6 162 ILE n 
6 163 LEU n 
6 164 ASP n 
6 165 SER n 
6 166 LEU n 
6 167 ASP n 
6 168 LEU n 
6 169 ASN n 
6 170 GLU n 
6 171 ASP n 
6 172 GLU n 
6 173 ARG n 
6 174 GLU n 
6 175 VAL n 
6 176 LEU n 
6 177 ILE n 
6 178 ASN n 
6 179 ASN n 
6 180 ILE n 
6 181 ASN n 
6 182 ARG n 
6 183 ARG n 
6 184 LEU n 
6 185 THR n 
6 186 PRO n 
6 187 GLN n 
6 188 ALA n 
6 189 VAL n 
6 190 LYS n 
6 191 ILE n 
6 192 ARG n 
6 193 ALA n 
6 194 ASP n 
6 195 ILE n 
6 196 GLU n 
6 197 VAL n 
6 198 ALA n 
6 199 CYS n 
6 200 TYR n 
6 201 GLY n 
6 202 TYR n 
6 203 GLU n 
6 204 GLY n 
6 205 ILE n 
6 206 ASP n 
6 207 ALA n 
6 208 VAL n 
6 209 LYS n 
6 210 GLU n 
6 211 ALA n 
6 212 LEU n 
6 213 ARG n 
6 214 ALA n 
6 215 GLY n 
6 216 LEU n 
6 217 ASN n 
6 218 CYS n 
6 219 SER n 
6 220 THR n 
6 221 GLU n 
6 222 ASN n 
6 223 MET n 
6 224 PRO n 
6 225 ILE n 
6 226 LYS n 
6 227 ILE n 
6 228 ASN n 
6 229 LEU n 
6 230 ILE n 
6 231 ALA n 
6 232 PRO n 
6 233 PRO n 
6 234 ARG n 
6 235 TYR n 
6 236 VAL n 
6 237 MET n 
6 238 THR n 
6 239 THR n 
6 240 THR n 
6 241 THR n 
6 242 LEU n 
6 243 GLU n 
6 244 ARG n 
6 245 THR n 
6 246 GLU n 
6 247 GLY n 
6 248 LEU n 
6 249 SER n 
6 250 VAL n 
6 251 LEU n 
6 252 SER n 
6 253 GLN n 
6 254 ALA n 
6 255 MET n 
6 256 ALA n 
6 257 VAL n 
6 258 ILE n 
6 259 LYS n 
6 260 GLU n 
6 261 LYS n 
6 262 ILE n 
6 263 GLU n 
6 264 GLU n 
6 265 LYS n 
6 266 ARG n 
6 267 GLY n 
6 268 VAL n 
6 269 PHE n 
6 270 ASN n 
6 271 VAL n 
6 272 GLN n 
6 273 MET n 
6 274 GLU n 
6 275 PRO n 
6 276 LYS n 
6 277 VAL n 
6 278 VAL n 
6 279 THR n 
6 280 ASP n 
6 281 THR n 
6 282 ASP n 
6 283 GLU n 
6 284 THR n 
6 285 GLU n 
6 286 LEU n 
6 287 ALA n 
6 288 ARG n 
6 289 GLN n 
6 290 MET n 
6 291 GLU n 
6 292 ARG n 
6 293 LEU n 
6 294 GLU n 
6 295 ARG n 
6 296 GLU n 
6 297 ASN n 
6 298 ALA n 
6 299 GLU n 
6 300 VAL n 
6 301 ASP n 
6 302 GLY n 
6 303 ASP n 
6 304 ASP n 
6 305 ASP n 
6 306 ALA n 
6 307 GLU n 
6 308 GLU n 
6 309 MET n 
6 310 GLU n 
6 311 ALA n 
6 312 LYS n 
6 313 ALA n 
6 314 GLU n 
6 315 ASP n 
7 1   MET n 
7 2   ALA n 
7 3   GLY n 
7 4   GLY n 
7 5   GLU n 
7 6   ALA n 
7 7   GLY n 
7 8   VAL n 
7 9   THR n 
7 10  LEU n 
7 11  GLY n 
7 12  GLN n 
7 13  PRO n 
7 14  HIS n 
7 15  LEU n 
7 16  SER n 
7 17  ARG n 
7 18  GLN n 
7 19  ASP n 
7 20  LEU n 
7 21  THR n 
7 22  THR n 
7 23  LEU n 
7 24  ASP n 
7 25  VAL n 
7 26  THR n 
7 27  LYS n 
7 28  LEU n 
7 29  THR n 
7 30  PRO n 
7 31  LEU n 
7 32  SER n 
7 33  HIS n 
7 34  GLU n 
7 35  VAL n 
7 36  ILE n 
7 37  SER n 
7 38  ARG n 
7 39  GLN n 
7 40  ALA n 
7 41  THR n 
7 42  ILE n 
7 43  ASN n 
7 44  ILE n 
7 45  GLY n 
7 46  THR n 
7 47  ILE n 
7 48  GLY n 
7 49  HIS n 
7 50  VAL n 
7 51  ALA n 
7 52  HIS n 
7 53  GLY n 
7 54  LYS n 
7 55  SER n 
7 56  THR n 
7 57  VAL n 
7 58  VAL n 
7 59  LYS n 
7 60  ALA n 
7 61  ILE n 
7 62  SER n 
7 63  GLY n 
7 64  VAL n 
7 65  HIS n 
7 66  THR n 
7 67  VAL n 
7 68  ARG n 
7 69  PHE n 
7 70  LYS n 
7 71  ASN n 
7 72  GLU n 
7 73  LEU n 
7 74  GLU n 
7 75  ARG n 
7 76  ASN n 
7 77  ILE n 
7 78  THR n 
7 79  ILE n 
7 80  LYS n 
7 81  LEU n 
7 82  GLY n 
7 83  TYR n 
7 84  ALA n 
7 85  ASN n 
7 86  ALA n 
7 87  LYS n 
7 88  ILE n 
7 89  TYR n 
7 90  LYS n 
7 91  LEU n 
7 92  ASP n 
7 93  ASP n 
7 94  PRO n 
7 95  SER n 
7 96  CYS n 
7 97  PRO n 
7 98  ARG n 
7 99  PRO n 
7 100 GLU n 
7 101 CYS n 
7 102 TYR n 
7 103 ARG n 
7 104 SER n 
7 105 CYS n 
7 106 GLY n 
7 107 SER n 
7 108 SER n 
7 109 THR n 
7 110 PRO n 
7 111 ASP n 
7 112 GLU n 
7 113 PHE n 
7 114 PRO n 
7 115 THR n 
7 116 ASP n 
7 117 ILE n 
7 118 PRO n 
7 119 GLY n 
7 120 THR n 
7 121 LYS n 
7 122 GLY n 
7 123 ASN n 
7 124 PHE n 
7 125 LYS n 
7 126 LEU n 
7 127 VAL n 
7 128 ARG n 
7 129 HIS n 
7 130 VAL n 
7 131 SER n 
7 132 PHE n 
7 133 VAL n 
7 134 ASP n 
7 135 CYS n 
7 136 PRO n 
7 137 GLY n 
7 138 HIS n 
7 139 ASP n 
7 140 ILE n 
7 141 LEU n 
7 142 MET n 
7 143 ALA n 
7 144 THR n 
7 145 MET n 
7 146 LEU n 
7 147 ASN n 
7 148 GLY n 
7 149 ALA n 
7 150 ALA n 
7 151 VAL n 
7 152 MET n 
7 153 ASP n 
7 154 ALA n 
7 155 ALA n 
7 156 LEU n 
7 157 LEU n 
7 158 LEU n 
7 159 ILE n 
7 160 ALA n 
7 161 GLY n 
7 162 ASN n 
7 163 GLU n 
7 164 SER n 
7 165 CYS n 
7 166 PRO n 
7 167 GLN n 
7 168 PRO n 
7 169 GLN n 
7 170 THR n 
7 171 SER n 
7 172 GLU n 
7 173 HIS n 
7 174 LEU n 
7 175 ALA n 
7 176 ALA n 
7 177 ILE n 
7 178 GLU n 
7 179 ILE n 
7 180 MET n 
7 181 LYS n 
7 182 LEU n 
7 183 LYS n 
7 184 HIS n 
7 185 ILE n 
7 186 LEU n 
7 187 ILE n 
7 188 LEU n 
7 189 GLN n 
7 190 ASN n 
7 191 LYS n 
7 192 ILE n 
7 193 ASP n 
7 194 LEU n 
7 195 VAL n 
7 196 LYS n 
7 197 GLU n 
7 198 SER n 
7 199 GLN n 
7 200 ALA n 
7 201 LYS n 
7 202 GLU n 
7 203 GLN n 
7 204 TYR n 
7 205 GLU n 
7 206 GLN n 
7 207 ILE n 
7 208 LEU n 
7 209 ALA n 
7 210 PHE n 
7 211 VAL n 
7 212 GLN n 
7 213 GLY n 
7 214 THR n 
7 215 VAL n 
7 216 ALA n 
7 217 GLU n 
7 218 GLY n 
7 219 ALA n 
7 220 PRO n 
7 221 ILE n 
7 222 ILE n 
7 223 PRO n 
7 224 ILE n 
7 225 SER n 
7 226 ALA n 
7 227 GLN n 
7 228 LEU n 
7 229 LYS n 
7 230 TYR n 
7 231 ASN n 
7 232 ILE n 
7 233 GLU n 
7 234 VAL n 
7 235 VAL n 
7 236 CYS n 
7 237 GLU n 
7 238 TYR n 
7 239 ILE n 
7 240 VAL n 
7 241 LYS n 
7 242 LYS n 
7 243 ILE n 
7 244 PRO n 
7 245 VAL n 
7 246 PRO n 
7 247 PRO n 
7 248 ARG n 
7 249 ASP n 
7 250 PHE n 
7 251 THR n 
7 252 SER n 
7 253 GLU n 
7 254 PRO n 
7 255 ARG n 
7 256 LEU n 
7 257 ILE n 
7 258 VAL n 
7 259 ILE n 
7 260 ARG n 
7 261 SER n 
7 262 PHE n 
7 263 ASP n 
7 264 VAL n 
7 265 ASN n 
7 266 LYS n 
7 267 PRO n 
7 268 GLY n 
7 269 CYS n 
7 270 GLU n 
7 271 VAL n 
7 272 ASP n 
7 273 ASP n 
7 274 LEU n 
7 275 LYS n 
7 276 GLY n 
7 277 GLY n 
7 278 VAL n 
7 279 ALA n 
7 280 GLY n 
7 281 GLY n 
7 282 SER n 
7 283 ILE n 
7 284 LEU n 
7 285 LYS n 
7 286 GLY n 
7 287 VAL n 
7 288 LEU n 
7 289 LYS n 
7 290 VAL n 
7 291 GLY n 
7 292 GLN n 
7 293 GLU n 
7 294 ILE n 
7 295 GLU n 
7 296 VAL n 
7 297 ARG n 
7 298 PRO n 
7 299 GLY n 
7 300 ILE n 
7 301 VAL n 
7 302 SER n 
7 303 LYS n 
7 304 ALA n 
7 305 SER n 
7 306 GLU n 
7 307 GLY n 
7 308 LYS n 
7 309 LEU n 
7 310 MET n 
7 311 CYS n 
7 312 LYS n 
7 313 PRO n 
7 314 LYS n 
7 315 PHE n 
7 316 SER n 
7 317 LYS n 
7 318 ILE n 
7 319 VAL n 
7 320 SER n 
7 321 LEU n 
7 322 PHE n 
7 323 ALA n 
7 324 GLU n 
7 325 HIS n 
7 326 ASN n 
7 327 ASP n 
7 328 LEU n 
7 329 GLN n 
7 330 TYR n 
7 331 ALA n 
7 332 ALA n 
7 333 PRO n 
7 334 GLY n 
7 335 GLY n 
7 336 LEU n 
7 337 ILE n 
7 338 GLY n 
7 339 VAL n 
7 340 GLY n 
7 341 THR n 
7 342 LYS n 
7 343 ILE n 
7 344 ASP n 
7 345 PRO n 
7 346 THR n 
7 347 LEU n 
7 348 CYS n 
7 349 ARG n 
7 350 ALA n 
7 351 ASP n 
7 352 ARG n 
7 353 MET n 
7 354 VAL n 
7 355 GLY n 
7 356 GLN n 
7 357 VAL n 
7 358 LEU n 
7 359 GLY n 
7 360 ALA n 
7 361 VAL n 
7 362 GLY n 
7 363 ALA n 
7 364 LEU n 
7 365 PRO n 
7 366 GLU n 
7 367 ILE n 
7 368 PHE n 
7 369 THR n 
7 370 GLU n 
7 371 LEU n 
7 372 GLU n 
7 373 ILE n 
7 374 SER n 
7 375 TYR n 
7 376 PHE n 
7 377 LEU n 
7 378 LEU n 
7 379 ARG n 
7 380 ARG n 
7 381 LEU n 
7 382 LEU n 
7 383 GLY n 
7 384 VAL n 
7 385 ARG n 
7 386 THR n 
7 387 GLU n 
7 388 GLY n 
7 389 ASP n 
7 390 LYS n 
7 391 LYS n 
7 392 ALA n 
7 393 ALA n 
7 394 LYS n 
7 395 VAL n 
7 396 GLN n 
7 397 LYS n 
7 398 LEU n 
7 399 SER n 
7 400 LYS n 
7 401 ASN n 
7 402 GLU n 
7 403 VAL n 
7 404 LEU n 
7 405 MET n 
7 406 VAL n 
7 407 ASN n 
7 408 ILE n 
7 409 GLY n 
7 410 SER n 
7 411 LEU n 
7 412 SER n 
7 413 THR n 
7 414 GLY n 
7 415 GLY n 
7 416 ARG n 
7 417 VAL n 
7 418 SER n 
7 419 ALA n 
7 420 VAL n 
7 421 LYS n 
7 422 ALA n 
7 423 ASP n 
7 424 LEU n 
7 425 GLY n 
7 426 LYS n 
7 427 ILE n 
7 428 VAL n 
7 429 LEU n 
7 430 THR n 
7 431 ASN n 
7 432 PRO n 
7 433 VAL n 
7 434 CYS n 
7 435 THR n 
7 436 GLU n 
7 437 VAL n 
7 438 GLY n 
7 439 GLU n 
7 440 LYS n 
7 441 ILE n 
7 442 ALA n 
7 443 LEU n 
7 444 SER n 
7 445 ARG n 
7 446 ARG n 
7 447 VAL n 
7 448 GLU n 
7 449 LYS n 
7 450 HIS n 
7 451 TRP n 
7 452 ARG n 
7 453 LEU n 
7 454 ILE n 
7 455 GLY n 
7 456 TRP n 
7 457 GLY n 
7 458 GLN n 
7 459 ILE n 
7 460 ARG n 
7 461 ARG n 
7 462 GLY n 
7 463 VAL n 
7 464 THR n 
7 465 ILE n 
7 466 LYS n 
7 467 PRO n 
7 468 THR n 
7 469 VAL n 
7 470 ASP n 
7 471 ASP n 
7 472 ASP n 
8 1   UNK n 
8 2   UNK n 
8 3   UNK n 
8 4   UNK n 
8 5   UNK n 
8 6   UNK n 
8 7   UNK n 
8 8   UNK n 
8 9   UNK n 
8 10  UNK n 
8 11  UNK n 
8 12  UNK n 
8 13  UNK n 
8 14  UNK n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 721 Human ? 'EIF2B5, EIF2BE' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 368 Human ? 'EIF2B2, EIF2BB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 523 Human ? 'EIF2B4, EIF2BD' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 305 Human ? 'EIF2B1, EIF2BA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 452 Human ? EIF2B3           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 315 Human ? 'EIF2S1, EIF2A'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 472 Human ? 'EIF2S3, EIF2G'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 14  human ? ?                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP EI2BE_HUMAN Q13144 ? 1 
;MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTL
EFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNIN
ITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYP
LTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGV
RVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGT
LQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAA
DHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
;
1 
2 UNP EI2BB_HUMAN P49770 ? 2 
;PGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNM
VRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHS
NEVIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTILA
NGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPELI
TLFISNIGGNAPSYIYRLMSELYHPDDHVL
;
2 
3 UNP EI2BD_HUMAN Q9UI10 ? 3 
;MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPES
GIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVK
KPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSELRAAIDRYVQEKIVLAAQAIS
RFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSK
VLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
;
1 
4 UNP EI2BA_HUMAN Q14232 ? 4 
;MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
;
1 
5 UNP EI2BG_HUMAN Q9NR50 ? 5 
;MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPD
DADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGV
DSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYM
EANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEE
GSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
;
1 
6 UNP IF2A_HUMAN  P05198 ? 6 
;MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEK
GYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDP
SILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED
;
1 
7 UNP IF2G_HUMAN  P41091 ? 7 
;MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIK
LGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIA
GNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVS
LFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSK
NEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
;
1 
8 PDB 6O81        6O81   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6O81 A 1  ? 721 ? Q13144 1 ? 721 ? 1 721 
2  1 6O81 B 1  ? 721 ? Q13144 1 ? 721 ? 1 721 
3  2 6O81 C 19 ? 368 ? P49770 2 ? 351 ? 2 351 
4  2 6O81 D 19 ? 368 ? P49770 2 ? 351 ? 2 351 
5  3 6O81 E 1  ? 523 ? Q9UI10 1 ? 523 ? 1 523 
6  3 6O81 F 1  ? 523 ? Q9UI10 1 ? 523 ? 1 523 
7  4 6O81 G 1  ? 305 ? Q14232 1 ? 305 ? 1 305 
8  4 6O81 H 1  ? 305 ? Q14232 1 ? 305 ? 1 305 
9  5 6O81 I 1  ? 452 ? Q9NR50 1 ? 452 ? 1 452 
10 5 6O81 J 1  ? 452 ? Q9NR50 1 ? 452 ? 1 452 
11 6 6O81 L 1  ? 315 ? P05198 1 ? 315 ? 0 314 
12 6 6O81 M 1  ? 315 ? P05198 1 ? 315 ? 0 314 
13 7 6O81 S 1  ? 472 ? P41091 1 ? 472 ? 1 472 
14 7 6O81 T 1  ? 472 ? P41091 1 ? 472 ? 1 472 
15 8 6O81 d 1  ? 14  ? 6O81   3 ? 16  ? 3 16  
16 8 6O81 e 1  ? 14  ? 6O81   3 ? 16  ? 3 16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6O81 LYS A 563 ? UNP Q13144 ARG 563 conflict                563 1  
1  6O81 GLY A 678 ? UNP Q13144 GLU 678 conflict                678 2  
2  6O81 LYS B 563 ? UNP Q13144 ARG 563 conflict                563 3  
2  6O81 GLY B 678 ? UNP Q13144 GLU 678 conflict                678 4  
3  6O81 MET C 1   ? UNP P49770 ?   ?   'initiating methionine' -16 5  
3  6O81 HIS C 2   ? UNP P49770 ?   ?   'expression tag'        -15 6  
3  6O81 HIS C 3   ? UNP P49770 ?   ?   'expression tag'        -14 7  
3  6O81 HIS C 4   ? UNP P49770 ?   ?   'expression tag'        -13 8  
3  6O81 HIS C 5   ? UNP P49770 ?   ?   'expression tag'        -12 9  
3  6O81 HIS C 6   ? UNP P49770 ?   ?   'expression tag'        -11 10 
3  6O81 HIS C 7   ? UNP P49770 ?   ?   'expression tag'        -10 11 
3  6O81 GLY C 8   ? UNP P49770 ?   ?   'expression tag'        -9  12 
3  6O81 GLY C 9   ? UNP P49770 ?   ?   'expression tag'        -8  13 
3  6O81 GLY C 10  ? UNP P49770 ?   ?   'expression tag'        -7  14 
3  6O81 SER C 11  ? UNP P49770 ?   ?   'expression tag'        -6  15 
3  6O81 GLU C 12  ? UNP P49770 ?   ?   'expression tag'        -5  16 
3  6O81 ASN C 13  ? UNP P49770 ?   ?   'expression tag'        -4  17 
3  6O81 LEU C 14  ? UNP P49770 ?   ?   'expression tag'        -3  18 
3  6O81 TYR C 15  ? UNP P49770 ?   ?   'expression tag'        -2  19 
3  6O81 PHE C 16  ? UNP P49770 ?   ?   'expression tag'        -1  20 
3  6O81 GLN C 17  ? UNP P49770 ?   ?   'expression tag'        0   21 
3  6O81 SER C 18  ? UNP P49770 ?   ?   'expression tag'        1   22 
4  6O81 MET D 1   ? UNP P49770 ?   ?   'initiating methionine' -16 23 
4  6O81 HIS D 2   ? UNP P49770 ?   ?   'expression tag'        -15 24 
4  6O81 HIS D 3   ? UNP P49770 ?   ?   'expression tag'        -14 25 
4  6O81 HIS D 4   ? UNP P49770 ?   ?   'expression tag'        -13 26 
4  6O81 HIS D 5   ? UNP P49770 ?   ?   'expression tag'        -12 27 
4  6O81 HIS D 6   ? UNP P49770 ?   ?   'expression tag'        -11 28 
4  6O81 HIS D 7   ? UNP P49770 ?   ?   'expression tag'        -10 29 
4  6O81 GLY D 8   ? UNP P49770 ?   ?   'expression tag'        -9  30 
4  6O81 GLY D 9   ? UNP P49770 ?   ?   'expression tag'        -8  31 
4  6O81 GLY D 10  ? UNP P49770 ?   ?   'expression tag'        -7  32 
4  6O81 SER D 11  ? UNP P49770 ?   ?   'expression tag'        -6  33 
4  6O81 GLU D 12  ? UNP P49770 ?   ?   'expression tag'        -5  34 
4  6O81 ASN D 13  ? UNP P49770 ?   ?   'expression tag'        -4  35 
4  6O81 LEU D 14  ? UNP P49770 ?   ?   'expression tag'        -3  36 
4  6O81 TYR D 15  ? UNP P49770 ?   ?   'expression tag'        -2  37 
4  6O81 PHE D 16  ? UNP P49770 ?   ?   'expression tag'        -1  38 
4  6O81 GLN D 17  ? UNP P49770 ?   ?   'expression tag'        0   39 
4  6O81 SER D 18  ? UNP P49770 ?   ?   'expression tag'        1   40 
13 6O81 ALA S 304 ? UNP P41091 ASP 304 conflict                304 41 
13 6O81 LYS S 314 ? UNP P41091 ILE 314 conflict                314 42 
14 6O81 ALA T 304 ? UNP P41091 ASP 304 conflict                304 43 
14 6O81 LYS T 314 ? UNP P41091 ILE 314 conflict                314 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                     ?     
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ?     
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ?     
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ?     
'C4 H7 N O4'        133.103 
C7B non-polymer         . '2-(4-chloranylphenoxy)-~{N}-[4-[2-(4-chloranylphenoxy)ethanoylamino]cyclohexyl]ethanamide' ISRIB 
'C22 H24 Cl2 N2 O4' 451.343 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ?     
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ?     
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ?     
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ?     
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ?     
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ?     
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ?     
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ?     
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ?     
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ?     
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ?     
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                      ?     
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ?     
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ?     
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ?     
'C9 H11 N O3'       181.189 
UNK 'L-peptide linking' . UNKNOWN                                                                                     ?     
'C4 H9 N O2'        103.120 
VAL 'L-peptide linking' y VALINE                                                                                      ?     
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6O81 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6O81 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.003 ? 34128 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.692 ? 46617 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 7.187 ? 20335 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.049 ? 5692  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006 ? 6128  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6O81 
_struct.title                        
;Electron cryo-microscopy of the eukaryotic translation initiation factor 2B bound to translation initiation factor 2 from Homo sapiens
;
_struct.pdbx_descriptor              
;Translation initiation factor eIF-2B subunit epsilon, Translation initiation factor eIF-2B subunit beta, Translation initiation factor eIF-2B subunit delta, Translation initiation factor eIF-2B subunit alpha, Translation initiation factor eIF-2B subunit gamma, Eukaryotic translation initiation factor 2 subunit 1, Eukaryotic translation initiation factor 2 subunit 3, Translation initiation factor eiF2 beta-subunit
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6O81 
_struct_keywords.text            'Translation initiation, TRANSLATION' 
_struct_keywords.pdbx_keywords   TRANSLATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ALA A 74  ? GLY A 87  ? ALA A 74  GLY A 87  1 ? 14 
HELX_P HELX_P2   AA2 LYS A 98  ? LEU A 107 ? LYS A 98  LEU A 107 1 ? 10 
HELX_P HELX_P3   AA3 SER A 130 ? ALA A 142 ? SER A 130 ALA A 142 1 ? 13 
HELX_P HELX_P4   AA4 ILE A 161 ? GLU A 175 ? ILE A 161 GLU A 175 1 ? 15 
HELX_P HELX_P5   AA5 LEU A 228 ? SER A 234 ? LEU A 228 SER A 234 1 ? 7  
HELX_P HELX_P6   AA6 PRO A 254 ? ASN A 263 ? PRO A 254 ASN A 263 1 ? 10 
HELX_P HELX_P7   AA7 THR A 268 ? ASN A 279 ? THR A 268 ASN A 279 1 ? 12 
HELX_P HELX_P8   AA8 ASN A 302 ? ARG A 315 ? ASN A 302 ARG A 315 1 ? 14 
HELX_P HELX_P9   AA9 SER A 330 ? SER A 334 ? SER A 330 SER A 334 5 ? 5  
HELX_P HELX_P10  AB1 ARG A 339 ? ASN A 341 ? ARG A 339 ASN A 341 5 ? 3  
HELX_P HELX_P11  AB2 ILE A 550 ? GLU A 567 ? ILE A 550 GLU A 567 1 ? 18 
HELX_P HELX_P12  AB3 SER A 570 ? ASN A 586 ? SER A 570 ASN A 586 1 ? 17 
HELX_P HELX_P13  AB4 SER A 588 ? GLN A 607 ? SER A 588 GLN A 607 1 ? 20 
HELX_P HELX_P14  AB5 ASP A 613 ? TRP A 628 ? ASP A 613 TRP A 628 1 ? 16 
HELX_P HELX_P15  AB6 TRP A 628 ? ILE A 636 ? TRP A 628 ILE A 636 1 ? 9  
HELX_P HELX_P16  AB7 ARG A 638 ? HIS A 656 ? ARG A 638 HIS A 656 1 ? 19 
HELX_P HELX_P17  AB8 GLU A 657 ? ILE A 661 ? GLU A 657 ILE A 661 5 ? 5  
HELX_P HELX_P18  AB9 SER A 662 ? TYR A 671 ? SER A 662 TYR A 671 1 ? 10 
HELX_P HELX_P19  AC1 ALA A 677 ? GLN A 687 ? ALA A 677 GLN A 687 1 ? 11 
HELX_P HELX_P20  AC2 LYS A 693 ? LYS A 699 ? LYS A 693 LYS A 699 1 ? 7  
HELX_P HELX_P21  AC3 ASN A 700 ? GLU A 715 ? ASN A 700 GLU A 715 1 ? 16 
HELX_P HELX_P22  AC4 ALA B 74  ? GLY B 87  ? ALA B 74  GLY B 87  1 ? 14 
HELX_P HELX_P23  AC5 LYS B 98  ? LEU B 107 ? LYS B 98  LEU B 107 1 ? 10 
HELX_P HELX_P24  AC6 SER B 130 ? ALA B 142 ? SER B 130 ALA B 142 1 ? 13 
HELX_P HELX_P25  AC7 ILE B 161 ? GLU B 175 ? ILE B 161 GLU B 175 1 ? 15 
HELX_P HELX_P26  AC8 LEU B 228 ? SER B 234 ? LEU B 228 SER B 234 1 ? 7  
HELX_P HELX_P27  AC9 PRO B 254 ? ASN B 263 ? PRO B 254 ASN B 263 1 ? 10 
HELX_P HELX_P28  AD1 THR B 268 ? ASN B 279 ? THR B 268 ASN B 279 1 ? 12 
HELX_P HELX_P29  AD2 ASN B 302 ? ARG B 315 ? ASN B 302 ARG B 315 1 ? 14 
HELX_P HELX_P30  AD3 SER B 330 ? SER B 334 ? SER B 330 SER B 334 5 ? 5  
HELX_P HELX_P31  AD4 ARG B 339 ? ASN B 341 ? ARG B 339 ASN B 341 5 ? 3  
HELX_P HELX_P32  AD5 ILE B 550 ? GLU B 567 ? ILE B 550 GLU B 567 1 ? 18 
HELX_P HELX_P33  AD6 SER B 570 ? ASN B 586 ? SER B 570 ASN B 586 1 ? 17 
HELX_P HELX_P34  AD7 SER B 588 ? GLN B 607 ? SER B 588 GLN B 607 1 ? 20 
HELX_P HELX_P35  AD8 ASP B 613 ? TRP B 628 ? ASP B 613 TRP B 628 1 ? 16 
HELX_P HELX_P36  AD9 TRP B 628 ? ILE B 636 ? TRP B 628 ILE B 636 1 ? 9  
HELX_P HELX_P37  AE1 ARG B 638 ? HIS B 656 ? ARG B 638 HIS B 656 1 ? 19 
HELX_P HELX_P38  AE2 GLU B 657 ? ILE B 661 ? GLU B 657 ILE B 661 5 ? 5  
HELX_P HELX_P39  AE3 SER B 662 ? TYR B 671 ? SER B 662 TYR B 671 1 ? 10 
HELX_P HELX_P40  AE4 ALA B 677 ? GLN B 687 ? ALA B 677 GLN B 687 1 ? 11 
HELX_P HELX_P41  AE5 LYS B 693 ? LYS B 699 ? LYS B 693 LYS B 699 1 ? 7  
HELX_P HELX_P42  AE6 ASN B 700 ? GLU B 715 ? ASN B 700 GLU B 715 1 ? 16 
HELX_P HELX_P43  AE7 SER C 26  ? ARG C 41  ? SER C 9   ARG C 24  1 ? 16 
HELX_P HELX_P44  AE8 SER C 47  ? ASP C 65  ? SER C 30  ASP C 48  1 ? 19 
HELX_P HELX_P45  AE9 ASN C 70  ? GLN C 89  ? ASN C 53  GLN C 72  1 ? 20 
HELX_P HELX_P46  AF1 THR C 93  ? GLY C 115 ? THR C 76  GLY C 98  1 ? 23 
HELX_P HELX_P47  AF2 GLN C 145 ? GLY C 163 ? GLN C 128 GLY C 146 1 ? 19 
HELX_P HELX_P48  AF3 THR C 164 ? ALA C 172 ? THR C 147 ALA C 155 1 ? 9  
HELX_P HELX_P49  AF4 LEU C 173 ? HIS C 175 ? LEU C 156 HIS C 158 5 ? 3  
HELX_P HELX_P50  AF5 SER C 188 ? ALA C 199 ? SER C 171 ALA C 182 1 ? 12 
HELX_P HELX_P51  AF6 GLN C 216 ? SER C 225 ? GLN C 199 SER C 208 1 ? 10 
HELX_P HELX_P52  AF7 ALA C 238 ? MET C 243 ? ALA C 221 MET C 226 1 ? 6  
HELX_P HELX_P53  AF8 GLY C 267 ? HIS C 278 ? GLY C 250 HIS C 261 1 ? 12 
HELX_P HELX_P54  AF9 PRO C 287 ? LEU C 291 ? PRO C 270 LEU C 274 5 ? 5  
HELX_P HELX_P55  AG1 GLY C 317 ? GLU C 321 ? GLY C 300 GLU C 304 5 ? 5  
HELX_P HELX_P56  AG2 PRO C 334 ? ILE C 338 ? PRO C 317 ILE C 321 5 ? 5  
HELX_P HELX_P57  AG3 TYR C 352 ? TYR C 361 ? TYR C 335 TYR C 344 1 ? 10 
HELX_P HELX_P58  AG4 HIS C 362 ? VAL C 367 ? HIS C 345 VAL C 350 5 ? 6  
HELX_P HELX_P59  AG5 SER D 26  ? GLY D 42  ? SER D 9   GLY D 25  1 ? 17 
HELX_P HELX_P60  AG6 SER D 47  ? ASP D 65  ? SER D 30  ASP D 48  1 ? 19 
HELX_P HELX_P61  AG7 ASN D 70  ? GLN D 89  ? ASN D 53  GLN D 72  1 ? 20 
HELX_P HELX_P62  AG8 THR D 93  ? GLY D 115 ? THR D 76  GLY D 98  1 ? 23 
HELX_P HELX_P63  AG9 TYR D 143 ? GLY D 163 ? TYR D 126 GLY D 146 1 ? 21 
HELX_P HELX_P64  AH1 GLY D 163 ? GLN D 171 ? GLY D 146 GLN D 154 1 ? 9  
HELX_P HELX_P65  AH2 ALA D 172 ? HIS D 175 ? ALA D 155 HIS D 158 5 ? 4  
HELX_P HELX_P66  AH3 SER D 188 ? ALA D 199 ? SER D 171 ALA D 182 1 ? 12 
HELX_P HELX_P67  AH4 GLN D 216 ? SER D 225 ? GLN D 199 SER D 208 1 ? 10 
HELX_P HELX_P68  AH5 THR D 235 ? ALA D 237 ? THR D 218 ALA D 220 5 ? 3  
HELX_P HELX_P69  AH6 ALA D 238 ? SER D 244 ? ALA D 221 SER D 227 1 ? 7  
HELX_P HELX_P70  AH7 GLY D 267 ? HIS D 278 ? GLY D 250 HIS D 261 1 ? 12 
HELX_P HELX_P71  AH8 ALA D 307 ? VAL D 311 ? ALA D 290 VAL D 294 5 ? 5  
HELX_P HELX_P72  AH9 GLY D 317 ? GLU D 321 ? GLY D 300 GLU D 304 5 ? 5  
HELX_P HELX_P73  AI1 PRO D 334 ? ILE D 338 ? PRO D 317 ILE D 321 5 ? 5  
HELX_P HELX_P74  AI2 TYR D 352 ? TYR D 361 ? TYR D 335 TYR D 344 1 ? 10 
HELX_P HELX_P75  AI3 HIS D 362 ? HIS D 366 ? HIS D 345 HIS D 349 5 ? 5  
HELX_P HELX_P76  AI4 VAL E 177 ? SER E 181 ? VAL E 177 SER E 181 5 ? 5  
HELX_P HELX_P77  AI5 SER E 191 ? MET E 196 ? SER E 191 MET E 196 5 ? 6  
HELX_P HELX_P78  AI6 HIS E 204 ? GLN E 216 ? HIS E 204 GLN E 216 1 ? 13 
HELX_P HELX_P79  AI7 GLY E 221 ? ASP E 239 ? GLY E 221 ASP E 239 1 ? 19 
HELX_P HELX_P80  AI8 GLU E 247 ? ARG E 267 ? GLU E 247 ARG E 267 1 ? 21 
HELX_P HELX_P81  AI9 SER E 270 ? SER E 286 ? SER E 270 SER E 286 1 ? 17 
HELX_P HELX_P82  AJ1 ARG E 292 ? GLN E 325 ? ARG E 292 GLN E 325 1 ? 34 
HELX_P HELX_P83  AJ2 SER E 339 ? GLY E 353 ? SER E 339 GLY E 353 1 ? 15 
HELX_P HELX_P84  AJ3 GLU E 368 ? HIS E 378 ? GLU E 368 HIS E 378 1 ? 11 
HELX_P HELX_P85  AJ4 ALA E 390 ? LEU E 395 ? ALA E 390 LEU E 395 1 ? 6  
HELX_P HELX_P86  AJ5 THR E 420 ? HIS E 430 ? THR E 420 HIS E 430 1 ? 11 
HELX_P HELX_P87  AJ6 GLU E 439 ? PHE E 443 ? GLU E 439 PHE E 443 5 ? 5  
HELX_P HELX_P88  AJ7 ASP E 459 ? LEU E 463 ? ASP E 459 LEU E 463 5 ? 5  
HELX_P HELX_P89  AJ8 ASN E 475 ? HIS E 479 ? ASN E 475 HIS E 479 5 ? 5  
HELX_P HELX_P90  AJ9 PRO E 508 ? SER E 510 ? PRO E 508 SER E 510 5 ? 3  
HELX_P HELX_P91  AK1 SER E 511 ? VAL E 518 ? SER E 511 VAL E 518 1 ? 8  
HELX_P HELX_P92  AK2 VAL F 177 ? SER F 181 ? VAL F 177 SER F 181 5 ? 5  
HELX_P HELX_P93  AK3 SER F 191 ? MET F 196 ? SER F 191 MET F 196 5 ? 6  
HELX_P HELX_P94  AK4 HIS F 204 ? GLN F 216 ? HIS F 204 GLN F 216 1 ? 13 
HELX_P HELX_P95  AK5 GLY F 221 ? ASP F 239 ? GLY F 221 ASP F 239 1 ? 19 
HELX_P HELX_P96  AK6 GLU F 247 ? ARG F 267 ? GLU F 247 ARG F 267 1 ? 21 
HELX_P HELX_P97  AK7 SER F 270 ? SER F 286 ? SER F 270 SER F 286 1 ? 17 
HELX_P HELX_P98  AK8 ARG F 292 ? GLN F 325 ? ARG F 292 GLN F 325 1 ? 34 
HELX_P HELX_P99  AK9 SER F 339 ? GLU F 352 ? SER F 339 GLU F 352 1 ? 14 
HELX_P HELX_P100 AL1 GLU F 368 ? HIS F 378 ? GLU F 368 HIS F 378 1 ? 11 
HELX_P HELX_P101 AL2 ALA F 390 ? LEU F 395 ? ALA F 390 LEU F 395 1 ? 6  
HELX_P HELX_P102 AL3 THR F 420 ? HIS F 430 ? THR F 420 HIS F 430 1 ? 11 
HELX_P HELX_P103 AL4 GLU F 439 ? PHE F 443 ? GLU F 439 PHE F 443 5 ? 5  
HELX_P HELX_P104 AL5 ASP F 459 ? LEU F 463 ? ASP F 459 LEU F 463 5 ? 5  
HELX_P HELX_P105 AL6 PRO F 508 ? SER F 510 ? PRO F 508 SER F 510 5 ? 3  
HELX_P HELX_P106 AL7 SER F 511 ? VAL F 518 ? SER F 511 VAL F 518 1 ? 8  
HELX_P HELX_P107 AL8 GLU G 5   ? GLU G 16  ? GLU G 5   GLU G 16  1 ? 12 
HELX_P HELX_P108 AL9 ALA G 21  ? LYS G 38  ? ALA G 21  LYS G 38  1 ? 18 
HELX_P HELX_P109 AM1 ILE G 42  ? ASP G 60  ? ILE G 42  ASP G 60  1 ? 19 
HELX_P HELX_P110 AM2 SER G 62  ? TYR G 83  ? SER G 62  TYR G 83  1 ? 22 
HELX_P HELX_P111 AM3 ASP G 85  ? LEU G 106 ? ASP G 85  LEU G 106 1 ? 22 
HELX_P HELX_P112 AM4 LEU G 106 ? HIS G 116 ? LEU G 106 HIS G 116 1 ? 11 
HELX_P HELX_P113 AM5 THR G 117 ? ILE G 119 ? THR G 117 ILE G 119 5 ? 3  
HELX_P HELX_P114 AM6 SER G 131 ? ALA G 144 ? SER G 131 ALA G 144 1 ? 14 
HELX_P HELX_P115 AM7 SER G 160 ? HIS G 170 ? SER G 160 HIS G 170 1 ? 11 
HELX_P HELX_P116 AM8 GLY G 211 ? GLN G 222 ? GLY G 211 GLN G 222 1 ? 12 
HELX_P HELX_P117 AM9 GLU G 231 ? PHE G 235 ? GLU G 231 PHE G 235 5 ? 5  
HELX_P HELX_P118 AN1 ALA G 277 ? ILE G 281 ? ALA G 277 ILE G 281 5 ? 5  
HELX_P HELX_P119 AN2 SER G 294 ? TYR G 304 ? SER G 294 TYR G 304 1 ? 11 
HELX_P HELX_P120 AN3 GLU H 5   ? GLU H 16  ? GLU H 5   GLU H 16  1 ? 12 
HELX_P HELX_P121 AN4 ALA H 21  ? LYS H 38  ? ALA H 21  LYS H 38  1 ? 18 
HELX_P HELX_P122 AN5 ILE H 42  ? ASP H 60  ? ILE H 42  ASP H 60  1 ? 19 
HELX_P HELX_P123 AN6 SER H 62  ? TYR H 83  ? SER H 62  TYR H 83  1 ? 22 
HELX_P HELX_P124 AN7 ASP H 85  ? LEU H 106 ? ASP H 85  LEU H 106 1 ? 22 
HELX_P HELX_P125 AN8 LEU H 106 ? HIS H 116 ? LEU H 106 HIS H 116 1 ? 11 
HELX_P HELX_P126 AN9 THR H 117 ? ILE H 119 ? THR H 117 ILE H 119 5 ? 3  
HELX_P HELX_P127 AO1 SER H 131 ? ALA H 144 ? SER H 131 ALA H 144 1 ? 14 
HELX_P HELX_P128 AO2 SER H 160 ? HIS H 170 ? SER H 160 HIS H 170 1 ? 11 
HELX_P HELX_P129 AO3 GLY H 211 ? GLN H 222 ? GLY H 211 GLN H 222 1 ? 12 
HELX_P HELX_P130 AO4 GLU H 231 ? PHE H 235 ? GLU H 231 PHE H 235 5 ? 5  
HELX_P HELX_P131 AO5 ALA H 277 ? ILE H 281 ? ALA H 277 ILE H 281 5 ? 5  
HELX_P HELX_P132 AO6 SER H 294 ? TYR H 304 ? SER H 294 TYR H 304 1 ? 11 
HELX_P HELX_P133 AO7 ILE I 36  ? VAL I 46  ? ILE I 36  VAL I 46  1 ? 11 
HELX_P HELX_P134 AO8 ALA I 62  ? LYS I 68  ? ALA I 62  LYS I 68  1 ? 7  
HELX_P HELX_P135 AO9 GLY I 85  ? ILE I 93  ? GLY I 85  ILE I 93  1 ? 9  
HELX_P HELX_P136 AP1 TYR I 94  ? LEU I 97  ? TYR I 94  LEU I 97  5 ? 4  
HELX_P HELX_P137 AP2 LEU I 114 ? TYR I 124 ? LEU I 114 TYR I 124 1 ? 11 
HELX_P HELX_P138 AP3 GLY I 184 ? HIS I 190 ? GLY I 184 HIS I 190 1 ? 7  
HELX_P HELX_P139 AP4 LYS I 208 ? ASN I 218 ? LYS I 208 ASN I 218 1 ? 11 
HELX_P HELX_P140 AP5 SER I 223 ? LEU I 228 ? SER I 223 LEU I 228 1 ? 6  
HELX_P HELX_P141 AP6 ILE I 229 ? GLN I 236 ? ILE I 229 GLN I 236 1 ? 8  
HELX_P HELX_P142 AP7 CYS I 281 ? ASP I 292 ? CYS I 281 ASP I 292 1 ? 12 
HELX_P HELX_P143 AP8 ILE J 36  ? VAL J 46  ? ILE J 36  VAL J 46  1 ? 11 
HELX_P HELX_P144 AP9 ALA J 62  ? LYS J 68  ? ALA J 62  LYS J 68  1 ? 7  
HELX_P HELX_P145 AQ1 GLY J 85  ? ILE J 93  ? GLY J 85  ILE J 93  1 ? 9  
HELX_P HELX_P146 AQ2 TYR J 94  ? LEU J 97  ? TYR J 94  LEU J 97  5 ? 4  
HELX_P HELX_P147 AQ3 LEU J 114 ? TYR J 124 ? LEU J 114 TYR J 124 1 ? 11 
HELX_P HELX_P148 AQ4 GLY J 184 ? HIS J 190 ? GLY J 184 HIS J 190 1 ? 7  
HELX_P HELX_P149 AQ5 LYS J 208 ? ASN J 218 ? LYS J 208 ASN J 218 1 ? 11 
HELX_P HELX_P150 AQ6 SER J 223 ? LEU J 228 ? SER J 223 LEU J 228 1 ? 6  
HELX_P HELX_P151 AQ7 ILE J 229 ? GLN J 236 ? ILE J 229 GLN J 236 1 ? 8  
HELX_P HELX_P152 AQ8 CYS J 281 ? ASP J 292 ? CYS J 281 ASP J 292 1 ? 12 
HELX_P HELX_P153 AQ9 SER K 58  ? LEU K 62  ? SER L 57  LEU L 61  5 ? 5  
HELX_P HELX_P154 AR1 SER K 91  ? GLU K 120 ? SER L 90  GLU L 119 1 ? 30 
HELX_P HELX_P155 AR2 LYS K 123 ? ALA K 135 ? LYS L 122 ALA L 134 1 ? 13 
HELX_P HELX_P156 AR3 ALA K 135 ? LYS K 143 ? ALA L 134 LYS L 142 1 ? 9  
HELX_P HELX_P157 AR4 GLY K 146 ? ASP K 159 ? GLY L 145 ASP L 158 1 ? 14 
HELX_P HELX_P158 AR5 ILE K 162 ? LEU K 166 ? ILE L 161 LEU L 165 5 ? 5  
HELX_P HELX_P159 AR6 ASN K 169 ? LEU K 184 ? ASN L 168 LEU L 183 1 ? 16 
HELX_P HELX_P160 AR7 GLU K 203 ? CYS K 218 ? GLU L 202 CYS L 217 1 ? 16 
HELX_P HELX_P161 AR8 GLU K 243 ? LYS K 265 ? GLU L 242 LYS L 264 1 ? 23 
HELX_P HELX_P162 AR9 SER L 58  ? LEU L 62  ? SER M 57  LEU M 61  5 ? 5  
HELX_P HELX_P163 AS1 SER L 91  ? GLU L 120 ? SER M 90  GLU M 119 1 ? 30 
HELX_P HELX_P164 AS2 LYS L 123 ? ALA L 135 ? LYS M 122 ALA M 134 1 ? 13 
HELX_P HELX_P165 AS3 ALA L 135 ? LYS L 143 ? ALA M 134 LYS M 142 1 ? 9  
HELX_P HELX_P166 AS4 GLY L 146 ? ASP L 159 ? GLY M 145 ASP M 158 1 ? 14 
HELX_P HELX_P167 AS5 ILE L 162 ? LEU L 166 ? ILE M 161 LEU M 165 5 ? 5  
HELX_P HELX_P168 AS6 ASN L 169 ? LEU L 184 ? ASN M 168 LEU M 183 1 ? 16 
HELX_P HELX_P169 AS7 GLU L 203 ? CYS L 218 ? GLU M 202 CYS M 217 1 ? 16 
HELX_P HELX_P170 AS8 GLU L 243 ? LYS L 265 ? GLU M 242 LYS M 264 1 ? 23 
HELX_P HELX_P171 AS9 GLY M 53  ? SER M 62  ? GLY S 53  SER S 62  1 ? 10 
HELX_P HELX_P172 AT1 GLY M 137 ? LEU M 146 ? GLY S 137 LEU S 146 1 ? 10 
HELX_P HELX_P173 AT2 CYS M 165 ? ILE M 179 ? CYS S 165 ILE S 179 1 ? 15 
HELX_P HELX_P174 AT3 VAL M 195 ? GLU M 217 ? VAL S 195 GLU S 217 1 ? 23 
HELX_P HELX_P175 AT4 LYS M 229 ? ILE M 243 ? LYS S 229 ILE S 243 1 ? 15 
HELX_P HELX_P176 AT5 GLY N 53  ? SER N 62  ? GLY T 53  SER T 62  1 ? 10 
HELX_P HELX_P177 AT6 GLY N 137 ? LEU N 146 ? GLY T 137 LEU T 146 1 ? 10 
HELX_P HELX_P178 AT7 CYS N 165 ? ILE N 179 ? CYS T 165 ILE T 179 1 ? 15 
HELX_P HELX_P179 AT8 VAL N 195 ? GLU N 217 ? VAL T 195 GLU T 217 1 ? 23 
HELX_P HELX_P180 AT9 LYS N 229 ? ILE N 243 ? LYS T 229 ILE T 243 1 ? 15 
HELX_P HELX_P181 AU1 UNK O 2   ? UNK O 14  ? UNK d 4   UNK d 16  1 ? 13 
HELX_P HELX_P182 AU2 UNK P 2   ? UNK P 14  ? UNK e 4   UNK e 16  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 57  A . ? PHE 57  A PRO 58  A ? PRO 58  A 1 -4.04 
2 TYR 319 A . ? TYR 319 A PRO 320 A ? PRO 320 A 1 11.94 
3 PHE 57  B . ? PHE 57  B PRO 58  B ? PRO 58  B 1 -4.07 
4 TYR 319 B . ? TYR 319 B PRO 320 B ? PRO 320 B 1 12.01 
5 GLY 44  C . ? GLY 27  C PRO 45  C ? PRO 28  C 1 -2.85 
6 GLY 44  D . ? GLY 27  D PRO 45  D ? PRO 28  D 1 0.78  
7 ARG 364 E . ? ARG 364 E PRO 365 E ? PRO 365 E 1 -1.10 
8 ARG 364 F . ? ARG 364 F PRO 365 F ? PRO 365 F 1 -1.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 9 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 9 ? 
AB6 ? 2 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 3 ? 
AC1 ? 4 ? 
AC2 ? 2 ? 
AC3 ? 8 ? 
AC4 ? 3 ? 
AC5 ? 8 ? 
AC6 ? 3 ? 
AC7 ? 8 ? 
AC8 ? 3 ? 
AC9 ? 7 ? 
AD1 ? 3 ? 
AD2 ? 7 ? 
AD3 ? 3 ? 
AD4 ? 7 ? 
AD5 ? 3 ? 
AD6 ? 4 ? 
AD7 ? 3 ? 
AD8 ? 4 ? 
AD9 ? 3 ? 
AE1 ? 6 ? 
AE2 ? 4 ? 
AE3 ? 4 ? 
AE4 ? 6 ? 
AE5 ? 4 ? 
AE6 ? 4 ? 
AE7 ? 3 ? 
AE8 ? 2 ? 
AE9 ? 7 ? 
AF1 ? 2 ? 
AF2 ? 8 ? 
AF3 ? 3 ? 
AF4 ? 2 ? 
AF5 ? 7 ? 
AF6 ? 2 ? 
AF7 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA4 7 8 ? anti-parallel 
AA4 8 9 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB5 6 7 ? anti-parallel 
AB5 7 8 ? anti-parallel 
AB5 8 9 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? parallel      
AB7 3 4 ? parallel      
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AC1 1 2 ? parallel      
AC1 2 3 ? parallel      
AC1 3 4 ? parallel      
AC2 1 2 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? parallel      
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC3 5 6 ? parallel      
AC3 6 7 ? parallel      
AC3 7 8 ? parallel      
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? parallel      
AC5 3 4 ? parallel      
AC5 4 5 ? parallel      
AC5 5 6 ? parallel      
AC5 6 7 ? parallel      
AC5 7 8 ? parallel      
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC7 4 5 ? parallel      
AC7 5 6 ? parallel      
AC7 6 7 ? parallel      
AC7 7 8 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AC9 4 5 ? parallel      
AC9 5 6 ? parallel      
AC9 6 7 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? parallel      
AD2 5 6 ? parallel      
AD2 6 7 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? parallel      
AD4 3 4 ? parallel      
AD4 4 5 ? parallel      
AD4 5 6 ? parallel      
AD4 6 7 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD7 1 2 ? anti-parallel 
AD7 2 3 ? parallel      
AD8 1 2 ? parallel      
AD8 2 3 ? parallel      
AD8 3 4 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? parallel      
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? parallel      
AE1 4 5 ? anti-parallel 
AE1 5 6 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? parallel      
AE4 4 5 ? anti-parallel 
AE4 5 6 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? anti-parallel 
AE8 1 2 ? parallel      
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AE9 4 5 ? anti-parallel 
AE9 5 6 ? anti-parallel 
AE9 6 7 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? anti-parallel 
AF2 6 7 ? anti-parallel 
AF2 7 8 ? anti-parallel 
AF3 1 2 ? parallel      
AF3 2 3 ? anti-parallel 
AF4 1 2 ? parallel      
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF5 4 5 ? anti-parallel 
AF5 5 6 ? anti-parallel 
AF5 6 7 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF7 4 5 ? anti-parallel 
AF7 5 6 ? anti-parallel 
AF7 6 7 ? anti-parallel 
AF7 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 122 ? THR A 124 ? ILE A 122 THR A 124 
AA1 2 GLU A 90  ? CYS A 95  ? GLU A 90  CYS A 95  
AA1 3 GLN A 44  ? VAL A 48  ? GLN A 44  VAL A 48  
AA1 4 LEU A 149 ? TYR A 152 ? LEU A 149 TYR A 152 
AA2 1 VAL A 155 ? SER A 157 ? VAL A 155 SER A 157 
AA2 2 GLY A 297 ? ARG A 299 ? GLY A 297 ARG A 299 
AA3 1 LEU A 244 ? ASP A 246 ? LEU A 244 ASP A 246 
AA3 2 MET A 181 ? GLU A 187 ? MET A 181 GLU A 187 
AA3 3 ILE A 251 ? CYS A 252 ? ILE A 251 CYS A 252 
AA4 1 LEU A 244 ? ASP A 246 ? LEU A 244 ASP A 246 
AA4 2 MET A 181 ? GLU A 187 ? MET A 181 GLU A 187 
AA4 3 ILE A 287 ? THR A 292 ? ILE A 287 THR A 292 
AA4 4 ARG A 211 ? LYS A 217 ? ARG A 211 LYS A 217 
AA4 5 VAL A 201 ? VAL A 205 ? VAL A 201 VAL A 205 
AA4 6 VAL A 238 ? ARG A 241 ? VAL A 238 ARG A 241 
AA4 7 ARG I 192 ? HIS I 196 ? ARG I 192 HIS I 196 
AA4 8 ASP I 156 ? ASP I 161 ? ASP I 156 ASP I 161 
AA4 9 LEU I 167 ? ASN I 172 ? LEU I 167 ASN I 172 
AA5 1 ARG A 223 ? PHE A 224 ? ARG A 223 PHE A 224 
AA5 2 ILE I 182 ? LYS I 183 ? ILE I 182 LYS I 183 
AA6 1 THR A 336 ? HIS A 337 ? THR A 336 HIS A 337 
AA6 2 TYR A 343 ? ARG A 344 ? TYR A 343 ARG A 344 
AA6 3 VAL A 360 ? LEU A 362 ? VAL A 360 LEU A 362 
AA6 4 SER A 377 ? VAL A 378 ? SER A 377 VAL A 378 
AA7 1 ILE A 355 ? LEU A 356 ? ILE A 355 LEU A 356 
AA7 2 PHE A 373 ? THR A 375 ? PHE A 373 THR A 375 
AA7 3 VAL A 390 ? ASP A 392 ? VAL A 390 ASP A 392 
AA7 4 GLN A 407 ? HIS A 409 ? GLN A 407 HIS A 409 
AA8 1 VAL A 367 ? ILE A 368 ? VAL A 367 ILE A 368 
AA8 2 HIS A 384 ? ILE A 385 ? HIS A 384 ILE A 385 
AA8 3 ARG A 401 ? VAL A 402 ? ARG A 401 VAL A 402 
AA9 1 TYR A 395 ? LEU A 396 ? TYR A 395 LEU A 396 
AA9 2 SER A 411 ? LEU A 413 ? SER A 411 LEU A 413 
AA9 3 SER A 429 ? LEU A 431 ? SER A 429 LEU A 431 
AA9 4 SER A 447 ? ILE A 449 ? SER A 447 ILE A 449 
AB1 1 GLU A 418 ? VAL A 419 ? GLU A 418 VAL A 419 
AB1 2 VAL A 436 ? VAL A 437 ? VAL A 436 VAL A 437 
AB2 1 ILE B 122 ? THR B 124 ? ILE B 122 THR B 124 
AB2 2 GLU B 90  ? CYS B 95  ? GLU B 90  CYS B 95  
AB2 3 GLN B 44  ? VAL B 48  ? GLN B 44  VAL B 48  
AB2 4 LEU B 149 ? TYR B 152 ? LEU B 149 TYR B 152 
AB3 1 VAL B 155 ? SER B 157 ? VAL B 155 SER B 157 
AB3 2 GLY B 297 ? ARG B 299 ? GLY B 297 ARG B 299 
AB4 1 LEU B 244 ? ASP B 246 ? LEU B 244 ASP B 246 
AB4 2 MET B 181 ? GLU B 187 ? MET B 181 GLU B 187 
AB4 3 ILE B 251 ? CYS B 252 ? ILE B 251 CYS B 252 
AB5 1 LEU B 244 ? ASP B 246 ? LEU B 244 ASP B 246 
AB5 2 MET B 181 ? GLU B 187 ? MET B 181 GLU B 187 
AB5 3 ILE B 287 ? THR B 292 ? ILE B 287 THR B 292 
AB5 4 ARG B 211 ? LYS B 217 ? ARG B 211 LYS B 217 
AB5 5 VAL B 201 ? VAL B 205 ? VAL B 201 VAL B 205 
AB5 6 VAL B 238 ? ARG B 241 ? VAL B 238 ARG B 241 
AB5 7 ARG J 192 ? HIS J 196 ? ARG J 192 HIS J 196 
AB5 8 ASP J 156 ? ASP J 161 ? ASP J 156 ASP J 161 
AB5 9 LEU J 167 ? ASN J 172 ? LEU J 167 ASN J 172 
AB6 1 ARG B 223 ? PHE B 224 ? ARG B 223 PHE B 224 
AB6 2 ILE J 182 ? LYS J 183 ? ILE J 182 LYS J 183 
AB7 1 THR B 336 ? HIS B 337 ? THR B 336 HIS B 337 
AB7 2 TYR B 343 ? ARG B 344 ? TYR B 343 ARG B 344 
AB7 3 VAL B 360 ? LEU B 362 ? VAL B 360 LEU B 362 
AB7 4 SER B 377 ? VAL B 378 ? SER B 377 VAL B 378 
AB8 1 ILE B 355 ? LEU B 356 ? ILE B 355 LEU B 356 
AB8 2 PHE B 373 ? THR B 375 ? PHE B 373 THR B 375 
AB8 3 VAL B 390 ? ASP B 392 ? VAL B 390 ASP B 392 
AB8 4 GLN B 407 ? HIS B 409 ? GLN B 407 HIS B 409 
AB9 1 VAL B 367 ? ILE B 368 ? VAL B 367 ILE B 368 
AB9 2 HIS B 384 ? ILE B 385 ? HIS B 384 ILE B 385 
AB9 3 ARG B 401 ? VAL B 402 ? ARG B 401 VAL B 402 
AC1 1 TYR B 395 ? LEU B 396 ? TYR B 395 LEU B 396 
AC1 2 SER B 411 ? LEU B 413 ? SER B 411 LEU B 413 
AC1 3 SER B 429 ? LEU B 431 ? SER B 429 LEU B 431 
AC1 4 SER B 447 ? ILE B 449 ? SER B 447 ILE B 449 
AC2 1 GLU B 418 ? VAL B 419 ? GLU B 418 VAL B 419 
AC2 2 VAL B 436 ? VAL B 437 ? VAL B 436 VAL B 437 
AC3 1 GLY C 346 ? ASN C 348 ? GLY C 329 ASN C 331 
AC3 2 LEU C 340 ? SER C 343 ? LEU C 323 SER C 326 
AC3 3 LEU C 282 ? CYS C 285 ? LEU C 265 CYS C 268 
AC3 4 LYS C 248 ? ILE C 251 ? LYS C 231 ILE C 234 
AC3 5 VAL C 181 ? ILE C 185 ? VAL C 164 ILE C 168 
AC3 6 HIS C 205 ? ALA C 209 ? HIS C 188 ALA C 192 
AC3 7 THR C 231 ? MET C 234 ? THR C 214 MET C 217 
AC3 8 LEU F 482 ? LEU F 484 ? LEU F 482 LEU F 484 
AC4 1 THR C 255 ? ILE C 256 ? THR C 238 ILE C 239 
AC4 2 LEU C 262 ? VAL C 265 ? LEU C 245 VAL C 248 
AC4 3 PHE C 330 ? VAL C 333 ? PHE C 313 VAL C 316 
AC5 1 GLY D 346 ? ASN D 348 ? GLY D 329 ASN D 331 
AC5 2 LEU D 340 ? SER D 343 ? LEU D 323 SER D 326 
AC5 3 LEU D 282 ? CYS D 285 ? LEU D 265 CYS D 268 
AC5 4 LYS D 248 ? ILE D 251 ? LYS D 231 ILE D 234 
AC5 5 VAL D 181 ? ILE D 185 ? VAL D 164 ILE D 168 
AC5 6 HIS D 205 ? ALA D 209 ? HIS D 188 ALA D 192 
AC5 7 THR D 231 ? MET D 234 ? THR D 214 MET D 217 
AC5 8 LEU E 482 ? LEU E 484 ? LEU E 482 LEU E 484 
AC6 1 THR D 255 ? ILE D 256 ? THR D 238 ILE D 239 
AC6 2 LEU D 262 ? VAL D 265 ? LEU D 245 VAL D 248 
AC6 3 PHE D 330 ? VAL D 333 ? PHE D 313 VAL D 316 
AC7 1 VAL D 323 ? VAL D 325 ? VAL D 306 VAL D 308 
AC7 2 ALA E 383 ? LEU E 387 ? ALA E 383 LEU E 387 
AC7 3 ARG E 357 ? ASP E 362 ? ARG E 357 ASP E 362 
AC7 4 VAL E 332 ? TYR E 336 ? VAL E 332 TYR E 336 
AC7 5 LYS E 400 ? GLY E 404 ? LYS E 400 GLY E 404 
AC7 6 VAL E 434 ? CYS E 437 ? VAL E 434 CYS E 437 
AC7 7 LEU E 499 ? THR E 502 ? LEU E 499 THR E 502 
AC7 8 GLY E 505 ? ILE E 507 ? GLY E 505 ILE E 507 
AC8 1 ALA E 407 ? LEU E 408 ? ALA E 407 LEU E 408 
AC8 2 VAL E 414 ? ARG E 417 ? VAL E 414 ARG E 417 
AC8 3 TYR E 489 ? ASP E 490 ? TYR E 489 ASP E 490 
AC9 1 ALA F 383 ? LEU F 387 ? ALA F 383 LEU F 387 
AC9 2 ARG F 357 ? ASP F 362 ? ARG F 357 ASP F 362 
AC9 3 VAL F 332 ? TYR F 336 ? VAL F 332 TYR F 336 
AC9 4 LYS F 400 ? GLY F 404 ? LYS F 400 GLY F 404 
AC9 5 VAL F 434 ? CYS F 437 ? VAL F 434 CYS F 437 
AC9 6 LEU F 499 ? THR F 502 ? LEU F 499 THR F 502 
AC9 7 GLY F 505 ? ILE F 507 ? GLY F 505 ILE F 507 
AD1 1 ALA F 407 ? LEU F 408 ? ALA F 407 LEU F 408 
AD1 2 VAL F 414 ? ARG F 417 ? VAL F 414 ARG F 417 
AD1 3 TYR F 489 ? ASP F 490 ? TYR F 489 ASP F 490 
AD2 1 VAL G 175 ? VAL G 178 ? VAL G 175 VAL G 178 
AD2 2 PHE G 148 ? THR G 153 ? PHE G 148 THR G 153 
AD2 3 ALA G 123 ? THR G 127 ? ALA G 123 THR G 127 
AD2 4 LEU G 192 ? GLY G 196 ? LEU G 192 GLY G 196 
AD2 5 PHE G 226 ? VAL G 229 ? PHE G 226 VAL G 229 
AD2 6 LEU G 283 ? THR G 286 ? LEU G 283 THR G 286 
AD2 7 GLY G 289 ? LEU G 291 ? GLY G 289 LEU G 291 
AD3 1 GLY G 199 ? VAL G 200 ? GLY G 199 VAL G 200 
AD3 2 ILE G 206 ? ASN G 208 ? ILE G 206 ASN G 208 
AD3 3 ASP G 274 ? THR G 276 ? ASP G 274 THR G 276 
AD4 1 VAL H 175 ? VAL H 178 ? VAL H 175 VAL H 178 
AD4 2 PHE H 148 ? THR H 153 ? PHE H 148 THR H 153 
AD4 3 ALA H 123 ? THR H 127 ? ALA H 123 THR H 127 
AD4 4 LEU H 192 ? GLY H 196 ? LEU H 192 GLY H 196 
AD4 5 PHE H 226 ? VAL H 229 ? PHE H 226 VAL H 229 
AD4 6 LEU H 283 ? THR H 286 ? LEU H 283 THR H 286 
AD4 7 GLY H 289 ? LEU H 291 ? GLY H 289 LEU H 291 
AD5 1 GLY H 199 ? VAL H 200 ? GLY H 199 VAL H 200 
AD5 2 ILE H 206 ? ASN H 208 ? ILE H 206 ASN H 208 
AD5 3 ASP H 274 ? THR H 276 ? ASP H 274 THR H 276 
AD6 1 ILE I 75  ? ILE I 78  ? ILE I 75  ILE I 78  
AD6 2 VAL I 51  ? VAL I 54  ? VAL I 51  VAL I 54  
AD6 3 PHE I 3   ? VAL I 7   ? PHE I 3   VAL I 7   
AD6 4 ASP I 100 ? LEU I 104 ? ASP I 100 LEU I 104 
AD7 1 VAL I 200 ? ASP I 201 ? VAL I 200 ASP I 201 
AD7 2 LEU I 128 ? ARG I 133 ? LEU I 128 ARG I 133 
AD7 3 ILE I 263 ? LYS I 268 ? ILE I 263 LYS I 268 
AD8 1 ILE J 75  ? ILE J 78  ? ILE J 75  ILE J 78  
AD8 2 VAL J 51  ? VAL J 54  ? VAL J 51  VAL J 54  
AD8 3 PHE J 3   ? VAL J 7   ? PHE J 3   VAL J 7   
AD8 4 ASP J 100 ? LEU J 104 ? ASP J 100 LEU J 104 
AD9 1 VAL J 200 ? ASP J 201 ? VAL J 200 ASP J 201 
AD9 2 LEU J 128 ? ARG J 133 ? LEU J 128 ARG J 133 
AD9 3 ILE J 263 ? LYS J 268 ? ILE J 263 LYS J 268 
AE1 1 VAL K 19  ? ILE K 27  ? VAL L 18  ILE L 26  
AE1 2 GLY K 31  ? LEU K 36  ? GLY L 30  LEU L 35  
AE1 3 GLU K 43  ? LEU K 47  ? GLU L 42  LEU L 46  
AE1 4 TYR K 82  ? SER K 86  ? TYR L 81  SER L 85  
AE1 5 ASN K 68  ? ASP K 77  ? ASN L 67  ASP L 76  
AE1 6 VAL K 19  ? ILE K 27  ? VAL L 18  ILE L 26  
AE2 1 ILE K 225 ? ASN K 228 ? ILE L 224 ASN L 227 
AE2 2 TYR K 235 ? THR K 239 ? TYR L 234 THR L 238 
AE2 3 ILE K 191 ? VAL K 197 ? ILE L 190 VAL L 196 
AE2 4 PHE K 269 ? ASN K 270 ? PHE L 268 ASN L 269 
AE3 1 ILE K 225 ? ASN K 228 ? ILE L 224 ASN L 227 
AE3 2 TYR K 235 ? THR K 239 ? TYR L 234 THR L 238 
AE3 3 ILE K 191 ? VAL K 197 ? ILE L 190 VAL L 196 
AE3 4 LYS K 276 ? VAL K 277 ? LYS L 275 VAL L 276 
AE4 1 VAL L 19  ? ILE L 27  ? VAL M 18  ILE M 26  
AE4 2 GLY L 31  ? LEU L 36  ? GLY M 30  LEU M 35  
AE4 3 GLU L 43  ? LEU L 47  ? GLU M 42  LEU M 46  
AE4 4 TYR L 82  ? SER L 86  ? TYR M 81  SER M 85  
AE4 5 ASN L 68  ? ASP L 77  ? ASN M 67  ASP M 76  
AE4 6 VAL L 19  ? ILE L 27  ? VAL M 18  ILE M 26  
AE5 1 ILE L 225 ? ASN L 228 ? ILE M 224 ASN M 227 
AE5 2 TYR L 235 ? THR L 239 ? TYR M 234 THR M 238 
AE5 3 ILE L 191 ? VAL L 197 ? ILE M 190 VAL M 196 
AE5 4 PHE L 269 ? ASN L 270 ? PHE M 268 ASN M 269 
AE6 1 ILE L 225 ? ASN L 228 ? ILE M 224 ASN M 227 
AE6 2 TYR L 235 ? THR L 239 ? TYR M 234 THR M 238 
AE6 3 ILE L 191 ? VAL L 197 ? ILE M 190 VAL M 196 
AE6 4 LYS L 276 ? VAL L 277 ? LYS M 275 VAL M 276 
AE7 1 ILE M 42  ? THR M 46  ? ILE S 42  THR S 46  
AE7 2 LYS M 125 ? ASP M 134 ? LYS S 125 ASP S 134 
AE7 3 GLY M 82  ? LYS M 90  ? GLY S 82  LYS S 90  
AE8 1 ALA M 155 ? ILE M 159 ? ALA S 155 ILE S 159 
AE8 2 ILE M 185 ? GLN M 189 ? ILE S 185 GLN S 189 
AE9 1 LEU M 256 ? VAL M 258 ? LEU S 256 VAL S 258 
AE9 2 VAL M 278 ? ILE M 283 ? VAL S 278 ILE S 283 
AE9 3 LEU M 336 ? THR M 341 ? LEU S 336 THR S 341 
AE9 4 PHE M 315 ? LEU M 321 ? PHE S 315 LEU S 321 
AE9 5 GLU M 293 ? VAL M 296 ? GLU S 293 VAL S 296 
AE9 6 VAL M 357 ? GLY M 359 ? VAL S 357 GLY S 359 
AE9 7 LEU M 256 ? VAL M 258 ? LEU S 256 VAL S 258 
AF1 1 ILE M 300 ? SER M 302 ? ILE S 300 SER S 302 
AF1 2 MET M 310 ? LYS M 312 ? MET S 310 LYS S 312 
AF2 1 PHE M 376 ? LEU M 377 ? PHE S 376 LEU S 377 
AF2 2 TRP M 451 ? ILE M 465 ? TRP S 451 ILE S 465 
AF2 3 LYS M 440 ? ARG M 446 ? LYS S 440 ARG S 446 
AF2 4 VAL M 403 ? ILE M 408 ? VAL S 403 ILE S 408 
AF2 5 LEU M 411 ? LYS M 421 ? LEU S 411 LYS S 421 
AF2 6 LEU M 424 ? VAL M 433 ? LEU S 424 VAL S 433 
AF2 7 ILE M 367 ? SER M 374 ? ILE S 367 SER S 374 
AF2 8 TRP M 451 ? ILE M 465 ? TRP S 451 ILE S 465 
AF3 1 ILE N 42  ? THR N 46  ? ILE T 42  THR T 46  
AF3 2 LYS N 125 ? ASP N 134 ? LYS T 125 ASP T 134 
AF3 3 GLY N 82  ? LYS N 90  ? GLY T 82  LYS T 90  
AF4 1 ALA N 155 ? ILE N 159 ? ALA T 155 ILE T 159 
AF4 2 ILE N 185 ? GLN N 189 ? ILE T 185 GLN T 189 
AF5 1 LEU N 256 ? VAL N 258 ? LEU T 256 VAL T 258 
AF5 2 VAL N 278 ? ILE N 283 ? VAL T 278 ILE T 283 
AF5 3 LEU N 336 ? THR N 341 ? LEU T 336 THR T 341 
AF5 4 PHE N 315 ? LEU N 321 ? PHE T 315 LEU T 321 
AF5 5 GLU N 293 ? VAL N 296 ? GLU T 293 VAL T 296 
AF5 6 VAL N 357 ? GLY N 359 ? VAL T 357 GLY T 359 
AF5 7 LEU N 256 ? VAL N 258 ? LEU T 256 VAL T 258 
AF6 1 ILE N 300 ? SER N 302 ? ILE T 300 SER T 302 
AF6 2 MET N 310 ? LYS N 312 ? MET T 310 LYS T 312 
AF7 1 PHE N 376 ? LEU N 377 ? PHE T 376 LEU T 377 
AF7 2 TRP N 451 ? ILE N 465 ? TRP T 451 ILE T 465 
AF7 3 LYS N 440 ? ARG N 446 ? LYS T 440 ARG T 446 
AF7 4 VAL N 403 ? ILE N 408 ? VAL T 403 ILE T 408 
AF7 5 LEU N 411 ? LYS N 421 ? LEU T 411 LYS T 421 
AF7 6 LEU N 424 ? VAL N 433 ? LEU T 424 VAL T 433 
AF7 7 ILE N 367 ? SER N 374 ? ILE T 367 SER T 374 
AF7 8 TRP N 451 ? ILE N 465 ? TRP T 451 ILE T 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ILE A 123 ? O ILE A 123 N VAL A 93  ? N VAL A 93  
AA1 2 3 O PHE A 94  ? O PHE A 94  N LEU A 47  ? N LEU A 47  
AA1 3 4 N GLN A 44  ? N GLN A 44  O LEU A 149 ? O LEU A 149 
AA2 1 2 N ILE A 156 ? N ILE A 156 O ALA A 298 ? O ALA A 298 
AA3 1 2 O LEU A 245 ? O LEU A 245 N LYS A 186 ? N LYS A 186 
AA3 2 3 N THR A 182 ? N THR A 182 O ILE A 251 ? O ILE A 251 
AA4 1 2 O LEU A 245 ? O LEU A 245 N LYS A 186 ? N LYS A 186 
AA4 2 3 N GLU A 187 ? N GLU A 187 O THR A 292 ? O THR A 292 
AA4 3 4 O ILE A 287 ? O ILE A 287 N VAL A 212 ? N VAL A 212 
AA4 4 5 O GLN A 216 ? O GLN A 216 N VAL A 202 ? N VAL A 202 
AA4 5 6 N VAL A 205 ? N VAL A 205 O GLU A 239 ? O GLU A 239 
AA4 6 7 N VAL A 240 ? N VAL A 240 O ILE I 193 ? O ILE I 193 
AA4 7 8 O ARG I 194 ? O ARG I 194 N VAL I 160 ? N VAL I 160 
AA4 8 9 N GLY I 159 ? N GLY I 159 O LEU I 168 ? O LEU I 168 
AA5 1 2 N PHE A 224 ? N PHE A 224 O ILE I 182 ? O ILE I 182 
AA6 1 2 N THR A 336 ? N THR A 336 O ARG A 344 ? O ARG A 344 
AA6 2 3 N TYR A 343 ? N TYR A 343 O VAL A 360 ? O VAL A 360 
AA6 3 4 N LEU A 361 ? N LEU A 361 O SER A 377 ? O SER A 377 
AA7 1 2 N ILE A 355 ? N ILE A 355 O ILE A 374 ? O ILE A 374 
AA7 2 3 N PHE A 373 ? N PHE A 373 O LEU A 391 ? O LEU A 391 
AA7 3 4 N ASP A 392 ? N ASP A 392 O ILE A 408 ? O ILE A 408 
AA8 1 2 N VAL A 367 ? N VAL A 367 O ILE A 385 ? O ILE A 385 
AA8 2 3 N HIS A 384 ? N HIS A 384 O VAL A 402 ? O VAL A 402 
AA9 1 2 N TYR A 395 ? N TYR A 395 O LEU A 413 ? O LEU A 413 
AA9 2 3 N LEU A 412 ? N LEU A 412 O LEU A 431 ? O LEU A 431 
AA9 3 4 N VAL A 430 ? N VAL A 430 O ILE A 449 ? O ILE A 449 
AB1 1 2 N GLU A 418 ? N GLU A 418 O VAL A 437 ? O VAL A 437 
AB2 1 2 O ILE B 123 ? O ILE B 123 N VAL B 93  ? N VAL B 93  
AB2 2 3 O PHE B 94  ? O PHE B 94  N LEU B 47  ? N LEU B 47  
AB2 3 4 N GLN B 44  ? N GLN B 44  O LEU B 149 ? O LEU B 149 
AB3 1 2 N ILE B 156 ? N ILE B 156 O ALA B 298 ? O ALA B 298 
AB4 1 2 O LEU B 245 ? O LEU B 245 N LYS B 186 ? N LYS B 186 
AB4 2 3 N THR B 182 ? N THR B 182 O ILE B 251 ? O ILE B 251 
AB5 1 2 O LEU B 245 ? O LEU B 245 N LYS B 186 ? N LYS B 186 
AB5 2 3 N GLU B 187 ? N GLU B 187 O THR B 292 ? O THR B 292 
AB5 3 4 O ILE B 287 ? O ILE B 287 N VAL B 212 ? N VAL B 212 
AB5 4 5 O GLN B 216 ? O GLN B 216 N VAL B 202 ? N VAL B 202 
AB5 5 6 N VAL B 205 ? N VAL B 205 O GLU B 239 ? O GLU B 239 
AB5 6 7 N VAL B 238 ? N VAL B 238 O PHE J 195 ? O PHE J 195 
AB5 7 8 O ARG J 194 ? O ARG J 194 N VAL J 160 ? N VAL J 160 
AB5 8 9 N GLY J 159 ? N GLY J 159 O LEU J 168 ? O LEU J 168 
AB6 1 2 N PHE B 224 ? N PHE B 224 O ILE J 182 ? O ILE J 182 
AB7 1 2 N THR B 336 ? N THR B 336 O ARG B 344 ? O ARG B 344 
AB7 2 3 N TYR B 343 ? N TYR B 343 O VAL B 360 ? O VAL B 360 
AB7 3 4 N LEU B 361 ? N LEU B 361 O SER B 377 ? O SER B 377 
AB8 1 2 N ILE B 355 ? N ILE B 355 O ILE B 374 ? O ILE B 374 
AB8 2 3 N PHE B 373 ? N PHE B 373 O LEU B 391 ? O LEU B 391 
AB8 3 4 N ASP B 392 ? N ASP B 392 O ILE B 408 ? O ILE B 408 
AB9 1 2 N VAL B 367 ? N VAL B 367 O ILE B 385 ? O ILE B 385 
AB9 2 3 N HIS B 384 ? N HIS B 384 O VAL B 402 ? O VAL B 402 
AC1 1 2 N TYR B 395 ? N TYR B 395 O LEU B 413 ? O LEU B 413 
AC1 2 3 N LEU B 412 ? N LEU B 412 O LEU B 431 ? O LEU B 431 
AC1 3 4 N VAL B 430 ? N VAL B 430 O ILE B 449 ? O ILE B 449 
AC2 1 2 N GLU B 418 ? N GLU B 418 O VAL B 437 ? O VAL B 437 
AC3 1 2 O ASN C 348 ? O ASN C 331 N PHE C 341 ? N PHE C 324 
AC3 2 3 O ILE C 342 ? O ILE C 325 N VAL C 284 ? N VAL C 267 
AC3 3 4 O ILE C 283 ? O ILE C 266 N VAL C 249 ? N VAL C 232 
AC3 4 5 O ILE C 250 ? O ILE C 233 N MET C 183 ? N MET C 166 
AC3 5 6 N ILE C 182 ? N ILE C 165 O ILE C 207 ? O ILE C 190 
AC3 6 7 N VAL C 208 ? N VAL C 191 O THR C 232 ? O THR C 215 
AC3 7 8 N VAL C 233 ? N VAL C 216 O ARG F 483 ? O ARG F 483 
AC4 1 2 N THR C 255 ? N THR C 238 O ARG C 263 ? O ARG C 246 
AC4 2 3 N LEU C 262 ? N LEU C 245 O VAL C 333 ? O VAL C 316 
AC5 1 2 O ASN D 348 ? O ASN D 331 N PHE D 341 ? N PHE D 324 
AC5 2 3 O ILE D 342 ? O ILE D 325 N VAL D 284 ? N VAL D 267 
AC5 3 4 O ILE D 283 ? O ILE D 266 N ILE D 251 ? N ILE D 234 
AC5 4 5 O LYS D 248 ? O LYS D 231 N VAL D 181 ? N VAL D 164 
AC5 5 6 N ILE D 182 ? N ILE D 165 O ILE D 207 ? O ILE D 190 
AC5 6 7 N VAL D 206 ? N VAL D 189 O THR D 232 ? O THR D 215 
AC5 7 8 N THR D 231 ? N THR D 214 O ARG E 483 ? O ARG E 483 
AC6 1 2 N THR D 255 ? N THR D 238 O ARG D 263 ? O ARG D 246 
AC6 2 3 N LEU D 262 ? N LEU D 245 O VAL D 333 ? O VAL D 316 
AC7 1 2 N SER D 324 ? N SER D 307 O ALA E 383 ? O ALA E 383 
AC7 2 3 O SER E 384 ? O SER E 384 N VAL E 360 ? N VAL E 360 
AC7 3 4 O VAL E 359 ? O VAL E 359 N ILE E 333 ? N ILE E 333 
AC7 4 5 N LEU E 334 ? N LEU E 334 O LEU E 402 ? O LEU E 402 
AC7 5 6 N LEU E 403 ? N LEU E 403 O LEU E 435 ? O LEU E 435 
AC7 6 7 N VAL E 436 ? N VAL E 436 O ILE E 501 ? O ILE E 501 
AC7 7 8 N VAL E 500 ? N VAL E 500 O ILE E 507 ? O ILE E 507 
AC8 1 2 N ALA E 407 ? N ALA E 407 O MET E 415 ? O MET E 415 
AC8 2 3 N SER E 416 ? N SER E 416 O ASP E 490 ? O ASP E 490 
AC9 1 2 O LEU F 386 ? O LEU F 386 N VAL F 360 ? N VAL F 360 
AC9 2 3 O VAL F 359 ? O VAL F 359 N ILE F 333 ? N ILE F 333 
AC9 3 4 N LEU F 334 ? N LEU F 334 O LEU F 402 ? O LEU F 402 
AC9 4 5 N LEU F 403 ? N LEU F 403 O LEU F 435 ? O LEU F 435 
AC9 5 6 N VAL F 436 ? N VAL F 436 O ILE F 501 ? O ILE F 501 
AC9 6 7 N VAL F 500 ? N VAL F 500 O ILE F 507 ? O ILE F 507 
AD1 1 2 N ALA F 407 ? N ALA F 407 O MET F 415 ? O MET F 415 
AD1 2 3 N SER F 416 ? N SER F 416 O ASP F 490 ? O ASP F 490 
AD2 1 2 O VAL G 178 ? O VAL G 178 N VAL G 152 ? N VAL G 152 
AD2 2 3 O TYR G 151 ? O TYR G 151 N THR G 127 ? N THR G 127 
AD2 3 4 N LEU G 126 ? N LEU G 126 O ILE G 194 ? O ILE G 194 
AD2 4 5 N VAL G 193 ? N VAL G 193 O TYR G 227 ? O TYR G 227 
AD2 5 6 N VAL G 228 ? N VAL G 228 O LEU G 283 ? O LEU G 283 
AD2 6 7 N THR G 286 ? N THR G 286 O GLY G 289 ? O GLY G 289 
AD3 1 2 N GLY G 199 ? N GLY G 199 O ILE G 207 ? O ILE G 207 
AD3 2 3 N ILE G 206 ? N ILE G 206 O THR G 276 ? O THR G 276 
AD4 1 2 O VAL H 178 ? O VAL H 178 N VAL H 152 ? N VAL H 152 
AD4 2 3 O TYR H 151 ? O TYR H 151 N THR H 127 ? N THR H 127 
AD4 3 4 N LEU H 126 ? N LEU H 126 O ILE H 194 ? O ILE H 194 
AD4 4 5 N VAL H 193 ? N VAL H 193 O TYR H 227 ? O TYR H 227 
AD4 5 6 N VAL H 228 ? N VAL H 228 O LEU H 283 ? O LEU H 283 
AD4 6 7 N THR H 286 ? N THR H 286 O GLY H 289 ? O GLY H 289 
AD5 1 2 N GLY H 199 ? N GLY H 199 O ILE H 207 ? O ILE H 207 
AD5 2 3 N ILE H 206 ? N ILE H 206 O THR H 276 ? O THR H 276 
AD6 1 2 O VAL I 76  ? O VAL I 76  N VAL I 53  ? N VAL I 53  
AD6 2 3 O ILE I 52  ? O ILE I 52  N ALA I 5   ? N ALA I 5   
AD6 3 4 N VAL I 6   ? N VAL I 6   O LEU I 104 ? O LEU I 104 
AD7 1 2 O VAL I 200 ? O VAL I 200 N ARG I 133 ? N ARG I 133 
AD7 2 3 N MET I 132 ? N MET I 132 O LYS I 268 ? O LYS I 268 
AD8 1 2 O VAL J 76  ? O VAL J 76  N VAL J 53  ? N VAL J 53  
AD8 2 3 O ILE J 52  ? O ILE J 52  N ALA J 5   ? N ALA J 5   
AD8 3 4 N VAL J 6   ? N VAL J 6   O LEU J 104 ? O LEU J 104 
AD9 1 2 O VAL J 200 ? O VAL J 200 N ARG J 133 ? N ARG J 133 
AD9 2 3 N MET J 132 ? N MET J 132 O LYS J 268 ? O LYS J 268 
AE1 1 2 N ARG K 25  ? N ARG L 24  O TYR K 33  ? O TYR L 32  
AE1 2 3 N ALA K 32  ? N ALA L 31  O ILE K 46  ? O ILE L 45  
AE1 3 4 N MET K 45  ? N MET L 44  O LEU K 85  ? O LEU L 84  
AE1 4 5 O ASP K 84  ? O ASP L 83  N ARG K 75  ? N ARG L 74  
AE1 5 6 O VAL K 71  ? O VAL L 70  N VAL K 20  ? N VAL L 19  
AE2 1 2 N ASN K 228 ? N ASN L 227 O VAL K 236 ? O VAL L 235 
AE2 2 3 O TYR K 235 ? O TYR L 234 N ILE K 195 ? N ILE L 194 
AE2 3 4 N GLU K 196 ? N GLU L 195 O ASN K 270 ? O ASN L 269 
AE3 1 2 N ASN K 228 ? N ASN L 227 O VAL K 236 ? O VAL L 235 
AE3 2 3 O TYR K 235 ? O TYR L 234 N ILE K 195 ? N ILE L 194 
AE3 3 4 N ARG K 192 ? N ARG L 191 O LYS K 276 ? O LYS L 275 
AE4 1 2 N ARG L 25  ? N ARG M 24  O TYR L 33  ? O TYR M 32  
AE4 2 3 N ALA L 32  ? N ALA M 31  O ILE L 46  ? O ILE M 45  
AE4 3 4 N MET L 45  ? N MET M 44  O LEU L 85  ? O LEU M 84  
AE4 4 5 O ASP L 84  ? O ASP M 83  N ARG L 75  ? N ARG M 74  
AE4 5 6 O VAL L 71  ? O VAL M 70  N VAL L 20  ? N VAL M 19  
AE5 1 2 N ASN L 228 ? N ASN M 227 O VAL L 236 ? O VAL M 235 
AE5 2 3 O TYR L 235 ? O TYR M 234 N ILE L 195 ? N ILE M 194 
AE5 3 4 N GLU L 196 ? N GLU M 195 O ASN L 270 ? O ASN M 269 
AE6 1 2 N ASN L 228 ? N ASN M 227 O VAL L 236 ? O VAL M 235 
AE6 2 3 O TYR L 235 ? O TYR M 234 N ILE L 195 ? N ILE M 194 
AE6 3 4 N ARG L 192 ? N ARG M 191 O LYS L 276 ? O LYS M 275 
AE7 1 2 N ILE M 44  ? N ILE S 44  O SER M 131 ? O SER S 131 
AE7 2 3 O LYS M 125 ? O LYS S 125 N LYS M 90  ? N LYS S 90  
AE8 1 2 N LEU M 157 ? N LEU S 157 O LEU M 188 ? O LEU S 188 
AE9 1 2 N ILE M 257 ? N ILE S 257 O SER M 282 ? O SER S 282 
AE9 2 3 N GLY M 281 ? N GLY S 281 O ILE M 337 ? O ILE S 337 
AE9 3 4 O GLY M 340 ? O GLY S 340 N SER M 320 ? N SER S 320 
AE9 4 5 O SER M 316 ? O SER S 316 N ILE M 294 ? N ILE S 294 
AE9 5 6 N GLU M 295 ? N GLU S 295 O GLY M 359 ? O GLY S 359 
AE9 6 7 O LEU M 358 ? O LEU S 358 N LEU M 256 ? N LEU S 256 
AF1 1 2 N SER M 302 ? N SER S 302 O MET M 310 ? O MET S 310 
AF2 1 2 N PHE M 376 ? N PHE S 376 O TRP M 456 ? O TRP S 456 
AF2 2 3 O ARG M 452 ? O ARG S 452 N ARG M 445 ? N ARG S 445 
AF2 3 4 O SER M 444 ? O SER S 444 N MET M 405 ? N MET S 405 
AF2 4 5 N VAL M 406 ? N VAL S 406 O THR M 413 ? O THR S 413 
AF2 5 6 N ARG M 416 ? N ARG S 416 O VAL M 428 ? O VAL S 428 
AF2 6 7 O VAL M 433 ? O VAL S 433 N PHE M 368 ? N PHE S 368 
AF2 7 8 N THR M 369 ? N THR S 369 O VAL M 463 ? O VAL S 463 
AF3 1 2 N ILE N 44  ? N ILE T 44  O SER N 131 ? O SER T 131 
AF3 2 3 O LYS N 125 ? O LYS T 125 N LYS N 90  ? N LYS T 90  
AF4 1 2 N LEU N 157 ? N LEU T 157 O LEU N 188 ? O LEU T 188 
AF5 1 2 N ILE N 257 ? N ILE T 257 O SER N 282 ? O SER T 282 
AF5 2 3 N GLY N 281 ? N GLY T 281 O ILE N 337 ? O ILE T 337 
AF5 3 4 O GLY N 340 ? O GLY T 340 N SER N 320 ? N SER T 320 
AF5 4 5 O SER N 316 ? O SER T 316 N ILE N 294 ? N ILE T 294 
AF5 5 6 N GLU N 295 ? N GLU T 295 O GLY N 359 ? O GLY T 359 
AF5 6 7 O LEU N 358 ? O LEU T 358 N LEU N 256 ? N LEU T 256 
AF6 1 2 N SER N 302 ? N SER T 302 O MET N 310 ? O MET T 310 
AF7 1 2 N PHE N 376 ? N PHE T 376 O TRP N 456 ? O TRP T 456 
AF7 2 3 O ARG N 452 ? O ARG T 452 N ARG N 445 ? N ARG T 445 
AF7 3 4 O SER N 444 ? O SER T 444 N MET N 405 ? N MET T 405 
AF7 4 5 N VAL N 406 ? N VAL T 406 O THR N 413 ? O THR T 413 
AF7 5 6 N ARG N 416 ? N ARG T 416 O VAL N 428 ? O VAL T 428 
AF7 6 7 O VAL N 433 ? O VAL T 433 N PHE N 368 ? N PHE T 368 
AF7 7 8 N THR N 369 ? N THR T 369 O VAL N 463 ? O VAL T 463 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    C 
_struct_site.pdbx_auth_comp_id    C7B 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    20 
_struct_site.details              'binding site for residue C7B C 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 ASN C 179 ? ASN C 162 . ? 1_555 ? 
2  AC1 20 VAL C 181 ? VAL C 164 . ? 1_555 ? 
3  AC1 20 HIS C 205 ? HIS C 188 . ? 1_555 ? 
4  AC1 20 ILE C 207 ? ILE C 190 . ? 1_555 ? 
5  AC1 20 THR C 232 ? THR C 215 . ? 1_555 ? 
6  AC1 20 VAL C 242 ? VAL C 225 . ? 1_555 ? 
7  AC1 20 ASN D 179 ? ASN D 162 . ? 1_555 ? 
8  AC1 20 VAL D 181 ? VAL D 164 . ? 1_555 ? 
9  AC1 20 HIS D 205 ? HIS D 188 . ? 1_555 ? 
10 AC1 20 ILE D 207 ? ILE D 190 . ? 1_555 ? 
11 AC1 20 THR D 232 ? THR D 215 . ? 1_555 ? 
12 AC1 20 VAL D 242 ? VAL D 225 . ? 1_555 ? 
13 AC1 20 VAL E 177 ? VAL E 177 . ? 1_555 ? 
14 AC1 20 SER E 178 ? SER E 178 . ? 1_555 ? 
15 AC1 20 LEU E 179 ? LEU E 179 . ? 1_555 ? 
16 AC1 20 LEU E 485 ? LEU E 485 . ? 1_555 ? 
17 AC1 20 VAL F 177 ? VAL F 177 . ? 1_555 ? 
18 AC1 20 SER F 178 ? SER F 178 . ? 1_555 ? 
19 AC1 20 LEU F 179 ? LEU F 179 . ? 1_555 ? 
20 AC1 20 LEU F 485 ? LEU F 485 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6O81 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . PRO A 1 41  ? 177.681 155.104 223.271 1.00 86.44  0  41  PRO A N   1 
ATOM   2     C  CA  . PRO A 1 41  ? 176.535 154.585 222.516 1.00 86.44  0  41  PRO A CA  1 
ATOM   3     C  C   . PRO A 1 41  ? 176.568 155.000 221.048 1.00 86.44  0  41  PRO A C   1 
ATOM   4     O  O   . PRO A 1 41  ? 176.993 156.114 220.745 1.00 86.44  0  41  PRO A O   1 
ATOM   5     C  CB  . PRO A 1 41  ? 175.333 155.211 223.230 1.00 86.44  0  41  PRO A CB  1 
ATOM   6     C  CG  . PRO A 1 41  ? 175.817 155.489 224.609 1.00 86.44  0  41  PRO A CG  1 
ATOM   7     C  CD  . PRO A 1 41  ? 177.261 155.860 224.463 1.00 86.44  0  41  PRO A CD  1 
ATOM   8     N  N   . PRO A 1 42  ? 176.129 154.119 220.152 1.00 81.97  0  42  PRO A N   1 
ATOM   9     C  CA  . PRO A 1 42  ? 176.095 154.468 218.728 1.00 81.97  0  42  PRO A CA  1 
ATOM   10    C  C   . PRO A 1 42  ? 174.949 155.421 218.424 1.00 81.97  0  42  PRO A C   1 
ATOM   11    O  O   . PRO A 1 42  ? 174.049 155.649 219.235 1.00 81.97  0  42  PRO A O   1 
ATOM   12    C  CB  . PRO A 1 42  ? 175.901 153.118 218.037 1.00 81.97  0  42  PRO A CB  1 
ATOM   13    C  CG  . PRO A 1 42  ? 175.166 152.300 219.041 1.00 81.97  0  42  PRO A CG  1 
ATOM   14    C  CD  . PRO A 1 42  ? 175.674 152.737 220.391 1.00 81.97  0  42  PRO A CD  1 
ATOM   15    N  N   . LEU A 1 43  ? 174.993 155.984 217.219 1.00 75.94  0  43  LEU A N   1 
ATOM   16    C  CA  . LEU A 1 43  ? 173.996 156.947 216.762 1.00 75.94  0  43  LEU A CA  1 
ATOM   17    C  C   . LEU A 1 43  ? 173.253 156.352 215.574 1.00 75.94  0  43  LEU A C   1 
ATOM   18    O  O   . LEU A 1 43  ? 173.793 156.290 214.464 1.00 75.94  0  43  LEU A O   1 
ATOM   19    C  CB  . LEU A 1 43  ? 174.648 158.277 216.390 1.00 75.94  0  43  LEU A CB  1 
ATOM   20    C  CG  . LEU A 1 43  ? 173.693 159.440 216.109 1.00 75.94  0  43  LEU A CG  1 
ATOM   21    C  CD1 . LEU A 1 43  ? 172.725 159.636 217.264 1.00 75.94  0  43  LEU A CD1 1 
ATOM   22    C  CD2 . LEU A 1 43  ? 174.473 160.716 215.843 1.00 75.94  0  43  LEU A CD2 1 
ATOM   23    N  N   . GLN A 1 44  ? 172.020 155.919 215.808 1.00 76.22  0  44  GLN A N   1 
ATOM   24    C  CA  . GLN A 1 44  ? 171.181 155.365 214.759 1.00 76.22  0  44  GLN A CA  1 
ATOM   25    C  C   . GLN A 1 44  ? 170.341 156.466 214.120 1.00 76.22  0  44  GLN A C   1 
ATOM   26    O  O   . GLN A 1 44  ? 170.199 157.566 214.657 1.00 76.22  0  44  GLN A O   1 
ATOM   27    C  CB  . GLN A 1 44  ? 170.272 154.267 215.311 1.00 76.22  0  44  GLN A CB  1 
ATOM   28    C  CG  . GLN A 1 44  ? 171.005 153.013 215.754 1.00 76.22  0  44  GLN A CG  1 
ATOM   29    C  CD  . GLN A 1 44  ? 171.355 153.034 217.227 1.00 76.22  0  44  GLN A CD  1 
ATOM   30    O  OE1 . GLN A 1 44  ? 171.128 154.029 217.916 1.00 76.22  0  44  GLN A OE1 1 
ATOM   31    N  NE2 . GLN A 1 44  ? 171.911 151.934 217.720 1.00 76.22  0  44  GLN A NE2 1 
ATOM   32    N  N   . ALA A 1 45  ? 169.779 156.150 212.957 1.00 69.04  0  45  ALA A N   1 
ATOM   33    C  CA  . ALA A 1 45  ? 168.949 157.096 212.228 1.00 69.04  0  45  ALA A CA  1 
ATOM   34    C  C   . ALA A 1 45  ? 167.990 156.325 211.338 1.00 69.04  0  45  ALA A C   1 
ATOM   35    O  O   . ALA A 1 45  ? 168.324 155.256 210.826 1.00 69.04  0  45  ALA A O   1 
ATOM   36    C  CB  . ALA A 1 45  ? 169.794 158.059 211.387 1.00 69.04  0  45  ALA A CB  1 
ATOM   37    N  N   . VAL A 1 46  ? 166.792 156.874 211.169 1.00 69.56  0  46  VAL A N   1 
ATOM   38    C  CA  . VAL A 1 46  ? 165.821 156.360 210.213 1.00 69.56  0  46  VAL A CA  1 
ATOM   39    C  C   . VAL A 1 46  ? 165.544 157.445 209.179 1.00 69.56  0  46  VAL A C   1 
ATOM   40    O  O   . VAL A 1 46  ? 165.557 158.646 209.486 1.00 69.56  0  46  VAL A O   1 
ATOM   41    C  CB  . VAL A 1 46  ? 164.524 155.854 210.889 1.00 69.56  0  46  VAL A CB  1 
ATOM   42    C  CG1 . VAL A 1 46  ? 164.851 154.799 211.936 1.00 69.56  0  46  VAL A CG1 1 
ATOM   43    C  CG2 . VAL A 1 46  ? 163.740 156.978 211.534 1.00 69.56  0  46  VAL A CG2 1 
ATOM   44    N  N   . LEU A 1 47  ? 165.354 157.009 207.937 1.00 71.87  0  47  LEU A N   1 
ATOM   45    C  CA  . LEU A 1 47  ? 165.237 157.893 206.784 1.00 71.87  0  47  LEU A CA  1 
ATOM   46    C  C   . LEU A 1 47  ? 164.013 157.468 205.988 1.00 71.87  0  47  LEU A C   1 
ATOM   47    O  O   . LEU A 1 47  ? 164.028 156.424 205.328 1.00 71.87  0  47  LEU A O   1 
ATOM   48    C  CB  . LEU A 1 47  ? 166.507 157.837 205.931 1.00 71.87  0  47  LEU A CB  1 
ATOM   49    C  CG  . LEU A 1 47  ? 166.734 158.842 204.801 1.00 71.87  0  47  LEU A CG  1 
ATOM   50    C  CD1 . LEU A 1 47  ? 168.200 159.217 204.749 1.00 71.87  0  47  LEU A CD1 1 
ATOM   51    C  CD2 . LEU A 1 47  ? 166.309 158.264 203.465 1.00 71.87  0  47  LEU A CD2 1 
ATOM   52    N  N   . VAL A 1 48  ? 162.958 158.276 206.049 1.00 73.14  0  48  VAL A N   1 
ATOM   53    C  CA  . VAL A 1 48  ? 161.730 158.002 205.306 1.00 73.14  0  48  VAL A CA  1 
ATOM   54    C  C   . VAL A 1 48  ? 161.962 158.475 203.874 1.00 73.14  0  48  VAL A C   1 
ATOM   55    O  O   . VAL A 1 48  ? 161.810 159.657 203.566 1.00 73.14  0  48  VAL A O   1 
ATOM   56    C  CB  . VAL A 1 48  ? 160.514 158.680 205.939 1.00 73.14  0  48  VAL A CB  1 
ATOM   57    C  CG1 . VAL A 1 48  ? 159.241 158.251 205.229 1.00 73.14  0  48  VAL A CG1 1 
ATOM   58    C  CG2 . VAL A 1 48  ? 160.439 158.351 207.421 1.00 73.14  0  48  VAL A CG2 1 
ATOM   59    N  N   . ALA A 1 49  ? 162.320 157.544 202.990 1.00 77.73  0  49  ALA A N   1 
ATOM   60    C  CA  . ALA A 1 49  ? 162.619 157.843 201.597 1.00 77.73  0  49  ALA A CA  1 
ATOM   61    C  C   . ALA A 1 49  ? 161.386 157.789 200.703 1.00 77.73  0  49  ALA A C   1 
ATOM   62    O  O   . ALA A 1 49  ? 161.518 157.581 199.491 1.00 77.73  0  49  ALA A O   1 
ATOM   63    C  CB  . ALA A 1 49  ? 163.689 156.886 201.070 1.00 77.73  0  49  ALA A CB  1 
ATOM   64    N  N   . ASP A 1 50  ? 160.195 157.969 201.270 1.00 87.13  0  50  ASP A N   1 
ATOM   65    C  CA  . ASP A 1 50  ? 158.961 157.971 200.489 1.00 87.13  0  50  ASP A CA  1 
ATOM   66    C  C   . ASP A 1 50  ? 158.056 158.994 201.171 1.00 87.13  0  50  ASP A C   1 
ATOM   67    O  O   . ASP A 1 50  ? 157.428 158.689 202.187 1.00 87.13  0  50  ASP A O   1 
ATOM   68    C  CB  . ASP A 1 50  ? 158.337 156.578 200.452 1.00 87.13  0  50  ASP A CB  1 
ATOM   69    C  CG  . ASP A 1 50  ? 157.140 156.459 199.496 1.00 87.13  0  50  ASP A CG  1 
ATOM   70    O  OD1 . ASP A 1 50  ? 156.498 157.463 199.121 1.00 87.13  0  50  ASP A OD1 1 
ATOM   71    O  OD2 . ASP A 1 50  ? 156.837 155.312 199.111 1.00 87.13  -1 50  ASP A OD2 1 
ATOM   72    N  N   . SER A 1 51  ? 158.005 160.200 200.614 1.00 86.10  0  51  SER A N   1 
ATOM   73    C  CA  . SER A 1 51  ? 157.104 161.224 201.126 1.00 86.10  0  51  SER A CA  1 
ATOM   74    C  C   . SER A 1 51  ? 155.676 160.893 200.714 1.00 86.10  0  51  SER A C   1 
ATOM   75    O  O   . SER A 1 51  ? 155.364 160.831 199.521 1.00 86.10  0  51  SER A O   1 
ATOM   76    C  CB  . SER A 1 51  ? 157.515 162.598 200.604 1.00 86.10  0  51  SER A CB  1 
ATOM   77    O  OG  . SER A 1 51  ? 158.803 162.958 201.071 1.00 86.10  0  51  SER A OG  1 
ATOM   78    N  N   . PHE A 1 52  ? 154.809 160.679 201.703 1.00 87.17  0  52  PHE A N   1 
ATOM   79    C  CA  . PHE A 1 52  ? 153.467 160.165 201.474 1.00 87.17  0  52  PHE A CA  1 
ATOM   80    C  C   . PHE A 1 52  ? 152.442 161.260 201.203 1.00 87.17  0  52  PHE A C   1 
ATOM   81    O  O   . PHE A 1 52  ? 151.240 161.024 201.371 1.00 87.17  0  52  PHE A O   1 
ATOM   82    C  CB  . PHE A 1 52  ? 153.027 159.324 202.672 1.00 87.17  0  52  PHE A CB  1 
ATOM   83    C  CG  . PHE A 1 52  ? 153.982 158.221 203.018 1.00 87.17  0  52  PHE A CG  1 
ATOM   84    C  CD1 . PHE A 1 52  ? 154.089 157.101 202.209 1.00 87.17  0  52  PHE A CD1 1 
ATOM   85    C  CD2 . PHE A 1 52  ? 154.779 158.309 204.148 1.00 87.17  0  52  PHE A CD2 1 
ATOM   86    C  CE1 . PHE A 1 52  ? 154.974 156.083 202.525 1.00 87.17  0  52  PHE A CE1 1 
ATOM   87    C  CE2 . PHE A 1 52  ? 155.664 157.294 204.472 1.00 87.17  0  52  PHE A CE2 1 
ATOM   88    C  CZ  . PHE A 1 52  ? 155.761 156.181 203.658 1.00 87.17  0  52  PHE A CZ  1 
ATOM   89    N  N   . ASP A 1 53  ? 152.881 162.443 200.790 1.00 91.04  0  53  ASP A N   1 
ATOM   90    C  CA  . ASP A 1 53  ? 151.978 163.502 200.364 1.00 91.04  0  53  ASP A CA  1 
ATOM   91    C  C   . ASP A 1 53  ? 151.932 163.570 198.844 1.00 91.04  0  53  ASP A C   1 
ATOM   92    O  O   . ASP A 1 53  ? 152.957 163.426 198.170 1.00 91.04  0  53  ASP A O   1 
ATOM   93    C  CB  . ASP A 1 53  ? 152.395 164.855 200.950 1.00 91.04  0  53  ASP A CB  1 
ATOM   94    C  CG  . ASP A 1 53  ? 153.884 165.121 200.822 1.00 91.04  0  53  ASP A CG  1 
ATOM   95    O  OD1 . ASP A 1 53  ? 154.622 164.221 200.372 1.00 91.04  0  53  ASP A OD1 1 
ATOM   96    O  OD2 . ASP A 1 53  ? 154.318 166.237 201.175 1.00 91.04  -1 53  ASP A OD2 1 
ATOM   97    N  N   . ARG A 1 54  ? 150.731 163.773 198.304 1.00 95.91  0  54  ARG A N   1 
ATOM   98    C  CA  . ARG A 1 54  ? 150.530 163.767 196.856 1.00 95.91  0  54  ARG A CA  1 
ATOM   99    C  C   . ARG A 1 54  ? 150.724 165.194 196.353 1.00 95.91  0  54  ARG A C   1 
ATOM   100   O  O   . ARG A 1 54  ? 149.778 165.919 196.037 1.00 95.91  0  54  ARG A O   1 
ATOM   101   C  CB  . ARG A 1 54  ? 149.156 163.209 196.503 1.00 95.91  0  54  ARG A CB  1 
ATOM   102   C  CG  . ARG A 1 54  ? 148.883 161.789 197.012 1.00 95.91  0  54  ARG A CG  1 
ATOM   103   C  CD  . ARG A 1 54  ? 150.074 160.854 196.804 1.00 95.91  0  54  ARG A CD  1 
ATOM   104   N  NE  . ARG A 1 54  ? 149.670 159.535 196.325 1.00 95.91  0  54  ARG A NE  1 
ATOM   105   C  CZ  . ARG A 1 54  ? 150.481 158.484 196.265 1.00 95.91  0  54  ARG A CZ  1 
ATOM   106   N  NH1 . ARG A 1 54  ? 151.743 158.595 196.658 1.00 95.91  1  54  ARG A NH1 1 
ATOM   107   N  NH2 . ARG A 1 54  ? 150.032 157.320 195.815 1.00 95.91  0  54  ARG A NH2 1 
ATOM   108   N  N   . ARG A 1 55  ? 151.988 165.596 196.282 1.00 90.41  0  55  ARG A N   1 
ATOM   109   C  CA  . ARG A 1 55  ? 152.367 166.961 195.940 1.00 90.41  0  55  ARG A CA  1 
ATOM   110   C  C   . ARG A 1 55  ? 153.157 167.060 194.648 1.00 90.41  0  55  ARG A C   1 
ATOM   111   O  O   . ARG A 1 55  ? 152.915 167.972 193.854 1.00 90.41  0  55  ARG A O   1 
ATOM   112   C  CB  . ARG A 1 55  ? 153.182 167.582 197.082 1.00 90.41  0  55  ARG A CB  1 
ATOM   113   C  CG  . ARG A 1 55  ? 152.420 167.723 198.389 1.00 90.41  0  55  ARG A CG  1 
ATOM   114   C  CD  . ARG A 1 55  ? 151.150 168.540 198.210 1.00 90.41  0  55  ARG A CD  1 
ATOM   115   N  NE  . ARG A 1 55  ? 151.410 169.826 197.568 1.00 90.41  0  55  ARG A NE  1 
ATOM   116   C  CZ  . ARG A 1 55  ? 151.707 170.942 198.225 1.00 90.41  0  55  ARG A CZ  1 
ATOM   117   N  NH1 . ARG A 1 55  ? 151.925 172.067 197.559 1.00 90.41  1  55  ARG A NH1 1 
ATOM   118   N  NH2 . ARG A 1 55  ? 151.783 170.934 199.549 1.00 90.41  0  55  ARG A NH2 1 
ATOM   119   N  N   . PHE A 1 56  ? 154.099 166.149 194.412 1.00 85.11  0  56  PHE A N   1 
ATOM   120   C  CA  . PHE A 1 56  ? 154.923 166.193 193.204 1.00 85.11  0  56  PHE A CA  1 
ATOM   121   C  C   . PHE A 1 56  ? 154.279 165.378 192.081 1.00 85.11  0  56  PHE A C   1 
ATOM   122   O  O   . PHE A 1 56  ? 154.848 164.426 191.548 1.00 85.11  0  56  PHE A O   1 
ATOM   123   C  CB  . PHE A 1 56  ? 156.334 165.699 193.506 1.00 85.11  0  56  PHE A CB  1 
ATOM   124   C  CG  . PHE A 1 56  ? 157.259 166.771 194.006 1.00 85.11  0  56  PHE A CG  1 
ATOM   125   C  CD1 . PHE A 1 56  ? 157.865 167.647 193.119 1.00 85.11  0  56  PHE A CD1 1 
ATOM   126   C  CD2 . PHE A 1 56  ? 157.529 166.899 195.359 1.00 85.11  0  56  PHE A CD2 1 
ATOM   127   C  CE1 . PHE A 1 56  ? 158.722 168.635 193.572 1.00 85.11  0  56  PHE A CE1 1 
ATOM   128   C  CE2 . PHE A 1 56  ? 158.385 167.884 195.821 1.00 85.11  0  56  PHE A CE2 1 
ATOM   129   C  CZ  . PHE A 1 56  ? 158.981 168.752 194.925 1.00 85.11  0  56  PHE A CZ  1 
ATOM   130   N  N   . PHE A 1 57  ? 153.061 165.780 191.720 1.00 92.94  0  57  PHE A N   1 
ATOM   131   C  CA  . PHE A 1 57  ? 152.376 165.124 190.623 1.00 92.94  0  57  PHE A CA  1 
ATOM   132   C  C   . PHE A 1 57  ? 152.357 166.023 189.395 1.00 92.94  0  57  PHE A C   1 
ATOM   133   O  O   . PHE A 1 57  ? 152.143 167.234 189.519 1.00 92.94  0  57  PHE A O   1 
ATOM   134   C  CB  . PHE A 1 57  ? 150.935 164.744 190.995 1.00 92.94  0  57  PHE A CB  1 
ATOM   135   C  CG  . PHE A 1 57  ? 150.824 163.474 191.791 1.00 92.94  0  57  PHE A CG  1 
ATOM   136   C  CD1 . PHE A 1 57  ? 151.902 162.605 191.898 1.00 92.94  0  57  PHE A CD1 1 
ATOM   137   C  CD2 . PHE A 1 57  ? 149.629 163.132 192.406 1.00 92.94  0  57  PHE A CD2 1 
ATOM   138   C  CE1 . PHE A 1 57  ? 151.795 161.430 192.621 1.00 92.94  0  57  PHE A CE1 1 
ATOM   139   C  CE2 . PHE A 1 57  ? 149.515 161.957 193.129 1.00 92.94  0  57  PHE A CE2 1 
ATOM   140   C  CZ  . PHE A 1 57  ? 150.601 161.106 193.235 1.00 92.94  0  57  PHE A CZ  1 
ATOM   141   N  N   . PRO A 1 58  ? 152.578 165.467 188.193 1.00 92.81  0  58  PRO A N   1 
ATOM   142   C  CA  . PRO A 1 58  ? 152.923 164.062 187.961 1.00 92.81  0  58  PRO A CA  1 
ATOM   143   C  C   . PRO A 1 58  ? 154.425 163.843 187.842 1.00 92.81  0  58  PRO A C   1 
ATOM   144   O  O   . PRO A 1 58  ? 154.867 163.040 187.020 1.00 92.81  0  58  PRO A O   1 
ATOM   145   C  CB  . PRO A 1 58  ? 152.226 163.756 186.641 1.00 92.81  0  58  PRO A CB  1 
ATOM   146   C  CG  . PRO A 1 58  ? 152.256 165.052 185.915 1.00 92.81  0  58  PRO A CG  1 
ATOM   147   C  CD  . PRO A 1 58  ? 152.246 166.158 186.938 1.00 92.81  0  58  PRO A CD  1 
ATOM   148   N  N   . ILE A 1 59  ? 155.199 164.555 188.664 1.00 90.65  0  59  ILE A N   1 
ATOM   149   C  CA  . ILE A 1 59  ? 156.648 164.386 188.643 1.00 90.65  0  59  ILE A CA  1 
ATOM   150   C  C   . ILE A 1 59  ? 157.036 163.077 189.318 1.00 90.65  0  59  ILE A C   1 
ATOM   151   O  O   . ILE A 1 59  ? 157.909 162.347 188.832 1.00 90.65  0  59  ILE A O   1 
ATOM   152   C  CB  . ILE A 1 59  ? 157.339 165.600 189.294 1.00 90.65  0  59  ILE A CB  1 
ATOM   153   C  CG1 . ILE A 1 59  ? 156.924 166.896 188.592 1.00 90.65  0  59  ILE A CG1 1 
ATOM   154   C  CG2 . ILE A 1 59  ? 158.853 165.458 189.248 1.00 90.65  0  59  ILE A CG2 1 
ATOM   155   C  CD1 . ILE A 1 59  ? 155.996 167.776 189.406 1.00 90.65  0  59  ILE A CD1 1 
ATOM   156   N  N   . SER A 1 60  ? 156.376 162.737 190.427 1.00 92.75  0  60  SER A N   1 
ATOM   157   C  CA  . SER A 1 60  ? 156.734 161.528 191.158 1.00 92.75  0  60  SER A CA  1 
ATOM   158   C  C   . SER A 1 60  ? 156.105 160.271 190.569 1.00 92.75  0  60  SER A C   1 
ATOM   159   O  O   . SER A 1 60  ? 156.272 159.189 191.144 1.00 92.75  0  60  SER A O   1 
ATOM   160   C  CB  . SER A 1 60  ? 156.340 161.662 192.632 1.00 92.75  0  60  SER A CB  1 
ATOM   161   O  OG  . SER A 1 60  ? 155.007 161.235 192.846 1.00 92.75  0  60  SER A OG  1 
ATOM   162   N  N   . LYS A 1 61  ? 155.398 160.382 189.443 1.00 94.95  0  61  LYS A N   1 
ATOM   163   C  CA  . LYS A 1 61  ? 154.779 159.237 188.789 1.00 94.95  0  61  LYS A CA  1 
ATOM   164   C  C   . LYS A 1 61  ? 155.754 158.450 187.926 1.00 94.95  0  61  LYS A C   1 
ATOM   165   O  O   . LYS A 1 61  ? 155.406 157.356 187.470 1.00 94.95  0  61  LYS A O   1 
ATOM   166   C  CB  . LYS A 1 61  ? 153.586 159.682 187.940 1.00 94.95  0  61  LYS A CB  1 
ATOM   167   C  CG  . LYS A 1 61  ? 152.414 160.206 188.750 1.00 94.95  0  61  LYS A CG  1 
ATOM   168   C  CD  . LYS A 1 61  ? 151.193 160.414 187.872 1.00 94.95  0  61  LYS A CD  1 
ATOM   169   C  CE  . LYS A 1 61  ? 150.716 159.097 187.282 1.00 94.95  0  61  LYS A CE  1 
ATOM   170   N  NZ  . LYS A 1 61  ? 149.508 159.272 186.431 1.00 94.95  1  61  LYS A NZ  1 
ATOM   171   N  N   . ASP A 1 62  ? 156.953 158.976 187.682 1.00 93.62  0  62  ASP A N   1 
ATOM   172   C  CA  . ASP A 1 62  ? 157.957 158.299 186.872 1.00 93.62  0  62  ASP A CA  1 
ATOM   173   C  C   . ASP A 1 62  ? 159.160 157.870 187.695 1.00 93.62  0  62  ASP A C   1 
ATOM   174   O  O   . ASP A 1 62  ? 159.528 156.691 187.694 1.00 93.62  0  62  ASP A O   1 
ATOM   175   C  CB  . ASP A 1 62  ? 158.412 159.231 185.739 1.00 93.62  0  62  ASP A CB  1 
ATOM   176   C  CG  . ASP A 1 62  ? 157.310 159.521 184.739 1.00 93.62  0  62  ASP A CG  1 
ATOM   177   O  OD1 . ASP A 1 62  ? 157.103 158.700 183.822 1.00 93.62  0  62  ASP A OD1 1 
ATOM   178   O  OD2 . ASP A 1 62  ? 156.649 160.573 184.873 1.00 93.62  -1 62  ASP A OD2 1 
ATOM   179   N  N   . GLN A 1 63  ? 159.784 158.807 188.401 1.00 88.71  0  63  GLN A N   1 
ATOM   180   C  CA  . GLN A 1 63  ? 160.812 158.562 189.397 1.00 88.71  0  63  GLN A CA  1 
ATOM   181   C  C   . GLN A 1 63  ? 160.400 159.294 190.666 1.00 88.71  0  63  GLN A C   1 
ATOM   182   O  O   . GLN A 1 63  ? 159.754 160.345 190.581 1.00 88.71  0  63  GLN A O   1 
ATOM   183   C  CB  . GLN A 1 63  ? 162.205 159.019 188.915 1.00 88.71  0  63  GLN A CB  1 
ATOM   184   C  CG  . GLN A 1 63  ? 162.380 160.510 188.680 1.00 88.71  0  63  GLN A CG  1 
ATOM   185   C  CD  . GLN A 1 63  ? 162.032 160.929 187.266 1.00 88.71  0  63  GLN A CD  1 
ATOM   186   O  OE1 . GLN A 1 63  ? 161.533 160.130 186.474 1.00 88.71  0  63  GLN A OE1 1 
ATOM   187   N  NE2 . GLN A 1 63  ? 162.299 162.188 186.940 1.00 88.71  0  63  GLN A NE2 1 
ATOM   188   N  N   . PRO A 1 64  ? 160.693 158.748 191.848 1.00 80.37  0  64  PRO A N   1 
ATOM   189   C  CA  . PRO A 1 64  ? 160.189 159.358 193.086 1.00 80.37  0  64  PRO A CA  1 
ATOM   190   C  C   . PRO A 1 64  ? 160.877 160.684 193.383 1.00 80.37  0  64  PRO A C   1 
ATOM   191   O  O   . PRO A 1 64  ? 161.891 161.047 192.784 1.00 80.37  0  64  PRO A O   1 
ATOM   192   C  CB  . PRO A 1 64  ? 160.510 158.312 194.157 1.00 80.37  0  64  PRO A CB  1 
ATOM   193   C  CG  . PRO A 1 64  ? 161.649 157.544 193.592 1.00 80.37  0  64  PRO A CG  1 
ATOM   194   C  CD  . PRO A 1 64  ? 161.391 157.478 192.117 1.00 80.37  0  64  PRO A CD  1 
ATOM   195   N  N   . ARG A 1 65  ? 160.297 161.416 194.338 1.00 81.44  0  65  ARG A N   1 
ATOM   196   C  CA  . ARG A 1 65  ? 160.770 162.763 194.640 1.00 81.44  0  65  ARG A CA  1 
ATOM   197   C  C   . ARG A 1 65  ? 162.101 162.779 195.377 1.00 81.44  0  65  ARG A C   1 
ATOM   198   O  O   . ARG A 1 65  ? 162.734 163.837 195.447 1.00 81.44  0  65  ARG A O   1 
ATOM   199   C  CB  . ARG A 1 65  ? 159.724 163.531 195.452 1.00 81.44  0  65  ARG A CB  1 
ATOM   200   C  CG  . ARG A 1 65  ? 159.748 163.257 196.942 1.00 81.44  0  65  ARG A CG  1 
ATOM   201   C  CD  . ARG A 1 65  ? 159.008 164.346 197.696 1.00 81.44  0  65  ARG A CD  1 
ATOM   202   N  NE  . ARG A 1 65  ? 157.567 164.275 197.479 1.00 81.44  0  65  ARG A NE  1 
ATOM   203   C  CZ  . ARG A 1 65  ? 156.677 165.026 198.119 1.00 81.44  0  65  ARG A CZ  1 
ATOM   204   N  NH1 . ARG A 1 65  ? 157.080 165.910 199.022 1.00 81.44  1  65  ARG A NH1 1 
ATOM   205   N  NH2 . ARG A 1 65  ? 155.384 164.893 197.857 1.00 81.44  0  65  ARG A NH2 1 
ATOM   206   N  N   . VAL A 1 66  ? 162.542 161.642 195.924 1.00 74.98  0  66  VAL A N   1 
ATOM   207   C  CA  . VAL A 1 66  ? 163.845 161.568 196.572 1.00 74.98  0  66  VAL A CA  1 
ATOM   208   C  C   . VAL A 1 66  ? 164.961 161.242 195.591 1.00 74.98  0  66  VAL A C   1 
ATOM   209   O  O   . VAL A 1 66  ? 166.136 161.236 195.982 1.00 74.98  0  66  VAL A O   1 
ATOM   210   C  CB  . VAL A 1 66  ? 163.815 160.533 197.713 1.00 74.98  0  66  VAL A CB  1 
ATOM   211   C  CG1 . VAL A 1 66  ? 162.767 160.914 198.745 1.00 74.98  0  66  VAL A CG1 1 
ATOM   212   C  CG2 . VAL A 1 66  ? 163.546 159.146 197.161 1.00 74.98  0  66  VAL A CG2 1 
ATOM   213   N  N   . LEU A 1 67  ? 164.634 160.971 194.328 1.00 76.61  0  67  LEU A N   1 
ATOM   214   C  CA  . LEU A 1 67  ? 165.627 160.700 193.297 1.00 76.61  0  67  LEU A CA  1 
ATOM   215   C  C   . LEU A 1 67  ? 165.749 161.829 192.282 1.00 76.61  0  67  LEU A C   1 
ATOM   216   O  O   . LEU A 1 67  ? 166.476 161.684 191.294 1.00 76.61  0  67  LEU A O   1 
ATOM   217   C  CB  . LEU A 1 67  ? 165.300 159.388 192.581 1.00 76.61  0  67  LEU A CB  1 
ATOM   218   C  CG  . LEU A 1 67  ? 166.104 158.151 192.984 1.00 76.61  0  67  LEU A CG  1 
ATOM   219   C  CD1 . LEU A 1 67  ? 165.836 157.770 194.429 1.00 76.61  0  67  LEU A CD1 1 
ATOM   220   C  CD2 . LEU A 1 67  ? 165.776 156.995 192.056 1.00 76.61  0  67  LEU A CD2 1 
ATOM   221   N  N   . LEU A 1 68  ? 165.054 162.946 192.496 1.00 76.04  0  68  LEU A N   1 
ATOM   222   C  CA  . LEU A 1 68  ? 165.171 164.081 191.590 1.00 76.04  0  68  LEU A CA  1 
ATOM   223   C  C   . LEU A 1 68  ? 166.498 164.799 191.826 1.00 76.04  0  68  LEU A C   1 
ATOM   224   O  O   . LEU A 1 68  ? 166.966 164.871 192.961 1.00 76.04  0  68  LEU A O   1 
ATOM   225   C  CB  . LEU A 1 68  ? 164.017 165.059 191.795 1.00 76.04  0  68  LEU A CB  1 
ATOM   226   C  CG  . LEU A 1 68  ? 162.599 164.495 191.883 1.00 76.04  0  68  LEU A CG  1 
ATOM   227   C  CD1 . LEU A 1 68  ? 161.589 165.617 192.063 1.00 76.04  0  68  LEU A CD1 1 
ATOM   228   C  CD2 . LEU A 1 68  ? 162.255 163.658 190.664 1.00 76.04  0  68  LEU A CD2 1 
ATOM   229   N  N   . PRO A 1 69  ? 167.139 165.313 190.781 1.00 72.31  0  69  PRO A N   1 
ATOM   230   C  CA  . PRO A 1 69  ? 168.397 166.040 190.997 1.00 72.31  0  69  PRO A CA  1 
ATOM   231   C  C   . PRO A 1 69  ? 168.185 167.512 191.324 1.00 72.31  0  69  PRO A C   1 
ATOM   232   O  O   . PRO A 1 69  ? 167.458 168.215 190.615 1.00 72.31  0  69  PRO A O   1 
ATOM   233   C  CB  . PRO A 1 69  ? 169.137 165.862 189.665 1.00 72.31  0  69  PRO A CB  1 
ATOM   234   C  CG  . PRO A 1 69  ? 168.064 165.647 188.656 1.00 72.31  0  69  PRO A CG  1 
ATOM   235   C  CD  . PRO A 1 69  ? 166.892 165.021 189.358 1.00 72.31  0  69  PRO A CD  1 
ATOM   236   N  N   . LEU A 1 70  ? 168.806 167.988 192.406 1.00 72.02  0  70  LEU A N   1 
ATOM   237   C  CA  . LEU A 1 70  ? 168.882 169.428 192.635 1.00 72.02  0  70  LEU A CA  1 
ATOM   238   C  C   . LEU A 1 70  ? 169.898 170.065 191.700 1.00 72.02  0  70  LEU A C   1 
ATOM   239   O  O   . LEU A 1 70  ? 169.550 170.880 190.838 1.00 72.02  0  70  LEU A O   1 
ATOM   240   C  CB  . LEU A 1 70  ? 169.252 169.721 194.089 1.00 72.02  0  70  LEU A CB  1 
ATOM   241   C  CG  . LEU A 1 70  ? 168.230 169.485 195.194 1.00 72.02  0  70  LEU A CG  1 
ATOM   242   C  CD1 . LEU A 1 70  ? 168.895 169.713 196.529 1.00 72.02  0  70  LEU A CD1 1 
ATOM   243   C  CD2 . LEU A 1 70  ? 167.053 170.422 195.031 1.00 72.02  0  70  LEU A CD2 1 
ATOM   244   N  N   . ALA A 1 71  ? 171.169 169.694 191.853 1.00 72.96  0  71  ALA A N   1 
ATOM   245   C  CA  . ALA A 1 71  ? 172.227 170.048 190.910 1.00 72.96  0  71  ALA A CA  1 
ATOM   246   C  C   . ALA A 1 71  ? 172.972 168.757 190.589 1.00 72.96  0  71  ALA A C   1 
ATOM   247   O  O   . ALA A 1 71  ? 174.018 168.471 191.178 1.00 72.96  0  71  ALA A O   1 
ATOM   248   C  CB  . ALA A 1 71  ? 173.141 171.114 191.493 1.00 72.96  0  71  ALA A CB  1 
ATOM   249   N  N   . ASN A 1 72  ? 172.406 167.981 189.658 1.00 76.15  0  72  ASN A N   1 
ATOM   250   C  CA  . ASN A 1 72  ? 172.904 166.686 189.178 1.00 76.15  0  72  ASN A CA  1 
ATOM   251   C  C   . ASN A 1 72  ? 173.103 165.647 190.286 1.00 76.15  0  72  ASN A C   1 
ATOM   252   O  O   . ASN A 1 72  ? 173.787 164.642 190.073 1.00 76.15  0  72  ASN A O   1 
ATOM   253   C  CB  . ASN A 1 72  ? 174.207 166.853 188.386 1.00 76.15  0  72  ASN A CB  1 
ATOM   254   C  CG  . ASN A 1 72  ? 174.069 167.837 187.250 1.00 76.15  0  72  ASN A CG  1 
ATOM   255   O  OD1 . ASN A 1 72  ? 172.981 168.030 186.713 1.00 76.15  0  72  ASN A OD1 1 
ATOM   256   N  ND2 . ASN A 1 72  ? 175.178 168.457 186.866 1.00 76.15  0  72  ASN A ND2 1 
ATOM   257   N  N   . VAL A 1 73  ? 172.523 165.851 191.468 1.00 73.05  0  73  VAL A N   1 
ATOM   258   C  CA  . VAL A 1 73  ? 172.681 164.956 192.611 1.00 73.05  0  73  VAL A CA  1 
ATOM   259   C  C   . VAL A 1 73  ? 171.309 164.774 193.244 1.00 73.05  0  73  VAL A C   1 
ATOM   260   O  O   . VAL A 1 73  ? 170.624 165.760 193.536 1.00 73.05  0  73  VAL A O   1 
ATOM   261   C  CB  . VAL A 1 73  ? 173.690 165.501 193.649 1.00 73.05  0  73  VAL A CB  1 
ATOM   262   C  CG1 . VAL A 1 73  ? 173.656 164.677 194.925 1.00 73.05  0  73  VAL A CG1 1 
ATOM   263   C  CG2 . VAL A 1 73  ? 175.112 165.513 193.096 1.00 73.05  0  73  VAL A CG2 1 
ATOM   264   N  N   . ALA A 1 74  ? 170.901 163.521 193.439 1.00 72.57  0  74  ALA A N   1 
ATOM   265   C  CA  . ALA A 1 74  ? 169.618 163.226 194.057 1.00 72.57  0  74  ALA A CA  1 
ATOM   266   C  C   . ALA A 1 74  ? 169.614 163.638 195.528 1.00 72.57  0  74  ALA A C   1 
ATOM   267   O  O   . ALA A 1 74  ? 170.661 163.760 196.171 1.00 72.57  0  74  ALA A O   1 
ATOM   268   C  CB  . ALA A 1 74  ? 169.289 161.740 193.929 1.00 72.57  0  74  ALA A CB  1 
ATOM   269   N  N   . LEU A 1 75  ? 168.408 163.849 196.063 1.00 72.68  0  75  LEU A N   1 
ATOM   270   C  CA  . LEU A 1 75  ? 168.274 164.300 197.444 1.00 72.68  0  75  LEU A CA  1 
ATOM   271   C  C   . LEU A 1 75  ? 168.586 163.194 198.446 1.00 72.68  0  75  LEU A C   1 
ATOM   272   O  O   . LEU A 1 75  ? 168.868 163.496 199.613 1.00 72.68  0  75  LEU A O   1 
ATOM   273   C  CB  . LEU A 1 75  ? 166.867 164.857 197.701 1.00 72.68  0  75  LEU A CB  1 
ATOM   274   C  CG  . LEU A 1 75  ? 166.528 166.275 197.208 1.00 72.68  0  75  LEU A CG  1 
ATOM   275   C  CD1 . LEU A 1 75  ? 166.173 166.334 195.740 1.00 72.68  0  75  LEU A CD1 1 
ATOM   276   C  CD2 . LEU A 1 75  ? 165.421 166.907 198.025 1.00 72.68  0  75  LEU A CD2 1 
ATOM   277   N  N   . ILE A 1 76  ? 168.539 161.929 198.012 1.00 72.30  0  76  ILE A N   1 
ATOM   278   C  CA  . ILE A 1 76  ? 168.973 160.815 198.852 1.00 72.30  0  76  ILE A CA  1 
ATOM   279   C  C   . ILE A 1 76  ? 170.457 160.940 199.172 1.00 72.30  0  76  ILE A C   1 
ATOM   280   O  O   . ILE A 1 76  ? 170.875 160.775 200.327 1.00 72.30  0  76  ILE A O   1 
ATOM   281   C  CB  . ILE A 1 76  ? 168.643 159.476 198.160 1.00 72.30  0  76  ILE A CB  1 
ATOM   282   C  CG1 . ILE A 1 76  ? 167.171 159.122 198.356 1.00 72.30  0  76  ILE A CG1 1 
ATOM   283   C  CG2 . ILE A 1 76  ? 169.516 158.334 198.673 1.00 72.30  0  76  ILE A CG2 1 
ATOM   284   C  CD1 . ILE A 1 76  ? 166.771 158.956 199.801 1.00 72.30  0  76  ILE A CD1 1 
ATOM   285   N  N   . ASP A 1 77  ? 171.268 161.274 198.162 1.00 76.46  0  77  ASP A N   1 
ATOM   286   C  CA  . ASP A 1 77  ? 172.702 161.448 198.370 1.00 76.46  0  77  ASP A CA  1 
ATOM   287   C  C   . ASP A 1 77  ? 172.996 162.662 199.243 1.00 76.46  0  77  ASP A C   1 
ATOM   288   O  O   . ASP A 1 77  ? 173.920 162.628 200.063 1.00 76.46  0  77  ASP A O   1 
ATOM   289   C  CB  . ASP A 1 77  ? 173.414 161.570 197.023 1.00 76.46  0  77  ASP A CB  1 
ATOM   290   C  CG  . ASP A 1 77  ? 173.214 160.351 196.145 1.00 76.46  0  77  ASP A CG  1 
ATOM   291   O  OD1 . ASP A 1 77  ? 173.027 159.245 196.695 1.00 76.46  0  77  ASP A OD1 1 
ATOM   292   O  OD2 . ASP A 1 77  ? 173.246 160.497 194.905 1.00 76.46  -1 77  ASP A OD2 1 
ATOM   293   N  N   . TYR A 1 78  ? 172.195 163.724 199.106 1.00 72.06  0  78  TYR A N   1 
ATOM   294   C  CA  . TYR A 1 78  ? 172.346 164.907 199.950 1.00 72.06  0  78  TYR A CA  1 
ATOM   295   C  C   . TYR A 1 78  ? 172.039 164.589 201.409 1.00 72.06  0  78  TYR A C   1 
ATOM   296   O  O   . TYR A 1 78  ? 172.790 164.980 202.313 1.00 72.06  0  78  TYR A O   1 
ATOM   297   C  CB  . TYR A 1 78  ? 171.424 166.020 199.457 1.00 72.06  0  78  TYR A CB  1 
ATOM   298   C  CG  . TYR A 1 78  ? 171.978 166.909 198.365 1.00 72.06  0  78  TYR A CG  1 
ATOM   299   C  CD1 . TYR A 1 78  ? 172.986 167.826 198.633 1.00 72.06  0  78  TYR A CD1 1 
ATOM   300   C  CD2 . TYR A 1 78  ? 171.465 166.856 197.074 1.00 72.06  0  78  TYR A CD2 1 
ATOM   301   C  CE1 . TYR A 1 78  ? 173.486 168.652 197.641 1.00 72.06  0  78  TYR A CE1 1 
ATOM   302   C  CE2 . TYR A 1 78  ? 171.957 167.678 196.075 1.00 72.06  0  78  TYR A CE2 1 
ATOM   303   C  CZ  . TYR A 1 78  ? 172.968 168.571 196.364 1.00 72.06  0  78  TYR A CZ  1 
ATOM   304   O  OH  . TYR A 1 78  ? 173.461 169.389 195.374 1.00 72.06  0  78  TYR A OH  1 
ATOM   305   N  N   . THR A 1 79  ? 170.943 163.864 201.653 1.00 69.89  0  79  THR A N   1 
ATOM   306   C  CA  . THR A 1 79  ? 170.561 163.519 203.020 1.00 69.89  0  79  THR A CA  1 
ATOM   307   C  C   . THR A 1 79  ? 171.544 162.531 203.641 1.00 69.89  0  79  THR A C   1 
ATOM   308   O  O   . THR A 1 79  ? 171.866 162.633 204.830 1.00 69.89  0  79  THR A O   1 
ATOM   309   C  CB  . THR A 1 79  ? 169.142 162.951 203.036 1.00 69.89  0  79  THR A CB  1 
ATOM   310   O  OG1 . THR A 1 79  ? 168.299 163.758 202.206 1.00 69.89  0  79  THR A OG1 1 
ATOM   311   C  CG2 . THR A 1 79  ? 168.584 162.957 204.448 1.00 69.89  0  79  THR A CG2 1 
ATOM   312   N  N   . LEU A 1 80  ? 172.066 161.596 202.843 1.00 71.32  0  80  LEU A N   1 
ATOM   313   C  CA  . LEU A 1 80  ? 173.044 160.647 203.364 1.00 71.32  0  80  LEU A CA  1 
ATOM   314   C  C   . LEU A 1 80  ? 174.385 161.320 203.639 1.00 71.32  0  80  LEU A C   1 
ATOM   315   O  O   . LEU A 1 80  ? 175.068 160.973 204.610 1.00 71.32  0  80  LEU A O   1 
ATOM   316   C  CB  . LEU A 1 80  ? 173.209 159.482 202.391 1.00 71.32  0  80  LEU A CB  1 
ATOM   317   C  CG  . LEU A 1 80  ? 172.088 158.442 202.412 1.00 71.32  0  80  LEU A CG  1 
ATOM   318   C  CD1 . LEU A 1 80  ? 172.317 157.386 201.345 1.00 71.32  0  80  LEU A CD1 1 
ATOM   319   C  CD2 . LEU A 1 80  ? 171.972 157.807 203.787 1.00 71.32  0  80  LEU A CD2 1 
ATOM   320   N  N   . GLU A 1 81  ? 174.772 162.298 202.811 1.00 73.32  0  81  GLU A N   1 
ATOM   321   C  CA  . GLU A 1 81  ? 175.985 163.061 203.085 1.00 73.32  0  81  GLU A CA  1 
ATOM   322   C  C   . GLU A 1 81  ? 175.823 163.924 204.330 1.00 73.32  0  81  GLU A C   1 
ATOM   323   O  O   . GLU A 1 81  ? 176.770 164.074 205.112 1.00 73.32  0  81  GLU A O   1 
ATOM   324   C  CB  . GLU A 1 81  ? 176.348 163.919 201.874 1.00 73.32  0  81  GLU A CB  1 
ATOM   325   C  CG  . GLU A 1 81  ? 177.637 164.706 202.034 1.00 73.32  0  81  GLU A CG  1 
ATOM   326   C  CD  . GLU A 1 81  ? 178.853 163.812 202.169 1.00 73.32  0  81  GLU A CD  1 
ATOM   327   O  OE1 . GLU A 1 81  ? 178.912 162.772 201.479 1.00 73.32  0  81  GLU A OE1 1 
ATOM   328   O  OE2 . GLU A 1 81  ? 179.751 164.147 202.970 1.00 73.32  -1 81  GLU A OE2 1 
ATOM   329   N  N   . PHE A 1 82  ? 174.622 164.470 204.544 1.00 69.61  0  82  PHE A N   1 
ATOM   330   C  CA  . PHE A 1 82  ? 174.335 165.184 205.786 1.00 69.61  0  82  PHE A CA  1 
ATOM   331   C  C   . PHE A 1 82  ? 174.395 164.248 206.990 1.00 69.61  0  82  PHE A C   1 
ATOM   332   O  O   . PHE A 1 82  ? 174.845 164.643 208.071 1.00 69.61  0  82  PHE A O   1 
ATOM   333   C  CB  . PHE A 1 82  ? 172.965 165.859 205.691 1.00 69.61  0  82  PHE A CB  1 
ATOM   334   C  CG  . PHE A 1 82  ? 172.325 166.136 207.023 1.00 69.61  0  82  PHE A CG  1 
ATOM   335   C  CD1 . PHE A 1 82  ? 172.815 167.139 207.848 1.00 69.61  0  82  PHE A CD1 1 
ATOM   336   C  CD2 . PHE A 1 82  ? 171.230 165.398 207.448 1.00 69.61  0  82  PHE A CD2 1 
ATOM   337   C  CE1 . PHE A 1 82  ? 172.232 167.393 209.073 1.00 69.61  0  82  PHE A CE1 1 
ATOM   338   C  CE2 . PHE A 1 82  ? 170.645 165.648 208.670 1.00 69.61  0  82  PHE A CE2 1 
ATOM   339   C  CZ  . PHE A 1 82  ? 171.144 166.648 209.483 1.00 69.61  0  82  PHE A CZ  1 
ATOM   340   N  N   . LEU A 1 83  ? 173.955 163.000 206.815 1.00 69.28  0  83  LEU A N   1 
ATOM   341   C  CA  . LEU A 1 83  ? 173.995 162.036 207.912 1.00 69.28  0  83  LEU A CA  1 
ATOM   342   C  C   . LEU A 1 83  ? 175.424 161.626 208.255 1.00 69.28  0  83  LEU A C   1 
ATOM   343   O  O   . LEU A 1 83  ? 175.766 161.492 209.436 1.00 69.28  0  83  LEU A O   1 
ATOM   344   C  CB  . LEU A 1 83  ? 173.149 160.814 207.563 1.00 69.28  0  83  LEU A CB  1 
ATOM   345   C  CG  . LEU A 1 83  ? 171.646 160.992 207.786 1.00 69.28  0  83  LEU A CG  1 
ATOM   346   C  CD1 . LEU A 1 83  ? 170.886 159.753 207.355 1.00 69.28  0  83  LEU A CD1 1 
ATOM   347   C  CD2 . LEU A 1 83  ? 171.361 161.317 209.242 1.00 69.28  0  83  LEU A CD2 1 
ATOM   348   N  N   . THR A 1 84  ? 176.275 161.422 207.246 1.00 73.31  0  84  THR A N   1 
ATOM   349   C  CA  . THR A 1 84  ? 177.678 161.123 207.535 1.00 73.31  0  84  THR A CA  1 
ATOM   350   C  C   . THR A 1 84  ? 178.436 162.341 208.052 1.00 73.31  0  84  THR A C   1 
ATOM   351   O  O   . THR A 1 84  ? 179.396 162.185 208.815 1.00 73.31  0  84  THR A O   1 
ATOM   352   C  CB  . THR A 1 84  ? 178.389 160.557 206.306 1.00 73.31  0  84  THR A CB  1 
ATOM   353   O  OG1 . THR A 1 84  ? 178.532 161.578 205.310 1.00 73.31  0  84  THR A OG1 1 
ATOM   354   C  CG2 . THR A 1 84  ? 177.654 159.357 205.752 1.00 73.31  0  84  THR A CG2 1 
ATOM   355   N  N   . ALA A 1 85  ? 178.034 163.550 207.658 1.00 74.69  0  85  ALA A N   1 
ATOM   356   C  CA  . ALA A 1 85  ? 178.613 164.744 208.261 1.00 74.69  0  85  ALA A CA  1 
ATOM   357   C  C   . ALA A 1 85  ? 178.124 164.963 209.685 1.00 74.69  0  85  ALA A C   1 
ATOM   358   O  O   . ALA A 1 85  ? 178.810 165.629 210.468 1.00 74.69  0  85  ALA A O   1 
ATOM   359   C  CB  . ALA A 1 85  ? 178.300 165.971 207.405 1.00 74.69  0  85  ALA A CB  1 
ATOM   360   N  N   . THR A 1 86  ? 176.953 164.427 210.031 1.00 73.10  0  86  THR A N   1 
ATOM   361   C  CA  . THR A 1 86  ? 176.494 164.456 211.415 1.00 73.10  0  86  THR A CA  1 
ATOM   362   C  C   . THR A 1 86  ? 177.328 163.535 212.295 1.00 73.10  0  86  THR A C   1 
ATOM   363   O  O   . THR A 1 86  ? 177.811 163.943 213.358 1.00 73.10  0  86  THR A O   1 
ATOM   364   C  CB  . THR A 1 86  ? 175.019 164.063 211.483 1.00 73.10  0  86  THR A CB  1 
ATOM   365   O  OG1 . THR A 1 86  ? 174.279 164.799 210.502 1.00 73.10  0  86  THR A OG1 1 
ATOM   366   C  CG2 . THR A 1 86  ? 174.462 164.337 212.861 1.00 73.10  0  86  THR A CG2 1 
ATOM   367   N  N   . GLY A 1 87  ? 177.509 162.288 211.869 1.00 75.11  0  87  GLY A N   1 
ATOM   368   C  CA  . GLY A 1 87  ? 178.306 161.345 212.627 1.00 75.11  0  87  GLY A CA  1 
ATOM   369   C  C   . GLY A 1 87  ? 177.545 160.097 213.019 1.00 75.11  0  87  GLY A C   1 
ATOM   370   O  O   . GLY A 1 87  ? 177.878 159.449 214.016 1.00 75.11  0  87  GLY A O   1 
ATOM   371   N  N   . VAL A 1 88  ? 176.512 159.752 212.246 1.00 72.18  0  88  VAL A N   1 
ATOM   372   C  CA  . VAL A 1 88  ? 175.756 158.539 212.529 1.00 72.18  0  88  VAL A CA  1 
ATOM   373   C  C   . VAL A 1 88  ? 176.563 157.314 212.107 1.00 72.18  0  88  VAL A C   1 
ATOM   374   O  O   . VAL A 1 88  ? 177.475 157.382 211.273 1.00 72.18  0  88  VAL A O   1 
ATOM   375   C  CB  . VAL A 1 88  ? 174.380 158.568 211.842 1.00 72.18  0  88  VAL A CB  1 
ATOM   376   C  CG1 . VAL A 1 88  ? 173.603 159.805 212.264 1.00 72.18  0  88  VAL A CG1 1 
ATOM   377   C  CG2 . VAL A 1 88  ? 174.525 158.520 210.331 1.00 72.18  0  88  VAL A CG2 1 
ATOM   378   N  N   . GLN A 1 89  ? 176.232 156.175 212.713 1.00 75.92  0  89  GLN A N   1 
ATOM   379   C  CA  . GLN A 1 89  ? 176.933 154.930 212.431 1.00 75.92  0  89  GLN A CA  1 
ATOM   380   C  C   . GLN A 1 89  ? 176.138 153.978 211.552 1.00 75.92  0  89  GLN A C   1 
ATOM   381   O  O   . GLN A 1 89  ? 176.736 153.235 210.767 1.00 75.92  0  89  GLN A O   1 
ATOM   382   C  CB  . GLN A 1 89  ? 177.294 154.219 213.740 1.00 75.92  0  89  GLN A CB  1 
ATOM   383   C  CG  . GLN A 1 89  ? 178.010 155.102 214.746 1.00 75.92  0  89  GLN A CG  1 
ATOM   384   C  CD  . GLN A 1 89  ? 179.302 155.676 214.204 1.00 75.92  0  89  GLN A CD  1 
ATOM   385   O  OE1 . GLN A 1 89  ? 179.528 156.884 214.258 1.00 75.92  0  89  GLN A OE1 1 
ATOM   386   N  NE2 . GLN A 1 89  ? 180.160 154.809 213.680 1.00 75.92  0  89  GLN A NE2 1 
ATOM   387   N  N   . GLU A 1 90  ? 174.813 153.982 211.658 1.00 75.67  0  90  GLU A N   1 
ATOM   388   C  CA  . GLU A 1 90  ? 173.978 153.117 210.838 1.00 75.67  0  90  GLU A CA  1 
ATOM   389   C  C   . GLU A 1 90  ? 172.652 153.816 210.576 1.00 75.67  0  90  GLU A C   1 
ATOM   390   O  O   . GLU A 1 90  ? 172.129 154.519 211.445 1.00 75.67  0  90  GLU A O   1 
ATOM   391   C  CB  . GLU A 1 90  ? 173.776 151.746 211.505 1.00 75.67  0  90  GLU A CB  1 
ATOM   392   C  CG  . GLU A 1 90  ? 173.080 151.770 212.855 1.00 75.67  0  90  GLU A CG  1 
ATOM   393   C  CD  . GLU A 1 90  ? 172.999 150.390 213.494 1.00 75.67  0  90  GLU A CD  1 
ATOM   394   O  OE1 . GLU A 1 90  ? 171.897 149.800 213.513 1.00 75.67  0  90  GLU A OE1 1 
ATOM   395   O  OE2 . GLU A 1 90  ? 174.040 149.893 213.972 1.00 75.67  -1 90  GLU A OE2 1 
ATOM   396   N  N   . THR A 1 91  ? 172.136 153.657 209.361 1.00 74.96  0  91  THR A N   1 
ATOM   397   C  CA  . THR A 1 91  ? 170.862 154.242 208.975 1.00 74.96  0  91  THR A CA  1 
ATOM   398   C  C   . THR A 1 91  ? 169.874 153.143 208.608 1.00 74.96  0  91  THR A C   1 
ATOM   399   O  O   . THR A 1 91  ? 170.242 151.986 208.395 1.00 74.96  0  91  THR A O   1 
ATOM   400   C  CB  . THR A 1 91  ? 171.017 155.212 207.796 1.00 74.96  0  91  THR A CB  1 
ATOM   401   O  OG1 . THR A 1 91  ? 171.383 154.484 206.620 1.00 74.96  0  91  THR A OG1 1 
ATOM   402   C  CG2 . THR A 1 91  ? 172.082 156.256 208.089 1.00 74.96  0  91  THR A CG2 1 
ATOM   403   N  N   . PHE A 1 92  ? 168.601 153.526 208.533 1.00 74.88  0  92  PHE A N   1 
ATOM   404   C  CA  . PHE A 1 92  ? 167.512 152.623 208.161 1.00 74.88  0  92  PHE A CA  1 
ATOM   405   C  C   . PHE A 1 92  ? 166.656 153.329 207.115 1.00 74.88  0  92  PHE A C   1 
ATOM   406   O  O   . PHE A 1 92  ? 165.779 154.126 207.459 1.00 74.88  0  92  PHE A O   1 
ATOM   407   C  CB  . PHE A 1 92  ? 166.683 152.217 209.374 1.00 74.88  0  92  PHE A CB  1 
ATOM   408   C  CG  . PHE A 1 92  ? 167.468 151.501 210.432 1.00 74.88  0  92  PHE A CG  1 
ATOM   409   C  CD1 . PHE A 1 92  ? 167.792 150.162 210.282 1.00 74.88  0  92  PHE A CD1 1 
ATOM   410   C  CD2 . PHE A 1 92  ? 167.875 152.162 211.581 1.00 74.88  0  92  PHE A CD2 1 
ATOM   411   C  CE1 . PHE A 1 92  ? 168.513 149.496 211.255 1.00 74.88  0  92  PHE A CE1 1 
ATOM   412   C  CE2 . PHE A 1 92  ? 168.597 151.502 212.558 1.00 74.88  0  92  PHE A CE2 1 
ATOM   413   C  CZ  . PHE A 1 92  ? 168.915 150.168 212.393 1.00 74.88  0  92  PHE A CZ  1 
ATOM   414   N  N   . VAL A 1 93  ? 166.909 153.038 205.845 1.00 77.09  0  93  VAL A N   1 
ATOM   415   C  CA  . VAL A 1 93  ? 166.172 153.672 204.759 1.00 77.09  0  93  VAL A CA  1 
ATOM   416   C  C   . VAL A 1 93  ? 164.854 152.935 204.559 1.00 77.09  0  93  VAL A C   1 
ATOM   417   O  O   . VAL A 1 93  ? 164.828 151.706 204.431 1.00 77.09  0  93  VAL A O   1 
ATOM   418   C  CB  . VAL A 1 93  ? 167.007 153.682 203.470 1.00 77.09  0  93  VAL A CB  1 
ATOM   419   C  CG1 . VAL A 1 93  ? 166.363 154.580 202.430 1.00 77.09  0  93  VAL A CG1 1 
ATOM   420   C  CG2 . VAL A 1 93  ? 168.427 154.134 203.766 1.00 77.09  0  93  VAL A CG2 1 
ATOM   421   N  N   . PHE A 1 94  ? 163.757 153.687 204.530 1.00 79.49  0  94  PHE A N   1 
ATOM   422   C  CA  . PHE A 1 94  ? 162.420 153.135 204.351 1.00 79.49  0  94  PHE A CA  1 
ATOM   423   C  C   . PHE A 1 94  ? 161.815 153.719 203.085 1.00 79.49  0  94  PHE A C   1 
ATOM   424   O  O   . PHE A 1 94  ? 161.637 154.937 202.984 1.00 79.49  0  94  PHE A O   1 
ATOM   425   C  CB  . PHE A 1 94  ? 161.530 153.439 205.557 1.00 79.49  0  94  PHE A CB  1 
ATOM   426   C  CG  . PHE A 1 94  ? 161.766 152.532 206.727 1.00 79.49  0  94  PHE A CG  1 
ATOM   427   C  CD1 . PHE A 1 94  ? 162.800 152.781 207.616 1.00 79.49  0  94  PHE A CD1 1 
ATOM   428   C  CD2 . PHE A 1 94  ? 160.948 151.434 206.943 1.00 79.49  0  94  PHE A CD2 1 
ATOM   429   C  CE1 . PHE A 1 94  ? 163.017 151.947 208.698 1.00 79.49  0  94  PHE A CE1 1 
ATOM   430   C  CE2 . PHE A 1 94  ? 161.158 150.597 208.023 1.00 79.49  0  94  PHE A CE2 1 
ATOM   431   C  CZ  . PHE A 1 94  ? 162.194 150.854 208.900 1.00 79.49  0  94  PHE A CZ  1 
ATOM   432   N  N   . CYS A 1 95  ? 161.496 152.853 202.127 1.00 86.35  0  95  CYS A N   1 
ATOM   433   C  CA  . CYS A 1 95  ? 160.927 153.276 200.855 1.00 86.35  0  95  CYS A CA  1 
ATOM   434   C  C   . CYS A 1 95  ? 159.873 152.276 200.410 1.00 86.35  0  95  CYS A C   1 
ATOM   435   O  O   . CYS A 1 95  ? 160.116 151.066 200.433 1.00 86.35  0  95  CYS A O   1 
ATOM   436   C  CB  . CYS A 1 95  ? 162.019 153.416 199.789 1.00 86.35  0  95  CYS A CB  1 
ATOM   437   S  SG  . CYS A 1 95  ? 163.203 152.050 199.747 1.00 86.35  0  95  CYS A SG  1 
ATOM   438   N  N   . CYS A 1 96  ? 158.704 152.780 200.015 1.00 91.69  0  96  CYS A N   1 
ATOM   439   C  CA  . CYS A 1 96  ? 157.590 151.933 199.610 1.00 91.69  0  96  CYS A CA  1 
ATOM   440   C  C   . CYS A 1 96  ? 157.297 152.041 198.118 1.00 91.69  0  96  CYS A C   1 
ATOM   441   O  O   . CYS A 1 96  ? 157.287 151.025 197.417 1.00 91.69  0  96  CYS A O   1 
ATOM   442   C  CB  . CYS A 1 96  ? 156.339 152.284 200.426 1.00 91.69  0  96  CYS A CB  1 
ATOM   443   S  SG  . CYS A 1 96  ? 154.807 151.580 199.777 1.00 91.69  0  96  CYS A SG  1 
ATOM   444   N  N   . TRP A 1 97  ? 157.061 153.247 197.608 1.00 90.12  0  97  TRP A N   1 
ATOM   445   C  CA  . TRP A 1 97  ? 156.716 153.433 196.204 1.00 90.12  0  97  TRP A CA  1 
ATOM   446   C  C   . TRP A 1 97  ? 157.983 153.544 195.370 1.00 90.12  0  97  TRP A C   1 
ATOM   447   O  O   . TRP A 1 97  ? 158.854 154.370 195.669 1.00 90.12  0  97  TRP A O   1 
ATOM   448   C  CB  . TRP A 1 97  ? 155.846 154.675 196.009 1.00 90.12  0  97  TRP A CB  1 
ATOM   449   C  CG  . TRP A 1 97  ? 155.156 154.700 194.681 1.00 90.12  0  97  TRP A CG  1 
ATOM   450   C  CD1 . TRP A 1 97  ? 154.849 153.626 193.898 1.00 90.12  0  97  TRP A CD1 1 
ATOM   451   C  CD2 . TRP A 1 97  ? 154.684 155.856 193.979 1.00 90.12  0  97  TRP A CD2 1 
ATOM   452   N  NE1 . TRP A 1 97  ? 154.217 154.040 192.751 1.00 90.12  0  97  TRP A NE1 1 
ATOM   453   C  CE2 . TRP A 1 97  ? 154.103 155.405 192.776 1.00 90.12  0  97  TRP A CE2 1 
ATOM   454   C  CE3 . TRP A 1 97  ? 154.696 157.227 194.250 1.00 90.12  0  97  TRP A CE3 1 
ATOM   455   C  CZ2 . TRP A 1 97  ? 153.540 156.277 191.847 1.00 90.12  0  97  TRP A CZ2 1 
ATOM   456   C  CZ3 . TRP A 1 97  ? 154.136 158.091 193.326 1.00 90.12  0  97  TRP A CZ3 1 
ATOM   457   C  CH2 . TRP A 1 97  ? 153.567 157.613 192.139 1.00 90.12  0  97  TRP A CH2 1 
ATOM   458   N  N   . LYS A 1 98  ? 158.059 152.719 194.316 1.00 84.78  0  98  LYS A N   1 
ATOM   459   C  CA  . LYS A 1 98  ? 159.216 152.611 193.415 1.00 84.78  0  98  LYS A CA  1 
ATOM   460   C  C   . LYS A 1 98  ? 160.501 152.322 194.187 1.00 84.78  0  98  LYS A C   1 
ATOM   461   O  O   . LYS A 1 98  ? 161.553 152.909 193.929 1.00 84.78  0  98  LYS A O   1 
ATOM   462   C  CB  . LYS A 1 98  ? 159.368 153.858 192.539 1.00 84.78  0  98  LYS A CB  1 
ATOM   463   C  CG  . LYS A 1 98  ? 158.186 154.116 191.621 1.00 84.78  0  98  LYS A CG  1 
ATOM   464   C  CD  . LYS A 1 98  ? 158.354 155.418 190.859 1.00 84.78  0  98  LYS A CD  1 
ATOM   465   C  CE  . LYS A 1 98  ? 157.175 155.669 189.937 1.00 84.78  0  98  LYS A CE  1 
ATOM   466   N  NZ  . LYS A 1 98  ? 157.068 154.626 188.881 1.00 84.78  1  98  LYS A NZ  1 
ATOM   467   N  N   . ALA A 1 99  ? 160.406 151.402 195.150 1.00 84.31  0  99  ALA A N   1 
ATOM   468   C  CA  . ALA A 1 99  ? 161.515 151.142 196.059 1.00 84.31  0  99  ALA A CA  1 
ATOM   469   C  C   . ALA A 1 99  ? 162.654 150.393 195.382 1.00 84.31  0  99  ALA A C   1 
ATOM   470   O  O   . ALA A 1 99  ? 163.800 150.498 195.832 1.00 84.31  0  99  ALA A O   1 
ATOM   471   C  CB  . ALA A 1 99  ? 161.023 150.358 197.273 1.00 84.31  0  99  ALA A CB  1 
ATOM   472   N  N   . ALA A 1 100 ? 162.363 149.651 194.311 1.00 84.79  0  100 ALA A N   1 
ATOM   473   C  CA  . ALA A 1 100 ? 163.419 148.991 193.552 1.00 84.79  0  100 ALA A CA  1 
ATOM   474   C  C   . ALA A 1 100 ? 164.286 150.011 192.826 1.00 84.79  0  100 ALA A C   1 
ATOM   475   O  O   . ALA A 1 100 ? 165.504 149.832 192.714 1.00 84.79  0  100 ALA A O   1 
ATOM   476   C  CB  . ALA A 1 100 ? 162.815 147.995 192.563 1.00 84.79  0  100 ALA A CB  1 
ATOM   477   N  N   . GLN A 1 101 ? 163.674 151.099 192.348 1.00 85.60  0  101 GLN A N   1 
ATOM   478   C  CA  . GLN A 1 101 ? 164.429 152.152 191.676 1.00 85.60  0  101 GLN A CA  1 
ATOM   479   C  C   . GLN A 1 101 ? 165.315 152.909 192.658 1.00 85.60  0  101 GLN A C   1 
ATOM   480   O  O   . GLN A 1 101 ? 166.467 153.229 192.340 1.00 85.60  0  101 GLN A O   1 
ATOM   481   C  CB  . GLN A 1 101 ? 163.471 153.104 190.961 1.00 85.60  0  101 GLN A CB  1 
ATOM   482   C  CG  . GLN A 1 101 ? 164.158 154.139 190.088 1.00 85.60  0  101 GLN A CG  1 
ATOM   483   C  CD  . GLN A 1 101 ? 163.175 154.957 189.276 1.00 85.60  0  101 GLN A CD  1 
ATOM   484   O  OE1 . GLN A 1 101 ? 161.962 154.827 189.437 1.00 85.60  0  101 GLN A OE1 1 
ATOM   485   N  NE2 . GLN A 1 101 ? 163.694 155.804 188.396 1.00 85.60  0  101 GLN A NE2 1 
ATOM   486   N  N   . ILE A 1 102 ? 164.805 153.179 193.865 1.00 82.31  0  102 ILE A N   1 
ATOM   487   C  CA  . ILE A 1 102 ? 165.616 153.811 194.904 1.00 82.31  0  102 ILE A CA  1 
ATOM   488   C  C   . ILE A 1 102 ? 166.747 152.884 195.336 1.00 82.31  0  102 ILE A C   1 
ATOM   489   O  O   . ILE A 1 102 ? 167.875 153.332 195.585 1.00 82.31  0  102 ILE A O   1 
ATOM   490   C  CB  . ILE A 1 102 ? 164.727 154.225 196.092 1.00 82.31  0  102 ILE A CB  1 
ATOM   491   C  CG1 . ILE A 1 102 ? 163.517 155.016 195.595 1.00 82.31  0  102 ILE A CG1 1 
ATOM   492   C  CG2 . ILE A 1 102 ? 165.513 155.044 197.105 1.00 82.31  0  102 ILE A CG2 1 
ATOM   493   C  CD1 . ILE A 1 102 ? 162.548 155.412 196.684 1.00 82.31  0  102 ILE A CD1 1 
ATOM   494   N  N   . LYS A 1 103 ? 166.469 151.577 195.398 1.00 85.03  0  103 LYS A N   1 
ATOM   495   C  CA  . LYS A 1 103 ? 167.482 150.602 195.790 1.00 85.03  0  103 LYS A CA  1 
ATOM   496   C  C   . LYS A 1 103 ? 168.598 150.514 194.754 1.00 85.03  0  103 LYS A C   1 
ATOM   497   O  O   . LYS A 1 103 ? 169.783 150.543 195.105 1.00 85.03  0  103 LYS A O   1 
ATOM   498   C  CB  . LYS A 1 103 ? 166.837 149.233 196.004 1.00 85.03  0  103 LYS A CB  1 
ATOM   499   C  CG  . LYS A 1 103 ? 167.796 148.167 196.509 1.00 85.03  0  103 LYS A CG  1 
ATOM   500   C  CD  . LYS A 1 103 ? 167.138 146.797 196.524 1.00 85.03  0  103 LYS A CD  1 
ATOM   501   C  CE  . LYS A 1 103 ? 168.030 145.759 197.184 1.00 85.03  0  103 LYS A CE  1 
ATOM   502   N  NZ  . LYS A 1 103 ? 168.208 146.016 198.639 1.00 85.03  1  103 LYS A NZ  1 
ATOM   503   N  N   . GLU A 1 104 ? 168.243 150.438 193.467 1.00 86.50  0  104 GLU A N   1 
ATOM   504   C  CA  . GLU A 1 104 ? 169.271 150.399 192.432 1.00 86.50  0  104 GLU A CA  1 
ATOM   505   C  C   . GLU A 1 104 ? 169.948 151.751 192.244 1.00 86.50  0  104 GLU A C   1 
ATOM   506   O  O   . GLU A 1 104 ? 171.043 151.805 191.676 1.00 86.50  0  104 GLU A O   1 
ATOM   507   C  CB  . GLU A 1 104 ? 168.686 149.907 191.102 1.00 86.50  0  104 GLU A CB  1 
ATOM   508   C  CG  . GLU A 1 104 ? 167.690 150.844 190.434 1.00 86.50  0  104 GLU A CG  1 
ATOM   509   C  CD  . GLU A 1 104 ? 168.308 151.685 189.331 1.00 86.50  0  104 GLU A CD  1 
ATOM   510   O  OE1 . GLU A 1 104 ? 169.396 151.319 188.839 1.00 86.50  0  104 GLU A OE1 1 
ATOM   511   O  OE2 . GLU A 1 104 ? 167.706 152.716 188.962 1.00 86.50  -1 104 GLU A OE2 1 
ATOM   512   N  N   . HIS A 1 105 ? 169.328 152.839 192.705 1.00 84.20  0  105 HIS A N   1 
ATOM   513   C  CA  . HIS A 1 105 ? 170.018 154.121 192.688 1.00 84.20  0  105 HIS A CA  1 
ATOM   514   C  C   . HIS A 1 105 ? 171.066 154.204 193.790 1.00 84.20  0  105 HIS A C   1 
ATOM   515   O  O   . HIS A 1 105 ? 172.182 154.678 193.551 1.00 84.20  0  105 HIS A O   1 
ATOM   516   C  CB  . HIS A 1 105 ? 169.020 155.269 192.829 1.00 84.20  0  105 HIS A CB  1 
ATOM   517   C  CG  . HIS A 1 105 ? 169.661 156.582 193.151 1.00 84.20  0  105 HIS A CG  1 
ATOM   518   N  ND1 . HIS A 1 105 ? 170.480 157.247 192.265 1.00 84.20  0  105 HIS A ND1 1 
ATOM   519   C  CD2 . HIS A 1 105 ? 169.611 157.350 194.265 1.00 84.20  0  105 HIS A CD2 1 
ATOM   520   C  CE1 . HIS A 1 105 ? 170.904 158.369 192.817 1.00 84.20  0  105 HIS A CE1 1 
ATOM   521   N  NE2 . HIS A 1 105 ? 170.391 158.456 194.030 1.00 84.20  0  105 HIS A NE2 1 
ATOM   522   N  N   . LEU A 1 106 ? 170.732 153.753 195.001 1.00 84.71  0  106 LEU A N   1 
ATOM   523   C  CA  . LEU A 1 106 ? 171.649 153.943 196.117 1.00 84.71  0  106 LEU A CA  1 
ATOM   524   C  C   . LEU A 1 106 ? 172.619 152.785 196.331 1.00 84.71  0  106 LEU A C   1 
ATOM   525   O  O   . LEU A 1 106 ? 173.560 152.942 197.115 1.00 84.71  0  106 LEU A O   1 
ATOM   526   C  CB  . LEU A 1 106 ? 170.870 154.226 197.416 1.00 84.71  0  106 LEU A CB  1 
ATOM   527   C  CG  . LEU A 1 106 ? 170.006 153.202 198.157 1.00 84.71  0  106 LEU A CG  1 
ATOM   528   C  CD1 . LEU A 1 106 ? 170.779 152.512 199.270 1.00 84.71  0  106 LEU A CD1 1 
ATOM   529   C  CD2 . LEU A 1 106 ? 168.773 153.884 198.733 1.00 84.71  0  106 LEU A CD2 1 
ATOM   530   N  N   . LEU A 1 107 ? 172.439 151.637 195.662 1.00 84.32  0  107 LEU A N   1 
ATOM   531   C  CA  . LEU A 1 107 ? 173.446 150.582 195.782 1.00 84.32  0  107 LEU A CA  1 
ATOM   532   C  C   . LEU A 1 107 ? 174.728 150.927 195.036 1.00 84.32  0  107 LEU A C   1 
ATOM   533   O  O   . LEU A 1 107 ? 175.811 150.487 195.438 1.00 84.32  0  107 LEU A O   1 
ATOM   534   C  CB  . LEU A 1 107 ? 172.903 149.239 195.289 1.00 84.32  0  107 LEU A CB  1 
ATOM   535   C  CG  . LEU A 1 107 ? 171.992 148.429 196.214 1.00 84.32  0  107 LEU A CG  1 
ATOM   536   C  CD1 . LEU A 1 107 ? 171.413 147.235 195.474 1.00 84.32  0  107 LEU A CD1 1 
ATOM   537   C  CD2 . LEU A 1 107 ? 172.748 147.972 197.447 1.00 84.32  0  107 LEU A CD2 1 
ATOM   538   N  N   . LYS A 1 108 ? 174.636 151.708 193.964 1.00 81.10  0  108 LYS A N   1 
ATOM   539   C  CA  . LYS A 1 108 ? 175.813 152.133 193.220 1.00 81.10  0  108 LYS A CA  1 
ATOM   540   C  C   . LYS A 1 108 ? 176.389 153.443 193.741 1.00 81.10  0  108 LYS A C   1 
ATOM   541   O  O   . LYS A 1 108 ? 177.222 154.054 193.064 1.00 81.10  0  108 LYS A O   1 
ATOM   542   C  CB  . LYS A 1 108 ? 175.479 152.264 191.732 1.00 81.10  0  108 LYS A CB  1 
ATOM   543   C  CG  . LYS A 1 108 ? 174.374 153.261 191.428 1.00 81.10  0  108 LYS A CG  1 
ATOM   544   C  CD  . LYS A 1 108 ? 174.079 153.319 189.939 1.00 81.10  0  108 LYS A CD  1 
ATOM   545   C  CE  . LYS A 1 108 ? 173.581 151.980 189.422 1.00 81.10  0  108 LYS A CE  1 
ATOM   546   N  NZ  . LYS A 1 108 ? 173.304 152.021 187.960 1.00 81.10  1  108 LYS A NZ  1 
ATOM   547   N  N   . SER A 1 109 ? 175.972 153.879 194.925 1.00 80.65  0  109 SER A N   1 
ATOM   548   C  CA  . SER A 1 109 ? 176.425 155.132 195.505 1.00 80.65  0  109 SER A CA  1 
ATOM   549   C  C   . SER A 1 109 ? 177.641 154.887 196.397 1.00 80.65  0  109 SER A C   1 
ATOM   550   O  O   . SER A 1 109 ? 178.169 153.775 196.482 1.00 80.65  0  109 SER A O   1 
ATOM   551   C  CB  . SER A 1 109 ? 175.283 155.793 196.273 1.00 80.65  0  109 SER A CB  1 
ATOM   552   O  OG  . SER A 1 109 ? 175.205 155.286 197.593 1.00 80.65  0  109 SER A OG  1 
ATOM   553   N  N   . LYS A 1 110 ? 178.096 155.940 197.078 1.00 81.23  0  110 LYS A N   1 
ATOM   554   C  CA  . LYS A 1 110 ? 179.249 155.846 197.964 1.00 81.23  0  110 LYS A CA  1 
ATOM   555   C  C   . LYS A 1 110 ? 178.916 155.184 199.294 1.00 81.23  0  110 LYS A C   1 
ATOM   556   O  O   . LYS A 1 110 ? 179.808 154.612 199.930 1.00 81.23  0  110 LYS A O   1 
ATOM   557   C  CB  . LYS A 1 110 ? 179.820 157.245 198.216 1.00 81.23  0  110 LYS A CB  1 
ATOM   558   C  CG  . LYS A 1 110 ? 181.266 157.274 198.689 1.00 81.23  0  110 LYS A CG  1 
ATOM   559   C  CD  . LYS A 1 110 ? 181.691 158.684 199.068 1.00 81.23  0  110 LYS A CD  1 
ATOM   560   C  CE  . LYS A 1 110 ? 180.826 159.244 200.185 1.00 81.23  0  110 LYS A CE  1 
ATOM   561   N  NZ  . LYS A 1 110 ? 181.212 160.636 200.541 1.00 81.23  1  110 LYS A NZ  1 
ATOM   562   N  N   . TRP A 1 111 ? 177.653 155.228 199.716 1.00 77.47  0  111 TRP A N   1 
ATOM   563   C  CA  . TRP A 1 111 ? 177.284 154.798 201.058 1.00 77.47  0  111 TRP A CA  1 
ATOM   564   C  C   . TRP A 1 111 ? 177.066 153.294 201.173 1.00 77.47  0  111 TRP A C   1 
ATOM   565   O  O   . TRP A 1 111 ? 177.094 152.766 202.290 1.00 77.47  0  111 TRP A O   1 
ATOM   566   C  CB  . TRP A 1 111 ? 176.034 155.554 201.510 1.00 77.47  0  111 TRP A CB  1 
ATOM   567   C  CG  . TRP A 1 111 ? 176.279 157.028 201.637 1.00 77.47  0  111 TRP A CG  1 
ATOM   568   C  CD1 . TRP A 1 111 ? 176.686 157.693 202.753 1.00 77.47  0  111 TRP A CD1 1 
ATOM   569   C  CD2 . TRP A 1 111 ? 176.159 158.014 200.603 1.00 77.47  0  111 TRP A CD2 1 
ATOM   570   N  NE1 . TRP A 1 111 ? 176.817 159.034 202.485 1.00 77.47  0  111 TRP A NE1 1 
ATOM   571   C  CE2 . TRP A 1 111 ? 176.502 159.256 201.171 1.00 77.47  0  111 TRP A CE2 1 
ATOM   572   C  CE3 . TRP A 1 111 ? 175.792 157.968 199.255 1.00 77.47  0  111 TRP A CE3 1 
ATOM   573   C  CZ2 . TRP A 1 111 ? 176.485 160.442 200.441 1.00 77.47  0  111 TRP A CZ2 1 
ATOM   574   C  CZ3 . TRP A 1 111 ? 175.778 159.146 198.531 1.00 77.47  0  111 TRP A CZ3 1 
ATOM   575   C  CH2 . TRP A 1 111 ? 176.123 160.366 199.126 1.00 77.47  0  111 TRP A CH2 1 
ATOM   576   N  N   . CYS A 1 112 ? 176.855 152.593 200.062 1.00 82.22  0  112 CYS A N   1 
ATOM   577   C  CA  . CYS A 1 112 ? 176.751 151.139 200.084 1.00 82.22  0  112 CYS A CA  1 
ATOM   578   C  C   . CYS A 1 112 ? 178.092 150.440 199.918 1.00 82.22  0  112 CYS A C   1 
ATOM   579   O  O   . CYS A 1 112 ? 178.127 149.207 199.851 1.00 82.22  0  112 CYS A O   1 
ATOM   580   C  CB  . CYS A 1 112 ? 175.786 150.654 199.000 1.00 82.22  0  112 CYS A CB  1 
ATOM   581   S  SG  . CYS A 1 112 ? 174.051 150.777 199.462 1.00 82.22  0  112 CYS A SG  1 
ATOM   582   N  N   . ARG A 1 113 ? 179.184 151.185 199.845 1.00 84.04  0  113 ARG A N   1 
ATOM   583   C  CA  . ARG A 1 113 ? 180.498 150.578 199.740 1.00 84.04  0  113 ARG A CA  1 
ATOM   584   C  C   . ARG A 1 113 ? 180.930 150.022 201.096 1.00 84.04  0  113 ARG A C   1 
ATOM   585   O  O   . ARG A 1 113 ? 180.525 150.539 202.141 1.00 84.04  0  113 ARG A O   1 
ATOM   586   C  CB  . ARG A 1 113 ? 181.511 151.605 199.246 1.00 84.04  0  113 ARG A CB  1 
ATOM   587   C  CG  . ARG A 1 113 ? 181.139 152.222 197.912 1.00 84.04  0  113 ARG A CG  1 
ATOM   588   C  CD  . ARG A 1 113 ? 182.092 153.334 197.524 1.00 84.04  0  113 ARG A CD  1 
ATOM   589   N  NE  . ARG A 1 113 ? 181.707 153.952 196.260 1.00 84.04  0  113 ARG A NE  1 
ATOM   590   C  CZ  . ARG A 1 113 ? 182.355 154.965 195.697 1.00 84.04  0  113 ARG A CZ  1 
ATOM   591   N  NH1 . ARG A 1 113 ? 183.426 155.477 196.287 1.00 84.04  1  113 ARG A NH1 1 
ATOM   592   N  NH2 . ARG A 1 113 ? 181.934 155.464 194.542 1.00 84.04  0  113 ARG A NH2 1 
ATOM   593   N  N   . PRO A 1 114 ? 181.740 148.954 201.109 1.00 89.35  0  114 PRO A N   1 
ATOM   594   C  CA  . PRO A 1 114 ? 182.216 148.418 202.396 1.00 89.35  0  114 PRO A CA  1 
ATOM   595   C  C   . PRO A 1 114 ? 183.199 149.326 203.117 1.00 89.35  0  114 PRO A C   1 
ATOM   596   O  O   . PRO A 1 114 ? 183.396 149.155 204.326 1.00 89.35  0  114 PRO A O   1 
ATOM   597   C  CB  . PRO A 1 114 ? 182.874 147.088 202.003 1.00 89.35  0  114 PRO A CB  1 
ATOM   598   C  CG  . PRO A 1 114 ? 183.220 147.248 200.562 1.00 89.35  0  114 PRO A CG  1 
ATOM   599   C  CD  . PRO A 1 114 ? 182.124 148.086 199.982 1.00 89.35  0  114 PRO A CD  1 
ATOM   600   N  N   . THR A 1 115 ? 183.817 150.282 202.425 1.00 89.85  0  115 THR A N   1 
ATOM   601   C  CA  . THR A 1 115 ? 184.715 151.232 203.067 1.00 89.85  0  115 THR A CA  1 
ATOM   602   C  C   . THR A 1 115 ? 183.982 152.421 203.674 1.00 89.85  0  115 THR A C   1 
ATOM   603   O  O   . THR A 1 115 ? 184.632 153.291 204.264 1.00 89.85  0  115 THR A O   1 
ATOM   604   C  CB  . THR A 1 115 ? 185.758 151.734 202.065 1.00 89.85  0  115 THR A CB  1 
ATOM   605   O  OG1 . THR A 1 115 ? 186.684 152.600 202.732 1.00 89.85  0  115 THR A OG1 1 
ATOM   606   C  CG2 . THR A 1 115 ? 185.085 152.495 200.934 1.00 89.85  0  115 THR A CG2 1 
ATOM   607   N  N   . SER A 1 116 ? 182.660 152.482 203.541 1.00 85.63  0  116 SER A N   1 
ATOM   608   C  CA  . SER A 1 116 ? 181.894 153.572 204.126 1.00 85.63  0  116 SER A CA  1 
ATOM   609   C  C   . SER A 1 116 ? 181.774 153.391 205.634 1.00 85.63  0  116 SER A C   1 
ATOM   610   O  O   . SER A 1 116 ? 181.496 152.294 206.125 1.00 85.63  0  116 SER A O   1 
ATOM   611   C  CB  . SER A 1 116 ? 180.505 153.645 203.493 1.00 85.63  0  116 SER A CB  1 
ATOM   612   O  OG  . SER A 1 116 ? 179.589 154.306 204.349 1.00 85.63  0  116 SER A OG  1 
ATOM   613   N  N   . LEU A 1 117 ? 181.986 154.483 206.370 1.00 82.28  0  117 LEU A N   1 
ATOM   614   C  CA  . LEU A 1 117 ? 181.902 154.437 207.824 1.00 82.28  0  117 LEU A CA  1 
ATOM   615   C  C   . LEU A 1 117 ? 180.465 154.371 208.321 1.00 82.28  0  117 LEU A C   1 
ATOM   616   O  O   . LEU A 1 117 ? 180.232 153.909 209.443 1.00 82.28  0  117 LEU A O   1 
ATOM   617   C  CB  . LEU A 1 117 ? 182.601 155.651 208.452 1.00 82.28  0  117 LEU A CB  1 
ATOM   618   C  CG  . LEU A 1 117 ? 181.946 157.042 208.505 1.00 82.28  0  117 LEU A CG  1 
ATOM   619   C  CD1 . LEU A 1 117 ? 182.750 157.946 209.427 1.00 82.28  0  117 LEU A CD1 1 
ATOM   620   C  CD2 . LEU A 1 117 ? 181.794 157.707 207.140 1.00 82.28  0  117 LEU A CD2 1 
ATOM   621   N  N   . ASN A 1 118 ? 179.505 154.821 207.519 1.00 78.75  0  118 ASN A N   1 
ATOM   622   C  CA  . ASN A 1 118 ? 178.090 154.822 207.880 1.00 78.75  0  118 ASN A CA  1 
ATOM   623   C  C   . ASN A 1 118 ? 177.383 153.814 206.979 1.00 78.75  0  118 ASN A C   1 
ATOM   624   O  O   . ASN A 1 118 ? 177.150 154.080 205.797 1.00 78.75  0  118 ASN A O   1 
ATOM   625   C  CB  . ASN A 1 118 ? 177.496 156.220 207.736 1.00 78.75  0  118 ASN A CB  1 
ATOM   626   C  CG  . ASN A 1 118 ? 176.002 156.250 207.982 1.00 78.75  0  118 ASN A CG  1 
ATOM   627   O  OD1 . ASN A 1 118 ? 175.482 155.518 208.824 1.00 78.75  0  118 ASN A OD1 1 
ATOM   628   N  ND2 . ASN A 1 118 ? 175.300 157.101 207.242 1.00 78.75  0  118 ASN A ND2 1 
ATOM   629   N  N   . VAL A 1 119 ? 177.042 152.656 207.542 1.00 78.00  0  119 VAL A N   1 
ATOM   630   C  CA  . VAL A 1 119 ? 176.352 151.630 206.774 1.00 78.00  0  119 VAL A CA  1 
ATOM   631   C  C   . VAL A 1 119 ? 174.867 151.965 206.671 1.00 78.00  0  119 VAL A C   1 
ATOM   632   O  O   . VAL A 1 119 ? 174.317 152.748 207.450 1.00 78.00  0  119 VAL A O   1 
ATOM   633   C  CB  . VAL A 1 119 ? 176.572 150.235 207.389 1.00 78.00  0  119 VAL A CB  1 
ATOM   634   C  CG1 . VAL A 1 119 ? 178.058 149.966 207.565 1.00 78.00  0  119 VAL A CG1 1 
ATOM   635   C  CG2 . VAL A 1 119 ? 175.849 150.113 208.722 1.00 78.00  0  119 VAL A CG2 1 
ATOM   636   N  N   . VAL A 1 120 ? 174.216 151.374 205.673 1.00 77.45  0  120 VAL A N   1 
ATOM   637   C  CA  . VAL A 1 120 ? 172.796 151.583 205.430 1.00 77.45  0  120 VAL A CA  1 
ATOM   638   C  C   . VAL A 1 120 ? 172.080 150.244 205.540 1.00 77.45  0  120 VAL A C   1 
ATOM   639   O  O   . VAL A 1 120 ? 172.678 149.178 205.358 1.00 77.45  0  120 VAL A O   1 
ATOM   640   C  CB  . VAL A 1 120 ? 172.533 152.236 204.053 1.00 77.45  0  120 VAL A CB  1 
ATOM   641   C  CG1 . VAL A 1 120 ? 173.177 153.612 203.980 1.00 77.45  0  120 VAL A CG1 1 
ATOM   642   C  CG2 . VAL A 1 120 ? 173.050 151.355 202.935 1.00 77.45  0  120 VAL A CG2 1 
ATOM   643   N  N   . ARG A 1 121 ? 170.790 150.305 205.864 1.00 81.34  0  121 ARG A N   1 
ATOM   644   C  CA  . ARG A 1 121 ? 169.930 149.124 205.944 1.00 81.34  0  121 ARG A CA  1 
ATOM   645   C  C   . ARG A 1 121 ? 168.708 149.385 205.069 1.00 81.34  0  121 ARG A C   1 
ATOM   646   O  O   . ARG A 1 121 ? 167.796 150.113 205.470 1.00 81.34  0  121 ARG A O   1 
ATOM   647   C  CB  . ARG A 1 121 ? 169.520 148.818 207.383 1.00 81.34  0  121 ARG A CB  1 
ATOM   648   C  CG  . ARG A 1 121 ? 170.670 148.690 208.369 1.00 81.34  0  121 ARG A CG  1 
ATOM   649   C  CD  . ARG A 1 121 ? 171.587 147.537 208.009 1.00 81.34  0  121 ARG A CD  1 
ATOM   650   N  NE  . ARG A 1 121 ? 172.772 147.502 208.860 1.00 81.34  0  121 ARG A NE  1 
ATOM   651   C  CZ  . ARG A 1 121 ? 173.839 146.747 208.624 1.00 81.34  0  121 ARG A CZ  1 
ATOM   652   N  NH1 . ARG A 1 121 ? 173.875 145.963 207.555 1.00 81.34  1  121 ARG A NH1 1 
ATOM   653   N  NH2 . ARG A 1 121 ? 174.873 146.779 209.454 1.00 81.34  0  121 ARG A NH2 1 
ATOM   654   N  N   . ILE A 1 122 ? 168.691 148.794 203.879 1.00 82.62  0  122 ILE A N   1 
ATOM   655   C  CA  . ILE A 1 122 ? 167.566 148.956 202.965 1.00 82.62  0  122 ILE A CA  1 
ATOM   656   C  C   . ILE A 1 122 ? 166.435 148.045 203.422 1.00 82.62  0  122 ILE A C   1 
ATOM   657   O  O   . ILE A 1 122 ? 166.593 146.821 203.477 1.00 82.62  0  122 ILE A O   1 
ATOM   658   C  CB  . ILE A 1 122 ? 167.975 148.640 201.520 1.00 82.62  0  122 ILE A CB  1 
ATOM   659   C  CG1 . ILE A 1 122 ? 169.303 149.317 201.178 1.00 82.62  0  122 ILE A CG1 1 
ATOM   660   C  CG2 . ILE A 1 122 ? 166.889 149.084 200.554 1.00 82.62  0  122 ILE A CG2 1 
ATOM   661   C  CD1 . ILE A 1 122 ? 169.851 148.913 199.828 1.00 82.62  0  122 ILE A CD1 1 
ATOM   662   N  N   . ILE A 1 123 ? 165.291 148.639 203.748 1.00 84.38  0  123 ILE A N   1 
ATOM   663   C  CA  . ILE A 1 123 ? 164.113 147.902 204.190 1.00 84.38  0  123 ILE A CA  1 
ATOM   664   C  C   . ILE A 1 123 ? 162.991 148.178 203.201 1.00 84.38  0  123 ILE A C   1 
ATOM   665   O  O   . ILE A 1 123 ? 162.573 149.330 203.032 1.00 84.38  0  123 ILE A O   1 
ATOM   666   C  CB  . ILE A 1 123 ? 163.703 148.287 205.620 1.00 84.38  0  123 ILE A CB  1 
ATOM   667   C  CG1 . ILE A 1 123 ? 164.785 147.844 206.607 1.00 84.38  0  123 ILE A CG1 1 
ATOM   668   C  CG2 . ILE A 1 123 ? 162.358 147.671 205.973 1.00 84.38  0  123 ILE A CG2 1 
ATOM   669   C  CD1 . ILE A 1 123 ? 164.475 148.158 208.048 1.00 84.38  0  123 ILE A CD1 1 
ATOM   670   N  N   . THR A 1 124 ? 162.507 147.123 202.549 1.00 94.32  0  124 THR A N   1 
ATOM   671   C  CA  . THR A 1 124 ? 161.537 147.237 201.467 1.00 94.32  0  124 THR A CA  1 
ATOM   672   C  C   . THR A 1 124 ? 160.260 146.506 201.850 1.00 94.32  0  124 THR A C   1 
ATOM   673   O  O   . THR A 1 124 ? 160.294 145.306 202.145 1.00 94.32  0  124 THR A O   1 
ATOM   674   C  CB  . THR A 1 124 ? 162.103 146.661 200.166 1.00 94.32  0  124 THR A CB  1 
ATOM   675   O  OG1 . THR A 1 124 ? 163.438 147.142 199.965 1.00 94.32  0  124 THR A OG1 1 
ATOM   676   C  CG2 . THR A 1 124 ? 161.232 147.049 198.985 1.00 94.32  0  124 THR A CG2 1 
ATOM   677   N  N   . SER A 1 125 ? 159.141 147.228 201.838 1.00 92.99  0  125 SER A N   1 
ATOM   678   C  CA  . SER A 1 125 ? 157.826 146.639 202.050 1.00 92.99  0  125 SER A CA  1 
ATOM   679   C  C   . SER A 1 125 ? 156.779 147.575 201.467 1.00 92.99  0  125 SER A C   1 
ATOM   680   O  O   . SER A 1 125 ? 156.844 148.789 201.671 1.00 92.99  0  125 SER A O   1 
ATOM   681   C  CB  . SER A 1 125 ? 157.543 146.385 203.536 1.00 92.99  0  125 SER A CB  1 
ATOM   682   O  OG  . SER A 1 125 ? 156.149 146.310 203.782 1.00 92.99  0  125 SER A OG  1 
ATOM   683   N  N   . GLU A 1 126 ? 155.822 147.005 200.740 1.00 91.40  0  126 GLU A N   1 
ATOM   684   C  CA  . GLU A 1 126 ? 154.738 147.769 200.140 1.00 91.40  0  126 GLU A CA  1 
ATOM   685   C  C   . GLU A 1 126 ? 153.522 147.875 201.051 1.00 91.40  0  126 GLU A C   1 
ATOM   686   O  O   . GLU A 1 126 ? 152.467 148.339 200.606 1.00 91.40  0  126 GLU A O   1 
ATOM   687   C  CB  . GLU A 1 126 ? 154.333 147.145 198.801 1.00 91.40  0  126 GLU A CB  1 
ATOM   688   N  N   . LEU A 1 127 ? 153.647 147.459 202.312 1.00 90.35  0  127 LEU A N   1 
ATOM   689   C  CA  . LEU A 1 127 ? 152.506 147.475 203.221 1.00 90.35  0  127 LEU A CA  1 
ATOM   690   C  C   . LEU A 1 127 ? 152.304 148.843 203.862 1.00 90.35  0  127 LEU A C   1 
ATOM   691   O  O   . LEU A 1 127 ? 151.164 149.302 203.995 1.00 90.35  0  127 LEU A O   1 
ATOM   692   C  CB  . LEU A 1 127 ? 152.684 146.405 204.300 1.00 90.35  0  127 LEU A CB  1 
ATOM   693   N  N   . TYR A 1 128 ? 153.384 149.507 204.265 1.00 89.61  0  128 TYR A N   1 
ATOM   694   C  CA  . TYR A 1 128 ? 153.250 150.773 204.969 1.00 89.61  0  128 TYR A CA  1 
ATOM   695   C  C   . TYR A 1 128 ? 153.049 151.927 203.993 1.00 89.61  0  128 TYR A C   1 
ATOM   696   O  O   . TYR A 1 128 ? 153.587 151.934 202.881 1.00 89.61  0  128 TYR A O   1 
ATOM   697   C  CB  . TYR A 1 128 ? 154.469 151.034 205.861 1.00 89.61  0  128 TYR A CB  1 
ATOM   698   C  CG  . TYR A 1 128 ? 155.824 150.995 205.182 1.00 89.61  0  128 TYR A CG  1 
ATOM   699   C  CD1 . TYR A 1 128 ? 156.585 149.833 205.176 1.00 89.61  0  128 TYR A CD1 1 
ATOM   700   C  CD2 . TYR A 1 128 ? 156.361 152.134 204.588 1.00 89.61  0  128 TYR A CD2 1 
ATOM   701   C  CE1 . TYR A 1 128 ? 157.829 149.797 204.572 1.00 89.61  0  128 TYR A CE1 1 
ATOM   702   C  CE2 . TYR A 1 128 ? 157.602 152.105 203.979 1.00 89.61  0  128 TYR A CE2 1 
ATOM   703   C  CZ  . TYR A 1 128 ? 158.331 150.934 203.974 1.00 89.61  0  128 TYR A CZ  1 
ATOM   704   O  OH  . TYR A 1 128 ? 159.567 150.902 203.373 1.00 89.61  0  128 TYR A OH  1 
ATOM   705   N  N   . ARG A 1 129 ? 152.259 152.915 204.427 1.00 90.39  0  129 ARG A N   1 
ATOM   706   C  CA  . ARG A 1 129 ? 152.011 154.110 203.630 1.00 90.39  0  129 ARG A CA  1 
ATOM   707   C  C   . ARG A 1 129 ? 151.969 155.364 204.496 1.00 90.39  0  129 ARG A C   1 
ATOM   708   O  O   . ARG A 1 129 ? 151.285 156.334 204.151 1.00 90.39  0  129 ARG A O   1 
ATOM   709   C  CB  . ARG A 1 129 ? 150.709 153.979 202.838 1.00 90.39  0  129 ARG A CB  1 
ATOM   710   N  N   . SER A 1 130 ? 152.689 155.364 205.616 1.00 91.38  0  130 SER A N   1 
ATOM   711   C  CA  . SER A 1 130 ? 152.694 156.503 206.523 1.00 91.38  0  130 SER A CA  1 
ATOM   712   C  C   . SER A 1 130 ? 153.969 156.462 207.352 1.00 91.38  0  130 SER A C   1 
ATOM   713   O  O   . SER A 1 130 ? 154.596 155.411 207.501 1.00 91.38  0  130 SER A O   1 
ATOM   714   C  CB  . SER A 1 130 ? 151.462 156.505 207.431 1.00 91.38  0  130 SER A CB  1 
ATOM   715   O  OG  . SER A 1 130 ? 151.442 157.652 208.258 1.00 91.38  0  130 SER A OG  1 
ATOM   716   N  N   . LEU A 1 131 ? 154.347 157.628 207.889 1.00 86.42  0  131 LEU A N   1 
ATOM   717   C  CA  . LEU A 1 131 ? 155.528 157.702 208.746 1.00 86.42  0  131 LEU A CA  1 
ATOM   718   C  C   . LEU A 1 131 ? 155.293 157.002 210.078 1.00 86.42  0  131 LEU A C   1 
ATOM   719   O  O   . LEU A 1 131 ? 156.227 156.420 210.646 1.00 86.42  0  131 LEU A O   1 
ATOM   720   C  CB  . LEU A 1 131 ? 155.934 159.164 208.959 1.00 86.42  0  131 LEU A CB  1 
ATOM   721   C  CG  . LEU A 1 131 ? 157.225 159.508 209.717 1.00 86.42  0  131 LEU A CG  1 
ATOM   722   C  CD1 . LEU A 1 131 ? 157.887 160.704 209.074 1.00 86.42  0  131 LEU A CD1 1 
ATOM   723   C  CD2 . LEU A 1 131 ? 156.971 159.818 211.188 1.00 86.42  0  131 LEU A CD2 1 
ATOM   724   N  N   . GLY A 1 132 ? 154.064 157.063 210.596 1.00 91.46  0  132 GLY A N   1 
ATOM   725   C  CA  . GLY A 1 132 ? 153.737 156.316 211.799 1.00 91.46  0  132 GLY A CA  1 
ATOM   726   C  C   . GLY A 1 132 ? 153.789 154.821 211.585 1.00 91.46  0  132 GLY A C   1 
ATOM   727   O  O   . GLY A 1 132 ? 154.171 154.075 212.490 1.00 91.46  0  132 GLY A O   1 
ATOM   728   N  N   . ASP A 1 133 ? 153.433 154.367 210.381 1.00 91.72  0  133 ASP A N   1 
ATOM   729   C  CA  . ASP A 1 133 ? 153.590 152.960 210.039 1.00 91.72  0  133 ASP A CA  1 
ATOM   730   C  C   . ASP A 1 133 ? 155.063 152.572 209.969 1.00 91.72  0  133 ASP A C   1 
ATOM   731   O  O   . ASP A 1 133 ? 155.437 151.471 210.389 1.00 91.72  0  133 ASP A O   1 
ATOM   732   C  CB  . ASP A 1 133 ? 152.884 152.666 208.718 1.00 91.72  0  133 ASP A CB  1 
ATOM   733   C  CG  . ASP A 1 133 ? 151.382 152.841 208.809 1.00 91.72  0  133 ASP A CG  1 
ATOM   734   O  OD1 . ASP A 1 133 ? 150.821 152.616 209.901 1.00 91.72  0  133 ASP A OD1 1 
ATOM   735   O  OD2 . ASP A 1 133 ? 150.762 153.205 207.788 1.00 91.72  -1 133 ASP A OD2 1 
ATOM   736   N  N   . VAL A 1 134 ? 155.912 153.482 209.479 1.00 86.57  0  134 VAL A N   1 
ATOM   737   C  CA  . VAL A 1 134 ? 157.359 153.258 209.469 1.00 86.57  0  134 VAL A CA  1 
ATOM   738   C  C   . VAL A 1 134 ? 157.893 153.125 210.892 1.00 86.57  0  134 VAL A C   1 
ATOM   739   O  O   . VAL A 1 134 ? 158.656 152.202 211.205 1.00 86.57  0  134 VAL A O   1 
ATOM   740   C  CB  . VAL A 1 134 ? 158.068 154.390 208.701 1.00 86.57  0  134 VAL A CB  1 
ATOM   741   C  CG1 . VAL A 1 134 ? 159.573 154.302 208.867 1.00 86.57  0  134 VAL A CG1 1 
ATOM   742   C  CG2 . VAL A 1 134 ? 157.708 154.333 207.228 1.00 86.57  0  134 VAL A CG2 1 
ATOM   743   N  N   . LEU A 1 135 ? 157.465 154.021 211.785 1.00 89.56  0  135 LEU A N   1 
ATOM   744   C  CA  . LEU A 1 135 ? 157.962 153.979 213.157 1.00 89.56  0  135 LEU A CA  1 
ATOM   745   C  C   . LEU A 1 135 ? 157.410 152.786 213.933 1.00 89.56  0  135 LEU A C   1 
ATOM   746   O  O   . LEU A 1 135 ? 158.103 152.241 214.802 1.00 89.56  0  135 LEU A O   1 
ATOM   747   C  CB  . LEU A 1 135 ? 157.646 155.293 213.868 1.00 89.56  0  135 LEU A CB  1 
ATOM   748   C  CG  . LEU A 1 135 ? 158.594 156.428 213.467 1.00 89.56  0  135 LEU A CG  1 
ATOM   749   C  CD1 . LEU A 1 135 ? 158.230 157.727 214.155 1.00 89.56  0  135 LEU A CD1 1 
ATOM   750   C  CD2 . LEU A 1 135 ? 160.040 156.054 213.766 1.00 89.56  0  135 LEU A CD2 1 
ATOM   751   N  N   . ARG A 1 136 ? 156.197 152.327 213.614 1.00 92.69  0  136 ARG A N   1 
ATOM   752   C  CA  . ARG A 1 136 ? 155.709 151.133 214.295 1.00 92.69  0  136 ARG A CA  1 
ATOM   753   C  C   . ARG A 1 136 ? 156.333 149.861 213.728 1.00 92.69  0  136 ARG A C   1 
ATOM   754   O  O   . ARG A 1 136 ? 156.474 148.880 214.462 1.00 92.69  0  136 ARG A O   1 
ATOM   755   C  CB  . ARG A 1 136 ? 154.177 151.070 214.268 1.00 92.69  0  136 ARG A CB  1 
ATOM   756   C  CG  . ARG A 1 136 ? 153.535 150.712 212.952 1.00 92.69  0  136 ARG A CG  1 
ATOM   757   C  CD  . ARG A 1 136 ? 152.019 150.767 213.070 1.00 92.69  0  136 ARG A CD  1 
ATOM   758   N  NE  . ARG A 1 136 ? 151.579 151.838 213.963 1.00 92.69  0  136 ARG A NE  1 
ATOM   759   C  CZ  . ARG A 1 136 ? 151.087 153.003 213.557 1.00 92.69  0  136 ARG A CZ  1 
ATOM   760   N  NH1 . ARG A 1 136 ? 150.962 153.261 212.263 1.00 92.69  1  136 ARG A NH1 1 
ATOM   761   N  NH2 . ARG A 1 136 ? 150.714 153.913 214.447 1.00 92.69  0  136 ARG A NH2 1 
ATOM   762   N  N   . ASP A 1 137 ? 156.761 149.859 212.459 1.00 91.38  0  137 ASP A N   1 
ATOM   763   C  CA  . ASP A 1 137 ? 157.591 148.747 211.994 1.00 91.38  0  137 ASP A CA  1 
ATOM   764   C  C   . ASP A 1 137 ? 158.984 148.786 212.610 1.00 91.38  0  137 ASP A C   1 
ATOM   765   O  O   . ASP A 1 137 ? 159.601 147.731 212.802 1.00 91.38  0  137 ASP A O   1 
ATOM   766   C  CB  . ASP A 1 137 ? 157.700 148.730 210.468 1.00 91.38  0  137 ASP A CB  1 
ATOM   767   C  CG  . ASP A 1 137 ? 156.355 148.610 209.786 1.00 91.38  0  137 ASP A CG  1 
ATOM   768   O  OD1 . ASP A 1 137 ? 156.194 149.182 208.686 1.00 91.38  0  137 ASP A OD1 1 
ATOM   769   O  OD2 . ASP A 1 137 ? 155.459 147.951 210.348 1.00 91.38  -1 137 ASP A OD2 1 
ATOM   770   N  N   . VAL A 1 138 ? 159.495 149.983 212.917 1.00 90.25  0  138 VAL A N   1 
ATOM   771   C  CA  . VAL A 1 138 ? 160.751 150.098 213.660 1.00 90.25  0  138 VAL A CA  1 
ATOM   772   C  C   . VAL A 1 138 ? 160.594 149.521 215.064 1.00 90.25  0  138 VAL A C   1 
ATOM   773   O  O   . VAL A 1 138 ? 161.460 148.780 215.550 1.00 90.25  0  138 VAL A O   1 
ATOM   774   C  CB  . VAL A 1 138 ? 161.218 151.569 213.688 1.00 90.25  0  138 VAL A CB  1 
ATOM   775   C  CG1 . VAL A 1 138 ? 162.293 151.800 214.745 1.00 90.25  0  138 VAL A CG1 1 
ATOM   776   C  CG2 . VAL A 1 138 ? 161.750 151.978 212.329 1.00 90.25  0  138 VAL A CG2 1 
ATOM   777   N  N   . ASP A 1 139 ? 159.470 149.823 215.721 1.00 95.20  0  139 ASP A N   1 
ATOM   778   C  CA  . ASP A 1 139 ? 159.200 149.267 217.046 1.00 95.20  0  139 ASP A CA  1 
ATOM   779   C  C   . ASP A 1 139 ? 158.966 147.760 216.998 1.00 95.20  0  139 ASP A C   1 
ATOM   780   O  O   . ASP A 1 139 ? 159.347 147.039 217.928 1.00 95.20  0  139 ASP A O   1 
ATOM   781   C  CB  . ASP A 1 139 ? 157.995 149.966 217.670 1.00 95.20  0  139 ASP A CB  1 
ATOM   782   C  CG  . ASP A 1 139 ? 157.918 149.763 219.169 1.00 95.20  0  139 ASP A CG  1 
ATOM   783   O  OD1 . ASP A 1 139 ? 158.743 150.358 219.892 1.00 95.20  0  139 ASP A OD1 1 
ATOM   784   O  OD2 . ASP A 1 139 ? 157.033 149.008 219.624 1.00 95.20  -1 139 ASP A OD2 1 
ATOM   785   N  N   . ALA A 1 140 ? 158.337 147.265 215.928 1.00 93.29  0  140 ALA A N   1 
ATOM   786   C  CA  . ALA A 1 140 ? 158.105 145.830 215.801 1.00 93.29  0  140 ALA A CA  1 
ATOM   787   C  C   . ALA A 1 140 ? 159.387 145.075 215.478 1.00 93.29  0  140 ALA A C   1 
ATOM   788   O  O   . ALA A 1 140 ? 159.539 143.916 215.882 1.00 93.29  0  140 ALA A O   1 
ATOM   789   C  CB  . ALA A 1 140 ? 157.049 145.561 214.731 1.00 93.29  0  140 ALA A CB  1 
ATOM   790   N  N   . LYS A 1 141 ? 160.314 145.703 214.758 1.00 91.62  0  141 LYS A N   1 
ATOM   791   C  CA  . LYS A 1 141 ? 161.591 145.074 214.452 1.00 91.62  0  141 LYS A CA  1 
ATOM   792   C  C   . LYS A 1 141 ? 162.634 145.296 215.537 1.00 91.62  0  141 LYS A C   1 
ATOM   793   O  O   . LYS A 1 141 ? 163.602 144.528 215.600 1.00 91.62  0  141 LYS A O   1 
ATOM   794   C  CB  . LYS A 1 141 ? 162.130 145.588 213.115 1.00 91.62  0  141 LYS A CB  1 
ATOM   795   C  CG  . LYS A 1 141 ? 161.391 145.056 211.899 1.00 91.62  0  141 LYS A CG  1 
ATOM   796   C  CD  . LYS A 1 141 ? 161.971 145.621 210.612 1.00 91.62  0  141 LYS A CD  1 
ATOM   797   C  CE  . LYS A 1 141 ? 161.237 145.088 209.393 1.00 91.62  0  141 LYS A CE  1 
ATOM   798   N  NZ  . LYS A 1 141 ? 159.802 145.486 209.389 1.00 91.62  1  141 LYS A NZ  1 
ATOM   799   N  N   . ALA A 1 142 ? 162.440 146.320 216.379 1.00 88.81  0  142 ALA A N   1 
ATOM   800   C  CA  . ALA A 1 142 ? 163.345 146.718 217.466 1.00 88.81  0  142 ALA A CA  1 
ATOM   801   C  C   . ALA A 1 142 ? 164.764 146.973 216.950 1.00 88.81  0  142 ALA A C   1 
ATOM   802   O  O   . ALA A 1 142 ? 165.735 146.334 217.360 1.00 88.81  0  142 ALA A O   1 
ATOM   803   C  CB  . ALA A 1 142 ? 163.340 145.689 218.604 1.00 88.81  0  142 ALA A CB  1 
ATOM   804   N  N   . LEU A 1 143 ? 164.863 147.931 216.030 1.00 84.96  0  143 LEU A N   1 
ATOM   805   C  CA  . LEU A 1 143 ? 166.132 148.262 215.396 1.00 84.96  0  143 LEU A CA  1 
ATOM   806   C  C   . LEU A 1 143 ? 166.941 149.253 216.224 1.00 84.96  0  143 LEU A C   1 
ATOM   807   O  O   . LEU A 1 143 ? 168.135 149.041 216.460 1.00 84.96  0  143 LEU A O   1 
ATOM   808   C  CB  . LEU A 1 143 ? 165.884 148.829 213.996 1.00 84.96  0  143 LEU A CB  1 
ATOM   809   C  CG  . LEU A 1 143 ? 165.055 147.959 213.051 1.00 84.96  0  143 LEU A CG  1 
ATOM   810   C  CD1 . LEU A 1 143 ? 164.740 148.715 211.773 1.00 84.96  0  143 LEU A CD1 1 
ATOM   811   C  CD2 . LEU A 1 143 ? 165.781 146.660 212.744 1.00 84.96  0  143 LEU A CD2 1 
ATOM   812   N  N   . VAL A 1 144 ? 166.306 150.334 216.668 1.00 81.39  0  144 VAL A N   1 
ATOM   813   C  CA  . VAL A 1 144 ? 167.024 151.390 217.368 1.00 81.39  0  144 VAL A CA  1 
ATOM   814   C  C   . VAL A 1 144 ? 167.203 151.015 218.836 1.00 81.39  0  144 VAL A C   1 
ATOM   815   O  O   . VAL A 1 144 ? 166.506 150.155 219.381 1.00 81.39  0  144 VAL A O   1 
ATOM   816   C  CB  . VAL A 1 144 ? 166.293 152.735 217.215 1.00 81.39  0  144 VAL A CB  1 
ATOM   817   C  CG1 . VAL A 1 144 ? 166.148 153.079 215.741 1.00 81.39  0  144 VAL A CG1 1 
ATOM   818   C  CG2 . VAL A 1 144 ? 164.932 152.683 217.889 1.00 81.39  0  144 VAL A CG2 1 
ATOM   819   N  N   . ARG A 1 145 ? 168.167 151.669 219.482 1.00 85.70  0  145 ARG A N   1 
ATOM   820   C  CA  . ARG A 1 145 ? 168.481 151.406 220.881 1.00 85.70  0  145 ARG A CA  1 
ATOM   821   C  C   . ARG A 1 145 ? 168.182 152.603 221.775 1.00 85.70  0  145 ARG A C   1 
ATOM   822   O  O   . ARG A 1 145 ? 167.390 152.488 222.715 1.00 85.70  0  145 ARG A O   1 
ATOM   823   C  CB  . ARG A 1 145 ? 169.952 150.990 221.017 1.00 85.70  0  145 ARG A CB  1 
ATOM   824   C  CG  . ARG A 1 145 ? 170.313 149.730 220.250 1.00 85.70  0  145 ARG A CG  1 
ATOM   825   C  CD  . ARG A 1 145 ? 169.881 148.484 221.007 1.00 85.70  0  145 ARG A CD  1 
ATOM   826   N  NE  . ARG A 1 145 ? 168.590 147.979 220.548 1.00 85.70  0  145 ARG A NE  1 
ATOM   827   C  CZ  . ARG A 1 145 ? 168.026 146.860 220.989 1.00 85.70  0  145 ARG A CZ  1 
ATOM   828   N  NH1 . ARG A 1 145 ? 168.638 146.123 221.906 1.00 85.70  1  145 ARG A NH1 1 
ATOM   829   N  NH2 . ARG A 1 145 ? 166.848 146.476 220.515 1.00 85.70  0  145 ARG A NH2 1 
ATOM   830   N  N   . SER A 1 146 ? 168.785 153.758 221.493 1.00 82.90  0  146 SER A N   1 
ATOM   831   C  CA  . SER A 1 146 ? 168.617 154.940 222.331 1.00 82.90  0  146 SER A CA  1 
ATOM   832   C  C   . SER A 1 146 ? 169.010 156.175 221.536 1.00 82.90  0  146 SER A C   1 
ATOM   833   O  O   . SER A 1 146 ? 170.104 156.213 220.964 1.00 82.90  0  146 SER A O   1 
ATOM   834   C  CB  . SER A 1 146 ? 169.466 154.844 223.605 1.00 82.90  0  146 SER A CB  1 
ATOM   835   O  OG  . SER A 1 146 ? 170.846 154.968 223.308 1.00 82.90  0  146 SER A OG  1 
ATOM   836   N  N   . ASP A 1 147 ? 168.111 157.167 221.514 1.00 79.97  0  147 ASP A N   1 
ATOM   837   C  CA  . ASP A 1 147 ? 168.330 158.495 220.926 1.00 79.97  0  147 ASP A CA  1 
ATOM   838   C  C   . ASP A 1 147 ? 168.690 158.410 219.440 1.00 79.97  0  147 ASP A C   1 
ATOM   839   O  O   . ASP A 1 147 ? 169.779 158.793 219.008 1.00 79.97  0  147 ASP A O   1 
ATOM   840   C  CB  . ASP A 1 147 ? 169.391 159.277 221.711 1.00 79.97  0  147 ASP A CB  1 
ATOM   841   C  CG  . ASP A 1 147 ? 168.887 159.740 223.062 1.00 79.97  0  147 ASP A CG  1 
ATOM   842   O  OD1 . ASP A 1 147 ? 169.702 159.834 224.004 1.00 79.97  0  147 ASP A OD1 1 
ATOM   843   O  OD2 . ASP A 1 147 ? 167.674 160.011 223.181 1.00 79.97  -1 147 ASP A OD2 1 
ATOM   844   N  N   . PHE A 1 148 ? 167.746 157.894 218.663 1.00 72.95  0  148 PHE A N   1 
ATOM   845   C  CA  . PHE A 1 148 ? 167.933 157.746 217.229 1.00 72.95  0  148 PHE A CA  1 
ATOM   846   C  C   . PHE A 1 148 ? 167.394 158.964 216.491 1.00 72.95  0  148 PHE A C   1 
ATOM   847   O  O   . PHE A 1 148 ? 166.496 159.662 216.968 1.00 72.95  0  148 PHE A O   1 
ATOM   848   C  CB  . PHE A 1 148 ? 167.255 156.471 216.718 1.00 72.95  0  148 PHE A CB  1 
ATOM   849   C  CG  . PHE A 1 148 ? 165.762 156.586 216.554 1.00 72.95  0  148 PHE A CG  1 
ATOM   850   C  CD1 . PHE A 1 148 ? 164.927 156.603 217.661 1.00 72.95  0  148 PHE A CD1 1 
ATOM   851   C  CD2 . PHE A 1 148 ? 165.192 156.650 215.291 1.00 72.95  0  148 PHE A CD2 1 
ATOM   852   C  CE1 . PHE A 1 148 ? 163.556 156.698 217.512 1.00 72.95  0  148 PHE A CE1 1 
ATOM   853   C  CE2 . PHE A 1 148 ? 163.821 156.748 215.138 1.00 72.95  0  148 PHE A CE2 1 
ATOM   854   C  CZ  . PHE A 1 148 ? 163.003 156.771 216.249 1.00 72.95  0  148 PHE A CZ  1 
ATOM   855   N  N   . LEU A 1 149 ? 167.957 159.211 215.316 1.00 69.22  0  149 LEU A N   1 
ATOM   856   C  CA  . LEU A 1 149 ? 167.597 160.363 214.507 1.00 69.22  0  149 LEU A CA  1 
ATOM   857   C  C   . LEU A 1 149 ? 166.439 160.007 213.581 1.00 69.22  0  149 LEU A C   1 
ATOM   858   O  O   . LEU A 1 149 ? 166.278 158.856 213.173 1.00 69.22  0  149 LEU A O   1 
ATOM   859   C  CB  . LEU A 1 149 ? 168.816 160.835 213.708 1.00 69.22  0  149 LEU A CB  1 
ATOM   860   C  CG  . LEU A 1 149 ? 168.875 162.182 212.985 1.00 69.22  0  149 LEU A CG  1 
ATOM   861   C  CD1 . LEU A 1 149 ? 170.302 162.689 213.013 1.00 69.22  0  149 LEU A CD1 1 
ATOM   862   C  CD2 . LEU A 1 149 ? 168.413 162.067 211.549 1.00 69.22  0  149 LEU A CD2 1 
ATOM   863   N  N   . LEU A 1 150 ? 165.629 161.011 213.255 1.00 69.03  0  150 LEU A N   1 
ATOM   864   C  CA  . LEU A 1 150 ? 164.502 160.859 212.342 1.00 69.03  0  150 LEU A CA  1 
ATOM   865   C  C   . LEU A 1 150 ? 164.637 161.889 211.234 1.00 69.03  0  150 LEU A C   1 
ATOM   866   O  O   . LEU A 1 150 ? 164.717 163.089 211.514 1.00 69.03  0  150 LEU A O   1 
ATOM   867   C  CB  . LEU A 1 150 ? 163.171 161.034 213.080 1.00 69.03  0  150 LEU A CB  1 
ATOM   868   C  CG  . LEU A 1 150 ? 161.894 161.222 212.255 1.00 69.03  0  150 LEU A CG  1 
ATOM   869   C  CD1 . LEU A 1 150 ? 161.587 160.013 211.391 1.00 69.03  0  150 LEU A CD1 1 
ATOM   870   C  CD2 . LEU A 1 150 ? 160.721 161.536 213.169 1.00 69.03  0  150 LEU A CD2 1 
ATOM   871   N  N   . VAL A 1 151 ? 164.661 161.434 209.981 1.00 70.30  0  151 VAL A N   1 
ATOM   872   C  CA  . VAL A 1 151 ? 164.807 162.357 208.863 1.00 70.30  0  151 VAL A CA  1 
ATOM   873   C  C   . VAL A 1 151 ? 163.995 161.824 207.688 1.00 70.30  0  151 VAL A C   1 
ATOM   874   O  O   . VAL A 1 151 ? 163.814 160.614 207.530 1.00 70.30  0  151 VAL A O   1 
ATOM   875   C  CB  . VAL A 1 151 ? 166.309 162.563 208.516 1.00 70.30  0  151 VAL A CB  1 
ATOM   876   C  CG1 . VAL A 1 151 ? 166.968 161.273 208.030 1.00 70.30  0  151 VAL A CG1 1 
ATOM   877   C  CG2 . VAL A 1 151 ? 166.535 163.724 207.554 1.00 70.30  0  151 VAL A CG2 1 
ATOM   878   N  N   . TYR A 1 152 ? 163.450 162.743 206.895 1.00 74.15  0  152 TYR A N   1 
ATOM   879   C  CA  . TYR A 1 152 ? 162.838 162.385 205.629 1.00 74.15  0  152 TYR A CA  1 
ATOM   880   C  C   . TYR A 1 152 ? 163.919 162.104 204.587 1.00 74.15  0  152 TYR A C   1 
ATOM   881   O  O   . TYR A 1 152 ? 165.107 162.364 204.795 1.00 74.15  0  152 TYR A O   1 
ATOM   882   C  CB  . TYR A 1 152 ? 161.912 163.497 205.142 1.00 74.15  0  152 TYR A CB  1 
ATOM   883   C  CG  . TYR A 1 152 ? 160.497 163.406 205.663 1.00 74.15  0  152 TYR A CG  1 
ATOM   884   C  CD1 . TYR A 1 152 ? 160.165 163.909 206.916 1.00 74.15  0  152 TYR A CD1 1 
ATOM   885   C  CD2 . TYR A 1 152 ? 159.493 162.823 204.900 1.00 74.15  0  152 TYR A CD2 1 
ATOM   886   C  CE1 . TYR A 1 152 ? 158.869 163.832 207.396 1.00 74.15  0  152 TYR A CE1 1 
ATOM   887   C  CE2 . TYR A 1 152 ? 158.195 162.740 205.371 1.00 74.15  0  152 TYR A CE2 1 
ATOM   888   C  CZ  . TYR A 1 152 ? 157.889 163.248 206.617 1.00 74.15  0  152 TYR A CZ  1 
ATOM   889   O  OH  . TYR A 1 152 ? 156.600 163.166 207.090 1.00 74.15  0  152 TYR A OH  1 
ATOM   890   N  N   . GLY A 1 153 ? 163.494 161.575 203.447 1.00 77.27  0  153 GLY A N   1 
ATOM   891   C  CA  . GLY A 1 153 ? 164.416 161.299 202.368 1.00 77.27  0  153 GLY A CA  1 
ATOM   892   C  C   . GLY A 1 153 ? 164.670 162.467 201.445 1.00 77.27  0  153 GLY A C   1 
ATOM   893   O  O   . GLY A 1 153 ? 165.350 162.302 200.427 1.00 77.27  0  153 GLY A O   1 
ATOM   894   N  N   . ASP A 1 154 ? 164.149 163.646 201.770 1.00 76.89  0  154 ASP A N   1 
ATOM   895   C  CA  . ASP A 1 154 ? 164.290 164.824 200.926 1.00 76.89  0  154 ASP A CA  1 
ATOM   896   C  C   . ASP A 1 154 ? 164.639 166.046 201.774 1.00 76.89  0  154 ASP A C   1 
ATOM   897   O  O   . ASP A 1 154 ? 164.091 167.134 201.600 1.00 76.89  0  154 ASP A O   1 
ATOM   898   C  CB  . ASP A 1 154 ? 163.019 165.027 200.097 1.00 76.89  0  154 ASP A CB  1 
ATOM   899   C  CG  . ASP A 1 154 ? 161.741 164.949 200.927 1.00 76.89  0  154 ASP A CG  1 
ATOM   900   O  OD1 . ASP A 1 154 ? 161.609 165.661 201.944 1.00 76.89  0  154 ASP A OD1 1 
ATOM   901   O  OD2 . ASP A 1 154 ? 160.851 164.158 200.548 1.00 76.89  -1 154 ASP A OD2 1 
ATOM   902   N  N   . VAL A 1 155 ? 165.582 165.873 202.697 1.00 71.73  0  155 VAL A N   1 
ATOM   903   C  CA  . VAL A 1 155 ? 166.001 166.923 203.618 1.00 71.73  0  155 VAL A CA  1 
ATOM   904   C  C   . VAL A 1 155 ? 167.421 167.342 203.264 1.00 71.73  0  155 VAL A C   1 
ATOM   905   O  O   . VAL A 1 155 ? 168.326 166.502 203.202 1.00 71.73  0  155 VAL A O   1 
ATOM   906   C  CB  . VAL A 1 155 ? 165.908 166.454 205.080 1.00 71.73  0  155 VAL A CB  1 
ATOM   907   C  CG1 . VAL A 1 155 ? 166.575 167.449 206.013 1.00 71.73  0  155 VAL A CG1 1 
ATOM   908   C  CG2 . VAL A 1 155 ? 164.456 166.248 205.477 1.00 71.73  0  155 VAL A CG2 1 
ATOM   909   N  N   . ILE A 1 156 ? 167.613 168.638 203.033 1.00 65.97  0  156 ILE A N   1 
ATOM   910   C  CA  . ILE A 1 156 ? 168.904 169.203 202.658 1.00 65.97  0  156 ILE A CA  1 
ATOM   911   C  C   . ILE A 1 156 ? 169.415 170.009 203.841 1.00 65.97  0  156 ILE A C   1 
ATOM   912   O  O   . ILE A 1 156 ? 168.772 170.979 204.265 1.00 65.97  0  156 ILE A O   1 
ATOM   913   C  CB  . ILE A 1 156 ? 168.796 170.075 201.399 1.00 65.97  0  156 ILE A CB  1 
ATOM   914   C  CG1 . ILE A 1 156 ? 167.900 169.394 200.366 1.00 65.97  0  156 ILE A CG1 1 
ATOM   915   C  CG2 . ILE A 1 156 ? 170.176 170.355 200.825 1.00 65.97  0  156 ILE A CG2 1 
ATOM   916   C  CD1 . ILE A 1 156 ? 168.449 168.100 199.847 1.00 65.97  0  156 ILE A CD1 1 
ATOM   917   N  N   . SER A 1 157 ? 170.575 169.620 204.364 1.00 65.41  0  157 SER A N   1 
ATOM   918   C  CA  . SER A 1 157 ? 171.063 170.211 205.600 1.00 65.41  0  157 SER A CA  1 
ATOM   919   C  C   . SER A 1 157 ? 172.564 169.995 205.712 1.00 65.41  0  157 SER A C   1 
ATOM   920   O  O   . SER A 1 157 ? 173.140 169.138 205.039 1.00 65.41  0  157 SER A O   1 
ATOM   921   C  CB  . SER A 1 157 ? 170.346 169.611 206.811 1.00 65.41  0  157 SER A CB  1 
ATOM   922   O  OG  . SER A 1 157 ? 170.539 170.403 207.964 1.00 65.41  0  157 SER A OG  1 
ATOM   923   N  N   . ASN A 1 158 ? 173.190 170.800 206.576 1.00 62.85  0  158 ASN A N   1 
ATOM   924   C  CA  . ASN A 1 158 ? 174.600 170.638 206.907 1.00 62.85  0  158 ASN A CA  1 
ATOM   925   C  C   . ASN A 1 158 ? 174.853 170.897 208.388 1.00 62.85  0  158 ASN A C   1 
ATOM   926   O  O   . ASN A 1 158 ? 175.965 171.273 208.775 1.00 62.85  0  158 ASN A O   1 
ATOM   927   C  CB  . ASN A 1 158 ? 175.479 171.561 206.059 1.00 62.85  0  158 ASN A CB  1 
ATOM   928   C  CG  . ASN A 1 158 ? 175.179 173.028 206.291 1.00 62.85  0  158 ASN A CG  1 
ATOM   929   O  OD1 . ASN A 1 158 ? 174.048 173.402 206.587 1.00 62.85  0  158 ASN A OD1 1 
ATOM   930   N  ND2 . ASN A 1 158 ? 176.198 173.866 206.167 1.00 62.85  0  158 ASN A ND2 1 
ATOM   931   N  N   . ILE A 1 159 ? 173.844 170.691 209.229 1.00 65.18  0  159 ILE A N   1 
ATOM   932   C  CA  . ILE A 1 159 ? 173.951 171.031 210.643 1.00 65.18  0  159 ILE A CA  1 
ATOM   933   C  C   . ILE A 1 159 ? 174.632 169.892 211.387 1.00 65.18  0  159 ILE A C   1 
ATOM   934   O  O   . ILE A 1 159 ? 174.277 168.720 211.217 1.00 65.18  0  159 ILE A O   1 
ATOM   935   C  CB  . ILE A 1 159 ? 172.566 171.324 211.243 1.00 65.18  0  159 ILE A CB  1 
ATOM   936   C  CG1 . ILE A 1 159 ? 171.768 172.252 210.336 1.00 65.18  0  159 ILE A CG1 1 
ATOM   937   C  CG2 . ILE A 1 159 ? 172.706 171.970 212.607 1.00 65.18  0  159 ILE A CG2 1 
ATOM   938   C  CD1 . ILE A 1 159 ? 170.318 172.394 210.733 1.00 65.18  0  159 ILE A CD1 1 
ATOM   939   N  N   . ASN A 1 160 ? 175.614 170.235 212.214 1.00 73.12  0  160 ASN A N   1 
ATOM   940   C  CA  . ASN A 1 160 ? 176.173 169.301 213.180 1.00 73.12  0  160 ASN A CA  1 
ATOM   941   C  C   . ASN A 1 160 ? 175.379 169.442 214.471 1.00 73.12  0  160 ASN A C   1 
ATOM   942   O  O   . ASN A 1 160 ? 175.392 170.507 215.099 1.00 73.12  0  160 ASN A O   1 
ATOM   943   C  CB  . ASN A 1 160 ? 177.656 169.578 213.416 1.00 73.12  0  160 ASN A CB  1 
ATOM   944   C  CG  . ASN A 1 160 ? 178.327 168.494 214.233 1.00 73.12  0  160 ASN A CG  1 
ATOM   945   O  OD1 . ASN A 1 160 ? 177.918 167.334 214.200 1.00 73.12  0  160 ASN A OD1 1 
ATOM   946   N  ND2 . ASN A 1 160 ? 179.364 168.866 214.974 1.00 73.12  0  160 ASN A ND2 1 
ATOM   947   N  N   . ILE A 1 161 ? 174.689 168.375 214.866 1.00 73.33  0  161 ILE A N   1 
ATOM   948   C  CA  . ILE A 1 161 ? 173.739 168.461 215.968 1.00 73.33  0  161 ILE A CA  1 
ATOM   949   C  C   . ILE A 1 161 ? 174.252 167.679 217.169 1.00 73.33  0  161 ILE A C   1 
ATOM   950   O  O   . ILE A 1 161 ? 173.463 167.153 217.962 1.00 73.33  0  161 ILE A O   1 
ATOM   951   C  CB  . ILE A 1 161 ? 172.343 167.975 215.539 1.00 73.33  0  161 ILE A CB  1 
ATOM   952   C  CG1 . ILE A 1 161 ? 172.413 166.570 214.943 1.00 73.33  0  161 ILE A CG1 1 
ATOM   953   C  CG2 . ILE A 1 161 ? 171.743 168.941 214.539 1.00 73.33  0  161 ILE A CG2 1 
ATOM   954   C  CD1 . ILE A 1 161 ? 171.087 166.057 214.436 1.00 73.33  0  161 ILE A CD1 1 
ATOM   955   N  N   . THR A 1 162 ? 175.579 167.607 217.311 1.00 77.76  0  162 THR A N   1 
ATOM   956   C  CA  . THR A 1 162 ? 176.167 166.971 218.485 1.00 77.76  0  162 THR A CA  1 
ATOM   957   C  C   . THR A 1 162 ? 175.863 167.763 219.749 1.00 77.76  0  162 THR A C   1 
ATOM   958   O  O   . THR A 1 162 ? 175.704 167.174 220.825 1.00 77.76  0  162 THR A O   1 
ATOM   959   C  CB  . THR A 1 162 ? 177.676 166.817 218.305 1.00 77.76  0  162 THR A CB  1 
ATOM   960   O  OG1 . THR A 1 162 ? 178.246 168.082 217.944 1.00 77.76  0  162 THR A OG1 1 
ATOM   961   C  CG2 . THR A 1 162 ? 177.981 165.799 217.218 1.00 77.76  0  162 THR A CG2 1 
ATOM   962   N  N   . ARG A 1 163 ? 175.763 169.091 219.631 1.00 84.33  0  163 ARG A N   1 
ATOM   963   C  CA  . ARG A 1 163 ? 175.366 169.921 220.763 1.00 84.33  0  163 ARG A CA  1 
ATOM   964   C  C   . ARG A 1 163 ? 173.921 169.646 221.161 1.00 84.33  0  163 ARG A C   1 
ATOM   965   O  O   . ARG A 1 163 ? 173.617 169.490 222.350 1.00 84.33  0  163 ARG A O   1 
ATOM   966   C  CB  . ARG A 1 163 ? 175.550 171.396 220.413 1.00 84.33  0  163 ARG A CB  1 
ATOM   967   C  CG  . ARG A 1 163 ? 175.351 172.352 221.574 1.00 84.33  0  163 ARG A CG  1 
ATOM   968   C  CD  . ARG A 1 163 ? 175.283 173.787 221.080 1.00 84.33  0  163 ARG A CD  1 
ATOM   969   N  NE  . ARG A 1 163 ? 176.310 174.069 220.081 1.00 84.33  0  163 ARG A NE  1 
ATOM   970   C  CZ  . ARG A 1 163 ? 176.360 175.180 219.354 1.00 84.33  0  163 ARG A CZ  1 
ATOM   971   N  NH1 . ARG A 1 163 ? 175.438 176.121 219.513 1.00 84.33  1  163 ARG A NH1 1 
ATOM   972   N  NH2 . ARG A 1 163 ? 177.330 175.352 218.467 1.00 84.33  0  163 ARG A NH2 1 
ATOM   973   N  N   . ALA A 1 164 ? 173.023 169.561 220.174 1.00 78.71  0  164 ALA A N   1 
ATOM   974   C  CA  . ALA A 1 164 ? 171.629 169.233 220.454 1.00 78.71  0  164 ALA A CA  1 
ATOM   975   C  C   . ALA A 1 164 ? 171.474 167.798 220.938 1.00 78.71  0  164 ALA A C   1 
ATOM   976   O  O   . ALA A 1 164 ? 170.601 167.519 221.768 1.00 78.71  0  164 ALA A O   1 
ATOM   977   C  CB  . ALA A 1 164 ? 170.773 169.469 219.210 1.00 78.71  0  164 ALA A CB  1 
ATOM   978   N  N   . LEU A 1 165 ? 172.322 166.885 220.453 1.00 79.90  0  165 LEU A N   1 
ATOM   979   C  CA  . LEU A 1 165 ? 172.286 165.505 220.929 1.00 79.90  0  165 LEU A CA  1 
ATOM   980   C  C   . LEU A 1 165 ? 172.729 165.410 222.383 1.00 79.90  0  165 LEU A C   1 
ATOM   981   O  O   . LEU A 1 165 ? 172.116 164.686 223.176 1.00 79.90  0  165 LEU A O   1 
ATOM   982   C  CB  . LEU A 1 165 ? 173.160 164.620 220.042 1.00 79.90  0  165 LEU A CB  1 
ATOM   983   C  CG  . LEU A 1 165 ? 173.193 163.129 220.374 1.00 79.90  0  165 LEU A CG  1 
ATOM   984   C  CD1 . LEU A 1 165 ? 171.798 162.534 220.295 1.00 79.90  0  165 LEU A CD1 1 
ATOM   985   C  CD2 . LEU A 1 165 ? 174.145 162.402 219.441 1.00 79.90  0  165 LEU A CD2 1 
ATOM   986   N  N   . GLU A 1 166 ? 173.774 166.156 222.759 1.00 83.92  0  166 GLU A N   1 
ATOM   987   C  CA  . GLU A 1 166 ? 174.201 166.172 224.155 1.00 83.92  0  166 GLU A CA  1 
ATOM   988   C  C   . GLU A 1 166 ? 173.185 166.874 225.047 1.00 83.92  0  166 GLU A C   1 
ATOM   989   O  O   . GLU A 1 166 ? 173.005 166.473 226.203 1.00 83.92  0  166 GLU A O   1 
ATOM   990   C  CB  . GLU A 1 166 ? 175.573 166.835 224.287 1.00 83.92  0  166 GLU A CB  1 
ATOM   991   C  CG  . GLU A 1 166 ? 176.722 166.009 223.731 1.00 83.92  0  166 GLU A CG  1 
ATOM   992   C  CD  . GLU A 1 166 ? 176.639 164.547 224.127 1.00 83.92  0  166 GLU A CD  1 
ATOM   993   O  OE1 . GLU A 1 166 ? 176.684 164.252 225.340 1.00 83.92  0  166 GLU A OE1 1 
ATOM   994   O  OE2 . GLU A 1 166 ? 176.530 163.691 223.224 1.00 83.92  -1 166 GLU A OE2 1 
ATOM   995   N  N   . GLU A 1 167 ? 172.505 167.901 224.525 1.00 82.33  0  167 GLU A N   1 
ATOM   996   C  CA  . GLU A 1 167 ? 171.441 168.558 225.282 1.00 82.33  0  167 GLU A CA  1 
ATOM   997   C  C   . GLU A 1 167 ? 170.265 167.617 225.521 1.00 82.33  0  167 GLU A C   1 
ATOM   998   O  O   . GLU A 1 167 ? 169.722 167.567 226.632 1.00 82.33  0  167 GLU A O   1 
ATOM   999   C  CB  . GLU A 1 167 ? 170.978 169.819 224.554 1.00 82.33  0  167 GLU A CB  1 
ATOM   1000  C  CG  . GLU A 1 167 ? 171.890 171.018 224.747 1.00 82.33  0  167 GLU A CG  1 
ATOM   1001  C  CD  . GLU A 1 167 ? 171.533 172.172 223.832 1.00 82.33  0  167 GLU A CD  1 
ATOM   1002  O  OE1 . GLU A 1 167 ? 170.608 172.015 223.008 1.00 82.33  0  167 GLU A OE1 1 
ATOM   1003  O  OE2 . GLU A 1 167 ? 172.178 173.237 223.937 1.00 82.33  -1 167 GLU A OE2 1 
ATOM   1004  N  N   . HIS A 1 168 ? 169.874 166.853 224.495 1.00 80.46  0  168 HIS A N   1 
ATOM   1005  C  CA  . HIS A 1 168 ? 168.815 165.860 224.653 1.00 80.46  0  168 HIS A CA  1 
ATOM   1006  C  C   . HIS A 1 168 ? 169.229 164.748 225.610 1.00 80.46  0  168 HIS A C   1 
ATOM   1007  O  O   . HIS A 1 168 ? 168.412 164.276 226.411 1.00 80.46  0  168 HIS A O   1 
ATOM   1008  C  CB  . HIS A 1 168 ? 168.444 165.279 223.289 1.00 80.46  0  168 HIS A CB  1 
ATOM   1009  C  CG  . HIS A 1 168 ? 167.273 164.350 223.326 1.00 80.46  0  168 HIS A CG  1 
ATOM   1010  N  ND1 . HIS A 1 168 ? 166.103 164.654 223.988 1.00 80.46  0  168 HIS A ND1 1 
ATOM   1011  C  CD2 . HIS A 1 168 ? 167.089 163.125 222.779 1.00 80.46  0  168 HIS A CD2 1 
ATOM   1012  C  CE1 . HIS A 1 168 ? 165.249 163.655 223.849 1.00 80.46  0  168 HIS A CE1 1 
ATOM   1013  N  NE2 . HIS A 1 168 ? 165.823 162.715 223.120 1.00 80.46  0  168 HIS A NE2 1 
ATOM   1014  N  N   . ARG A 1 169 ? 170.504 164.345 225.569 1.00 80.83  0  169 ARG A N   1 
ATOM   1015  C  CA  . ARG A 1 169 ? 170.981 163.295 226.462 1.00 80.83  0  169 ARG A CA  1 
ATOM   1016  C  C   . ARG A 1 169 ? 171.013 163.760 227.914 1.00 80.83  0  169 ARG A C   1 
ATOM   1017  O  O   . ARG A 1 169 ? 170.623 163.009 228.815 1.00 80.83  0  169 ARG A O   1 
ATOM   1018  C  CB  . ARG A 1 169 ? 172.362 162.819 226.011 1.00 80.83  0  169 ARG A CB  1 
ATOM   1019  C  CG  . ARG A 1 169 ? 172.314 161.798 224.885 1.00 80.83  0  169 ARG A CG  1 
ATOM   1020  C  CD  . ARG A 1 169 ? 173.675 161.614 224.237 1.00 80.83  0  169 ARG A CD  1 
ATOM   1021  N  NE  . ARG A 1 169 ? 173.643 160.609 223.179 1.00 80.83  0  169 ARG A NE  1 
ATOM   1022  C  CZ  . ARG A 1 169 ? 174.662 160.347 222.367 1.00 80.83  0  169 ARG A CZ  1 
ATOM   1023  N  NH1 . ARG A 1 169 ? 175.799 161.018 222.491 1.00 80.83  1  169 ARG A NH1 1 
ATOM   1024  N  NH2 . ARG A 1 169 ? 174.544 159.415 221.432 1.00 80.83  0  169 ARG A NH2 1 
ATOM   1025  N  N   . LEU A 1 170 ? 171.439 165.004 228.163 1.00 83.30  0  170 LEU A N   1 
ATOM   1026  C  CA  . LEU A 1 170 ? 171.430 165.502 229.538 1.00 83.30  0  170 LEU A CA  1 
ATOM   1027  C  C   . LEU A 1 170 ? 170.011 165.770 230.029 1.00 83.30  0  170 LEU A C   1 
ATOM   1028  O  O   . LEU A 1 170 ? 169.729 165.577 231.217 1.00 83.30  0  170 LEU A O   1 
ATOM   1029  C  CB  . LEU A 1 170 ? 172.309 166.754 229.674 1.00 83.30  0  170 LEU A CB  1 
ATOM   1030  C  CG  . LEU A 1 170 ? 172.032 168.093 228.982 1.00 83.30  0  170 LEU A CG  1 
ATOM   1031  C  CD1 . LEU A 1 170 ? 171.193 169.040 229.837 1.00 83.30  0  170 LEU A CD1 1 
ATOM   1032  C  CD2 . LEU A 1 170 ? 173.348 168.759 228.608 1.00 83.30  0  170 LEU A CD2 1 
ATOM   1033  N  N   . ARG A 1 171 ? 169.107 166.197 229.140 1.00 82.54  0  171 ARG A N   1 
ATOM   1034  C  CA  . ARG A 1 171 ? 167.713 166.375 229.535 1.00 82.54  0  171 ARG A CA  1 
ATOM   1035  C  C   . ARG A 1 171 ? 167.035 165.043 229.828 1.00 82.54  0  171 ARG A C   1 
ATOM   1036  O  O   . ARG A 1 171 ? 166.118 164.985 230.656 1.00 82.54  0  171 ARG A O   1 
ATOM   1037  C  CB  . ARG A 1 171 ? 166.951 167.140 228.456 1.00 82.54  0  171 ARG A CB  1 
ATOM   1038  C  CG  . ARG A 1 171 ? 167.176 168.641 228.506 1.00 82.54  0  171 ARG A CG  1 
ATOM   1039  C  CD  . ARG A 1 171 ? 166.189 169.371 227.622 1.00 82.54  0  171 ARG A CD  1 
ATOM   1040  N  NE  . ARG A 1 171 ? 166.168 168.825 226.269 1.00 82.54  0  171 ARG A NE  1 
ATOM   1041  C  CZ  . ARG A 1 171 ? 166.821 169.354 225.241 1.00 82.54  0  171 ARG A CZ  1 
ATOM   1042  N  NH1 . ARG A 1 171 ? 167.550 170.449 225.408 1.00 82.54  1  171 ARG A NH1 1 
ATOM   1043  N  NH2 . ARG A 1 171 ? 166.746 168.789 224.046 1.00 82.54  0  171 ARG A NH2 1 
ATOM   1044  N  N   . ARG A 1 172 ? 167.465 163.968 229.167 1.00 82.32  0  172 ARG A N   1 
ATOM   1045  C  CA  . ARG A 1 172 ? 166.965 162.647 229.526 1.00 82.32  0  172 ARG A CA  1 
ATOM   1046  C  C   . ARG A 1 172 ? 167.610 162.129 230.804 1.00 82.32  0  172 ARG A C   1 
ATOM   1047  O  O   . ARG A 1 172 ? 166.975 161.377 231.552 1.00 82.32  0  172 ARG A O   1 
ATOM   1048  C  CB  . ARG A 1 172 ? 167.212 161.659 228.388 1.00 82.32  0  172 ARG A CB  1 
ATOM   1049  C  CG  . ARG A 1 172 ? 166.292 161.836 227.204 1.00 82.32  0  172 ARG A CG  1 
ATOM   1050  C  CD  . ARG A 1 172 ? 166.472 160.703 226.218 1.00 82.32  0  172 ARG A CD  1 
ATOM   1051  N  NE  . ARG A 1 172 ? 166.307 159.395 226.847 1.00 82.32  0  172 ARG A NE  1 
ATOM   1052  C  CZ  . ARG A 1 172 ? 165.137 158.790 227.021 1.00 82.32  0  172 ARG A CZ  1 
ATOM   1053  N  NH1 . ARG A 1 172 ? 164.017 159.372 226.613 1.00 82.32  1  172 ARG A NH1 1 
ATOM   1054  N  NH2 . ARG A 1 172 ? 165.084 157.600 227.602 1.00 82.32  0  172 ARG A NH2 1 
ATOM   1055  N  N   . LYS A 1 173 ? 168.860 162.515 231.068 1.00 83.97  0  173 LYS A N   1 
ATOM   1056  C  CA  . LYS A 1 173 ? 169.560 162.015 232.245 1.00 83.97  0  173 LYS A CA  1 
ATOM   1057  C  C   . LYS A 1 173 ? 169.087 162.690 233.529 1.00 83.97  0  173 LYS A C   1 
ATOM   1058  O  O   . LYS A 1 173 ? 168.992 162.032 234.571 1.00 83.97  0  173 LYS A O   1 
ATOM   1059  C  CB  . LYS A 1 173 ? 171.069 162.195 232.071 1.00 83.97  0  173 LYS A CB  1 
ATOM   1060  C  CG  . LYS A 1 173 ? 171.732 161.071 231.289 1.00 83.97  0  173 LYS A CG  1 
ATOM   1061  C  CD  . LYS A 1 173 ? 173.116 161.469 230.805 1.00 83.97  0  173 LYS A CD  1 
ATOM   1062  C  CE  . LYS A 1 173 ? 173.702 160.411 229.883 1.00 83.97  0  173 LYS A CE  1 
ATOM   1063  N  NZ  . LYS A 1 173 ? 175.017 160.828 229.323 1.00 83.97  1  173 LYS A NZ  1 
ATOM   1064  N  N   . LEU A 1 174 ? 168.787 163.991 233.487 1.00 85.51  0  174 LEU A N   1 
ATOM   1065  C  CA  . LEU A 1 174 ? 168.341 164.664 234.705 1.00 85.51  0  174 LEU A CA  1 
ATOM   1066  C  C   . LEU A 1 174 ? 166.879 164.364 235.017 1.00 85.51  0  174 LEU A C   1 
ATOM   1067  O  O   . LEU A 1 174 ? 166.539 164.029 236.158 1.00 85.51  0  174 LEU A O   1 
ATOM   1068  C  CB  . LEU A 1 174 ? 168.552 166.177 234.601 1.00 85.51  0  174 LEU A CB  1 
ATOM   1069  C  CG  . LEU A 1 174 ? 169.941 166.730 234.283 1.00 85.51  0  174 LEU A CG  1 
ATOM   1070  C  CD1 . LEU A 1 174 ? 169.921 168.250 234.322 1.00 85.51  0  174 LEU A CD1 1 
ATOM   1071  C  CD2 . LEU A 1 174 ? 170.974 166.181 235.252 1.00 85.51  0  174 LEU A CD2 1 
ATOM   1072  N  N   . GLU A 1 175 ? 166.000 164.474 234.024 1.00 88.48  0  175 GLU A N   1 
ATOM   1073  C  CA  . GLU A 1 175 ? 164.566 164.374 234.262 1.00 88.48  0  175 GLU A CA  1 
ATOM   1074  C  C   . GLU A 1 175 ? 164.035 162.951 234.141 1.00 88.48  0  175 GLU A C   1 
ATOM   1075  O  O   . GLU A 1 175 ? 162.811 162.769 234.161 1.00 88.48  0  175 GLU A O   1 
ATOM   1076  C  CB  . GLU A 1 175 ? 163.803 165.298 233.311 1.00 88.48  0  175 GLU A CB  1 
ATOM   1077  C  CG  . GLU A 1 175 ? 164.010 166.774 233.603 1.00 88.48  0  175 GLU A CG  1 
ATOM   1078  C  CD  . GLU A 1 175 ? 162.894 167.640 233.056 1.00 88.48  0  175 GLU A CD  1 
ATOM   1079  O  OE1 . GLU A 1 175 ? 162.108 168.179 233.865 1.00 88.48  0  175 GLU A OE1 1 
ATOM   1080  O  OE2 . GLU A 1 175 ? 162.797 167.780 231.820 1.00 88.48  -1 175 GLU A OE2 1 
ATOM   1081  N  N   . LYS A 1 176 ? 164.927 161.959 234.019 1.00 86.29  0  176 LYS A N   1 
ATOM   1082  C  CA  . LYS A 1 176 ? 164.606 160.525 234.036 1.00 86.29  0  176 LYS A CA  1 
ATOM   1083  C  C   . LYS A 1 176 ? 163.622 160.148 232.924 1.00 86.29  0  176 LYS A C   1 
ATOM   1084  O  O   . LYS A 1 176 ? 162.486 159.738 233.178 1.00 86.29  0  176 LYS A O   1 
ATOM   1085  C  CB  . LYS A 1 176 ? 164.084 160.090 235.412 1.00 86.29  0  176 LYS A CB  1 
ATOM   1086  N  N   . ASN A 1 177 ? 164.092 160.325 231.680 1.00 83.83  0  177 ASN A N   1 
ATOM   1087  C  CA  . ASN A 1 177 ? 163.384 159.937 230.451 1.00 83.83  0  177 ASN A CA  1 
ATOM   1088  C  C   . ASN A 1 177 ? 162.041 160.654 230.314 1.00 83.83  0  177 ASN A C   1 
ATOM   1089  O  O   . ASN A 1 177 ? 161.042 160.069 229.890 1.00 83.83  0  177 ASN A O   1 
ATOM   1090  C  CB  . ASN A 1 177 ? 163.205 158.418 230.355 1.00 83.83  0  177 ASN A CB  1 
ATOM   1091  N  N   . VAL A 1 178 ? 162.017 161.932 230.682 1.00 82.57  0  178 VAL A N   1 
ATOM   1092  C  CA  . VAL A 1 178 ? 160.826 162.754 230.494 1.00 82.57  0  178 VAL A CA  1 
ATOM   1093  C  C   . VAL A 1 178 ? 160.828 163.421 229.125 1.00 82.57  0  178 VAL A C   1 
ATOM   1094  O  O   . VAL A 1 178 ? 159.802 163.453 228.442 1.00 82.57  0  178 VAL A O   1 
ATOM   1095  C  CB  . VAL A 1 178 ? 160.718 163.794 231.626 1.00 82.57  0  178 VAL A CB  1 
ATOM   1096  N  N   . SER A 1 179 ? 161.972 163.958 228.708 1.00 82.85  0  179 SER A N   1 
ATOM   1097  C  CA  . SER A 1 179 ? 162.111 164.517 227.371 1.00 82.85  0  179 SER A CA  1 
ATOM   1098  C  C   . SER A 1 179 ? 162.223 163.391 226.353 1.00 82.85  0  179 SER A C   1 
ATOM   1099  O  O   . SER A 1 179 ? 163.069 162.501 226.490 1.00 82.85  0  179 SER A O   1 
ATOM   1100  C  CB  . SER A 1 179 ? 163.340 165.421 227.297 1.00 82.85  0  179 SER A CB  1 
ATOM   1101  O  OG  . SER A 1 179 ? 163.296 166.247 226.147 1.00 82.85  0  179 SER A OG  1 
ATOM   1102  N  N   . VAL A 1 180 ? 161.370 163.429 225.328 1.00 79.86  0  180 VAL A N   1 
ATOM   1103  C  CA  . VAL A 1 180 ? 161.233 162.330 224.387 1.00 79.86  0  180 VAL A CA  1 
ATOM   1104  C  C   . VAL A 1 180 ? 161.654 162.726 222.974 1.00 79.86  0  180 VAL A C   1 
ATOM   1105  O  O   . VAL A 1 180 ? 162.266 161.926 222.258 1.00 79.86  0  180 VAL A O   1 
ATOM   1106  C  CB  . VAL A 1 180 ? 159.788 161.752 224.414 1.00 79.86  0  180 VAL A CB  1 
ATOM   1107  C  CG1 . VAL A 1 180 ? 158.720 162.789 224.042 1.00 79.86  0  180 VAL A CG1 1 
ATOM   1108  C  CG2 . VAL A 1 180 ? 159.669 160.481 223.588 1.00 79.86  0  180 VAL A CG2 1 
ATOM   1109  N  N   . MET A 1 181 ? 161.380 163.963 222.561 1.00 77.90  0  181 MET A N   1 
ATOM   1110  C  CA  . MET A 1 181 ? 161.668 164.419 221.208 1.00 77.90  0  181 MET A CA  1 
ATOM   1111  C  C   . MET A 1 181 ? 162.310 165.795 221.273 1.00 77.90  0  181 MET A C   1 
ATOM   1112  O  O   . MET A 1 181 ? 161.848 166.662 222.020 1.00 77.90  0  181 MET A O   1 
ATOM   1113  C  CB  . MET A 1 181 ? 160.391 164.461 220.355 1.00 77.90  0  181 MET A CB  1 
ATOM   1114  C  CG  . MET A 1 181 ? 160.582 165.027 218.953 1.00 77.90  0  181 MET A CG  1 
ATOM   1115  S  SD  . MET A 1 181 ? 159.181 164.734 217.857 1.00 77.90  0  181 MET A SD  1 
ATOM   1116  C  CE  . MET A 1 181 ? 159.386 162.992 217.501 1.00 77.90  0  181 MET A CE  1 
ATOM   1117  N  N   . THR A 1 182 ? 163.379 165.986 220.509 1.00 73.69  0  182 THR A N   1 
ATOM   1118  C  CA  . THR A 1 182 ? 164.033 167.283 220.370 1.00 73.69  0  182 THR A CA  1 
ATOM   1119  C  C   . THR A 1 182 ? 163.863 167.734 218.924 1.00 73.69  0  182 THR A C   1 
ATOM   1120  O  O   . THR A 1 182 ? 164.606 167.304 218.037 1.00 73.69  0  182 THR A O   1 
ATOM   1121  C  CB  . THR A 1 182 ? 165.505 167.208 220.762 1.00 73.69  0  182 THR A CB  1 
ATOM   1122  O  OG1 . THR A 1 182 ? 165.616 166.699 222.096 1.00 73.69  0  182 THR A OG1 1 
ATOM   1123  C  CG2 . THR A 1 182 ? 166.146 168.587 220.694 1.00 73.69  0  182 THR A CG2 1 
ATOM   1124  N  N   . MET A 1 183 ? 162.871 168.588 218.689 1.00 76.35  0  183 MET A N   1 
ATOM   1125  C  CA  . MET A 1 183 ? 162.680 169.149 217.360 1.00 76.35  0  183 MET A CA  1 
ATOM   1126  C  C   . MET A 1 183 ? 163.762 170.182 217.073 1.00 76.35  0  183 MET A C   1 
ATOM   1127  O  O   . MET A 1 183 ? 164.291 170.825 217.980 1.00 76.35  0  183 MET A O   1 
ATOM   1128  C  CB  . MET A 1 183 ? 161.293 169.779 217.236 1.00 76.35  0  183 MET A CB  1 
ATOM   1129  C  CG  . MET A 1 183 ? 160.154 168.787 217.407 1.00 76.35  0  183 MET A CG  1 
ATOM   1130  S  SD  . MET A 1 183 ? 158.554 169.574 217.674 1.00 76.35  0  183 MET A SD  1 
ATOM   1131  C  CE  . MET A 1 183 ? 158.256 170.307 216.070 1.00 76.35  0  183 MET A CE  1 
ATOM   1132  N  N   . ILE A 1 184 ? 164.110 170.315 215.796 1.00 71.22  0  184 ILE A N   1 
ATOM   1133  C  CA  . ILE A 1 184 ? 165.167 171.215 215.351 1.00 71.22  0  184 ILE A CA  1 
ATOM   1134  C  C   . ILE A 1 184 ? 164.562 172.211 214.373 1.00 71.22  0  184 ILE A C   1 
ATOM   1135  O  O   . ILE A 1 184 ? 163.826 171.822 213.460 1.00 71.22  0  184 ILE A O   1 
ATOM   1136  C  CB  . ILE A 1 184 ? 166.337 170.444 214.709 1.00 71.22  0  184 ILE A CB  1 
ATOM   1137  C  CG1 . ILE A 1 184 ? 166.871 169.387 215.679 1.00 71.22  0  184 ILE A CG1 1 
ATOM   1138  C  CG2 . ILE A 1 184 ? 167.454 171.393 214.294 1.00 71.22  0  184 ILE A CG2 1 
ATOM   1139  C  CD1 . ILE A 1 184 ? 168.088 168.649 215.186 1.00 71.22  0  184 ILE A CD1 1 
ATOM   1140  N  N   . PHE A 1 185 ? 164.853 173.494 214.579 1.00 71.95  0  185 PHE A N   1 
ATOM   1141  C  CA  . PHE A 1 185 ? 164.382 174.553 213.704 1.00 71.95  0  185 PHE A CA  1 
ATOM   1142  C  C   . PHE A 1 185 ? 165.547 175.455 213.327 1.00 71.95  0  185 PHE A C   1 
ATOM   1143  O  O   . PHE A 1 185 ? 166.593 175.459 213.981 1.00 71.95  0  185 PHE A O   1 
ATOM   1144  C  CB  . PHE A 1 185 ? 163.274 175.381 214.365 1.00 71.95  0  185 PHE A CB  1 
ATOM   1145  C  CG  . PHE A 1 185 ? 161.950 174.680 214.429 1.00 71.95  0  185 PHE A CG  1 
ATOM   1146  C  CD1 . PHE A 1 185 ? 161.625 173.885 215.515 1.00 71.95  0  185 PHE A CD1 1 
ATOM   1147  C  CD2 . PHE A 1 185 ? 161.029 174.818 213.403 1.00 71.95  0  185 PHE A CD2 1 
ATOM   1148  C  CE1 . PHE A 1 185 ? 160.405 173.239 215.579 1.00 71.95  0  185 PHE A CE1 1 
ATOM   1149  C  CE2 . PHE A 1 185 ? 159.807 174.175 213.458 1.00 71.95  0  185 PHE A CE2 1 
ATOM   1150  C  CZ  . PHE A 1 185 ? 159.495 173.385 214.548 1.00 71.95  0  185 PHE A CZ  1 
ATOM   1151  N  N   . LYS A 1 186 ? 165.357 176.219 212.257 1.00 68.28  0  186 LYS A N   1 
ATOM   1152  C  CA  . LYS A 1 186 ? 166.351 177.175 211.790 1.00 68.28  0  186 LYS A CA  1 
ATOM   1153  C  C   . LYS A 1 186 ? 165.793 178.584 211.921 1.00 68.28  0  186 LYS A C   1 
ATOM   1154  O  O   . LYS A 1 186 ? 164.618 178.822 211.633 1.00 68.28  0  186 LYS A O   1 
ATOM   1155  C  CB  . LYS A 1 186 ? 166.747 176.894 210.335 1.00 68.28  0  186 LYS A CB  1 
ATOM   1156  C  CG  . LYS A 1 186 ? 167.899 177.742 209.821 1.00 68.28  0  186 LYS A CG  1 
ATOM   1157  C  CD  . LYS A 1 186 ? 168.235 177.408 208.381 1.00 68.28  0  186 LYS A CD  1 
ATOM   1158  C  CE  . LYS A 1 186 ? 169.147 178.460 207.776 1.00 68.28  0  186 LYS A CE  1 
ATOM   1159  N  NZ  . LYS A 1 186 ? 170.332 178.730 208.634 1.00 68.28  1  186 LYS A NZ  1 
ATOM   1160  N  N   . GLU A 1 187 ? 166.632 179.513 212.374 1.00 69.27  0  187 GLU A N   1 
ATOM   1161  C  CA  . GLU A 1 187 ? 166.238 180.915 212.441 1.00 69.27  0  187 GLU A CA  1 
ATOM   1162  C  C   . GLU A 1 187 ? 166.109 181.477 211.031 1.00 69.27  0  187 GLU A C   1 
ATOM   1163  O  O   . GLU A 1 187 ? 167.073 181.466 210.259 1.00 69.27  0  187 GLU A O   1 
ATOM   1164  C  CB  . GLU A 1 187 ? 167.256 181.714 213.249 1.00 69.27  0  187 GLU A CB  1 
ATOM   1165  C  CG  . GLU A 1 187 ? 167.218 181.434 214.740 1.00 69.27  0  187 GLU A CG  1 
ATOM   1166  C  CD  . GLU A 1 187 ? 167.492 182.671 215.570 1.00 69.27  0  187 GLU A CD  1 
ATOM   1167  O  OE1 . GLU A 1 187 ? 167.124 182.682 216.763 1.00 69.27  0  187 GLU A OE1 1 
ATOM   1168  O  OE2 . GLU A 1 187 ? 168.076 183.634 215.029 1.00 69.27  -1 187 GLU A OE2 1 
ATOM   1169  N  N   . SER A 1 188 ? 164.918 181.966 210.695 1.00 67.06  0  188 SER A N   1 
ATOM   1170  C  CA  . SER A 1 188 ? 164.643 182.454 209.354 1.00 67.06  0  188 SER A CA  1 
ATOM   1171  C  C   . SER A 1 188 ? 163.691 183.636 209.439 1.00 67.06  0  188 SER A C   1 
ATOM   1172  O  O   . SER A 1 188 ? 163.164 183.962 210.503 1.00 67.06  0  188 SER A O   1 
ATOM   1173  C  CB  . SER A 1 188 ? 164.053 181.352 208.468 1.00 67.06  0  188 SER A CB  1 
ATOM   1174  O  OG  . SER A 1 188 ? 163.351 181.907 207.371 1.00 67.06  0  188 SER A OG  1 
ATOM   1175  N  N   . SER A 1 189 ? 163.486 184.269 208.322 1.00 70.19  0  189 SER A N   1 
ATOM   1176  C  CA  . SER A 1 189 ? 162.538 185.365 208.259 1.00 70.19  0  189 SER A CA  1 
ATOM   1177  C  C   . SER A 1 189 ? 161.216 184.884 207.672 1.00 70.19  0  189 SER A C   1 
ATOM   1178  O  O   . SER A 1 189 ? 161.204 184.012 206.799 1.00 70.19  0  189 SER A O   1 
ATOM   1179  C  CB  . SER A 1 189 ? 163.093 186.509 207.407 1.00 70.19  0  189 SER A CB  1 
ATOM   1180  O  OG  . SER A 1 189 ? 162.409 187.723 207.663 1.00 70.19  0  189 SER A OG  1 
ATOM   1181  N  N   . PRO A 1 190 ? 160.083 185.421 208.141 1.00 69.29  0  190 PRO A N   1 
ATOM   1182  C  CA  . PRO A 1 190 ? 158.787 184.999 207.582 1.00 69.29  0  190 PRO A CA  1 
ATOM   1183  C  C   . PRO A 1 190 ? 158.562 185.445 206.148 1.00 69.29  0  190 PRO A C   1 
ATOM   1184  O  O   . PRO A 1 190 ? 157.724 184.851 205.458 1.00 69.29  0  190 PRO A O   1 
ATOM   1185  C  CB  . PRO A 1 190 ? 157.766 185.646 208.528 1.00 69.29  0  190 PRO A CB  1 
ATOM   1186  C  CG  . PRO A 1 190 ? 158.531 185.960 209.772 1.00 69.29  0  190 PRO A CG  1 
ATOM   1187  C  CD  . PRO A 1 190 ? 159.914 186.289 209.317 1.00 69.29  0  190 PRO A CD  1 
ATOM   1188  N  N   . SER A 1 191 ? 159.278 186.463 205.677 1.00 72.68  0  191 SER A N   1 
ATOM   1189  C  CA  . SER A 1 191 ? 159.169 186.929 204.303 1.00 72.68  0  191 SER A CA  1 
ATOM   1190  C  C   . SER A 1 191 ? 160.165 186.251 203.371 1.00 72.68  0  191 SER A C   1 
ATOM   1191  O  O   . SER A 1 191 ? 160.278 186.655 202.210 1.00 72.68  0  191 SER A O   1 
ATOM   1192  C  CB  . SER A 1 191 ? 159.359 188.447 204.247 1.00 72.68  0  191 SER A CB  1 
ATOM   1193  O  OG  . SER A 1 191 ? 160.733 188.789 204.283 1.00 72.68  0  191 SER A OG  1 
ATOM   1194  N  N   . HIS A 1 192 ? 160.883 185.238 203.848 1.00 69.19  0  192 HIS A N   1 
ATOM   1195  C  CA  . HIS A 1 192 ? 161.881 184.581 203.019 1.00 69.19  0  192 HIS A CA  1 
ATOM   1196  C  C   . HIS A 1 192 ? 161.203 183.689 201.980 1.00 69.19  0  192 HIS A C   1 
ATOM   1197  O  O   . HIS A 1 192 ? 160.167 183.081 202.266 1.00 69.19  0  192 HIS A O   1 
ATOM   1198  C  CB  . HIS A 1 192 ? 162.829 183.748 203.882 1.00 69.19  0  192 HIS A CB  1 
ATOM   1199  C  CG  . HIS A 1 192 ? 164.167 183.511 203.254 1.00 69.19  0  192 HIS A CG  1 
ATOM   1200  N  ND1 . HIS A 1 192 ? 164.388 182.515 202.328 1.00 69.19  0  192 HIS A ND1 1 
ATOM   1201  C  CD2 . HIS A 1 192 ? 165.353 184.144 203.416 1.00 69.19  0  192 HIS A CD2 1 
ATOM   1202  C  CE1 . HIS A 1 192 ? 165.651 182.546 201.943 1.00 69.19  0  192 HIS A CE1 1 
ATOM   1203  N  NE2 . HIS A 1 192 ? 166.259 183.523 202.592 1.00 69.19  0  192 HIS A NE2 1 
ATOM   1204  N  N   . PRO A 1 193 ? 161.758 183.593 200.766 1.00 71.31  0  193 PRO A N   1 
ATOM   1205  C  CA  . PRO A 1 193 ? 161.171 182.701 199.752 1.00 71.31  0  193 PRO A CA  1 
ATOM   1206  C  C   . PRO A 1 193 ? 161.367 181.216 200.023 1.00 71.31  0  193 PRO A C   1 
ATOM   1207  O  O   . PRO A 1 193 ? 160.826 180.401 199.263 1.00 71.31  0  193 PRO A O   1 
ATOM   1208  C  CB  . PRO A 1 193 ? 161.887 183.118 198.460 1.00 71.31  0  193 PRO A CB  1 
ATOM   1209  C  CG  . PRO A 1 193 ? 162.387 184.496 198.725 1.00 71.31  0  193 PRO A CG  1 
ATOM   1210  C  CD  . PRO A 1 193 ? 162.743 184.516 200.176 1.00 71.31  0  193 PRO A CD  1 
ATOM   1211  N  N   . THR A 1 194 ? 162.123 180.832 201.054 1.00 71.98  0  194 THR A N   1 
ATOM   1212  C  CA  . THR A 1 194 ? 162.257 179.417 201.384 1.00 71.98  0  194 THR A CA  1 
ATOM   1213  C  C   . THR A 1 194 ? 160.963 178.872 201.974 1.00 71.98  0  194 THR A C   1 
ATOM   1214  O  O   . THR A 1 194 ? 160.354 177.950 201.423 1.00 71.98  0  194 THR A O   1 
ATOM   1215  C  CB  . THR A 1 194 ? 163.423 179.204 202.351 1.00 71.98  0  194 THR A CB  1 
ATOM   1216  O  OG1 . THR A 1 194 ? 164.651 179.563 201.707 1.00 71.98  0  194 THR A OG1 1 
ATOM   1217  C  CG2 . THR A 1 194 ? 163.497 177.748 202.783 1.00 71.98  0  194 THR A CG2 1 
ATOM   1218  N  N   . ARG A 1 195 ? 160.520 179.442 203.090 1.00 75.18  0  195 ARG A N   1 
ATOM   1219  C  CA  . ARG A 1 195 ? 159.281 179.015 203.726 1.00 75.18  0  195 ARG A CA  1 
ATOM   1220  C  C   . ARG A 1 195 ? 158.081 179.619 202.996 1.00 75.18  0  195 ARG A C   1 
ATOM   1221  O  O   . ARG A 1 195 ? 157.965 180.843 202.865 1.00 75.18  0  195 ARG A O   1 
ATOM   1222  C  CB  . ARG A 1 195 ? 159.317 179.366 205.217 1.00 75.18  0  195 ARG A CB  1 
ATOM   1223  C  CG  . ARG A 1 195 ? 159.669 180.811 205.563 1.00 75.18  0  195 ARG A CG  1 
ATOM   1224  C  CD  . ARG A 1 195 ? 159.787 181.017 207.065 1.00 75.18  0  195 ARG A CD  1 
ATOM   1225  N  NE  . ARG A 1 195 ? 158.513 180.876 207.760 1.00 75.18  0  195 ARG A NE  1 
ATOM   1226  C  CZ  . ARG A 1 195 ? 158.397 180.740 209.077 1.00 75.18  0  195 ARG A CZ  1 
ATOM   1227  N  NH1 . ARG A 1 195 ? 159.480 180.727 209.842 1.00 75.18  1  195 ARG A NH1 1 
ATOM   1228  N  NH2 . ARG A 1 195 ? 157.198 180.619 209.629 1.00 75.18  0  195 ARG A NH2 1 
ATOM   1229  N  N   . CYS A 1 196 ? 157.217 178.753 202.469 1.00 86.40  0  196 CYS A N   1 
ATOM   1230  C  CA  . CYS A 1 196 ? 156.017 179.186 201.773 1.00 86.40  0  196 CYS A CA  1 
ATOM   1231  C  C   . CYS A 1 196 ? 154.837 179.230 202.740 1.00 86.40  0  196 CYS A C   1 
ATOM   1232  O  O   . CYS A 1 196 ? 154.938 178.841 203.905 1.00 86.40  0  196 CYS A O   1 
ATOM   1233  C  CB  . CYS A 1 196 ? 155.710 178.265 200.594 1.00 86.40  0  196 CYS A CB  1 
ATOM   1234  S  SG  . CYS A 1 196 ? 155.710 176.506 200.993 1.00 86.40  0  196 CYS A SG  1 
ATOM   1235  N  N   . HIS A 1 197 ? 153.688 179.692 202.239 1.00 93.64  0  197 HIS A N   1 
ATOM   1236  C  CA  . HIS A 1 197 ? 152.494 179.795 203.068 1.00 93.64  0  197 HIS A CA  1 
ATOM   1237  C  C   . HIS A 1 197 ? 151.878 178.435 203.372 1.00 93.64  0  197 HIS A C   1 
ATOM   1238  O  O   . HIS A 1 197 ? 151.097 178.322 204.322 1.00 93.64  0  197 HIS A O   1 
ATOM   1239  C  CB  . HIS A 1 197 ? 151.458 180.691 202.389 1.00 93.64  0  197 HIS A CB  1 
ATOM   1240  C  CG  . HIS A 1 197 ? 151.986 182.037 202.001 1.00 93.64  0  197 HIS A CG  1 
ATOM   1241  N  ND1 . HIS A 1 197 ? 152.167 183.056 202.911 1.00 93.64  0  197 HIS A ND1 1 
ATOM   1242  C  CD2 . HIS A 1 197 ? 152.369 182.532 200.801 1.00 93.64  0  197 HIS A CD2 1 
ATOM   1243  C  CE1 . HIS A 1 197 ? 152.641 184.121 202.289 1.00 93.64  0  197 HIS A CE1 1 
ATOM   1244  N  NE2 . HIS A 1 197 ? 152.772 183.829 201.007 1.00 93.64  0  197 HIS A NE2 1 
ATOM   1245  N  N   . GLU A 1 198 ? 152.209 177.405 202.592 1.00 93.69  0  198 GLU A N   1 
ATOM   1246  C  CA  . GLU A 1 198 ? 151.685 176.070 202.842 1.00 93.69  0  198 GLU A CA  1 
ATOM   1247  C  C   . GLU A 1 198 ? 152.462 175.328 203.920 1.00 93.69  0  198 GLU A C   1 
ATOM   1248  O  O   . GLU A 1 198 ? 151.937 174.365 204.489 1.00 93.69  0  198 GLU A O   1 
ATOM   1249  C  CB  . GLU A 1 198 ? 151.687 175.243 201.552 1.00 93.69  0  198 GLU A CB  1 
ATOM   1250  C  CG  . GLU A 1 198 ? 150.712 175.723 200.482 1.00 93.69  0  198 GLU A CG  1 
ATOM   1251  C  CD  . GLU A 1 198 ? 151.297 176.794 199.580 1.00 93.69  0  198 GLU A CD  1 
ATOM   1252  O  OE1 . GLU A 1 198 ? 152.493 177.119 199.734 1.00 93.69  0  198 GLU A OE1 1 
ATOM   1253  O  OE2 . GLU A 1 198 ? 150.559 177.311 198.714 1.00 93.69  -1 198 GLU A OE2 1 
ATOM   1254  N  N   . ASP A 1 199 ? 153.694 175.753 204.220 1.00 88.26  0  199 ASP A N   1 
ATOM   1255  C  CA  . ASP A 1 199 ? 154.534 175.052 205.185 1.00 88.26  0  199 ASP A CA  1 
ATOM   1256  C  C   . ASP A 1 199 ? 155.059 175.981 206.275 1.00 88.26  0  199 ASP A C   1 
ATOM   1257  O  O   . ASP A 1 199 ? 156.050 175.650 206.935 1.00 88.26  0  199 ASP A O   1 
ATOM   1258  C  CB  . ASP A 1 199 ? 155.705 174.361 204.480 1.00 88.26  0  199 ASP A CB  1 
ATOM   1259  C  CG  . ASP A 1 199 ? 155.401 172.920 204.120 1.00 88.26  0  199 ASP A CG  1 
ATOM   1260  O  OD1 . ASP A 1 199 ? 156.358 172.155 203.876 1.00 88.26  0  199 ASP A OD1 1 
ATOM   1261  O  OD2 . ASP A 1 199 ? 154.209 172.552 204.080 1.00 88.26  -1 199 ASP A OD2 1 
ATOM   1262  N  N   . ASN A 1 200 ? 154.425 177.133 206.476 1.00 84.22  0  200 ASN A N   1 
ATOM   1263  C  CA  . ASN A 1 200 ? 154.827 178.026 207.554 1.00 84.22  0  200 ASN A CA  1 
ATOM   1264  C  C   . ASN A 1 200 ? 154.387 177.450 208.893 1.00 84.22  0  200 ASN A C   1 
ATOM   1265  O  O   . ASN A 1 200 ? 153.262 176.964 209.038 1.00 84.22  0  200 ASN A O   1 
ATOM   1266  C  CB  . ASN A 1 200 ? 154.231 179.418 207.359 1.00 84.22  0  200 ASN A CB  1 
ATOM   1267  C  CG  . ASN A 1 200 ? 155.156 180.351 206.605 1.00 84.22  0  200 ASN A CG  1 
ATOM   1268  O  OD1 . ASN A 1 200 ? 156.376 180.268 206.730 1.00 84.22  0  200 ASN A OD1 1 
ATOM   1269  N  ND2 . ASN A 1 200 ? 154.577 181.247 205.816 1.00 84.22  0  200 ASN A ND2 1 
ATOM   1270  N  N   . VAL A 1 201 ? 155.280 177.505 209.875 1.00 74.82  0  201 VAL A N   1 
ATOM   1271  C  CA  . VAL A 1 201 ? 155.073 176.867 211.167 1.00 74.82  0  201 VAL A CA  1 
ATOM   1272  C  C   . VAL A 1 201 ? 155.236 177.921 212.252 1.00 74.82  0  201 VAL A C   1 
ATOM   1273  O  O   . VAL A 1 201 ? 156.260 178.611 212.303 1.00 74.82  0  201 VAL A O   1 
ATOM   1274  C  CB  . VAL A 1 201 ? 156.059 175.699 211.378 1.00 74.82  0  201 VAL A CB  1 
ATOM   1275  C  CG1 . VAL A 1 201 ? 156.186 175.337 212.849 1.00 74.82  0  201 VAL A CG1 1 
ATOM   1276  C  CG2 . VAL A 1 201 ? 155.628 174.489 210.565 1.00 74.82  0  201 VAL A CG2 1 
ATOM   1277  N  N   . VAL A 1 202 ? 154.225 178.054 213.110 1.00 69.88  0  202 VAL A N   1 
ATOM   1278  C  CA  . VAL A 1 202 ? 154.294 178.931 214.270 1.00 69.88  0  202 VAL A CA  1 
ATOM   1279  C  C   . VAL A 1 202 ? 154.211 178.073 215.529 1.00 69.88  0  202 VAL A C   1 
ATOM   1280  O  O   . VAL A 1 202 ? 153.352 177.187 215.643 1.00 69.88  0  202 VAL A O   1 
ATOM   1281  C  CB  . VAL A 1 202 ? 153.209 180.032 214.223 1.00 69.88  0  202 VAL A CB  1 
ATOM   1282  C  CG1 . VAL A 1 202 ? 151.802 179.467 214.028 1.00 69.88  0  202 VAL A CG1 1 
ATOM   1283  C  CG2 . VAL A 1 202 ? 153.266 180.906 215.470 1.00 69.88  0  202 VAL A CG2 1 
ATOM   1284  N  N   . VAL A 1 203 ? 155.151 178.292 216.446 1.00 69.06  0  203 VAL A N   1 
ATOM   1285  C  CA  . VAL A 1 203 ? 155.218 177.533 217.684 1.00 69.06  0  203 VAL A CA  1 
ATOM   1286  C  C   . VAL A 1 203 ? 155.131 178.501 218.854 1.00 69.06  0  203 VAL A C   1 
ATOM   1287  O  O   . VAL A 1 203 ? 155.209 179.718 218.698 1.00 69.06  0  203 VAL A O   1 
ATOM   1288  C  CB  . VAL A 1 203 ? 156.494 176.673 217.788 1.00 69.06  0  203 VAL A CB  1 
ATOM   1289  C  CG1 . VAL A 1 203 ? 156.641 175.760 216.583 1.00 69.06  0  203 VAL A CG1 1 
ATOM   1290  C  CG2 . VAL A 1 203 ? 157.716 177.558 217.934 1.00 69.06  0  203 VAL A CG2 1 
ATOM   1291  N  N   . ALA A 1 204 ? 154.964 177.933 220.041 1.00 71.73  0  204 ALA A N   1 
ATOM   1292  C  CA  . ALA A 1 204 ? 154.995 178.684 221.289 1.00 71.73  0  204 ALA A CA  1 
ATOM   1293  C  C   . ALA A 1 204 ? 155.770 177.831 222.279 1.00 71.73  0  204 ALA A C   1 
ATOM   1294  O  O   . ALA A 1 204 ? 155.280 176.778 222.701 1.00 71.73  0  204 ALA A O   1 
ATOM   1295  C  CB  . ALA A 1 204 ? 153.589 178.990 221.802 1.00 71.73  0  204 ALA A CB  1 
ATOM   1296  N  N   . VAL A 1 205 ? 156.985 178.262 222.614 1.00 76.78  0  205 VAL A N   1 
ATOM   1297  C  CA  . VAL A 1 205 ? 157.907 177.441 223.386 1.00 76.78  0  205 VAL A CA  1 
ATOM   1298  C  C   . VAL A 1 205 ? 158.288 178.190 224.653 1.00 76.78  0  205 VAL A C   1 
ATOM   1299  O  O   . VAL A 1 205 ? 157.800 179.296 224.906 1.00 76.78  0  205 VAL A O   1 
ATOM   1300  C  CB  . VAL A 1 205 ? 159.164 177.089 222.569 1.00 76.78  0  205 VAL A CB  1 
ATOM   1301  C  CG1 . VAL A 1 205 ? 158.797 176.275 221.338 1.00 76.78  0  205 VAL A CG1 1 
ATOM   1302  C  CG2 . VAL A 1 205 ? 159.906 178.354 222.174 1.00 76.78  0  205 VAL A CG2 1 
ATOM   1303  N  N   . ASP A 1 206 ? 159.154 177.590 225.458 1.00 85.74  0  206 ASP A N   1 
ATOM   1304  C  CA  . ASP A 1 206 ? 159.691 178.221 226.652 1.00 85.74  0  206 ASP A CA  1 
ATOM   1305  C  C   . ASP A 1 206 ? 161.003 178.921 226.300 1.00 85.74  0  206 ASP A C   1 
ATOM   1306  O  O   . ASP A 1 206 ? 161.680 178.582 225.327 1.00 85.74  0  206 ASP A O   1 
ATOM   1307  C  CB  . ASP A 1 206 ? 159.854 177.192 227.781 1.00 85.74  0  206 ASP A CB  1 
ATOM   1308  C  CG  . ASP A 1 206 ? 160.158 177.827 229.151 1.00 85.74  0  206 ASP A CG  1 
ATOM   1309  O  OD1 . ASP A 1 206 ? 160.239 177.079 230.139 1.00 85.74  0  206 ASP A OD1 1 
ATOM   1310  O  OD2 . ASP A 1 206 ? 160.387 179.047 229.252 1.00 85.74  -1 206 ASP A OD2 1 
ATOM   1311  N  N   . SER A 1 207 ? 161.344 179.923 227.105 1.00 88.37  0  207 SER A N   1 
ATOM   1312  C  CA  . SER A 1 207 ? 162.510 180.756 226.848 1.00 88.37  0  207 SER A CA  1 
ATOM   1313  C  C   . SER A 1 207 ? 163.776 180.240 227.519 1.00 88.37  0  207 SER A C   1 
ATOM   1314  O  O   . SER A 1 207 ? 164.863 180.383 226.948 1.00 88.37  0  207 SER A O   1 
ATOM   1315  C  CB  . SER A 1 207 ? 162.239 182.193 227.302 1.00 88.37  0  207 SER A CB  1 
ATOM   1316  O  OG  . SER A 1 207 ? 161.607 182.220 228.569 1.00 88.37  0  207 SER A OG  1 
ATOM   1317  N  N   . THR A 1 208 ? 163.678 179.638 228.706 1.00 90.71  0  208 THR A N   1 
ATOM   1318  C  CA  . THR A 1 208 ? 164.884 179.273 229.438 1.00 90.71  0  208 THR A CA  1 
ATOM   1319  C  C   . THR A 1 208 ? 165.228 177.790 229.366 1.00 90.71  0  208 THR A C   1 
ATOM   1320  O  O   . THR A 1 208 ? 166.391 177.437 229.585 1.00 90.71  0  208 THR A O   1 
ATOM   1321  C  CB  . THR A 1 208 ? 164.751 179.682 230.911 1.00 90.71  0  208 THR A CB  1 
ATOM   1322  O  OG1 . THR A 1 208 ? 163.937 178.730 231.606 1.00 90.71  0  208 THR A OG1 1 
ATOM   1323  C  CG2 . THR A 1 208 ? 164.122 181.063 231.031 1.00 90.71  0  208 THR A CG2 1 
ATOM   1324  N  N   . THR A 1 209 ? 164.265 176.913 229.068 1.00 85.64  0  209 THR A N   1 
ATOM   1325  C  CA  . THR A 1 209 ? 164.551 175.490 228.918 1.00 85.64  0  209 THR A CA  1 
ATOM   1326  C  C   . THR A 1 209 ? 164.028 174.947 227.592 1.00 85.64  0  209 THR A C   1 
ATOM   1327  O  O   . THR A 1 209 ? 164.009 173.725 227.410 1.00 85.64  0  209 THR A O   1 
ATOM   1328  C  CB  . THR A 1 209 ? 163.996 174.659 230.084 1.00 85.64  0  209 THR A CB  1 
ATOM   1329  O  OG1 . THR A 1 209 ? 164.281 173.274 229.856 1.00 85.64  0  209 THR A OG1 1 
ATOM   1330  C  CG2 . THR A 1 209 ? 162.512 174.815 230.198 1.00 85.64  0  209 THR A CG2 1 
ATOM   1331  N  N   . ASN A 1 210 ? 163.617 175.837 226.675 1.00 81.78  0  210 ASN A N   1 
ATOM   1332  C  CA  . ASN A 1 210 ? 163.188 175.625 225.285 1.00 81.78  0  210 ASN A CA  1 
ATOM   1333  C  C   . ASN A 1 210 ? 162.330 174.388 225.016 1.00 81.78  0  210 ASN A C   1 
ATOM   1334  O  O   . ASN A 1 210 ? 162.518 173.703 224.006 1.00 81.78  0  210 ASN A O   1 
ATOM   1335  C  CB  . ASN A 1 210 ? 164.404 175.648 224.332 1.00 81.78  0  210 ASN A CB  1 
ATOM   1336  C  CG  . ASN A 1 210 ? 165.500 174.644 224.691 1.00 81.78  0  210 ASN A CG  1 
ATOM   1337  O  OD1 . ASN A 1 210 ? 165.256 173.451 224.866 1.00 81.78  0  210 ASN A OD1 1 
ATOM   1338  N  ND2 . ASN A 1 210 ? 166.725 175.142 224.805 1.00 81.78  0  210 ASN A ND2 1 
ATOM   1339  N  N   . ARG A 1 211 ? 161.370 174.112 225.896 1.00 79.79  0  211 ARG A N   1 
ATOM   1340  C  CA  . ARG A 1 211 ? 160.413 173.037 225.674 1.00 79.79  0  211 ARG A CA  1 
ATOM   1341  C  C   . ARG A 1 211 ? 159.209 173.559 224.899 1.00 79.79  0  211 ARG A C   1 
ATOM   1342  O  O   . ARG A 1 211 ? 158.725 174.667 225.148 1.00 79.79  0  211 ARG A O   1 
ATOM   1343  C  CB  . ARG A 1 211 ? 159.954 172.423 226.999 1.00 79.79  0  211 ARG A CB  1 
ATOM   1344  C  CG  . ARG A 1 211 ? 159.573 173.424 228.077 1.00 79.79  0  211 ARG A CG  1 
ATOM   1345  C  CD  . ARG A 1 211 ? 159.248 172.713 229.379 1.00 79.79  0  211 ARG A CD  1 
ATOM   1346  N  NE  . ARG A 1 211 ? 158.151 171.763 229.219 1.00 79.79  0  211 ARG A NE  1 
ATOM   1347  C  CZ  . ARG A 1 211 ? 156.903 171.984 229.617 1.00 79.79  0  211 ARG A CZ  1 
ATOM   1348  N  NH1 . ARG A 1 211 ? 156.586 173.128 230.208 1.00 79.79  1  211 ARG A NH1 1 
ATOM   1349  N  NH2 . ARG A 1 211 ? 155.971 171.060 229.427 1.00 79.79  0  211 ARG A NH2 1 
ATOM   1350  N  N   . VAL A 1 212 ? 158.739 172.759 223.948 1.00 73.88  0  212 VAL A N   1 
ATOM   1351  C  CA  . VAL A 1 212 ? 157.640 173.163 223.079 1.00 73.88  0  212 VAL A CA  1 
ATOM   1352  C  C   . VAL A 1 212 ? 156.326 173.011 223.831 1.00 73.88  0  212 VAL A C   1 
ATOM   1353  O  O   . VAL A 1 212 ? 156.062 171.970 224.443 1.00 73.88  0  212 VAL A O   1 
ATOM   1354  C  CB  . VAL A 1 212 ? 157.637 172.333 221.785 1.00 73.88  0  212 VAL A CB  1 
ATOM   1355  C  CG1 . VAL A 1 212 ? 156.605 172.870 220.805 1.00 73.88  0  212 VAL A CG1 1 
ATOM   1356  C  CG2 . VAL A 1 212 ? 159.018 172.323 221.158 1.00 73.88  0  212 VAL A CG2 1 
ATOM   1357  N  N   . LEU A 1 213 ? 155.500 174.054 223.791 1.00 74.97  0  213 LEU A N   1 
ATOM   1358  C  CA  . LEU A 1 213 ? 154.177 174.039 224.403 1.00 74.97  0  213 LEU A CA  1 
ATOM   1359  C  C   . LEU A 1 213 ? 153.052 174.046 223.383 1.00 74.97  0  213 LEU A C   1 
ATOM   1360  O  O   . LEU A 1 213 ? 152.014 173.422 223.614 1.00 74.97  0  213 LEU A O   1 
ATOM   1361  C  CB  . LEU A 1 213 ? 154.013 175.238 225.344 1.00 74.97  0  213 LEU A CB  1 
ATOM   1362  C  CG  . LEU A 1 213 ? 155.177 175.518 226.295 1.00 74.97  0  213 LEU A CG  1 
ATOM   1363  C  CD1 . LEU A 1 213 ? 154.913 176.777 227.104 1.00 74.97  0  213 LEU A CD1 1 
ATOM   1364  C  CD2 . LEU A 1 213 ? 155.416 174.331 227.211 1.00 74.97  0  213 LEU A CD2 1 
ATOM   1365  N  N   . HIS A 1 214 ? 153.229 174.738 222.260 1.00 75.92  0  214 HIS A N   1 
ATOM   1366  C  CA  . HIS A 1 214 ? 152.244 174.731 221.189 1.00 75.92  0  214 HIS A CA  1 
ATOM   1367  C  C   . HIS A 1 214 ? 152.962 174.703 219.849 1.00 75.92  0  214 HIS A C   1 
ATOM   1368  O  O   . HIS A 1 214 ? 154.070 175.223 219.713 1.00 75.92  0  214 HIS A O   1 
ATOM   1369  C  CB  . HIS A 1 214 ? 151.310 175.945 221.261 1.00 75.92  0  214 HIS A CB  1 
ATOM   1370  C  CG  . HIS A 1 214 ? 150.049 175.780 220.472 1.00 75.92  0  214 HIS A CG  1 
ATOM   1371  N  ND1 . HIS A 1 214 ? 149.059 174.891 220.830 1.00 75.92  0  214 HIS A ND1 1 
ATOM   1372  C  CD2 . HIS A 1 214 ? 149.618 176.387 219.341 1.00 75.92  0  214 HIS A CD2 1 
ATOM   1373  C  CE1 . HIS A 1 214 ? 148.072 174.958 219.955 1.00 75.92  0  214 HIS A CE1 1 
ATOM   1374  N  NE2 . HIS A 1 214 ? 148.386 175.859 219.042 1.00 75.92  0  214 HIS A NE2 1 
ATOM   1375  N  N   . PHE A 1 215 ? 152.302 174.117 218.853 1.00 74.67  0  215 PHE A N   1 
ATOM   1376  C  CA  . PHE A 1 215 ? 152.909 173.897 217.542 1.00 74.67  0  215 PHE A CA  1 
ATOM   1377  C  C   . PHE A 1 215 ? 151.791 173.798 216.519 1.00 74.67  0  215 PHE A C   1 
ATOM   1378  O  O   . PHE A 1 215 ? 150.942 172.907 216.628 1.00 74.67  0  215 PHE A O   1 
ATOM   1379  C  CB  . PHE A 1 215 ? 153.764 172.621 217.562 1.00 74.67  0  215 PHE A CB  1 
ATOM   1380  C  CG  . PHE A 1 215 ? 154.089 172.065 216.199 1.00 74.67  0  215 PHE A CG  1 
ATOM   1381  C  CD1 . PHE A 1 215 ? 155.107 172.613 215.437 1.00 74.67  0  215 PHE A CD1 1 
ATOM   1382  C  CD2 . PHE A 1 215 ? 153.405 170.961 215.701 1.00 74.67  0  215 PHE A CD2 1 
ATOM   1383  C  CE1 . PHE A 1 215 ? 155.418 172.092 214.192 1.00 74.67  0  215 PHE A CE1 1 
ATOM   1384  C  CE2 . PHE A 1 215 ? 153.708 170.441 214.456 1.00 74.67  0  215 PHE A CE2 1 
ATOM   1385  C  CZ  . PHE A 1 215 ? 154.717 171.006 213.702 1.00 74.67  0  215 PHE A CZ  1 
ATOM   1386  N  N   . GLN A 1 216 ? 151.780 174.692 215.530 1.00 74.10  0  216 GLN A N   1 
ATOM   1387  C  CA  . GLN A 1 216 ? 150.746 174.642 214.507 1.00 74.10  0  216 GLN A CA  1 
ATOM   1388  C  C   . GLN A 1 216 ? 151.277 175.246 213.215 1.00 74.10  0  216 GLN A C   1 
ATOM   1389  O  O   . GLN A 1 216 ? 152.376 175.805 213.165 1.00 74.10  0  216 GLN A O   1 
ATOM   1390  C  CB  . GLN A 1 216 ? 149.469 175.362 214.959 1.00 74.10  0  216 GLN A CB  1 
ATOM   1391  C  CG  . GLN A 1 216 ? 149.694 176.763 215.489 1.00 74.10  0  216 GLN A CG  1 
ATOM   1392  C  CD  . GLN A 1 216 ? 148.417 177.403 215.993 1.00 74.10  0  216 GLN A CD  1 
ATOM   1393  O  OE1 . GLN A 1 216 ? 147.360 176.775 216.012 1.00 74.10  0  216 GLN A OE1 1 
ATOM   1394  N  NE2 . GLN A 1 216 ? 148.509 178.662 216.403 1.00 74.10  0  216 GLN A NE2 1 
ATOM   1395  N  N   . LYS A 1 217 ? 150.475 175.117 212.165 1.00 75.96  0  217 LYS A N   1 
ATOM   1396  C  CA  . LYS A 1 217 ? 150.780 175.649 210.847 1.00 75.96  0  217 LYS A CA  1 
ATOM   1397  C  C   . LYS A 1 217 ? 149.802 176.763 210.498 1.00 75.96  0  217 LYS A C   1 
ATOM   1398  O  O   . LYS A 1 217 ? 148.779 176.958 211.159 1.00 75.96  0  217 LYS A O   1 
ATOM   1399  C  CB  . LYS A 1 217 ? 150.735 174.541 209.789 1.00 75.96  0  217 LYS A CB  1 
ATOM   1400  C  CG  . LYS A 1 217 ? 151.756 173.438 210.009 1.00 75.96  0  217 LYS A CG  1 
ATOM   1401  C  CD  . LYS A 1 217 ? 151.630 172.353 208.955 1.00 75.96  0  217 LYS A CD  1 
ATOM   1402  C  CE  . LYS A 1 217 ? 152.638 171.241 209.188 1.00 75.96  0  217 LYS A CE  1 
ATOM   1403  N  NZ  . LYS A 1 217 ? 154.038 171.729 209.063 1.00 75.96  1  217 LYS A NZ  1 
ATOM   1404  N  N   . THR A 1 218 ? 150.131 177.500 209.441 1.00 81.30  0  218 THR A N   1 
ATOM   1405  C  CA  . THR A 1 218 ? 149.342 178.644 208.998 1.00 81.30  0  218 THR A CA  1 
ATOM   1406  C  C   . THR A 1 218 ? 148.626 178.350 207.684 1.00 81.30  0  218 THR A C   1 
ATOM   1407  O  O   . THR A 1 218 ? 148.507 179.219 206.817 1.00 81.30  0  218 THR A O   1 
ATOM   1408  C  CB  . THR A 1 218 ? 150.218 179.883 208.840 1.00 81.30  0  218 THR A CB  1 
ATOM   1409  O  OG1 . THR A 1 218 ? 151.000 179.756 207.648 1.00 81.30  0  218 THR A OG1 1 
ATOM   1410  C  CG2 . THR A 1 218 ? 151.160 180.024 210.025 1.00 81.30  0  218 THR A CG2 1 
ATOM   1411  N  N   . GLN A 1 219 ? 148.151 177.116 207.518 1.00 85.68  0  219 GLN A N   1 
ATOM   1412  C  CA  . GLN A 1 219 ? 147.524 176.708 206.267 1.00 85.68  0  219 GLN A CA  1 
ATOM   1413  C  C   . GLN A 1 219 ? 146.132 177.316 206.155 1.00 85.68  0  219 GLN A C   1 
ATOM   1414  O  O   . GLN A 1 219 ? 145.135 176.682 206.512 1.00 85.68  0  219 GLN A O   1 
ATOM   1415  C  CB  . GLN A 1 219 ? 147.453 175.182 206.172 1.00 85.68  0  219 GLN A CB  1 
ATOM   1416  N  N   . GLY A 1 220 ? 146.063 178.549 205.659 1.00 87.85  0  220 GLY A N   1 
ATOM   1417  C  CA  . GLY A 1 220 ? 144.804 179.250 205.517 1.00 87.85  0  220 GLY A CA  1 
ATOM   1418  C  C   . GLY A 1 220 ? 144.273 179.758 206.841 1.00 87.85  0  220 GLY A C   1 
ATOM   1419  O  O   . GLY A 1 220 ? 143.149 179.432 207.235 1.00 87.85  0  220 GLY A O   1 
ATOM   1420  N  N   . LEU A 1 221 ? 145.076 180.560 207.538 1.00 86.22  0  221 LEU A N   1 
ATOM   1421  C  CA  . LEU A 1 221 ? 144.697 181.110 208.837 1.00 86.22  0  221 LEU A CA  1 
ATOM   1422  C  C   . LEU A 1 221 ? 145.262 182.519 208.939 1.00 86.22  0  221 LEU A C   1 
ATOM   1423  O  O   . LEU A 1 221 ? 146.483 182.698 208.990 1.00 86.22  0  221 LEU A O   1 
ATOM   1424  C  CB  . LEU A 1 221 ? 145.206 180.233 209.981 1.00 86.22  0  221 LEU A CB  1 
ATOM   1425  N  N   . ARG A 1 222 ? 144.379 183.516 208.969 1.00 84.01  0  222 ARG A N   1 
ATOM   1426  C  CA  . ARG A 1 222 ? 144.796 184.901 209.139 1.00 84.01  0  222 ARG A CA  1 
ATOM   1427  C  C   . ARG A 1 222 ? 144.927 185.306 210.600 1.00 84.01  0  222 ARG A C   1 
ATOM   1428  O  O   . ARG A 1 222 ? 145.646 186.265 210.901 1.00 84.01  0  222 ARG A O   1 
ATOM   1429  C  CB  . ARG A 1 222 ? 143.809 185.841 208.440 1.00 84.01  0  222 ARG A CB  1 
ATOM   1430  N  N   . ARG A 1 223 ? 144.253 184.603 211.507 1.00 84.54  0  223 ARG A N   1 
ATOM   1431  C  CA  . ARG A 1 223 ? 144.311 184.881 212.934 1.00 84.54  0  223 ARG A CA  1 
ATOM   1432  C  C   . ARG A 1 223 ? 144.614 183.590 213.676 1.00 84.54  0  223 ARG A C   1 
ATOM   1433  O  O   . ARG A 1 223 ? 143.926 182.583 213.480 1.00 84.54  0  223 ARG A O   1 
ATOM   1434  C  CB  . ARG A 1 223 ? 142.997 185.489 213.433 1.00 84.54  0  223 ARG A CB  1 
ATOM   1435  N  N   . PHE A 1 224 ? 145.637 183.619 214.524 1.00 82.49  0  224 PHE A N   1 
ATOM   1436  C  CA  . PHE A 1 224 ? 146.100 182.433 215.229 1.00 82.49  0  224 PHE A CA  1 
ATOM   1437  C  C   . PHE A 1 224 ? 145.629 182.457 216.676 1.00 82.49  0  224 PHE A C   1 
ATOM   1438  O  O   . PHE A 1 224 ? 145.635 183.505 217.328 1.00 82.49  0  224 PHE A O   1 
ATOM   1439  C  CB  . PHE A 1 224 ? 147.625 182.334 215.179 1.00 82.49  0  224 PHE A CB  1 
ATOM   1440  C  CG  . PHE A 1 224 ? 148.196 182.558 213.812 1.00 82.49  0  224 PHE A CG  1 
ATOM   1441  C  CD1 . PHE A 1 224 ? 147.922 181.673 212.781 1.00 82.49  0  224 PHE A CD1 1 
ATOM   1442  C  CD2 . PHE A 1 224 ? 149.004 183.654 213.555 1.00 82.49  0  224 PHE A CD2 1 
ATOM   1443  C  CE1 . PHE A 1 224 ? 148.442 181.878 211.518 1.00 82.49  0  224 PHE A CE1 1 
ATOM   1444  C  CE2 . PHE A 1 224 ? 149.532 183.865 212.294 1.00 82.49  0  224 PHE A CE2 1 
ATOM   1445  C  CZ  . PHE A 1 224 ? 149.250 182.974 211.274 1.00 82.49  0  224 PHE A CZ  1 
ATOM   1446  N  N   . ALA A 1 225 ? 145.223 181.291 217.171 1.00 83.84  0  225 ALA A N   1 
ATOM   1447  C  CA  . ALA A 1 225 ? 144.736 181.128 218.533 1.00 83.84  0  225 ALA A CA  1 
ATOM   1448  C  C   . ALA A 1 225 ? 145.655 180.177 219.285 1.00 83.84  0  225 ALA A C   1 
ATOM   1449  O  O   . ALA A 1 225 ? 145.936 179.072 218.810 1.00 83.84  0  225 ALA A O   1 
ATOM   1450  C  CB  . ALA A 1 225 ? 143.299 180.600 218.546 1.00 83.84  0  225 ALA A CB  1 
ATOM   1451  N  N   . PHE A 1 226 ? 146.118 180.609 220.452 1.00 83.54  0  226 PHE A N   1 
ATOM   1452  C  CA  . PHE A 1 226 ? 146.968 179.809 221.314 1.00 83.54  0  226 PHE A CA  1 
ATOM   1453  C  C   . PHE A 1 226 ? 146.237 179.471 222.610 1.00 83.54  0  226 PHE A C   1 
ATOM   1454  O  O   . PHE A 1 226 ? 145.435 180.273 223.095 1.00 83.54  0  226 PHE A O   1 
ATOM   1455  C  CB  . PHE A 1 226 ? 148.273 180.549 221.636 1.00 83.54  0  226 PHE A CB  1 
ATOM   1456  C  CG  . PHE A 1 226 ? 149.182 180.706 220.454 1.00 83.54  0  226 PHE A CG  1 
ATOM   1457  C  CD1 . PHE A 1 226 ? 149.093 181.821 219.635 1.00 83.54  0  226 PHE A CD1 1 
ATOM   1458  C  CD2 . PHE A 1 226 ? 150.121 179.731 220.155 1.00 83.54  0  226 PHE A CD2 1 
ATOM   1459  C  CE1 . PHE A 1 226 ? 149.927 181.964 218.542 1.00 83.54  0  226 PHE A CE1 1 
ATOM   1460  C  CE2 . PHE A 1 226 ? 150.959 179.866 219.063 1.00 83.54  0  226 PHE A CE2 1 
ATOM   1461  C  CZ  . PHE A 1 226 ? 150.860 180.984 218.255 1.00 83.54  0  226 PHE A CZ  1 
ATOM   1462  N  N   . PRO A 1 227 ? 146.474 178.290 223.182 1.00 85.86  0  227 PRO A N   1 
ATOM   1463  C  CA  . PRO A 1 227 ? 145.751 177.892 224.398 1.00 85.86  0  227 PRO A CA  1 
ATOM   1464  C  C   . PRO A 1 227 ? 146.198 178.689 225.615 1.00 85.86  0  227 PRO A C   1 
ATOM   1465  O  O   . PRO A 1 227 ? 147.218 179.381 225.616 1.00 85.86  0  227 PRO A O   1 
ATOM   1466  C  CB  . PRO A 1 227 ? 146.093 176.406 224.552 1.00 85.86  0  227 PRO A CB  1 
ATOM   1467  C  CG  . PRO A 1 227 ? 146.598 175.979 223.210 1.00 85.86  0  227 PRO A CG  1 
ATOM   1468  C  CD  . PRO A 1 227 ? 147.280 177.180 222.647 1.00 85.86  0  227 PRO A CD  1 
ATOM   1469  N  N   . LEU A 1 228 ? 145.399 178.573 226.675 1.00 89.55  0  228 LEU A N   1 
ATOM   1470  C  CA  . LEU A 1 228 ? 145.626 179.320 227.904 1.00 89.55  0  228 LEU A CA  1 
ATOM   1471  C  C   . LEU A 1 228 ? 146.330 178.510 228.982 1.00 89.55  0  228 LEU A C   1 
ATOM   1472  O  O   . LEU A 1 228 ? 146.864 179.102 229.926 1.00 89.55  0  228 LEU A O   1 
ATOM   1473  C  CB  . LEU A 1 228 ? 144.292 179.832 228.461 1.00 89.55  0  228 LEU A CB  1 
ATOM   1474  C  CG  . LEU A 1 228 ? 144.296 181.192 229.159 1.00 89.55  0  228 LEU A CG  1 
ATOM   1475  C  CD1 . LEU A 1 228 ? 144.675 182.288 228.179 1.00 89.55  0  228 LEU A CD1 1 
ATOM   1476  C  CD2 . LEU A 1 228 ? 142.941 181.473 229.787 1.00 89.55  0  228 LEU A CD2 1 
ATOM   1477  N  N   . SER A 1 229 ? 146.348 177.182 228.868 1.00 91.06  0  229 SER A N   1 
ATOM   1478  C  CA  . SER A 1 229 ? 146.975 176.341 229.879 1.00 91.06  0  229 SER A CA  1 
ATOM   1479  C  C   . SER A 1 229 ? 148.497 176.360 229.813 1.00 91.06  0  229 SER A C   1 
ATOM   1480  O  O   . SER A 1 229 ? 149.144 175.901 230.762 1.00 91.06  0  229 SER A O   1 
ATOM   1481  C  CB  . SER A 1 229 ? 146.477 174.900 229.746 1.00 91.06  0  229 SER A CB  1 
ATOM   1482  N  N   . LEU A 1 230 ? 149.079 176.881 228.727 1.00 88.65  0  230 LEU A N   1 
ATOM   1483  C  CA  . LEU A 1 230 ? 150.532 176.949 228.618 1.00 88.65  0  230 LEU A CA  1 
ATOM   1484  C  C   . LEU A 1 230 ? 151.123 177.968 229.583 1.00 88.65  0  230 LEU A C   1 
ATOM   1485  O  O   . LEU A 1 230 ? 152.277 177.827 230.003 1.00 88.65  0  230 LEU A O   1 
ATOM   1486  C  CB  . LEU A 1 230 ? 150.934 177.291 227.183 1.00 88.65  0  230 LEU A CB  1 
ATOM   1487  C  CG  . LEU A 1 230 ? 150.107 176.650 226.067 1.00 88.65  0  230 LEU A CG  1 
ATOM   1488  C  CD1 . LEU A 1 230 ? 150.458 177.271 224.725 1.00 88.65  0  230 LEU A CD1 1 
ATOM   1489  C  CD2 . LEU A 1 230 ? 150.308 175.143 226.034 1.00 88.65  0  230 LEU A CD2 1 
ATOM   1490  N  N   . PHE A 1 231 ? 150.353 178.996 229.943 1.00 90.73  0  231 PHE A N   1 
ATOM   1491  C  CA  . PHE A 1 231 ? 150.819 179.974 230.917 1.00 90.73  0  231 PHE A CA  1 
ATOM   1492  C  C   . PHE A 1 231 ? 150.643 179.476 232.344 1.00 90.73  0  231 PHE A C   1 
ATOM   1493  O  O   . PHE A 1 231 ? 151.472 179.781 233.209 1.00 90.73  0  231 PHE A O   1 
ATOM   1494  C  CB  . PHE A 1 231 ? 150.081 181.297 230.722 1.00 90.73  0  231 PHE A CB  1 
ATOM   1495  C  CG  . PHE A 1 231 ? 150.009 181.740 229.292 1.00 90.73  0  231 PHE A CG  1 
ATOM   1496  C  CD1 . PHE A 1 231 ? 151.166 181.917 228.551 1.00 90.73  0  231 PHE A CD1 1 
ATOM   1497  C  CD2 . PHE A 1 231 ? 148.785 181.968 228.683 1.00 90.73  0  231 PHE A CD2 1 
ATOM   1498  C  CE1 . PHE A 1 231 ? 151.107 182.322 227.230 1.00 90.73  0  231 PHE A CE1 1 
ATOM   1499  C  CE2 . PHE A 1 231 ? 148.718 182.373 227.364 1.00 90.73  0  231 PHE A CE2 1 
ATOM   1500  C  CZ  . PHE A 1 231 ? 149.881 182.550 226.636 1.00 90.73  0  231 PHE A CZ  1 
ATOM   1501  N  N   . GLN A 1 232 ? 149.578 178.714 232.606 1.00 95.32  0  232 GLN A N   1 
ATOM   1502  C  CA  . GLN A 1 232 ? 149.370 178.172 233.944 1.00 95.32  0  232 GLN A CA  1 
ATOM   1503  C  C   . GLN A 1 232 ? 150.316 177.014 234.231 1.00 95.32  0  232 GLN A C   1 
ATOM   1504  O  O   . GLN A 1 232 ? 150.704 176.807 235.386 1.00 95.32  0  232 GLN A O   1 
ATOM   1505  C  CB  . GLN A 1 232 ? 147.917 177.726 234.110 1.00 95.32  0  232 GLN A CB  1 
ATOM   1506  N  N   . GLY A 1 233 ? 150.696 176.252 233.203 1.00 98.61  0  233 GLY A N   1 
ATOM   1507  C  CA  . GLY A 1 233 ? 151.643 175.172 233.407 1.00 98.61  0  233 GLY A CA  1 
ATOM   1508  C  C   . GLY A 1 233 ? 153.071 175.643 233.574 1.00 98.61  0  233 GLY A C   1 
ATOM   1509  O  O   . GLY A 1 233 ? 153.876 174.963 234.218 1.00 98.61  0  233 GLY A O   1 
ATOM   1510  N  N   . SER A 1 234 ? 153.407 176.801 233.006 1.00 97.59  0  234 SER A N   1 
ATOM   1511  C  CA  . SER A 1 234 ? 154.759 177.356 233.088 1.00 97.59  0  234 SER A CA  1 
ATOM   1512  C  C   . SER A 1 234 ? 154.634 178.860 233.313 1.00 97.59  0  234 SER A C   1 
ATOM   1513  O  O   . SER A 1 234 ? 154.372 179.614 232.371 1.00 97.59  0  234 SER A O   1 
ATOM   1514  C  CB  . SER A 1 234 ? 155.562 177.046 231.830 1.00 97.59  0  234 SER A CB  1 
ATOM   1515  N  N   . SER A 1 235 ? 154.823 179.290 234.561 1.00 100.33 0  235 SER A N   1 
ATOM   1516  C  CA  . SER A 1 235 ? 154.754 180.697 234.933 1.00 100.33 0  235 SER A CA  1 
ATOM   1517  C  C   . SER A 1 235 ? 156.127 181.359 234.968 1.00 100.33 0  235 SER A C   1 
ATOM   1518  O  O   . SER A 1 235 ? 156.273 182.441 235.547 1.00 100.33 0  235 SER A O   1 
ATOM   1519  C  CB  . SER A 1 235 ? 154.062 180.850 236.288 1.00 100.33 0  235 SER A CB  1 
ATOM   1520  N  N   . ASP A 1 236 ? 157.131 180.735 234.358 1.00 96.95  0  236 ASP A N   1 
ATOM   1521  C  CA  . ASP A 1 236 ? 158.491 181.256 234.365 1.00 96.95  0  236 ASP A CA  1 
ATOM   1522  C  C   . ASP A 1 236 ? 158.888 181.926 233.061 1.00 96.95  0  236 ASP A C   1 
ATOM   1523  O  O   . ASP A 1 236 ? 159.719 182.840 233.077 1.00 96.95  0  236 ASP A O   1 
ATOM   1524  C  CB  . ASP A 1 236 ? 159.489 180.132 234.668 1.00 96.95  0  236 ASP A CB  1 
ATOM   1525  N  N   . GLY A 1 237 ? 158.327 181.493 231.936 1.00 90.84  0  237 GLY A N   1 
ATOM   1526  C  CA  . GLY A 1 237 ? 158.684 182.073 230.659 1.00 90.84  0  237 GLY A CA  1 
ATOM   1527  C  C   . GLY A 1 237 ? 158.028 181.391 229.477 1.00 90.84  0  237 GLY A C   1 
ATOM   1528  O  O   . GLY A 1 237 ? 157.841 180.172 229.489 1.00 90.84  0  237 GLY A O   1 
ATOM   1529  N  N   . VAL A 1 238 ? 157.587 182.176 228.498 1.00 81.37  0  238 VAL A N   1 
ATOM   1530  C  CA  . VAL A 1 238 ? 156.903 181.654 227.317 1.00 81.37  0  238 VAL A CA  1 
ATOM   1531  C  C   . VAL A 1 238 ? 157.107 182.652 226.180 1.00 81.37  0  238 VAL A C   1 
ATOM   1532  O  O   . VAL A 1 238 ? 157.062 183.868 226.389 1.00 81.37  0  238 VAL A O   1 
ATOM   1533  C  CB  . VAL A 1 238 ? 155.408 181.362 227.618 1.00 81.37  0  238 VAL A CB  1 
ATOM   1534  C  CG1 . VAL A 1 238 ? 154.703 182.580 228.203 1.00 81.37  0  238 VAL A CG1 1 
ATOM   1535  C  CG2 . VAL A 1 238 ? 154.672 180.816 226.387 1.00 81.37  0  238 VAL A CG2 1 
ATOM   1536  N  N   . GLU A 1 239 ? 157.374 182.136 224.980 1.00 75.69  0  239 GLU A N   1 
ATOM   1537  C  CA  . GLU A 1 239 ? 157.665 182.966 223.819 1.00 75.69  0  239 GLU A CA  1 
ATOM   1538  C  C   . GLU A 1 239 ? 157.051 182.334 222.580 1.00 75.69  0  239 GLU A C   1 
ATOM   1539  O  O   . GLU A 1 239 ? 157.235 181.138 222.333 1.00 75.69  0  239 GLU A O   1 
ATOM   1540  C  CB  . GLU A 1 239 ? 159.176 183.141 223.622 1.00 75.69  0  239 GLU A CB  1 
ATOM   1541  C  CG  . GLU A 1 239 ? 159.551 184.163 222.561 1.00 75.69  0  239 GLU A CG  1 
ATOM   1542  C  CD  . GLU A 1 239 ? 161.050 184.362 222.445 1.00 75.69  0  239 GLU A CD  1 
ATOM   1543  O  OE1 . GLU A 1 239 ? 161.798 183.712 223.204 1.00 75.69  0  239 GLU A OE1 1 
ATOM   1544  O  OE2 . GLU A 1 239 ? 161.478 185.172 221.596 1.00 75.69  -1 239 GLU A OE2 1 
ATOM   1545  N  N   . VAL A 1 240 ? 156.344 183.142 221.800 1.00 69.42  0  240 VAL A N   1 
ATOM   1546  C  CA  . VAL A 1 240 ? 155.746 182.702 220.545 1.00 69.42  0  240 VAL A CA  1 
ATOM   1547  C  C   . VAL A 1 240 ? 156.736 182.967 219.421 1.00 69.42  0  240 VAL A C   1 
ATOM   1548  O  O   . VAL A 1 240 ? 157.235 184.088 219.277 1.00 69.42  0  240 VAL A O   1 
ATOM   1549  C  CB  . VAL A 1 240 ? 154.412 183.422 220.294 1.00 69.42  0  240 VAL A CB  1 
ATOM   1550  C  CG1 . VAL A 1 240 ? 153.806 182.978 218.977 1.00 69.42  0  240 VAL A CG1 1 
ATOM   1551  C  CG2 . VAL A 1 240 ? 153.452 183.157 221.440 1.00 69.42  0  240 VAL A CG2 1 
ATOM   1552  N  N   . ARG A 1 241 ? 157.020 181.942 218.622 1.00 68.63  0  241 ARG A N   1 
ATOM   1553  C  CA  . ARG A 1 241 ? 158.038 182.014 217.583 1.00 68.63  0  241 ARG A CA  1 
ATOM   1554  C  C   . ARG A 1 241 ? 157.398 181.760 216.226 1.00 68.63  0  241 ARG A C   1 
ATOM   1555  O  O   . ARG A 1 241 ? 156.758 180.723 216.015 1.00 68.63  0  241 ARG A O   1 
ATOM   1556  C  CB  . ARG A 1 241 ? 159.157 181.004 217.841 1.00 68.63  0  241 ARG A CB  1 
ATOM   1557  C  CG  . ARG A 1 241 ? 159.851 181.163 219.180 1.00 68.63  0  241 ARG A CG  1 
ATOM   1558  C  CD  . ARG A 1 241 ? 160.746 182.388 219.192 1.00 68.63  0  241 ARG A CD  1 
ATOM   1559  N  NE  . ARG A 1 241 ? 161.788 182.311 218.173 1.00 68.63  0  241 ARG A NE  1 
ATOM   1560  C  CZ  . ARG A 1 241 ? 162.979 181.752 218.362 1.00 68.63  0  241 ARG A CZ  1 
ATOM   1561  N  NH1 . ARG A 1 241 ? 163.283 181.216 219.536 1.00 68.63  1  241 ARG A NH1 1 
ATOM   1562  N  NH2 . ARG A 1 241 ? 163.865 181.729 217.377 1.00 68.63  0  241 ARG A NH2 1 
ATOM   1563  N  N   . TYR A 1 242 ? 157.574 182.717 215.314 1.00 67.78  0  242 TYR A N   1 
ATOM   1564  C  CA  . TYR A 1 242 ? 157.224 182.571 213.911 1.00 67.78  0  242 TYR A CA  1 
ATOM   1565  C  C   . TYR A 1 242 ? 158.451 182.563 213.009 1.00 67.78  0  242 TYR A C   1 
ATOM   1566  O  O   . TYR A 1 242 ? 158.321 182.310 211.807 1.00 67.78  0  242 TYR A O   1 
ATOM   1567  C  CB  . TYR A 1 242 ? 156.270 183.704 213.492 1.00 67.78  0  242 TYR A CB  1 
ATOM   1568  C  CG  . TYR A 1 242 ? 155.526 183.475 212.194 1.00 67.78  0  242 TYR A CG  1 
ATOM   1569  C  CD1 . TYR A 1 242 ? 154.937 182.249 211.914 1.00 67.78  0  242 TYR A CD1 1 
ATOM   1570  C  CD2 . TYR A 1 242 ? 155.411 184.490 211.252 1.00 67.78  0  242 TYR A CD2 1 
ATOM   1571  C  CE1 . TYR A 1 242 ? 154.256 182.037 210.729 1.00 67.78  0  242 TYR A CE1 1 
ATOM   1572  C  CE2 . TYR A 1 242 ? 154.731 184.289 210.065 1.00 67.78  0  242 TYR A CE2 1 
ATOM   1573  C  CZ  . TYR A 1 242 ? 154.157 183.061 209.809 1.00 67.78  0  242 TYR A CZ  1 
ATOM   1574  O  OH  . TYR A 1 242 ? 153.480 182.857 208.629 1.00 67.78  0  242 TYR A OH  1 
ATOM   1575  N  N   . ASP A 1 243 ? 159.641 182.804 213.566 1.00 69.80  0  243 ASP A N   1 
ATOM   1576  C  CA  . ASP A 1 243 ? 160.884 182.897 212.810 1.00 69.80  0  243 ASP A CA  1 
ATOM   1577  C  C   . ASP A 1 243 ? 161.584 181.554 212.650 1.00 69.80  0  243 ASP A C   1 
ATOM   1578  O  O   . ASP A 1 243 ? 162.809 181.518 212.469 1.00 69.80  0  243 ASP A O   1 
ATOM   1579  C  CB  . ASP A 1 243 ? 161.827 183.894 213.484 1.00 69.80  0  243 ASP A CB  1 
ATOM   1580  C  CG  . ASP A 1 243 ? 162.112 183.539 214.928 1.00 69.80  0  243 ASP A CG  1 
ATOM   1581  O  OD1 . ASP A 1 243 ? 161.249 182.903 215.566 1.00 69.80  0  243 ASP A OD1 1 
ATOM   1582  O  OD2 . ASP A 1 243 ? 163.201 183.895 215.425 1.00 69.80  -1 243 ASP A OD2 1 
ATOM   1583  N  N   . LEU A 1 244 ? 160.850 180.447 212.711 1.00 70.02  0  244 LEU A N   1 
ATOM   1584  C  CA  . LEU A 1 244 ? 161.447 179.117 212.760 1.00 70.02  0  244 LEU A CA  1 
ATOM   1585  C  C   . LEU A 1 244 ? 161.056 178.330 211.517 1.00 70.02  0  244 LEU A C   1 
ATOM   1586  O  O   . LEU A 1 244 ? 159.897 177.931 211.365 1.00 70.02  0  244 LEU A O   1 
ATOM   1587  C  CB  . LEU A 1 244 ? 161.019 178.387 214.030 1.00 70.02  0  244 LEU A CB  1 
ATOM   1588  C  CG  . LEU A 1 244 ? 161.593 178.974 215.319 1.00 70.02  0  244 LEU A CG  1 
ATOM   1589  C  CD1 . LEU A 1 244 ? 161.176 178.138 216.504 1.00 70.02  0  244 LEU A CD1 1 
ATOM   1590  C  CD2 . LEU A 1 244 ? 163.109 179.075 215.242 1.00 70.02  0  244 LEU A CD2 1 
ATOM   1591  N  N   . LEU A 1 245 ? 162.026 178.111 210.635 1.00 69.92  0  245 LEU A N   1 
ATOM   1592  C  CA  . LEU A 1 245 ? 161.851 177.214 209.503 1.00 69.92  0  245 LEU A CA  1 
ATOM   1593  C  C   . LEU A 1 245 ? 162.049 175.775 209.963 1.00 69.92  0  245 LEU A C   1 
ATOM   1594  O  O   . LEU A 1 245 ? 163.027 175.464 210.651 1.00 69.92  0  245 LEU A O   1 
ATOM   1595  C  CB  . LEU A 1 245 ? 162.841 177.563 208.392 1.00 69.92  0  245 LEU A CB  1 
ATOM   1596  C  CG  . LEU A 1 245 ? 162.971 176.575 207.232 1.00 69.92  0  245 LEU A CG  1 
ATOM   1597  C  CD1 . LEU A 1 245 ? 161.743 176.632 206.339 1.00 69.92  0  245 LEU A CD1 1 
ATOM   1598  C  CD2 . LEU A 1 245 ? 164.232 176.857 206.434 1.00 69.92  0  245 LEU A CD2 1 
ATOM   1599  N  N   . ASP A 1 246 ? 161.114 174.906 209.589 1.00 78.77  0  246 ASP A N   1 
ATOM   1600  C  CA  . ASP A 1 246 ? 161.174 173.506 209.981 1.00 78.77  0  246 ASP A CA  1 
ATOM   1601  C  C   . ASP A 1 246 ? 162.050 172.723 209.012 1.00 78.77  0  246 ASP A C   1 
ATOM   1602  O  O   . ASP A 1 246 ? 161.861 172.790 207.794 1.00 78.77  0  246 ASP A O   1 
ATOM   1603  C  CB  . ASP A 1 246 ? 159.770 172.906 210.025 1.00 78.77  0  246 ASP A CB  1 
ATOM   1604  C  CG  . ASP A 1 246 ? 159.688 171.681 210.911 1.00 78.77  0  246 ASP A CG  1 
ATOM   1605  O  OD1 . ASP A 1 246 ? 160.697 171.352 211.569 1.00 78.77  0  246 ASP A OD1 1 
ATOM   1606  O  OD2 . ASP A 1 246 ? 158.614 171.046 210.947 1.00 78.77  -1 246 ASP A OD2 1 
ATOM   1607  N  N   . CYS A 1 247 ? 163.009 171.977 209.559 1.00 78.08  0  247 CYS A N   1 
ATOM   1608  C  CA  . CYS A 1 247 ? 163.911 171.161 208.762 1.00 78.08  0  247 CYS A CA  1 
ATOM   1609  C  C   . CYS A 1 247 ? 163.624 169.668 208.850 1.00 78.08  0  247 CYS A C   1 
ATOM   1610  O  O   . CYS A 1 247 ? 164.210 168.905 208.072 1.00 78.08  0  247 CYS A O   1 
ATOM   1611  C  CB  . CYS A 1 247 ? 165.365 171.430 209.175 1.00 78.08  0  247 CYS A CB  1 
ATOM   1612  S  SG  . CYS A 1 247 ? 165.717 171.089 210.912 1.00 78.08  0  247 CYS A SG  1 
ATOM   1613  N  N   . HIS A 1 248 ? 162.748 169.247 209.775 1.00 77.36  0  248 HIS A N   1 
ATOM   1614  C  CA  . HIS A 1 248 ? 162.282 167.860 209.930 1.00 77.36  0  248 HIS A CA  1 
ATOM   1615  C  C   . HIS A 1 248 ? 163.430 166.889 210.209 1.00 77.36  0  248 HIS A C   1 
ATOM   1616  O  O   . HIS A 1 248 ? 163.466 165.776 209.681 1.00 77.36  0  248 HIS A O   1 
ATOM   1617  C  CB  . HIS A 1 248 ? 161.463 167.397 208.719 1.00 77.36  0  248 HIS A CB  1 
ATOM   1618  C  CG  . HIS A 1 248 ? 160.143 168.089 208.578 1.00 77.36  0  248 HIS A CG  1 
ATOM   1619  N  ND1 . HIS A 1 248 ? 158.941 167.416 208.620 1.00 77.36  0  248 HIS A ND1 1 
ATOM   1620  C  CD2 . HIS A 1 248 ? 159.835 169.394 208.389 1.00 77.36  0  248 HIS A CD2 1 
ATOM   1621  C  CE1 . HIS A 1 248 ? 157.951 168.276 208.463 1.00 77.36  0  248 HIS A CE1 1 
ATOM   1622  N  NE2 . HIS A 1 248 ? 158.466 169.484 208.321 1.00 77.36  0  248 HIS A NE2 1 
ATOM   1623  N  N   . ILE A 1 249 ? 164.376 167.312 211.046 1.00 72.58  0  249 ILE A N   1 
ATOM   1624  C  CA  . ILE A 1 249 ? 165.476 166.460 211.486 1.00 72.58  0  249 ILE A CA  1 
ATOM   1625  C  C   . ILE A 1 249 ? 165.320 166.281 212.991 1.00 72.58  0  249 ILE A C   1 
ATOM   1626  O  O   . ILE A 1 249 ? 166.304 166.278 213.739 1.00 72.58  0  249 ILE A O   1 
ATOM   1627  C  CB  . ILE A 1 249 ? 166.855 167.045 211.123 1.00 72.58  0  249 ILE A CB  1 
ATOM   1628  C  CG1 . ILE A 1 249 ? 166.805 167.745 209.773 1.00 72.58  0  249 ILE A CG1 1 
ATOM   1629  C  CG2 . ILE A 1 249 ? 167.894 165.939 210.983 1.00 72.58  0  249 ILE A CG2 1 
ATOM   1630  C  CD1 . ILE A 1 249 ? 168.019 168.574 209.499 1.00 72.58  0  249 ILE A CD1 1 
ATOM   1631  N  N   . SER A 1 250 ? 164.074 166.182 213.444 1.00 74.70  0  250 SER A N   1 
ATOM   1632  C  CA  . SER A 1 250 ? 163.757 166.113 214.868 1.00 74.70  0  250 SER A CA  1 
ATOM   1633  C  C   . SER A 1 250 ? 164.278 164.805 215.449 1.00 74.70  0  250 SER A C   1 
ATOM   1634  O  O   . SER A 1 250 ? 163.698 163.739 215.235 1.00 74.70  0  250 SER A O   1 
ATOM   1635  C  CB  . SER A 1 250 ? 162.253 166.239 215.073 1.00 74.70  0  250 SER A CB  1 
ATOM   1636  O  OG  . SER A 1 250 ? 161.609 164.990 214.897 1.00 74.70  0  250 SER A OG  1 
ATOM   1637  N  N   . ILE A 1 251 ? 165.394 164.887 216.179 1.00 75.05  0  251 ILE A N   1 
ATOM   1638  C  CA  . ILE A 1 251 ? 165.916 163.724 216.882 1.00 75.05  0  251 ILE A CA  1 
ATOM   1639  C  C   . ILE A 1 251 ? 165.000 163.393 218.053 1.00 75.05  0  251 ILE A C   1 
ATOM   1640  O  O   . ILE A 1 251 ? 164.302 164.262 218.595 1.00 75.05  0  251 ILE A O   1 
ATOM   1641  C  CB  . ILE A 1 251 ? 167.364 163.961 217.349 1.00 75.05  0  251 ILE A CB  1 
ATOM   1642  C  CG1 . ILE A 1 251 ? 167.444 165.176 218.273 1.00 75.05  0  251 ILE A CG1 1 
ATOM   1643  C  CG2 . ILE A 1 251 ? 168.286 164.144 216.155 1.00 75.05  0  251 ILE A CG2 1 
ATOM   1644  C  CD1 . ILE A 1 251 ? 168.834 165.454 218.802 1.00 75.05  0  251 ILE A CD1 1 
ATOM   1645  N  N   . CYS A 1 252 ? 164.996 162.124 218.449 1.00 78.39  0  252 CYS A N   1 
ATOM   1646  C  CA  . CYS A 1 252 ? 163.966 161.650 219.358 1.00 78.39  0  252 CYS A CA  1 
ATOM   1647  C  C   . CYS A 1 252 ? 164.434 160.392 220.071 1.00 78.39  0  252 CYS A C   1 
ATOM   1648  O  O   . CYS A 1 252 ? 165.389 159.731 219.656 1.00 78.39  0  252 CYS A O   1 
ATOM   1649  C  CB  . CYS A 1 252 ? 162.658 161.390 218.606 1.00 78.39  0  252 CYS A CB  1 
ATOM   1650  S  SG  . CYS A 1 252 ? 162.835 160.221 217.246 1.00 78.39  0  252 CYS A SG  1 
ATOM   1651  N  N   . SER A 1 253 ? 163.740 160.079 221.157 1.00 80.95  0  253 SER A N   1 
ATOM   1652  C  CA  . SER A 1 253 ? 163.926 158.841 221.886 1.00 80.95  0  253 SER A CA  1 
ATOM   1653  C  C   . SER A 1 253 ? 163.266 157.697 221.126 1.00 80.95  0  253 SER A C   1 
ATOM   1654  O  O   . SER A 1 253 ? 162.431 157.929 220.250 1.00 80.95  0  253 SER A O   1 
ATOM   1655  C  CB  . SER A 1 253 ? 163.310 158.968 223.277 1.00 80.95  0  253 SER A CB  1 
ATOM   1656  O  OG  . SER A 1 253 ? 164.165 159.676 224.149 1.00 80.95  0  253 SER A OG  1 
ATOM   1657  N  N   . PRO A 1 254 ? 163.609 156.442 221.443 1.00 82.02  0  254 PRO A N   1 
ATOM   1658  C  CA  . PRO A 1 254 ? 162.827 155.315 220.908 1.00 82.02  0  254 PRO A CA  1 
ATOM   1659  C  C   . PRO A 1 254 ? 161.418 155.196 221.482 1.00 82.02  0  254 PRO A C   1 
ATOM   1660  O  O   . PRO A 1 254 ? 160.670 154.313 221.047 1.00 82.02  0  254 PRO A O   1 
ATOM   1661  C  CB  . PRO A 1 254 ? 163.677 154.088 221.282 1.00 82.02  0  254 PRO A CB  1 
ATOM   1662  C  CG  . PRO A 1 254 ? 164.598 154.561 222.355 1.00 82.02  0  254 PRO A CG  1 
ATOM   1663  C  CD  . PRO A 1 254 ? 164.885 155.983 222.020 1.00 82.02  0  254 PRO A CD  1 
ATOM   1664  N  N   . GLN A 1 255 ? 161.031 156.047 222.437 1.00 85.91  0  255 GLN A N   1 
ATOM   1665  C  CA  . GLN A 1 255 ? 159.684 156.020 222.989 1.00 85.91  0  255 GLN A CA  1 
ATOM   1666  C  C   . GLN A 1 255 ? 158.642 156.586 222.031 1.00 85.91  0  255 GLN A C   1 
ATOM   1667  O  O   . GLN A 1 255 ? 157.446 156.356 222.242 1.00 85.91  0  255 GLN A O   1 
ATOM   1668  C  CB  . GLN A 1 255 ? 159.642 156.794 224.306 1.00 85.91  0  255 GLN A CB  1 
ATOM   1669  C  CG  . GLN A 1 255 ? 160.675 156.350 225.326 1.00 85.91  0  255 GLN A CG  1 
ATOM   1670  C  CD  . GLN A 1 255 ? 160.607 157.157 226.606 1.00 85.91  0  255 GLN A CD  1 
ATOM   1671  O  OE1 . GLN A 1 255 ? 159.571 157.736 226.933 1.00 85.91  0  255 GLN A OE1 1 
ATOM   1672  N  NE2 . GLN A 1 255 ? 161.714 157.202 227.338 1.00 85.91  0  255 GLN A NE2 1 
ATOM   1673  N  N   . VAL A 1 256 ? 159.055 157.330 220.997 1.00 87.33  0  256 VAL A N   1 
ATOM   1674  C  CA  . VAL A 1 256 ? 158.081 157.803 220.016 1.00 87.33  0  256 VAL A CA  1 
ATOM   1675  C  C   . VAL A 1 256 ? 157.555 156.640 219.183 1.00 87.33  0  256 VAL A C   1 
ATOM   1676  O  O   . VAL A 1 256 ? 156.399 156.659 218.747 1.00 87.33  0  256 VAL A O   1 
ATOM   1677  C  CB  . VAL A 1 256 ? 158.658 158.926 219.125 1.00 87.33  0  256 VAL A CB  1 
ATOM   1678  C  CG1 . VAL A 1 256 ? 159.075 160.113 219.964 1.00 87.33  0  256 VAL A CG1 1 
ATOM   1679  C  CG2 . VAL A 1 256 ? 159.823 158.443 218.278 1.00 87.33  0  256 VAL A CG2 1 
ATOM   1680  N  N   . ALA A 1 257 ? 158.360 155.590 218.997 1.00 92.86  0  257 ALA A N   1 
ATOM   1681  C  CA  . ALA A 1 257 ? 157.869 154.398 218.318 1.00 92.86  0  257 ALA A CA  1 
ATOM   1682  C  C   . ALA A 1 257 ? 156.863 153.658 219.188 1.00 92.86  0  257 ALA A C   1 
ATOM   1683  O  O   . ALA A 1 257 ? 155.867 153.127 218.680 1.00 92.86  0  257 ALA A O   1 
ATOM   1684  C  CB  . ALA A 1 257 ? 159.042 153.494 217.944 1.00 92.86  0  257 ALA A CB  1 
ATOM   1685  N  N   . GLN A 1 258 ? 157.084 153.659 220.506 1.00 97.60  0  258 GLN A N   1 
ATOM   1686  C  CA  . GLN A 1 258 ? 156.108 153.099 221.435 1.00 97.60  0  258 GLN A CA  1 
ATOM   1687  C  C   . GLN A 1 258 ? 154.809 153.895 221.417 1.00 97.60  0  258 GLN A C   1 
ATOM   1688  O  O   . GLN A 1 258 ? 153.718 153.314 221.403 1.00 97.60  0  258 GLN A O   1 
ATOM   1689  C  CB  . GLN A 1 258 ? 156.693 153.067 222.847 1.00 97.60  0  258 GLN A CB  1 
ATOM   1690  C  CG  . GLN A 1 258 ? 158.104 152.508 222.927 1.00 97.60  0  258 GLN A CG  1 
ATOM   1691  C  CD  . GLN A 1 258 ? 158.135 150.994 222.943 1.00 97.60  0  258 GLN A CD  1 
ATOM   1692  O  OE1 . GLN A 1 258 ? 157.129 150.345 223.226 1.00 97.60  0  258 GLN A OE1 1 
ATOM   1693  N  NE2 . GLN A 1 258 ? 159.294 150.422 222.637 1.00 97.60  0  258 GLN A NE2 1 
ATOM   1694  N  N   . LEU A 1 259 ? 154.909 155.229 221.386 1.00 93.66  0  259 LEU A N   1 
ATOM   1695  C  CA  . LEU A 1 259 ? 153.717 156.071 221.334 1.00 93.66  0  259 LEU A CA  1 
ATOM   1696  C  C   . LEU A 1 259 ? 152.995 155.957 219.997 1.00 93.66  0  259 LEU A C   1 
ATOM   1697  O  O   . LEU A 1 259 ? 151.779 156.174 219.932 1.00 93.66  0  259 LEU A O   1 
ATOM   1698  C  CB  . LEU A 1 259 ? 154.089 157.529 221.608 1.00 93.66  0  259 LEU A CB  1 
ATOM   1699  C  CG  . LEU A 1 259 ? 154.555 157.883 223.023 1.00 93.66  0  259 LEU A CG  1 
ATOM   1700  C  CD1 . LEU A 1 259 ? 154.610 159.391 223.205 1.00 93.66  0  259 LEU A CD1 1 
ATOM   1701  C  CD2 . LEU A 1 259 ? 153.652 157.253 224.072 1.00 93.66  0  259 LEU A CD2 1 
ATOM   1702  N  N   . PHE A 1 260 ? 153.717 155.622 218.927 1.00 93.49  0  260 PHE A N   1 
ATOM   1703  C  CA  . PHE A 1 260 ? 153.065 155.382 217.647 1.00 93.49  0  260 PHE A CA  1 
ATOM   1704  C  C   . PHE A 1 260 ? 152.417 154.005 217.589 1.00 93.49  0  260 PHE A C   1 
ATOM   1705  O  O   . PHE A 1 260 ? 151.423 153.824 216.876 1.00 93.49  0  260 PHE A O   1 
ATOM   1706  C  CB  . PHE A 1 260 ? 154.070 155.547 216.506 1.00 93.49  0  260 PHE A CB  1 
ATOM   1707  C  CG  . PHE A 1 260 ? 154.060 156.916 215.884 1.00 93.49  0  260 PHE A CG  1 
ATOM   1708  C  CD1 . PHE A 1 260 ? 152.984 157.338 215.121 1.00 93.49  0  260 PHE A CD1 1 
ATOM   1709  C  CD2 . PHE A 1 260 ? 155.129 157.780 216.061 1.00 93.49  0  260 PHE A CD2 1 
ATOM   1710  C  CE1 . PHE A 1 260 ? 152.979 158.596 214.541 1.00 93.49  0  260 PHE A CE1 1 
ATOM   1711  C  CE2 . PHE A 1 260 ? 155.126 159.040 215.491 1.00 93.49  0  260 PHE A CE2 1 
ATOM   1712  C  CZ  . PHE A 1 260 ? 154.050 159.447 214.729 1.00 93.49  0  260 PHE A CZ  1 
ATOM   1713  N  N   . THR A 1 261 ? 152.958 153.024 218.318 1.00 98.60  0  261 THR A N   1 
ATOM   1714  C  CA  . THR A 1 261 ? 152.258 151.747 218.436 1.00 98.60  0  261 THR A CA  1 
ATOM   1715  C  C   . THR A 1 261 ? 151.031 151.848 219.333 1.00 98.60  0  261 THR A C   1 
ATOM   1716  O  O   . THR A 1 261 ? 150.055 151.122 219.116 1.00 98.60  0  261 THR A O   1 
ATOM   1717  C  CB  . THR A 1 261 ? 153.188 150.646 218.952 1.00 98.60  0  261 THR A CB  1 
ATOM   1718  O  OG1 . THR A 1 261 ? 153.704 151.004 220.240 1.00 98.60  0  261 THR A OG1 1 
ATOM   1719  C  CG2 . THR A 1 261 ? 154.307 150.359 217.966 1.00 98.60  0  261 THR A CG2 1 
ATOM   1720  N  N   . ASP A 1 262 ? 151.056 152.715 220.349 1.00 101.90 0  262 ASP A N   1 
ATOM   1721  C  CA  . ASP A 1 262 ? 149.863 152.896 221.174 1.00 101.90 0  262 ASP A CA  1 
ATOM   1722  C  C   . ASP A 1 262 ? 148.777 153.643 220.411 1.00 101.90 0  262 ASP A C   1 
ATOM   1723  O  O   . ASP A 1 262 ? 147.645 153.161 220.289 1.00 101.90 0  262 ASP A O   1 
ATOM   1724  C  CB  . ASP A 1 262 ? 150.205 153.625 222.474 1.00 101.90 0  262 ASP A CB  1 
ATOM   1725  C  CG  . ASP A 1 262 ? 151.304 152.943 223.252 1.00 101.90 0  262 ASP A CG  1 
ATOM   1726  O  OD1 . ASP A 1 262 ? 151.401 151.701 223.175 1.00 101.90 0  262 ASP A OD1 1 
ATOM   1727  O  OD2 . ASP A 1 262 ? 152.073 153.648 223.941 1.00 101.90 -1 262 ASP A OD2 1 
ATOM   1728  N  N   . ASN A 1 263 ? 149.101 154.822 219.889 1.00 99.17  0  263 ASN A N   1 
ATOM   1729  C  CA  . ASN A 1 263 ? 148.127 155.642 219.173 1.00 99.17  0  263 ASN A CA  1 
ATOM   1730  C  C   . ASN A 1 263 ? 148.242 155.336 217.686 1.00 99.17  0  263 ASN A C   1 
ATOM   1731  O  O   . ASN A 1 263 ? 149.179 155.779 217.017 1.00 99.17  0  263 ASN A O   1 
ATOM   1732  C  CB  . ASN A 1 263 ? 148.354 157.121 219.460 1.00 99.17  0  263 ASN A CB  1 
ATOM   1733  C  CG  . ASN A 1 263 ? 148.586 157.399 220.929 1.00 99.17  0  263 ASN A CG  1 
ATOM   1734  O  OD1 . ASN A 1 263 ? 149.625 157.936 221.313 1.00 99.17  0  263 ASN A OD1 1 
ATOM   1735  N  ND2 . ASN A 1 263 ? 147.617 157.038 221.761 1.00 99.17  0  263 ASN A ND2 1 
ATOM   1736  N  N   . PHE A 1 264 ? 147.282 154.572 217.165 1.00 104.47 0  264 PHE A N   1 
ATOM   1737  C  CA  . PHE A 1 264 ? 147.250 154.263 215.742 1.00 104.47 0  264 PHE A CA  1 
ATOM   1738  C  C   . PHE A 1 264 ? 146.719 155.418 214.905 1.00 104.47 0  264 PHE A C   1 
ATOM   1739  O  O   . PHE A 1 264 ? 146.940 155.439 213.690 1.00 104.47 0  264 PHE A O   1 
ATOM   1740  C  CB  . PHE A 1 264 ? 146.394 153.019 215.493 1.00 104.47 0  264 PHE A CB  1 
ATOM   1741  C  CG  . PHE A 1 264 ? 146.910 151.781 216.168 1.00 104.47 0  264 PHE A CG  1 
ATOM   1742  C  CD1 . PHE A 1 264 ? 147.898 151.012 215.571 1.00 104.47 0  264 PHE A CD1 1 
ATOM   1743  C  CD2 . PHE A 1 264 ? 146.410 151.387 217.400 1.00 104.47 0  264 PHE A CD2 1 
ATOM   1744  C  CE1 . PHE A 1 264 ? 148.376 149.869 216.189 1.00 104.47 0  264 PHE A CE1 1 
ATOM   1745  C  CE2 . PHE A 1 264 ? 146.882 150.245 218.025 1.00 104.47 0  264 PHE A CE2 1 
ATOM   1746  C  CZ  . PHE A 1 264 ? 147.866 149.485 217.416 1.00 104.47 0  264 PHE A CZ  1 
ATOM   1747  N  N   . ASP A 1 265 ? 146.026 156.373 215.526 1.00 105.56 0  265 ASP A N   1 
ATOM   1748  C  CA  . ASP A 1 265 ? 145.447 157.490 214.792 1.00 105.56 0  265 ASP A CA  1 
ATOM   1749  C  C   . ASP A 1 265 ? 146.480 158.532 214.392 1.00 105.56 0  265 ASP A C   1 
ATOM   1750  O  O   . ASP A 1 265 ? 146.211 159.333 213.490 1.00 105.56 0  265 ASP A O   1 
ATOM   1751  C  CB  . ASP A 1 265 ? 144.350 158.154 215.624 1.00 105.56 0  265 ASP A CB  1 
ATOM   1752  C  CG  . ASP A 1 265 ? 144.838 158.580 216.991 1.00 105.56 0  265 ASP A CG  1 
ATOM   1753  O  OD1 . ASP A 1 265 ? 145.611 157.820 217.611 1.00 105.56 0  265 ASP A OD1 1 
ATOM   1754  O  OD2 . ASP A 1 265 ? 144.459 159.680 217.442 1.00 105.56 -1 265 ASP A OD2 1 
ATOM   1755  N  N   . TYR A 1 266 ? 147.643 158.549 215.042 1.00 97.87  0  266 TYR A N   1 
ATOM   1756  C  CA  . TYR A 1 266 ? 148.705 159.485 214.682 1.00 97.87  0  266 TYR A CA  1 
ATOM   1757  C  C   . TYR A 1 266 ? 149.314 159.047 213.357 1.00 97.87  0  266 TYR A C   1 
ATOM   1758  O  O   . TYR A 1 266 ? 150.011 158.030 213.289 1.00 97.87  0  266 TYR A O   1 
ATOM   1759  C  CB  . TYR A 1 266 ? 149.764 159.544 215.778 1.00 97.87  0  266 TYR A CB  1 
ATOM   1760  C  CG  . TYR A 1 266 ? 149.320 160.197 217.070 1.00 97.87  0  266 TYR A CG  1 
ATOM   1761  C  CD1 . TYR A 1 266 ? 148.175 160.986 217.126 1.00 97.87  0  266 TYR A CD1 1 
ATOM   1762  C  CD2 . TYR A 1 266 ? 150.057 160.027 218.236 1.00 97.87  0  266 TYR A CD2 1 
ATOM   1763  C  CE1 . TYR A 1 266 ? 147.772 161.578 218.311 1.00 97.87  0  266 TYR A CE1 1 
ATOM   1764  C  CE2 . TYR A 1 266 ? 149.663 160.614 219.424 1.00 97.87  0  266 TYR A CE2 1 
ATOM   1765  C  CZ  . TYR A 1 266 ? 148.522 161.388 219.455 1.00 97.87  0  266 TYR A CZ  1 
ATOM   1766  O  OH  . TYR A 1 266 ? 148.131 161.973 220.637 1.00 97.87  0  266 TYR A OH  1 
ATOM   1767  N  N   . GLN A 1 267 ? 149.052 159.815 212.303 1.00 95.95  0  267 GLN A N   1 
ATOM   1768  C  CA  . GLN A 1 267 ? 149.457 159.434 210.956 1.00 95.95  0  267 GLN A CA  1 
ATOM   1769  C  C   . GLN A 1 267 ? 150.882 159.861 210.625 1.00 95.95  0  267 GLN A C   1 
ATOM   1770  O  O   . GLN A 1 267 ? 151.645 159.072 210.058 1.00 95.95  0  267 GLN A O   1 
ATOM   1771  C  CB  . GLN A 1 267 ? 148.486 160.026 209.931 1.00 95.95  0  267 GLN A CB  1 
ATOM   1772  C  CG  . GLN A 1 267 ? 148.506 159.321 208.587 1.00 95.95  0  267 GLN A CG  1 
ATOM   1773  C  CD  . GLN A 1 267 ? 147.776 157.992 208.625 1.00 95.95  0  267 GLN A CD  1 
ATOM   1774  O  OE1 . GLN A 1 267 ? 148.394 156.929 208.596 1.00 95.95  0  267 GLN A OE1 1 
ATOM   1775  N  NE2 . GLN A 1 267 ? 146.451 158.047 208.688 1.00 95.95  0  267 GLN A NE2 1 
ATOM   1776  N  N   . THR A 1 268 ? 151.265 161.084 210.976 1.00 89.78  0  268 THR A N   1 
ATOM   1777  C  CA  . THR A 1 268 ? 152.566 161.650 210.610 1.00 89.78  0  268 THR A CA  1 
ATOM   1778  C  C   . THR A 1 268 ? 153.113 162.378 211.832 1.00 89.78  0  268 THR A C   1 
ATOM   1779  O  O   . THR A 1 268 ? 152.730 162.102 212.973 1.00 89.78  0  268 THR A O   1 
ATOM   1780  C  CB  . THR A 1 268 ? 152.492 162.625 209.412 1.00 89.78  0  268 THR A CB  1 
ATOM   1781  O  OG1 . THR A 1 268 ? 151.892 163.859 209.831 1.00 89.78  0  268 THR A OG1 1 
ATOM   1782  C  CG2 . THR A 1 268 ? 151.750 162.067 208.188 1.00 89.78  0  268 THR A CG2 1 
ATOM   1783  N  N   . ARG A 1 269 ? 154.071 163.276 211.604 1.00 84.17  0  269 ARG A N   1 
ATOM   1784  C  CA  . ARG A 1 269 ? 154.770 163.914 212.714 1.00 84.17  0  269 ARG A CA  1 
ATOM   1785  C  C   . ARG A 1 269 ? 153.933 165.015 213.357 1.00 84.17  0  269 ARG A C   1 
ATOM   1786  O  O   . ARG A 1 269 ? 153.881 165.115 214.590 1.00 84.17  0  269 ARG A O   1 
ATOM   1787  C  CB  . ARG A 1 269 ? 156.111 164.471 212.234 1.00 84.17  0  269 ARG A CB  1 
ATOM   1788  C  CG  . ARG A 1 269 ? 157.070 164.828 213.357 1.00 84.17  0  269 ARG A CG  1 
ATOM   1789  C  CD  . ARG A 1 269 ? 158.419 165.261 212.808 1.00 84.17  0  269 ARG A CD  1 
ATOM   1790  N  NE  . ARG A 1 269 ? 158.316 166.472 212.002 1.00 84.17  0  269 ARG A NE  1 
ATOM   1791  C  CZ  . ARG A 1 269 ? 158.538 167.697 212.465 1.00 84.17  0  269 ARG A CZ  1 
ATOM   1792  N  NH1 . ARG A 1 269 ? 158.882 167.876 213.732 1.00 84.17  1  269 ARG A NH1 1 
ATOM   1793  N  NH2 . ARG A 1 269 ? 158.420 168.744 211.661 1.00 84.17  0  269 ARG A NH2 1 
ATOM   1794  N  N   . ASP A 1 270 ? 153.269 165.842 212.541 1.00 90.61  0  270 ASP A N   1 
ATOM   1795  C  CA  . ASP A 1 270 ? 152.675 167.070 213.062 1.00 90.61  0  270 ASP A CA  1 
ATOM   1796  C  C   . ASP A 1 270 ? 151.411 166.801 213.873 1.00 90.61  0  270 ASP A C   1 
ATOM   1797  O  O   . ASP A 1 270 ? 151.194 167.432 214.913 1.00 90.61  0  270 ASP A O   1 
ATOM   1798  C  CB  . ASP A 1 270 ? 152.436 168.065 211.912 1.00 90.61  0  270 ASP A CB  1 
ATOM   1799  C  CG  . ASP A 1 270 ? 151.481 167.548 210.814 1.00 90.61  0  270 ASP A CG  1 
ATOM   1800  O  OD1 . ASP A 1 270 ? 151.822 167.760 209.632 1.00 90.61  0  270 ASP A OD1 1 
ATOM   1801  O  OD2 . ASP A 1 270 ? 150.395 166.988 211.080 1.00 90.61  -1 270 ASP A OD2 1 
ATOM   1802  N  N   . ASP A 1 271 ? 150.581 165.848 213.439 1.00 93.14  0  271 ASP A N   1 
ATOM   1803  C  CA  . ASP A 1 271 ? 149.422 165.487 214.250 1.00 93.14  0  271 ASP A CA  1 
ATOM   1804  C  C   . ASP A 1 271 ? 149.830 164.695 215.487 1.00 93.14  0  271 ASP A C   1 
ATOM   1805  O  O   . ASP A 1 271 ? 149.136 164.752 216.507 1.00 93.14  0  271 ASP A O   1 
ATOM   1806  C  CB  . ASP A 1 271 ? 148.384 164.730 213.415 1.00 93.14  0  271 ASP A CB  1 
ATOM   1807  C  CG  . ASP A 1 271 ? 148.946 163.497 212.737 1.00 93.14  0  271 ASP A CG  1 
ATOM   1808  O  OD1 . ASP A 1 271 ? 150.173 163.299 212.762 1.00 93.14  0  271 ASP A OD1 1 
ATOM   1809  O  OD2 . ASP A 1 271 ? 148.148 162.717 212.176 1.00 93.14  -1 271 ASP A OD2 1 
ATOM   1810  N  N   . PHE A 1 272 ? 150.970 163.995 215.432 1.00 87.82  0  272 PHE A N   1 
ATOM   1811  C  CA  . PHE A 1 272 ? 151.519 163.363 216.630 1.00 87.82  0  272 PHE A CA  1 
ATOM   1812  C  C   . PHE A 1 272 ? 151.939 164.402 217.662 1.00 87.82  0  272 PHE A C   1 
ATOM   1813  O  O   . PHE A 1 272 ? 151.653 164.247 218.855 1.00 87.82  0  272 PHE A O   1 
ATOM   1814  C  CB  . PHE A 1 272 ? 152.702 162.466 216.256 1.00 87.82  0  272 PHE A CB  1 
ATOM   1815  C  CG  . PHE A 1 272 ? 153.667 162.216 217.386 1.00 87.82  0  272 PHE A CG  1 
ATOM   1816  C  CD1 . PHE A 1 272 ? 153.322 161.383 218.443 1.00 87.82  0  272 PHE A CD1 1 
ATOM   1817  C  CD2 . PHE A 1 272 ? 154.928 162.797 217.382 1.00 87.82  0  272 PHE A CD2 1 
ATOM   1818  C  CE1 . PHE A 1 272 ? 154.209 161.149 219.480 1.00 87.82  0  272 PHE A CE1 1 
ATOM   1819  C  CE2 . PHE A 1 272 ? 155.819 162.566 218.417 1.00 87.82  0  272 PHE A CE2 1 
ATOM   1820  C  CZ  . PHE A 1 272 ? 155.459 161.741 219.465 1.00 87.82  0  272 PHE A CZ  1 
ATOM   1821  N  N   . VAL A 1 273 ? 152.605 165.473 217.220 1.00 84.88  0  273 VAL A N   1 
ATOM   1822  C  CA  . VAL A 1 273 ? 153.002 166.533 218.144 1.00 84.88  0  273 VAL A CA  1 
ATOM   1823  C  C   . VAL A 1 273 ? 151.775 167.287 218.653 1.00 84.88  0  273 VAL A C   1 
ATOM   1824  O  O   . VAL A 1 273 ? 151.682 167.616 219.843 1.00 84.88  0  273 VAL A O   1 
ATOM   1825  C  CB  . VAL A 1 273 ? 154.023 167.470 217.467 1.00 84.88  0  273 VAL A CB  1 
ATOM   1826  C  CG1 . VAL A 1 273 ? 154.370 168.652 218.360 1.00 84.88  0  273 VAL A CG1 1 
ATOM   1827  C  CG2 . VAL A 1 273 ? 155.287 166.704 217.120 1.00 84.88  0  273 VAL A CG2 1 
ATOM   1828  N  N   . ARG A 1 274 ? 150.792 167.522 217.776 1.00 90.84  0  274 ARG A N   1 
ATOM   1829  C  CA  . ARG A 1 274 ? 149.575 168.224 218.175 1.00 90.84  0  274 ARG A CA  1 
ATOM   1830  C  C   . ARG A 1 274 ? 148.717 167.394 219.124 1.00 90.84  0  274 ARG A C   1 
ATOM   1831  O  O   . ARG A 1 274 ? 147.971 167.959 219.930 1.00 90.84  0  274 ARG A O   1 
ATOM   1832  C  CB  . ARG A 1 274 ? 148.766 168.617 216.940 1.00 90.84  0  274 ARG A CB  1 
ATOM   1833  C  CG  . ARG A 1 274 ? 149.290 169.851 216.225 1.00 90.84  0  274 ARG A CG  1 
ATOM   1834  C  CD  . ARG A 1 274 ? 148.326 170.321 215.149 1.00 90.84  0  274 ARG A CD  1 
ATOM   1835  N  NE  . ARG A 1 274 ? 148.453 169.543 213.920 1.00 90.84  0  274 ARG A NE  1 
ATOM   1836  C  CZ  . ARG A 1 274 ? 147.586 168.615 213.529 1.00 90.84  0  274 ARG A CZ  1 
ATOM   1837  N  NH1 . ARG A 1 274 ? 146.522 168.342 214.272 1.00 90.84  1  274 ARG A NH1 1 
ATOM   1838  N  NH2 . ARG A 1 274 ? 147.783 167.958 212.394 1.00 90.84  0  274 ARG A NH2 1 
ATOM   1839  N  N   . GLY A 1 275 ? 148.806 166.064 219.048 1.00 91.49  0  275 GLY A N   1 
ATOM   1840  C  CA  . GLY A 1 275 ? 148.108 165.230 220.008 1.00 91.49  0  275 GLY A CA  1 
ATOM   1841  C  C   . GLY A 1 275 ? 148.869 165.036 221.300 1.00 91.49  0  275 GLY A C   1 
ATOM   1842  O  O   . GLY A 1 275 ? 148.257 164.865 222.358 1.00 91.49  0  275 GLY A O   1 
ATOM   1843  N  N   . LEU A 1 276 ? 150.204 165.053 221.240 1.00 88.30  0  276 LEU A N   1 
ATOM   1844  C  CA  . LEU A 1 276 ? 150.995 164.936 222.459 1.00 88.30  0  276 LEU A CA  1 
ATOM   1845  C  C   . LEU A 1 276 ? 150.950 166.220 223.276 1.00 88.30  0  276 LEU A C   1 
ATOM   1846  O  O   . LEU A 1 276 ? 151.017 166.173 224.510 1.00 88.30  0  276 LEU A O   1 
ATOM   1847  C  CB  . LEU A 1 276 ? 152.438 164.566 222.110 1.00 88.30  0  276 LEU A CB  1 
ATOM   1848  C  CG  . LEU A 1 276 ? 153.413 164.264 223.251 1.00 88.30  0  276 LEU A CG  1 
ATOM   1849  C  CD1 . LEU A 1 276 ? 152.815 163.260 224.222 1.00 88.30  0  276 LEU A CD1 1 
ATOM   1850  C  CD2 . LEU A 1 276 ? 154.734 163.754 222.702 1.00 88.30  0  276 LEU A CD2 1 
ATOM   1851  N  N   . LEU A 1 277 ? 150.822 167.372 222.614 1.00 87.78  0  277 LEU A N   1 
ATOM   1852  C  CA  . LEU A 1 277 ? 150.783 168.638 223.335 1.00 87.78  0  277 LEU A CA  1 
ATOM   1853  C  C   . LEU A 1 277 ? 149.441 168.878 224.016 1.00 87.78  0  277 LEU A C   1 
ATOM   1854  O  O   . LEU A 1 277 ? 149.385 169.604 225.014 1.00 87.78  0  277 LEU A O   1 
ATOM   1855  C  CB  . LEU A 1 277 ? 151.107 169.794 222.387 1.00 87.78  0  277 LEU A CB  1 
ATOM   1856  C  CG  . LEU A 1 277 ? 152.586 169.945 222.031 1.00 87.78  0  277 LEU A CG  1 
ATOM   1857  C  CD1 . LEU A 1 277 ? 152.776 170.980 220.937 1.00 87.78  0  277 LEU A CD1 1 
ATOM   1858  C  CD2 . LEU A 1 277 ? 153.395 170.305 223.264 1.00 87.78  0  277 LEU A CD2 1 
ATOM   1859  N  N   . VAL A 1 278 ? 148.356 168.297 223.500 1.00 91.61  0  278 VAL A N   1 
ATOM   1860  C  CA  . VAL A 1 278 ? 147.058 168.472 224.144 1.00 91.61  0  278 VAL A CA  1 
ATOM   1861  C  C   . VAL A 1 278 ? 146.757 167.374 225.159 1.00 91.61  0  278 VAL A C   1 
ATOM   1862  O  O   . VAL A 1 278 ? 145.897 167.570 226.029 1.00 91.61  0  278 VAL A O   1 
ATOM   1863  C  CB  . VAL A 1 278 ? 145.922 168.553 223.106 1.00 91.61  0  278 VAL A CB  1 
ATOM   1864  C  CG1 . VAL A 1 278 ? 146.152 169.722 222.160 1.00 91.61  0  278 VAL A CG1 1 
ATOM   1865  C  CG2 . VAL A 1 278 ? 145.788 167.248 222.333 1.00 91.61  0  278 VAL A CG2 1 
ATOM   1866  N  N   . ASN A 1 279 ? 147.434 166.227 225.076 1.00 96.37  0  279 ASN A N   1 
ATOM   1867  C  CA  . ASN A 1 279 ? 147.263 165.150 226.048 1.00 96.37  0  279 ASN A CA  1 
ATOM   1868  C  C   . ASN A 1 279 ? 148.434 165.226 227.022 1.00 96.37  0  279 ASN A C   1 
ATOM   1869  O  O   . ASN A 1 279 ? 149.380 164.441 226.970 1.00 96.37  0  279 ASN A O   1 
ATOM   1870  C  CB  . ASN A 1 279 ? 147.180 163.796 225.350 1.00 96.37  0  279 ASN A CB  1 
ATOM   1871  N  N   . GLU A 1 280 ? 148.359 166.200 227.928 1.00 104.46 0  280 GLU A N   1 
ATOM   1872  C  CA  . GLU A 1 280 ? 149.411 166.415 228.911 1.00 104.46 0  280 GLU A CA  1 
ATOM   1873  C  C   . GLU A 1 280 ? 149.081 165.865 230.290 1.00 104.46 0  280 GLU A C   1 
ATOM   1874  O  O   . GLU A 1 280 ? 149.997 165.683 231.099 1.00 104.46 0  280 GLU A O   1 
ATOM   1875  C  CB  . GLU A 1 280 ? 149.728 167.913 229.031 1.00 104.46 0  280 GLU A CB  1 
ATOM   1876  C  CG  . GLU A 1 280 ? 150.592 168.494 227.905 1.00 104.46 0  280 GLU A CG  1 
ATOM   1877  C  CD  . GLU A 1 280 ? 152.097 168.283 228.083 1.00 104.46 0  280 GLU A CD  1 
ATOM   1878  O  OE1 . GLU A 1 280 ? 152.538 167.207 228.541 1.00 104.46 0  280 GLU A OE1 1 
ATOM   1879  O  OE2 . GLU A 1 280 ? 152.854 169.220 227.750 1.00 104.46 -1 280 GLU A OE2 1 
ATOM   1880  N  N   . GLU A 1 281 ? 147.804 165.597 230.580 1.00 108.51 0  281 GLU A N   1 
ATOM   1881  C  CA  . GLU A 1 281 ? 147.455 165.034 231.880 1.00 108.51 0  281 GLU A CA  1 
ATOM   1882  C  C   . GLU A 1 281 ? 147.868 163.572 231.990 1.00 108.51 0  281 GLU A C   1 
ATOM   1883  O  O   . GLU A 1 281 ? 148.191 163.103 233.088 1.00 108.51 0  281 GLU A O   1 
ATOM   1884  C  CB  . GLU A 1 281 ? 145.953 165.186 232.135 1.00 108.51 0  281 GLU A CB  1 
ATOM   1885  C  CG  . GLU A 1 281 ? 145.062 164.706 230.995 1.00 108.51 0  281 GLU A CG  1 
ATOM   1886  C  CD  . GLU A 1 281 ? 144.585 165.838 230.106 1.00 108.51 0  281 GLU A CD  1 
ATOM   1887  O  OE1 . GLU A 1 281 ? 145.200 166.925 230.144 1.00 108.51 0  281 GLU A OE1 1 
ATOM   1888  O  OE2 . GLU A 1 281 ? 143.598 165.642 229.367 1.00 108.51 -1 281 GLU A OE2 1 
ATOM   1889  N  N   . ILE A 1 282 ? 147.870 162.842 230.879 1.00 104.29 0  282 ILE A N   1 
ATOM   1890  C  CA  . ILE A 1 282 ? 148.385 161.481 230.834 1.00 104.29 0  282 ILE A CA  1 
ATOM   1891  C  C   . ILE A 1 282 ? 149.432 161.412 229.727 1.00 104.29 0  282 ILE A C   1 
ATOM   1892  O  O   . ILE A 1 282 ? 149.242 161.988 228.649 1.00 104.29 0  282 ILE A O   1 
ATOM   1893  C  CB  . ILE A 1 282 ? 147.248 160.443 230.649 1.00 104.29 0  282 ILE A CB  1 
ATOM   1894  C  CG1 . ILE A 1 282 ? 147.802 159.017 230.649 1.00 104.29 0  282 ILE A CG1 1 
ATOM   1895  C  CG2 . ILE A 1 282 ? 146.376 160.739 229.421 1.00 104.29 0  282 ILE A CG2 1 
ATOM   1896  C  CD1 . ILE A 1 282 ? 148.547 158.682 231.926 1.00 104.29 0  282 ILE A CD1 1 
ATOM   1897  N  N   . LEU A 1 283 ? 150.550 160.736 230.021 1.00 101.72 0  283 LEU A N   1 
ATOM   1898  C  CA  . LEU A 1 283 ? 151.713 160.563 229.137 1.00 101.72 0  283 LEU A CA  1 
ATOM   1899  C  C   . LEU A 1 283 ? 152.225 161.921 228.637 1.00 101.72 0  283 LEU A C   1 
ATOM   1900  O  O   . LEU A 1 283 ? 152.101 162.295 227.473 1.00 101.72 0  283 LEU A O   1 
ATOM   1901  C  CB  . LEU A 1 283 ? 151.397 159.544 228.023 1.00 101.72 0  283 LEU A CB  1 
ATOM   1902  C  CG  . LEU A 1 283 ? 150.434 159.559 226.815 1.00 101.72 0  283 LEU A CG  1 
ATOM   1903  C  CD1 . LEU A 1 283 ? 151.078 159.981 225.491 1.00 101.72 0  283 LEU A CD1 1 
ATOM   1904  C  CD2 . LEU A 1 283 ? 149.753 158.203 226.667 1.00 101.72 0  283 LEU A CD2 1 
ATOM   1905  N  N   . GLY A 1 284 ? 152.754 162.675 229.607 1.00 97.02  0  284 GLY A N   1 
ATOM   1906  C  CA  . GLY A 1 284 ? 153.191 164.049 229.421 1.00 97.02  0  284 GLY A CA  1 
ATOM   1907  C  C   . GLY A 1 284 ? 154.202 164.253 228.313 1.00 97.02  0  284 GLY A C   1 
ATOM   1908  O  O   . GLY A 1 284 ? 153.849 164.814 227.270 1.00 97.02  0  284 GLY A O   1 
ATOM   1909  N  N   . ASN A 1 285 ? 155.435 163.773 228.526 1.00 89.90  0  285 ASN A N   1 
ATOM   1910  C  CA  . ASN A 1 285 ? 156.453 163.561 227.489 1.00 89.90  0  285 ASN A CA  1 
ATOM   1911  C  C   . ASN A 1 285 ? 156.768 164.859 226.735 1.00 89.90  0  285 ASN A C   1 
ATOM   1912  O  O   . ASN A 1 285 ? 156.465 165.015 225.550 1.00 89.90  0  285 ASN A O   1 
ATOM   1913  C  CB  . ASN A 1 285 ? 156.011 162.451 226.528 1.00 89.90  0  285 ASN A CB  1 
ATOM   1914  C  CG  . ASN A 1 285 ? 156.006 161.084 227.181 1.00 89.90  0  285 ASN A CG  1 
ATOM   1915  O  OD1 . ASN A 1 285 ? 156.838 160.790 228.038 1.00 89.90  0  285 ASN A OD1 1 
ATOM   1916  N  ND2 . ASN A 1 285 ? 155.062 160.241 226.780 1.00 89.90  0  285 ASN A ND2 1 
ATOM   1917  N  N   . GLN A 1 286 ? 157.353 165.797 227.479 1.00 84.04  0  286 GLN A N   1 
ATOM   1918  C  CA  . GLN A 1 286 ? 157.558 167.152 226.979 1.00 84.04  0  286 GLN A CA  1 
ATOM   1919  C  C   . GLN A 1 286 ? 158.571 167.177 225.838 1.00 84.04  0  286 GLN A C   1 
ATOM   1920  O  O   . GLN A 1 286 ? 159.645 166.573 225.923 1.00 84.04  0  286 GLN A O   1 
ATOM   1921  C  CB  . GLN A 1 286 ? 158.003 168.070 228.118 1.00 84.04  0  286 GLN A CB  1 
ATOM   1922  C  CG  . GLN A 1 286 ? 159.082 167.490 229.018 1.00 84.04  0  286 GLN A CG  1 
ATOM   1923  C  CD  . GLN A 1 286 ? 159.440 168.413 230.162 1.00 84.04  0  286 GLN A CD  1 
ATOM   1924  O  OE1 . GLN A 1 286 ? 158.875 169.498 230.299 1.00 84.04  0  286 GLN A OE1 1 
ATOM   1925  N  NE2 . GLN A 1 286 ? 160.383 167.987 230.993 1.00 84.04  0  286 GLN A NE2 1 
ATOM   1926  N  N   . ILE A 1 287 ? 158.209 167.863 224.758 1.00 79.27  0  287 ILE A N   1 
ATOM   1927  C  CA  . ILE A 1 287 ? 159.049 167.966 223.572 1.00 79.27  0  287 ILE A CA  1 
ATOM   1928  C  C   . ILE A 1 287 ? 159.893 169.227 223.681 1.00 79.27  0  287 ILE A C   1 
ATOM   1929  O  O   . ILE A 1 287 ? 159.365 170.322 223.908 1.00 79.27  0  287 ILE A O   1 
ATOM   1930  C  CB  . ILE A 1 287 ? 158.190 167.987 222.296 1.00 79.27  0  287 ILE A CB  1 
ATOM   1931  C  CG1 . ILE A 1 287 ? 157.363 166.705 222.185 1.00 79.27  0  287 ILE A CG1 1 
ATOM   1932  C  CG2 . ILE A 1 287 ? 159.053 168.173 221.061 1.00 79.27  0  287 ILE A CG2 1 
ATOM   1933  C  CD1 . ILE A 1 287 ? 156.421 166.693 221.003 1.00 79.27  0  287 ILE A CD1 1 
ATOM   1934  N  N   . HIS A 1 288 ? 161.202 169.076 223.523 1.00 78.57  0  288 HIS A N   1 
ATOM   1935  C  CA  . HIS A 1 288 ? 162.123 170.200 223.565 1.00 78.57  0  288 HIS A CA  1 
ATOM   1936  C  C   . HIS A 1 288 ? 162.519 170.618 222.154 1.00 78.57  0  288 HIS A C   1 
ATOM   1937  O  O   . HIS A 1 288 ? 162.196 169.958 221.163 1.00 78.57  0  288 HIS A O   1 
ATOM   1938  C  CB  . HIS A 1 288 ? 163.357 169.851 224.397 1.00 78.57  0  288 HIS A CB  1 
ATOM   1939  C  CG  . HIS A 1 288 ? 163.092 169.817 225.869 1.00 78.57  0  288 HIS A CG  1 
ATOM   1940  N  ND1 . HIS A 1 288 ? 162.779 168.656 226.541 1.00 78.57  0  288 HIS A ND1 1 
ATOM   1941  C  CD2 . HIS A 1 288 ? 163.080 170.803 226.795 1.00 78.57  0  288 HIS A CD2 1 
ATOM   1942  C  CE1 . HIS A 1 288 ? 162.594 168.927 227.821 1.00 78.57  0  288 HIS A CE1 1 
ATOM   1943  N  NE2 . HIS A 1 288 ? 162.771 170.224 228.001 1.00 78.57  0  288 HIS A NE2 1 
ATOM   1944  N  N   . MET A 1 289 ? 163.236 171.736 222.073 1.00 76.06  0  289 MET A N   1 
ATOM   1945  C  CA  . MET A 1 289 ? 163.519 172.365 220.794 1.00 76.06  0  289 MET A CA  1 
ATOM   1946  C  C   . MET A 1 289 ? 164.941 172.904 220.776 1.00 76.06  0  289 MET A C   1 
ATOM   1947  O  O   . MET A 1 289 ? 165.461 173.375 221.790 1.00 76.06  0  289 MET A O   1 
ATOM   1948  C  CB  . MET A 1 289 ? 162.527 173.497 220.513 1.00 76.06  0  289 MET A CB  1 
ATOM   1949  C  CG  . MET A 1 289 ? 162.387 173.858 219.053 1.00 76.06  0  289 MET A CG  1 
ATOM   1950  S  SD  . MET A 1 289 ? 161.364 175.320 218.839 1.00 76.06  0  289 MET A SD  1 
ATOM   1951  C  CE  . MET A 1 289 ? 162.320 176.528 219.751 1.00 76.06  0  289 MET A CE  1 
ATOM   1952  N  N   . HIS A 1 290 ? 165.559 172.826 219.602 1.00 73.02  0  290 HIS A N   1 
ATOM   1953  C  CA  . HIS A 1 290 ? 166.877 173.382 219.345 1.00 73.02  0  290 HIS A CA  1 
ATOM   1954  C  C   . HIS A 1 290 ? 166.779 174.297 218.135 1.00 73.02  0  290 HIS A C   1 
ATOM   1955  O  O   . HIS A 1 290 ? 166.030 174.014 217.195 1.00 73.02  0  290 HIS A O   1 
ATOM   1956  C  CB  . HIS A 1 290 ? 167.911 172.278 219.099 1.00 73.02  0  290 HIS A CB  1 
ATOM   1957  C  CG  . HIS A 1 290 ? 169.306 172.786 218.915 1.00 73.02  0  290 HIS A CG  1 
ATOM   1958  N  ND1 . HIS A 1 290 ? 169.945 172.777 217.694 1.00 73.02  0  290 HIS A ND1 1 
ATOM   1959  C  CD2 . HIS A 1 290 ? 170.186 173.317 219.796 1.00 73.02  0  290 HIS A CD2 1 
ATOM   1960  C  CE1 . HIS A 1 290 ? 171.159 173.281 217.831 1.00 73.02  0  290 HIS A CE1 1 
ATOM   1961  N  NE2 . HIS A 1 290 ? 171.330 173.617 219.097 1.00 73.02  0  290 HIS A NE2 1 
ATOM   1962  N  N   . VAL A 1 291 ? 167.519 175.402 218.169 1.00 71.16  0  291 VAL A N   1 
ATOM   1963  C  CA  . VAL A 1 291 ? 167.510 176.385 217.095 1.00 71.16  0  291 VAL A CA  1 
ATOM   1964  C  C   . VAL A 1 291 ? 168.906 176.481 216.494 1.00 71.16  0  291 VAL A C   1 
ATOM   1965  O  O   . VAL A 1 291 ? 169.913 176.383 217.204 1.00 71.16  0  291 VAL A O   1 
ATOM   1966  C  CB  . VAL A 1 291 ? 167.015 177.764 217.583 1.00 71.16  0  291 VAL A CB  1 
ATOM   1967  C  CG1 . VAL A 1 291 ? 165.520 177.718 217.841 1.00 71.16  0  291 VAL A CG1 1 
ATOM   1968  C  CG2 . VAL A 1 291 ? 167.746 178.189 218.850 1.00 71.16  0  291 VAL A CG2 1 
ATOM   1969  N  N   . THR A 1 292 ? 168.957 176.637 215.174 1.00 69.89  0  292 THR A N   1 
ATOM   1970  C  CA  . THR A 1 292 ? 170.203 176.794 214.435 1.00 69.89  0  292 THR A CA  1 
ATOM   1971  C  C   . THR A 1 292 ? 170.195 178.151 213.750 1.00 69.89  0  292 THR A C   1 
ATOM   1972  O  O   . THR A 1 292 ? 169.256 178.473 213.015 1.00 69.89  0  292 THR A O   1 
ATOM   1973  C  CB  . THR A 1 292 ? 170.391 175.684 213.393 1.00 69.89  0  292 THR A CB  1 
ATOM   1974  O  OG1 . THR A 1 292 ? 169.566 175.952 212.253 1.00 69.89  0  292 THR A OG1 1 
ATOM   1975  C  CG2 . THR A 1 292 ? 170.032 174.321 213.970 1.00 69.89  0  292 THR A CG2 1 
ATOM   1976  N  N   . ALA A 1 293 ? 171.241 178.940 213.985 1.00 63.89  0  293 ALA A N   1 
ATOM   1977  C  CA  . ALA A 1 293 ? 171.354 180.264 213.395 1.00 63.89  0  293 ALA A CA  1 
ATOM   1978  C  C   . ALA A 1 293 ? 172.530 180.416 212.445 1.00 63.89  0  293 ALA A C   1 
ATOM   1979  O  O   . ALA A 1 293 ? 172.573 181.402 211.701 1.00 63.89  0  293 ALA A O   1 
ATOM   1980  C  CB  . ALA A 1 293 ? 171.459 181.333 214.493 1.00 63.89  0  293 ALA A CB  1 
ATOM   1981  N  N   . LYS A 1 294 ? 173.478 179.481 212.440 1.00 63.74  0  294 LYS A N   1 
ATOM   1982  C  CA  . LYS A 1 294 ? 174.649 179.572 211.582 1.00 63.74  0  294 LYS A CA  1 
ATOM   1983  C  C   . LYS A 1 294 ? 174.746 178.437 210.573 1.00 63.74  0  294 LYS A C   1 
ATOM   1984  O  O   . LYS A 1 294 ? 175.691 178.419 209.775 1.00 63.74  0  294 LYS A O   1 
ATOM   1985  C  CB  . LYS A 1 294 ? 175.928 179.609 212.430 1.00 63.74  0  294 LYS A CB  1 
ATOM   1986  N  N   . GLU A 1 295 ? 173.808 177.494 210.582 1.00 64.42  0  295 GLU A N   1 
ATOM   1987  C  CA  . GLU A 1 295 ? 173.827 176.363 209.668 1.00 64.42  0  295 GLU A CA  1 
ATOM   1988  C  C   . GLU A 1 295 ? 172.479 176.253 208.969 1.00 64.42  0  295 GLU A C   1 
ATOM   1989  O  O   . GLU A 1 295 ? 171.457 176.730 209.467 1.00 64.42  0  295 GLU A O   1 
ATOM   1990  C  CB  . GLU A 1 295 ? 174.157 175.056 210.401 1.00 64.42  0  295 GLU A CB  1 
ATOM   1991  C  CG  . GLU A 1 295 ? 175.543 175.021 211.024 1.00 64.42  0  295 GLU A CG  1 
ATOM   1992  C  CD  . GLU A 1 295 ? 175.563 174.305 212.359 1.00 64.42  0  295 GLU A CD  1 
ATOM   1993  O  OE1 . GLU A 1 295 ? 176.450 173.450 212.564 1.00 64.42  0  295 GLU A OE1 1 
ATOM   1994  O  OE2 . GLU A 1 295 ? 174.696 174.602 213.207 1.00 64.42  -1 295 GLU A OE2 1 
ATOM   1995  N  N   . TYR A 1 296 ? 172.489 175.609 207.805 1.00 62.89  0  296 TYR A N   1 
ATOM   1996  C  CA  . TYR A 1 296 ? 171.317 175.523 206.944 1.00 62.89  0  296 TYR A CA  1 
ATOM   1997  C  C   . TYR A 1 296 ? 170.614 174.184 207.110 1.00 62.89  0  296 TYR A C   1 
ATOM   1998  O  O   . TYR A 1 296 ? 171.260 173.139 207.220 1.00 62.89  0  296 TYR A O   1 
ATOM   1999  C  CB  . TYR A 1 296 ? 171.706 175.719 205.477 1.00 62.89  0  296 TYR A CB  1 
ATOM   2000  C  CG  . TYR A 1 296 ? 170.539 176.014 204.562 1.00 62.89  0  296 TYR A CG  1 
ATOM   2001  C  CD1 . TYR A 1 296 ? 169.884 174.991 203.885 1.00 62.89  0  296 TYR A CD1 1 
ATOM   2002  C  CD2 . TYR A 1 296 ? 170.094 177.316 204.369 1.00 62.89  0  296 TYR A CD2 1 
ATOM   2003  C  CE1 . TYR A 1 296 ? 168.818 175.254 203.047 1.00 62.89  0  296 TYR A CE1 1 
ATOM   2004  C  CE2 . TYR A 1 296 ? 169.030 177.589 203.531 1.00 62.89  0  296 TYR A CE2 1 
ATOM   2005  C  CZ  . TYR A 1 296 ? 168.397 176.555 202.874 1.00 62.89  0  296 TYR A CZ  1 
ATOM   2006  O  OH  . TYR A 1 296 ? 167.336 176.826 202.041 1.00 62.89  0  296 TYR A OH  1 
ATOM   2007  N  N   . GLY A 1 297 ? 169.286 174.221 207.114 1.00 67.93  0  297 GLY A N   1 
ATOM   2008  C  CA  . GLY A 1 297 ? 168.499 173.007 207.123 1.00 67.93  0  297 GLY A CA  1 
ATOM   2009  C  C   . GLY A 1 297 ? 167.088 173.233 206.626 1.00 67.93  0  297 GLY A C   1 
ATOM   2010  O  O   . GLY A 1 297 ? 166.383 174.110 207.136 1.00 67.93  0  297 GLY A O   1 
ATOM   2011  N  N   . ALA A 1 298 ? 166.658 172.443 205.646 1.00 70.47  0  298 ALA A N   1 
ATOM   2012  C  CA  . ALA A 1 298 ? 165.322 172.571 205.076 1.00 70.47  0  298 ALA A CA  1 
ATOM   2013  C  C   . ALA A 1 298 ? 164.959 171.249 204.414 1.00 70.47  0  298 ALA A C   1 
ATOM   2014  O  O   . ALA A 1 298 ? 165.731 170.289 204.435 1.00 70.47  0  298 ALA A O   1 
ATOM   2015  C  CB  . ALA A 1 298 ? 165.247 173.729 204.076 1.00 70.47  0  298 ALA A CB  1 
ATOM   2016  N  N   . ARG A 1 299 ? 163.769 171.207 203.822 1.00 74.72  0  299 ARG A N   1 
ATOM   2017  C  CA  . ARG A 1 299 ? 163.334 170.076 203.018 1.00 74.72  0  299 ARG A CA  1 
ATOM   2018  C  C   . ARG A 1 299 ? 162.553 170.615 201.829 1.00 74.72  0  299 ARG A C   1 
ATOM   2019  O  O   . ARG A 1 299 ? 162.410 171.828 201.657 1.00 74.72  0  299 ARG A O   1 
ATOM   2020  C  CB  . ARG A 1 299 ? 162.507 169.090 203.853 1.00 74.72  0  299 ARG A CB  1 
ATOM   2021  C  CG  . ARG A 1 299 ? 161.127 169.595 204.242 1.00 74.72  0  299 ARG A CG  1 
ATOM   2022  C  CD  . ARG A 1 299 ? 160.351 168.536 205.009 1.00 74.72  0  299 ARG A CD  1 
ATOM   2023  N  NE  . ARG A 1 299 ? 160.258 167.272 204.286 1.00 74.72  0  299 ARG A NE  1 
ATOM   2024  C  CZ  . ARG A 1 299 ? 159.197 166.891 203.583 1.00 74.72  0  299 ARG A CZ  1 
ATOM   2025  N  NH1 . ARG A 1 299 ? 158.133 167.678 203.508 1.00 74.72  1  299 ARG A NH1 1 
ATOM   2026  N  NH2 . ARG A 1 299 ? 159.198 165.723 202.957 1.00 74.72  0  299 ARG A NH2 1 
ATOM   2027  N  N   . VAL A 1 300 ? 162.051 169.714 200.992 1.00 73.96  0  300 VAL A N   1 
ATOM   2028  C  CA  . VAL A 1 300 ? 161.226 170.108 199.859 1.00 73.96  0  300 VAL A CA  1 
ATOM   2029  C  C   . VAL A 1 300 ? 159.819 169.562 200.058 1.00 73.96  0  300 VAL A C   1 
ATOM   2030  O  O   . VAL A 1 300 ? 159.610 168.507 200.670 1.00 73.96  0  300 VAL A O   1 
ATOM   2031  C  CB  . VAL A 1 300 ? 161.824 169.660 198.504 1.00 73.96  0  300 VAL A CB  1 
ATOM   2032  C  CG1 . VAL A 1 300 ? 163.206 170.265 198.312 1.00 73.96  0  300 VAL A CG1 1 
ATOM   2033  C  CG2 . VAL A 1 300 ? 161.893 168.148 198.395 1.00 73.96  0  300 VAL A CG2 1 
ATOM   2034  N  N   . SER A 1 301 ? 158.840 170.328 199.582 1.00 76.84  0  301 SER A N   1 
ATOM   2035  C  CA  . SER A 1 301 ? 157.449 169.884 199.587 1.00 76.84  0  301 SER A CA  1 
ATOM   2036  C  C   . SER A 1 301 ? 156.709 170.155 198.289 1.00 76.84  0  301 SER A C   1 
ATOM   2037  O  O   . SER A 1 301 ? 155.739 169.445 198.004 1.00 76.84  0  301 SER A O   1 
ATOM   2038  C  CB  . SER A 1 301 ? 156.681 170.541 200.740 1.00 76.84  0  301 SER A CB  1 
ATOM   2039  O  OG  . SER A 1 301 ? 157.430 170.497 201.943 1.00 76.84  0  301 SER A OG  1 
ATOM   2040  N  N   . ASN A 1 302 ? 157.119 171.133 197.492 1.00 77.42  0  302 ASN A N   1 
ATOM   2041  C  CA  . ASN A 1 302 ? 156.483 171.427 196.215 1.00 77.42  0  302 ASN A CA  1 
ATOM   2042  C  C   . ASN A 1 302 ? 157.540 172.040 195.301 1.00 77.42  0  302 ASN A C   1 
ATOM   2043  O  O   . ASN A 1 302 ? 158.742 171.926 195.562 1.00 77.42  0  302 ASN A O   1 
ATOM   2044  C  CB  . ASN A 1 302 ? 155.244 172.321 196.417 1.00 77.42  0  302 ASN A CB  1 
ATOM   2045  C  CG  . ASN A 1 302 ? 155.488 173.462 197.391 1.00 77.42  0  302 ASN A CG  1 
ATOM   2046  O  OD1 . ASN A 1 302 ? 156.575 174.033 197.445 1.00 77.42  0  302 ASN A OD1 1 
ATOM   2047  N  ND2 . ASN A 1 302 ? 154.468 173.795 198.173 1.00 77.42  0  302 ASN A ND2 1 
ATOM   2048  N  N   . LEU A 1 303 ? 157.093 172.692 194.224 1.00 79.82  0  303 LEU A N   1 
ATOM   2049  C  CA  . LEU A 1 303 ? 158.032 173.339 193.314 1.00 79.82  0  303 LEU A CA  1 
ATOM   2050  C  C   . LEU A 1 303 ? 158.658 174.584 193.934 1.00 79.82  0  303 LEU A C   1 
ATOM   2051  O  O   . LEU A 1 303 ? 159.774 174.963 193.560 1.00 79.82  0  303 LEU A O   1 
ATOM   2052  C  CB  . LEU A 1 303 ? 157.343 173.693 191.991 1.00 79.82  0  303 LEU A CB  1 
ATOM   2053  C  CG  . LEU A 1 303 ? 156.385 174.889 191.870 1.00 79.82  0  303 LEU A CG  1 
ATOM   2054  C  CD1 . LEU A 1 303 ? 156.256 175.294 190.412 1.00 79.82  0  303 LEU A CD1 1 
ATOM   2055  C  CD2 . LEU A 1 303 ? 155.003 174.603 192.447 1.00 79.82  0  303 LEU A CD2 1 
ATOM   2056  N  N   . HIS A 1 304 ? 157.971 175.217 194.890 1.00 78.37  0  304 HIS A N   1 
ATOM   2057  C  CA  . HIS A 1 304 ? 158.502 176.423 195.519 1.00 78.37  0  304 HIS A CA  1 
ATOM   2058  C  C   . HIS A 1 304 ? 159.670 176.099 196.444 1.00 78.37  0  304 HIS A C   1 
ATOM   2059  O  O   . HIS A 1 304 ? 160.716 176.762 196.393 1.00 78.37  0  304 HIS A O   1 
ATOM   2060  C  CB  . HIS A 1 304 ? 157.393 177.144 196.285 1.00 78.37  0  304 HIS A CB  1 
ATOM   2061  C  CG  . HIS A 1 304 ? 157.748 178.540 196.691 1.00 78.37  0  304 HIS A CG  1 
ATOM   2062  N  ND1 . HIS A 1 304 ? 157.003 179.262 197.599 1.00 78.37  0  304 HIS A ND1 1 
ATOM   2063  C  CD2 . HIS A 1 304 ? 158.765 179.349 196.312 1.00 78.37  0  304 HIS A CD2 1 
ATOM   2064  C  CE1 . HIS A 1 304 ? 157.548 180.454 197.763 1.00 78.37  0  304 HIS A CE1 1 
ATOM   2065  N  NE2 . HIS A 1 304 ? 158.618 180.533 196.993 1.00 78.37  0  304 HIS A NE2 1 
ATOM   2066  N  N   . MET A 1 305 ? 159.509 175.080 197.296 1.00 74.53  0  305 MET A N   1 
ATOM   2067  C  CA  . MET A 1 305 ? 160.609 174.641 198.150 1.00 74.53  0  305 MET A CA  1 
ATOM   2068  C  C   . MET A 1 305 ? 161.753 174.063 197.329 1.00 74.53  0  305 MET A C   1 
ATOM   2069  O  O   . MET A 1 305 ? 162.922 174.259 197.674 1.00 74.53  0  305 MET A O   1 
ATOM   2070  C  CB  . MET A 1 305 ? 160.122 173.612 199.170 1.00 74.53  0  305 MET A CB  1 
ATOM   2071  C  CG  . MET A 1 305 ? 158.806 173.949 199.840 1.00 74.53  0  305 MET A CG  1 
ATOM   2072  S  SD  . MET A 1 305 ? 158.992 175.024 201.271 1.00 74.53  0  305 MET A SD  1 
ATOM   2073  C  CE  . MET A 1 305 ? 160.021 174.023 202.337 1.00 74.53  0  305 MET A CE  1 
ATOM   2074  N  N   . TYR A 1 306 ? 161.433 173.369 196.229 1.00 69.89  0  306 TYR A N   1 
ATOM   2075  C  CA  . TYR A 1 306 ? 162.465 172.852 195.334 1.00 69.89  0  306 TYR A CA  1 
ATOM   2076  C  C   . TYR A 1 306 ? 163.275 173.982 194.711 1.00 69.89  0  306 TYR A C   1 
ATOM   2077  O  O   . TYR A 1 306 ? 164.511 173.926 194.689 1.00 69.89  0  306 TYR A O   1 
ATOM   2078  C  CB  . TYR A 1 306 ? 161.828 171.988 194.244 1.00 69.89  0  306 TYR A CB  1 
ATOM   2079  C  CG  . TYR A 1 306 ? 162.807 171.425 193.233 1.00 69.89  0  306 TYR A CG  1 
ATOM   2080  C  CD1 . TYR A 1 306 ? 163.566 170.298 193.525 1.00 69.89  0  306 TYR A CD1 1 
ATOM   2081  C  CD2 . TYR A 1 306 ? 162.957 172.010 191.979 1.00 69.89  0  306 TYR A CD2 1 
ATOM   2082  C  CE1 . TYR A 1 306 ? 164.456 169.777 192.601 1.00 69.89  0  306 TYR A CE1 1 
ATOM   2083  C  CE2 . TYR A 1 306 ? 163.848 171.499 191.052 1.00 69.89  0  306 TYR A CE2 1 
ATOM   2084  C  CZ  . TYR A 1 306 ? 164.593 170.383 191.369 1.00 69.89  0  306 TYR A CZ  1 
ATOM   2085  O  OH  . TYR A 1 306 ? 165.477 169.869 190.450 1.00 69.89  0  306 TYR A OH  1 
ATOM   2086  N  N   . SER A 1 307 ? 162.595 175.035 194.246 1.00 68.51  0  307 SER A N   1 
ATOM   2087  C  CA  . SER A 1 307 ? 163.281 176.169 193.635 1.00 68.51  0  307 SER A CA  1 
ATOM   2088  C  C   . SER A 1 307 ? 164.121 176.932 194.652 1.00 68.51  0  307 SER A C   1 
ATOM   2089  O  O   . SER A 1 307 ? 165.257 177.322 194.356 1.00 68.51  0  307 SER A O   1 
ATOM   2090  C  CB  . SER A 1 307 ? 162.264 177.100 192.975 1.00 68.51  0  307 SER A CB  1 
ATOM   2091  O  OG  . SER A 1 307 ? 161.543 176.429 191.957 1.00 68.51  0  307 SER A OG  1 
ATOM   2092  N  N   . ALA A 1 308 ? 163.591 177.122 195.865 1.00 64.96  0  308 ALA A N   1 
ATOM   2093  C  CA  . ALA A 1 308 ? 164.318 177.871 196.886 1.00 64.96  0  308 ALA A CA  1 
ATOM   2094  C  C   . ALA A 1 308 ? 165.537 177.105 197.392 1.00 64.96  0  308 ALA A C   1 
ATOM   2095  O  O   . ALA A 1 308 ? 166.623 177.683 197.536 1.00 64.96  0  308 ALA A O   1 
ATOM   2096  C  CB  . ALA A 1 308 ? 163.384 178.214 198.042 1.00 64.96  0  308 ALA A CB  1 
ATOM   2097  N  N   . VAL A 1 309 ? 165.387 175.802 197.648 1.00 63.64  0  309 VAL A N   1 
ATOM   2098  C  CA  . VAL A 1 309 ? 166.519 174.992 198.087 1.00 63.64  0  309 VAL A CA  1 
ATOM   2099  C  C   . VAL A 1 309 ? 167.548 174.819 196.970 1.00 63.64  0  309 VAL A C   1 
ATOM   2100  O  O   . VAL A 1 309 ? 168.755 174.818 197.236 1.00 63.64  0  309 VAL A O   1 
ATOM   2101  C  CB  . VAL A 1 309 ? 165.995 173.650 198.644 1.00 63.64  0  309 VAL A CB  1 
ATOM   2102  C  CG1 . VAL A 1 309 ? 167.116 172.678 198.933 1.00 63.64  0  309 VAL A CG1 1 
ATOM   2103  C  CG2 . VAL A 1 309 ? 165.232 173.897 199.937 1.00 63.64  0  309 VAL A CG2 1 
ATOM   2104  N  N   . CYS A 1 310 ? 167.114 174.749 195.705 1.00 65.13  0  310 CYS A N   1 
ATOM   2105  C  CA  . CYS A 1 310 ? 168.072 174.694 194.603 1.00 65.13  0  310 CYS A CA  1 
ATOM   2106  C  C   . CYS A 1 310 ? 168.848 176.000 194.461 1.00 65.13  0  310 CYS A C   1 
ATOM   2107  O  O   . CYS A 1 310 ? 170.068 175.980 194.249 1.00 65.13  0  310 CYS A O   1 
ATOM   2108  C  CB  . CYS A 1 310 ? 167.354 174.356 193.298 1.00 65.13  0  310 CYS A CB  1 
ATOM   2109  S  SG  . CYS A 1 310 ? 168.449 173.748 191.999 1.00 65.13  0  310 CYS A SG  1 
ATOM   2110  N  N   . ALA A 1 311 ? 168.165 177.142 194.594 1.00 61.67  0  311 ALA A N   1 
ATOM   2111  C  CA  . ALA A 1 311 ? 168.848 178.431 194.561 1.00 61.67  0  311 ALA A CA  1 
ATOM   2112  C  C   . ALA A 1 311 ? 169.765 178.632 195.763 1.00 61.67  0  311 ALA A C   1 
ATOM   2113  O  O   . ALA A 1 311 ? 170.751 179.370 195.667 1.00 61.67  0  311 ALA A O   1 
ATOM   2114  C  CB  . ALA A 1 311 ? 167.825 179.564 194.483 1.00 61.67  0  311 ALA A CB  1 
ATOM   2115  N  N   . ASP A 1 312 ? 169.468 177.990 196.894 1.00 61.32  0  312 ASP A N   1 
ATOM   2116  C  CA  . ASP A 1 312 ? 170.368 178.072 198.042 1.00 61.32  0  312 ASP A CA  1 
ATOM   2117  C  C   . ASP A 1 312 ? 171.571 177.140 197.910 1.00 61.32  0  312 ASP A C   1 
ATOM   2118  O  O   . ASP A 1 312 ? 172.669 177.483 198.361 1.00 61.32  0  312 ASP A O   1 
ATOM   2119  C  CB  . ASP A 1 312 ? 169.600 177.774 199.328 1.00 61.32  0  312 ASP A CB  1 
ATOM   2120  C  CG  . ASP A 1 312 ? 168.640 178.886 199.701 1.00 61.32  0  312 ASP A CG  1 
ATOM   2121  O  OD1 . ASP A 1 312 ? 168.691 179.956 199.059 1.00 61.32  0  312 ASP A OD1 1 
ATOM   2122  O  OD2 . ASP A 1 312 ? 167.833 178.693 200.634 1.00 61.32  -1 312 ASP A OD2 1 
ATOM   2123  N  N   . VAL A 1 313 ? 171.389 175.961 197.309 1.00 58.68  0  313 VAL A N   1 
ATOM   2124  C  CA  . VAL A 1 313 ? 172.516 175.062 197.064 1.00 58.68  0  313 VAL A CA  1 
ATOM   2125  C  C   . VAL A 1 313 ? 173.455 175.648 196.012 1.00 58.68  0  313 VAL A C   1 
ATOM   2126  O  O   . VAL A 1 313 ? 174.685 175.562 196.144 1.00 58.68  0  313 VAL A O   1 
ATOM   2127  C  CB  . VAL A 1 313 ? 171.999 173.660 196.673 1.00 58.68  0  313 VAL A CB  1 
ATOM   2128  C  CG1 . VAL A 1 313 ? 173.112 172.766 196.143 1.00 58.68  0  313 VAL A CG1 1 
ATOM   2129  C  CG2 . VAL A 1 313 ? 171.369 172.982 197.873 1.00 58.68  0  313 VAL A CG2 1 
ATOM   2130  N  N   . ILE A 1 314 ? 172.900 176.290 194.980 1.00 60.51  0  314 ILE A N   1 
ATOM   2131  C  CA  . ILE A 1 314 ? 173.734 176.924 193.960 1.00 60.51  0  314 ILE A CA  1 
ATOM   2132  C  C   . ILE A 1 314 ? 174.488 178.122 194.541 1.00 60.51  0  314 ILE A C   1 
ATOM   2133  O  O   . ILE A 1 314 ? 175.671 178.332 194.245 1.00 60.51  0  314 ILE A O   1 
ATOM   2134  C  CB  . ILE A 1 314 ? 172.869 177.305 192.741 1.00 60.51  0  314 ILE A CB  1 
ATOM   2135  C  CG1 . ILE A 1 314 ? 172.428 176.047 191.994 1.00 60.51  0  314 ILE A CG1 1 
ATOM   2136  C  CG2 . ILE A 1 314 ? 173.619 178.192 191.768 1.00 60.51  0  314 ILE A CG2 1 
ATOM   2137  C  CD1 . ILE A 1 314 ? 173.574 175.196 191.506 1.00 60.51  0  314 ILE A CD1 1 
ATOM   2138  N  N   . ARG A 1 315 ? 173.853 178.875 195.439 1.00 61.15  0  315 ARG A N   1 
ATOM   2139  C  CA  . ARG A 1 315 ? 174.500 180.009 196.086 1.00 61.15  0  315 ARG A CA  1 
ATOM   2140  C  C   . ARG A 1 315 ? 175.258 179.624 197.358 1.00 61.15  0  315 ARG A C   1 
ATOM   2141  O  O   . ARG A 1 315 ? 175.482 180.492 198.211 1.00 61.15  0  315 ARG A O   1 
ATOM   2142  C  CB  . ARG A 1 315 ? 173.471 181.098 196.394 1.00 61.15  0  315 ARG A CB  1 
ATOM   2143  C  CG  . ARG A 1 315 ? 172.963 181.823 195.163 1.00 61.15  0  315 ARG A CG  1 
ATOM   2144  C  CD  . ARG A 1 315 ? 171.994 182.930 195.534 1.00 61.15  0  315 ARG A CD  1 
ATOM   2145  N  NE  . ARG A 1 315 ? 170.847 182.423 196.280 1.00 61.15  0  315 ARG A NE  1 
ATOM   2146  C  CZ  . ARG A 1 315 ? 169.846 183.181 196.714 1.00 61.15  0  315 ARG A CZ  1 
ATOM   2147  N  NH1 . ARG A 1 315 ? 169.846 184.484 196.475 1.00 61.15  1  315 ARG A NH1 1 
ATOM   2148  N  NH2 . ARG A 1 315 ? 168.842 182.634 197.386 1.00 61.15  0  315 ARG A NH2 1 
ATOM   2149  N  N   . ARG A 1 316 ? 175.627 178.344 197.499 1.00 61.22  0  316 ARG A N   1 
ATOM   2150  C  CA  . ARG A 1 316 ? 176.547 177.830 198.526 1.00 61.22  0  316 ARG A CA  1 
ATOM   2151  C  C   . ARG A 1 316 ? 176.041 178.046 199.949 1.00 61.22  0  316 ARG A C   1 
ATOM   2152  O  O   . ARG A 1 316 ? 176.834 178.168 200.884 1.00 61.22  0  316 ARG A O   1 
ATOM   2153  C  CB  . ARG A 1 316 ? 177.952 178.426 198.382 1.00 61.22  0  316 ARG A CB  1 
ATOM   2154  C  CG  . ARG A 1 316 ? 178.545 178.306 196.999 1.00 61.22  0  316 ARG A CG  1 
ATOM   2155  C  CD  . ARG A 1 316 ? 179.939 178.890 196.963 1.00 61.22  0  316 ARG A CD  1 
ATOM   2156  N  NE  . ARG A 1 316 ? 180.874 178.080 197.735 1.00 61.22  0  316 ARG A NE  1 
ATOM   2157  C  CZ  . ARG A 1 316 ? 181.693 177.182 197.201 1.00 61.22  0  316 ARG A CZ  1 
ATOM   2158  N  NH1 . ARG A 1 316 ? 181.690 176.985 195.891 1.00 61.22  1  316 ARG A NH1 1 
ATOM   2159  N  NH2 . ARG A 1 316 ? 182.514 176.484 197.973 1.00 61.22  0  316 ARG A NH2 1 
ATOM   2160  N  N   . TRP A 1 317 ? 174.722 178.080 200.139 1.00 58.58  0  317 TRP A N   1 
ATOM   2161  C  CA  . TRP A 1 317 ? 174.181 178.241 201.483 1.00 58.58  0  317 TRP A CA  1 
ATOM   2162  C  C   . TRP A 1 317 ? 174.276 176.966 202.307 1.00 58.58  0  317 TRP A C   1 
ATOM   2163  O  O   . TRP A 1 317 ? 174.125 177.024 203.532 1.00 58.58  0  317 TRP A O   1 
ATOM   2164  C  CB  . TRP A 1 317 ? 172.723 178.699 201.416 1.00 58.58  0  317 TRP A CB  1 
ATOM   2165  C  CG  . TRP A 1 317 ? 172.575 180.129 201.028 1.00 58.58  0  317 TRP A CG  1 
ATOM   2166  C  CD1 . TRP A 1 317 ? 172.608 180.636 199.765 1.00 58.58  0  317 TRP A CD1 1 
ATOM   2167  C  CD2 . TRP A 1 317 ? 172.358 181.241 201.902 1.00 58.58  0  317 TRP A CD2 1 
ATOM   2168  N  NE1 . TRP A 1 317 ? 172.433 181.997 199.795 1.00 58.58  0  317 TRP A NE1 1 
ATOM   2169  C  CE2 . TRP A 1 317 ? 172.275 182.394 201.097 1.00 58.58  0  317 TRP A CE2 1 
ATOM   2170  C  CE3 . TRP A 1 317 ? 172.227 181.374 203.287 1.00 58.58  0  317 TRP A CE3 1 
ATOM   2171  C  CZ2 . TRP A 1 317 ? 172.068 183.662 201.630 1.00 58.58  0  317 TRP A CZ2 1 
ATOM   2172  C  CZ3 . TRP A 1 317 ? 172.021 182.636 203.815 1.00 58.58  0  317 TRP A CZ3 1 
ATOM   2173  C  CH2 . TRP A 1 317 ? 171.945 183.762 202.988 1.00 58.58  0  317 TRP A CH2 1 
ATOM   2174  N  N   . VAL A 1 318 ? 174.521 175.822 201.669 1.00 61.46  0  318 VAL A N   1 
ATOM   2175  C  CA  . VAL A 1 318 ? 174.554 174.543 202.367 1.00 61.46  0  318 VAL A CA  1 
ATOM   2176  C  C   . VAL A 1 318 ? 175.990 174.029 202.279 1.00 61.46  0  318 VAL A C   1 
ATOM   2177  O  O   . VAL A 1 318 ? 176.230 172.830 202.109 1.00 61.46  0  318 VAL A O   1 
ATOM   2178  C  CB  . VAL A 1 318 ? 173.533 173.547 201.771 1.00 61.46  0  318 VAL A CB  1 
ATOM   2179  C  CG1 . VAL A 1 318 ? 173.146 172.445 202.782 1.00 61.46  0  318 VAL A CG1 1 
ATOM   2180  C  CG2 . VAL A 1 318 ? 172.297 174.269 201.258 1.00 61.46  0  318 VAL A CG2 1 
ATOM   2181  N  N   . TYR A 1 319 ? 176.953 174.948 202.319 1.00 59.63  0  319 TYR A N   1 
ATOM   2182  C  CA  . TYR A 1 319 ? 178.356 174.564 202.416 1.00 59.63  0  319 TYR A CA  1 
ATOM   2183  C  C   . TYR A 1 319 ? 178.587 173.813 203.727 1.00 59.63  0  319 TYR A C   1 
ATOM   2184  O  O   . TYR A 1 319 ? 178.077 174.229 204.774 1.00 59.63  0  319 TYR A O   1 
ATOM   2185  C  CB  . TYR A 1 319 ? 179.240 175.812 202.342 1.00 59.63  0  319 TYR A CB  1 
ATOM   2186  C  CG  . TYR A 1 319 ? 180.727 175.550 202.283 1.00 59.63  0  319 TYR A CG  1 
ATOM   2187  C  CD1 . TYR A 1 319 ? 181.350 175.242 201.080 1.00 59.63  0  319 TYR A CD1 1 
ATOM   2188  C  CD2 . TYR A 1 319 ? 181.510 175.615 203.430 1.00 59.63  0  319 TYR A CD2 1 
ATOM   2189  C  CE1 . TYR A 1 319 ? 182.710 175.001 201.020 1.00 59.63  0  319 TYR A CE1 1 
ATOM   2190  C  CE2 . TYR A 1 319 ? 182.872 175.375 203.381 1.00 59.63  0  319 TYR A CE2 1 
ATOM   2191  C  CZ  . TYR A 1 319 ? 183.465 175.069 202.173 1.00 59.63  0  319 TYR A CZ  1 
ATOM   2192  O  OH  . TYR A 1 319 ? 184.819 174.831 202.119 1.00 59.63  0  319 TYR A OH  1 
ATOM   2193  N  N   . PRO A 1 320 ? 179.358 172.708 203.723 1.00 63.87  0  320 PRO A N   1 
ATOM   2194  C  CA  . PRO A 1 320 ? 180.265 172.120 202.727 1.00 63.87  0  320 PRO A CA  1 
ATOM   2195  C  C   . PRO A 1 320 ? 179.623 171.313 201.601 1.00 63.87  0  320 PRO A C   1 
ATOM   2196  O  O   . PRO A 1 320 ? 180.346 170.932 200.680 1.00 63.87  0  320 PRO A O   1 
ATOM   2197  C  CB  . PRO A 1 320 ? 181.152 171.190 203.572 1.00 63.87  0  320 PRO A CB  1 
ATOM   2198  C  CG  . PRO A 1 320 ? 180.713 171.382 205.009 1.00 63.87  0  320 PRO A CG  1 
ATOM   2199  C  CD  . PRO A 1 320 ? 179.326 171.888 204.941 1.00 63.87  0  320 PRO A CD  1 
ATOM   2200  N  N   . LEU A 1 321 ? 178.319 171.042 201.667 1.00 68.84  0  321 LEU A N   1 
ATOM   2201  C  CA  . LEU A 1 321 ? 177.673 170.264 200.615 1.00 68.84  0  321 LEU A CA  1 
ATOM   2202  C  C   . LEU A 1 321 ? 177.547 171.129 199.366 1.00 68.84  0  321 LEU A C   1 
ATOM   2203  O  O   . LEU A 1 321 ? 176.582 171.883 199.212 1.00 68.84  0  321 LEU A O   1 
ATOM   2204  C  CB  . LEU A 1 321 ? 176.306 169.747 201.072 1.00 68.84  0  321 LEU A CB  1 
ATOM   2205  C  CG  . LEU A 1 321 ? 176.253 168.367 201.738 1.00 68.84  0  321 LEU A CG  1 
ATOM   2206  C  CD1 . LEU A 1 321 ? 176.818 168.394 203.153 1.00 68.84  0  321 LEU A CD1 1 
ATOM   2207  C  CD2 . LEU A 1 321 ? 174.830 167.844 201.752 1.00 68.84  0  321 LEU A CD2 1 
ATOM   2208  N  N   . THR A 1 322 ? 178.529 171.016 198.473 1.00 71.58  0  322 THR A N   1 
ATOM   2209  C  CA  . THR A 1 322 ? 178.729 171.908 197.346 1.00 71.58  0  322 THR A CA  1 
ATOM   2210  C  C   . THR A 1 322 ? 178.859 171.069 196.081 1.00 71.58  0  322 THR A C   1 
ATOM   2211  O  O   . THR A 1 322 ? 179.421 169.968 196.136 1.00 71.58  0  322 THR A O   1 
ATOM   2212  C  CB  . THR A 1 322 ? 179.999 172.748 197.567 1.00 71.58  0  322 THR A CB  1 
ATOM   2213  O  OG1 . THR A 1 322 ? 180.120 173.057 198.957 1.00 71.58  0  322 THR A OG1 1 
ATOM   2214  C  CG2 . THR A 1 322 ? 179.930 174.055 196.812 1.00 71.58  0  322 THR A CG2 1 
ATOM   2215  N  N   . PRO A 1 323 ? 178.316 171.530 194.943 1.00 72.20  0  323 PRO A N   1 
ATOM   2216  C  CA  . PRO A 1 323 ? 178.413 170.723 193.710 1.00 72.20  0  323 PRO A CA  1 
ATOM   2217  C  C   . PRO A 1 323 ? 179.827 170.509 193.190 1.00 72.20  0  323 PRO A C   1 
ATOM   2218  O  O   . PRO A 1 323 ? 180.125 169.418 192.691 1.00 72.20  0  323 PRO A O   1 
ATOM   2219  C  CB  . PRO A 1 323 ? 177.562 171.518 192.715 1.00 72.20  0  323 PRO A CB  1 
ATOM   2220  C  CG  . PRO A 1 323 ? 176.561 172.201 193.555 1.00 72.20  0  323 PRO A CG  1 
ATOM   2221  C  CD  . PRO A 1 323 ? 177.276 172.570 194.823 1.00 72.20  0  323 PRO A CD  1 
ATOM   2222  N  N   . GLU A 1 324 ? 180.708 171.506 193.277 1.00 73.00  0  324 GLU A N   1 
ATOM   2223  C  CA  . GLU A 1 324 ? 182.077 171.280 192.830 1.00 73.00  0  324 GLU A CA  1 
ATOM   2224  C  C   . GLU A 1 324 ? 182.917 170.549 193.870 1.00 73.00  0  324 GLU A C   1 
ATOM   2225  O  O   . GLU A 1 324 ? 184.009 170.074 193.538 1.00 73.00  0  324 GLU A O   1 
ATOM   2226  C  CB  . GLU A 1 324 ? 182.754 172.602 192.454 1.00 73.00  0  324 GLU A CB  1 
ATOM   2227  C  CG  . GLU A 1 324 ? 183.440 173.313 193.604 1.00 73.00  0  324 GLU A CG  1 
ATOM   2228  C  CD  . GLU A 1 324 ? 182.556 174.354 194.238 1.00 73.00  0  324 GLU A CD  1 
ATOM   2229  O  OE1 . GLU A 1 324 ? 181.373 174.430 193.853 1.00 73.00  0  324 GLU A OE1 1 
ATOM   2230  O  OE2 . GLU A 1 324 ? 183.039 175.090 195.123 1.00 73.00  -1 324 GLU A OE2 1 
ATOM   2231  N  N   . ALA A 1 325 ? 182.431 170.444 195.110 1.00 73.14  0  325 ALA A N   1 
ATOM   2232  C  CA  . ALA A 1 325 ? 183.157 169.699 196.131 1.00 73.14  0  325 ALA A CA  1 
ATOM   2233  C  C   . ALA A 1 325 ? 183.112 168.201 195.869 1.00 73.14  0  325 ALA A C   1 
ATOM   2234  O  O   . ALA A 1 325 ? 184.052 167.489 196.244 1.00 73.14  0  325 ALA A O   1 
ATOM   2235  C  CB  . ALA A 1 325 ? 182.590 170.011 197.515 1.00 73.14  0  325 ALA A CB  1 
ATOM   2236  N  N   . ASN A 1 326 ? 182.039 167.724 195.224 1.00 75.11  0  326 ASN A N   1 
ATOM   2237  C  CA  . ASN A 1 326 ? 181.830 166.328 194.823 1.00 75.11  0  326 ASN A CA  1 
ATOM   2238  C  C   . ASN A 1 326 ? 181.892 165.390 196.034 1.00 75.11  0  326 ASN A C   1 
ATOM   2239  O  O   . ASN A 1 326 ? 182.796 164.564 196.179 1.00 75.11  0  326 ASN A O   1 
ATOM   2240  C  CB  . ASN A 1 326 ? 182.825 165.904 193.733 1.00 75.11  0  326 ASN A CB  1 
ATOM   2241  C  CG  . ASN A 1 326 ? 182.313 164.751 192.895 1.00 75.11  0  326 ASN A CG  1 
ATOM   2242  O  OD1 . ASN A 1 326 ? 181.111 164.621 192.667 1.00 75.11  0  326 ASN A OD1 1 
ATOM   2243  N  ND2 . ASN A 1 326 ? 183.226 163.906 192.431 1.00 75.11  0  326 ASN A ND2 1 
ATOM   2244  N  N   . PHE A 1 327 ? 180.904 165.571 196.917 1.00 76.14  0  327 PHE A N   1 
ATOM   2245  C  CA  . PHE A 1 327 ? 180.851 164.795 198.153 1.00 76.14  0  327 PHE A CA  1 
ATOM   2246  C  C   . PHE A 1 327 ? 180.572 163.320 197.887 1.00 76.14  0  327 PHE A C   1 
ATOM   2247  O  O   . PHE A 1 327 ? 180.991 162.461 198.672 1.00 76.14  0  327 PHE A O   1 
ATOM   2248  C  CB  . PHE A 1 327 ? 179.806 165.382 199.108 1.00 76.14  0  327 PHE A CB  1 
ATOM   2249  C  CG  . PHE A 1 327 ? 178.466 165.661 198.472 1.00 76.14  0  327 PHE A CG  1 
ATOM   2250  C  CD1 . PHE A 1 327 ? 177.498 164.669 198.390 1.00 76.14  0  327 PHE A CD1 1 
ATOM   2251  C  CD2 . PHE A 1 327 ? 178.162 166.927 197.988 1.00 76.14  0  327 PHE A CD2 1 
ATOM   2252  C  CE1 . PHE A 1 327 ? 176.267 164.926 197.816 1.00 76.14  0  327 PHE A CE1 1 
ATOM   2253  C  CE2 . PHE A 1 327 ? 176.932 167.189 197.412 1.00 76.14  0  327 PHE A CE2 1 
ATOM   2254  C  CZ  . PHE A 1 327 ? 175.984 166.187 197.328 1.00 76.14  0  327 PHE A CZ  1 
ATOM   2255  N  N   . THR A 1 328 ? 179.871 163.007 196.804 1.00 77.91  0  328 THR A N   1 
ATOM   2256  C  CA  . THR A 1 328 ? 179.753 161.634 196.344 1.00 77.91  0  328 THR A CA  1 
ATOM   2257  C  C   . THR A 1 328 ? 180.812 161.356 195.282 1.00 77.91  0  328 THR A C   1 
ATOM   2258  O  O   . THR A 1 328 ? 181.223 162.248 194.533 1.00 77.91  0  328 THR A O   1 
ATOM   2259  C  CB  . THR A 1 328 ? 178.344 161.349 195.808 1.00 77.91  0  328 THR A CB  1 
ATOM   2260  O  OG1 . THR A 1 328 ? 178.253 159.981 195.388 1.00 77.91  0  328 THR A OG1 1 
ATOM   2261  C  CG2 . THR A 1 328 ? 177.975 162.277 194.655 1.00 77.91  0  328 THR A CG2 1 
ATOM   2262  N  N   . ASP A 1 329 ? 181.288 160.116 195.253 1.00 82.39  0  329 ASP A N   1 
ATOM   2263  C  CA  . ASP A 1 329 ? 182.376 159.732 194.356 1.00 82.39  0  329 ASP A CA  1 
ATOM   2264  C  C   . ASP A 1 329 ? 181.776 159.333 193.014 1.00 82.39  0  329 ASP A C   1 
ATOM   2265  O  O   . ASP A 1 329 ? 181.301 158.208 192.840 1.00 82.39  0  329 ASP A O   1 
ATOM   2266  C  CB  . ASP A 1 329 ? 183.203 158.605 194.962 1.00 82.39  0  329 ASP A CB  1 
ATOM   2267  C  CG  . ASP A 1 329 ? 183.895 159.016 196.246 1.00 82.39  0  329 ASP A CG  1 
ATOM   2268  O  OD1 . ASP A 1 329 ? 183.737 160.184 196.660 1.00 82.39  0  329 ASP A OD1 1 
ATOM   2269  O  OD2 . ASP A 1 329 ? 184.596 158.172 196.843 1.00 82.39  -1 329 ASP A OD2 1 
ATOM   2270  N  N   . SER A 1 330 ? 181.799 160.263 192.063 1.00 83.93  0  330 SER A N   1 
ATOM   2271  C  CA  . SER A 1 330 ? 181.301 160.010 190.718 1.00 83.93  0  330 SER A CA  1 
ATOM   2272  C  C   . SER A 1 330 ? 182.035 160.925 189.751 1.00 83.93  0  330 SER A C   1 
ATOM   2273  O  O   . SER A 1 330 ? 182.163 162.125 190.010 1.00 83.93  0  330 SER A O   1 
ATOM   2274  C  CB  . SER A 1 330 ? 179.789 160.240 190.632 1.00 83.93  0  330 SER A CB  1 
ATOM   2275  O  OG  . SER A 1 330 ? 179.497 161.599 190.364 1.00 83.93  0  330 SER A OG  1 
ATOM   2276  N  N   . THR A 1 331 ? 182.511 160.357 188.643 1.00 87.18  0  331 THR A N   1 
ATOM   2277  C  CA  . THR A 1 331 ? 183.292 161.129 187.685 1.00 87.18  0  331 THR A CA  1 
ATOM   2278  C  C   . THR A 1 331 ? 182.425 162.021 186.808 1.00 87.18  0  331 THR A C   1 
ATOM   2279  O  O   . THR A 1 331 ? 182.937 162.988 186.233 1.00 87.18  0  331 THR A O   1 
ATOM   2280  C  CB  . THR A 1 331 ? 184.122 160.195 186.801 1.00 87.18  0  331 THR A CB  1 
ATOM   2281  O  OG1 . THR A 1 331 ? 183.275 159.590 185.816 1.00 87.18  0  331 THR A OG1 1 
ATOM   2282  C  CG2 . THR A 1 331 ? 184.772 159.106 187.641 1.00 87.18  0  331 THR A CG2 1 
ATOM   2283  N  N   . THR A 1 332 ? 181.133 161.721 186.694 1.00 87.90  0  332 THR A N   1 
ATOM   2284  C  CA  . THR A 1 332 ? 180.229 162.491 185.850 1.00 87.90  0  332 THR A CA  1 
ATOM   2285  C  C   . THR A 1 332 ? 179.706 163.750 186.530 1.00 87.90  0  332 THR A C   1 
ATOM   2286  O  O   . THR A 1 332 ? 178.955 164.504 185.903 1.00 87.90  0  332 THR A O   1 
ATOM   2287  C  CB  . THR A 1 332 ? 179.047 161.622 185.412 1.00 87.90  0  332 THR A CB  1 
ATOM   2288  O  OG1 . THR A 1 332 ? 178.262 162.332 184.445 1.00 87.90  0  332 THR A OG1 1 
ATOM   2289  C  CG2 . THR A 1 332 ? 178.174 161.271 186.608 1.00 87.90  0  332 THR A CG2 1 
ATOM   2290  N  N   . GLN A 1 333 ? 180.078 163.996 187.787 1.00 85.07  0  333 GLN A N   1 
ATOM   2291  C  CA  . GLN A 1 333 ? 179.634 165.178 188.514 1.00 85.07  0  333 GLN A CA  1 
ATOM   2292  C  C   . GLN A 1 333 ? 180.792 166.030 189.018 1.00 85.07  0  333 GLN A C   1 
ATOM   2293  O  O   . GLN A 1 333 ? 180.575 166.913 189.857 1.00 85.07  0  333 GLN A O   1 
ATOM   2294  C  CB  . GLN A 1 333 ? 178.736 164.773 189.687 1.00 85.07  0  333 GLN A CB  1 
ATOM   2295  C  CG  . GLN A 1 333 ? 177.464 164.052 189.272 1.00 85.07  0  333 GLN A CG  1 
ATOM   2296  C  CD  . GLN A 1 333 ? 176.752 163.412 190.445 1.00 85.07  0  333 GLN A CD  1 
ATOM   2297  O  OE1 . GLN A 1 333 ? 177.307 163.306 191.538 1.00 85.07  0  333 GLN A OE1 1 
ATOM   2298  N  NE2 . GLN A 1 333 ? 175.520 162.972 190.222 1.00 85.07  0  333 GLN A NE2 1 
ATOM   2299  N  N   . SER A 1 334 ? 182.011 165.787 188.542 1.00 83.36  0  334 SER A N   1 
ATOM   2300  C  CA  . SER A 1 334 ? 183.139 166.626 188.918 1.00 83.36  0  334 SER A CA  1 
ATOM   2301  C  C   . SER A 1 334 ? 183.026 167.977 188.226 1.00 83.36  0  334 SER A C   1 
ATOM   2302  O  O   . SER A 1 334 ? 182.712 168.059 187.037 1.00 83.36  0  334 SER A O   1 
ATOM   2303  C  CB  . SER A 1 334 ? 184.458 165.948 188.548 1.00 83.36  0  334 SER A CB  1 
ATOM   2304  O  OG  . SER A 1 334 ? 184.785 166.177 187.189 1.00 83.36  0  334 SER A OG  1 
ATOM   2305  N  N   . CYS A 1 335 ? 183.273 169.045 188.980 1.00 77.92  0  335 CYS A N   1 
ATOM   2306  C  CA  . CYS A 1 335 ? 182.984 170.388 188.505 1.00 77.92  0  335 CYS A CA  1 
ATOM   2307  C  C   . CYS A 1 335 ? 184.084 171.345 188.944 1.00 77.92  0  335 CYS A C   1 
ATOM   2308  O  O   . CYS A 1 335 ? 184.931 171.013 189.777 1.00 77.92  0  335 CYS A O   1 
ATOM   2309  C  CB  . CYS A 1 335 ? 181.618 170.848 189.022 1.00 77.92  0  335 CYS A CB  1 
ATOM   2310  S  SG  . CYS A 1 335 ? 181.109 172.456 188.451 1.00 77.92  0  335 CYS A SG  1 
ATOM   2311  N  N   . THR A 1 336 ? 184.067 172.550 188.369 1.00 70.76  0  336 THR A N   1 
ATOM   2312  C  CA  . THR A 1 336 ? 184.936 173.635 188.804 1.00 70.76  0  336 THR A CA  1 
ATOM   2313  C  C   . THR A 1 336 ? 184.109 174.893 189.035 1.00 70.76  0  336 THR A C   1 
ATOM   2314  O  O   . THR A 1 336 ? 183.042 175.080 188.439 1.00 70.76  0  336 THR A O   1 
ATOM   2315  C  CB  . THR A 1 336 ? 186.078 173.911 187.799 1.00 70.76  0  336 THR A CB  1 
ATOM   2316  O  OG1 . THR A 1 336 ? 186.969 174.892 188.345 1.00 70.76  0  336 THR A OG1 1 
ATOM   2317  C  CG2 . THR A 1 336 ? 185.548 174.403 186.460 1.00 70.76  0  336 THR A CG2 1 
ATOM   2318  N  N   . HIS A 1 337 ? 184.608 175.749 189.925 1.00 65.57  0  337 HIS A N   1 
ATOM   2319  C  CA  . HIS A 1 337 ? 183.877 176.914 190.415 1.00 65.57  0  337 HIS A CA  1 
ATOM   2320  C  C   . HIS A 1 337 ? 184.616 178.179 189.999 1.00 65.57  0  337 HIS A C   1 
ATOM   2321  O  O   . HIS A 1 337 ? 185.691 178.479 190.530 1.00 65.57  0  337 HIS A O   1 
ATOM   2322  C  CB  . HIS A 1 337 ? 183.715 176.847 191.933 1.00 65.57  0  337 HIS A CB  1 
ATOM   2323  C  CG  . HIS A 1 337 ? 183.218 178.118 192.547 1.00 65.57  0  337 HIS A CG  1 
ATOM   2324  N  ND1 . HIS A 1 337 ? 181.882 178.449 192.593 1.00 65.57  0  337 HIS A ND1 1 
ATOM   2325  C  CD2 . HIS A 1 337 ? 183.878 179.134 193.152 1.00 65.57  0  337 HIS A CD2 1 
ATOM   2326  C  CE1 . HIS A 1 337 ? 181.739 179.617 193.193 1.00 65.57  0  337 HIS A CE1 1 
ATOM   2327  N  NE2 . HIS A 1 337 ? 182.936 180.054 193.541 1.00 65.57  0  337 HIS A NE2 1 
ATOM   2328  N  N   . SER A 1 338 ? 184.043 178.918 189.052 1.00 60.65  0  338 SER A N   1 
ATOM   2329  C  CA  . SER A 1 338 ? 184.567 180.211 188.645 1.00 60.65  0  338 SER A CA  1 
ATOM   2330  C  C   . SER A 1 338 ? 183.899 181.309 189.473 1.00 60.65  0  338 SER A C   1 
ATOM   2331  O  O   . SER A 1 338 ? 183.239 181.044 190.481 1.00 60.65  0  338 SER A O   1 
ATOM   2332  C  CB  . SER A 1 338 ? 184.358 180.416 187.146 1.00 60.65  0  338 SER A CB  1 
ATOM   2333  O  OG  . SER A 1 338 ? 185.222 179.583 186.392 1.00 60.65  0  338 SER A OG  1 
ATOM   2334  N  N   . ARG A 1 339 ? 184.072 182.560 189.055 1.00 61.11  0  339 ARG A N   1 
ATOM   2335  C  CA  . ARG A 1 339 ? 183.470 183.683 189.755 1.00 61.11  0  339 ARG A CA  1 
ATOM   2336  C  C   . ARG A 1 339 ? 181.966 183.739 189.497 1.00 61.11  0  339 ARG A C   1 
ATOM   2337  O  O   . ARG A 1 339 ? 181.447 183.113 188.568 1.00 61.11  0  339 ARG A O   1 
ATOM   2338  C  CB  . ARG A 1 339 ? 184.121 184.995 189.320 1.00 61.11  0  339 ARG A CB  1 
ATOM   2339  C  CG  . ARG A 1 339 ? 185.623 184.900 189.110 1.00 61.11  0  339 ARG A CG  1 
ATOM   2340  C  CD  . ARG A 1 339 ? 186.197 186.234 188.669 1.00 61.11  0  339 ARG A CD  1 
ATOM   2341  N  NE  . ARG A 1 339 ? 185.991 187.271 189.675 1.00 61.11  0  339 ARG A NE  1 
ATOM   2342  C  CZ  . ARG A 1 339 ? 186.932 187.702 190.507 1.00 61.11  0  339 ARG A CZ  1 
ATOM   2343  N  NH1 . ARG A 1 339 ? 188.153 187.186 190.454 1.00 61.11  1  339 ARG A NH1 1 
ATOM   2344  N  NH2 . ARG A 1 339 ? 186.654 188.649 191.391 1.00 61.11  0  339 ARG A NH2 1 
ATOM   2345  N  N   . HIS A 1 340 ? 181.273 184.499 190.358 1.00 63.36  0  340 HIS A N   1 
ATOM   2346  C  CA  . HIS A 1 340 ? 179.816 184.704 190.329 1.00 63.36  0  340 HIS A CA  1 
ATOM   2347  C  C   . HIS A 1 340 ? 179.035 183.395 190.434 1.00 63.36  0  340 HIS A C   1 
ATOM   2348  O  O   . HIS A 1 340 ? 177.951 183.273 189.853 1.00 63.36  0  340 HIS A O   1 
ATOM   2349  C  CB  . HIS A 1 340 ? 179.372 185.489 189.089 1.00 63.36  0  340 HIS A CB  1 
ATOM   2350  C  CG  . HIS A 1 340 ? 180.083 186.794 188.910 1.00 63.36  0  340 HIS A CG  1 
ATOM   2351  N  ND1 . HIS A 1 340 ? 180.302 187.357 187.671 1.00 63.36  0  340 HIS A ND1 1 
ATOM   2352  C  CD2 . HIS A 1 340 ? 180.615 187.651 189.812 1.00 63.36  0  340 HIS A CD2 1 
ATOM   2353  C  CE1 . HIS A 1 340 ? 180.943 188.502 187.817 1.00 63.36  0  340 HIS A CE1 1 
ATOM   2354  N  NE2 . HIS A 1 340 ? 181.145 188.704 189.107 1.00 63.36  0  340 HIS A NE2 1 
ATOM   2355  N  N   . ASN A 1 341 ? 179.595 182.430 191.179 1.00 62.82  0  341 ASN A N   1 
ATOM   2356  C  CA  . ASN A 1 341 ? 179.014 181.099 191.409 1.00 62.82  0  341 ASN A CA  1 
ATOM   2357  C  C   . ASN A 1 341 ? 178.727 180.356 190.105 1.00 62.82  0  341 ASN A C   1 
ATOM   2358  O  O   . ASN A 1 341 ? 177.705 179.682 189.967 1.00 62.82  0  341 ASN A O   1 
ATOM   2359  C  CB  . ASN A 1 341 ? 177.756 181.177 192.280 1.00 62.82  0  341 ASN A CB  1 
ATOM   2360  C  CG  . ASN A 1 341 ? 178.046 181.683 193.677 1.00 62.82  0  341 ASN A CG  1 
ATOM   2361  O  OD1 . ASN A 1 341 ? 179.116 181.433 194.230 1.00 62.82  0  341 ASN A OD1 1 
ATOM   2362  N  ND2 . ASN A 1 341 ? 177.091 182.401 194.256 1.00 62.82  0  341 ASN A ND2 1 
ATOM   2363  N  N   . ILE A 1 342 ? 179.628 180.483 189.138 1.00 61.70  0  342 ILE A N   1 
ATOM   2364  C  CA  . ILE A 1 342 ? 179.509 179.770 187.872 1.00 61.70  0  342 ILE A CA  1 
ATOM   2365  C  C   . ILE A 1 342 ? 180.137 178.394 188.043 1.00 61.70  0  342 ILE A C   1 
ATOM   2366  O  O   . ILE A 1 342 ? 181.319 178.275 188.380 1.00 61.70  0  342 ILE A O   1 
ATOM   2367  C  CB  . ILE A 1 342 ? 180.175 180.546 186.727 1.00 61.70  0  342 ILE A CB  1 
ATOM   2368  C  CG1 . ILE A 1 342 ? 179.355 181.787 186.380 1.00 61.70  0  342 ILE A CG1 1 
ATOM   2369  C  CG2 . ILE A 1 342 ? 180.328 179.666 185.497 1.00 61.70  0  342 ILE A CG2 1 
ATOM   2370  C  CD1 . ILE A 1 342 ? 180.070 182.735 185.450 1.00 61.70  0  342 ILE A CD1 1 
ATOM   2371  N  N   . TYR A 1 343 ? 179.344 177.353 187.828 1.00 64.07  0  343 TYR A N   1 
ATOM   2372  C  CA  . TYR A 1 343 ? 179.795 175.977 187.972 1.00 64.07  0  343 TYR A CA  1 
ATOM   2373  C  C   . TYR A 1 343 ? 179.914 175.353 186.589 1.00 64.07  0  343 TYR A C   1 
ATOM   2374  O  O   . TYR A 1 343 ? 178.923 175.269 185.857 1.00 64.07  0  343 TYR A O   1 
ATOM   2375  C  CB  . TYR A 1 343 ? 178.829 175.186 188.848 1.00 64.07  0  343 TYR A CB  1 
ATOM   2376  C  CG  . TYR A 1 343 ? 178.561 175.819 190.187 1.00 64.07  0  343 TYR A CG  1 
ATOM   2377  C  CD1 . TYR A 1 343 ? 179.528 175.814 191.183 1.00 64.07  0  343 TYR A CD1 1 
ATOM   2378  C  CD2 . TYR A 1 343 ? 177.339 176.420 190.457 1.00 64.07  0  343 TYR A CD2 1 
ATOM   2379  C  CE1 . TYR A 1 343 ? 179.286 176.391 192.410 1.00 64.07  0  343 TYR A CE1 1 
ATOM   2380  C  CE2 . TYR A 1 343 ? 177.089 177.000 191.682 1.00 64.07  0  343 TYR A CE2 1 
ATOM   2381  C  CZ  . TYR A 1 343 ? 178.066 176.982 192.653 1.00 64.07  0  343 TYR A CZ  1 
ATOM   2382  O  OH  . TYR A 1 343 ? 177.822 177.558 193.874 1.00 64.07  0  343 TYR A OH  1 
ATOM   2383  N  N   . ARG A 1 344 ? 181.120 174.921 186.230 1.00 73.81  0  344 ARG A N   1 
ATOM   2384  C  CA  . ARG A 1 344 ? 181.380 174.376 184.904 1.00 73.81  0  344 ARG A CA  1 
ATOM   2385  C  C   . ARG A 1 344 ? 181.868 172.939 185.018 1.00 73.81  0  344 ARG A C   1 
ATOM   2386  O  O   . ARG A 1 344 ? 182.833 172.660 185.736 1.00 73.81  0  344 ARG A O   1 
ATOM   2387  C  CB  . ARG A 1 344 ? 182.405 175.228 184.151 1.00 73.81  0  344 ARG A CB  1 
ATOM   2388  C  CG  . ARG A 1 344 ? 182.726 174.714 182.759 1.00 73.81  0  344 ARG A CG  1 
ATOM   2389  C  CD  . ARG A 1 344 ? 183.407 175.778 181.918 1.00 73.81  0  344 ARG A CD  1 
ATOM   2390  N  NE  . ARG A 1 344 ? 183.793 175.269 180.606 1.00 73.81  0  344 ARG A NE  1 
ATOM   2391  C  CZ  . ARG A 1 344 ? 184.235 176.029 179.610 1.00 73.81  0  344 ARG A CZ  1 
ATOM   2392  N  NH1 . ARG A 1 344 ? 184.348 177.340 179.774 1.00 73.81  1  344 ARG A NH1 1 
ATOM   2393  N  NH2 . ARG A 1 344 ? 184.564 175.480 178.449 1.00 73.81  0  344 ARG A NH2 1 
ATOM   2394  N  N   . GLY A 1 345 ? 181.202 172.034 184.307 1.00 73.63  0  345 GLY A N   1 
ATOM   2395  C  CA  . GLY A 1 345 ? 181.618 170.654 184.252 1.00 73.63  0  345 GLY A CA  1 
ATOM   2396  C  C   . GLY A 1 345 ? 182.666 170.426 183.182 1.00 73.63  0  345 GLY A C   1 
ATOM   2397  O  O   . GLY A 1 345 ? 183.193 171.371 182.588 1.00 73.63  0  345 GLY A O   1 
ATOM   2398  N  N   . PRO A 1 346 ? 183.004 169.165 182.925 1.00 76.61  0  346 PRO A N   1 
ATOM   2399  C  CA  . PRO A 1 346 ? 183.933 168.854 181.837 1.00 76.61  0  346 PRO A CA  1 
ATOM   2400  C  C   . PRO A 1 346 ? 183.229 168.706 180.498 1.00 76.61  0  346 PRO A C   1 
ATOM   2401  O  O   . PRO A 1 346 ? 182.086 168.250 180.412 1.00 76.61  0  346 PRO A O   1 
ATOM   2402  C  CB  . PRO A 1 346 ? 184.548 167.520 182.285 1.00 76.61  0  346 PRO A CB  1 
ATOM   2403  C  CG  . PRO A 1 346 ? 183.474 166.873 183.085 1.00 76.61  0  346 PRO A CG  1 
ATOM   2404  C  CD  . PRO A 1 346 ? 182.676 167.977 183.733 1.00 76.61  0  346 PRO A CD  1 
ATOM   2405  N  N   . GLU A 1 347 ? 183.951 169.123 179.450 1.00 79.18  0  347 GLU A N   1 
ATOM   2406  C  CA  . GLU A 1 347 ? 183.548 169.005 178.042 1.00 79.18  0  347 GLU A CA  1 
ATOM   2407  C  C   . GLU A 1 347 ? 182.223 169.723 177.766 1.00 79.18  0  347 GLU A C   1 
ATOM   2408  O  O   . GLU A 1 347 ? 181.214 169.114 177.406 1.00 79.18  0  347 GLU A O   1 
ATOM   2409  C  CB  . GLU A 1 347 ? 183.487 167.536 177.604 1.00 79.18  0  347 GLU A CB  1 
ATOM   2410  N  N   . VAL A 1 348 ? 182.246 171.040 177.943 1.00 80.69  0  348 VAL A N   1 
ATOM   2411  C  CA  . VAL A 1 348 ? 181.063 171.859 177.694 1.00 80.69  0  348 VAL A CA  1 
ATOM   2412  C  C   . VAL A 1 348 ? 181.067 172.429 176.281 1.00 80.69  0  348 VAL A C   1 
ATOM   2413  O  O   . VAL A 1 348 ? 180.024 172.446 175.620 1.00 80.69  0  348 VAL A O   1 
ATOM   2414  C  CB  . VAL A 1 348 ? 180.965 172.974 178.754 1.00 80.69  0  348 VAL A CB  1 
ATOM   2415  C  CG1 . VAL A 1 348 ? 179.618 173.673 178.674 1.00 80.69  0  348 VAL A CG1 1 
ATOM   2416  C  CG2 . VAL A 1 348 ? 181.181 172.399 180.140 1.00 80.69  0  348 VAL A CG2 1 
ATOM   2417  N  N   . SER A 1 349 ? 182.240 172.874 175.813 1.00 88.60  0  349 SER A N   1 
ATOM   2418  C  CA  . SER A 1 349 ? 182.461 173.508 174.506 1.00 88.60  0  349 SER A CA  1 
ATOM   2419  C  C   . SER A 1 349 ? 181.549 174.728 174.329 1.00 88.60  0  349 SER A C   1 
ATOM   2420  O  O   . SER A 1 349 ? 180.629 174.753 173.508 1.00 88.60  0  349 SER A O   1 
ATOM   2421  C  CB  . SER A 1 349 ? 182.294 172.510 173.348 1.00 88.60  0  349 SER A CB  1 
ATOM   2422  O  OG  . SER A 1 349 ? 180.952 172.076 173.212 1.00 88.60  0  349 SER A OG  1 
ATOM   2423  N  N   . LEU A 1 350 ? 181.831 175.734 175.152 1.00 88.72  0  350 LEU A N   1 
ATOM   2424  C  CA  . LEU A 1 350 ? 181.038 176.954 175.178 1.00 88.72  0  350 LEU A CA  1 
ATOM   2425  C  C   . LEU A 1 350 ? 181.247 177.762 173.899 1.00 88.72  0  350 LEU A C   1 
ATOM   2426  O  O   . LEU A 1 350 ? 182.340 177.793 173.328 1.00 88.72  0  350 LEU A O   1 
ATOM   2427  C  CB  . LEU A 1 350 ? 181.409 177.791 176.402 1.00 88.72  0  350 LEU A CB  1 
ATOM   2428  C  CG  . LEU A 1 350 ? 180.441 178.894 176.828 1.00 88.72  0  350 LEU A CG  1 
ATOM   2429  C  CD1 . LEU A 1 350 ? 179.144 178.290 177.344 1.00 88.72  0  350 LEU A CD1 1 
ATOM   2430  C  CD2 . LEU A 1 350 ? 181.074 179.792 177.879 1.00 88.72  0  350 LEU A CD2 1 
ATOM   2431  N  N   . GLY A 1 351 ? 180.178 178.423 173.451 1.00 85.51  0  351 GLY A N   1 
ATOM   2432  C  CA  . GLY A 1 351 ? 180.186 179.141 172.197 1.00 85.51  0  351 GLY A CA  1 
ATOM   2433  C  C   . GLY A 1 351 ? 180.408 180.639 172.365 1.00 85.51  0  351 GLY A C   1 
ATOM   2434  O  O   . GLY A 1 351 ? 180.481 181.178 173.466 1.00 85.51  0  351 GLY A O   1 
ATOM   2435  N  N   . HIS A 1 352 ? 180.516 181.310 171.221 1.00 85.82  0  352 HIS A N   1 
ATOM   2436  C  CA  . HIS A 1 352 ? 180.757 182.746 171.194 1.00 85.82  0  352 HIS A CA  1 
ATOM   2437  C  C   . HIS A 1 352 ? 179.480 183.512 171.505 1.00 85.82  0  352 HIS A C   1 
ATOM   2438  O  O   . HIS A 1 352 ? 178.397 183.167 171.027 1.00 85.82  0  352 HIS A O   1 
ATOM   2439  C  CB  . HIS A 1 352 ? 181.297 183.171 169.828 1.00 85.82  0  352 HIS A CB  1 
ATOM   2440  C  CG  . HIS A 1 352 ? 182.585 182.507 169.453 1.00 85.82  0  352 HIS A CG  1 
ATOM   2441  N  ND1 . HIS A 1 352 ? 183.816 183.056 169.741 1.00 85.82  0  352 HIS A ND1 1 
ATOM   2442  C  CD2 . HIS A 1 352 ? 182.833 181.341 168.812 1.00 85.82  0  352 HIS A CD2 1 
ATOM   2443  C  CE1 . HIS A 1 352 ? 184.767 182.256 169.294 1.00 85.82  0  352 HIS A CE1 1 
ATOM   2444  N  NE2 . HIS A 1 352 ? 184.198 181.208 168.726 1.00 85.82  0  352 HIS A NE2 1 
ATOM   2445  N  N   . GLY A 1 353 ? 179.612 184.561 172.314 1.00 84.83  0  353 GLY A N   1 
ATOM   2446  C  CA  . GLY A 1 353 ? 178.491 185.412 172.646 1.00 84.83  0  353 GLY A CA  1 
ATOM   2447  C  C   . GLY A 1 353 ? 177.600 184.910 173.759 1.00 84.83  0  353 GLY A C   1 
ATOM   2448  O  O   . GLY A 1 353 ? 176.667 185.624 174.149 1.00 84.83  0  353 GLY A O   1 
ATOM   2449  N  N   . SER A 1 354 ? 177.846 183.711 174.280 1.00 83.13  0  354 SER A N   1 
ATOM   2450  C  CA  . SER A 1 354 ? 177.039 183.190 175.373 1.00 83.13  0  354 SER A CA  1 
ATOM   2451  C  C   . SER A 1 354 ? 177.408 183.887 176.676 1.00 83.13  0  354 SER A C   1 
ATOM   2452  O  O   . SER A 1 354 ? 178.587 184.069 176.989 1.00 83.13  0  354 SER A O   1 
ATOM   2453  C  CB  . SER A 1 354 ? 177.237 181.683 175.513 1.00 83.13  0  354 SER A CB  1 
ATOM   2454  O  OG  . SER A 1 354 ? 178.329 181.407 176.369 1.00 83.13  0  354 SER A OG  1 
ATOM   2455  N  N   . ILE A 1 355 ? 176.390 184.275 177.438 1.00 79.05  0  355 ILE A N   1 
ATOM   2456  C  CA  . ILE A 1 355 ? 176.572 185.052 178.658 1.00 79.05  0  355 ILE A CA  1 
ATOM   2457  C  C   . ILE A 1 355 ? 176.113 184.213 179.840 1.00 79.05  0  355 ILE A C   1 
ATOM   2458  O  O   . ILE A 1 355 ? 174.944 183.813 179.911 1.00 79.05  0  355 ILE A O   1 
ATOM   2459  C  CB  . ILE A 1 355 ? 175.806 186.383 178.605 1.00 79.05  0  355 ILE A CB  1 
ATOM   2460  C  CG1 . ILE A 1 355 ? 176.304 187.238 177.438 1.00 79.05  0  355 ILE A CG1 1 
ATOM   2461  C  CG2 . ILE A 1 355 ? 175.949 187.132 179.919 1.00 79.05  0  355 ILE A CG2 1 
ATOM   2462  C  CD1 . ILE A 1 355 ? 175.485 188.487 177.204 1.00 79.05  0  355 ILE A CD1 1 
ATOM   2463  N  N   . LEU A 1 356 ? 177.033 183.947 180.765 1.00 76.81  0  356 LEU A N   1 
ATOM   2464  C  CA  . LEU A 1 356 ? 176.727 183.337 182.055 1.00 76.81  0  356 LEU A CA  1 
ATOM   2465  C  C   . LEU A 1 356 ? 177.090 184.361 183.120 1.00 76.81  0  356 LEU A C   1 
ATOM   2466  O  O   . LEU A 1 356 ? 178.274 184.607 183.369 1.00 76.81  0  356 LEU A O   1 
ATOM   2467  C  CB  . LEU A 1 356 ? 177.506 182.037 182.257 1.00 76.81  0  356 LEU A CB  1 
ATOM   2468  C  CG  . LEU A 1 356 ? 177.635 181.084 181.069 1.00 76.81  0  356 LEU A CG  1 
ATOM   2469  C  CD1 . LEU A 1 356 ? 178.520 179.903 181.434 1.00 76.81  0  356 LEU A CD1 1 
ATOM   2470  C  CD2 . LEU A 1 356 ? 176.273 180.606 180.604 1.00 76.81  0  356 LEU A CD2 1 
ATOM   2471  N  N   . GLU A 1 357 ? 176.081 184.970 183.739 1.00 75.08  0  357 GLU A N   1 
ATOM   2472  C  CA  . GLU A 1 357 ? 176.334 186.098 184.626 1.00 75.08  0  357 GLU A CA  1 
ATOM   2473  C  C   . GLU A 1 357 ? 176.249 185.748 186.106 1.00 75.08  0  357 GLU A C   1 
ATOM   2474  O  O   . GLU A 1 357 ? 177.022 186.294 186.900 1.00 75.08  0  357 GLU A O   1 
ATOM   2475  C  CB  . GLU A 1 357 ? 175.369 187.249 184.314 1.00 75.08  0  357 GLU A CB  1 
ATOM   2476  C  CG  . GLU A 1 357 ? 173.908 186.856 184.227 1.00 75.08  0  357 GLU A CG  1 
ATOM   2477  C  CD  . GLU A 1 357 ? 172.981 188.049 184.341 1.00 75.08  0  357 GLU A CD  1 
ATOM   2478  O  OE1 . GLU A 1 357 ? 173.433 189.182 184.069 1.00 75.08  0  357 GLU A OE1 1 
ATOM   2479  O  OE2 . GLU A 1 357 ? 171.803 187.856 184.705 1.00 75.08  -1 357 GLU A OE2 1 
ATOM   2480  N  N   . GLU A 1 358 ? 175.349 184.848 186.505 1.00 71.57  0  358 GLU A N   1 
ATOM   2481  C  CA  . GLU A 1 358 ? 175.132 184.595 187.925 1.00 71.57  0  358 GLU A CA  1 
ATOM   2482  C  C   . GLU A 1 358 ? 174.455 183.247 188.118 1.00 71.57  0  358 GLU A C   1 
ATOM   2483  O  O   . GLU A 1 358 ? 173.435 182.973 187.476 1.00 71.57  0  358 GLU A O   1 
ATOM   2484  C  CB  . GLU A 1 358 ? 174.276 185.705 188.550 1.00 71.57  0  358 GLU A CB  1 
ATOM   2485  C  CG  . GLU A 1 358 ? 174.051 185.560 190.044 1.00 71.57  0  358 GLU A CG  1 
ATOM   2486  C  CD  . GLU A 1 358 ? 172.802 186.278 190.516 1.00 71.57  0  358 GLU A CD  1 
ATOM   2487  O  OE1 . GLU A 1 358 ? 172.117 186.897 189.674 1.00 71.57  0  358 GLU A OE1 1 
ATOM   2488  O  OE2 . GLU A 1 358 ? 172.506 186.225 191.728 1.00 71.57  -1 358 GLU A OE2 1 
ATOM   2489  N  N   . ASN A 1 359 ? 175.041 182.417 188.990 1.00 67.51  0  359 ASN A N   1 
ATOM   2490  C  CA  . ASN A 1 359 ? 174.421 181.214 189.559 1.00 67.51  0  359 ASN A CA  1 
ATOM   2491  C  C   . ASN A 1 359 ? 174.075 180.178 188.484 1.00 67.51  0  359 ASN A C   1 
ATOM   2492  O  O   . ASN A 1 359 ? 172.939 179.717 188.369 1.00 67.51  0  359 ASN A O   1 
ATOM   2493  C  CB  . ASN A 1 359 ? 173.182 181.584 190.384 1.00 67.51  0  359 ASN A CB  1 
ATOM   2494  C  CG  . ASN A 1 359 ? 173.523 182.372 191.630 1.00 67.51  0  359 ASN A CG  1 
ATOM   2495  O  OD1 . ASN A 1 359 ? 174.606 182.229 192.193 1.00 67.51  0  359 ASN A OD1 1 
ATOM   2496  N  ND2 . ASN A 1 359 ? 172.594 183.213 192.068 1.00 67.51  0  359 ASN A ND2 1 
ATOM   2497  N  N   . VAL A 1 360 ? 175.084 179.793 187.709 1.00 65.05  0  360 VAL A N   1 
ATOM   2498  C  CA  . VAL A 1 360 ? 174.898 178.911 186.563 1.00 65.05  0  360 VAL A CA  1 
ATOM   2499  C  C   . VAL A 1 360 ? 175.705 177.641 186.786 1.00 65.05  0  360 VAL A C   1 
ATOM   2500  O  O   . VAL A 1 360 ? 176.906 177.705 187.071 1.00 65.05  0  360 VAL A O   1 
ATOM   2501  C  CB  . VAL A 1 360 ? 175.314 179.607 185.253 1.00 65.05  0  360 VAL A CB  1 
ATOM   2502  C  CG1 . VAL A 1 360 ? 175.280 178.637 184.085 1.00 65.05  0  360 VAL A CG1 1 
ATOM   2503  C  CG2 . VAL A 1 360 ? 174.415 180.799 184.981 1.00 65.05  0  360 VAL A CG2 1 
ATOM   2504  N  N   . LEU A 1 361 ? 175.046 176.490 186.656 1.00 63.65  0  361 LEU A N   1 
ATOM   2505  C  CA  . LEU A 1 361 ? 175.704 175.192 186.721 1.00 63.65  0  361 LEU A CA  1 
ATOM   2506  C  C   . LEU A 1 361 ? 175.534 174.486 185.385 1.00 63.65  0  361 LEU A C   1 
ATOM   2507  O  O   . LEU A 1 361 ? 174.434 174.465 184.824 1.00 63.65  0  361 LEU A O   1 
ATOM   2508  C  CB  . LEU A 1 361 ? 175.145 174.332 187.862 1.00 63.65  0  361 LEU A CB  1 
ATOM   2509  C  CG  . LEU A 1 361 ? 175.906 173.044 188.210 1.00 63.65  0  361 LEU A CG  1 
ATOM   2510  C  CD1 . LEU A 1 361 ? 175.884 172.860 189.704 1.00 63.65  0  361 LEU A CD1 1 
ATOM   2511  C  CD2 . LEU A 1 361 ? 175.355 171.791 187.541 1.00 63.65  0  361 LEU A CD2 1 
ATOM   2512  N  N   . LEU A 1 362 ? 176.622 173.907 184.885 1.00 69.47  0  362 LEU A N   1 
ATOM   2513  C  CA  . LEU A 1 362 ? 176.631 173.188 183.619 1.00 69.47  0  362 LEU A CA  1 
ATOM   2514  C  C   . LEU A 1 362 ? 177.112 171.765 183.860 1.00 69.47  0  362 LEU A C   1 
ATOM   2515  O  O   . LEU A 1 362 ? 178.178 171.559 184.450 1.00 69.47  0  362 LEU A O   1 
ATOM   2516  C  CB  . LEU A 1 362 ? 177.526 173.888 182.593 1.00 69.47  0  362 LEU A CB  1 
ATOM   2517  C  CG  . LEU A 1 362 ? 177.248 175.376 182.380 1.00 69.47  0  362 LEU A CG  1 
ATOM   2518  C  CD1 . LEU A 1 362 ? 178.210 175.973 181.366 1.00 69.47  0  362 LEU A CD1 1 
ATOM   2519  C  CD2 . LEU A 1 362 ? 175.806 175.589 181.955 1.00 69.47  0  362 LEU A CD2 1 
ATOM   2520  N  N   . GLY A 1 363 ? 176.330 170.790 183.404 1.00 73.39  0  363 GLY A N   1 
ATOM   2521  C  CA  . GLY A 1 363 ? 176.680 169.398 183.575 1.00 73.39  0  363 GLY A CA  1 
ATOM   2522  C  C   . GLY A 1 363 ? 177.749 168.939 182.602 1.00 73.39  0  363 GLY A C   1 
ATOM   2523  O  O   . GLY A 1 363 ? 178.188 169.665 181.711 1.00 73.39  0  363 GLY A O   1 
ATOM   2524  N  N   . SER A 1 364 ? 178.172 167.691 182.787 1.00 77.00  0  364 SER A N   1 
ATOM   2525  C  CA  . SER A 1 364 ? 179.202 167.098 181.944 1.00 77.00  0  364 SER A CA  1 
ATOM   2526  C  C   . SER A 1 364 ? 178.614 166.733 180.587 1.00 77.00  0  364 SER A C   1 
ATOM   2527  O  O   . SER A 1 364 ? 177.637 165.981 180.508 1.00 77.00  0  364 SER A O   1 
ATOM   2528  C  CB  . SER A 1 364 ? 179.797 165.865 182.621 1.00 77.00  0  364 SER A CB  1 
ATOM   2529  O  OG  . SER A 1 364 ? 178.781 165.053 183.184 1.00 77.00  0  364 SER A OG  1 
ATOM   2530  N  N   . GLY A 1 365 ? 179.211 167.259 179.521 1.00 79.08  0  365 GLY A N   1 
ATOM   2531  C  CA  . GLY A 1 365 ? 178.740 166.985 178.181 1.00 79.08  0  365 GLY A CA  1 
ATOM   2532  C  C   . GLY A 1 365 ? 177.612 167.866 177.697 1.00 79.08  0  365 GLY A C   1 
ATOM   2533  O  O   . GLY A 1 365 ? 177.016 167.564 176.658 1.00 79.08  0  365 GLY A O   1 
ATOM   2534  N  N   . THR A 1 366 ? 177.297 168.943 178.413 1.00 78.42  0  366 THR A N   1 
ATOM   2535  C  CA  . THR A 1 366 ? 176.227 169.845 178.006 1.00 78.42  0  366 THR A CA  1 
ATOM   2536  C  C   . THR A 1 366 ? 176.699 170.706 176.841 1.00 78.42  0  366 THR A C   1 
ATOM   2537  O  O   . THR A 1 366 ? 177.656 171.475 176.979 1.00 78.42  0  366 THR A O   1 
ATOM   2538  C  CB  . THR A 1 366 ? 175.791 170.721 179.177 1.00 78.42  0  366 THR A CB  1 
ATOM   2539  O  OG1 . THR A 1 366 ? 175.191 169.905 180.191 1.00 78.42  0  366 THR A OG1 1 
ATOM   2540  C  CG2 . THR A 1 366 ? 174.788 171.766 178.715 1.00 78.42  0  366 THR A CG2 1 
ATOM   2541  N  N   . VAL A 1 367 ? 176.029 170.581 175.701 1.00 80.17  0  367 VAL A N   1 
ATOM   2542  C  CA  . VAL A 1 367 ? 176.381 171.332 174.501 1.00 80.17  0  367 VAL A CA  1 
ATOM   2543  C  C   . VAL A 1 367 ? 175.614 172.648 174.515 1.00 80.17  0  367 VAL A C   1 
ATOM   2544  O  O   . VAL A 1 367 ? 174.381 172.655 174.584 1.00 80.17  0  367 VAL A O   1 
ATOM   2545  C  CB  . VAL A 1 367 ? 176.075 170.525 173.231 1.00 80.17  0  367 VAL A CB  1 
ATOM   2546  C  CG1 . VAL A 1 367 ? 176.351 171.360 171.989 1.00 80.17  0  367 VAL A CG1 1 
ATOM   2547  C  CG2 . VAL A 1 367 ? 176.892 169.242 173.211 1.00 80.17  0  367 VAL A CG2 1 
ATOM   2548  N  N   . ILE A 1 368 ? 176.341 173.760 174.449 1.00 83.05  0  368 ILE A N   1 
ATOM   2549  C  CA  . ILE A 1 368 ? 175.755 175.095 174.482 1.00 83.05  0  368 ILE A CA  1 
ATOM   2550  C  C   . ILE A 1 368 ? 176.149 175.821 173.204 1.00 83.05  0  368 ILE A C   1 
ATOM   2551  O  O   . ILE A 1 368 ? 177.334 175.873 172.854 1.00 83.05  0  368 ILE A O   1 
ATOM   2552  C  CB  . ILE A 1 368 ? 176.209 175.878 175.728 1.00 83.05  0  368 ILE A CB  1 
ATOM   2553  C  CG1 . ILE A 1 368 ? 175.647 175.228 176.993 1.00 83.05  0  368 ILE A CG1 1 
ATOM   2554  C  CG2 . ILE A 1 368 ? 175.783 177.341 175.648 1.00 83.05  0  368 ILE A CG2 1 
ATOM   2555  C  CD1 . ILE A 1 368 ? 175.996 175.964 178.259 1.00 83.05  0  368 ILE A CD1 1 
ATOM   2556  N  N   . GLY A 1 369 ? 175.158 176.379 172.511 1.00 85.64  0  369 GLY A N   1 
ATOM   2557  C  CA  . GLY A 1 369 ? 175.395 177.099 171.276 1.00 85.64  0  369 GLY A CA  1 
ATOM   2558  C  C   . GLY A 1 369 ? 175.933 178.504 171.464 1.00 85.64  0  369 GLY A C   1 
ATOM   2559  O  O   . GLY A 1 369 ? 176.736 178.761 172.366 1.00 85.64  0  369 GLY A O   1 
ATOM   2560  N  N   . SER A 1 370 ? 175.495 179.426 170.612 1.00 86.73  0  370 SER A N   1 
ATOM   2561  C  CA  . SER A 1 370 ? 176.005 180.787 170.593 1.00 86.73  0  370 SER A CA  1 
ATOM   2562  C  C   . SER A 1 370 ? 174.929 181.777 171.021 1.00 86.73  0  370 SER A C   1 
ATOM   2563  O  O   . SER A 1 370 ? 173.732 181.520 170.862 1.00 86.73  0  370 SER A O   1 
ATOM   2564  C  CB  . SER A 1 370 ? 176.518 181.153 169.197 1.00 86.73  0  370 SER A CB  1 
ATOM   2565  O  OG  . SER A 1 370 ? 177.307 180.109 168.655 1.00 86.73  0  370 SER A OG  1 
ATOM   2566  N  N   . ASN A 1 371 ? 175.388 182.907 171.579 1.00 87.62  0  371 ASN A N   1 
ATOM   2567  C  CA  . ASN A 1 371 ? 174.555 184.061 171.952 1.00 87.62  0  371 ASN A CA  1 
ATOM   2568  C  C   . ASN A 1 371 ? 173.475 183.698 172.971 1.00 87.62  0  371 ASN A C   1 
ATOM   2569  O  O   . ASN A 1 371 ? 172.357 184.215 172.928 1.00 87.62  0  371 ASN A O   1 
ATOM   2570  C  CB  . ASN A 1 371 ? 173.936 184.728 170.719 1.00 87.62  0  371 ASN A CB  1 
ATOM   2571  C  CG  . ASN A 1 371 ? 174.922 184.874 169.578 1.00 87.62  0  371 ASN A CG  1 
ATOM   2572  O  OD1 . ASN A 1 371 ? 175.809 185.727 169.614 1.00 87.62  0  371 ASN A OD1 1 
ATOM   2573  N  ND2 . ASN A 1 371 ? 174.771 184.041 168.555 1.00 87.62  0  371 ASN A ND2 1 
ATOM   2574  N  N   . CYS A 1 372 ? 173.809 182.807 173.897 1.00 86.24  0  372 CYS A N   1 
ATOM   2575  C  CA  . CYS A 1 372 ? 172.884 182.418 174.949 1.00 86.24  0  372 CYS A CA  1 
ATOM   2576  C  C   . CYS A 1 372 ? 172.999 183.366 176.141 1.00 86.24  0  372 CYS A C   1 
ATOM   2577  O  O   . CYS A 1 372 ? 173.952 184.138 176.269 1.00 86.24  0  372 CYS A O   1 
ATOM   2578  C  CB  . CYS A 1 372 ? 173.153 180.979 175.387 1.00 86.24  0  372 CYS A CB  1 
ATOM   2579  S  SG  . CYS A 1 372 ? 173.536 179.851 174.028 1.00 86.24  0  372 CYS A SG  1 
ATOM   2580  N  N   . PHE A 1 373 ? 172.002 183.304 177.023 1.00 76.89  0  373 PHE A N   1 
ATOM   2581  C  CA  . PHE A 1 373 ? 171.992 184.123 178.236 1.00 76.89  0  373 PHE A CA  1 
ATOM   2582  C  C   . PHE A 1 373 ? 171.379 183.286 179.352 1.00 76.89  0  373 PHE A C   1 
ATOM   2583  O  O   . PHE A 1 373 ? 170.154 183.174 179.451 1.00 76.89  0  373 PHE A O   1 
ATOM   2584  C  CB  . PHE A 1 373 ? 171.221 185.420 178.028 1.00 76.89  0  373 PHE A CB  1 
ATOM   2585  C  CG  . PHE A 1 373 ? 171.085 186.249 179.271 1.00 76.89  0  373 PHE A CG  1 
ATOM   2586  C  CD1 . PHE A 1 373 ? 172.190 186.883 179.819 1.00 76.89  0  373 PHE A CD1 1 
ATOM   2587  C  CD2 . PHE A 1 373 ? 169.854 186.397 179.891 1.00 76.89  0  373 PHE A CD2 1 
ATOM   2588  C  CE1 . PHE A 1 373 ? 172.070 187.649 180.965 1.00 76.89  0  373 PHE A CE1 1 
ATOM   2589  C  CE2 . PHE A 1 373 ? 169.726 187.162 181.037 1.00 76.89  0  373 PHE A CE2 1 
ATOM   2590  C  CZ  . PHE A 1 373 ? 170.836 187.789 181.574 1.00 76.89  0  373 PHE A CZ  1 
ATOM   2591  N  N   . ILE A 1 374 ? 172.232 182.712 180.195 1.00 74.30  0  374 ILE A N   1 
ATOM   2592  C  CA  . ILE A 1 374 ? 171.818 181.804 181.258 1.00 74.30  0  374 ILE A CA  1 
ATOM   2593  C  C   . ILE A 1 374 ? 172.098 182.473 182.596 1.00 74.30  0  374 ILE A C   1 
ATOM   2594  O  O   . ILE A 1 374 ? 173.191 183.013 182.805 1.00 74.30  0  374 ILE A O   1 
ATOM   2595  C  CB  . ILE A 1 374 ? 172.551 180.456 181.150 1.00 74.30  0  374 ILE A CB  1 
ATOM   2596  C  CG1 . ILE A 1 374 ? 172.509 179.939 179.710 1.00 74.30  0  374 ILE A CG1 1 
ATOM   2597  C  CG2 . ILE A 1 374 ? 171.952 179.447 182.094 1.00 74.30  0  374 ILE A CG2 1 
ATOM   2598  C  CD1 . ILE A 1 374 ? 173.237 178.626 179.508 1.00 74.30  0  374 ILE A CD1 1 
ATOM   2599  N  N   . THR A 1 375 ? 171.115 182.446 183.498 1.00 70.33  0  375 THR A N   1 
ATOM   2600  C  CA  . THR A 1 375 ? 171.294 183.007 184.831 1.00 70.33  0  375 THR A CA  1 
ATOM   2601  C  C   . THR A 1 375 ? 170.374 182.305 185.821 1.00 70.33  0  375 THR A C   1 
ATOM   2602  O  O   . THR A 1 375 ? 169.235 181.964 185.486 1.00 70.33  0  375 THR A O   1 
ATOM   2603  C  CB  . THR A 1 375 ? 171.056 184.525 184.855 1.00 70.33  0  375 THR A CB  1 
ATOM   2604  O  OG1 . THR A 1 375 ? 171.031 184.987 186.212 1.00 70.33  0  375 THR A OG1 1 
ATOM   2605  C  CG2 . THR A 1 375 ? 169.767 184.901 184.155 1.00 70.33  0  375 THR A CG2 1 
ATOM   2606  N  N   . ASN A 1 376 ? 170.903 182.072 187.030 1.00 69.16  0  376 ASN A N   1 
ATOM   2607  C  CA  . ASN A 1 376 ? 170.179 181.503 188.175 1.00 69.16  0  376 ASN A CA  1 
ATOM   2608  C  C   . ASN A 1 376 ? 169.577 180.130 187.877 1.00 69.16  0  376 ASN A C   1 
ATOM   2609  O  O   . ASN A 1 376 ? 168.538 179.766 188.432 1.00 69.16  0  376 ASN A O   1 
ATOM   2610  C  CB  . ASN A 1 376 ? 169.092 182.457 188.684 1.00 69.16  0  376 ASN A CB  1 
ATOM   2611  C  CG  . ASN A 1 376 ? 169.659 183.764 189.199 1.00 69.16  0  376 ASN A CG  1 
ATOM   2612  O  OD1 . ASN A 1 376 ? 169.968 183.895 190.383 1.00 69.16  0  376 ASN A OD1 1 
ATOM   2613  N  ND2 . ASN A 1 376 ? 169.799 184.740 188.311 1.00 69.16  0  376 ASN A ND2 1 
ATOM   2614  N  N   . SER A 1 377 ? 170.226 179.346 187.019 1.00 66.31  0  377 SER A N   1 
ATOM   2615  C  CA  . SER A 1 377 ? 169.671 178.080 186.565 1.00 66.31  0  377 SER A CA  1 
ATOM   2616  C  C   . SER A 1 377 ? 170.717 176.982 186.694 1.00 66.31  0  377 SER A C   1 
ATOM   2617  O  O   . SER A 1 377 ? 171.921 177.242 186.742 1.00 66.31  0  377 SER A O   1 
ATOM   2618  C  CB  . SER A 1 377 ? 169.191 178.156 185.112 1.00 66.31  0  377 SER A CB  1 
ATOM   2619  O  OG  . SER A 1 377 ? 170.195 177.699 184.228 1.00 66.31  0  377 SER A OG  1 
ATOM   2620  N  N   . VAL A 1 378 ? 170.236 175.743 186.753 1.00 64.11  0  378 VAL A N   1 
ATOM   2621  C  CA  . VAL A 1 378 ? 171.084 174.558 186.761 1.00 64.11  0  378 VAL A CA  1 
ATOM   2622  C  C   . VAL A 1 378 ? 170.781 173.750 185.502 1.00 64.11  0  378 VAL A C   1 
ATOM   2623  O  O   . VAL A 1 378 ? 169.615 173.588 185.123 1.00 64.11  0  378 VAL A O   1 
ATOM   2624  C  CB  . VAL A 1 378 ? 170.895 173.736 188.056 1.00 64.11  0  378 VAL A CB  1 
ATOM   2625  C  CG1 . VAL A 1 378 ? 169.431 173.427 188.328 1.00 64.11  0  378 VAL A CG1 1 
ATOM   2626  C  CG2 . VAL A 1 378 ? 171.705 172.451 188.029 1.00 64.11  0  378 VAL A CG2 1 
ATOM   2627  N  N   . ILE A 1 379 ? 171.834 173.302 184.819 1.00 67.73  0  379 ILE A N   1 
ATOM   2628  C  CA  . ILE A 1 379 ? 171.712 172.499 183.609 1.00 67.73  0  379 ILE A CA  1 
ATOM   2629  C  C   . ILE A 1 379 ? 172.290 171.120 183.891 1.00 67.73  0  379 ILE A C   1 
ATOM   2630  O  O   . ILE A 1 379 ? 173.341 170.996 184.530 1.00 67.73  0  379 ILE A O   1 
ATOM   2631  C  CB  . ILE A 1 379 ? 172.425 173.158 182.408 1.00 67.73  0  379 ILE A CB  1 
ATOM   2632  C  CG1 . ILE A 1 379 ? 172.160 174.666 182.380 1.00 67.73  0  379 ILE A CG1 1 
ATOM   2633  C  CG2 . ILE A 1 379 ? 171.972 172.527 181.101 1.00 67.73  0  379 ILE A CG2 1 
ATOM   2634  C  CD1 . ILE A 1 379 ? 170.714 175.036 182.117 1.00 67.73  0  379 ILE A CD1 1 
ATOM   2635  N  N   . GLY A 1 380 ? 171.604 170.083 183.410 1.00 74.05  0  380 GLY A N   1 
ATOM   2636  C  CA  . GLY A 1 380 ? 172.032 168.725 183.636 1.00 74.05  0  380 GLY A CA  1 
ATOM   2637  C  C   . GLY A 1 380 ? 173.194 168.327 182.751 1.00 74.05  0  380 GLY A C   1 
ATOM   2638  O  O   . GLY A 1 380 ? 173.717 169.113 181.950 1.00 74.05  0  380 GLY A O   1 
ATOM   2639  N  N   . PRO A 1 381 ? 173.628 167.077 182.902 1.00 76.48  0  381 PRO A N   1 
ATOM   2640  C  CA  . PRO A 1 381 ? 174.681 166.555 182.025 1.00 76.48  0  381 PRO A CA  1 
ATOM   2641  C  C   . PRO A 1 381 ? 174.122 166.018 180.717 1.00 76.48  0  381 PRO A C   1 
ATOM   2642  O  O   . PRO A 1 381 ? 173.042 165.424 180.671 1.00 76.48  0  381 PRO A O   1 
ATOM   2643  C  CB  . PRO A 1 381 ? 175.310 165.435 182.862 1.00 76.48  0  381 PRO A CB  1 
ATOM   2644  C  CG  . PRO A 1 381 ? 174.203 164.962 183.733 1.00 76.48  0  381 PRO A CG  1 
ATOM   2645  C  CD  . PRO A 1 381 ? 173.318 166.150 184.005 1.00 76.48  0  381 PRO A CD  1 
ATOM   2646  N  N   . GLY A 1 382 ? 174.875 166.240 179.644 1.00 79.55  0  382 GLY A N   1 
ATOM   2647  C  CA  . GLY A 1 382 ? 174.505 165.732 178.333 1.00 79.55  0  382 GLY A CA  1 
ATOM   2648  C  C   . GLY A 1 382 ? 173.328 166.431 177.688 1.00 79.55  0  382 GLY A C   1 
ATOM   2649  O  O   . GLY A 1 382 ? 172.453 165.765 177.121 1.00 79.55  0  382 GLY A O   1 
ATOM   2650  N  N   . CYS A 1 383 ? 173.283 167.755 177.758 1.00 79.68  0  383 CYS A N   1 
ATOM   2651  C  CA  . CYS A 1 383 ? 172.206 168.535 177.169 1.00 79.68  0  383 CYS A CA  1 
ATOM   2652  C  C   . CYS A 1 383 ? 172.673 169.210 175.884 1.00 79.68  0  383 CYS A C   1 
ATOM   2653  O  O   . CYS A 1 383 ? 173.865 169.268 175.573 1.00 79.68  0  383 CYS A O   1 
ATOM   2654  C  CB  . CYS A 1 383 ? 171.692 169.578 178.164 1.00 79.68  0  383 CYS A CB  1 
ATOM   2655  S  SG  . CYS A 1 383 ? 171.293 168.911 179.789 1.00 79.68  0  383 CYS A SG  1 
ATOM   2656  N  N   . HIS A 1 384 ? 171.704 169.726 175.131 1.00 80.66  0  384 HIS A N   1 
ATOM   2657  C  CA  . HIS A 1 384 ? 171.966 170.416 173.874 1.00 80.66  0  384 HIS A CA  1 
ATOM   2658  C  C   . HIS A 1 384 ? 171.141 171.692 173.852 1.00 80.66  0  384 HIS A C   1 
ATOM   2659  O  O   . HIS A 1 384 ? 169.907 171.636 173.836 1.00 80.66  0  384 HIS A O   1 
ATOM   2660  C  CB  . HIS A 1 384 ? 171.634 169.530 172.670 1.00 80.66  0  384 HIS A CB  1 
ATOM   2661  C  CG  . HIS A 1 384 ? 172.473 168.293 172.583 1.00 80.66  0  384 HIS A CG  1 
ATOM   2662  N  ND1 . HIS A 1 384 ? 172.254 167.186 173.374 1.00 80.66  0  384 HIS A ND1 1 
ATOM   2663  C  CD2 . HIS A 1 384 ? 173.535 167.990 171.799 1.00 80.66  0  384 HIS A CD2 1 
ATOM   2664  C  CE1 . HIS A 1 384 ? 173.144 166.255 173.081 1.00 80.66  0  384 HIS A CE1 1 
ATOM   2665  N  NE2 . HIS A 1 384 ? 173.932 166.717 172.127 1.00 80.66  0  384 HIS A NE2 1 
ATOM   2666  N  N   . ILE A 1 385 ? 171.821 172.834 173.852 1.00 82.50  0  385 ILE A N   1 
ATOM   2667  C  CA  . ILE A 1 385 ? 171.183 174.144 173.891 1.00 82.50  0  385 ILE A CA  1 
ATOM   2668  C  C   . ILE A 1 385 ? 171.388 174.822 172.543 1.00 82.50  0  385 ILE A C   1 
ATOM   2669  O  O   . ILE A 1 385 ? 172.469 174.732 171.950 1.00 82.50  0  385 ILE A O   1 
ATOM   2670  C  CB  . ILE A 1 385 ? 171.744 175.002 175.042 1.00 82.50  0  385 ILE A CB  1 
ATOM   2671  C  CG1 . ILE A 1 385 ? 171.940 174.150 176.300 1.00 82.50  0  385 ILE A CG1 1 
ATOM   2672  C  CG2 . ILE A 1 385 ? 170.814 176.155 175.352 1.00 82.50  0  385 ILE A CG2 1 
ATOM   2673  C  CD1 . ILE A 1 385 ? 170.648 173.665 176.940 1.00 82.50  0  385 ILE A CD1 1 
ATOM   2674  N  N   . GLY A 1 386 ? 170.349 175.503 172.060 1.00 86.67  0  386 GLY A N   1 
ATOM   2675  C  CA  . GLY A 1 386 ? 170.398 176.139 170.758 1.00 86.67  0  386 GLY A CA  1 
ATOM   2676  C  C   . GLY A 1 386 ? 171.090 177.486 170.727 1.00 86.67  0  386 GLY A C   1 
ATOM   2677  O  O   . GLY A 1 386 ? 172.128 177.675 171.366 1.00 86.67  0  386 GLY A O   1 
ATOM   2678  N  N   . ASP A 1 387 ? 170.519 178.435 169.988 1.00 87.82  0  387 ASP A N   1 
ATOM   2679  C  CA  . ASP A 1 387 ? 171.116 179.748 169.785 1.00 87.82  0  387 ASP A CA  1 
ATOM   2680  C  C   . ASP A 1 387 ? 170.090 180.831 170.079 1.00 87.82  0  387 ASP A C   1 
ATOM   2681  O  O   . ASP A 1 387 ? 168.904 180.660 169.780 1.00 87.82  0  387 ASP A O   1 
ATOM   2682  C  CB  . ASP A 1 387 ? 171.642 179.903 168.353 1.00 87.82  0  387 ASP A CB  1 
ATOM   2683  C  CG  . ASP A 1 387 ? 172.808 178.983 168.059 1.00 87.82  0  387 ASP A CG  1 
ATOM   2684  O  OD1 . ASP A 1 387 ? 173.633 178.759 168.969 1.00 87.82  0  387 ASP A OD1 1 
ATOM   2685  O  OD2 . ASP A 1 387 ? 172.902 178.483 166.918 1.00 87.82  -1 387 ASP A OD2 1 
ATOM   2686  N  N   . ASN A 1 388 ? 170.570 181.947 170.649 1.00 88.74  0  388 ASN A N   1 
ATOM   2687  C  CA  . ASN A 1 388 ? 169.746 183.094 171.060 1.00 88.74  0  388 ASN A CA  1 
ATOM   2688  C  C   . ASN A 1 388 ? 168.640 182.662 172.023 1.00 88.74  0  388 ASN A C   1 
ATOM   2689  O  O   . ASN A 1 388 ? 167.455 182.934 171.817 1.00 88.74  0  388 ASN A O   1 
ATOM   2690  C  CB  . ASN A 1 388 ? 169.175 183.850 169.854 1.00 88.74  0  388 ASN A CB  1 
ATOM   2691  C  CG  . ASN A 1 388 ? 170.220 184.128 168.789 1.00 88.74  0  388 ASN A CG  1 
ATOM   2692  O  OD1 . ASN A 1 388 ? 170.735 183.211 168.149 1.00 88.74  0  388 ASN A OD1 1 
ATOM   2693  N  ND2 . ASN A 1 388 ? 170.538 185.402 168.594 1.00 88.74  0  388 ASN A ND2 1 
ATOM   2694  N  N   . VAL A 1 389 ? 169.046 181.976 173.085 1.00 82.78  0  389 VAL A N   1 
ATOM   2695  C  CA  . VAL A 1 389 ? 168.137 181.442 174.088 1.00 82.78  0  389 VAL A CA  1 
ATOM   2696  C  C   . VAL A 1 389 ? 168.398 182.159 175.409 1.00 82.78  0  389 VAL A C   1 
ATOM   2697  O  O   . VAL A 1 389 ? 169.515 182.619 175.680 1.00 82.78  0  389 VAL A O   1 
ATOM   2698  C  CB  . VAL A 1 389 ? 168.358 179.908 174.169 1.00 82.78  0  389 VAL A CB  1 
ATOM   2699  C  CG1 . VAL A 1 389 ? 169.816 179.598 174.444 1.00 82.78  0  389 VAL A CG1 1 
ATOM   2700  C  CG2 . VAL A 1 389 ? 167.456 179.201 175.187 1.00 82.78  0  389 VAL A CG2 1 
ATOM   2701  N  N   . VAL A 1 390 ? 167.346 182.297 176.216 1.00 79.63  0  390 VAL A N   1 
ATOM   2702  C  CA  . VAL A 1 390 ? 167.450 182.843 177.562 1.00 79.63  0  390 VAL A CA  1 
ATOM   2703  C  C   . VAL A 1 390 ? 167.003 181.779 178.553 1.00 79.63  0  390 VAL A C   1 
ATOM   2704  O  O   . VAL A 1 390 ? 166.112 180.969 178.274 1.00 79.63  0  390 VAL A O   1 
ATOM   2705  C  CB  . VAL A 1 390 ? 166.629 184.142 177.730 1.00 79.63  0  390 VAL A CB  1 
ATOM   2706  C  CG1 . VAL A 1 390 ? 167.298 185.286 176.989 1.00 79.63  0  390 VAL A CG1 1 
ATOM   2707  C  CG2 . VAL A 1 390 ? 165.207 183.953 177.225 1.00 79.63  0  390 VAL A CG2 1 
ATOM   2708  N  N   . LEU A 1 391 ? 167.652 181.768 179.714 1.00 74.64  0  391 LEU A N   1 
ATOM   2709  C  CA  . LEU A 1 391 ? 167.356 180.817 180.784 1.00 74.64  0  391 LEU A CA  1 
ATOM   2710  C  C   . LEU A 1 391 ? 167.307 181.588 182.099 1.00 74.64  0  391 LEU A C   1 
ATOM   2711  O  O   . LEU A 1 391 ? 168.349 181.956 182.653 1.00 74.64  0  391 LEU A O   1 
ATOM   2712  C  CB  . LEU A 1 391 ? 168.384 179.690 180.833 1.00 74.64  0  391 LEU A CB  1 
ATOM   2713  C  CG  . LEU A 1 391 ? 168.345 178.692 179.672 1.00 74.64  0  391 LEU A CG  1 
ATOM   2714  C  CD1 . LEU A 1 391 ? 169.493 177.705 179.756 1.00 74.64  0  391 LEU A CD1 1 
ATOM   2715  C  CD2 . LEU A 1 391 ? 167.012 177.964 179.642 1.00 74.64  0  391 LEU A CD2 1 
ATOM   2716  N  N   . ASP A 1 392 ? 166.095 181.842 182.590 1.00 75.84  0  392 ASP A N   1 
ATOM   2717  C  CA  . ASP A 1 392 ? 165.871 182.659 183.778 1.00 75.84  0  392 ASP A CA  1 
ATOM   2718  C  C   . ASP A 1 392 ? 165.259 181.761 184.843 1.00 75.84  0  392 ASP A C   1 
ATOM   2719  O  O   . ASP A 1 392 ? 164.074 181.420 184.752 1.00 75.84  0  392 ASP A O   1 
ATOM   2720  C  CB  . ASP A 1 392 ? 164.941 183.834 183.477 1.00 75.84  0  392 ASP A CB  1 
ATOM   2721  C  CG  . ASP A 1 392 ? 165.658 185.008 182.848 1.00 75.84  0  392 ASP A CG  1 
ATOM   2722  O  OD1 . ASP A 1 392 ? 166.875 184.906 182.609 1.00 75.84  0  392 ASP A OD1 1 
ATOM   2723  O  OD2 . ASP A 1 392 ? 164.999 186.040 182.598 1.00 75.84  -1 392 ASP A OD2 1 
ATOM   2724  N  N   . GLN A 1 393 ? 166.072 181.384 185.839 1.00 73.30  0  393 GLN A N   1 
ATOM   2725  C  CA  . GLN A 1 393 ? 165.653 180.615 187.020 1.00 73.30  0  393 GLN A CA  1 
ATOM   2726  C  C   . GLN A 1 393 ? 165.039 179.263 186.655 1.00 73.30  0  393 GLN A C   1 
ATOM   2727  O  O   . GLN A 1 393 ? 164.144 178.770 187.346 1.00 73.30  0  393 GLN A O   1 
ATOM   2728  C  CB  . GLN A 1 393 ? 164.693 181.419 187.905 1.00 73.30  0  393 GLN A CB  1 
ATOM   2729  C  CG  . GLN A 1 393 ? 165.284 182.714 188.433 1.00 73.30  0  393 GLN A CG  1 
ATOM   2730  C  CD  . GLN A 1 393 ? 164.387 183.393 189.447 1.00 73.30  0  393 GLN A CD  1 
ATOM   2731  O  OE1 . GLN A 1 393 ? 163.399 182.817 189.902 1.00 73.30  0  393 GLN A OE1 1 
ATOM   2732  N  NE2 . GLN A 1 393 ? 164.727 184.625 189.808 1.00 73.30  0  393 GLN A NE2 1 
ATOM   2733  N  N   . THR A 1 394 ? 165.520 178.646 185.581 1.00 70.95  0  394 THR A N   1 
ATOM   2734  C  CA  . THR A 1 394 ? 164.999 177.365 185.133 1.00 70.95  0  394 THR A CA  1 
ATOM   2735  C  C   . THR A 1 394 ? 165.767 176.219 185.784 1.00 70.95  0  394 THR A C   1 
ATOM   2736  O  O   . THR A 1 394 ? 166.786 176.415 186.445 1.00 70.95  0  394 THR A O   1 
ATOM   2737  C  CB  . THR A 1 394 ? 165.078 177.262 183.612 1.00 70.95  0  394 THR A CB  1 
ATOM   2738  O  OG1 . THR A 1 394 ? 166.417 176.933 183.225 1.00 70.95  0  394 THR A OG1 1 
ATOM   2739  C  CG2 . THR A 1 394 ? 164.696 178.589 182.981 1.00 70.95  0  394 THR A CG2 1 
ATOM   2740  N  N   . TYR A 1 395 ? 165.246 175.002 185.618 1.00 69.75  0  395 TYR A N   1 
ATOM   2741  C  CA  . TYR A 1 395 ? 165.867 173.803 186.192 1.00 69.75  0  395 TYR A CA  1 
ATOM   2742  C  C   . TYR A 1 395 ? 165.850 172.707 185.128 1.00 69.75  0  395 TYR A C   1 
ATOM   2743  O  O   . TYR A 1 395 ? 164.871 171.967 184.992 1.00 69.75  0  395 TYR A O   1 
ATOM   2744  C  CB  . TYR A 1 395 ? 165.161 173.382 187.477 1.00 69.75  0  395 TYR A CB  1 
ATOM   2745  C  CG  . TYR A 1 395 ? 165.117 174.496 188.500 1.00 69.75  0  395 TYR A CG  1 
ATOM   2746  C  CD1 . TYR A 1 395 ? 166.255 174.848 189.213 1.00 69.75  0  395 TYR A CD1 1 
ATOM   2747  C  CD2 . TYR A 1 395 ? 163.956 175.228 188.715 1.00 69.75  0  395 TYR A CD2 1 
ATOM   2748  C  CE1 . TYR A 1 395 ? 166.237 175.877 190.130 1.00 69.75  0  395 TYR A CE1 1 
ATOM   2749  C  CE2 . TYR A 1 395 ? 163.926 176.263 189.636 1.00 69.75  0  395 TYR A CE2 1 
ATOM   2750  C  CZ  . TYR A 1 395 ? 165.073 176.580 190.340 1.00 69.75  0  395 TYR A CZ  1 
ATOM   2751  O  OH  . TYR A 1 395 ? 165.065 177.606 191.254 1.00 69.75  0  395 TYR A OH  1 
ATOM   2752  N  N   . LEU A 1 396 ? 166.944 172.612 184.378 1.00 70.09  0  396 LEU A N   1 
ATOM   2753  C  CA  . LEU A 1 396 ? 167.082 171.664 183.280 1.00 70.09  0  396 LEU A CA  1 
ATOM   2754  C  C   . LEU A 1 396 ? 167.843 170.438 183.764 1.00 70.09  0  396 LEU A C   1 
ATOM   2755  O  O   . LEU A 1 396 ? 168.946 170.562 184.306 1.00 70.09  0  396 LEU A O   1 
ATOM   2756  C  CB  . LEU A 1 396 ? 167.812 172.304 182.098 1.00 70.09  0  396 LEU A CB  1 
ATOM   2757  C  CG  . LEU A 1 396 ? 166.984 172.852 180.933 1.00 70.09  0  396 LEU A CG  1 
ATOM   2758  C  CD1 . LEU A 1 396 ? 166.048 173.957 181.394 1.00 70.09  0  396 LEU A CD1 1 
ATOM   2759  C  CD2 . LEU A 1 396 ? 167.898 173.358 179.830 1.00 70.09  0  396 LEU A CD2 1 
ATOM   2760  N  N   . TRP A 1 397 ? 167.259 169.262 183.565 1.00 72.90  0  397 TRP A N   1 
ATOM   2761  C  CA  . TRP A 1 397 ? 167.865 168.014 183.994 1.00 72.90  0  397 TRP A CA  1 
ATOM   2762  C  C   . TRP A 1 397 ? 168.610 167.383 182.819 1.00 72.90  0  397 TRP A C   1 
ATOM   2763  O  O   . TRP A 1 397 ? 168.834 168.018 181.785 1.00 72.90  0  397 TRP A O   1 
ATOM   2764  C  CB  . TRP A 1 397 ? 166.804 167.084 184.589 1.00 72.90  0  397 TRP A CB  1 
ATOM   2765  C  CG  . TRP A 1 397 ? 166.230 167.584 185.889 1.00 72.90  0  397 TRP A CG  1 
ATOM   2766  C  CD1 . TRP A 1 397 ? 166.629 168.683 186.595 1.00 72.90  0  397 TRP A CD1 1 
ATOM   2767  C  CD2 . TRP A 1 397 ? 165.158 166.999 186.638 1.00 72.90  0  397 TRP A CD2 1 
ATOM   2768  N  NE1 . TRP A 1 397 ? 165.870 168.822 187.729 1.00 72.90  0  397 TRP A NE1 1 
ATOM   2769  C  CE2 . TRP A 1 397 ? 164.960 167.799 187.780 1.00 72.90  0  397 TRP A CE2 1 
ATOM   2770  C  CE3 . TRP A 1 397 ? 164.348 165.874 186.455 1.00 72.90  0  397 TRP A CE3 1 
ATOM   2771  C  CZ2 . TRP A 1 397 ? 163.985 167.514 188.731 1.00 72.90  0  397 TRP A CZ2 1 
ATOM   2772  C  CZ3 . TRP A 1 397 ? 163.379 165.595 187.398 1.00 72.90  0  397 TRP A CZ3 1 
ATOM   2773  C  CH2 . TRP A 1 397 ? 163.206 166.411 188.521 1.00 72.90  0  397 TRP A CH2 1 
ATOM   2774  N  N   . GLN A 1 398 ? 169.021 166.127 182.982 1.00 79.48  0  398 GLN A N   1 
ATOM   2775  C  CA  . GLN A 1 398 ? 169.863 165.476 181.988 1.00 79.48  0  398 GLN A CA  1 
ATOM   2776  C  C   . GLN A 1 398 ? 169.073 165.104 180.738 1.00 79.48  0  398 GLN A C   1 
ATOM   2777  O  O   . GLN A 1 398 ? 167.876 164.812 180.791 1.00 79.48  0  398 GLN A O   1 
ATOM   2778  C  CB  . GLN A 1 398 ? 170.511 164.222 182.578 1.00 79.48  0  398 GLN A CB  1 
ATOM   2779  C  CG  . GLN A 1 398 ? 169.533 163.246 183.211 1.00 79.48  0  398 GLN A CG  1 
ATOM   2780  C  CD  . GLN A 1 398 ? 170.220 162.020 183.778 1.00 79.48  0  398 GLN A CD  1 
ATOM   2781  O  OE1 . GLN A 1 398 ? 171.448 161.952 183.833 1.00 79.48  0  398 GLN A OE1 1 
ATOM   2782  N  NE2 . GLN A 1 398 ? 169.429 161.042 184.203 1.00 79.48  0  398 GLN A NE2 1 
ATOM   2783  N  N   . GLY A 1 399 ? 169.761 165.129 179.600 1.00 82.11  0  399 GLY A N   1 
ATOM   2784  C  CA  . GLY A 1 399 ? 169.210 164.625 178.360 1.00 82.11  0  399 GLY A CA  1 
ATOM   2785  C  C   . GLY A 1 399 ? 168.265 165.547 177.625 1.00 82.11  0  399 GLY A C   1 
ATOM   2786  O  O   . GLY A 1 399 ? 167.658 165.115 176.638 1.00 82.11  0  399 GLY A O   1 
ATOM   2787  N  N   . VAL A 1 400 ? 168.116 166.798 178.059 1.00 80.91  0  400 VAL A N   1 
ATOM   2788  C  CA  . VAL A 1 400 ? 167.189 167.712 177.399 1.00 80.91  0  400 VAL A CA  1 
ATOM   2789  C  C   . VAL A 1 400 ? 167.797 168.216 176.097 1.00 80.91  0  400 VAL A C   1 
ATOM   2790  O  O   . VAL A 1 400 ? 169.002 168.070 175.860 1.00 80.91  0  400 VAL A O   1 
ATOM   2791  C  CB  . VAL A 1 400 ? 166.799 168.889 178.311 1.00 80.91  0  400 VAL A CB  1 
ATOM   2792  C  CG1 . VAL A 1 400 ? 166.316 168.383 179.651 1.00 80.91  0  400 VAL A CG1 1 
ATOM   2793  C  CG2 . VAL A 1 400 ? 167.965 169.842 178.484 1.00 80.91  0  400 VAL A CG2 1 
ATOM   2794  N  N   . ARG A 1 401 ? 166.963 168.804 175.242 1.00 83.79  0  401 ARG A N   1 
ATOM   2795  C  CA  . ARG A 1 401 ? 167.413 169.370 173.974 1.00 83.79  0  401 ARG A CA  1 
ATOM   2796  C  C   . ARG A 1 401 ? 166.584 170.614 173.693 1.00 83.79  0  401 ARG A C   1 
ATOM   2797  O  O   . ARG A 1 401 ? 165.389 170.512 173.397 1.00 83.79  0  401 ARG A O   1 
ATOM   2798  C  CB  . ARG A 1 401 ? 167.280 168.358 172.836 1.00 83.79  0  401 ARG A CB  1 
ATOM   2799  C  CG  . ARG A 1 401 ? 167.771 168.868 171.493 1.00 83.79  0  401 ARG A CG  1 
ATOM   2800  C  CD  . ARG A 1 401 ? 167.829 167.748 170.468 1.00 83.79  0  401 ARG A CD  1 
ATOM   2801  N  NE  . ARG A 1 401 ? 168.654 166.633 170.924 1.00 83.79  0  401 ARG A NE  1 
ATOM   2802  C  CZ  . ARG A 1 401 ? 169.959 166.530 170.699 1.00 83.79  0  401 ARG A CZ  1 
ATOM   2803  N  NH1 . ARG A 1 401 ? 170.594 167.475 170.020 1.00 83.79  1  401 ARG A NH1 1 
ATOM   2804  N  NH2 . ARG A 1 401 ? 170.630 165.480 171.152 1.00 83.79  0  401 ARG A NH2 1 
ATOM   2805  N  N   . VAL A 1 402 ? 167.212 171.782 173.787 1.00 82.63  0  402 VAL A N   1 
ATOM   2806  C  CA  . VAL A 1 402 ? 166.554 173.062 173.555 1.00 82.63  0  402 VAL A CA  1 
ATOM   2807  C  C   . VAL A 1 402 ? 167.033 173.612 172.220 1.00 82.63  0  402 VAL A C   1 
ATOM   2808  O  O   . VAL A 1 402 ? 168.242 173.752 171.998 1.00 82.63  0  402 VAL A O   1 
ATOM   2809  C  CB  . VAL A 1 402 ? 166.836 174.055 174.696 1.00 82.63  0  402 VAL A CB  1 
ATOM   2810  C  CG1 . VAL A 1 402 ? 166.122 175.370 174.441 1.00 82.63  0  402 VAL A CG1 1 
ATOM   2811  C  CG2 . VAL A 1 402 ? 166.410 173.462 176.028 1.00 82.63  0  402 VAL A CG2 1 
ATOM   2812  N  N   . ALA A 1 403 ? 166.090 173.922 171.335 1.00 87.63  0  403 ALA A N   1 
ATOM   2813  C  CA  . ALA A 1 403 ? 166.424 174.435 170.014 1.00 87.63  0  403 ALA A CA  1 
ATOM   2814  C  C   . ALA A 1 403 ? 166.671 175.941 170.088 1.00 87.63  0  403 ALA A C   1 
ATOM   2815  O  O   . ALA A 1 403 ? 166.674 176.549 171.162 1.00 87.63  0  403 ALA A O   1 
ATOM   2816  C  CB  . ALA A 1 403 ? 165.326 174.081 169.015 1.00 87.63  0  403 ALA A CB  1 
ATOM   2817  N  N   . ALA A 1 404 ? 166.875 176.562 168.931 1.00 90.26  0  404 ALA A N   1 
ATOM   2818  C  CA  . ALA A 1 404 ? 167.234 177.969 168.866 1.00 90.26  0  404 ALA A CA  1 
ATOM   2819  C  C   . ALA A 1 404 ? 166.017 178.868 169.053 1.00 90.26  0  404 ALA A C   1 
ATOM   2820  O  O   . ALA A 1 404 ? 164.887 178.503 168.716 1.00 90.26  0  404 ALA A O   1 
ATOM   2821  C  CB  . ALA A 1 404 ? 167.911 178.287 167.532 1.00 90.26  0  404 ALA A CB  1 
ATOM   2822  N  N   . GLY A 1 405 ? 166.261 180.057 169.603 1.00 91.23  0  405 GLY A N   1 
ATOM   2823  C  CA  . GLY A 1 405 ? 165.217 181.055 169.743 1.00 91.23  0  405 GLY A CA  1 
ATOM   2824  C  C   . GLY A 1 405 ? 164.179 180.777 170.804 1.00 91.23  0  405 GLY A C   1 
ATOM   2825  O  O   . GLY A 1 405 ? 163.120 181.409 170.799 1.00 91.23  0  405 GLY A O   1 
ATOM   2826  N  N   . ALA A 1 406 ? 164.447 179.851 171.718 1.00 87.43  0  406 ALA A N   1 
ATOM   2827  C  CA  . ALA A 1 406 ? 163.501 179.502 172.767 1.00 87.43  0  406 ALA A CA  1 
ATOM   2828  C  C   . ALA A 1 406 ? 163.657 180.434 173.962 1.00 87.43  0  406 ALA A C   1 
ATOM   2829  O  O   . ALA A 1 406 ? 164.769 180.831 174.314 1.00 87.43  0  406 ALA A O   1 
ATOM   2830  C  CB  . ALA A 1 406 ? 163.697 178.051 173.203 1.00 87.43  0  406 ALA A CB  1 
ATOM   2831  N  N   . GLN A 1 407 ? 162.530 180.810 174.562 1.00 85.89  0  407 GLN A N   1 
ATOM   2832  C  CA  . GLN A 1 407 ? 162.512 181.677 175.737 1.00 85.89  0  407 GLN A CA  1 
ATOM   2833  C  C   . GLN A 1 407 ? 161.933 180.881 176.900 1.00 85.89  0  407 GLN A C   1 
ATOM   2834  O  O   . GLN A 1 407 ? 160.724 180.632 176.944 1.00 85.89  0  407 GLN A O   1 
ATOM   2835  C  CB  . GLN A 1 407 ? 161.697 182.943 175.478 1.00 85.89  0  407 GLN A CB  1 
ATOM   2836  C  CG  . GLN A 1 407 ? 161.983 183.610 174.143 1.00 85.89  0  407 GLN A CG  1 
ATOM   2837  C  CD  . GLN A 1 407 ? 163.344 184.273 174.102 1.00 85.89  0  407 GLN A CD  1 
ATOM   2838  O  OE1 . GLN A 1 407 ? 164.321 183.685 173.639 1.00 85.89  0  407 GLN A OE1 1 
ATOM   2839  N  NE2 . GLN A 1 407 ? 163.417 185.506 174.590 1.00 85.89  0  407 GLN A NE2 1 
ATOM   2840  N  N   . ILE A 1 408 ? 162.790 180.483 177.837 1.00 79.70  0  408 ILE A N   1 
ATOM   2841  C  CA  . ILE A 1 408 ? 162.388 179.671 178.981 1.00 79.70  0  408 ILE A CA  1 
ATOM   2842  C  C   . ILE A 1 408 ? 162.655 180.472 180.248 1.00 79.70  0  408 ILE A C   1 
ATOM   2843  O  O   . ILE A 1 408 ? 163.785 180.922 180.477 1.00 79.70  0  408 ILE A O   1 
ATOM   2844  C  CB  . ILE A 1 408 ? 163.133 178.327 179.020 1.00 79.70  0  408 ILE A CB  1 
ATOM   2845  C  CG1 . ILE A 1 408 ? 162.990 177.585 177.692 1.00 79.70  0  408 ILE A CG1 1 
ATOM   2846  C  CG2 . ILE A 1 408 ? 162.592 177.455 180.125 1.00 79.70  0  408 ILE A CG2 1 
ATOM   2847  C  CD1 . ILE A 1 408 ? 164.260 177.556 176.879 1.00 79.70  0  408 ILE A CD1 1 
ATOM   2848  N  N   . HIS A 1 409 ? 161.620 180.651 181.067 1.00 78.98  0  409 HIS A N   1 
ATOM   2849  C  CA  . HIS A 1 409 ? 161.708 181.440 182.291 1.00 78.98  0  409 HIS A CA  1 
ATOM   2850  C  C   . HIS A 1 409 ? 161.058 180.670 183.430 1.00 78.98  0  409 HIS A C   1 
ATOM   2851  O  O   . HIS A 1 409 ? 159.865 180.358 183.353 1.00 78.98  0  409 HIS A O   1 
ATOM   2852  C  CB  . HIS A 1 409 ? 161.033 182.805 182.124 1.00 78.98  0  409 HIS A CB  1 
ATOM   2853  C  CG  . HIS A 1 409 ? 161.633 183.655 181.047 1.00 78.98  0  409 HIS A CG  1 
ATOM   2854  N  ND1 . HIS A 1 409 ? 161.408 183.428 179.707 1.00 78.98  0  409 HIS A ND1 1 
ATOM   2855  C  CD2 . HIS A 1 409 ? 162.446 184.736 181.114 1.00 78.98  0  409 HIS A CD2 1 
ATOM   2856  C  CE1 . HIS A 1 409 ? 162.059 184.330 178.994 1.00 78.98  0  409 HIS A CE1 1 
ATOM   2857  N  NE2 . HIS A 1 409 ? 162.697 185.135 179.824 1.00 78.98  0  409 HIS A NE2 1 
ATOM   2858  N  N   . GLN A 1 410 ? 161.849 180.366 184.471 1.00 76.82  0  410 GLN A N   1 
ATOM   2859  C  CA  . GLN A 1 410 ? 161.373 179.805 185.747 1.00 76.82  0  410 GLN A CA  1 
ATOM   2860  C  C   . GLN A 1 410 ? 160.640 178.478 185.568 1.00 76.82  0  410 GLN A C   1 
ATOM   2861  O  O   . GLN A 1 410 ? 159.602 178.233 186.186 1.00 76.82  0  410 GLN A O   1 
ATOM   2862  C  CB  . GLN A 1 410 ? 160.497 180.808 186.503 1.00 76.82  0  410 GLN A CB  1 
ATOM   2863  C  CG  . GLN A 1 410 ? 161.174 182.137 186.786 1.00 76.82  0  410 GLN A CG  1 
ATOM   2864  C  CD  . GLN A 1 410 ? 160.351 183.024 187.699 1.00 76.82  0  410 GLN A CD  1 
ATOM   2865  O  OE1 . GLN A 1 410 ? 159.431 182.559 188.371 1.00 76.82  0  410 GLN A OE1 1 
ATOM   2866  N  NE2 . GLN A 1 410 ? 160.679 184.310 187.727 1.00 76.82  0  410 GLN A NE2 1 
ATOM   2867  N  N   . SER A 1 411 ? 161.177 177.614 184.717 1.00 77.57  0  411 SER A N   1 
ATOM   2868  C  CA  . SER A 1 411 ? 160.529 176.359 184.378 1.00 77.57  0  411 SER A CA  1 
ATOM   2869  C  C   . SER A 1 411 ? 161.284 175.186 184.992 1.00 77.57  0  411 SER A C   1 
ATOM   2870  O  O   . SER A 1 411 ? 162.289 175.351 185.688 1.00 77.57  0  411 SER A O   1 
ATOM   2871  C  CB  . SER A 1 411 ? 160.436 176.207 182.861 1.00 77.57  0  411 SER A CB  1 
ATOM   2872  O  OG  . SER A 1 411 ? 159.382 176.992 182.336 1.00 77.57  0  411 SER A OG  1 
ATOM   2873  N  N   . LEU A 1 412 ? 160.779 173.985 184.722 1.00 74.67  0  412 LEU A N   1 
ATOM   2874  C  CA  . LEU A 1 412 ? 161.400 172.746 185.180 1.00 74.67  0  412 LEU A CA  1 
ATOM   2875  C  C   . LEU A 1 412 ? 161.320 171.739 184.042 1.00 74.67  0  412 LEU A C   1 
ATOM   2876  O  O   . LEU A 1 412 ? 160.224 171.313 183.664 1.00 74.67  0  412 LEU A O   1 
ATOM   2877  C  CB  . LEU A 1 412 ? 160.714 172.212 186.438 1.00 74.67  0  412 LEU A CB  1 
ATOM   2878  C  CG  . LEU A 1 412 ? 161.071 170.790 186.878 1.00 74.67  0  412 LEU A CG  1 
ATOM   2879  C  CD1 . LEU A 1 412 ? 162.536 170.690 187.264 1.00 74.67  0  412 LEU A CD1 1 
ATOM   2880  C  CD2 . LEU A 1 412 ? 160.182 170.351 188.030 1.00 74.67  0  412 LEU A CD2 1 
ATOM   2881  N  N   . LEU A 1 413 ? 162.471 171.367 183.494 1.00 74.17  0  413 LEU A N   1 
ATOM   2882  C  CA  . LEU A 1 413 ? 162.555 170.428 182.382 1.00 74.17  0  413 LEU A CA  1 
ATOM   2883  C  C   . LEU A 1 413 ? 163.170 169.132 182.890 1.00 74.17  0  413 LEU A C   1 
ATOM   2884  O  O   . LEU A 1 413 ? 164.305 169.129 183.378 1.00 74.17  0  413 LEU A O   1 
ATOM   2885  C  CB  . LEU A 1 413 ? 163.373 171.003 181.224 1.00 74.17  0  413 LEU A CB  1 
ATOM   2886  C  CG  . LEU A 1 413 ? 162.688 171.936 180.216 1.00 74.17  0  413 LEU A CG  1 
ATOM   2887  C  CD1 . LEU A 1 413 ? 162.390 173.322 180.780 1.00 74.17  0  413 LEU A CD1 1 
ATOM   2888  C  CD2 . LEU A 1 413 ? 163.531 172.044 178.955 1.00 74.17  0  413 LEU A CD2 1 
ATOM   2889  N  N   . CYS A 1 414 ? 162.423 168.039 182.774 1.00 78.59  0  414 CYS A N   1 
ATOM   2890  C  CA  . CYS A 1 414 ? 162.845 166.759 183.320 1.00 78.59  0  414 CYS A CA  1 
ATOM   2891  C  C   . CYS A 1 414 ? 163.663 165.986 182.287 1.00 78.59  0  414 CYS A C   1 
ATOM   2892  O  O   . CYS A 1 414 ? 164.111 166.536 181.278 1.00 78.59  0  414 CYS A O   1 
ATOM   2893  C  CB  . CYS A 1 414 ? 161.637 165.967 183.807 1.00 78.59  0  414 CYS A CB  1 
ATOM   2894  S  SG  . CYS A 1 414 ? 160.742 166.758 185.164 1.00 78.59  0  414 CYS A SG  1 
ATOM   2895  N  N   . ASP A 1 415 ? 163.866 164.695 182.544 1.00 79.67  0  415 ASP A N   1 
ATOM   2896  C  CA  . ASP A 1 415 ? 164.841 163.903 181.806 1.00 79.67  0  415 ASP A CA  1 
ATOM   2897  C  C   . ASP A 1 415 ? 164.393 163.629 180.374 1.00 79.67  0  415 ASP A C   1 
ATOM   2898  O  O   . ASP A 1 415 ? 163.202 163.442 180.104 1.00 79.67  0  415 ASP A O   1 
ATOM   2899  C  CB  . ASP A 1 415 ? 165.094 162.580 182.528 1.00 79.67  0  415 ASP A CB  1 
ATOM   2900  C  CG  . ASP A 1 415 ? 165.582 162.776 183.949 1.00 79.67  0  415 ASP A CG  1 
ATOM   2901  O  OD1 . ASP A 1 415 ? 166.341 163.738 184.191 1.00 79.67  0  415 ASP A OD1 1 
ATOM   2902  O  OD2 . ASP A 1 415 ? 165.206 161.970 184.825 1.00 79.67  -1 415 ASP A OD2 1 
ATOM   2903  N  N   . ASN A 1 416 ? 165.375 163.629 179.461 1.00 83.15  0  416 ASN A N   1 
ATOM   2904  C  CA  . ASN A 1 416 ? 165.223 163.269 178.044 1.00 83.15  0  416 ASN A CA  1 
ATOM   2905  C  C   . ASN A 1 416 ? 164.221 164.160 177.309 1.00 83.15  0  416 ASN A C   1 
ATOM   2906  O  O   . ASN A 1 416 ? 163.589 163.729 176.344 1.00 83.15  0  416 ASN A O   1 
ATOM   2907  C  CB  . ASN A 1 416 ? 164.850 161.791 177.875 1.00 83.15  0  416 ASN A CB  1 
ATOM   2908  C  CG  . ASN A 1 416 ? 165.604 160.888 178.832 1.00 83.15  0  416 ASN A CG  1 
ATOM   2909  O  OD1 . ASN A 1 416 ? 166.827 160.769 178.759 1.00 83.15  0  416 ASN A OD1 1 
ATOM   2910  N  ND2 . ASN A 1 416 ? 164.875 160.247 179.739 1.00 83.15  0  416 ASN A ND2 1 
ATOM   2911  N  N   . ALA A 1 417 ? 164.087 165.410 177.742 1.00 86.15  0  417 ALA A N   1 
ATOM   2912  C  CA  . ALA A 1 417 ? 163.100 166.310 177.170 1.00 86.15  0  417 ALA A CA  1 
ATOM   2913  C  C   . ALA A 1 417 ? 163.559 166.825 175.808 1.00 86.15  0  417 ALA A C   1 
ATOM   2914  O  O   . ALA A 1 417 ? 164.730 166.722 175.434 1.00 86.15  0  417 ALA A O   1 
ATOM   2915  C  CB  . ALA A 1 417 ? 162.835 167.484 178.111 1.00 86.15  0  417 ALA A CB  1 
ATOM   2916  N  N   . GLU A 1 418 ? 162.607 167.369 175.053 1.00 89.37  0  418 GLU A N   1 
ATOM   2917  C  CA  . GLU A 1 418 ? 162.889 167.989 173.764 1.00 89.37  0  418 GLU A CA  1 
ATOM   2918  C  C   . GLU A 1 418 ? 162.066 169.260 173.639 1.00 89.37  0  418 GLU A C   1 
ATOM   2919  O  O   . GLU A 1 418 ? 160.871 169.259 173.943 1.00 89.37  0  418 GLU A O   1 
ATOM   2920  C  CB  . GLU A 1 418 ? 162.572 167.042 172.597 1.00 89.37  0  418 GLU A CB  1 
ATOM   2921  C  CG  . GLU A 1 418 ? 163.557 165.896 172.419 1.00 89.37  0  418 GLU A CG  1 
ATOM   2922  C  CD  . GLU A 1 418 ? 164.550 166.149 171.302 1.00 89.37  0  418 GLU A CD  1 
ATOM   2923  O  OE1 . GLU A 1 418 ? 164.358 167.123 170.543 1.00 89.37  0  418 GLU A OE1 1 
ATOM   2924  O  OE2 . GLU A 1 418 ? 165.523 165.375 171.183 1.00 89.37  -1 418 GLU A OE2 1 
ATOM   2925  N  N   . VAL A 1 419 ? 162.710 170.344 173.211 1.00 88.91  0  419 VAL A N   1 
ATOM   2926  C  CA  . VAL A 1 419 ? 162.050 171.629 173.008 1.00 88.91  0  419 VAL A CA  1 
ATOM   2927  C  C   . VAL A 1 419 ? 162.388 172.116 171.606 1.00 88.91  0  419 VAL A C   1 
ATOM   2928  O  O   . VAL A 1 419 ? 163.566 172.194 171.240 1.00 88.91  0  419 VAL A O   1 
ATOM   2929  C  CB  . VAL A 1 419 ? 162.481 172.670 174.064 1.00 88.91  0  419 VAL A CB  1 
ATOM   2930  C  CG1 . VAL A 1 419 ? 161.906 174.034 173.742 1.00 88.91  0  419 VAL A CG1 1 
ATOM   2931  C  CG2 . VAL A 1 419 ? 162.047 172.243 175.459 1.00 88.91  0  419 VAL A CG2 1 
ATOM   2932  N  N   . LYS A 1 420 ? 161.360 172.441 170.824 1.00 93.33  0  420 LYS A N   1 
ATOM   2933  C  CA  . LYS A 1 420 ? 161.548 172.904 169.456 1.00 93.33  0  420 LYS A CA  1 
ATOM   2934  C  C   . LYS A 1 420 ? 161.818 174.409 169.454 1.00 93.33  0  420 LYS A C   1 
ATOM   2935  O  O   . LYS A 1 420 ? 161.997 175.038 170.501 1.00 93.33  0  420 LYS A O   1 
ATOM   2936  C  CB  . LYS A 1 420 ? 160.343 172.531 168.598 1.00 93.33  0  420 LYS A CB  1 
ATOM   2937  C  CG  . LYS A 1 420 ? 160.069 171.036 168.538 1.00 93.33  0  420 LYS A CG  1 
ATOM   2938  C  CD  . LYS A 1 420 ? 161.259 170.278 167.974 1.00 93.33  0  420 LYS A CD  1 
ATOM   2939  C  CE  . LYS A 1 420 ? 160.983 168.785 167.913 1.00 93.33  0  420 LYS A CE  1 
ATOM   2940  N  NZ  . LYS A 1 420 ? 162.130 168.032 167.336 1.00 93.33  1  420 LYS A NZ  1 
ATOM   2941  N  N   . GLU A 1 421 ? 161.849 175.006 168.268 1.00 94.84  0  421 GLU A N   1 
ATOM   2942  C  CA  . GLU A 1 421 ? 162.210 176.406 168.121 1.00 94.84  0  421 GLU A CA  1 
ATOM   2943  C  C   . GLU A 1 421 ? 160.972 177.299 168.170 1.00 94.84  0  421 GLU A C   1 
ATOM   2944  O  O   . GLU A 1 421 ? 159.836 176.833 168.056 1.00 94.84  0  421 GLU A O   1 
ATOM   2945  C  CB  . GLU A 1 421 ? 162.967 176.620 166.809 1.00 94.84  0  421 GLU A CB  1 
ATOM   2946  N  N   . ARG A 1 422 ? 161.226 178.604 168.352 1.00 97.27  0  422 ARG A N   1 
ATOM   2947  C  CA  . ARG A 1 422 ? 160.216 179.673 168.339 1.00 97.27  0  422 ARG A CA  1 
ATOM   2948  C  C   . ARG A 1 422 ? 159.131 179.455 169.396 1.00 97.27  0  422 ARG A C   1 
ATOM   2949  O  O   . ARG A 1 422 ? 157.935 179.427 169.097 1.00 97.27  0  422 ARG A O   1 
ATOM   2950  C  CB  . ARG A 1 422 ? 159.602 179.842 166.945 1.00 97.27  0  422 ARG A CB  1 
ATOM   2951  N  N   . VAL A 1 423 ? 159.559 179.299 170.646 1.00 93.66  0  423 VAL A N   1 
ATOM   2952  C  CA  . VAL A 1 423 ? 158.658 179.018 171.757 1.00 93.66  0  423 VAL A CA  1 
ATOM   2953  C  C   . VAL A 1 423 ? 159.022 179.939 172.920 1.00 93.66  0  423 VAL A C   1 
ATOM   2954  O  O   . VAL A 1 423 ? 160.202 180.220 173.158 1.00 93.66  0  423 VAL A O   1 
ATOM   2955  C  CB  . VAL A 1 423 ? 158.710 177.517 172.144 1.00 93.66  0  423 VAL A CB  1 
ATOM   2956  C  CG1 . VAL A 1 423 ? 160.130 177.063 172.457 1.00 93.66  0  423 VAL A CG1 1 
ATOM   2957  C  CG2 . VAL A 1 423 ? 157.749 177.177 173.283 1.00 93.66  0  423 VAL A CG2 1 
ATOM   2958  N  N   . THR A 1 424 ? 158.003 180.453 173.609 1.00 91.58  0  424 THR A N   1 
ATOM   2959  C  CA  . THR A 1 424 ? 158.182 181.313 174.772 1.00 91.58  0  424 THR A CA  1 
ATOM   2960  C  C   . THR A 1 424 ? 157.472 180.684 175.962 1.00 91.58  0  424 THR A C   1 
ATOM   2961  O  O   . THR A 1 424 ? 156.257 180.466 175.919 1.00 91.58  0  424 THR A O   1 
ATOM   2962  C  CB  . THR A 1 424 ? 157.643 182.720 174.507 1.00 91.58  0  424 THR A CB  1 
ATOM   2963  O  OG1 . THR A 1 424 ? 158.406 183.338 173.463 1.00 91.58  0  424 THR A OG1 1 
ATOM   2964  C  CG2 . THR A 1 424 ? 157.733 183.573 175.764 1.00 91.58  0  424 THR A CG2 1 
ATOM   2965  N  N   . LEU A 1 425 ? 158.229 180.393 177.016 1.00 85.62  0  425 LEU A N   1 
ATOM   2966  C  CA  . LEU A 1 425 ? 157.699 179.778 178.224 1.00 85.62  0  425 LEU A CA  1 
ATOM   2967  C  C   . LEU A 1 425 ? 157.505 180.819 179.321 1.00 85.62  0  425 LEU A C   1 
ATOM   2968  O  O   . LEU A 1 425 ? 158.224 181.819 179.392 1.00 85.62  0  425 LEU A O   1 
ATOM   2969  C  CB  . LEU A 1 425 ? 158.616 178.662 178.735 1.00 85.62  0  425 LEU A CB  1 
ATOM   2970  C  CG  . LEU A 1 425 ? 158.545 177.267 178.100 1.00 85.62  0  425 LEU A CG  1 
ATOM   2971  C  CD1 . LEU A 1 425 ? 159.238 177.203 176.744 1.00 85.62  0  425 LEU A CD1 1 
ATOM   2972  C  CD2 . LEU A 1 425 ? 159.120 176.222 179.045 1.00 85.62  0  425 LEU A CD2 1 
ATOM   2973  N  N   . LYS A 1 426 ? 156.523 180.567 180.175 1.00 86.27  0  426 LYS A N   1 
ATOM   2974  C  CA  . LYS A 1 426 ? 156.160 181.416 181.297 1.00 86.27  0  426 LYS A CA  1 
ATOM   2975  C  C   . LYS A 1 426 ? 156.632 180.786 182.605 1.00 86.27  0  426 LYS A C   1 
ATOM   2976  O  O   . LYS A 1 426 ? 157.007 179.608 182.626 1.00 86.27  0  426 LYS A O   1 
ATOM   2977  C  CB  . LYS A 1 426 ? 154.636 181.629 181.319 1.00 86.27  0  426 LYS A CB  1 
ATOM   2978  C  CG  . LYS A 1 426 ? 154.097 182.388 180.115 1.00 86.27  0  426 LYS A CG  1 
ATOM   2979  C  CD  . LYS A 1 426 ? 154.912 183.640 179.819 1.00 86.27  0  426 LYS A CD  1 
ATOM   2980  C  CE  . LYS A 1 426 ? 154.030 184.764 179.303 1.00 86.27  0  426 LYS A CE  1 
ATOM   2981  N  NZ  . LYS A 1 426 ? 153.189 185.349 180.383 1.00 86.27  1  426 LYS A NZ  1 
ATOM   2982  N  N   . PRO A 1 427 ? 156.694 181.557 183.702 1.00 85.19  0  427 PRO A N   1 
ATOM   2983  C  CA  . PRO A 1 427 ? 157.056 180.965 184.998 1.00 85.19  0  427 PRO A CA  1 
ATOM   2984  C  C   . PRO A 1 427 ? 156.084 179.892 185.472 1.00 85.19  0  427 PRO A C   1 
ATOM   2985  O  O   . PRO A 1 427 ? 154.904 179.888 185.114 1.00 85.19  0  427 PRO A O   1 
ATOM   2986  C  CB  . PRO A 1 427 ? 157.050 182.169 185.944 1.00 85.19  0  427 PRO A CB  1 
ATOM   2987  C  CG  . PRO A 1 427 ? 157.467 183.291 185.084 1.00 85.19  0  427 PRO A CG  1 
ATOM   2988  C  CD  . PRO A 1 427 ? 156.866 183.025 183.727 1.00 85.19  0  427 PRO A CD  1 
ATOM   2989  N  N   . ARG A 1 428 ? 156.630 178.972 186.280 1.00 85.67  0  428 ARG A N   1 
ATOM   2990  C  CA  . ARG A 1 428 ? 155.924 177.828 186.872 1.00 85.67  0  428 ARG A CA  1 
ATOM   2991  C  C   . ARG A 1 428 ? 155.311 176.919 185.805 1.00 85.67  0  428 ARG A C   1 
ATOM   2992  O  O   . ARG A 1 428 ? 154.137 176.550 185.866 1.00 85.67  0  428 ARG A O   1 
ATOM   2993  C  CB  . ARG A 1 428 ? 154.867 178.287 187.883 1.00 85.67  0  428 ARG A CB  1 
ATOM   2994  C  CG  . ARG A 1 428 ? 155.436 179.048 189.067 1.00 85.67  0  428 ARG A CG  1 
ATOM   2995  C  CD  . ARG A 1 428 ? 154.332 179.534 189.989 1.00 85.67  0  428 ARG A CD  1 
ATOM   2996  N  NE  . ARG A 1 428 ? 153.458 180.497 189.325 1.00 85.67  0  428 ARG A NE  1 
ATOM   2997  C  CZ  . ARG A 1 428 ? 152.415 181.082 189.904 1.00 85.67  0  428 ARG A CZ  1 
ATOM   2998  N  NH1 . ARG A 1 428 ? 151.676 181.947 189.223 1.00 85.67  1  428 ARG A NH1 1 
ATOM   2999  N  NH2 . ARG A 1 428 ? 152.111 180.803 191.164 1.00 85.67  0  428 ARG A NH2 1 
ATOM   3000  N  N   . SER A 1 429 ? 156.126 176.552 184.819 1.00 83.96  0  429 SER A N   1 
ATOM   3001  C  CA  . SER A 1 429 ? 155.734 175.621 183.768 1.00 83.96  0  429 SER A CA  1 
ATOM   3002  C  C   . SER A 1 429 ? 156.574 174.359 183.914 1.00 83.96  0  429 SER A C   1 
ATOM   3003  O  O   . SER A 1 429 ? 157.807 174.427 183.896 1.00 83.96  0  429 SER A O   1 
ATOM   3004  C  CB  . SER A 1 429 ? 155.901 176.238 182.379 1.00 83.96  0  429 SER A CB  1 
ATOM   3005  O  OG  . SER A 1 429 ? 157.254 176.241 181.974 1.00 83.96  0  429 SER A OG  1 
ATOM   3006  N  N   . VAL A 1 430 ? 155.910 173.216 184.057 1.00 83.56  0  430 VAL A N   1 
ATOM   3007  C  CA  . VAL A 1 430 ? 156.566 171.937 184.305 1.00 83.56  0  430 VAL A CA  1 
ATOM   3008  C  C   . VAL A 1 430 ? 156.298 171.018 183.122 1.00 83.56  0  430 VAL A C   1 
ATOM   3009  O  O   . VAL A 1 430 ? 155.160 170.925 182.648 1.00 83.56  0  430 VAL A O   1 
ATOM   3010  C  CB  . VAL A 1 430 ? 156.077 171.294 185.618 1.00 83.56  0  430 VAL A CB  1 
ATOM   3011  C  CG1 . VAL A 1 430 ? 156.931 170.087 185.980 1.00 83.56  0  430 VAL A CG1 1 
ATOM   3012  C  CG2 . VAL A 1 430 ? 156.079 172.310 186.751 1.00 83.56  0  430 VAL A CG2 1 
ATOM   3013  N  N   . LEU A 1 431 ? 157.344 170.350 182.641 1.00 81.71  0  431 LEU A N   1 
ATOM   3014  C  CA  . LEU A 1 431 ? 157.196 169.298 181.644 1.00 81.71  0  431 LEU A CA  1 
ATOM   3015  C  C   . LEU A 1 431 ? 158.082 168.128 182.045 1.00 81.71  0  431 LEU A C   1 
ATOM   3016  O  O   . LEU A 1 431 ? 159.273 168.307 182.316 1.00 81.71  0  431 LEU A O   1 
ATOM   3017  C  CB  . LEU A 1 431 ? 157.520 169.821 180.232 1.00 81.71  0  431 LEU A CB  1 
ATOM   3018  C  CG  . LEU A 1 431 ? 158.858 170.456 179.831 1.00 81.71  0  431 LEU A CG  1 
ATOM   3019  C  CD1 . LEU A 1 431 ? 159.849 169.436 179.284 1.00 81.71  0  431 LEU A CD1 1 
ATOM   3020  C  CD2 . LEU A 1 431 ? 158.631 171.578 178.827 1.00 81.71  0  431 LEU A CD2 1 
ATOM   3021  N  N   . THR A 1 432 ? 157.481 166.941 182.133 1.00 88.95  0  432 THR A N   1 
ATOM   3022  C  CA  . THR A 1 432 ? 158.120 165.769 182.716 1.00 88.95  0  432 THR A CA  1 
ATOM   3023  C  C   . THR A 1 432 ? 158.232 164.647 181.695 1.00 88.95  0  432 THR A C   1 
ATOM   3024  O  O   . THR A 1 432 ? 157.263 164.353 180.986 1.00 88.95  0  432 THR A O   1 
ATOM   3025  C  CB  . THR A 1 432 ? 157.348 165.251 183.940 1.00 88.95  0  432 THR A CB  1 
ATOM   3026  O  OG1 . THR A 1 432 ? 156.247 164.444 183.505 1.00 88.95  0  432 THR A OG1 1 
ATOM   3027  C  CG2 . THR A 1 432 ? 156.825 166.396 184.801 1.00 88.95  0  432 THR A CG2 1 
ATOM   3028  N  N   . SER A 1 433 ? 159.416 164.024 181.643 1.00 89.11  0  433 SER A N   1 
ATOM   3029  C  CA  . SER A 1 433 ? 159.679 162.749 180.966 1.00 89.11  0  433 SER A CA  1 
ATOM   3030  C  C   . SER A 1 433 ? 159.387 162.822 179.463 1.00 89.11  0  433 SER A C   1 
ATOM   3031  O  O   . SER A 1 433 ? 158.419 162.247 178.958 1.00 89.11  0  433 SER A O   1 
ATOM   3032  C  CB  . SER A 1 433 ? 158.891 161.611 181.628 1.00 89.11  0  433 SER A CB  1 
ATOM   3033  O  OG  . SER A 1 433 ? 158.995 161.677 183.039 1.00 89.11  0  433 SER A OG  1 
ATOM   3034  N  N   . GLN A 1 434 ? 160.240 163.599 178.782 1.00 89.58  0  434 GLN A N   1 
ATOM   3035  C  CA  . GLN A 1 434 ? 160.311 163.673 177.315 1.00 89.58  0  434 GLN A CA  1 
ATOM   3036  C  C   . GLN A 1 434 ? 159.032 164.246 176.704 1.00 89.58  0  434 GLN A C   1 
ATOM   3037  O  O   . GLN A 1 434 ? 158.421 163.654 175.813 1.00 89.58  0  434 GLN A O   1 
ATOM   3038  C  CB  . GLN A 1 434 ? 160.652 162.310 176.697 1.00 89.58  0  434 GLN A CB  1 
ATOM   3039  N  N   . VAL A 1 435 ? 158.629 165.414 177.191 1.00 91.80  0  435 VAL A N   1 
ATOM   3040  C  CA  . VAL A 1 435 ? 157.523 166.157 176.600 1.00 91.80  0  435 VAL A CA  1 
ATOM   3041  C  C   . VAL A 1 435 ? 158.090 167.070 175.521 1.00 91.80  0  435 VAL A C   1 
ATOM   3042  O  O   . VAL A 1 435 ? 158.976 167.890 175.788 1.00 91.80  0  435 VAL A O   1 
ATOM   3043  C  CB  . VAL A 1 435 ? 156.756 166.957 177.664 1.00 91.80  0  435 VAL A CB  1 
ATOM   3044  C  CG1 . VAL A 1 435 ? 155.907 168.051 177.023 1.00 91.80  0  435 VAL A CG1 1 
ATOM   3045  C  CG2 . VAL A 1 435 ? 155.882 166.031 178.477 1.00 91.80  0  435 VAL A CG2 1 
ATOM   3046  N  N   . VAL A 1 436 ? 157.597 166.913 174.298 1.00 95.34  0  436 VAL A N   1 
ATOM   3047  C  CA  . VAL A 1 436 ? 158.014 167.738 173.173 1.00 95.34  0  436 VAL A CA  1 
ATOM   3048  C  C   . VAL A 1 436 ? 157.028 168.888 173.028 1.00 95.34  0  436 VAL A C   1 
ATOM   3049  O  O   . VAL A 1 436 ? 155.812 168.674 173.008 1.00 95.34  0  436 VAL A O   1 
ATOM   3050  C  CB  . VAL A 1 436 ? 158.097 166.906 171.882 1.00 95.34  0  436 VAL A CB  1 
ATOM   3051  C  CG1 . VAL A 1 436 ? 158.546 167.768 170.711 1.00 95.34  0  436 VAL A CG1 1 
ATOM   3052  C  CG2 . VAL A 1 436 ? 159.037 165.727 172.075 1.00 95.34  0  436 VAL A CG2 1 
ATOM   3053  N  N   . VAL A 1 437 ? 157.544 170.110 172.942 1.00 96.30  0  437 VAL A N   1 
ATOM   3054  C  CA  . VAL A 1 437 ? 156.722 171.302 172.766 1.00 96.30  0  437 VAL A CA  1 
ATOM   3055  C  C   . VAL A 1 437 ? 156.921 171.792 171.340 1.00 96.30  0  437 VAL A C   1 
ATOM   3056  O  O   . VAL A 1 437 ? 158.045 172.117 170.939 1.00 96.30  0  437 VAL A O   1 
ATOM   3057  C  CB  . VAL A 1 437 ? 157.076 172.394 173.786 1.00 96.30  0  437 VAL A CB  1 
ATOM   3058  C  CG1 . VAL A 1 437 ? 156.313 173.671 173.480 1.00 96.30  0  437 VAL A CG1 1 
ATOM   3059  C  CG2 . VAL A 1 437 ? 156.775 171.914 175.197 1.00 96.30  0  437 VAL A CG2 1 
ATOM   3060  N  N   . GLY A 1 438 ? 155.830 171.844 170.576 1.00 101.04 0  438 GLY A N   1 
ATOM   3061  C  CA  . GLY A 1 438 ? 155.881 172.194 169.176 1.00 101.04 0  438 GLY A CA  1 
ATOM   3062  C  C   . GLY A 1 438 ? 156.209 173.652 168.923 1.00 101.04 0  438 GLY A C   1 
ATOM   3063  O  O   . GLY A 1 438 ? 156.164 174.491 169.829 1.00 101.04 0  438 GLY A O   1 
ATOM   3064  N  N   . PRO A 1 439 ? 156.552 173.980 167.678 1.00 103.44 0  439 PRO A N   1 
ATOM   3065  C  CA  . PRO A 1 439 ? 156.932 175.359 167.358 1.00 103.44 0  439 PRO A CA  1 
ATOM   3066  C  C   . PRO A 1 439 ? 155.727 176.283 167.306 1.00 103.44 0  439 PRO A C   1 
ATOM   3067  O  O   . PRO A 1 439 ? 154.602 175.855 167.028 1.00 103.44 0  439 PRO A O   1 
ATOM   3068  C  CB  . PRO A 1 439 ? 157.596 175.239 165.978 1.00 103.44 0  439 PRO A CB  1 
ATOM   3069  C  CG  . PRO A 1 439 ? 157.825 173.766 165.766 1.00 103.44 0  439 PRO A CG  1 
ATOM   3070  C  CD  . PRO A 1 439 ? 156.744 173.081 166.529 1.00 103.44 0  439 PRO A CD  1 
ATOM   3071  N  N   . ASN A 1 440 ? 155.996 177.568 167.585 1.00 105.11 0  440 ASN A N   1 
ATOM   3072  C  CA  . ASN A 1 440 ? 155.012 178.660 167.566 1.00 105.11 0  440 ASN A CA  1 
ATOM   3073  C  C   . ASN A 1 440 ? 153.846 178.384 168.514 1.00 105.11 0  440 ASN A C   1 
ATOM   3074  O  O   . ASN A 1 440 ? 152.685 178.652 168.198 1.00 105.11 0  440 ASN A O   1 
ATOM   3075  C  CB  . ASN A 1 440 ? 154.510 178.944 166.146 1.00 105.11 0  440 ASN A CB  1 
ATOM   3076  N  N   . ILE A 1 441 ? 154.161 177.844 169.689 1.00 102.05 0  441 ILE A N   1 
ATOM   3077  C  CA  . ILE A 1 441 ? 153.151 177.505 170.683 1.00 102.05 0  441 ILE A CA  1 
ATOM   3078  C  C   . ILE A 1 441 ? 153.626 177.945 172.059 1.00 102.05 0  441 ILE A C   1 
ATOM   3079  O  O   . ILE A 1 441 ? 154.433 177.260 172.697 1.00 102.05 0  441 ILE A O   1 
ATOM   3080  C  CB  . ILE A 1 441 ? 152.834 176.000 170.664 1.00 102.05 0  441 ILE A CB  1 
ATOM   3081  N  N   . THR A 1 442 ? 153.130 179.085 172.527 1.00 97.58  0  442 THR A N   1 
ATOM   3082  C  CA  . THR A 1 442 ? 153.465 179.551 173.862 1.00 97.58  0  442 THR A CA  1 
ATOM   3083  C  C   . THR A 1 442 ? 152.569 178.887 174.902 1.00 97.58  0  442 THR A C   1 
ATOM   3084  O  O   . THR A 1 442 ? 151.419 178.526 174.632 1.00 97.58  0  442 THR A O   1 
ATOM   3085  C  CB  . THR A 1 442 ? 153.355 181.077 173.952 1.00 97.58  0  442 THR A CB  1 
ATOM   3086  O  OG1 . THR A 1 442 ? 153.648 181.504 175.289 1.00 97.58  0  442 THR A OG1 1 
ATOM   3087  C  CG2 . THR A 1 442 ? 151.966 181.562 173.547 1.00 97.58  0  442 THR A CG2 1 
ATOM   3088  N  N   . LEU A 1 443 ? 153.119 178.697 176.082 1.00 94.13  0  443 LEU A N   1 
ATOM   3089  C  CA  . LEU A 1 443 ? 152.414 178.087 177.194 1.00 94.13  0  443 LEU A CA  1 
ATOM   3090  C  C   . LEU A 1 443 ? 151.926 179.156 178.164 1.00 94.13  0  443 LEU A C   1 
ATOM   3091  O  O   . LEU A 1 443 ? 152.508 180.240 178.241 1.00 94.13  0  443 LEU A O   1 
ATOM   3092  C  CB  . LEU A 1 443 ? 153.331 177.105 177.932 1.00 94.13  0  443 LEU A CB  1 
ATOM   3093  C  CG  . LEU A 1 443 ? 153.826 175.901 177.129 1.00 94.13  0  443 LEU A CG  1 
ATOM   3094  C  CD1 . LEU A 1 443 ? 154.648 174.973 178.009 1.00 94.13  0  443 LEU A CD1 1 
ATOM   3095  C  CD2 . LEU A 1 443 ? 152.659 175.154 176.503 1.00 94.13  0  443 LEU A CD2 1 
ATOM   3096  N  N   . PRO A 1 444 ? 150.845 178.901 178.915 1.00 92.65  0  444 PRO A N   1 
ATOM   3097  C  CA  . PRO A 1 444 ? 150.426 179.867 179.941 1.00 92.65  0  444 PRO A CA  1 
ATOM   3098  C  C   . PRO A 1 444 ? 151.282 179.799 181.197 1.00 92.65  0  444 PRO A C   1 
ATOM   3099  O  O   . PRO A 1 444 ? 152.285 179.079 181.238 1.00 92.65  0  444 PRO A O   1 
ATOM   3100  C  CB  . PRO A 1 444 ? 148.974 179.464 180.229 1.00 92.65  0  444 PRO A CB  1 
ATOM   3101  C  CG  . PRO A 1 444 ? 148.913 178.021 179.882 1.00 92.65  0  444 PRO A CG  1 
ATOM   3102  C  CD  . PRO A 1 444 ? 149.843 177.837 178.719 1.00 92.65  0  444 PRO A CD  1 
ATOM   3103  N  N   . GLU A 1 445 ? 150.895 180.558 182.226 1.00 90.40  0  445 GLU A N   1 
ATOM   3104  C  CA  . GLU A 1 445 ? 151.637 180.547 183.483 1.00 90.40  0  445 GLU A CA  1 
ATOM   3105  C  C   . GLU A 1 445 ? 151.463 179.217 184.208 1.00 90.40  0  445 GLU A C   1 
ATOM   3106  O  O   . GLU A 1 445 ? 152.436 178.494 184.449 1.00 90.40  0  445 GLU A O   1 
ATOM   3107  C  CB  . GLU A 1 445 ? 151.185 181.711 184.368 1.00 90.40  0  445 GLU A CB  1 
ATOM   3108  N  N   . GLY A 1 446 ? 150.227 178.870 184.553 1.00 93.31  0  446 GLY A N   1 
ATOM   3109  C  CA  . GLY A 1 446 ? 149.971 177.573 185.142 1.00 93.31  0  446 GLY A CA  1 
ATOM   3110  C  C   . GLY A 1 446 ? 149.763 176.512 184.082 1.00 93.31  0  446 GLY A C   1 
ATOM   3111  O  O   . GLY A 1 446 ? 148.672 176.394 183.518 1.00 93.31  0  446 GLY A O   1 
ATOM   3112  N  N   . SER A 1 447 ? 150.805 175.732 183.804 1.00 89.75  0  447 SER A N   1 
ATOM   3113  C  CA  . SER A 1 447 ? 150.750 174.728 182.748 1.00 89.75  0  447 SER A CA  1 
ATOM   3114  C  C   . SER A 1 447 ? 151.722 173.611 183.086 1.00 89.75  0  447 SER A C   1 
ATOM   3115  O  O   . SER A 1 447 ? 152.933 173.842 183.144 1.00 89.75  0  447 SER A O   1 
ATOM   3116  C  CB  . SER A 1 447 ? 151.088 175.340 181.387 1.00 89.75  0  447 SER A CB  1 
ATOM   3117  O  OG  . SER A 1 447 ? 152.487 175.338 181.162 1.00 89.75  0  447 SER A OG  1 
ATOM   3118  N  N   . VAL A 1 448 ? 151.197 172.409 183.303 1.00 89.06  0  448 VAL A N   1 
ATOM   3119  C  CA  . VAL A 1 448 ? 152.005 171.228 183.581 1.00 89.06  0  448 VAL A CA  1 
ATOM   3120  C  C   . VAL A 1 448 ? 151.651 170.168 182.548 1.00 89.06  0  448 VAL A C   1 
ATOM   3121  O  O   . VAL A 1 448 ? 150.492 169.746 182.459 1.00 89.06  0  448 VAL A O   1 
ATOM   3122  C  CB  . VAL A 1 448 ? 151.783 170.696 185.006 1.00 89.06  0  448 VAL A CB  1 
ATOM   3123  C  CG1 . VAL A 1 448 ? 152.565 169.417 185.208 1.00 89.06  0  448 VAL A CG1 1 
ATOM   3124  C  CG2 . VAL A 1 448 ? 152.189 171.736 186.040 1.00 89.06  0  448 VAL A CG2 1 
ATOM   3125  N  N   . ILE A 1 449 ? 152.643 169.741 181.770 1.00 89.66  0  449 ILE A N   1 
ATOM   3126  C  CA  . ILE A 1 449 ? 152.446 168.783 180.689 1.00 89.66  0  449 ILE A CA  1 
ATOM   3127  C  C   . ILE A 1 449 ? 153.212 167.509 181.015 1.00 89.66  0  449 ILE A C   1 
ATOM   3128  O  O   . ILE A 1 449 ? 154.342 167.564 181.511 1.00 89.66  0  449 ILE A O   1 
ATOM   3129  C  CB  . ILE A 1 449 ? 152.900 169.355 179.328 1.00 89.66  0  449 ILE A CB  1 
ATOM   3130  C  CG1 . ILE A 1 449 ? 152.578 170.848 179.231 1.00 89.66  0  449 ILE A CG1 1 
ATOM   3131  C  CG2 . ILE A 1 449 ? 152.238 168.602 178.188 1.00 89.66  0  449 ILE A CG2 1 
ATOM   3132  C  CD1 . ILE A 1 449 ? 153.032 171.490 177.939 1.00 89.66  0  449 ILE A CD1 1 
ATOM   3133  N  N   . SER A 1 450 ? 152.595 166.363 180.734 1.00 95.81  0  450 SER A N   1 
ATOM   3134  C  CA  . SER A 1 450 ? 153.230 165.069 180.934 1.00 95.81  0  450 SER A CA  1 
ATOM   3135  C  C   . SER A 1 450 ? 152.607 164.063 179.976 1.00 95.81  0  450 SER A C   1 
ATOM   3136  O  O   . SER A 1 450 ? 151.756 164.404 179.151 1.00 95.81  0  450 SER A O   1 
ATOM   3137  C  CB  . SER A 1 450 ? 153.098 164.600 182.384 1.00 95.81  0  450 SER A CB  1 
ATOM   3138  O  OG  . SER A 1 450 ? 154.045 163.588 182.679 1.00 95.81  0  450 SER A OG  1 
ATOM   3139  N  N   . LEU A 1 451 ? 153.040 162.807 180.093 1.00 96.66  0  451 LEU A N   1 
ATOM   3140  C  CA  . LEU A 1 451 ? 152.484 161.742 179.269 1.00 96.66  0  451 LEU A CA  1 
ATOM   3141  C  C   . LEU A 1 451 ? 151.193 161.172 179.840 1.00 96.66  0  451 LEU A C   1 
ATOM   3142  O  O   . LEU A 1 451 ? 150.437 160.530 179.103 1.00 96.66  0  451 LEU A O   1 
ATOM   3143  C  CB  . LEU A 1 451 ? 153.509 160.621 179.084 1.00 96.66  0  451 LEU A CB  1 
ATOM   3144  C  CG  . LEU A 1 451 ? 154.364 160.657 177.812 1.00 96.66  0  451 LEU A CG  1 
ATOM   3145  C  CD1 . LEU A 1 451 ? 155.317 161.843 177.795 1.00 96.66  0  451 LEU A CD1 1 
ATOM   3146  C  CD2 . LEU A 1 451 ? 155.130 159.353 177.650 1.00 96.66  0  451 LEU A CD2 1 
ATOM   3147  N  N   . HIS A 1 452 ? 150.925 161.387 181.126 1.00 100.30 0  452 HIS A N   1 
ATOM   3148  C  CA  . HIS A 1 452 ? 149.673 160.948 181.729 1.00 100.30 0  452 HIS A CA  1 
ATOM   3149  C  C   . HIS A 1 452 ? 148.619 162.031 181.546 1.00 100.30 0  452 HIS A C   1 
ATOM   3150  O  O   . HIS A 1 452 ? 148.853 163.177 181.955 1.00 100.30 0  452 HIS A O   1 
ATOM   3151  C  CB  . HIS A 1 452 ? 149.862 160.648 183.206 1.00 100.30 0  452 HIS A CB  1 
ATOM   3152  C  CG  . HIS A 1 452 ? 151.103 159.868 183.511 1.00 100.30 0  452 HIS A CG  1 
ATOM   3153  N  ND1 . HIS A 1 452 ? 151.179 158.501 183.358 1.00 100.30 0  452 HIS A ND1 1 
ATOM   3154  C  CD2 . HIS A 1 452 ? 152.317 160.264 183.961 1.00 100.30 0  452 HIS A CD2 1 
ATOM   3155  C  CE1 . HIS A 1 452 ? 152.386 158.088 183.701 1.00 100.30 0  452 HIS A CE1 1 
ATOM   3156  N  NE2 . HIS A 1 452 ? 153.096 159.138 184.070 1.00 100.30 0  452 HIS A NE2 1 
ATOM   3157  N  N   . PRO A 1 453 ? 147.481 161.733 180.922 1.00 99.71  0  453 PRO A N   1 
ATOM   3158  C  CA  . PRO A 1 453 ? 146.433 162.758 180.724 1.00 99.71  0  453 PRO A CA  1 
ATOM   3159  C  C   . PRO A 1 453 ? 145.802 163.267 182.018 1.00 99.71  0  453 PRO A C   1 
ATOM   3160  O  O   . PRO A 1 453 ? 145.791 164.493 182.213 1.00 99.71  0  453 PRO A O   1 
ATOM   3161  C  CB  . PRO A 1 453 ? 145.409 162.053 179.814 1.00 99.71  0  453 PRO A CB  1 
ATOM   3162  C  CG  . PRO A 1 453 ? 146.207 161.008 179.105 1.00 99.71  0  453 PRO A CG  1 
ATOM   3163  C  CD  . PRO A 1 453 ? 147.247 160.540 180.087 1.00 99.71  0  453 PRO A CD  1 
ATOM   3164  N  N   . PRO A 1 454 ? 145.257 162.434 182.931 1.00 98.79  0  454 PRO A N   1 
ATOM   3165  C  CA  . PRO A 1 454 ? 144.469 163.042 184.017 1.00 98.79  0  454 PRO A CA  1 
ATOM   3166  C  C   . PRO A 1 454 ? 145.298 163.633 185.148 1.00 98.79  0  454 PRO A C   1 
ATOM   3167  O  O   . PRO A 1 454 ? 144.749 164.396 185.955 1.00 98.79  0  454 PRO A O   1 
ATOM   3168  C  CB  . PRO A 1 454 ? 143.616 161.875 184.519 1.00 98.79  0  454 PRO A CB  1 
ATOM   3169  C  CG  . PRO A 1 454 ? 144.503 160.736 184.407 1.00 98.79  0  454 PRO A CG  1 
ATOM   3170  C  CD  . PRO A 1 454 ? 145.360 160.972 183.185 1.00 98.79  0  454 PRO A CD  1 
ATOM   3171  N  N   . ASP A 1 455 ? 146.591 163.314 185.236 1.00 99.19  0  455 ASP A N   1 
ATOM   3172  C  CA  . ASP A 1 455 ? 147.427 163.864 186.298 1.00 99.19  0  455 ASP A CA  1 
ATOM   3173  C  C   . ASP A 1 455 ? 147.960 165.244 185.931 1.00 99.19  0  455 ASP A C   1 
ATOM   3174  O  O   . ASP A 1 455 ? 148.032 166.132 186.787 1.00 99.19  0  455 ASP A O   1 
ATOM   3175  C  CB  . ASP A 1 455 ? 148.580 162.910 186.606 1.00 99.19  0  455 ASP A CB  1 
ATOM   3176  N  N   . ALA A 1 456 ? 148.335 165.439 184.670 1.00 97.28  0  456 ALA A N   1 
ATOM   3177  C  CA  . ALA A 1 456 ? 148.827 166.722 184.201 1.00 97.28  0  456 ALA A CA  1 
ATOM   3178  C  C   . ALA A 1 456 ? 147.680 167.531 183.597 1.00 97.28  0  456 ALA A C   1 
ATOM   3179  O  O   . ALA A 1 456 ? 146.529 167.091 183.554 1.00 97.28  0  456 ALA A O   1 
ATOM   3180  C  CB  . ALA A 1 456 ? 149.955 166.520 183.191 1.00 97.28  0  456 ALA A CB  1 
ATOM   3181  N  N   . GLU A 1 457 ? 147.997 168.739 183.126 1.00 95.63  0  457 GLU A N   1 
ATOM   3182  C  CA  . GLU A 1 457 ? 146.979 169.562 182.482 1.00 95.63  0  457 GLU A CA  1 
ATOM   3183  C  C   . GLU A 1 457 ? 146.657 169.051 181.084 1.00 95.63  0  457 GLU A C   1 
ATOM   3184  O  O   . GLU A 1 457 ? 145.491 169.057 180.670 1.00 95.63  0  457 GLU A O   1 
ATOM   3185  C  CB  . GLU A 1 457 ? 147.433 171.021 182.431 1.00 95.63  0  457 GLU A CB  1 
ATOM   3186  N  N   . GLU A 1 458 ? 147.668 168.594 180.349 1.00 97.76  0  458 GLU A N   1 
ATOM   3187  C  CA  . GLU A 1 458 ? 147.473 168.065 179.005 1.00 97.76  0  458 GLU A CA  1 
ATOM   3188  C  C   . GLU A 1 458 ? 148.641 167.146 178.670 1.00 97.76  0  458 GLU A C   1 
ATOM   3189  O  O   . GLU A 1 458 ? 149.570 166.972 179.463 1.00 97.76  0  458 GLU A O   1 
ATOM   3190  C  CB  . GLU A 1 458 ? 147.347 169.194 177.976 1.00 97.76  0  458 GLU A CB  1 
ATOM   3191  N  N   . ASP A 1 459 ? 148.580 166.552 177.481 1.00 104.39 0  459 ASP A N   1 
ATOM   3192  C  CA  . ASP A 1 459 ? 149.648 165.719 176.947 1.00 104.39 0  459 ASP A CA  1 
ATOM   3193  C  C   . ASP A 1 459 ? 150.074 166.254 175.586 1.00 104.39 0  459 ASP A C   1 
ATOM   3194  O  O   . ASP A 1 459 ? 149.229 166.580 174.747 1.00 104.39 0  459 ASP A O   1 
ATOM   3195  C  CB  . ASP A 1 459 ? 149.223 164.244 176.866 1.00 104.39 0  459 ASP A CB  1 
ATOM   3196  C  CG  . ASP A 1 459 ? 147.879 164.044 176.180 1.00 104.39 0  459 ASP A CG  1 
ATOM   3197  O  OD1 . ASP A 1 459 ? 147.164 165.035 175.927 1.00 104.39 0  459 ASP A OD1 1 
ATOM   3198  O  OD2 . ASP A 1 459 ? 147.538 162.878 175.891 1.00 104.39 -1 459 ASP A OD2 1 
ATOM   3199  N  N   . GLU A 1 460 ? 151.381 166.366 175.380 1.00 108.30 0  460 GLU A N   1 
ATOM   3200  C  CA  . GLU A 1 460 ? 151.930 166.998 174.190 1.00 108.30 0  460 GLU A CA  1 
ATOM   3201  C  C   . GLU A 1 460 ? 152.486 165.950 173.229 1.00 108.30 0  460 GLU A C   1 
ATOM   3202  O  O   . GLU A 1 460 ? 152.521 164.750 173.517 1.00 108.30 0  460 GLU A O   1 
ATOM   3203  C  CB  . GLU A 1 460 ? 153.004 168.014 174.576 1.00 108.30 0  460 GLU A CB  1 
ATOM   3204  N  N   . ASP A 1 461 ? 152.932 166.433 172.074 1.00 110.49 0  461 ASP A N   1 
ATOM   3205  C  CA  . ASP A 1 461 ? 153.412 165.605 170.974 1.00 110.49 0  461 ASP A CA  1 
ATOM   3206  C  C   . ASP A 1 461 ? 154.324 166.476 170.112 1.00 110.49 0  461 ASP A C   1 
ATOM   3207  O  O   . ASP A 1 461 ? 154.808 167.517 170.570 1.00 110.49 0  461 ASP A O   1 
ATOM   3208  C  CB  . ASP A 1 461 ? 152.230 165.009 170.190 1.00 110.49 0  461 ASP A CB  1 
ATOM   3209  N  N   . ASP A 1 462 ? 154.584 166.034 168.875 1.00 114.06 0  462 ASP A N   1 
ATOM   3210  C  CA  . ASP A 1 462 ? 155.335 166.855 167.927 1.00 114.06 0  462 ASP A CA  1 
ATOM   3211  C  C   . ASP A 1 462 ? 154.606 168.156 167.605 1.00 114.06 0  462 ASP A C   1 
ATOM   3212  O  O   . ASP A 1 462 ? 155.249 169.185 167.368 1.00 114.06 0  462 ASP A O   1 
ATOM   3213  C  CB  . ASP A 1 462 ? 155.603 166.066 166.646 1.00 114.06 0  462 ASP A CB  1 
ATOM   3214  N  N   . GLY A 1 463 ? 153.277 168.129 167.593 1.00 115.09 0  463 GLY A N   1 
ATOM   3215  C  CA  . GLY A 1 463 ? 152.465 169.333 167.571 1.00 115.09 0  463 GLY A CA  1 
ATOM   3216  C  C   . GLY A 1 463 ? 151.824 169.539 168.934 1.00 115.09 0  463 GLY A C   1 
ATOM   3217  O  O   . GLY A 1 463 ? 151.301 168.597 169.531 1.00 115.09 0  463 GLY A O   1 
ATOM   3218  N  N   . GLU A 1 464 ? 151.878 170.784 169.415 1.00 113.47 0  464 GLU A N   1 
ATOM   3219  C  CA  . GLU A 1 464 ? 151.384 171.079 170.755 1.00 113.47 0  464 GLU A CA  1 
ATOM   3220  C  C   . GLU A 1 464 ? 149.863 171.096 170.829 1.00 113.47 0  464 GLU A C   1 
ATOM   3221  O  O   . GLU A 1 464 ? 149.309 170.925 171.920 1.00 113.47 0  464 GLU A O   1 
ATOM   3222  C  CB  . GLU A 1 464 ? 151.942 172.418 171.239 1.00 113.47 0  464 GLU A CB  1 
ATOM   3223  N  N   . PHE A 1 465 ? 149.180 171.303 169.706 1.00 108.42 0  465 PHE A N   1 
ATOM   3224  C  CA  . PHE A 1 465 ? 147.719 171.282 169.675 1.00 108.42 0  465 PHE A CA  1 
ATOM   3225  C  C   . PHE A 1 465 ? 147.260 169.832 169.751 1.00 108.42 0  465 PHE A C   1 
ATOM   3226  O  O   . PHE A 1 465 ? 147.277 169.114 168.747 1.00 108.42 0  465 PHE A O   1 
ATOM   3227  C  CB  . PHE A 1 465 ? 147.198 171.967 168.418 1.00 108.42 0  465 PHE A CB  1 
ATOM   3228  N  N   . SER A 1 466 ? 146.852 169.414 170.953 1.00 108.57 0  466 SER A N   1 
ATOM   3229  C  CA  . SER A 1 466 ? 146.386 168.057 171.278 1.00 108.57 0  466 SER A CA  1 
ATOM   3230  C  C   . SER A 1 466 ? 147.385 166.963 170.895 1.00 108.57 0  466 SER A C   1 
ATOM   3231  O  O   . SER A 1 466 ? 147.540 165.972 171.608 1.00 108.57 0  466 SER A O   1 
ATOM   3232  C  CB  . SER A 1 466 ? 145.030 167.776 170.619 1.00 108.57 0  466 SER A CB  1 
ATOM   3233  N  N   . ASP A 1 549 ? 114.329 172.980 225.446 1.00 194.40 0  549 ASP A N   1 
ATOM   3234  C  CA  . ASP A 1 549 ? 114.681 171.767 226.174 1.00 194.40 0  549 ASP A CA  1 
ATOM   3235  C  C   . ASP A 1 549 ? 114.029 170.542 225.542 1.00 194.40 0  549 ASP A C   1 
ATOM   3236  O  O   . ASP A 1 549 ? 114.715 169.653 225.037 1.00 194.40 0  549 ASP A O   1 
ATOM   3237  C  CB  . ASP A 1 549 ? 114.269 171.884 227.643 1.00 194.40 0  549 ASP A CB  1 
ATOM   3238  N  N   . ILE A 1 550 ? 112.696 170.500 225.574 1.00 196.53 0  550 ILE A N   1 
ATOM   3239  C  CA  . ILE A 1 550 ? 111.975 169.371 224.997 1.00 196.53 0  550 ILE A CA  1 
ATOM   3240  C  C   . ILE A 1 550 ? 111.914 169.441 223.478 1.00 196.53 0  550 ILE A C   1 
ATOM   3241  O  O   . ILE A 1 550 ? 111.750 168.402 222.826 1.00 196.53 0  550 ILE A O   1 
ATOM   3242  C  CB  . ILE A 1 550 ? 110.551 169.281 225.569 1.00 196.53 0  550 ILE A CB  1 
ATOM   3243  N  N   . LYS A 1 551 ? 112.047 170.637 222.895 1.00 198.99 0  551 LYS A N   1 
ATOM   3244  C  CA  . LYS A 1 551 ? 111.992 170.766 221.442 1.00 198.99 0  551 LYS A CA  1 
ATOM   3245  C  C   . LYS A 1 551 ? 113.241 170.190 220.786 1.00 198.99 0  551 LYS A C   1 
ATOM   3246  O  O   . LYS A 1 551 ? 113.155 169.556 219.728 1.00 198.99 0  551 LYS A O   1 
ATOM   3247  C  CB  . LYS A 1 551 ? 111.808 172.233 221.052 1.00 198.99 0  551 LYS A CB  1 
ATOM   3248  N  N   . VAL A 1 552 ? 114.406 170.383 221.412 1.00 198.00 0  552 VAL A N   1 
ATOM   3249  C  CA  . VAL A 1 552 ? 115.644 169.821 220.880 1.00 198.00 0  552 VAL A CA  1 
ATOM   3250  C  C   . VAL A 1 552 ? 115.640 168.302 221.006 1.00 198.00 0  552 VAL A C   1 
ATOM   3251  O  O   . VAL A 1 552 ? 116.122 167.592 220.114 1.00 198.00 0  552 VAL A O   1 
ATOM   3252  C  CB  . VAL A 1 552 ? 116.860 170.445 221.588 1.00 198.00 0  552 VAL A CB  1 
ATOM   3253  N  N   . PHE A 1 553 ? 115.073 167.781 222.098 1.00 198.83 0  553 PHE A N   1 
ATOM   3254  C  CA  . PHE A 1 553 ? 114.961 166.334 222.263 1.00 198.83 0  553 PHE A CA  1 
ATOM   3255  C  C   . PHE A 1 553 ? 113.968 165.738 221.273 1.00 198.83 0  553 PHE A C   1 
ATOM   3256  O  O   . PHE A 1 553 ? 114.192 164.641 220.748 1.00 198.83 0  553 PHE A O   1 
ATOM   3257  C  CB  . PHE A 1 553 ? 114.554 166.001 223.698 1.00 198.83 0  553 PHE A CB  1 
ATOM   3258  N  N   . GLN A 1 554 ? 112.879 166.459 220.987 1.00 200.40 0  554 GLN A N   1 
ATOM   3259  C  CA  . GLN A 1 554 ? 111.918 165.999 219.988 1.00 200.40 0  554 GLN A CA  1 
ATOM   3260  C  C   . GLN A 1 554 ? 112.521 166.022 218.587 1.00 200.40 0  554 GLN A C   1 
ATOM   3261  O  O   . GLN A 1 554 ? 112.277 165.110 217.788 1.00 200.40 0  554 GLN A O   1 
ATOM   3262  C  CB  . GLN A 1 554 ? 110.653 166.854 220.043 1.00 200.40 0  554 GLN A CB  1 
ATOM   3263  N  N   . ASN A 1 555 ? 113.330 167.042 218.284 1.00 199.93 0  555 ASN A N   1 
ATOM   3264  C  CA  . ASN A 1 555 ? 114.001 167.103 216.989 1.00 199.93 0  555 ASN A CA  1 
ATOM   3265  C  C   . ASN A 1 555 ? 115.055 166.010 216.857 1.00 199.93 0  555 ASN A C   1 
ATOM   3266  O  O   . ASN A 1 555 ? 115.224 165.433 215.776 1.00 199.93 0  555 ASN A O   1 
ATOM   3267  C  CB  . ASN A 1 555 ? 114.628 168.482 216.788 1.00 199.93 0  555 ASN A CB  1 
ATOM   3268  N  N   . GLU A 1 556 ? 115.755 165.694 217.952 1.00 200.84 0  556 GLU A N   1 
ATOM   3269  C  CA  . GLU A 1 556 ? 116.733 164.610 217.925 1.00 200.84 0  556 GLU A CA  1 
ATOM   3270  C  C   . GLU A 1 556 ? 116.054 163.253 217.772 1.00 200.84 0  556 GLU A C   1 
ATOM   3271  O  O   . GLU A 1 556 ? 116.564 162.377 217.063 1.00 200.84 0  556 GLU A O   1 
ATOM   3272  C  CB  . GLU A 1 556 ? 117.588 164.643 219.191 1.00 200.84 0  556 GLU A CB  1 
ATOM   3273  N  N   . VAL A 1 557 ? 114.892 163.071 218.407 1.00 202.84 0  557 VAL A N   1 
ATOM   3274  C  CA  . VAL A 1 557 ? 114.149 161.822 218.266 1.00 202.84 0  557 VAL A CA  1 
ATOM   3275  C  C   . VAL A 1 557 ? 113.588 161.686 216.855 1.00 202.84 0  557 VAL A C   1 
ATOM   3276  O  O   . VAL A 1 557 ? 113.567 160.587 216.286 1.00 202.84 0  557 VAL A O   1 
ATOM   3277  C  CB  . VAL A 1 557 ? 113.037 161.740 219.327 1.00 202.84 0  557 VAL A CB  1 
ATOM   3278  N  N   . LEU A 1 558 ? 113.152 162.801 216.258 1.00 203.68 0  558 LEU A N   1 
ATOM   3279  C  CA  . LEU A 1 558 ? 112.662 162.769 214.882 1.00 203.68 0  558 LEU A CA  1 
ATOM   3280  C  C   . LEU A 1 558 ? 113.791 162.488 213.897 1.00 203.68 0  558 LEU A C   1 
ATOM   3281  O  O   . LEU A 1 558 ? 113.600 161.749 212.924 1.00 203.68 0  558 LEU A O   1 
ATOM   3282  C  CB  . LEU A 1 558 ? 111.968 164.087 214.542 1.00 203.68 0  558 LEU A CB  1 
ATOM   3283  N  N   . GLY A 1 559 ? 114.978 163.050 214.145 1.00 203.36 0  559 GLY A N   1 
ATOM   3284  C  CA  . GLY A 1 559 ? 116.123 162.749 213.300 1.00 203.36 0  559 GLY A CA  1 
ATOM   3285  C  C   . GLY A 1 559 ? 116.592 161.312 213.434 1.00 203.36 0  559 GLY A C   1 
ATOM   3286  O  O   . GLY A 1 559 ? 116.988 160.687 212.446 1.00 203.36 0  559 GLY A O   1 
ATOM   3287  N  N   . THR A 1 560 ? 116.530 160.761 214.651 1.00 204.59 0  560 THR A N   1 
ATOM   3288  C  CA  . THR A 1 560 ? 116.885 159.359 214.853 1.00 204.59 0  560 THR A CA  1 
ATOM   3289  C  C   . THR A 1 560 ? 115.871 158.430 214.195 1.00 204.59 0  560 THR A C   1 
ATOM   3290  O  O   . THR A 1 560 ? 116.248 157.398 213.626 1.00 204.59 0  560 THR A O   1 
ATOM   3291  C  CB  . THR A 1 560 ? 116.999 159.054 216.346 1.00 204.59 0  560 THR A CB  1 
ATOM   3292  N  N   . LEU A 1 561 ? 114.584 158.793 214.238 1.00 207.63 0  561 LEU A N   1 
ATOM   3293  C  CA  . LEU A 1 561 ? 113.563 157.995 213.565 1.00 207.63 0  561 LEU A CA  1 
ATOM   3294  C  C   . LEU A 1 561 ? 113.706 158.076 212.049 1.00 207.63 0  561 LEU A C   1 
ATOM   3295  O  O   . LEU A 1 561 ? 113.511 157.074 211.350 1.00 207.63 0  561 LEU A O   1 
ATOM   3296  C  CB  . LEU A 1 561 ? 112.171 158.451 213.999 1.00 207.63 0  561 LEU A CB  1 
ATOM   3297  N  N   . GLN A 1 562 ? 114.071 159.252 211.528 1.00 205.61 0  562 GLN A N   1 
ATOM   3298  C  CA  . GLN A 1 562 ? 114.301 159.395 210.093 1.00 205.61 0  562 GLN A CA  1 
ATOM   3299  C  C   . GLN A 1 562 ? 115.531 158.613 209.645 1.00 205.61 0  562 GLN A C   1 
ATOM   3300  O  O   . GLN A 1 562 ? 115.527 158.007 208.567 1.00 205.61 0  562 GLN A O   1 
ATOM   3301  C  CB  . GLN A 1 562 ? 114.442 160.872 209.729 1.00 205.61 0  562 GLN A CB  1 
ATOM   3302  N  N   . LYS A 1 563 ? 116.584 158.596 210.470 1.00 206.08 0  563 LYS A N   1 
ATOM   3303  C  CA  . LYS A 1 563 ? 117.774 157.816 210.141 1.00 206.08 0  563 LYS A CA  1 
ATOM   3304  C  C   . LYS A 1 563 ? 117.495 156.318 210.213 1.00 206.08 0  563 LYS A C   1 
ATOM   3305  O  O   . LYS A 1 563 ? 118.000 155.548 209.387 1.00 206.08 0  563 LYS A O   1 
ATOM   3306  C  CB  . LYS A 1 563 ? 118.923 158.194 211.075 1.00 206.08 0  563 LYS A CB  1 
ATOM   3307  N  N   . GLY A 1 564 ? 116.683 155.889 211.183 1.00 207.84 0  564 GLY A N   1 
ATOM   3308  C  CA  . GLY A 1 564 ? 116.315 154.487 211.265 1.00 207.84 0  564 GLY A CA  1 
ATOM   3309  C  C   . GLY A 1 564 ? 115.376 154.048 210.160 1.00 207.84 0  564 GLY A C   1 
ATOM   3310  O  O   . GLY A 1 564 ? 115.379 152.878 209.768 1.00 207.84 0  564 GLY A O   1 
ATOM   3311  N  N   . LYS A 1 565 ? 114.560 154.970 209.644 1.00 207.54 0  565 LYS A N   1 
ATOM   3312  C  CA  . LYS A 1 565 ? 113.703 154.647 208.511 1.00 207.54 0  565 LYS A CA  1 
ATOM   3313  C  C   . LYS A 1 565 ? 114.464 154.673 207.191 1.00 207.54 0  565 LYS A C   1 
ATOM   3314  O  O   . LYS A 1 565 ? 114.128 153.915 206.274 1.00 207.54 0  565 LYS A O   1 
ATOM   3315  C  CB  . LYS A 1 565 ? 112.520 155.615 208.453 1.00 207.54 0  565 LYS A CB  1 
ATOM   3316  N  N   . GLU A 1 566 ? 115.484 155.526 207.075 1.00 204.68 0  566 GLU A N   1 
ATOM   3317  C  CA  . GLU A 1 566 ? 116.247 155.610 205.835 1.00 204.68 0  566 GLU A CA  1 
ATOM   3318  C  C   . GLU A 1 566 ? 117.265 154.480 205.725 1.00 204.68 0  566 GLU A C   1 
ATOM   3319  O  O   . GLU A 1 566 ? 117.350 153.812 204.689 1.00 204.68 0  566 GLU A O   1 
ATOM   3320  C  CB  . GLU A 1 566 ? 116.943 156.969 205.740 1.00 204.68 0  566 GLU A CB  1 
ATOM   3321  N  N   . GLU A 1 567 ? 118.043 154.251 206.781 1.00 204.71 0  567 GLU A N   1 
ATOM   3322  C  CA  . GLU A 1 567 ? 119.097 153.245 206.762 1.00 204.71 0  567 GLU A CA  1 
ATOM   3323  C  C   . GLU A 1 567 ? 118.601 151.851 207.122 1.00 204.71 0  567 GLU A C   1 
ATOM   3324  O  O   . GLU A 1 567 ? 119.408 150.913 207.116 1.00 204.71 0  567 GLU A O   1 
ATOM   3325  C  CB  . GLU A 1 567 ? 120.226 153.649 207.715 1.00 204.71 0  567 GLU A CB  1 
ATOM   3326  N  N   . ASN A 1 568 ? 117.304 151.709 207.426 1.00 203.19 0  568 ASN A N   1 
ATOM   3327  C  CA  . ASN A 1 568 ? 116.652 150.451 207.815 1.00 203.19 0  568 ASN A CA  1 
ATOM   3328  C  C   . ASN A 1 568 ? 117.329 149.823 209.037 1.00 203.19 0  568 ASN A C   1 
ATOM   3329  O  O   . ASN A 1 568 ? 117.792 148.680 209.014 1.00 203.19 0  568 ASN A O   1 
ATOM   3330  C  CB  . ASN A 1 568 ? 116.589 149.465 206.640 1.00 203.19 0  568 ASN A CB  1 
ATOM   3331  N  N   . ILE A 1 569 ? 117.381 150.606 210.113 1.00 200.06 0  569 ILE A N   1 
ATOM   3332  C  CA  . ILE A 1 569 ? 118.011 150.152 211.346 1.00 200.06 0  569 ILE A CA  1 
ATOM   3333  C  C   . ILE A 1 569 ? 117.099 149.159 212.059 1.00 200.06 0  569 ILE A C   1 
ATOM   3334  O  O   . ILE A 1 569 ? 115.882 149.131 211.861 1.00 200.06 0  569 ILE A O   1 
ATOM   3335  C  CB  . ILE A 1 569 ? 118.363 151.341 212.257 1.00 200.06 0  569 ILE A CB  1 
ATOM   3336  N  N   . SER A 1 570 ? 117.706 148.331 212.905 1.00 194.85 0  570 SER A N   1 
ATOM   3337  C  CA  . SER A 1 570 ? 116.958 147.332 213.650 1.00 194.85 0  570 SER A CA  1 
ATOM   3338  C  C   . SER A 1 570 ? 116.227 147.978 214.826 1.00 194.85 0  570 SER A C   1 
ATOM   3339  O  O   . SER A 1 570 ? 116.422 149.153 215.150 1.00 194.85 0  570 SER A O   1 
ATOM   3340  C  CB  . SER A 1 570 ? 117.888 146.224 214.142 1.00 194.85 0  570 SER A CB  1 
ATOM   3341  N  N   . CYS A 1 571 ? 115.371 147.185 215.472 1.00 193.12 0  571 CYS A N   1 
ATOM   3342  C  CA  . CYS A 1 571 ? 114.608 147.687 216.609 1.00 193.12 0  571 CYS A CA  1 
ATOM   3343  C  C   . CYS A 1 571 ? 115.461 147.811 217.864 1.00 193.12 0  571 CYS A C   1 
ATOM   3344  O  O   . CYS A 1 571 ? 115.210 148.697 218.690 1.00 193.12 0  571 CYS A O   1 
ATOM   3345  C  CB  . CYS A 1 571 ? 113.409 146.776 216.880 1.00 193.12 0  571 CYS A CB  1 
ATOM   3346  N  N   . ASP A 1 572 ? 116.470 146.949 218.019 1.00 190.51 0  572 ASP A N   1 
ATOM   3347  C  CA  . ASP A 1 572 ? 117.317 146.998 219.208 1.00 190.51 0  572 ASP A CA  1 
ATOM   3348  C  C   . ASP A 1 572 ? 118.220 148.226 219.196 1.00 190.51 0  572 ASP A C   1 
ATOM   3349  O  O   . ASP A 1 572 ? 118.368 148.902 220.222 1.00 190.51 0  572 ASP A O   1 
ATOM   3350  C  CB  . ASP A 1 572 ? 118.150 145.720 219.311 1.00 190.51 0  572 ASP A CB  1 
ATOM   3351  N  N   . ASN A 1 573 ? 118.816 148.539 218.042 1.00 189.96 0  573 ASN A N   1 
ATOM   3352  C  CA  . ASN A 1 573 ? 119.646 149.735 217.933 1.00 189.96 0  573 ASN A CA  1 
ATOM   3353  C  C   . ASN A 1 573 ? 118.814 151.007 218.034 1.00 189.96 0  573 ASN A C   1 
ATOM   3354  O  O   . ASN A 1 573 ? 119.278 152.003 218.601 1.00 189.96 0  573 ASN A O   1 
ATOM   3355  C  CB  . ASN A 1 573 ? 120.428 149.714 216.619 1.00 189.96 0  573 ASN A CB  1 
ATOM   3356  N  N   . LEU A 1 574 ? 117.579 150.981 217.524 1.00 190.86 0  574 LEU A N   1 
ATOM   3357  C  CA  . LEU A 1 574 ? 116.694 152.134 217.656 1.00 190.86 0  574 LEU A CA  1 
ATOM   3358  C  C   . LEU A 1 574 ? 116.264 152.339 219.104 1.00 190.86 0  574 LEU A C   1 
ATOM   3359  O  O   . LEU A 1 574 ? 116.179 153.479 219.574 1.00 190.86 0  574 LEU A O   1 
ATOM   3360  C  CB  . LEU A 1 574 ? 115.473 151.964 216.752 1.00 190.86 0  574 LEU A CB  1 
ATOM   3361  N  N   . VAL A 1 575 ? 116.013 151.246 219.831 1.00 188.88 0  575 VAL A N   1 
ATOM   3362  C  CA  . VAL A 1 575 ? 115.655 151.353 221.243 1.00 188.88 0  575 VAL A CA  1 
ATOM   3363  C  C   . VAL A 1 575 ? 116.848 151.822 222.066 1.00 188.88 0  575 VAL A C   1 
ATOM   3364  O  O   . VAL A 1 575 ? 116.693 152.592 223.022 1.00 188.88 0  575 VAL A O   1 
ATOM   3365  C  CB  . VAL A 1 575 ? 115.104 150.011 221.757 1.00 188.88 0  575 VAL A CB  1 
ATOM   3366  N  N   . LEU A 1 576 ? 118.058 151.390 221.693 1.00 189.44 0  576 LEU A N   1 
ATOM   3367  C  CA  . LEU A 1 576 ? 119.261 151.853 222.381 1.00 189.44 0  576 LEU A CA  1 
ATOM   3368  C  C   . LEU A 1 576 ? 119.517 153.333 222.118 1.00 189.44 0  576 LEU A C   1 
ATOM   3369  O  O   . LEU A 1 576 ? 119.909 154.071 223.030 1.00 189.44 0  576 LEU A O   1 
ATOM   3370  C  CB  . LEU A 1 576 ? 120.465 151.015 221.953 1.00 189.44 0  576 LEU A CB  1 
ATOM   3371  N  N   . GLU A 1 577 ? 119.274 153.791 220.885 1.00 188.76 0  577 GLU A N   1 
ATOM   3372  C  CA  . GLU A 1 577 ? 119.426 155.209 220.576 1.00 188.76 0  577 GLU A CA  1 
ATOM   3373  C  C   . GLU A 1 577 ? 118.359 156.052 221.264 1.00 188.76 0  577 GLU A C   1 
ATOM   3374  O  O   . GLU A 1 577 ? 118.643 157.175 221.694 1.00 188.76 0  577 GLU A O   1 
ATOM   3375  C  CB  . GLU A 1 577 ? 119.382 155.426 219.063 1.00 188.76 0  577 GLU A CB  1 
ATOM   3376  N  N   . ILE A 1 578 ? 117.141 155.518 221.400 1.00 188.35 0  578 ILE A N   1 
ATOM   3377  C  CA  . ILE A 1 578 ? 116.082 156.235 222.106 1.00 188.35 0  578 ILE A CA  1 
ATOM   3378  C  C   . ILE A 1 578 ? 116.393 156.320 223.596 1.00 188.35 0  578 ILE A C   1 
ATOM   3379  O  O   . ILE A 1 578 ? 116.146 157.350 224.235 1.00 188.35 0  578 ILE A O   1 
ATOM   3380  C  CB  . ILE A 1 578 ? 114.721 155.565 221.849 1.00 188.35 0  578 ILE A CB  1 
ATOM   3381  N  N   . ASN A 1 579 ? 116.960 155.252 224.167 1.00 188.78 0  579 ASN A N   1 
ATOM   3382  C  CA  . ASN A 1 579 ? 117.357 155.282 225.572 1.00 188.78 0  579 ASN A CA  1 
ATOM   3383  C  C   . ASN A 1 579 ? 118.532 156.227 225.797 1.00 188.78 0  579 ASN A C   1 
ATOM   3384  O  O   . ASN A 1 579 ? 118.595 156.912 226.826 1.00 188.78 0  579 ASN A O   1 
ATOM   3385  C  CB  . ASN A 1 579 ? 117.704 153.871 226.049 1.00 188.78 0  579 ASN A CB  1 
ATOM   3386  N  N   . SER A 1 580 ? 119.457 156.298 224.834 1.00 188.05 0  580 SER A N   1 
ATOM   3387  C  CA  . SER A 1 580 ? 120.569 157.238 224.932 1.00 188.05 0  580 SER A CA  1 
ATOM   3388  C  C   . SER A 1 580 ? 120.089 158.682 224.824 1.00 188.05 0  580 SER A C   1 
ATOM   3389  O  O   . SER A 1 580 ? 120.583 159.559 225.543 1.00 188.05 0  580 SER A O   1 
ATOM   3390  C  CB  . SER A 1 580 ? 121.607 156.936 223.851 1.00 188.05 0  580 SER A CB  1 
ATOM   3391  N  N   . LEU A 1 581 ? 119.112 158.942 223.950 1.00 190.23 0  581 LEU A N   1 
ATOM   3392  C  CA  . LEU A 1 581 ? 118.550 160.286 223.840 1.00 190.23 0  581 LEU A CA  1 
ATOM   3393  C  C   . LEU A 1 581 ? 117.747 160.661 225.082 1.00 190.23 0  581 LEU A C   1 
ATOM   3394  O  O   . LEU A 1 581 ? 117.755 161.824 225.503 1.00 190.23 0  581 LEU A O   1 
ATOM   3395  C  CB  . LEU A 1 581 ? 117.681 160.388 222.587 1.00 190.23 0  581 LEU A CB  1 
ATOM   3396  N  N   . LYS A 1 582 ? 117.057 159.689 225.687 1.00 192.33 0  582 LYS A N   1 
ATOM   3397  C  CA  . LYS A 1 582 ? 116.324 159.957 226.920 1.00 192.33 0  582 LYS A CA  1 
ATOM   3398  C  C   . LYS A 1 582 ? 117.264 160.181 228.098 1.00 192.33 0  582 LYS A C   1 
ATOM   3399  O  O   . LYS A 1 582 ? 116.944 160.959 229.005 1.00 192.33 0  582 LYS A O   1 
ATOM   3400  C  CB  . LYS A 1 582 ? 115.362 158.808 227.221 1.00 192.33 0  582 LYS A CB  1 
ATOM   3401  N  N   . TYR A 1 583 ? 118.419 159.511 228.106 1.00 190.69 0  583 TYR A N   1 
ATOM   3402  C  CA  . TYR A 1 583 ? 119.404 159.758 229.153 1.00 190.69 0  583 TYR A CA  1 
ATOM   3403  C  C   . TYR A 1 583 ? 120.124 161.084 228.943 1.00 190.69 0  583 TYR A C   1 
ATOM   3404  O  O   . TYR A 1 583 ? 120.493 161.748 229.918 1.00 190.69 0  583 TYR A O   1 
ATOM   3405  C  CB  . TYR A 1 583 ? 120.411 158.609 229.209 1.00 190.69 0  583 TYR A CB  1 
ATOM   3406  N  N   . ALA A 1 584 ? 120.326 161.488 227.686 1.00 191.65 0  584 ALA A N   1 
ATOM   3407  C  CA  . ALA A 1 584 ? 121.000 162.753 227.413 1.00 191.65 0  584 ALA A CA  1 
ATOM   3408  C  C   . ALA A 1 584 ? 120.090 163.942 227.694 1.00 191.65 0  584 ALA A C   1 
ATOM   3409  O  O   . ALA A 1 584 ? 120.530 164.942 228.273 1.00 191.65 0  584 ALA A O   1 
ATOM   3410  C  CB  . ALA A 1 584 ? 121.489 162.782 225.966 1.00 191.65 0  584 ALA A CB  1 
ATOM   3411  N  N   . TYR A 1 585 ? 118.819 163.855 227.295 1.00 197.16 0  585 TYR A N   1 
ATOM   3412  C  CA  . TYR A 1 585 ? 117.887 164.950 227.532 1.00 197.16 0  585 TYR A CA  1 
ATOM   3413  C  C   . TYR A 1 585 ? 117.397 165.006 228.972 1.00 197.16 0  585 TYR A C   1 
ATOM   3414  O  O   . TYR A 1 585 ? 116.875 166.050 229.385 1.00 197.16 0  585 TYR A O   1 
ATOM   3415  C  CB  . TYR A 1 585 ? 116.689 164.835 226.586 1.00 197.16 0  585 TYR A CB  1 
ATOM   3416  N  N   . ASN A 1 586 ? 117.552 163.907 229.725 1.00 199.98 0  586 ASN A N   1 
ATOM   3417  C  CA  . ASN A 1 586 ? 117.138 163.773 231.130 1.00 199.98 0  586 ASN A CA  1 
ATOM   3418  C  C   . ASN A 1 586 ? 115.649 164.051 231.331 1.00 199.98 0  586 ASN A C   1 
ATOM   3419  O  O   . ASN A 1 586 ? 115.239 164.586 232.364 1.00 199.98 0  586 ASN A O   1 
ATOM   3420  C  CB  . ASN A 1 586 ? 117.980 164.661 232.057 1.00 199.98 0  586 ASN A CB  1 
ATOM   3421  N  N   . ILE A 1 587 ? 114.829 163.690 230.345 1.00 208.85 0  587 ILE A N   1 
ATOM   3422  C  CA  . ILE A 1 587 ? 113.386 163.881 230.425 1.00 208.85 0  587 ILE A CA  1 
ATOM   3423  C  C   . ILE A 1 587 ? 112.766 162.717 231.185 1.00 208.85 0  587 ILE A C   1 
ATOM   3424  O  O   . ILE A 1 587 ? 113.420 161.694 231.418 1.00 208.85 0  587 ILE A O   1 
ATOM   3425  C  CB  . ILE A 1 587 ? 112.762 164.020 229.024 1.00 208.85 0  587 ILE A CB  1 
ATOM   3426  N  N   . SER A 1 588 ? 111.504 162.866 231.579 1.00 221.01 0  588 SER A N   1 
ATOM   3427  C  CA  . SER A 1 588 ? 110.785 161.795 232.248 1.00 221.01 0  588 SER A CA  1 
ATOM   3428  C  C   . SER A 1 588 ? 110.371 160.721 231.242 1.00 221.01 0  588 SER A C   1 
ATOM   3429  O  O   . SER A 1 588 ? 110.508 160.879 230.027 1.00 221.01 0  588 SER A O   1 
ATOM   3430  C  CB  . SER A 1 588 ? 109.560 162.346 232.976 1.00 221.01 0  588 SER A CB  1 
ATOM   3431  N  N   . LEU A 1 589 ? 109.854 159.609 231.771 1.00 228.25 0  589 LEU A N   1 
ATOM   3432  C  CA  . LEU A 1 589 ? 109.449 158.498 230.913 1.00 228.25 0  589 LEU A CA  1 
ATOM   3433  C  C   . LEU A 1 589 ? 108.170 158.822 230.150 1.00 228.25 0  589 LEU A C   1 
ATOM   3434  O  O   . LEU A 1 589 ? 108.060 158.516 228.955 1.00 228.25 0  589 LEU A O   1 
ATOM   3435  C  CB  . LEU A 1 589 ? 109.271 157.230 231.747 1.00 228.25 0  589 LEU A CB  1 
ATOM   3436  N  N   . LYS A 1 590 ? 107.194 159.439 230.823 1.00 232.39 0  590 LYS A N   1 
ATOM   3437  C  CA  . LYS A 1 590 ? 105.952 159.821 230.157 1.00 232.39 0  590 LYS A CA  1 
ATOM   3438  C  C   . LYS A 1 590 ? 106.183 160.945 229.154 1.00 232.39 0  590 LYS A C   1 
ATOM   3439  O  O   . LYS A 1 590 ? 105.552 160.971 228.090 1.00 232.39 0  590 LYS A O   1 
ATOM   3440  C  CB  . LYS A 1 590 ? 104.907 160.233 231.194 1.00 232.39 0  590 LYS A CB  1 
ATOM   3441  N  N   . GLU A 1 591 ? 107.100 161.866 229.463 1.00 232.64 0  591 GLU A N   1 
ATOM   3442  C  CA  . GLU A 1 591 ? 107.430 162.932 228.522 1.00 232.64 0  591 GLU A CA  1 
ATOM   3443  C  C   . GLU A 1 591 ? 108.159 162.387 227.299 1.00 232.64 0  591 GLU A C   1 
ATOM   3444  O  O   . GLU A 1 591 ? 107.920 162.843 226.175 1.00 232.64 0  591 GLU A O   1 
ATOM   3445  C  CB  . GLU A 1 591 ? 108.272 164.003 229.216 1.00 232.64 0  591 GLU A CB  1 
ATOM   3446  N  N   . VAL A 1 592 ? 109.027 161.390 227.495 1.00 234.65 0  592 VAL A N   1 
ATOM   3447  C  CA  . VAL A 1 592 ? 109.719 160.770 226.368 1.00 234.65 0  592 VAL A CA  1 
ATOM   3448  C  C   . VAL A 1 592 ? 108.746 159.958 225.522 1.00 234.65 0  592 VAL A C   1 
ATOM   3449  O  O   . VAL A 1 592 ? 108.858 159.920 224.291 1.00 234.65 0  592 VAL A O   1 
ATOM   3450  C  CB  . VAL A 1 592 ? 110.892 159.906 226.865 1.00 234.65 0  592 VAL A CB  1 
ATOM   3451  N  N   . MET A 1 593 ? 107.763 159.316 226.164 1.00 236.33 0  593 MET A N   1 
ATOM   3452  C  CA  . MET A 1 593 ? 106.742 158.583 225.421 1.00 236.33 0  593 MET A CA  1 
ATOM   3453  C  C   . MET A 1 593 ? 105.846 159.528 224.627 1.00 236.33 0  593 MET A C   1 
ATOM   3454  O  O   . MET A 1 593 ? 105.475 159.226 223.486 1.00 236.33 0  593 MET A O   1 
ATOM   3455  C  CB  . MET A 1 593 ? 105.909 157.729 226.377 1.00 236.33 0  593 MET A CB  1 
ATOM   3456  N  N   . GLN A 1 594 ? 105.508 160.684 225.208 1.00 238.69 0  594 GLN A N   1 
ATOM   3457  C  CA  . GLN A 1 594 ? 104.716 161.679 224.491 1.00 238.69 0  594 GLN A CA  1 
ATOM   3458  C  C   . GLN A 1 594 ? 105.501 162.286 223.333 1.00 238.69 0  594 GLN A C   1 
ATOM   3459  O  O   . GLN A 1 594 ? 104.934 162.552 222.267 1.00 238.69 0  594 GLN A O   1 
ATOM   3460  C  CB  . GLN A 1 594 ? 104.249 162.770 225.454 1.00 238.69 0  594 GLN A CB  1 
ATOM   3461  N  N   . VAL A 1 595 ? 106.810 162.488 223.515 1.00 239.65 0  595 VAL A N   1 
ATOM   3462  C  CA  . VAL A 1 595 ? 107.643 163.018 222.439 1.00 239.65 0  595 VAL A CA  1 
ATOM   3463  C  C   . VAL A 1 595 ? 107.795 161.993 221.320 1.00 239.65 0  595 VAL A C   1 
ATOM   3464  O  O   . VAL A 1 595 ? 107.802 162.347 220.135 1.00 239.65 0  595 VAL A O   1 
ATOM   3465  C  CB  . VAL A 1 595 ? 109.010 163.460 222.991 1.00 239.65 0  595 VAL A CB  1 
ATOM   3466  N  N   . LEU A 1 596 ? 107.892 160.707 221.674 1.00 241.32 0  596 LEU A N   1 
ATOM   3467  C  CA  . LEU A 1 596 ? 107.976 159.657 220.662 1.00 241.32 0  596 LEU A CA  1 
ATOM   3468  C  C   . LEU A 1 596 ? 106.663 159.512 219.903 1.00 241.32 0  596 LEU A C   1 
ATOM   3469  O  O   . LEU A 1 596 ? 106.666 159.301 218.684 1.00 241.32 0  596 LEU A O   1 
ATOM   3470  C  CB  . LEU A 1 596 ? 108.370 158.331 221.313 1.00 241.32 0  596 LEU A CB  1 
ATOM   3471  N  N   . SER A 1 597 ? 105.531 159.643 220.603 1.00 243.25 0  597 SER A N   1 
ATOM   3472  C  CA  . SER A 1 597 ? 104.231 159.603 219.938 1.00 243.25 0  597 SER A CA  1 
ATOM   3473  C  C   . SER A 1 597 ? 104.032 160.816 219.035 1.00 243.25 0  597 SER A C   1 
ATOM   3474  O  O   . SER A 1 597 ? 103.464 160.695 217.943 1.00 243.25 0  597 SER A O   1 
ATOM   3475  C  CB  . SER A 1 597 ? 103.113 159.515 220.975 1.00 243.25 0  597 SER A CB  1 
ATOM   3476  N  N   . HIS A 1 598 ? 104.518 161.986 219.462 1.00 242.82 0  598 HIS A N   1 
ATOM   3477  C  CA  . HIS A 1 598 ? 104.429 163.180 218.628 1.00 242.82 0  598 HIS A CA  1 
ATOM   3478  C  C   . HIS A 1 598 ? 105.324 163.069 217.400 1.00 242.82 0  598 HIS A C   1 
ATOM   3479  O  O   . HIS A 1 598 ? 104.949 163.522 216.313 1.00 242.82 0  598 HIS A O   1 
ATOM   3480  C  CB  . HIS A 1 598 ? 104.791 164.419 219.446 1.00 242.82 0  598 HIS A CB  1 
ATOM   3481  N  N   . VAL A 1 599 ? 106.497 162.445 217.545 1.00 243.25 0  599 VAL A N   1 
ATOM   3482  C  CA  . VAL A 1 599 ? 107.384 162.247 216.401 1.00 243.25 0  599 VAL A CA  1 
ATOM   3483  C  C   . VAL A 1 599 ? 106.794 161.228 215.432 1.00 243.25 0  599 VAL A C   1 
ATOM   3484  O  O   . VAL A 1 599 ? 106.903 161.380 214.209 1.00 243.25 0  599 VAL A O   1 
ATOM   3485  C  CB  . VAL A 1 599 ? 108.786 161.829 216.879 1.00 243.25 0  599 VAL A CB  1 
ATOM   3486  N  N   . VAL A 1 600 ? 106.146 160.185 215.961 1.00 244.90 0  600 VAL A N   1 
ATOM   3487  C  CA  . VAL A 1 600 ? 105.519 159.182 215.104 1.00 244.90 0  600 VAL A CA  1 
ATOM   3488  C  C   . VAL A 1 600 ? 104.293 159.753 214.402 1.00 244.90 0  600 VAL A C   1 
ATOM   3489  O  O   . VAL A 1 600 ? 103.969 159.348 213.279 1.00 244.90 0  600 VAL A O   1 
ATOM   3490  C  CB  . VAL A 1 600 ? 105.164 157.927 215.923 1.00 244.90 0  600 VAL A CB  1 
ATOM   3491  N  N   . LEU A 1 601 ? 103.595 160.695 215.039 1.00 246.69 0  601 LEU A N   1 
ATOM   3492  C  CA  . LEU A 1 601 ? 102.478 161.358 214.377 1.00 246.69 0  601 LEU A CA  1 
ATOM   3493  C  C   . LEU A 1 601 ? 102.949 162.404 213.374 1.00 246.69 0  601 LEU A C   1 
ATOM   3494  O  O   . LEU A 1 601 ? 102.257 162.660 212.382 1.00 246.69 0  601 LEU A O   1 
ATOM   3495  C  CB  . LEU A 1 601 ? 101.559 162.002 215.414 1.00 246.69 0  601 LEU A CB  1 
ATOM   3496  N  N   . GLU A 1 602 ? 104.112 163.016 213.609 1.00 249.81 0  602 GLU A N   1 
ATOM   3497  C  CA  . GLU A 1 602 ? 104.623 164.031 212.700 1.00 249.81 0  602 GLU A CA  1 
ATOM   3498  C  C   . GLU A 1 602 ? 105.328 163.430 211.493 1.00 249.81 0  602 GLU A C   1 
ATOM   3499  O  O   . GLU A 1 602 ? 105.415 164.096 210.456 1.00 249.81 0  602 GLU A O   1 
ATOM   3500  C  CB  . GLU A 1 602 ? 105.579 164.969 213.440 1.00 249.81 0  602 GLU A CB  1 
ATOM   3501  N  N   . PHE A 1 603 ? 105.849 162.201 211.614 1.00 252.77 0  603 PHE A N   1 
ATOM   3502  C  CA  . PHE A 1 603 ? 106.455 161.543 210.457 1.00 252.77 0  603 PHE A CA  1 
ATOM   3503  C  C   . PHE A 1 603 ? 105.410 161.209 209.402 1.00 252.77 0  603 PHE A C   1 
ATOM   3504  O  O   . PHE A 1 603 ? 105.659 161.459 208.208 1.00 252.77 0  603 PHE A O   1 
ATOM   3505  C  CB  . PHE A 1 603 ? 107.224 160.298 210.907 1.00 252.77 0  603 PHE A CB  1 
ATOM   3506  N  N   . PRO A 1 604 ? 104.242 160.660 209.751 1.00 255.50 0  604 PRO A N   1 
ATOM   3507  C  CA  . PRO A 1 604 ? 103.177 160.502 208.749 1.00 255.50 0  604 PRO A CA  1 
ATOM   3508  C  C   . PRO A 1 604 ? 102.570 161.821 208.302 1.00 255.50 0  604 PRO A C   1 
ATOM   3509  O  O   . PRO A 1 604 ? 102.000 161.879 207.205 1.00 255.50 0  604 PRO A O   1 
ATOM   3510  C  CB  . PRO A 1 604 ? 102.143 159.626 209.468 1.00 255.50 0  604 PRO A CB  1 
ATOM   3511  N  N   . LEU A 1 605 ? 102.671 162.877 209.111 1.00 255.62 0  605 LEU A N   1 
ATOM   3512  C  CA  . LEU A 1 605 ? 102.230 164.195 208.674 1.00 255.62 0  605 LEU A CA  1 
ATOM   3513  C  C   . LEU A 1 605 ? 103.252 164.868 207.767 1.00 255.62 0  605 LEU A C   1 
ATOM   3514  O  O   . LEU A 1 605 ? 102.879 165.714 206.947 1.00 255.62 0  605 LEU A O   1 
ATOM   3515  C  CB  . LEU A 1 605 ? 101.940 165.082 209.886 1.00 255.62 0  605 LEU A CB  1 
ATOM   3516  N  N   . GLN A 1 606 ? 104.532 164.520 207.897 1.00 257.02 0  606 GLN A N   1 
ATOM   3517  C  CA  . GLN A 1 606 ? 105.557 165.037 207.000 1.00 257.02 0  606 GLN A CA  1 
ATOM   3518  C  C   . GLN A 1 606 ? 105.765 164.160 205.774 1.00 257.02 0  606 GLN A C   1 
ATOM   3519  O  O   . GLN A 1 606 ? 106.470 164.575 204.848 1.00 257.02 0  606 GLN A O   1 
ATOM   3520  C  CB  . GLN A 1 606 ? 106.890 165.196 207.741 1.00 257.02 0  606 GLN A CB  1 
ATOM   3521  N  N   . GLN A 1 607 ? 105.181 162.958 205.753 1.00 259.87 0  607 GLN A N   1 
ATOM   3522  C  CA  . GLN A 1 607 ? 105.243 162.120 204.559 1.00 259.87 0  607 GLN A CA  1 
ATOM   3523  C  C   . GLN A 1 607 ? 104.423 162.706 203.416 1.00 259.87 0  607 GLN A C   1 
ATOM   3524  O  O   . GLN A 1 607 ? 104.745 162.480 202.244 1.00 259.87 0  607 GLN A O   1 
ATOM   3525  C  CB  . GLN A 1 607 ? 104.766 160.705 204.885 1.00 259.87 0  607 GLN A CB  1 
ATOM   3526  N  N   . MET A 1 608 ? 103.370 163.453 203.733 1.00 262.38 0  608 MET A N   1 
ATOM   3527  C  CA  . MET A 1 608 ? 102.564 164.159 202.747 1.00 262.38 0  608 MET A CA  1 
ATOM   3528  C  C   . MET A 1 608 ? 102.760 165.658 202.928 1.00 262.38 0  608 MET A C   1 
ATOM   3529  O  O   . MET A 1 608 ? 102.717 166.160 204.056 1.00 262.38 0  608 MET A O   1 
ATOM   3530  C  CB  . MET A 1 608 ? 101.084 163.795 202.881 1.00 262.38 0  608 MET A CB  1 
ATOM   3531  N  N   . ASP A 1 609 ? 102.982 166.365 201.819 1.00 264.77 0  609 ASP A N   1 
ATOM   3532  C  CA  . ASP A 1 609 ? 103.247 167.799 201.890 1.00 264.77 0  609 ASP A CA  1 
ATOM   3533  C  C   . ASP A 1 609 ? 101.977 168.580 202.209 1.00 264.77 0  609 ASP A C   1 
ATOM   3534  O  O   . ASP A 1 609 ? 101.890 169.257 203.240 1.00 264.77 0  609 ASP A O   1 
ATOM   3535  C  CB  . ASP A 1 609 ? 103.865 168.282 200.576 1.00 264.77 0  609 ASP A CB  1 
ATOM   3536  N  N   . SER A 1 610 ? 100.978 168.497 201.335 1.00 264.48 0  610 SER A N   1 
ATOM   3537  C  CA  . SER A 1 610 ? 99.717  169.189 201.565 1.00 264.48 0  610 SER A CA  1 
ATOM   3538  C  C   . SER A 1 610 ? 98.561  168.389 200.979 1.00 264.48 0  610 SER A C   1 
ATOM   3539  O  O   . SER A 1 610 ? 97.757  168.931 200.209 1.00 264.48 0  610 SER A O   1 
ATOM   3540  C  CB  . SER A 1 610 ? 99.755  170.594 200.960 1.00 264.48 0  610 SER A CB  1 
ATOM   3541  N  N   . PRO A 1 611 ? 98.442  167.103 201.313 1.00 264.52 0  611 PRO A N   1 
ATOM   3542  C  CA  . PRO A 1 611 ? 97.328  166.309 200.777 1.00 264.52 0  611 PRO A CA  1 
ATOM   3543  C  C   . PRO A 1 611 ? 96.019  166.600 201.492 1.00 264.52 0  611 PRO A C   1 
ATOM   3544  O  O   . PRO A 1 611 ? 94.958  166.618 200.856 1.00 264.52 0  611 PRO A O   1 
ATOM   3545  C  CB  . PRO A 1 611 ? 97.787  164.863 201.006 1.00 264.52 0  611 PRO A CB  1 
ATOM   3546  N  N   . LEU A 1 612 ? 96.110  166.834 202.810 1.00 264.04 0  612 LEU A N   1 
ATOM   3547  C  CA  . LEU A 1 612 ? 94.969  167.106 203.698 1.00 264.04 0  612 LEU A CA  1 
ATOM   3548  C  C   . LEU A 1 612 ? 93.916  165.999 203.633 1.00 264.04 0  612 LEU A C   1 
ATOM   3549  O  O   . LEU A 1 612 ? 92.712  166.261 203.635 1.00 264.04 0  612 LEU A O   1 
ATOM   3550  C  CB  . LEU A 1 612 ? 94.343  168.474 203.408 1.00 264.04 0  612 LEU A CB  1 
ATOM   3551  N  N   . ASP A 1 613 ? 94.374  164.751 203.576 1.00 261.87 0  613 ASP A N   1 
ATOM   3552  C  CA  . ASP A 1 613 ? 93.494  163.601 203.460 1.00 261.87 0  613 ASP A CA  1 
ATOM   3553  C  C   . ASP A 1 613 ? 93.865  162.563 204.509 1.00 261.87 0  613 ASP A C   1 
ATOM   3554  O  O   . ASP A 1 613 ? 94.962  162.580 205.072 1.00 261.87 0  613 ASP A O   1 
ATOM   3555  C  CB  . ASP A 1 613 ? 93.561  162.979 202.058 1.00 261.87 0  613 ASP A CB  1 
ATOM   3556  N  N   . SER A 1 614 ? 92.927  161.652 204.765 1.00 260.19 0  614 SER A N   1 
ATOM   3557  C  CA  . SER A 1 614 ? 93.128  160.605 205.756 1.00 260.19 0  614 SER A CA  1 
ATOM   3558  C  C   . SER A 1 614 ? 93.755  159.344 205.178 1.00 260.19 0  614 SER A C   1 
ATOM   3559  O  O   . SER A 1 614 ? 94.355  158.570 205.933 1.00 260.19 0  614 SER A O   1 
ATOM   3560  C  CB  . SER A 1 614 ? 91.794  160.245 206.418 1.00 260.19 0  614 SER A CB  1 
ATOM   3561  N  N   . SER A 1 615 ? 93.645  159.132 203.864 1.00 260.62 0  615 SER A N   1 
ATOM   3562  C  CA  . SER A 1 615 ? 94.144  157.901 203.256 1.00 260.62 0  615 SER A CA  1 
ATOM   3563  C  C   . SER A 1 615 ? 95.668  157.872 203.232 1.00 260.62 0  615 SER A C   1 
ATOM   3564  O  O   . SER A 1 615 ? 96.284  156.862 203.595 1.00 260.62 0  615 SER A O   1 
ATOM   3565  C  CB  . SER A 1 615 ? 93.578  157.750 201.843 1.00 260.62 0  615 SER A CB  1 
ATOM   3566  N  N   . ARG A 1 616 ? 96.292  158.977 202.814 1.00 260.37 0  616 ARG A N   1 
ATOM   3567  C  CA  . ARG A 1 616 ? 97.751  159.040 202.765 1.00 260.37 0  616 ARG A CA  1 
ATOM   3568  C  C   . ARG A 1 616 ? 98.352  159.044 204.166 1.00 260.37 0  616 ARG A C   1 
ATOM   3569  O  O   . ARG A 1 616 ? 99.398  158.427 204.398 1.00 260.37 0  616 ARG A O   1 
ATOM   3570  C  CB  . ARG A 1 616 ? 98.198  160.276 201.985 1.00 260.37 0  616 ARG A CB  1 
ATOM   3571  N  N   . TYR A 1 617 ? 97.688  159.713 205.114 1.00 260.01 0  617 TYR A N   1 
ATOM   3572  C  CA  . TYR A 1 617 ? 98.157  159.713 206.497 1.00 260.01 0  617 TYR A CA  1 
ATOM   3573  C  C   . TYR A 1 617 ? 98.031  158.331 207.126 1.00 260.01 0  617 TYR A C   1 
ATOM   3574  O  O   . TYR A 1 617 ? 98.920  157.901 207.870 1.00 260.01 0  617 TYR A O   1 
ATOM   3575  C  CB  . TYR A 1 617 ? 97.383  160.748 207.313 1.00 260.01 0  617 TYR A CB  1 
ATOM   3576  N  N   . CYS A 1 618 ? 96.950  157.608 206.815 1.00 259.51 0  618 CYS A N   1 
ATOM   3577  C  CA  . CYS A 1 618 ? 96.789  156.252 207.331 1.00 259.51 0  618 CYS A CA  1 
ATOM   3578  C  C   . CYS A 1 618 ? 97.794  155.294 206.699 1.00 259.51 0  618 CYS A C   1 
ATOM   3579  O  O   . CYS A 1 618 ? 98.326  154.411 207.381 1.00 259.51 0  618 CYS A O   1 
ATOM   3580  C  CB  . CYS A 1 618 ? 95.360  155.766 207.092 1.00 259.51 0  618 CYS A CB  1 
ATOM   3581  N  N   . ALA A 1 619 ? 98.084  155.470 205.406 1.00 257.66 0  619 ALA A N   1 
ATOM   3582  C  CA  . ALA A 1 619 ? 99.073  154.622 204.747 1.00 257.66 0  619 ALA A CA  1 
ATOM   3583  C  C   . ALA A 1 619 ? 100.488 154.926 205.224 1.00 257.66 0  619 ALA A C   1 
ATOM   3584  O  O   . ALA A 1 619 ? 101.345 154.035 205.222 1.00 257.66 0  619 ALA A O   1 
ATOM   3585  C  CB  . ALA A 1 619 ? 98.978  154.785 203.230 1.00 257.66 0  619 ALA A CB  1 
ATOM   3586  N  N   . LEU A 1 620 ? 100.753 156.169 205.633 1.00 255.68 0  620 LEU A N   1 
ATOM   3587  C  CA  . LEU A 1 620 ? 102.059 156.499 206.191 1.00 255.68 0  620 LEU A CA  1 
ATOM   3588  C  C   . LEU A 1 620 ? 102.185 156.070 207.648 1.00 255.68 0  620 LEU A C   1 
ATOM   3589  O  O   . LEU A 1 620 ? 103.294 155.772 208.106 1.00 255.68 0  620 LEU A O   1 
ATOM   3590  C  CB  . LEU A 1 620 ? 102.321 158.000 206.060 1.00 255.68 0  620 LEU A CB  1 
ATOM   3591  N  N   . LEU A 1 621 ? 101.075 156.032 208.387 1.00 253.63 0  621 LEU A N   1 
ATOM   3592  C  CA  . LEU A 1 621 ? 101.109 155.655 209.794 1.00 253.63 0  621 LEU A CA  1 
ATOM   3593  C  C   . LEU A 1 621 ? 100.994 154.155 210.024 1.00 253.63 0  621 LEU A C   1 
ATOM   3594  O  O   . LEU A 1 621 ? 101.374 153.681 211.100 1.00 253.63 0  621 LEU A O   1 
ATOM   3595  C  CB  . LEU A 1 621 ? 99.988  156.368 210.557 1.00 253.63 0  621 LEU A CB  1 
ATOM   3596  N  N   . LEU A 1 622 ? 100.472 153.396 209.051 1.00 251.16 0  622 LEU A N   1 
ATOM   3597  C  CA  . LEU A 1 622 ? 100.357 151.951 209.243 1.00 251.16 0  622 LEU A CA  1 
ATOM   3598  C  C   . LEU A 1 622 ? 101.708 151.257 209.148 1.00 251.16 0  622 LEU A C   1 
ATOM   3599  O  O   . LEU A 1 622 ? 102.034 150.456 210.043 1.00 251.16 0  622 LEU A O   1 
ATOM   3600  C  CB  . LEU A 1 622 ? 99.355  151.372 208.241 1.00 251.16 0  622 LEU A CB  1 
ATOM   3601  N  N   . PRO A 1 623 ? 102.532 151.502 208.124 1.00 248.29 0  623 PRO A N   1 
ATOM   3602  C  CA  . PRO A 1 623 ? 103.841 150.832 208.075 1.00 248.29 0  623 PRO A CA  1 
ATOM   3603  C  C   . PRO A 1 623 ? 104.828 151.371 209.095 1.00 248.29 0  623 PRO A C   1 
ATOM   3604  O  O   . PRO A 1 623 ? 105.721 150.629 209.524 1.00 248.29 0  623 PRO A O   1 
ATOM   3605  C  CB  . PRO A 1 623 ? 104.314 151.090 206.638 1.00 248.29 0  623 PRO A CB  1 
ATOM   3606  N  N   . LEU A 1 624 ? 104.684 152.635 209.504 1.00 245.67 0  624 LEU A N   1 
ATOM   3607  C  CA  . LEU A 1 624 ? 105.546 153.183 210.546 1.00 245.67 0  624 LEU A CA  1 
ATOM   3608  C  C   . LEU A 1 624 ? 105.246 152.549 211.899 1.00 245.67 0  624 LEU A C   1 
ATOM   3609  O  O   . LEU A 1 624 ? 106.167 152.251 212.667 1.00 245.67 0  624 LEU A O   1 
ATOM   3610  C  CB  . LEU A 1 624 ? 105.386 154.701 210.616 1.00 245.67 0  624 LEU A CB  1 
ATOM   3611  N  N   . LEU A 1 625 ? 103.967 152.330 212.207 1.00 245.66 0  625 LEU A N   1 
ATOM   3612  C  CA  . LEU A 1 625 ? 103.608 151.626 213.431 1.00 245.66 0  625 LEU A CA  1 
ATOM   3613  C  C   . LEU A 1 625 ? 103.853 150.127 213.332 1.00 245.66 0  625 LEU A C   1 
ATOM   3614  O  O   . LEU A 1 625 ? 104.018 149.471 214.366 1.00 245.66 0  625 LEU A O   1 
ATOM   3615  C  CB  . LEU A 1 625 ? 102.142 151.885 213.784 1.00 245.66 0  625 LEU A CB  1 
ATOM   3616  N  N   . LYS A 1 626 ? 103.879 149.572 212.118 1.00 242.81 0  626 LYS A N   1 
ATOM   3617  C  CA  . LYS A 1 626 ? 104.161 148.149 211.961 1.00 242.81 0  626 LYS A CA  1 
ATOM   3618  C  C   . LYS A 1 626 ? 105.650 147.852 212.100 1.00 242.81 0  626 LYS A C   1 
ATOM   3619  O  O   . LYS A 1 626 ? 106.028 146.819 212.663 1.00 242.81 0  626 LYS A O   1 
ATOM   3620  C  CB  . LYS A 1 626 ? 103.644 147.658 210.609 1.00 242.81 0  626 LYS A CB  1 
ATOM   3621  N  N   . ALA A 1 627 ? 106.508 148.742 211.595 1.00 240.54 0  627 ALA A N   1 
ATOM   3622  C  CA  . ALA A 1 627 ? 107.946 148.511 211.674 1.00 240.54 0  627 ALA A CA  1 
ATOM   3623  C  C   . ALA A 1 627 ? 108.511 148.905 213.034 1.00 240.54 0  627 ALA A C   1 
ATOM   3624  O  O   . ALA A 1 627 ? 109.367 148.199 213.580 1.00 240.54 0  627 ALA A O   1 
ATOM   3625  C  CB  . ALA A 1 627 ? 108.663 149.273 210.559 1.00 240.54 0  627 ALA A CB  1 
ATOM   3626  N  N   . TRP A 1 628 ? 108.047 150.022 213.595 1.00 233.98 0  628 TRP A N   1 
ATOM   3627  C  CA  . TRP A 1 628 ? 108.532 150.527 214.875 1.00 233.98 0  628 TRP A CA  1 
ATOM   3628  C  C   . TRP A 1 628 ? 107.651 150.088 216.040 1.00 233.98 0  628 TRP A C   1 
ATOM   3629  O  O   . TRP A 1 628 ? 107.518 150.820 217.027 1.00 233.98 0  628 TRP A O   1 
ATOM   3630  C  CB  . TRP A 1 628 ? 108.642 152.053 214.843 1.00 233.98 0  628 TRP A CB  1 
ATOM   3631  C  CG  . TRP A 1 628 ? 109.556 152.596 213.775 1.00 233.98 0  628 TRP A CG  1 
ATOM   3632  C  CD1 . TRP A 1 628 ? 109.289 152.702 212.438 1.00 233.98 0  628 TRP A CD1 1 
ATOM   3633  C  CD2 . TRP A 1 628 ? 110.876 153.120 213.961 1.00 233.98 0  628 TRP A CD2 1 
ATOM   3634  N  NE1 . TRP A 1 628 ? 110.364 153.251 211.782 1.00 233.98 0  628 TRP A NE1 1 
ATOM   3635  C  CE2 . TRP A 1 628 ? 111.351 153.517 212.694 1.00 233.98 0  628 TRP A CE2 1 
ATOM   3636  C  CE3 . TRP A 1 628 ? 111.705 153.289 215.075 1.00 233.98 0  628 TRP A CE3 1 
ATOM   3637  C  CZ2 . TRP A 1 628 ? 112.616 154.072 212.511 1.00 233.98 0  628 TRP A CZ2 1 
ATOM   3638  C  CZ3 . TRP A 1 628 ? 112.961 153.841 214.891 1.00 233.98 0  628 TRP A CZ3 1 
ATOM   3639  C  CH2 . TRP A 1 628 ? 113.404 154.225 213.619 1.00 233.98 0  628 TRP A CH2 1 
ATOM   3640  N  N   . SER A 1 629 ? 107.036 148.908 215.939 1.00 238.82 0  629 SER A N   1 
ATOM   3641  C  CA  . SER A 1 629 ? 106.148 148.390 216.973 1.00 238.82 0  629 SER A CA  1 
ATOM   3642  C  C   . SER A 1 629 ? 106.942 147.989 218.210 1.00 238.82 0  629 SER A C   1 
ATOM   3643  O  O   . SER A 1 629 ? 106.443 148.115 219.336 1.00 238.82 0  629 SER A O   1 
ATOM   3644  C  CB  . SER A 1 629 ? 105.349 147.197 216.446 1.00 238.82 0  629 SER A CB  1 
ATOM   3645  N  N   . PRO A 1 630 ? 108.179 147.508 218.044 1.00 239.05 0  630 PRO A N   1 
ATOM   3646  C  CA  . PRO A 1 630 ? 108.957 147.110 219.229 1.00 239.05 0  630 PRO A CA  1 
ATOM   3647  C  C   . PRO A 1 630 ? 109.444 148.293 220.045 1.00 239.05 0  630 PRO A C   1 
ATOM   3648  O  O   . PRO A 1 630 ? 109.450 148.224 221.280 1.00 239.05 0  630 PRO A O   1 
ATOM   3649  C  CB  . PRO A 1 630 ? 110.120 146.308 218.628 1.00 239.05 0  630 PRO A CB  1 
ATOM   3650  N  N   . VAL A 1 631 ? 109.836 149.388 219.388 1.00 241.08 0  631 VAL A N   1 
ATOM   3651  C  CA  . VAL A 1 631 ? 110.234 150.590 220.115 1.00 241.08 0  631 VAL A CA  1 
ATOM   3652  C  C   . VAL A 1 631 ? 109.031 151.233 220.793 1.00 241.08 0  631 VAL A C   1 
ATOM   3653  O  O   . VAL A 1 631 ? 109.152 151.784 221.895 1.00 241.08 0  631 VAL A O   1 
ATOM   3654  C  CB  . VAL A 1 631 ? 110.941 151.578 219.170 1.00 241.08 0  631 VAL A CB  1 
ATOM   3655  N  N   . PHE A 1 632 ? 107.854 151.161 220.163 1.00 241.63 0  632 PHE A N   1 
ATOM   3656  C  CA  . PHE A 1 632 ? 106.645 151.684 220.790 1.00 241.63 0  632 PHE A CA  1 
ATOM   3657  C  C   . PHE A 1 632 ? 106.194 150.812 221.955 1.00 241.63 0  632 PHE A C   1 
ATOM   3658  O  O   . PHE A 1 632 ? 105.607 151.321 222.916 1.00 241.63 0  632 PHE A O   1 
ATOM   3659  C  CB  . PHE A 1 632 ? 105.527 151.807 219.754 1.00 241.63 0  632 PHE A CB  1 
ATOM   3660  N  N   . ARG A 1 633 ? 106.456 149.504 221.891 1.00 242.73 0  633 ARG A N   1 
ATOM   3661  C  CA  . ARG A 1 633 ? 106.138 148.633 223.015 1.00 242.73 0  633 ARG A CA  1 
ATOM   3662  C  C   . ARG A 1 633 ? 107.133 148.797 224.157 1.00 242.73 0  633 ARG A C   1 
ATOM   3663  O  O   . ARG A 1 633 ? 106.755 148.665 225.327 1.00 242.73 0  633 ARG A O   1 
ATOM   3664  C  CB  . ARG A 1 633 ? 106.099 147.174 222.557 1.00 242.73 0  633 ARG A CB  1 
ATOM   3665  N  N   . ASN A 1 634 ? 108.399 149.080 223.840 1.00 243.74 0  634 ASN A N   1 
ATOM   3666  C  CA  . ASN A 1 634 ? 109.392 149.307 224.884 1.00 243.74 0  634 ASN A CA  1 
ATOM   3667  C  C   . ASN A 1 634 ? 109.219 150.672 225.537 1.00 243.74 0  634 ASN A C   1 
ATOM   3668  O  O   . ASN A 1 634 ? 109.497 150.825 226.732 1.00 243.74 0  634 ASN A O   1 
ATOM   3669  C  CB  . ASN A 1 634 ? 110.801 149.168 224.310 1.00 243.74 0  634 ASN A CB  1 
ATOM   3670  N  N   . TYR A 1 635 ? 108.767 151.672 224.776 1.00 245.13 0  635 TYR A N   1 
ATOM   3671  C  CA  . TYR A 1 635 ? 108.540 152.997 225.344 1.00 245.13 0  635 TYR A CA  1 
ATOM   3672  C  C   . TYR A 1 635 ? 107.268 153.030 226.184 1.00 245.13 0  635 TYR A C   1 
ATOM   3673  O  O   . TYR A 1 635 ? 107.300 153.413 227.358 1.00 245.13 0  635 TYR A O   1 
ATOM   3674  C  CB  . TYR A 1 635 ? 108.475 154.042 224.229 1.00 245.13 0  635 TYR A CB  1 
ATOM   3675  N  N   . ILE A 1 636 ? 106.142 152.633 225.599 1.00 249.16 0  636 ILE A N   1 
ATOM   3676  C  CA  . ILE A 1 636 ? 104.859 152.598 226.290 1.00 249.16 0  636 ILE A CA  1 
ATOM   3677  C  C   . ILE A 1 636 ? 104.642 151.164 226.759 1.00 249.16 0  636 ILE A C   1 
ATOM   3678  O  O   . ILE A 1 636 ? 104.321 150.277 225.964 1.00 249.16 0  636 ILE A O   1 
ATOM   3679  C  CB  . ILE A 1 636 ? 103.717 153.082 225.393 1.00 249.16 0  636 ILE A CB  1 
ATOM   3680  N  N   . LYS A 1 637 ? 104.818 150.932 228.059 1.00 253.47 0  637 LYS A N   1 
ATOM   3681  C  CA  . LYS A 1 637 ? 104.682 149.602 228.640 1.00 253.47 0  637 LYS A CA  1 
ATOM   3682  C  C   . LYS A 1 637 ? 103.579 149.527 229.683 1.00 253.47 0  637 LYS A C   1 
ATOM   3683  O  O   . LYS A 1 637 ? 102.764 148.597 229.650 1.00 253.47 0  637 LYS A O   1 
ATOM   3684  C  CB  . LYS A 1 637 ? 106.018 149.160 229.258 1.00 253.47 0  637 LYS A CB  1 
ATOM   3685  N  N   . ARG A 1 638 ? 103.528 150.479 230.612 1.00 257.60 0  638 ARG A N   1 
ATOM   3686  C  CA  . ARG A 1 638 ? 102.550 150.443 231.688 1.00 257.60 0  638 ARG A CA  1 
ATOM   3687  C  C   . ARG A 1 638 ? 101.204 150.984 231.207 1.00 257.60 0  638 ARG A C   1 
ATOM   3688  O  O   . ARG A 1 638 ? 101.053 151.446 230.073 1.00 257.60 0  638 ARG A O   1 
ATOM   3689  C  CB  . ARG A 1 638 ? 103.060 151.231 232.892 1.00 257.60 0  638 ARG A CB  1 
ATOM   3690  N  N   . ALA A 1 639 ? 100.205 150.918 232.092 1.00 260.07 0  639 ALA A N   1 
ATOM   3691  C  CA  . ALA A 1 639 ? 98.886  151.448 231.764 1.00 260.07 0  639 ALA A CA  1 
ATOM   3692  C  C   . ALA A 1 639 ? 98.873  152.971 231.770 1.00 260.07 0  639 ALA A C   1 
ATOM   3693  O  O   . ALA A 1 639 ? 98.134  153.586 230.990 1.00 260.07 0  639 ALA A O   1 
ATOM   3694  C  CB  . ALA A 1 639 ? 97.842  150.904 232.738 1.00 260.07 0  639 ALA A CB  1 
ATOM   3695  N  N   . ALA A 1 640 ? 99.676  153.594 232.638 1.00 261.51 0  640 ALA A N   1 
ATOM   3696  C  CA  . ALA A 1 640 ? 99.805  155.048 232.619 1.00 261.51 0  640 ALA A CA  1 
ATOM   3697  C  C   . ALA A 1 640 ? 100.520 155.521 231.360 1.00 261.51 0  640 ALA A C   1 
ATOM   3698  O  O   . ALA A 1 640 ? 100.183 156.574 230.806 1.00 261.51 0  640 ALA A O   1 
ATOM   3699  C  CB  . ALA A 1 640 ? 100.541 155.527 233.870 1.00 261.51 0  640 ALA A CB  1 
ATOM   3700  N  N   . ASP A 1 641 ? 101.498 154.743 230.883 1.00 262.40 0  641 ASP A N   1 
ATOM   3701  C  CA  . ASP A 1 641 ? 102.135 155.048 229.606 1.00 262.40 0  641 ASP A CA  1 
ATOM   3702  C  C   . ASP A 1 641 ? 101.169 154.871 228.442 1.00 262.40 0  641 ASP A C   1 
ATOM   3703  O  O   . ASP A 1 641 ? 101.222 155.639 227.475 1.00 262.40 0  641 ASP A O   1 
ATOM   3704  C  CB  . ASP A 1 641 ? 103.370 154.169 229.411 1.00 262.40 0  641 ASP A CB  1 
ATOM   3705  N  N   . HIS A 1 642 ? 100.263 153.892 228.531 1.00 263.25 0  642 HIS A N   1 
ATOM   3706  C  CA  . HIS A 1 642 ? 99.244  153.723 227.498 1.00 263.25 0  642 HIS A CA  1 
ATOM   3707  C  C   . HIS A 1 642 ? 98.241  154.871 227.515 1.00 263.25 0  642 HIS A C   1 
ATOM   3708  O  O   . HIS A 1 642 ? 97.790  155.323 226.456 1.00 263.25 0  642 HIS A O   1 
ATOM   3709  C  CB  . HIS A 1 642 ? 98.532  152.383 227.678 1.00 263.25 0  642 HIS A CB  1 
ATOM   3710  N  N   . LEU A 1 643 ? 97.900  155.370 228.707 1.00 264.37 0  643 LEU A N   1 
ATOM   3711  C  CA  . LEU A 1 643 ? 97.007  156.522 228.804 1.00 264.37 0  643 LEU A CA  1 
ATOM   3712  C  C   . LEU A 1 643 ? 97.677  157.791 228.288 1.00 264.37 0  643 LEU A C   1 
ATOM   3713  O  O   . LEU A 1 643 ? 97.028  158.622 227.640 1.00 264.37 0  643 LEU A O   1 
ATOM   3714  C  CB  . LEU A 1 643 ? 96.547  156.708 230.250 1.00 264.37 0  643 LEU A CB  1 
ATOM   3715  N  N   . GLU A 1 644 ? 98.979  157.948 228.549 1.00 263.41 0  644 GLU A N   1 
ATOM   3716  C  CA  . GLU A 1 644 ? 99.715  159.089 228.011 1.00 263.41 0  644 GLU A CA  1 
ATOM   3717  C  C   . GLU A 1 644 ? 99.849  159.000 226.494 1.00 263.41 0  644 GLU A C   1 
ATOM   3718  O  O   . GLU A 1 644 ? 99.783  160.021 225.801 1.00 263.41 0  644 GLU A O   1 
ATOM   3719  C  CB  . GLU A 1 644 ? 101.093 159.180 228.667 1.00 263.41 0  644 GLU A CB  1 
ATOM   3720  N  N   . ALA A 1 645 ? 100.008 157.784 225.961 1.00 262.75 0  645 ALA A N   1 
ATOM   3721  C  CA  . ALA A 1 645 ? 100.055 157.606 224.512 1.00 262.75 0  645 ALA A CA  1 
ATOM   3722  C  C   . ALA A 1 645 ? 98.699  157.881 223.874 1.00 262.75 0  645 ALA A C   1 
ATOM   3723  O  O   . ALA A 1 645 ? 98.628  158.447 222.778 1.00 262.75 0  645 ALA A O   1 
ATOM   3724  C  CB  . ALA A 1 645 ? 100.533 156.194 224.173 1.00 262.75 0  645 ALA A CB  1 
ATOM   3725  N  N   . LEU A 1 646 ? 97.611  157.506 224.556 1.00 261.39 0  646 LEU A N   1 
ATOM   3726  C  CA  . LEU A 1 646 ? 96.273  157.816 224.059 1.00 261.39 0  646 LEU A CA  1 
ATOM   3727  C  C   . LEU A 1 646 ? 95.999  159.316 224.094 1.00 261.39 0  646 LEU A C   1 
ATOM   3728  O  O   . LEU A 1 646 ? 95.376  159.860 223.174 1.00 261.39 0  646 LEU A O   1 
ATOM   3729  C  CB  . LEU A 1 646 ? 95.224  157.059 224.872 1.00 261.39 0  646 LEU A CB  1 
ATOM   3730  N  N   . ALA A 1 647 ? 96.473  160.003 225.140 1.00 260.70 0  647 ALA A N   1 
ATOM   3731  C  CA  . ALA A 1 647 ? 96.324  161.454 225.211 1.00 260.70 0  647 ALA A CA  1 
ATOM   3732  C  C   . ALA A 1 647 ? 97.158  162.156 224.144 1.00 260.70 0  647 ALA A C   1 
ATOM   3733  O  O   . ALA A 1 647 ? 96.716  163.154 223.560 1.00 260.70 0  647 ALA A O   1 
ATOM   3734  C  CB  . ALA A 1 647 ? 96.705  161.953 226.604 1.00 260.70 0  647 ALA A CB  1 
ATOM   3735  N  N   . ALA A 1 648 ? 98.356  161.636 223.859 1.00 259.38 0  648 ALA A N   1 
ATOM   3736  C  CA  . ALA A 1 648 ? 99.180  162.203 222.796 1.00 259.38 0  648 ALA A CA  1 
ATOM   3737  C  C   . ALA A 1 648 ? 98.570  161.950 221.422 1.00 259.38 0  648 ALA A C   1 
ATOM   3738  O  O   . ALA A 1 648 ? 98.652  162.808 220.536 1.00 259.38 0  648 ALA A O   1 
ATOM   3739  C  CB  . ALA A 1 648 ? 100.596 161.634 222.869 1.00 259.38 0  648 ALA A CB  1 
ATOM   3740  N  N   . ILE A 1 649 ? 97.933  160.790 221.235 1.00 259.48 0  649 ILE A N   1 
ATOM   3741  C  CA  . ILE A 1 649 ? 97.257  160.503 219.973 1.00 259.48 0  649 ILE A CA  1 
ATOM   3742  C  C   . ILE A 1 649 ? 96.026  161.387 219.809 1.00 259.48 0  649 ILE A C   1 
ATOM   3743  O  O   . ILE A 1 649 ? 95.708  161.829 218.699 1.00 259.48 0  649 ILE A O   1 
ATOM   3744  C  CB  . ILE A 1 649 ? 96.898  159.009 219.888 1.00 259.48 0  649 ILE A CB  1 
ATOM   3745  N  N   . GLU A 1 650 ? 95.329  161.679 220.913 1.00 260.54 0  650 GLU A N   1 
ATOM   3746  C  CA  . GLU A 1 650 ? 94.187  162.587 220.854 1.00 260.54 0  650 GLU A CA  1 
ATOM   3747  C  C   . GLU A 1 650 ? 94.626  164.017 220.558 1.00 260.54 0  650 GLU A C   1 
ATOM   3748  O  O   . GLU A 1 650 ? 93.963  164.729 219.793 1.00 260.54 0  650 GLU A O   1 
ATOM   3749  C  CB  . GLU A 1 650 ? 93.401  162.527 222.164 1.00 260.54 0  650 GLU A CB  1 
ATOM   3750  N  N   . ASP A 1 651 ? 95.753  164.448 221.135 1.00 259.69 0  651 ASP A N   1 
ATOM   3751  C  CA  . ASP A 1 651 ? 96.281  165.776 220.834 1.00 259.69 0  651 ASP A CA  1 
ATOM   3752  C  C   . ASP A 1 651 ? 96.788  165.872 219.399 1.00 259.69 0  651 ASP A C   1 
ATOM   3753  O  O   . ASP A 1 651 ? 96.647  166.924 218.763 1.00 259.69 0  651 ASP A O   1 
ATOM   3754  C  CB  . ASP A 1 651 ? 97.397  166.132 221.816 1.00 259.69 0  651 ASP A CB  1 
ATOM   3755  N  N   . PHE A 1 652 ? 97.361  164.787 218.871 1.00 260.26 0  652 PHE A N   1 
ATOM   3756  C  CA  . PHE A 1 652 ? 97.787  164.778 217.476 1.00 260.26 0  652 PHE A CA  1 
ATOM   3757  C  C   . PHE A 1 652 ? 96.598  164.761 216.524 1.00 260.26 0  652 PHE A C   1 
ATOM   3758  O  O   . PHE A 1 652 ? 96.665  165.359 215.446 1.00 260.26 0  652 PHE A O   1 
ATOM   3759  C  CB  . PHE A 1 652 ? 98.694  163.577 217.213 1.00 260.26 0  652 PHE A CB  1 
ATOM   3760  N  N   . PHE A 1 653 ? 95.508  164.085 216.901 1.00 260.28 0  653 PHE A N   1 
ATOM   3761  C  CA  . PHE A 1 653 ? 94.298  164.121 216.087 1.00 260.28 0  653 PHE A CA  1 
ATOM   3762  C  C   . PHE A 1 653 ? 93.620  165.483 216.155 1.00 260.28 0  653 PHE A C   1 
ATOM   3763  O  O   . PHE A 1 653 ? 92.978  165.903 215.186 1.00 260.28 0  653 PHE A O   1 
ATOM   3764  C  CB  . PHE A 1 653 ? 93.332  163.024 216.533 1.00 260.28 0  653 PHE A CB  1 
ATOM   3765  N  N   . LEU A 1 654 ? 93.744  166.180 217.288 1.00 260.13 0  654 LEU A N   1 
ATOM   3766  C  CA  . LEU A 1 654 ? 93.237  167.545 217.375 1.00 260.13 0  654 LEU A CA  1 
ATOM   3767  C  C   . LEU A 1 654 ? 94.096  168.514 216.573 1.00 260.13 0  654 LEU A C   1 
ATOM   3768  O  O   . LEU A 1 654 ? 93.577  169.497 216.032 1.00 260.13 0  654 LEU A O   1 
ATOM   3769  C  CB  . LEU A 1 654 ? 93.160  167.986 218.836 1.00 260.13 0  654 LEU A CB  1 
ATOM   3770  N  N   . GLU A 1 655 ? 95.403  168.259 216.485 1.00 259.92 0  655 GLU A N   1 
ATOM   3771  C  CA  . GLU A 1 655 ? 96.285  169.113 215.698 1.00 259.92 0  655 GLU A CA  1 
ATOM   3772  C  C   . GLU A 1 655 ? 96.285  168.756 214.216 1.00 259.92 0  655 GLU A C   1 
ATOM   3773  O  O   . GLU A 1 655 ? 96.718  169.573 213.396 1.00 259.92 0  655 GLU A O   1 
ATOM   3774  C  CB  . GLU A 1 655 ? 97.713  169.041 216.243 1.00 259.92 0  655 GLU A CB  1 
ATOM   3775  N  N   . HIS A 1 656 ? 95.815  167.564 213.857 1.00 261.27 0  656 HIS A N   1 
ATOM   3776  C  CA  . HIS A 1 656 ? 95.758  167.093 212.475 1.00 261.27 0  656 HIS A CA  1 
ATOM   3777  C  C   . HIS A 1 656 ? 94.348  166.625 212.140 1.00 261.27 0  656 HIS A C   1 
ATOM   3778  O  O   . HIS A 1 656 ? 94.130  165.514 211.651 1.00 261.27 0  656 HIS A O   1 
ATOM   3779  C  CB  . HIS A 1 656 ? 96.772  165.981 212.223 1.00 261.27 0  656 HIS A CB  1 
ATOM   3780  N  N   . GLU A 1 657 ? 93.362  167.483 212.424 1.00 261.88 0  657 GLU A N   1 
ATOM   3781  C  CA  . GLU A 1 657 ? 91.955  167.139 212.235 1.00 261.88 0  657 GLU A CA  1 
ATOM   3782  C  C   . GLU A 1 657 ? 91.562  166.996 210.768 1.00 261.88 0  657 GLU A C   1 
ATOM   3783  O  O   . GLU A 1 657 ? 90.519  166.397 210.483 1.00 261.88 0  657 GLU A O   1 
ATOM   3784  C  CB  . GLU A 1 657 ? 91.066  168.188 212.905 1.00 261.88 0  657 GLU A CB  1 
ATOM   3785  N  N   . ALA A 1 658 ? 92.364  167.529 209.839 1.00 262.86 0  658 ALA A N   1 
ATOM   3786  C  CA  . ALA A 1 658 ? 92.091  167.345 208.416 1.00 262.86 0  658 ALA A CA  1 
ATOM   3787  C  C   . ALA A 1 658 ? 92.240  165.888 207.997 1.00 262.86 0  658 ALA A C   1 
ATOM   3788  O  O   . ALA A 1 658 ? 91.569  165.441 207.060 1.00 262.86 0  658 ALA A O   1 
ATOM   3789  C  CB  . ALA A 1 658 ? 93.014  168.235 207.583 1.00 262.86 0  658 ALA A CB  1 
ATOM   3790  N  N   . LEU A 1 659 ? 93.109  165.137 208.674 1.00 260.76 0  659 LEU A N   1 
ATOM   3791  C  CA  . LEU A 1 659 ? 93.174  163.687 208.544 1.00 260.76 0  659 LEU A CA  1 
ATOM   3792  C  C   . LEU A 1 659 ? 92.471  162.985 209.702 1.00 260.76 0  659 LEU A C   1 
ATOM   3793  O  O   . LEU A 1 659 ? 92.820  161.848 210.044 1.00 260.76 0  659 LEU A O   1 
ATOM   3794  C  CB  . LEU A 1 659 ? 94.627  163.226 208.442 1.00 260.76 0  659 LEU A CB  1 
ATOM   3795  N  N   . GLY A 1 660 ? 91.475  163.646 210.302 1.00 259.67 0  660 GLY A N   1 
ATOM   3796  C  CA  . GLY A 1 660 ? 90.791  163.124 211.475 1.00 259.67 0  660 GLY A CA  1 
ATOM   3797  C  C   . GLY A 1 660 ? 89.986  161.866 211.227 1.00 259.67 0  660 GLY A C   1 
ATOM   3798  O  O   . GLY A 1 660 ? 89.712  161.124 212.178 1.00 259.67 0  660 GLY A O   1 
ATOM   3799  N  N   . ILE A 1 661 ? 89.616  161.600 209.970 1.00 258.35 0  661 ILE A N   1 
ATOM   3800  C  CA  . ILE A 1 661 ? 88.978  160.336 209.624 1.00 258.35 0  661 ILE A CA  1 
ATOM   3801  C  C   . ILE A 1 661 ? 89.934  159.162 209.794 1.00 258.35 0  661 ILE A C   1 
ATOM   3802  O  O   . ILE A 1 661 ? 89.487  158.028 210.001 1.00 258.35 0  661 ILE A O   1 
ATOM   3803  C  CB  . ILE A 1 661 ? 88.432  160.383 208.185 1.00 258.35 0  661 ILE A CB  1 
ATOM   3804  N  N   . SER A 1 662 ? 91.244  159.404 209.713 1.00 258.23 0  662 SER A N   1 
ATOM   3805  C  CA  . SER A 1 662 ? 92.225  158.383 210.052 1.00 258.23 0  662 SER A CA  1 
ATOM   3806  C  C   . SER A 1 662 ? 92.493  158.300 211.548 1.00 258.23 0  662 SER A C   1 
ATOM   3807  O  O   . SER A 1 662 ? 93.234  157.406 211.974 1.00 258.23 0  662 SER A O   1 
ATOM   3808  C  CB  . SER A 1 662 ? 93.538  158.643 209.310 1.00 258.23 0  662 SER A CB  1 
ATOM   3809  N  N   . MET A 1 663 ? 91.910  159.205 212.347 1.00 256.16 0  663 MET A N   1 
ATOM   3810  C  CA  . MET A 1 663 ? 92.135  159.200 213.790 1.00 256.16 0  663 MET A CA  1 
ATOM   3811  C  C   . MET A 1 663 ? 91.536  157.966 214.452 1.00 256.16 0  663 MET A C   1 
ATOM   3812  O  O   . MET A 1 663 ? 92.067  157.485 215.460 1.00 256.16 0  663 MET A O   1 
ATOM   3813  C  CB  . MET A 1 663 ? 91.557  160.469 214.416 1.00 256.16 0  663 MET A CB  1 
ATOM   3814  N  N   . ALA A 1 664 ? 90.439  157.442 213.906 1.00 254.98 0  664 ALA A N   1 
ATOM   3815  C  CA  . ALA A 1 664 ? 89.947  156.142 214.340 1.00 254.98 0  664 ALA A CA  1 
ATOM   3816  C  C   . ALA A 1 664 ? 90.773  155.008 213.751 1.00 254.98 0  664 ALA A C   1 
ATOM   3817  O  O   . ALA A 1 664 ? 90.876  153.939 214.365 1.00 254.98 0  664 ALA A O   1 
ATOM   3818  C  CB  . ALA A 1 664 ? 88.475  155.978 213.959 1.00 254.98 0  664 ALA A CB  1 
ATOM   3819  N  N   . LYS A 1 665 ? 91.376  155.230 212.576 1.00 255.96 0  665 LYS A N   1 
ATOM   3820  C  CA  . LYS A 1 665 ? 92.182  154.196 211.933 1.00 255.96 0  665 LYS A CA  1 
ATOM   3821  C  C   . LYS A 1 665 ? 93.465  153.922 212.705 1.00 255.96 0  665 LYS A C   1 
ATOM   3822  O  O   . LYS A 1 665 ? 93.986  152.802 212.661 1.00 255.96 0  665 LYS A O   1 
ATOM   3823  C  CB  . LYS A 1 665 ? 92.504  154.599 210.494 1.00 255.96 0  665 LYS A CB  1 
ATOM   3824  N  N   . VAL A 1 666 ? 93.988  154.925 213.413 1.00 255.03 0  666 VAL A N   1 
ATOM   3825  C  CA  . VAL A 1 666 ? 95.083  154.672 214.339 1.00 255.03 0  666 VAL A CA  1 
ATOM   3826  C  C   . VAL A 1 666 ? 94.572  153.945 215.575 1.00 255.03 0  666 VAL A C   1 
ATOM   3827  O  O   . VAL A 1 666 ? 95.300  153.148 216.180 1.00 255.03 0  666 VAL A O   1 
ATOM   3828  C  CB  . VAL A 1 666 ? 95.790  155.988 214.710 1.00 255.03 0  666 VAL A CB  1 
ATOM   3829  N  N   . LEU A 1 667 ? 93.314  154.194 215.960 1.00 255.55 0  667 LEU A N   1 
ATOM   3830  C  CA  . LEU A 1 667 ? 92.742  153.536 217.132 1.00 255.55 0  667 LEU A CA  1 
ATOM   3831  C  C   . LEU A 1 667 ? 92.519  152.050 216.888 1.00 255.55 0  667 LEU A C   1 
ATOM   3832  O  O   . LEU A 1 667 ? 92.570  151.253 217.831 1.00 255.55 0  667 LEU A O   1 
ATOM   3833  C  CB  . LEU A 1 667 ? 91.430  154.212 217.527 1.00 255.55 0  667 LEU A CB  1 
ATOM   3834  N  N   . MET A 1 668 ? 92.272  151.661 215.638 1.00 255.78 0  668 MET A N   1 
ATOM   3835  C  CA  . MET A 1 668 ? 92.260  150.252 215.273 1.00 255.78 0  668 MET A CA  1 
ATOM   3836  C  C   . MET A 1 668 ? 93.658  149.702 215.027 1.00 255.78 0  668 MET A C   1 
ATOM   3837  O  O   . MET A 1 668 ? 93.813  148.483 214.899 1.00 255.78 0  668 MET A O   1 
ATOM   3838  C  CB  . MET A 1 668 ? 91.396  150.036 214.028 1.00 255.78 0  668 MET A CB  1 
ATOM   3839  N  N   . ALA A 1 669 ? 94.674  150.566 214.957 1.00 255.83 0  669 ALA A N   1 
ATOM   3840  C  CA  . ALA A 1 669 ? 96.040  150.119 214.720 1.00 255.83 0  669 ALA A CA  1 
ATOM   3841  C  C   . ALA A 1 669 ? 96.795  149.857 216.017 1.00 255.83 0  669 ALA A C   1 
ATOM   3842  O  O   . ALA A 1 669 ? 97.517  148.858 216.120 1.00 255.83 0  669 ALA A O   1 
ATOM   3843  C  CB  . ALA A 1 669 ? 96.794  151.151 213.878 1.00 255.83 0  669 ALA A CB  1 
ATOM   3844  N  N   . PHE A 1 670 ? 96.625  150.733 217.014 1.00 256.39 0  670 PHE A N   1 
ATOM   3845  C  CA  . PHE A 1 670 ? 97.315  150.567 218.291 1.00 256.39 0  670 PHE A CA  1 
ATOM   3846  C  C   . PHE A 1 670 ? 96.794  149.361 219.062 1.00 256.39 0  670 PHE A C   1 
ATOM   3847  O  O   . PHE A 1 670 ? 97.536  148.761 219.847 1.00 256.39 0  670 PHE A O   1 
ATOM   3848  C  CB  . PHE A 1 670 ? 97.175  151.836 219.131 1.00 256.39 0  670 PHE A CB  1 
ATOM   3849  N  N   . TYR A 1 671 ? 95.531  148.993 218.853 1.00 256.43 0  671 TYR A N   1 
ATOM   3850  C  CA  . TYR A 1 671 ? 95.007  147.749 219.395 1.00 256.43 0  671 TYR A CA  1 
ATOM   3851  C  C   . TYR A 1 671 ? 95.410  146.537 218.567 1.00 256.43 0  671 TYR A C   1 
ATOM   3852  O  O   . TYR A 1 671 ? 95.264  145.406 219.044 1.00 256.43 0  671 TYR A O   1 
ATOM   3853  C  CB  . TYR A 1 671 ? 93.481  147.818 219.497 1.00 256.43 0  671 TYR A CB  1 
ATOM   3854  N  N   . GLN A 1 672 ? 95.910  146.742 217.347 1.00 255.24 0  672 GLN A N   1 
ATOM   3855  C  CA  . GLN A 1 672 ? 96.334  145.632 216.503 1.00 255.24 0  672 GLN A CA  1 
ATOM   3856  C  C   . GLN A 1 672 ? 97.810  145.302 216.686 1.00 255.24 0  672 GLN A C   1 
ATOM   3857  O  O   . GLN A 1 672 ? 98.191  144.127 216.643 1.00 255.24 0  672 GLN A O   1 
ATOM   3858  C  CB  . GLN A 1 672 ? 96.050  145.949 215.032 1.00 255.24 0  672 GLN A CB  1 
ATOM   3859  N  N   . LEU A 1 673 ? 98.649  146.317 216.889 1.00 256.11 0  673 LEU A N   1 
ATOM   3860  C  CA  . LEU A 1 673 ? 100.076 146.126 217.106 1.00 256.11 0  673 LEU A CA  1 
ATOM   3861  C  C   . LEU A 1 673 ? 100.439 146.040 218.585 1.00 256.11 0  673 LEU A C   1 
ATOM   3862  O  O   . LEU A 1 673 ? 101.622 146.180 218.924 1.00 256.11 0  673 LEU A O   1 
ATOM   3863  C  CB  . LEU A 1 673 ? 100.866 147.253 216.436 1.00 256.11 0  673 LEU A CB  1 
ATOM   3864  N  N   . GLU A 1 674 ? 99.441  145.828 219.457 1.00 256.34 0  674 GLU A N   1 
ATOM   3865  C  CA  . GLU A 1 674 ? 99.601  145.684 220.912 1.00 256.34 0  674 GLU A CA  1 
ATOM   3866  C  C   . GLU A 1 674 ? 100.258 146.906 221.553 1.00 256.34 0  674 GLU A C   1 
ATOM   3867  O  O   . GLU A 1 674 ? 101.000 146.783 222.530 1.00 256.34 0  674 GLU A O   1 
ATOM   3868  C  CB  . GLU A 1 674 ? 100.369 144.407 221.276 1.00 256.34 0  674 GLU A CB  1 
ATOM   3869  N  N   . ILE A 1 675 ? 99.990  148.094 221.013 1.00 255.94 0  675 ILE A N   1 
ATOM   3870  C  CA  . ILE A 1 675 ? 100.512 149.331 221.584 1.00 255.94 0  675 ILE A CA  1 
ATOM   3871  C  C   . ILE A 1 675 ? 99.583  149.813 222.690 1.00 255.94 0  675 ILE A C   1 
ATOM   3872  O  O   . ILE A 1 675 ? 99.998  149.954 223.846 1.00 255.94 0  675 ILE A O   1 
ATOM   3873  C  CB  . ILE A 1 675 ? 100.690 150.413 220.504 1.00 255.94 0  675 ILE A CB  1 
ATOM   3874  N  N   . LEU A 1 676 ? 98.325  150.066 222.346 1.00 254.56 0  676 LEU A N   1 
ATOM   3875  C  CA  . LEU A 1 676 ? 97.302  150.446 223.310 1.00 254.56 0  676 LEU A CA  1 
ATOM   3876  C  C   . LEU A 1 676 ? 96.337  149.287 223.508 1.00 254.56 0  676 LEU A C   1 
ATOM   3877  O  O   . LEU A 1 676 ? 95.831  148.721 222.532 1.00 254.56 0  676 LEU A O   1 
ATOM   3878  C  CB  . LEU A 1 676 ? 96.546  151.693 222.846 1.00 254.56 0  676 LEU A CB  1 
ATOM   3879  N  N   . ALA A 1 677 ? 96.087  148.935 224.766 1.00 254.78 0  677 ALA A N   1 
ATOM   3880  C  CA  . ALA A 1 677 ? 95.213  147.819 225.086 1.00 254.78 0  677 ALA A CA  1 
ATOM   3881  C  C   . ALA A 1 677 ? 93.749  148.203 224.877 1.00 254.78 0  677 ALA A C   1 
ATOM   3882  O  O   . ALA A 1 677 ? 93.403  149.369 224.666 1.00 254.78 0  677 ALA A O   1 
ATOM   3883  C  CB  . ALA A 1 677 ? 95.442  147.355 226.524 1.00 254.78 0  677 ALA A CB  1 
ATOM   3884  N  N   . GLY A 1 678 ? 92.879  147.192 224.932 1.00 253.61 0  678 GLY A N   1 
ATOM   3885  C  CA  . GLY A 1 678 ? 91.456  147.444 224.776 1.00 253.61 0  678 GLY A CA  1 
ATOM   3886  C  C   . GLY A 1 678 ? 90.849  148.143 225.978 1.00 253.61 0  678 GLY A C   1 
ATOM   3887  O  O   . GLY A 1 678 ? 89.958  148.986 225.832 1.00 253.61 0  678 GLY A O   1 
ATOM   3888  N  N   . GLU A 1 679 ? 91.329  147.811 227.180 1.00 253.31 0  679 GLU A N   1 
ATOM   3889  C  CA  . GLU A 1 679 ? 90.862  148.493 228.384 1.00 253.31 0  679 GLU A CA  1 
ATOM   3890  C  C   . GLU A 1 679 ? 91.351  149.935 228.426 1.00 253.31 0  679 GLU A C   1 
ATOM   3891  O  O   . GLU A 1 679 ? 90.618  150.831 228.861 1.00 253.31 0  679 GLU A O   1 
ATOM   3892  C  CB  . GLU A 1 679 ? 91.320  147.734 229.628 1.00 253.31 0  679 GLU A CB  1 
ATOM   3893  N  N   . THR A 1 680 ? 92.578  150.182 227.956 1.00 254.39 0  680 THR A N   1 
ATOM   3894  C  CA  . THR A 1 680 ? 93.086  151.549 227.885 1.00 254.39 0  680 THR A CA  1 
ATOM   3895  C  C   . THR A 1 680 ? 92.345  152.359 226.828 1.00 254.39 0  680 THR A C   1 
ATOM   3896  O  O   . THR A 1 680 ? 92.093  153.555 227.020 1.00 254.39 0  680 THR A O   1 
ATOM   3897  C  CB  . THR A 1 680 ? 94.587  151.539 227.597 1.00 254.39 0  680 THR A CB  1 
ATOM   3898  N  N   . ILE A 1 681 ? 91.960  151.717 225.721 1.00 254.22 0  681 ILE A N   1 
ATOM   3899  C  CA  . ILE A 1 681 ? 91.183  152.401 224.691 1.00 254.22 0  681 ILE A CA  1 
ATOM   3900  C  C   . ILE A 1 681 ? 89.777  152.706 225.194 1.00 254.22 0  681 ILE A C   1 
ATOM   3901  O  O   . ILE A 1 681 ? 89.215  153.768 224.897 1.00 254.22 0  681 ILE A O   1 
ATOM   3902  C  CB  . ILE A 1 681 ? 91.154  151.565 223.400 1.00 254.22 0  681 ILE A CB  1 
ATOM   3903  N  N   . LEU A 1 682 ? 89.198  151.796 225.985 1.00 253.05 0  682 LEU A N   1 
ATOM   3904  C  CA  . LEU A 1 682 ? 87.881  152.046 226.565 1.00 253.05 0  682 LEU A CA  1 
ATOM   3905  C  C   . LEU A 1 682 ? 87.937  153.145 227.620 1.00 253.05 0  682 LEU A C   1 
ATOM   3906  O  O   . LEU A 1 682 ? 87.001  153.945 227.740 1.00 253.05 0  682 LEU A O   1 
ATOM   3907  C  CB  . LEU A 1 682 ? 87.319  150.756 227.162 1.00 253.05 0  682 LEU A CB  1 
ATOM   3908  N  N   . SER A 1 683 ? 89.030  153.208 228.386 1.00 250.51 0  683 SER A N   1 
ATOM   3909  C  CA  . SER A 1 683 ? 89.191  154.277 229.366 1.00 250.51 0  683 SER A CA  1 
ATOM   3910  C  C   . SER A 1 683 ? 89.451  155.622 228.699 1.00 250.51 0  683 SER A C   1 
ATOM   3911  O  O   . SER A 1 683 ? 89.039  156.662 229.227 1.00 250.51 0  683 SER A O   1 
ATOM   3912  C  CB  . SER A 1 683 ? 90.325  153.936 230.333 1.00 250.51 0  683 SER A CB  1 
ATOM   3913  N  N   . TRP A 1 684 ? 90.131  155.626 227.550 1.00 250.47 0  684 TRP A N   1 
ATOM   3914  C  CA  . TRP A 1 684 ? 90.335  156.872 226.817 1.00 250.47 0  684 TRP A CA  1 
ATOM   3915  C  C   . TRP A 1 684 ? 89.052  157.333 226.136 1.00 250.47 0  684 TRP A C   1 
ATOM   3916  O  O   . TRP A 1 684 ? 88.796  158.539 226.035 1.00 250.47 0  684 TRP A O   1 
ATOM   3917  C  CB  . TRP A 1 684 ? 91.456  156.700 225.792 1.00 250.47 0  684 TRP A CB  1 
ATOM   3918  N  N   . PHE A 1 685 ? 88.235  156.391 225.657 1.00 249.75 0  685 PHE A N   1 
ATOM   3919  C  CA  . PHE A 1 685 ? 86.961  156.760 225.048 1.00 249.75 0  685 PHE A CA  1 
ATOM   3920  C  C   . PHE A 1 685 ? 85.941  157.195 226.093 1.00 249.75 0  685 PHE A C   1 
ATOM   3921  O  O   . PHE A 1 685 ? 85.085  158.039 225.805 1.00 249.75 0  685 PHE A O   1 
ATOM   3922  C  CB  . PHE A 1 685 ? 86.414  155.593 224.226 1.00 249.75 0  685 PHE A CB  1 
ATOM   3923  N  N   . SER A 1 686 ? 86.013  156.637 227.303 1.00 248.37 0  686 SER A N   1 
ATOM   3924  C  CA  . SER A 1 686 ? 85.092  157.034 228.361 1.00 248.37 0  686 SER A CA  1 
ATOM   3925  C  C   . SER A 1 686 ? 85.466  158.377 228.974 1.00 248.37 0  686 SER A C   1 
ATOM   3926  O  O   . SER A 1 686 ? 84.588  159.094 229.465 1.00 248.37 0  686 SER A O   1 
ATOM   3927  C  CB  . SER A 1 686 ? 85.043  155.958 229.447 1.00 248.37 0  686 SER A CB  1 
ATOM   3928  N  N   . GLN A 1 687 ? 86.749  158.731 228.957 1.00 245.39 0  687 GLN A N   1 
ATOM   3929  C  CA  . GLN A 1 687 ? 87.194  160.000 229.516 1.00 245.39 0  687 GLN A CA  1 
ATOM   3930  C  C   . GLN A 1 687 ? 86.901  161.134 228.542 1.00 245.39 0  687 GLN A C   1 
ATOM   3931  O  O   . GLN A 1 687 ? 87.303  161.083 227.376 1.00 245.39 0  687 GLN A O   1 
ATOM   3932  C  CB  . GLN A 1 687 ? 88.688  159.948 229.835 1.00 245.39 0  687 GLN A CB  1 
ATOM   3933  N  N   . ARG A 1 688 ? 86.198  162.154 229.024 1.00 237.21 0  688 ARG A N   1 
ATOM   3934  C  CA  . ARG A 1 688 ? 85.852  163.304 228.198 1.00 237.21 0  688 ARG A CA  1 
ATOM   3935  C  C   . ARG A 1 688 ? 87.053  164.225 228.007 1.00 237.21 0  688 ARG A C   1 
ATOM   3936  O  O   . ARG A 1 688 ? 87.022  165.391 228.398 1.00 237.21 0  688 ARG A O   1 
ATOM   3937  C  CB  . ARG A 1 688 ? 84.688  164.079 228.819 1.00 237.21 0  688 ARG A CB  1 
ATOM   3938  N  N   . ASP A 1 692 ? 83.936  168.705 226.009 1.00 222.33 0  692 ASP A N   1 
ATOM   3939  C  CA  . ASP A 1 692 ? 85.162  169.335 225.533 1.00 222.33 0  692 ASP A CA  1 
ATOM   3940  C  C   . ASP A 1 692 ? 85.355  169.098 224.039 1.00 222.33 0  692 ASP A C   1 
ATOM   3941  O  O   . ASP A 1 692 ? 84.520  168.470 223.388 1.00 222.33 0  692 ASP A O   1 
ATOM   3942  C  CB  . ASP A 1 692 ? 86.371  168.810 226.310 1.00 222.33 0  692 ASP A CB  1 
ATOM   3943  N  N   . LYS A 1 693 ? 86.465  169.609 223.501 1.00 223.74 0  693 LYS A N   1 
ATOM   3944  C  CA  . LYS A 1 693 ? 86.752  169.421 222.083 1.00 223.74 0  693 LYS A CA  1 
ATOM   3945  C  C   . LYS A 1 693 ? 87.200  167.994 221.792 1.00 223.74 0  693 LYS A C   1 
ATOM   3946  O  O   . LYS A 1 693 ? 86.853  167.430 220.748 1.00 223.74 0  693 LYS A O   1 
ATOM   3947  C  CB  . LYS A 1 693 ? 87.814  170.421 221.626 1.00 223.74 0  693 LYS A CB  1 
ATOM   3948  N  N   . GLY A 1 694 ? 87.968  167.395 222.705 1.00 225.51 0  694 GLY A N   1 
ATOM   3949  C  CA  . GLY A 1 694 ? 88.405  166.022 222.507 1.00 225.51 0  694 GLY A CA  1 
ATOM   3950  C  C   . GLY A 1 694 ? 87.276  165.019 222.650 1.00 225.51 0  694 GLY A C   1 
ATOM   3951  O  O   . GLY A 1 694 ? 87.240  164.007 221.943 1.00 225.51 0  694 GLY A O   1 
ATOM   3952  N  N   . GLN A 1 695 ? 86.334  165.288 223.559 1.00 224.89 0  695 GLN A N   1 
ATOM   3953  C  CA  . GLN A 1 695 ? 85.169  164.420 223.696 1.00 224.89 0  695 GLN A CA  1 
ATOM   3954  C  C   . GLN A 1 695 ? 84.230  164.549 222.504 1.00 224.89 0  695 GLN A C   1 
ATOM   3955  O  O   . GLN A 1 695 ? 83.581  163.570 222.121 1.00 224.89 0  695 GLN A O   1 
ATOM   3956  C  CB  . GLN A 1 695 ? 84.426  164.737 224.993 1.00 224.89 0  695 GLN A CB  1 
ATOM   3957  N  N   . GLN A 1 696 ? 84.143  165.742 221.910 1.00 225.67 0  696 GLN A N   1 
ATOM   3958  C  CA  . GLN A 1 696 ? 83.341  165.909 220.703 1.00 225.67 0  696 GLN A CA  1 
ATOM   3959  C  C   . GLN A 1 696 ? 84.022  165.289 219.490 1.00 225.67 0  696 GLN A C   1 
ATOM   3960  O  O   . GLN A 1 696 ? 83.340  164.798 218.583 1.00 225.67 0  696 GLN A O   1 
ATOM   3961  C  CB  . GLN A 1 696 ? 83.061  167.391 220.457 1.00 225.67 0  696 GLN A CB  1 
ATOM   3962  N  N   . LEU A 1 697 ? 85.357  165.304 219.453 1.00 224.80 0  697 LEU A N   1 
ATOM   3963  C  CA  . LEU A 1 697 ? 86.073  164.664 218.355 1.00 224.80 0  697 LEU A CA  1 
ATOM   3964  C  C   . LEU A 1 697 ? 86.051  163.146 218.477 1.00 224.80 0  697 LEU A C   1 
ATOM   3965  O  O   . LEU A 1 697 ? 86.068  162.444 217.460 1.00 224.80 0  697 LEU A O   1 
ATOM   3966  C  CB  . LEU A 1 697 ? 87.514  165.172 218.300 1.00 224.80 0  697 LEU A CB  1 
ATOM   3967  N  N   . ARG A 1 698 ? 86.013  162.623 219.703 1.00 226.08 0  698 ARG A N   1 
ATOM   3968  C  CA  . ARG A 1 698 ? 85.937  161.183 219.913 1.00 226.08 0  698 ARG A CA  1 
ATOM   3969  C  C   . ARG A 1 698 ? 84.522  160.636 219.784 1.00 226.08 0  698 ARG A C   1 
ATOM   3970  O  O   . ARG A 1 698 ? 84.352  159.413 219.742 1.00 226.08 0  698 ARG A O   1 
ATOM   3971  C  CB  . ARG A 1 698 ? 86.502  160.822 221.289 1.00 226.08 0  698 ARG A CB  1 
ATOM   3972  N  N   . LYS A 1 699 ? 83.509  161.501 219.723 1.00 226.84 0  699 LYS A N   1 
ATOM   3973  C  CA  . LYS A 1 699 ? 82.123  161.079 219.579 1.00 226.84 0  699 LYS A CA  1 
ATOM   3974  C  C   . LYS A 1 699 ? 81.667  161.042 218.124 1.00 226.84 0  699 LYS A C   1 
ATOM   3975  O  O   . LYS A 1 699 ? 80.462  161.131 217.860 1.00 226.84 0  699 LYS A O   1 
ATOM   3976  C  CB  . LYS A 1 699 ? 81.206  161.994 220.392 1.00 226.84 0  699 LYS A CB  1 
ATOM   3977  N  N   . ASN A 1 700 ? 82.596  160.913 217.180 1.00 229.10 0  700 ASN A N   1 
ATOM   3978  C  CA  . ASN A 1 700 ? 82.248  160.857 215.770 1.00 229.10 0  700 ASN A CA  1 
ATOM   3979  C  C   . ASN A 1 700 ? 81.751  159.459 215.403 1.00 229.10 0  700 ASN A C   1 
ATOM   3980  O  O   . ASN A 1 700 ? 81.760  158.530 216.215 1.00 229.10 0  700 ASN A O   1 
ATOM   3981  C  CB  . ASN A 1 700 ? 83.446  161.260 214.913 1.00 229.10 0  700 ASN A CB  1 
ATOM   3982  N  N   . GLN A 1 701 ? 81.308  159.309 214.152 1.00 231.17 0  701 GLN A N   1 
ATOM   3983  C  CA  . GLN A 1 701 ? 80.805  158.017 213.698 1.00 231.17 0  701 GLN A CA  1 
ATOM   3984  C  C   . GLN A 1 701 ? 81.935  157.026 213.454 1.00 231.17 0  701 GLN A C   1 
ATOM   3985  O  O   . GLN A 1 701 ? 81.758  155.822 213.676 1.00 231.17 0  701 GLN A O   1 
ATOM   3986  C  CB  . GLN A 1 701 ? 79.971  158.194 212.429 1.00 231.17 0  701 GLN A CB  1 
ATOM   3987  N  N   . GLN A 1 702 ? 83.100  157.510 213.012 1.00 233.30 0  702 GLN A N   1 
ATOM   3988  C  CA  . GLN A 1 702 ? 84.224  156.619 212.742 1.00 233.30 0  702 GLN A CA  1 
ATOM   3989  C  C   . GLN A 1 702 ? 84.819  156.069 214.032 1.00 233.30 0  702 GLN A C   1 
ATOM   3990  O  O   . GLN A 1 702 ? 85.153  154.880 214.110 1.00 233.30 0  702 GLN A O   1 
ATOM   3991  C  CB  . GLN A 1 702 ? 85.290  157.353 211.928 1.00 233.30 0  702 GLN A CB  1 
ATOM   3992  N  N   . LEU A 1 703 ? 84.942  156.915 215.060 1.00 232.81 0  703 LEU A N   1 
ATOM   3993  C  CA  . LEU A 1 703 ? 85.465  156.457 216.345 1.00 232.81 0  703 LEU A CA  1 
ATOM   3994  C  C   . LEU A 1 703 ? 84.487  155.514 217.035 1.00 232.81 0  703 LEU A C   1 
ATOM   3995  O  O   . LEU A 1 703 ? 84.903  154.534 217.666 1.00 232.81 0  703 LEU A O   1 
ATOM   3996  C  CB  . LEU A 1 703 ? 85.780  157.655 217.240 1.00 232.81 0  703 LEU A CB  1 
ATOM   3997  N  N   . GLN A 1 704 ? 83.183  155.777 216.903 1.00 232.50 0  704 GLN A N   1 
ATOM   3998  C  CA  . GLN A 1 704 ? 82.180  154.880 217.469 1.00 232.50 0  704 GLN A CA  1 
ATOM   3999  C  C   . GLN A 1 704 ? 82.151  153.546 216.733 1.00 232.50 0  704 GLN A C   1 
ATOM   4000  O  O   . GLN A 1 704 ? 81.979  152.493 217.357 1.00 232.50 0  704 GLN A O   1 
ATOM   4001  C  CB  . GLN A 1 704 ? 80.803  155.543 217.435 1.00 232.50 0  704 GLN A CB  1 
ATOM   4002  N  N   . ARG A 1 705 ? 82.348  153.570 215.410 1.00 233.22 0  705 ARG A N   1 
ATOM   4003  C  CA  . ARG A 1 705 ? 82.408  152.328 214.643 1.00 233.22 0  705 ARG A CA  1 
ATOM   4004  C  C   . ARG A 1 705 ? 83.662  151.529 214.980 1.00 233.22 0  705 ARG A C   1 
ATOM   4005  O  O   . ARG A 1 705 ? 83.614  150.296 215.057 1.00 233.22 0  705 ARG A O   1 
ATOM   4006  C  CB  . ARG A 1 705 ? 82.350  152.633 213.147 1.00 233.22 0  705 ARG A CB  1 
ATOM   4007  N  N   . PHE A 1 706 ? 84.785  152.217 215.212 1.00 234.48 0  706 PHE A N   1 
ATOM   4008  C  CA  . PHE A 1 706 ? 86.010  151.530 215.613 1.00 234.48 0  706 PHE A CA  1 
ATOM   4009  C  C   . PHE A 1 706 ? 85.886  150.947 217.017 1.00 234.48 0  706 PHE A C   1 
ATOM   4010  O  O   . PHE A 1 706 ? 86.385  149.846 217.281 1.00 234.48 0  706 PHE A O   1 
ATOM   4011  C  CB  . PHE A 1 706 ? 87.199  152.488 215.532 1.00 234.48 0  706 PHE A CB  1 
ATOM   4012  N  N   . ILE A 1 707 ? 85.203  151.657 217.920 1.00 233.05 0  707 ILE A N   1 
ATOM   4013  C  CA  . ILE A 1 707 ? 84.990  151.145 219.271 1.00 233.05 0  707 ILE A CA  1 
ATOM   4014  C  C   . ILE A 1 707 ? 84.041  149.951 219.252 1.00 233.05 0  707 ILE A C   1 
ATOM   4015  O  O   . ILE A 1 707 ? 84.228  148.983 219.999 1.00 233.05 0  707 ILE A O   1 
ATOM   4016  C  CB  . ILE A 1 707 ? 84.472  152.266 220.190 1.00 233.05 0  707 ILE A CB  1 
ATOM   4017  N  N   . GLN A 1 708 ? 83.025  149.989 218.383 1.00 231.77 0  708 GLN A N   1 
ATOM   4018  C  CA  . GLN A 1 708 ? 82.113  148.855 218.253 1.00 231.77 0  708 GLN A CA  1 
ATOM   4019  C  C   . GLN A 1 708 ? 82.810  147.651 217.629 1.00 231.77 0  708 GLN A C   1 
ATOM   4020  O  O   . GLN A 1 708 ? 82.558  146.508 218.030 1.00 231.77 0  708 GLN A O   1 
ATOM   4021  C  CB  . GLN A 1 708 ? 80.892  149.257 217.426 1.00 231.77 0  708 GLN A CB  1 
ATOM   4022  N  N   . TRP A 1 709 ? 83.710  147.889 216.669 1.00 231.97 0  709 TRP A N   1 
ATOM   4023  C  CA  . TRP A 1 709 ? 84.474  146.795 216.077 1.00 231.97 0  709 TRP A CA  1 
ATOM   4024  C  C   . TRP A 1 709 ? 85.455  146.197 217.079 1.00 231.97 0  709 TRP A C   1 
ATOM   4025  O  O   . TRP A 1 709 ? 85.659  144.977 217.101 1.00 231.97 0  709 TRP A O   1 
ATOM   4026  C  CB  . TRP A 1 709 ? 85.211  147.285 214.831 1.00 231.97 0  709 TRP A CB  1 
ATOM   4027  N  N   . LEU A 1 710 ? 86.051  147.035 217.933 1.00 232.38 0  710 LEU A N   1 
ATOM   4028  C  CA  . LEU A 1 710 ? 86.947  146.530 218.970 1.00 232.38 0  710 LEU A CA  1 
ATOM   4029  C  C   . LEU A 1 710 ? 86.183  145.749 220.034 1.00 232.38 0  710 LEU A C   1 
ATOM   4030  O  O   . LEU A 1 710 ? 86.676  144.732 220.537 1.00 232.38 0  710 LEU A O   1 
ATOM   4031  C  CB  . LEU A 1 710 ? 87.720  147.686 219.604 1.00 232.38 0  710 LEU A CB  1 
ATOM   4032  N  N   . LYS A 1 711 ? 84.972  146.200 220.378 1.00 231.99 0  711 LYS A N   1 
ATOM   4033  C  CA  . LYS A 1 711 ? 84.155  145.468 221.341 1.00 231.99 0  711 LYS A CA  1 
ATOM   4034  C  C   . LYS A 1 711 ? 83.620  144.167 220.753 1.00 231.99 0  711 LYS A C   1 
ATOM   4035  O  O   . LYS A 1 711 ? 83.395  143.202 221.493 1.00 231.99 0  711 LYS A O   1 
ATOM   4036  C  CB  . LYS A 1 711 ? 83.001  146.345 221.825 1.00 231.99 0  711 LYS A CB  1 
ATOM   4037  N  N   . GLU A 1 712 ? 83.411  144.119 219.436 1.00 232.21 0  712 GLU A N   1 
ATOM   4038  C  CA  . GLU A 1 712 ? 82.975  142.880 218.801 1.00 232.21 0  712 GLU A CA  1 
ATOM   4039  C  C   . GLU A 1 712 ? 84.127  141.893 218.649 1.00 232.21 0  712 GLU A C   1 
ATOM   4040  O  O   . GLU A 1 712 ? 83.929  140.681 218.790 1.00 232.21 0  712 GLU A O   1 
ATOM   4041  C  CB  . GLU A 1 712 ? 82.347  143.181 217.439 1.00 232.21 0  712 GLU A CB  1 
ATOM   4042  N  N   . ALA A 1 713 ? 85.333  142.388 218.363 1.00 232.53 0  713 ALA A N   1 
ATOM   4043  C  CA  . ALA A 1 713 ? 86.487  141.514 218.210 1.00 232.53 0  713 ALA A CA  1 
ATOM   4044  C  C   . ALA A 1 713 ? 87.069  141.064 219.543 1.00 232.53 0  713 ALA A C   1 
ATOM   4045  O  O   . ALA A 1 713 ? 87.715  140.012 219.596 1.00 232.53 0  713 ALA A O   1 
ATOM   4046  C  CB  . ALA A 1 713 ? 87.571  142.211 217.386 1.00 232.53 0  713 ALA A CB  1 
ATOM   4047  N  N   . GLU A 1 714 ? 86.862  141.832 220.616 1.00 231.19 0  714 GLU A N   1 
ATOM   4048  C  CA  . GLU A 1 714 ? 87.375  141.436 221.923 1.00 231.19 0  714 GLU A CA  1 
ATOM   4049  C  C   . GLU A 1 714 ? 86.538  140.317 222.531 1.00 231.19 0  714 GLU A C   1 
ATOM   4050  O  O   . GLU A 1 714 ? 87.081  139.322 223.024 1.00 231.19 0  714 GLU A O   1 
ATOM   4051  C  CB  . GLU A 1 714 ? 87.418  142.645 222.858 1.00 231.19 0  714 GLU A CB  1 
ATOM   4052  N  N   . GLU A 1 715 ? 85.217  140.462 222.504 1.00 229.59 0  715 GLU A N   1 
ATOM   4053  C  CA  . GLU A 1 715 ? 84.324  139.449 223.055 1.00 229.59 0  715 GLU A CA  1 
ATOM   4054  C  C   . GLU A 1 715 ? 83.235  140.088 223.911 1.00 229.59 0  715 GLU A C   1 
ATOM   4055  O  O   . GLU A 1 715 ? 83.109  141.311 223.963 1.00 229.59 0  715 GLU A O   1 
ATOM   4056  N  N   . PRO B 1 41  ? 232.374 254.961 223.217 1.00 85.56  0  41  PRO B N   1 
ATOM   4057  C  CA  . PRO B 1 41  ? 233.520 255.476 222.460 1.00 85.56  0  41  PRO B CA  1 
ATOM   4058  C  C   . PRO B 1 41  ? 233.486 255.059 220.992 1.00 85.56  0  41  PRO B C   1 
ATOM   4059  O  O   . PRO B 1 41  ? 233.059 253.944 220.692 1.00 85.56  0  41  PRO B O   1 
ATOM   4060  C  CB  . PRO B 1 41  ? 234.722 254.851 223.174 1.00 85.56  0  41  PRO B CB  1 
ATOM   4061  C  CG  . PRO B 1 41  ? 234.239 254.577 224.554 1.00 85.56  0  41  PRO B CG  1 
ATOM   4062  C  CD  . PRO B 1 41  ? 232.794 254.206 224.410 1.00 85.56  0  41  PRO B CD  1 
ATOM   4063  N  N   . PRO B 1 42  ? 233.925 255.937 220.094 1.00 81.55  0  42  PRO B N   1 
ATOM   4064  C  CA  . PRO B 1 42  ? 233.958 255.585 218.671 1.00 81.55  0  42  PRO B CA  1 
ATOM   4065  C  C   . PRO B 1 42  ? 235.102 254.630 218.368 1.00 81.55  0  42  PRO B C   1 
ATOM   4066  O  O   . PRO B 1 42  ? 236.003 254.404 219.179 1.00 81.55  0  42  PRO B O   1 
ATOM   4067  C  CB  . PRO B 1 42  ? 234.152 256.934 217.977 1.00 81.55  0  42  PRO B CB  1 
ATOM   4068  C  CG  . PRO B 1 42  ? 234.889 257.752 218.979 1.00 81.55  0  42  PRO B CG  1 
ATOM   4069  C  CD  . PRO B 1 42  ? 234.382 257.319 220.330 1.00 81.55  0  42  PRO B CD  1 
ATOM   4070  N  N   . LEU B 1 43  ? 235.057 254.065 217.164 1.00 75.06  0  43  LEU B N   1 
ATOM   4071  C  CA  . LEU B 1 43  ? 236.052 253.100 216.708 1.00 75.06  0  43  LEU B CA  1 
ATOM   4072  C  C   . LEU B 1 43  ? 236.795 253.691 215.519 1.00 75.06  0  43  LEU B C   1 
ATOM   4073  O  O   . LEU B 1 43  ? 236.255 253.752 214.409 1.00 75.06  0  43  LEU B O   1 
ATOM   4074  C  CB  . LEU B 1 43  ? 235.399 251.769 216.340 1.00 75.06  0  43  LEU B CB  1 
ATOM   4075  C  CG  . LEU B 1 43  ? 236.352 250.606 216.061 1.00 75.06  0  43  LEU B CG  1 
ATOM   4076  C  CD1 . LEU B 1 43  ? 237.321 250.411 217.215 1.00 75.06  0  43  LEU B CD1 1 
ATOM   4077  C  CD2 . LEU B 1 43  ? 235.570 249.330 215.797 1.00 75.06  0  43  LEU B CD2 1 
ATOM   4078  N  N   . GLN B 1 44  ? 238.029 254.124 215.751 1.00 75.40  0  44  GLN B N   1 
ATOM   4079  C  CA  . GLN B 1 44  ? 238.868 254.674 214.700 1.00 75.40  0  44  GLN B CA  1 
ATOM   4080  C  C   . GLN B 1 44  ? 239.706 253.572 214.062 1.00 75.40  0  44  GLN B C   1 
ATOM   4081  O  O   . GLN B 1 44  ? 239.847 252.472 214.602 1.00 75.40  0  44  GLN B O   1 
ATOM   4082  C  CB  . GLN B 1 44  ? 239.779 255.773 215.249 1.00 75.40  0  44  GLN B CB  1 
ATOM   4083  C  CG  . GLN B 1 44  ? 239.047 257.029 215.689 1.00 75.40  0  44  GLN B CG  1 
ATOM   4084  C  CD  . GLN B 1 44  ? 238.699 257.011 217.163 1.00 75.40  0  44  GLN B CD  1 
ATOM   4085  O  OE1 . GLN B 1 44  ? 238.925 256.018 217.854 1.00 75.40  0  44  GLN B OE1 1 
ATOM   4086  N  NE2 . GLN B 1 44  ? 238.144 258.113 217.654 1.00 75.40  0  44  GLN B NE2 1 
ATOM   4087  N  N   . ALA B 1 45  ? 240.267 253.885 212.898 1.00 68.81  0  45  ALA B N   1 
ATOM   4088  C  CA  . ALA B 1 45  ? 241.096 252.935 212.171 1.00 68.81  0  45  ALA B CA  1 
ATOM   4089  C  C   . ALA B 1 45  ? 242.055 253.704 211.279 1.00 68.81  0  45  ALA B C   1 
ATOM   4090  O  O   . ALA B 1 45  ? 241.722 254.772 210.764 1.00 68.81  0  45  ALA B O   1 
ATOM   4091  C  CB  . ALA B 1 45  ? 240.249 251.972 211.333 1.00 68.81  0  45  ALA B CB  1 
ATOM   4092  N  N   . VAL B 1 46  ? 243.253 253.153 211.109 1.00 69.40  0  46  VAL B N   1 
ATOM   4093  C  CA  . VAL B 1 46  ? 244.223 253.664 210.152 1.00 69.40  0  46  VAL B CA  1 
ATOM   4094  C  C   . VAL B 1 46  ? 244.498 252.577 209.120 1.00 69.40  0  46  VAL B C   1 
ATOM   4095  O  O   . VAL B 1 46  ? 244.484 251.377 209.430 1.00 69.40  0  46  VAL B O   1 
ATOM   4096  C  CB  . VAL B 1 46  ? 245.521 254.170 210.826 1.00 69.40  0  46  VAL B CB  1 
ATOM   4097  C  CG1 . VAL B 1 46  ? 245.196 255.227 211.871 1.00 69.40  0  46  VAL B CG1 1 
ATOM   4098  C  CG2 . VAL B 1 46  ? 246.304 253.047 211.473 1.00 69.40  0  46  VAL B CG2 1 
ATOM   4099  N  N   . LEU B 1 47  ? 244.688 253.009 207.877 1.00 72.31  0  47  LEU B N   1 
ATOM   4100  C  CA  . LEU B 1 47  ? 244.803 252.123 206.726 1.00 72.31  0  47  LEU B CA  1 
ATOM   4101  C  C   . LEU B 1 47  ? 246.027 252.546 205.928 1.00 72.31  0  47  LEU B C   1 
ATOM   4102  O  O   . LEU B 1 47  ? 246.012 253.588 205.265 1.00 72.31  0  47  LEU B O   1 
ATOM   4103  C  CB  . LEU B 1 47  ? 243.533 252.178 205.874 1.00 72.31  0  47  LEU B CB  1 
ATOM   4104  C  CG  . LEU B 1 47  ? 243.303 251.171 204.746 1.00 72.31  0  47  LEU B CG  1 
ATOM   4105  C  CD1 . LEU B 1 47  ? 241.837 250.798 204.696 1.00 72.31  0  47  LEU B CD1 1 
ATOM   4106  C  CD2 . LEU B 1 47  ? 243.727 251.746 203.408 1.00 72.31  0  47  LEU B CD2 1 
ATOM   4107  N  N   . VAL B 1 48  ? 247.081 251.737 205.990 1.00 72.82  0  48  VAL B N   1 
ATOM   4108  C  CA  . VAL B 1 48  ? 248.308 252.007 205.245 1.00 72.82  0  48  VAL B CA  1 
ATOM   4109  C  C   . VAL B 1 48  ? 248.075 251.531 203.815 1.00 72.82  0  48  VAL B C   1 
ATOM   4110  O  O   . VAL B 1 48  ? 248.225 250.348 203.509 1.00 72.82  0  48  VAL B O   1 
ATOM   4111  C  CB  . VAL B 1 48  ? 249.524 251.330 205.879 1.00 72.82  0  48  VAL B CB  1 
ATOM   4112  C  CG1 . VAL B 1 48  ? 250.797 251.755 205.167 1.00 72.82  0  48  VAL B CG1 1 
ATOM   4113  C  CG2 . VAL B 1 48  ? 249.601 251.661 207.360 1.00 72.82  0  48  VAL B CG2 1 
ATOM   4114  N  N   . ALA B 1 49  ? 247.717 252.461 202.929 1.00 77.91  0  49  ALA B N   1 
ATOM   4115  C  CA  . ALA B 1 49  ? 247.417 252.159 201.537 1.00 77.91  0  49  ALA B CA  1 
ATOM   4116  C  C   . ALA B 1 49  ? 248.649 252.210 200.642 1.00 77.91  0  49  ALA B C   1 
ATOM   4117  O  O   . ALA B 1 49  ? 248.516 252.415 199.430 1.00 77.91  0  49  ALA B O   1 
ATOM   4118  C  CB  . ALA B 1 49  ? 246.348 253.116 201.008 1.00 77.91  0  49  ALA B CB  1 
ATOM   4119  N  N   . ASP B 1 50  ? 249.840 252.030 201.208 1.00 86.38  0  50  ASP B N   1 
ATOM   4120  C  CA  . ASP B 1 50  ? 251.074 252.025 200.426 1.00 86.38  0  50  ASP B CA  1 
ATOM   4121  C  C   . ASP B 1 50  ? 251.978 251.002 201.109 1.00 86.38  0  50  ASP B C   1 
ATOM   4122  O  O   . ASP B 1 50  ? 252.608 251.309 202.125 1.00 86.38  0  50  ASP B O   1 
ATOM   4123  C  CB  . ASP B 1 50  ? 251.699 253.417 200.386 1.00 86.38  0  50  ASP B CB  1 
ATOM   4124  C  CG  . ASP B 1 50  ? 252.896 253.533 199.429 1.00 86.38  0  50  ASP B CG  1 
ATOM   4125  O  OD1 . ASP B 1 50  ? 253.537 252.527 199.055 1.00 86.38  0  50  ASP B OD1 1 
ATOM   4126  O  OD2 . ASP B 1 50  ? 253.200 254.679 199.040 1.00 86.38  -1 50  ASP B OD2 1 
ATOM   4127  N  N   . SER B 1 51  ? 252.028 249.795 200.555 1.00 85.85  0  51  SER B N   1 
ATOM   4128  C  CA  . SER B 1 51  ? 252.928 248.771 201.068 1.00 85.85  0  51  SER B CA  1 
ATOM   4129  C  C   . SER B 1 51  ? 254.356 249.100 200.655 1.00 85.85  0  51  SER B C   1 
ATOM   4130  O  O   . SER B 1 51  ? 254.667 249.159 199.461 1.00 85.85  0  51  SER B O   1 
ATOM   4131  C  CB  . SER B 1 51  ? 252.515 247.397 200.550 1.00 85.85  0  51  SER B CB  1 
ATOM   4132  O  OG  . SER B 1 51  ? 251.227 247.039 201.019 1.00 85.85  0  51  SER B OG  1 
ATOM   4133  N  N   . PHE B 1 52  ? 255.224 249.315 201.643 1.00 86.16  0  52  PHE B N   1 
ATOM   4134  C  CA  . PHE B 1 52  ? 256.566 249.828 201.411 1.00 86.16  0  52  PHE B CA  1 
ATOM   4135  C  C   . PHE B 1 52  ? 257.590 248.730 201.142 1.00 86.16  0  52  PHE B C   1 
ATOM   4136  O  O   . PHE B 1 52  ? 258.792 248.966 201.308 1.00 86.16  0  52  PHE B O   1 
ATOM   4137  C  CB  . PHE B 1 52  ? 257.008 250.671 202.608 1.00 86.16  0  52  PHE B CB  1 
ATOM   4138  C  CG  . PHE B 1 52  ? 256.055 251.775 202.951 1.00 86.16  0  52  PHE B CG  1 
ATOM   4139  C  CD1 . PHE B 1 52  ? 255.948 252.894 202.140 1.00 86.16  0  52  PHE B CD1 1 
ATOM   4140  C  CD2 . PHE B 1 52  ? 255.258 251.691 204.083 1.00 86.16  0  52  PHE B CD2 1 
ATOM   4141  C  CE1 . PHE B 1 52  ? 255.065 253.913 202.455 1.00 86.16  0  52  PHE B CE1 1 
ATOM   4142  C  CE2 . PHE B 1 52  ? 254.375 252.707 204.405 1.00 86.16  0  52  PHE B CE2 1 
ATOM   4143  C  CZ  . PHE B 1 52  ? 254.278 253.818 203.589 1.00 86.16  0  52  PHE B CZ  1 
ATOM   4144  N  N   . ASP B 1 53  ? 257.149 247.547 200.732 1.00 89.41  0  53  ASP B N   1 
ATOM   4145  C  CA  . ASP B 1 53  ? 258.050 246.486 200.308 1.00 89.41  0  53  ASP B CA  1 
ATOM   4146  C  C   . ASP B 1 53  ? 258.095 246.415 198.787 1.00 89.41  0  53  ASP B C   1 
ATOM   4147  O  O   . ASP B 1 53  ? 257.070 246.558 198.114 1.00 89.41  0  53  ASP B O   1 
ATOM   4148  C  CB  . ASP B 1 53  ? 257.633 245.135 200.897 1.00 89.41  0  53  ASP B CB  1 
ATOM   4149  C  CG  . ASP B 1 53  ? 256.143 244.871 200.771 1.00 89.41  0  53  ASP B CG  1 
ATOM   4150  O  OD1 . ASP B 1 53  ? 255.406 245.770 200.319 1.00 89.41  0  53  ASP B OD1 1 
ATOM   4151  O  OD2 . ASP B 1 53  ? 255.708 243.755 201.126 1.00 89.41  -1 53  ASP B OD2 1 
ATOM   4152  N  N   . ARG B 1 54  ? 259.296 246.209 198.247 1.00 93.68  0  54  ARG B N   1 
ATOM   4153  C  CA  . ARG B 1 54  ? 259.496 246.213 196.799 1.00 93.68  0  54  ARG B CA  1 
ATOM   4154  C  C   . ARG B 1 54  ? 259.300 244.784 196.299 1.00 93.68  0  54  ARG B C   1 
ATOM   4155  O  O   . ARG B 1 54  ? 260.245 244.058 195.984 1.00 93.68  0  54  ARG B O   1 
ATOM   4156  C  CB  . ARG B 1 54  ? 260.870 246.768 196.443 1.00 93.68  0  54  ARG B CB  1 
ATOM   4157  C  CG  . ARG B 1 54  ? 261.145 248.189 196.949 1.00 93.68  0  54  ARG B CG  1 
ATOM   4158  C  CD  . ARG B 1 54  ? 259.955 249.125 196.740 1.00 93.68  0  54  ARG B CD  1 
ATOM   4159  N  NE  . ARG B 1 54  ? 260.360 250.442 196.259 1.00 93.68  0  54  ARG B NE  1 
ATOM   4160  C  CZ  . ARG B 1 54  ? 259.550 251.494 196.197 1.00 93.68  0  54  ARG B CZ  1 
ATOM   4161  N  NH1 . ARG B 1 54  ? 258.288 251.386 196.590 1.00 93.68  1  54  ARG B NH1 1 
ATOM   4162  N  NH2 . ARG B 1 54  ? 260.000 252.656 195.744 1.00 93.68  0  54  ARG B NH2 1 
ATOM   4163  N  N   . ARG B 1 55  ? 258.035 244.384 196.230 1.00 89.51  0  55  ARG B N   1 
ATOM   4164  C  CA  . ARG B 1 55  ? 257.655 243.019 195.892 1.00 89.51  0  55  ARG B CA  1 
ATOM   4165  C  C   . ARG B 1 55  ? 256.863 242.917 194.600 1.00 89.51  0  55  ARG B C   1 
ATOM   4166  O  O   . ARG B 1 55  ? 257.104 242.004 193.808 1.00 89.51  0  55  ARG B O   1 
ATOM   4167  C  CB  . ARG B 1 55  ? 256.840 242.401 197.035 1.00 89.51  0  55  ARG B CB  1 
ATOM   4168  C  CG  . ARG B 1 55  ? 257.602 242.261 198.342 1.00 89.51  0  55  ARG B CG  1 
ATOM   4169  C  CD  . ARG B 1 55  ? 258.871 241.443 198.164 1.00 89.51  0  55  ARG B CD  1 
ATOM   4170  N  NE  . ARG B 1 55  ? 258.609 240.156 197.525 1.00 89.51  0  55  ARG B NE  1 
ATOM   4171  C  CZ  . ARG B 1 55  ? 258.312 239.042 198.185 1.00 89.51  0  55  ARG B CZ  1 
ATOM   4172  N  NH1 . ARG B 1 55  ? 258.092 237.915 197.521 1.00 89.51  1  55  ARG B NH1 1 
ATOM   4173  N  NH2 . ARG B 1 55  ? 258.237 239.053 199.508 1.00 89.51  0  55  ARG B NH2 1 
ATOM   4174  N  N   . PHE B 1 56  ? 255.922 243.828 194.363 1.00 85.00  0  56  PHE B N   1 
ATOM   4175  C  CA  . PHE B 1 56  ? 255.097 243.784 193.156 1.00 85.00  0  56  PHE B CA  1 
ATOM   4176  C  C   . PHE B 1 56  ? 255.741 244.595 192.030 1.00 85.00  0  56  PHE B C   1 
ATOM   4177  O  O   . PHE B 1 56  ? 255.173 245.546 191.496 1.00 85.00  0  56  PHE B O   1 
ATOM   4178  C  CB  . PHE B 1 56  ? 253.688 244.279 193.458 1.00 85.00  0  56  PHE B CB  1 
ATOM   4179  C  CG  . PHE B 1 56  ? 252.761 243.210 193.961 1.00 85.00  0  56  PHE B CG  1 
ATOM   4180  C  CD1 . PHE B 1 56  ? 252.154 242.332 193.076 1.00 85.00  0  56  PHE B CD1 1 
ATOM   4181  C  CD2 . PHE B 1 56  ? 252.492 243.085 195.314 1.00 85.00  0  56  PHE B CD2 1 
ATOM   4182  C  CE1 . PHE B 1 56  ? 251.296 241.346 193.532 1.00 85.00  0  56  PHE B CE1 1 
ATOM   4183  C  CE2 . PHE B 1 56  ? 251.636 242.101 195.778 1.00 85.00  0  56  PHE B CE2 1 
ATOM   4184  C  CZ  . PHE B 1 56  ? 251.038 241.232 194.885 1.00 85.00  0  56  PHE B CZ  1 
ATOM   4185  N  N   . PHE B 1 57  ? 256.959 244.192 191.669 1.00 92.49  0  57  PHE B N   1 
ATOM   4186  C  CA  . PHE B 1 57  ? 257.643 244.844 190.570 1.00 92.49  0  57  PHE B CA  1 
ATOM   4187  C  C   . PHE B 1 57  ? 257.660 243.942 189.344 1.00 92.49  0  57  PHE B C   1 
ATOM   4188  O  O   . PHE B 1 57  ? 257.873 242.731 189.470 1.00 92.49  0  57  PHE B O   1 
ATOM   4189  C  CB  . PHE B 1 57  ? 259.085 245.223 190.940 1.00 92.49  0  57  PHE B CB  1 
ATOM   4190  C  CG  . PHE B 1 57  ? 259.198 246.495 191.734 1.00 92.49  0  57  PHE B CG  1 
ATOM   4191  C  CD1 . PHE B 1 57  ? 258.122 247.365 191.840 1.00 92.49  0  57  PHE B CD1 1 
ATOM   4192  C  CD2 . PHE B 1 57  ? 260.394 246.837 192.347 1.00 92.49  0  57  PHE B CD2 1 
ATOM   4193  C  CE1 . PHE B 1 57  ? 258.230 248.541 192.559 1.00 92.49  0  57  PHE B CE1 1 
ATOM   4194  C  CE2 . PHE B 1 57  ? 260.509 248.014 193.067 1.00 92.49  0  57  PHE B CE2 1 
ATOM   4195  C  CZ  . PHE B 1 57  ? 259.425 248.866 193.173 1.00 92.49  0  57  PHE B CZ  1 
ATOM   4196  N  N   . PRO B 1 58  ? 257.439 244.496 188.142 1.00 93.63  0  58  PRO B N   1 
ATOM   4197  C  CA  . PRO B 1 58  ? 257.095 245.901 187.907 1.00 93.63  0  58  PRO B CA  1 
ATOM   4198  C  C   . PRO B 1 58  ? 255.594 246.122 187.788 1.00 93.63  0  58  PRO B C   1 
ATOM   4199  O  O   . PRO B 1 58  ? 255.152 246.923 186.965 1.00 93.63  0  58  PRO B O   1 
ATOM   4200  C  CB  . PRO B 1 58  ? 257.792 246.203 186.585 1.00 93.63  0  58  PRO B CB  1 
ATOM   4201  C  CG  . PRO B 1 58  ? 257.759 244.906 185.862 1.00 93.63  0  58  PRO B CG  1 
ATOM   4202  C  CD  . PRO B 1 58  ? 257.769 243.802 186.887 1.00 93.63  0  58  PRO B CD  1 
ATOM   4203  N  N   . ILE B 1 59  ? 254.820 245.412 188.612 1.00 91.26  0  59  ILE B N   1 
ATOM   4204  C  CA  . ILE B 1 59  ? 253.371 245.582 188.592 1.00 91.26  0  59  ILE B CA  1 
ATOM   4205  C  C   . ILE B 1 59  ? 252.984 246.893 189.265 1.00 91.26  0  59  ILE B C   1 
ATOM   4206  O  O   . ILE B 1 59  ? 252.112 247.623 188.778 1.00 91.26  0  59  ILE B O   1 
ATOM   4207  C  CB  . ILE B 1 59  ? 252.679 244.370 189.246 1.00 91.26  0  59  ILE B CB  1 
ATOM   4208  C  CG1 . ILE B 1 59  ? 253.092 243.073 188.546 1.00 91.26  0  59  ILE B CG1 1 
ATOM   4209  C  CG2 . ILE B 1 59  ? 251.165 244.514 189.201 1.00 91.26  0  59  ILE B CG2 1 
ATOM   4210  C  CD1 . ILE B 1 59  ? 254.020 242.193 189.361 1.00 91.26  0  59  ILE B CD1 1 
ATOM   4211  N  N   . SER B 1 60  ? 253.646 247.234 190.372 1.00 93.18  0  60  SER B N   1 
ATOM   4212  C  CA  . SER B 1 60  ? 253.290 248.445 191.101 1.00 93.18  0  60  SER B CA  1 
ATOM   4213  C  C   . SER B 1 60  ? 253.919 249.701 190.509 1.00 93.18  0  60  SER B C   1 
ATOM   4214  O  O   . SER B 1 60  ? 253.755 250.784 191.081 1.00 93.18  0  60  SER B O   1 
ATOM   4215  C  CB  . SER B 1 60  ? 253.685 248.314 192.575 1.00 93.18  0  60  SER B CB  1 
ATOM   4216  O  OG  . SER B 1 60  ? 255.018 248.741 192.787 1.00 93.18  0  60  SER B OG  1 
ATOM   4217  N  N   . LYS B 1 61  ? 254.625 249.587 189.382 1.00 95.45  0  61  LYS B N   1 
ATOM   4218  C  CA  . LYS B 1 61  ? 255.245 250.730 188.726 1.00 95.45  0  61  LYS B CA  1 
ATOM   4219  C  C   . LYS B 1 61  ? 254.270 251.516 187.862 1.00 95.45  0  61  LYS B C   1 
ATOM   4220  O  O   . LYS B 1 61  ? 254.620 252.608 187.403 1.00 95.45  0  61  LYS B O   1 
ATOM   4221  C  CB  . LYS B 1 61  ? 256.437 250.282 187.877 1.00 95.45  0  61  LYS B CB  1 
ATOM   4222  C  CG  . LYS B 1 61  ? 257.609 249.758 188.687 1.00 95.45  0  61  LYS B CG  1 
ATOM   4223  C  CD  . LYS B 1 61  ? 258.829 249.547 187.809 1.00 95.45  0  61  LYS B CD  1 
ATOM   4224  C  CE  . LYS B 1 61  ? 259.307 250.862 187.215 1.00 95.45  0  61  LYS B CE  1 
ATOM   4225  N  NZ  . LYS B 1 61  ? 260.514 250.684 186.364 1.00 95.45  1  61  LYS B NZ  1 
ATOM   4226  N  N   . ASP B 1 62  ? 253.071 250.990 187.619 1.00 94.16  0  62  ASP B N   1 
ATOM   4227  C  CA  . ASP B 1 62  ? 252.067 251.667 186.809 1.00 94.16  0  62  ASP B CA  1 
ATOM   4228  C  C   . ASP B 1 62  ? 250.865 252.100 187.632 1.00 94.16  0  62  ASP B C   1 
ATOM   4229  O  O   . ASP B 1 62  ? 250.498 253.278 187.628 1.00 94.16  0  62  ASP B O   1 
ATOM   4230  C  CB  . ASP B 1 62  ? 251.610 250.733 185.679 1.00 94.16  0  62  ASP B CB  1 
ATOM   4231  C  CG  . ASP B 1 62  ? 252.711 250.440 184.678 1.00 94.16  0  62  ASP B CG  1 
ATOM   4232  O  OD1 . ASP B 1 62  ? 252.918 251.258 183.759 1.00 94.16  0  62  ASP B OD1 1 
ATOM   4233  O  OD2 . ASP B 1 62  ? 253.371 249.388 184.814 1.00 94.16  -1 62  ASP B OD2 1 
ATOM   4234  N  N   . GLN B 1 63  ? 250.240 251.165 188.340 1.00 89.47  0  63  GLN B N   1 
ATOM   4235  C  CA  . GLN B 1 63  ? 249.213 251.412 189.337 1.00 89.47  0  63  GLN B CA  1 
ATOM   4236  C  C   . GLN B 1 63  ? 249.626 250.682 190.607 1.00 89.47  0  63  GLN B C   1 
ATOM   4237  O  O   . GLN B 1 63  ? 250.271 249.631 190.524 1.00 89.47  0  63  GLN B O   1 
ATOM   4238  C  CB  . GLN B 1 63  ? 247.820 250.956 188.857 1.00 89.47  0  63  GLN B CB  1 
ATOM   4239  C  CG  . GLN B 1 63  ? 247.643 249.464 188.625 1.00 89.47  0  63  GLN B CG  1 
ATOM   4240  C  CD  . GLN B 1 63  ? 247.989 249.042 187.212 1.00 89.47  0  63  GLN B CD  1 
ATOM   4241  O  OE1 . GLN B 1 63  ? 248.489 249.839 186.418 1.00 89.47  0  63  GLN B OE1 1 
ATOM   4242  N  NE2 . GLN B 1 63  ? 247.720 247.782 186.888 1.00 89.47  0  63  GLN B NE2 1 
ATOM   4243  N  N   . PRO B 1 64  ? 249.334 251.232 191.788 1.00 81.42  0  64  PRO B N   1 
ATOM   4244  C  CA  . PRO B 1 64  ? 249.838 250.623 193.027 1.00 81.42  0  64  PRO B CA  1 
ATOM   4245  C  C   . PRO B 1 64  ? 249.150 249.299 193.327 1.00 81.42  0  64  PRO B C   1 
ATOM   4246  O  O   . PRO B 1 64  ? 248.135 248.936 192.730 1.00 81.42  0  64  PRO B O   1 
ATOM   4247  C  CB  . PRO B 1 64  ? 249.520 251.672 194.096 1.00 81.42  0  64  PRO B CB  1 
ATOM   4248  C  CG  . PRO B 1 64  ? 248.381 252.440 193.530 1.00 81.42  0  64  PRO B CG  1 
ATOM   4249  C  CD  . PRO B 1 64  ? 248.637 252.502 192.055 1.00 81.42  0  64  PRO B CD  1 
ATOM   4250  N  N   . ARG B 1 65  ? 249.729 248.568 194.284 1.00 81.27  0  65  ARG B N   1 
ATOM   4251  C  CA  . ARG B 1 65  ? 249.256 247.223 194.589 1.00 81.27  0  65  ARG B CA  1 
ATOM   4252  C  C   . ARG B 1 65  ? 247.925 247.210 195.327 1.00 81.27  0  65  ARG B C   1 
ATOM   4253  O  O   . ARG B 1 65  ? 247.290 246.152 195.399 1.00 81.27  0  65  ARG B O   1 
ATOM   4254  C  CB  . ARG B 1 65  ? 250.300 246.455 195.401 1.00 81.27  0  65  ARG B CB  1 
ATOM   4255  C  CG  . ARG B 1 65  ? 250.278 246.732 196.891 1.00 81.27  0  65  ARG B CG  1 
ATOM   4256  C  CD  . ARG B 1 65  ? 251.018 245.644 197.646 1.00 81.27  0  65  ARG B CD  1 
ATOM   4257  N  NE  . ARG B 1 65  ? 252.459 245.713 197.428 1.00 81.27  0  65  ARG B NE  1 
ATOM   4258  C  CZ  . ARG B 1 65  ? 253.348 244.963 198.069 1.00 81.27  0  65  ARG B CZ  1 
ATOM   4259  N  NH1 . ARG B 1 65  ? 252.945 244.081 198.974 1.00 81.27  1  65  ARG B NH1 1 
ATOM   4260  N  NH2 . ARG B 1 65  ? 254.641 245.094 197.806 1.00 81.27  0  65  ARG B NH2 1 
ATOM   4261  N  N   . VAL B 1 66  ? 247.485 248.348 195.872 1.00 74.27  0  66  VAL B N   1 
ATOM   4262  C  CA  . VAL B 1 66  ? 246.183 248.424 196.520 1.00 74.27  0  66  VAL B CA  1 
ATOM   4263  C  C   . VAL B 1 66  ? 245.067 248.750 195.540 1.00 74.27  0  66  VAL B C   1 
ATOM   4264  O  O   . VAL B 1 66  ? 243.892 248.758 195.932 1.00 74.27  0  66  VAL B O   1 
ATOM   4265  C  CB  . VAL B 1 66  ? 246.215 249.462 197.660 1.00 74.27  0  66  VAL B CB  1 
ATOM   4266  C  CG1 . VAL B 1 66  ? 247.263 249.082 198.691 1.00 74.27  0  66  VAL B CG1 1 
ATOM   4267  C  CG2 . VAL B 1 66  ? 246.485 250.848 197.104 1.00 74.27  0  66  VAL B CG2 1 
ATOM   4268  N  N   . LEU B 1 67  ? 245.393 249.018 194.276 1.00 77.15  0  67  LEU B N   1 
ATOM   4269  C  CA  . LEU B 1 67  ? 244.399 249.288 193.245 1.00 77.15  0  67  LEU B CA  1 
ATOM   4270  C  C   . LEU B 1 67  ? 244.275 248.156 192.233 1.00 77.15  0  67  LEU B C   1 
ATOM   4271  O  O   . LEU B 1 67  ? 243.548 248.300 191.245 1.00 77.15  0  67  LEU B O   1 
ATOM   4272  C  CB  . LEU B 1 67  ? 244.727 250.598 192.526 1.00 77.15  0  67  LEU B CB  1 
ATOM   4273  C  CG  . LEU B 1 67  ? 243.925 251.836 192.927 1.00 77.15  0  67  LEU B CG  1 
ATOM   4274  C  CD1 . LEU B 1 67  ? 244.195 252.220 194.371 1.00 77.15  0  67  LEU B CD1 1 
ATOM   4275  C  CD2 . LEU B 1 67  ? 244.254 252.991 191.997 1.00 77.15  0  67  LEU B CD2 1 
ATOM   4276  N  N   . LEU B 1 68  ? 244.969 247.040 192.448 1.00 75.82  0  68  LEU B N   1 
ATOM   4277  C  CA  . LEU B 1 68  ? 244.850 245.903 191.544 1.00 75.82  0  68  LEU B CA  1 
ATOM   4278  C  C   . LEU B 1 68  ? 243.523 245.187 191.783 1.00 75.82  0  68  LEU B C   1 
ATOM   4279  O  O   . LEU B 1 68  ? 243.055 245.117 192.919 1.00 75.82  0  68  LEU B O   1 
ATOM   4280  C  CB  . LEU B 1 68  ? 246.003 244.924 191.751 1.00 75.82  0  68  LEU B CB  1 
ATOM   4281  C  CG  . LEU B 1 68  ? 247.422 245.487 191.836 1.00 75.82  0  68  LEU B CG  1 
ATOM   4282  C  CD1 . LEU B 1 68  ? 248.431 244.364 192.018 1.00 75.82  0  68  LEU B CD1 1 
ATOM   4283  C  CD2 . LEU B 1 68  ? 247.766 246.321 190.615 1.00 75.82  0  68  LEU B CD2 1 
ATOM   4284  N  N   . PRO B 1 69  ? 242.880 244.672 190.740 1.00 72.83  0  69  PRO B N   1 
ATOM   4285  C  CA  . PRO B 1 69  ? 241.622 243.946 190.958 1.00 72.83  0  69  PRO B CA  1 
ATOM   4286  C  C   . PRO B 1 69  ? 241.833 242.475 191.289 1.00 72.83  0  69  PRO B C   1 
ATOM   4287  O  O   . PRO B 1 69  ? 242.558 241.769 190.580 1.00 72.83  0  69  PRO B O   1 
ATOM   4288  C  CB  . PRO B 1 69  ? 240.881 244.122 189.627 1.00 72.83  0  69  PRO B CB  1 
ATOM   4289  C  CG  . PRO B 1 69  ? 241.954 244.333 188.616 1.00 72.83  0  69  PRO B CG  1 
ATOM   4290  C  CD  . PRO B 1 69  ? 243.127 244.960 189.316 1.00 72.83  0  69  PRO B CD  1 
ATOM   4291  N  N   . LEU B 1 70  ? 241.212 242.001 192.372 1.00 72.01  0  70  LEU B N   1 
ATOM   4292  C  CA  . LEU B 1 70  ? 241.135 240.562 192.604 1.00 72.01  0  70  LEU B CA  1 
ATOM   4293  C  C   . LEU B 1 70  ? 240.117 239.924 191.671 1.00 72.01  0  70  LEU B C   1 
ATOM   4294  O  O   . LEU B 1 70  ? 240.464 239.106 190.811 1.00 72.01  0  70  LEU B O   1 
ATOM   4295  C  CB  . LEU B 1 70  ? 240.766 240.272 194.059 1.00 72.01  0  70  LEU B CB  1 
ATOM   4296  C  CG  . LEU B 1 70  ? 241.789 240.510 195.163 1.00 72.01  0  70  LEU B CG  1 
ATOM   4297  C  CD1 . LEU B 1 70  ? 241.124 240.285 196.499 1.00 72.01  0  70  LEU B CD1 1 
ATOM   4298  C  CD2 . LEU B 1 70  ? 242.964 239.571 195.001 1.00 72.01  0  70  LEU B CD2 1 
ATOM   4299  N  N   . ALA B 1 71  ? 238.847 240.297 191.825 1.00 72.53  0  71  ALA B N   1 
ATOM   4300  C  CA  . ALA B 1 71  ? 237.788 239.942 190.884 1.00 72.53  0  71  ALA B CA  1 
ATOM   4301  C  C   . ALA B 1 71  ? 237.044 241.233 190.560 1.00 72.53  0  71  ALA B C   1 
ATOM   4302  O  O   . ALA B 1 71  ? 235.999 241.521 191.149 1.00 72.53  0  71  ALA B O   1 
ATOM   4303  C  CB  . ALA B 1 71  ? 236.873 238.878 191.469 1.00 72.53  0  71  ALA B CB  1 
ATOM   4304  N  N   . ASN B 1 72  ? 237.610 242.006 189.627 1.00 75.02  0  72  ASN B N   1 
ATOM   4305  C  CA  . ASN B 1 72  ? 237.113 243.300 189.144 1.00 75.02  0  72  ASN B CA  1 
ATOM   4306  C  C   . ASN B 1 72  ? 236.916 244.343 190.250 1.00 75.02  0  72  ASN B C   1 
ATOM   4307  O  O   . ASN B 1 72  ? 236.232 245.348 190.036 1.00 75.02  0  72  ASN B O   1 
ATOM   4308  C  CB  . ASN B 1 72  ? 235.809 243.134 188.354 1.00 75.02  0  72  ASN B CB  1 
ATOM   4309  C  CG  . ASN B 1 72  ? 235.945 242.147 187.220 1.00 75.02  0  72  ASN B CG  1 
ATOM   4310  O  OD1 . ASN B 1 72  ? 237.032 241.952 186.682 1.00 75.02  0  72  ASN B OD1 1 
ATOM   4311  N  ND2 . ASN B 1 72  ? 234.835 241.527 186.838 1.00 75.02  0  72  ASN B ND2 1 
ATOM   4312  N  N   . VAL B 1 73  ? 237.496 244.140 191.433 1.00 71.87  0  73  VAL B N   1 
ATOM   4313  C  CA  . VAL B 1 73  ? 237.340 245.038 192.573 1.00 71.87  0  73  VAL B CA  1 
ATOM   4314  C  C   . VAL B 1 73  ? 238.713 245.220 193.205 1.00 71.87  0  73  VAL B C   1 
ATOM   4315  O  O   . VAL B 1 73  ? 239.397 244.233 193.498 1.00 71.87  0  73  VAL B O   1 
ATOM   4316  C  CB  . VAL B 1 73  ? 236.332 244.497 193.613 1.00 71.87  0  73  VAL B CB  1 
ATOM   4317  C  CG1 . VAL B 1 73  ? 236.367 245.323 194.888 1.00 71.87  0  73  VAL B CG1 1 
ATOM   4318  C  CG2 . VAL B 1 73  ? 234.909 244.485 193.062 1.00 71.87  0  73  VAL B CG2 1 
ATOM   4319  N  N   . ALA B 1 74  ? 239.122 246.473 193.397 1.00 71.01  0  74  ALA B N   1 
ATOM   4320  C  CA  . ALA B 1 74  ? 240.407 246.767 194.014 1.00 71.01  0  74  ALA B CA  1 
ATOM   4321  C  C   . ALA B 1 74  ? 240.410 246.359 195.486 1.00 71.01  0  74  ALA B C   1 
ATOM   4322  O  O   . ALA B 1 74  ? 239.365 246.239 196.129 1.00 71.01  0  74  ALA B O   1 
ATOM   4323  C  CB  . ALA B 1 74  ? 240.737 248.253 193.882 1.00 71.01  0  74  ALA B CB  1 
ATOM   4324  N  N   . LEU B 1 75  ? 241.617 246.147 196.020 1.00 71.01  0  75  LEU B N   1 
ATOM   4325  C  CA  . LEU B 1 75  ? 241.752 245.700 197.402 1.00 71.01  0  75  LEU B CA  1 
ATOM   4326  C  C   . LEU B 1 75  ? 241.441 246.808 198.401 1.00 71.01  0  75  LEU B C   1 
ATOM   4327  O  O   . LEU B 1 75  ? 241.160 246.509 199.569 1.00 71.01  0  75  LEU B O   1 
ATOM   4328  C  CB  . LEU B 1 75  ? 243.158 245.142 197.658 1.00 71.01  0  75  LEU B CB  1 
ATOM   4329  C  CG  . LEU B 1 75  ? 243.496 243.722 197.169 1.00 71.01  0  75  LEU B CG  1 
ATOM   4330  C  CD1 . LEU B 1 75  ? 243.849 243.659 195.701 1.00 71.01  0  75  LEU B CD1 1 
ATOM   4331  C  CD2 . LEU B 1 75  ? 244.603 243.091 197.986 1.00 71.01  0  75  LEU B CD2 1 
ATOM   4332  N  N   . ILE B 1 76  ? 241.489 248.072 197.965 1.00 70.65  0  76  ILE B N   1 
ATOM   4333  C  CA  . ILE B 1 76  ? 241.058 249.188 198.803 1.00 70.65  0  76  ILE B CA  1 
ATOM   4334  C  C   . ILE B 1 76  ? 239.573 249.066 199.125 1.00 70.65  0  76  ILE B C   1 
ATOM   4335  O  O   . ILE B 1 76  ? 239.156 249.233 200.279 1.00 70.65  0  76  ILE B O   1 
ATOM   4336  C  CB  . ILE B 1 76  ? 241.388 250.526 198.108 1.00 70.65  0  76  ILE B CB  1 
ATOM   4337  C  CG1 . ILE B 1 76  ? 242.860 250.878 198.302 1.00 70.65  0  76  ILE B CG1 1 
ATOM   4338  C  CG2 . ILE B 1 76  ? 240.517 251.669 198.620 1.00 70.65  0  76  ILE B CG2 1 
ATOM   4339  C  CD1 . ILE B 1 76  ? 243.262 251.047 199.746 1.00 70.65  0  76  ILE B CD1 1 
ATOM   4340  N  N   . ASP B 1 77  ? 238.762 248.730 198.116 1.00 73.98  0  77  ASP B N   1 
ATOM   4341  C  CA  . ASP B 1 77  ? 237.327 248.558 198.325 1.00 73.98  0  77  ASP B CA  1 
ATOM   4342  C  C   . ASP B 1 77  ? 237.032 247.346 199.201 1.00 73.98  0  77  ASP B C   1 
ATOM   4343  O  O   . ASP B 1 77  ? 236.109 247.383 200.022 1.00 73.98  0  77  ASP B O   1 
ATOM   4344  C  CB  . ASP B 1 77  ? 236.614 248.434 196.979 1.00 73.98  0  77  ASP B CB  1 
ATOM   4345  C  CG  . ASP B 1 77  ? 236.815 249.652 196.099 1.00 73.98  0  77  ASP B CG  1 
ATOM   4346  O  OD1 . ASP B 1 77  ? 237.004 250.758 196.646 1.00 73.98  0  77  ASP B OD1 1 
ATOM   4347  O  OD2 . ASP B 1 77  ? 236.782 249.503 194.859 1.00 73.98  -1 77  ASP B OD2 1 
ATOM   4348  N  N   . TYR B 1 78  ? 237.832 246.283 199.065 1.00 70.32  0  78  TYR B N   1 
ATOM   4349  C  CA  . TYR B 1 78  ? 237.680 245.102 199.912 1.00 70.32  0  78  TYR B CA  1 
ATOM   4350  C  C   . TYR B 1 78  ? 237.989 245.423 201.371 1.00 70.32  0  78  TYR B C   1 
ATOM   4351  O  O   . TYR B 1 78  ? 237.239 245.035 202.276 1.00 70.32  0  78  TYR B O   1 
ATOM   4352  C  CB  . TYR B 1 78  ? 238.602 243.987 199.420 1.00 70.32  0  78  TYR B CB  1 
ATOM   4353  C  CG  . TYR B 1 78  ? 238.046 243.096 198.332 1.00 70.32  0  78  TYR B CG  1 
ATOM   4354  C  CD1 . TYR B 1 78  ? 237.037 242.181 198.602 1.00 70.32  0  78  TYR B CD1 1 
ATOM   4355  C  CD2 . TYR B 1 78  ? 238.557 243.146 197.040 1.00 70.32  0  78  TYR B CD2 1 
ATOM   4356  C  CE1 . TYR B 1 78  ? 236.535 241.354 197.612 1.00 70.32  0  78  TYR B CE1 1 
ATOM   4357  C  CE2 . TYR B 1 78  ? 238.064 242.323 196.043 1.00 70.32  0  78  TYR B CE2 1 
ATOM   4358  C  CZ  . TYR B 1 78  ? 237.052 241.431 196.335 1.00 70.32  0  78  TYR B CZ  1 
ATOM   4359  O  OH  . TYR B 1 78  ? 236.557 240.612 195.346 1.00 70.32  0  78  TYR B OH  1 
ATOM   4360  N  N   . THR B 1 79  ? 239.087 246.148 201.612 1.00 68.48  0  79  THR B N   1 
ATOM   4361  C  CA  . THR B 1 79  ? 239.470 246.495 202.977 1.00 68.48  0  79  THR B CA  1 
ATOM   4362  C  C   . THR B 1 79  ? 238.488 247.485 203.597 1.00 68.48  0  79  THR B C   1 
ATOM   4363  O  O   . THR B 1 79  ? 238.167 247.386 204.788 1.00 68.48  0  79  THR B O   1 
ATOM   4364  C  CB  . THR B 1 79  ? 240.889 247.061 202.992 1.00 68.48  0  79  THR B CB  1 
ATOM   4365  O  OG1 . THR B 1 79  ? 241.731 246.251 202.163 1.00 68.48  0  79  THR B OG1 1 
ATOM   4366  C  CG2 . THR B 1 79  ? 241.448 247.058 204.404 1.00 68.48  0  79  THR B CG2 1 
ATOM   4367  N  N   . LEU B 1 80  ? 237.967 248.419 202.798 1.00 68.85  0  80  LEU B N   1 
ATOM   4368  C  CA  . LEU B 1 80  ? 236.990 249.370 203.318 1.00 68.85  0  80  LEU B CA  1 
ATOM   4369  C  C   . LEU B 1 80  ? 235.649 248.699 203.595 1.00 68.85  0  80  LEU B C   1 
ATOM   4370  O  O   . LEU B 1 80  ? 234.967 249.049 204.566 1.00 68.85  0  80  LEU B O   1 
ATOM   4371  C  CB  . LEU B 1 80  ? 236.826 250.534 202.343 1.00 68.85  0  80  LEU B CB  1 
ATOM   4372  C  CG  . LEU B 1 80  ? 237.948 251.572 202.360 1.00 68.85  0  80  LEU B CG  1 
ATOM   4373  C  CD1 . LEU B 1 80  ? 237.719 252.627 201.291 1.00 68.85  0  80  LEU B CD1 1 
ATOM   4374  C  CD2 . LEU B 1 80  ? 238.065 252.210 203.734 1.00 68.85  0  80  LEU B CD2 1 
ATOM   4375  N  N   . GLU B 1 81  ? 235.260 247.720 202.770 1.00 71.33  0  81  GLU B N   1 
ATOM   4376  C  CA  . GLU B 1 81  ? 234.047 246.959 203.046 1.00 71.33  0  81  GLU B CA  1 
ATOM   4377  C  C   . GLU B 1 81  ? 234.208 246.098 204.293 1.00 71.33  0  81  GLU B C   1 
ATOM   4378  O  O   . GLU B 1 81  ? 233.262 245.950 205.076 1.00 71.33  0  81  GLU B O   1 
ATOM   4379  C  CB  . GLU B 1 81  ? 233.681 246.098 201.837 1.00 71.33  0  81  GLU B CB  1 
ATOM   4380  C  CG  . GLU B 1 81  ? 232.392 245.313 202.000 1.00 71.33  0  81  GLU B CG  1 
ATOM   4381  C  CD  . GLU B 1 81  ? 231.176 246.209 202.134 1.00 71.33  0  81  GLU B CD  1 
ATOM   4382  O  OE1 . GLU B 1 81  ? 231.118 247.247 201.442 1.00 71.33  0  81  GLU B OE1 1 
ATOM   4383  O  OE2 . GLU B 1 81  ? 230.279 245.877 202.936 1.00 71.33  -1 81  GLU B OE2 1 
ATOM   4384  N  N   . PHE B 1 82  ? 235.409 245.551 204.507 1.00 68.15  0  82  PHE B N   1 
ATOM   4385  C  CA  . PHE B 1 82  ? 235.696 244.840 205.751 1.00 68.15  0  82  PHE B CA  1 
ATOM   4386  C  C   . PHE B 1 82  ? 235.638 245.779 206.952 1.00 68.15  0  82  PHE B C   1 
ATOM   4387  O  O   . PHE B 1 82  ? 235.188 245.386 208.035 1.00 68.15  0  82  PHE B O   1 
ATOM   4388  C  CB  . PHE B 1 82  ? 237.066 244.163 205.656 1.00 68.15  0  82  PHE B CB  1 
ATOM   4389  C  CG  . PHE B 1 82  ? 237.706 243.888 206.988 1.00 68.15  0  82  PHE B CG  1 
ATOM   4390  C  CD1 . PHE B 1 82  ? 237.215 242.887 207.815 1.00 68.15  0  82  PHE B CD1 1 
ATOM   4391  C  CD2 . PHE B 1 82  ? 238.802 244.626 207.410 1.00 68.15  0  82  PHE B CD2 1 
ATOM   4392  C  CE1 . PHE B 1 82  ? 237.800 242.635 209.041 1.00 68.15  0  82  PHE B CE1 1 
ATOM   4393  C  CE2 . PHE B 1 82  ? 239.388 244.378 208.632 1.00 68.15  0  82  PHE B CE2 1 
ATOM   4394  C  CZ  . PHE B 1 82  ? 238.888 243.381 209.448 1.00 68.15  0  82  PHE B CZ  1 
ATOM   4395  N  N   . LEU B 1 83  ? 236.079 247.026 206.775 1.00 67.36  0  83  LEU B N   1 
ATOM   4396  C  CA  . LEU B 1 83  ? 236.041 247.992 207.869 1.00 67.36  0  83  LEU B CA  1 
ATOM   4397  C  C   . LEU B 1 83  ? 234.613 248.404 208.213 1.00 67.36  0  83  LEU B C   1 
ATOM   4398  O  O   . LEU B 1 83  ? 234.272 248.541 209.394 1.00 67.36  0  83  LEU B O   1 
ATOM   4399  C  CB  . LEU B 1 83  ? 236.889 249.212 207.517 1.00 67.36  0  83  LEU B CB  1 
ATOM   4400  C  CG  . LEU B 1 83  ? 238.391 249.033 207.739 1.00 67.36  0  83  LEU B CG  1 
ATOM   4401  C  CD1 . LEU B 1 83  ? 239.152 250.270 207.305 1.00 67.36  0  83  LEU B CD1 1 
ATOM   4402  C  CD2 . LEU B 1 83  ? 238.677 248.711 209.196 1.00 67.36  0  83  LEU B CD2 1 
ATOM   4403  N  N   . THR B 1 84  ? 233.762 248.607 207.204 1.00 72.06  0  84  THR B N   1 
ATOM   4404  C  CA  . THR B 1 84  ? 232.359 248.908 207.493 1.00 72.06  0  84  THR B CA  1 
ATOM   4405  C  C   . THR B 1 84  ? 231.600 247.692 208.013 1.00 72.06  0  84  THR B C   1 
ATOM   4406  O  O   . THR B 1 84  ? 230.641 247.850 208.776 1.00 72.06  0  84  THR B O   1 
ATOM   4407  C  CB  . THR B 1 84  ? 231.648 249.473 206.264 1.00 72.06  0  84  THR B CB  1 
ATOM   4408  O  OG1 . THR B 1 84  ? 231.503 248.449 205.270 1.00 72.06  0  84  THR B OG1 1 
ATOM   4409  C  CG2 . THR B 1 84  ? 232.383 250.670 205.707 1.00 72.06  0  84  THR B CG2 1 
ATOM   4410  N  N   . ALA B 1 85  ? 232.001 246.481 207.622 1.00 72.44  0  85  ALA B N   1 
ATOM   4411  C  CA  . ALA B 1 85  ? 231.420 245.290 208.227 1.00 72.44  0  85  ALA B CA  1 
ATOM   4412  C  C   . ALA B 1 85  ? 231.910 245.073 209.652 1.00 72.44  0  85  ALA B C   1 
ATOM   4413  O  O   . ALA B 1 85  ? 231.224 244.410 210.436 1.00 72.44  0  85  ALA B O   1 
ATOM   4414  C  CB  . ALA B 1 85  ? 231.731 244.060 207.374 1.00 72.44  0  85  ALA B CB  1 
ATOM   4415  N  N   . THR B 1 86  ? 233.082 245.609 209.996 1.00 71.07  0  86  THR B N   1 
ATOM   4416  C  CA  . THR B 1 86  ? 233.542 245.582 211.380 1.00 71.07  0  86  THR B CA  1 
ATOM   4417  C  C   . THR B 1 86  ? 232.710 246.506 212.258 1.00 71.07  0  86  THR B C   1 
ATOM   4418  O  O   . THR B 1 86  ? 232.227 246.101 213.322 1.00 71.07  0  86  THR B O   1 
ATOM   4419  C  CB  . THR B 1 86  ? 235.017 245.974 211.446 1.00 71.07  0  86  THR B CB  1 
ATOM   4420  O  OG1 . THR B 1 86  ? 235.757 245.234 210.465 1.00 71.07  0  86  THR B OG1 1 
ATOM   4421  C  CG2 . THR B 1 86  ? 235.576 245.702 212.824 1.00 71.07  0  86  THR B CG2 1 
ATOM   4422  N  N   . GLY B 1 87  ? 232.530 247.752 211.830 1.00 72.67  0  87  GLY B N   1 
ATOM   4423  C  CA  . GLY B 1 87  ? 231.735 248.698 212.586 1.00 72.67  0  87  GLY B CA  1 
ATOM   4424  C  C   . GLY B 1 87  ? 232.498 249.946 212.975 1.00 72.67  0  87  GLY B C   1 
ATOM   4425  O  O   . GLY B 1 87  ? 232.166 250.596 213.971 1.00 72.67  0  87  GLY B O   1 
ATOM   4426  N  N   . VAL B 1 88  ? 233.530 250.288 212.200 1.00 70.66  0  88  VAL B N   1 
ATOM   4427  C  CA  . VAL B 1 88  ? 234.288 251.501 212.480 1.00 70.66  0  88  VAL B CA  1 
ATOM   4428  C  C   . VAL B 1 88  ? 233.482 252.726 212.056 1.00 70.66  0  88  VAL B C   1 
ATOM   4429  O  O   . VAL B 1 88  ? 232.568 252.657 211.223 1.00 70.66  0  88  VAL B O   1 
ATOM   4430  C  CB  . VAL B 1 88  ? 235.663 251.469 211.792 1.00 70.66  0  88  VAL B CB  1 
ATOM   4431  C  CG1 . VAL B 1 88  ? 236.439 250.232 212.216 1.00 70.66  0  88  VAL B CG1 1 
ATOM   4432  C  CG2 . VAL B 1 88  ? 235.517 251.514 210.281 1.00 70.66  0  88  VAL B CG2 1 
ATOM   4433  N  N   . GLN B 1 89  ? 233.814 253.865 212.659 1.00 73.65  0  89  GLN B N   1 
ATOM   4434  C  CA  . GLN B 1 89  ? 233.114 255.111 212.375 1.00 73.65  0  89  GLN B CA  1 
ATOM   4435  C  C   . GLN B 1 89  ? 233.909 256.060 211.494 1.00 73.65  0  89  GLN B C   1 
ATOM   4436  O  O   . GLN B 1 89  ? 233.312 256.802 210.708 1.00 73.65  0  89  GLN B O   1 
ATOM   4437  C  CB  . GLN B 1 89  ? 232.756 255.825 213.683 1.00 73.65  0  89  GLN B CB  1 
ATOM   4438  C  CG  . GLN B 1 89  ? 232.039 254.945 214.692 1.00 73.65  0  89  GLN B CG  1 
ATOM   4439  C  CD  . GLN B 1 89  ? 230.746 254.371 214.152 1.00 73.65  0  89  GLN B CD  1 
ATOM   4440  O  OE1 . GLN B 1 89  ? 230.519 253.163 214.209 1.00 73.65  0  89  GLN B OE1 1 
ATOM   4441  N  NE2 . GLN B 1 89  ? 229.889 255.238 213.627 1.00 73.65  0  89  GLN B NE2 1 
ATOM   4442  N  N   . GLU B 1 90  ? 235.235 256.055 211.599 1.00 73.73  0  90  GLU B N   1 
ATOM   4443  C  CA  . GLU B 1 90  ? 236.070 256.917 210.777 1.00 73.73  0  90  GLU B CA  1 
ATOM   4444  C  C   . GLU B 1 90  ? 237.395 256.216 210.514 1.00 73.73  0  90  GLU B C   1 
ATOM   4445  O  O   . GLU B 1 90  ? 237.918 255.515 211.385 1.00 73.73  0  90  GLU B O   1 
ATOM   4446  C  CB  . GLU B 1 90  ? 236.274 258.290 211.440 1.00 73.73  0  90  GLU B CB  1 
ATOM   4447  C  CG  . GLU B 1 90  ? 236.971 258.268 212.790 1.00 73.73  0  90  GLU B CG  1 
ATOM   4448  C  CD  . GLU B 1 90  ? 237.054 259.649 213.426 1.00 73.73  0  90  GLU B CD  1 
ATOM   4449  O  OE1 . GLU B 1 90  ? 238.156 260.238 213.443 1.00 73.73  0  90  GLU B OE1 1 
ATOM   4450  O  OE2 . GLU B 1 90  ? 236.014 260.148 213.903 1.00 73.73  -1 90  GLU B OE2 1 
ATOM   4451  N  N   . THR B 1 91  ? 237.910 256.372 209.299 1.00 73.17  0  91  THR B N   1 
ATOM   4452  C  CA  . THR B 1 91  ? 239.184 255.785 208.914 1.00 73.17  0  91  THR B CA  1 
ATOM   4453  C  C   . THR B 1 91  ? 240.173 256.882 208.544 1.00 73.17  0  91  THR B C   1 
ATOM   4454  O  O   . THR B 1 91  ? 239.805 258.039 208.328 1.00 73.17  0  91  THR B O   1 
ATOM   4455  C  CB  . THR B 1 91  ? 239.026 254.812 207.737 1.00 73.17  0  91  THR B CB  1 
ATOM   4456  O  OG1 . THR B 1 91  ? 238.661 255.539 206.559 1.00 73.17  0  91  THR B OG1 1 
ATOM   4457  C  CG2 . THR B 1 91  ? 237.961 253.770 208.033 1.00 73.17  0  91  THR B CG2 1 
ATOM   4458  N  N   . PHE B 1 92  ? 241.445 256.497 208.468 1.00 74.02  0  92  PHE B N   1 
ATOM   4459  C  CA  . PHE B 1 92  ? 242.534 257.398 208.093 1.00 74.02  0  92  PHE B CA  1 
ATOM   4460  C  C   . PHE B 1 92  ? 243.389 256.690 207.048 1.00 74.02  0  92  PHE B C   1 
ATOM   4461  O  O   . PHE B 1 92  ? 244.265 255.892 207.393 1.00 74.02  0  92  PHE B O   1 
ATOM   4462  C  CB  . PHE B 1 92  ? 243.365 257.807 209.305 1.00 74.02  0  92  PHE B CB  1 
ATOM   4463  C  CG  . PHE B 1 92  ? 242.581 258.525 210.362 1.00 74.02  0  92  PHE B CG  1 
ATOM   4464  C  CD1 . PHE B 1 92  ? 242.259 259.864 210.210 1.00 74.02  0  92  PHE B CD1 1 
ATOM   4465  C  CD2 . PHE B 1 92  ? 242.175 257.867 211.512 1.00 74.02  0  92  PHE B CD2 1 
ATOM   4466  C  CE1 . PHE B 1 92  ? 241.540 260.533 211.182 1.00 74.02  0  92  PHE B CE1 1 
ATOM   4467  C  CE2 . PHE B 1 92  ? 241.454 258.530 212.488 1.00 74.02  0  92  PHE B CE2 1 
ATOM   4468  C  CZ  . PHE B 1 92  ? 241.138 259.864 212.321 1.00 74.02  0  92  PHE B CZ  1 
ATOM   4469  N  N   . VAL B 1 93  ? 243.136 256.978 205.778 1.00 76.76  0  93  VAL B N   1 
ATOM   4470  C  CA  . VAL B 1 93  ? 243.871 256.341 204.693 1.00 76.76  0  93  VAL B CA  1 
ATOM   4471  C  C   . VAL B 1 93  ? 245.189 257.076 204.490 1.00 76.76  0  93  VAL B C   1 
ATOM   4472  O  O   . VAL B 1 93  ? 245.216 258.305 204.360 1.00 76.76  0  93  VAL B O   1 
ATOM   4473  C  CB  . VAL B 1 93  ? 243.035 256.329 203.404 1.00 76.76  0  93  VAL B CB  1 
ATOM   4474  C  CG1 . VAL B 1 93  ? 243.677 255.428 202.365 1.00 76.76  0  93  VAL B CG1 1 
ATOM   4475  C  CG2 . VAL B 1 93  ? 241.614 255.879 203.702 1.00 76.76  0  93  VAL B CG2 1 
ATOM   4476  N  N   . PHE B 1 94  ? 246.286 256.323 204.462 1.00 79.78  0  94  PHE B N   1 
ATOM   4477  C  CA  . PHE B 1 94  ? 247.623 256.873 204.281 1.00 79.78  0  94  PHE B CA  1 
ATOM   4478  C  C   . PHE B 1 94  ? 248.226 256.286 203.015 1.00 79.78  0  94  PHE B C   1 
ATOM   4479  O  O   . PHE B 1 94  ? 248.403 255.067 202.917 1.00 79.78  0  94  PHE B O   1 
ATOM   4480  C  CB  . PHE B 1 94  ? 248.513 256.571 205.487 1.00 79.78  0  94  PHE B CB  1 
ATOM   4481  C  CG  . PHE B 1 94  ? 248.279 257.480 206.655 1.00 79.78  0  94  PHE B CG  1 
ATOM   4482  C  CD1 . PHE B 1 94  ? 247.246 257.235 207.545 1.00 79.78  0  94  PHE B CD1 1 
ATOM   4483  C  CD2 . PHE B 1 94  ? 249.099 258.578 206.868 1.00 79.78  0  94  PHE B CD2 1 
ATOM   4484  C  CE1 . PHE B 1 94  ? 247.031 258.071 208.626 1.00 79.78  0  94  PHE B CE1 1 
ATOM   4485  C  CE2 . PHE B 1 94  ? 248.890 259.418 207.946 1.00 79.78  0  94  PHE B CE2 1 
ATOM   4486  C  CZ  . PHE B 1 94  ? 247.855 259.163 208.825 1.00 79.78  0  94  PHE B CZ  1 
ATOM   4487  N  N   . CYS B 1 95  ? 248.545 257.150 202.055 1.00 86.01  0  95  CYS B N   1 
ATOM   4488  C  CA  . CYS B 1 95  ? 249.113 256.722 200.784 1.00 86.01  0  95  CYS B CA  1 
ATOM   4489  C  C   . CYS B 1 95  ? 250.167 257.721 200.335 1.00 86.01  0  95  CYS B C   1 
ATOM   4490  O  O   . CYS B 1 95  ? 249.926 258.932 200.356 1.00 86.01  0  95  CYS B O   1 
ATOM   4491  C  CB  . CYS B 1 95  ? 248.020 256.582 199.719 1.00 86.01  0  95  CYS B CB  1 
ATOM   4492  S  SG  . CYS B 1 95  ? 246.838 257.949 199.675 1.00 86.01  0  95  CYS B SG  1 
ATOM   4493  N  N   . CYS B 1 96  ? 251.336 257.215 199.941 1.00 91.85  0  96  CYS B N   1 
ATOM   4494  C  CA  . CYS B 1 96  ? 252.451 258.059 199.533 1.00 91.85  0  96  CYS B CA  1 
ATOM   4495  C  C   . CYS B 1 96  ? 252.742 257.949 198.041 1.00 91.85  0  96  CYS B C   1 
ATOM   4496  O  O   . CYS B 1 96  ? 252.753 258.963 197.338 1.00 91.85  0  96  CYS B O   1 
ATOM   4497  C  CB  . CYS B 1 96  ? 253.702 257.709 200.349 1.00 91.85  0  96  CYS B CB  1 
ATOM   4498  S  SG  . CYS B 1 96  ? 255.234 258.410 199.697 1.00 91.85  0  96  CYS B SG  1 
ATOM   4499  N  N   . TRP B 1 97  ? 252.976 256.741 197.533 1.00 89.91  0  97  TRP B N   1 
ATOM   4500  C  CA  . TRP B 1 97  ? 253.320 256.551 196.130 1.00 89.91  0  97  TRP B CA  1 
ATOM   4501  C  C   . TRP B 1 97  ? 252.052 256.440 195.296 1.00 89.91  0  97  TRP B C   1 
ATOM   4502  O  O   . TRP B 1 97  ? 251.181 255.615 195.598 1.00 89.91  0  97  TRP B O   1 
ATOM   4503  C  CB  . TRP B 1 97  ? 254.189 255.308 195.937 1.00 89.91  0  97  TRP B CB  1 
ATOM   4504  C  CG  . TRP B 1 97  ? 254.878 255.279 194.608 1.00 89.91  0  97  TRP B CG  1 
ATOM   4505  C  CD1 . TRP B 1 97  ? 255.185 256.352 193.823 1.00 89.91  0  97  TRP B CD1 1 
ATOM   4506  C  CD2 . TRP B 1 97  ? 255.348 254.122 193.908 1.00 89.91  0  97  TRP B CD2 1 
ATOM   4507  N  NE1 . TRP B 1 97  ? 255.816 255.934 192.676 1.00 89.91  0  97  TRP B NE1 1 
ATOM   4508  C  CE2 . TRP B 1 97  ? 255.928 254.569 192.704 1.00 89.91  0  97  TRP B CE2 1 
ATOM   4509  C  CE3 . TRP B 1 97  ? 255.334 252.751 194.182 1.00 89.91  0  97  TRP B CE3 1 
ATOM   4510  C  CZ2 . TRP B 1 97  ? 256.490 253.695 191.776 1.00 89.91  0  97  TRP B CZ2 1 
ATOM   4511  C  CZ3 . TRP B 1 97  ? 255.893 251.884 193.259 1.00 89.91  0  97  TRP B CZ3 1 
ATOM   4512  C  CH2 . TRP B 1 97  ? 256.462 252.360 192.071 1.00 89.91  0  97  TRP B CH2 1 
ATOM   4513  N  N   . LYS B 1 98  ? 251.976 257.263 194.241 1.00 85.47  0  98  LYS B N   1 
ATOM   4514  C  CA  . LYS B 1 98  ? 250.819 257.371 193.341 1.00 85.47  0  98  LYS B CA  1 
ATOM   4515  C  C   . LYS B 1 98  ? 249.535 257.663 194.113 1.00 85.47  0  98  LYS B C   1 
ATOM   4516  O  O   . LYS B 1 98  ? 248.482 257.075 193.857 1.00 85.47  0  98  LYS B O   1 
ATOM   4517  C  CB  . LYS B 1 98  ? 250.665 256.122 192.467 1.00 85.47  0  98  LYS B CB  1 
ATOM   4518  C  CG  . LYS B 1 98  ? 251.846 255.860 191.550 1.00 85.47  0  98  LYS B CG  1 
ATOM   4519  C  CD  . LYS B 1 98  ? 251.676 254.557 190.790 1.00 85.47  0  98  LYS B CD  1 
ATOM   4520  C  CE  . LYS B 1 98  ? 252.855 254.302 189.868 1.00 85.47  0  98  LYS B CE  1 
ATOM   4521  N  NZ  . LYS B 1 98  ? 252.962 255.344 188.810 1.00 85.47  1  98  LYS B NZ  1 
ATOM   4522  N  N   . ALA B 1 99  ? 249.632 258.585 195.074 1.00 83.85  0  99  ALA B N   1 
ATOM   4523  C  CA  . ALA B 1 99  ? 248.523 258.848 195.983 1.00 83.85  0  99  ALA B CA  1 
ATOM   4524  C  C   . ALA B 1 99  ? 247.385 259.596 195.306 1.00 83.85  0  99  ALA B C   1 
ATOM   4525  O  O   . ALA B 1 99  ? 246.239 259.493 195.757 1.00 83.85  0  99  ALA B O   1 
ATOM   4526  C  CB  . ALA B 1 99  ? 249.018 259.634 197.195 1.00 83.85  0  99  ALA B CB  1 
ATOM   4527  N  N   . ALA B 1 100 ? 247.676 260.335 194.233 1.00 84.63  0  100 ALA B N   1 
ATOM   4528  C  CA  . ALA B 1 100 ? 246.620 260.995 193.473 1.00 84.63  0  100 ALA B CA  1 
ATOM   4529  C  C   . ALA B 1 100 ? 245.751 259.974 192.750 1.00 84.63  0  100 ALA B C   1 
ATOM   4530  O  O   . ALA B 1 100 ? 244.533 260.155 192.639 1.00 84.63  0  100 ALA B O   1 
ATOM   4531  C  CB  . ALA B 1 100 ? 247.225 261.988 192.482 1.00 84.63  0  100 ALA B CB  1 
ATOM   4532  N  N   . GLN B 1 101 ? 246.362 258.885 192.274 1.00 86.40  0  101 GLN B N   1 
ATOM   4533  C  CA  . GLN B 1 101 ? 245.605 257.831 191.605 1.00 86.40  0  101 GLN B CA  1 
ATOM   4534  C  C   . GLN B 1 101 ? 244.719 257.077 192.590 1.00 86.40  0  101 GLN B C   1 
ATOM   4535  O  O   . GLN B 1 101 ? 243.566 256.758 192.273 1.00 86.40  0  101 GLN B O   1 
ATOM   4536  C  CB  . GLN B 1 101 ? 246.561 256.877 190.891 1.00 86.40  0  101 GLN B CB  1 
ATOM   4537  C  CG  . GLN B 1 101 ? 245.873 255.841 190.021 1.00 86.40  0  101 GLN B CG  1 
ATOM   4538  C  CD  . GLN B 1 101 ? 246.854 255.020 189.210 1.00 86.40  0  101 GLN B CD  1 
ATOM   4539  O  OE1 . GLN B 1 101 ? 248.068 255.148 189.370 1.00 86.40  0  101 GLN B OE1 1 
ATOM   4540  N  NE2 . GLN B 1 101 ? 246.333 254.171 188.332 1.00 86.40  0  101 GLN B NE2 1 
ATOM   4541  N  N   . ILE B 1 102 ? 245.229 256.810 193.796 1.00 82.42  0  102 ILE B N   1 
ATOM   4542  C  CA  . ILE B 1 102 ? 244.419 256.180 194.837 1.00 82.42  0  102 ILE B CA  1 
ATOM   4543  C  C   . ILE B 1 102 ? 243.290 257.110 195.268 1.00 82.42  0  102 ILE B C   1 
ATOM   4544  O  O   . ILE B 1 102 ? 242.161 256.664 195.519 1.00 82.42  0  102 ILE B O   1 
ATOM   4545  C  CB  . ILE B 1 102 ? 245.309 255.768 196.025 1.00 82.42  0  102 ILE B CB  1 
ATOM   4546  C  CG1 . ILE B 1 102 ? 246.517 254.974 195.529 1.00 82.42  0  102 ILE B CG1 1 
ATOM   4547  C  CG2 . ILE B 1 102 ? 244.522 254.952 197.041 1.00 82.42  0  102 ILE B CG2 1 
ATOM   4548  C  CD1 . ILE B 1 102 ? 247.487 254.579 196.618 1.00 82.42  0  102 ILE B CD1 1 
ATOM   4549  N  N   . LYS B 1 103 ? 243.569 258.416 195.328 1.00 84.39  0  103 LYS B N   1 
ATOM   4550  C  CA  . LYS B 1 103 ? 242.557 259.393 195.718 1.00 84.39  0  103 LYS B CA  1 
ATOM   4551  C  C   . LYS B 1 103 ? 241.440 259.480 194.683 1.00 84.39  0  103 LYS B C   1 
ATOM   4552  O  O   . LYS B 1 103 ? 240.256 259.453 195.035 1.00 84.39  0  103 LYS B O   1 
ATOM   4553  C  CB  . LYS B 1 103 ? 243.204 260.762 195.929 1.00 84.39  0  103 LYS B CB  1 
ATOM   4554  C  CG  . LYS B 1 103 ? 242.246 261.830 196.433 1.00 84.39  0  103 LYS B CG  1 
ATOM   4555  C  CD  . LYS B 1 103 ? 242.905 263.199 196.443 1.00 84.39  0  103 LYS B CD  1 
ATOM   4556  C  CE  . LYS B 1 103 ? 242.015 264.240 197.102 1.00 84.39  0  103 LYS B CE  1 
ATOM   4557  N  NZ  . LYS B 1 103 ? 241.839 263.986 198.558 1.00 84.39  1  103 LYS B NZ  1 
ATOM   4558  N  N   . GLU B 1 104 ? 241.795 259.553 193.395 1.00 86.47  0  104 GLU B N   1 
ATOM   4559  C  CA  . GLU B 1 104 ? 240.765 259.591 192.361 1.00 86.47  0  104 GLU B CA  1 
ATOM   4560  C  C   . GLU B 1 104 ? 240.087 258.240 192.177 1.00 86.47  0  104 GLU B C   1 
ATOM   4561  O  O   . GLU B 1 104 ? 238.991 258.186 191.609 1.00 86.47  0  104 GLU B O   1 
ATOM   4562  C  CB  . GLU B 1 104 ? 241.350 260.080 191.030 1.00 86.47  0  104 GLU B CB  1 
ATOM   4563  C  CG  . GLU B 1 104 ? 242.344 259.140 190.363 1.00 86.47  0  104 GLU B CG  1 
ATOM   4564  C  CD  . GLU B 1 104 ? 241.725 258.297 189.262 1.00 86.47  0  104 GLU B CD  1 
ATOM   4565  O  OE1 . GLU B 1 104 ? 240.637 258.663 188.770 1.00 86.47  0  104 GLU B OE1 1 
ATOM   4566  O  OE2 . GLU B 1 104 ? 242.325 257.265 188.894 1.00 86.47  -1 104 GLU B OE2 1 
ATOM   4567  N  N   . HIS B 1 105 ? 240.707 257.151 192.639 1.00 83.06  0  105 HIS B N   1 
ATOM   4568  C  CA  . HIS B 1 105 ? 240.015 255.870 192.625 1.00 83.06  0  105 HIS B CA  1 
ATOM   4569  C  C   . HIS B 1 105 ? 238.968 255.791 193.729 1.00 83.06  0  105 HIS B C   1 
ATOM   4570  O  O   . HIS B 1 105 ? 237.851 255.318 193.491 1.00 83.06  0  105 HIS B O   1 
ATOM   4571  C  CB  . HIS B 1 105 ? 241.012 254.722 192.768 1.00 83.06  0  105 HIS B CB  1 
ATOM   4572  C  CG  . HIS B 1 105 ? 240.370 253.410 193.094 1.00 83.06  0  105 HIS B CG  1 
ATOM   4573  N  ND1 . HIS B 1 105 ? 239.549 252.744 192.210 1.00 83.06  0  105 HIS B ND1 1 
ATOM   4574  C  CD2 . HIS B 1 105 ? 240.420 252.644 194.209 1.00 83.06  0  105 HIS B CD2 1 
ATOM   4575  C  CE1 . HIS B 1 105 ? 239.124 251.623 192.764 1.00 83.06  0  105 HIS B CE1 1 
ATOM   4576  N  NE2 . HIS B 1 105 ? 239.639 251.538 193.977 1.00 83.06  0  105 HIS B NE2 1 
ATOM   4577  N  N   . LEU B 1 106 ? 239.303 256.244 194.938 1.00 83.72  0  106 LEU B N   1 
ATOM   4578  C  CA  . LEU B 1 106 ? 238.387 256.057 196.056 1.00 83.72  0  106 LEU B CA  1 
ATOM   4579  C  C   . LEU B 1 106 ? 237.418 257.217 196.267 1.00 83.72  0  106 LEU B C   1 
ATOM   4580  O  O   . LEU B 1 106 ? 236.478 257.063 197.053 1.00 83.72  0  106 LEU B O   1 
ATOM   4581  C  CB  . LEU B 1 106 ? 239.166 255.776 197.355 1.00 83.72  0  106 LEU B CB  1 
ATOM   4582  C  CG  . LEU B 1 106 ? 240.033 256.801 198.093 1.00 83.72  0  106 LEU B CG  1 
ATOM   4583  C  CD1 . LEU B 1 106 ? 239.260 257.494 199.205 1.00 83.72  0  106 LEU B CD1 1 
ATOM   4584  C  CD2 . LEU B 1 106 ? 241.265 256.119 198.669 1.00 83.72  0  106 LEU B CD2 1 
ATOM   4585  N  N   . LEU B 1 107 ? 237.599 258.363 195.596 1.00 83.81  0  107 LEU B N   1 
ATOM   4586  C  CA  . LEU B 1 107 ? 236.593 259.419 195.715 1.00 83.81  0  107 LEU B CA  1 
ATOM   4587  C  C   . LEU B 1 107 ? 235.310 259.075 194.970 1.00 83.81  0  107 LEU B C   1 
ATOM   4588  O  O   . LEU B 1 107 ? 234.228 259.517 195.372 1.00 83.81  0  107 LEU B O   1 
ATOM   4589  C  CB  . LEU B 1 107 ? 237.137 260.761 195.218 1.00 83.81  0  107 LEU B CB  1 
ATOM   4590  C  CG  . LEU B 1 107 ? 238.050 261.572 196.141 1.00 83.81  0  107 LEU B CG  1 
ATOM   4591  C  CD1 . LEU B 1 107 ? 238.629 262.764 195.398 1.00 83.81  0  107 LEU B CD1 1 
ATOM   4592  C  CD2 . LEU B 1 107 ? 237.296 262.033 197.374 1.00 83.81  0  107 LEU B CD2 1 
ATOM   4593  N  N   . LYS B 1 108 ? 235.400 258.291 193.900 1.00 81.44  0  108 LYS B N   1 
ATOM   4594  C  CA  . LYS B 1 108 ? 234.222 257.866 193.158 1.00 81.44  0  108 LYS B CA  1 
ATOM   4595  C  C   . LYS B 1 108 ? 233.645 256.558 193.682 1.00 81.44  0  108 LYS B C   1 
ATOM   4596  O  O   . LYS B 1 108 ? 232.812 255.946 193.007 1.00 81.44  0  108 LYS B O   1 
ATOM   4597  C  CB  . LYS B 1 108 ? 234.555 257.731 191.670 1.00 81.44  0  108 LYS B CB  1 
ATOM   4598  C  CG  . LYS B 1 108 ? 235.659 256.732 191.367 1.00 81.44  0  108 LYS B CG  1 
ATOM   4599  C  CD  . LYS B 1 108 ? 235.953 256.671 189.878 1.00 81.44  0  108 LYS B CD  1 
ATOM   4600  C  CE  . LYS B 1 108 ? 236.451 258.008 189.357 1.00 81.44  0  108 LYS B CE  1 
ATOM   4601  N  NZ  . LYS B 1 108 ? 236.728 257.964 187.895 1.00 81.44  1  108 LYS B NZ  1 
ATOM   4602  N  N   . SER B 1 109 ? 234.063 256.123 194.866 1.00 80.18  0  109 SER B N   1 
ATOM   4603  C  CA  . SER B 1 109 ? 233.609 254.872 195.450 1.00 80.18  0  109 SER B CA  1 
ATOM   4604  C  C   . SER B 1 109 ? 232.393 255.121 196.342 1.00 80.18  0  109 SER B C   1 
ATOM   4605  O  O   . SER B 1 109 ? 231.867 256.233 196.425 1.00 80.18  0  109 SER B O   1 
ATOM   4606  C  CB  . SER B 1 109 ? 234.751 254.212 196.218 1.00 80.18  0  109 SER B CB  1 
ATOM   4607  O  OG  . SER B 1 109 ? 234.830 254.721 197.537 1.00 80.18  0  109 SER B OG  1 
ATOM   4608  N  N   . LYS B 1 110 ? 231.938 254.070 197.025 1.00 79.51  0  110 LYS B N   1 
ATOM   4609  C  CA  . LYS B 1 110 ? 230.786 254.166 197.913 1.00 79.51  0  110 LYS B CA  1 
ATOM   4610  C  C   . LYS B 1 110 ? 231.121 254.831 199.241 1.00 79.51  0  110 LYS B C   1 
ATOM   4611  O  O   . LYS B 1 110 ? 230.230 255.405 199.876 1.00 79.51  0  110 LYS B O   1 
ATOM   4612  C  CB  . LYS B 1 110 ? 230.214 252.768 198.168 1.00 79.51  0  110 LYS B CB  1 
ATOM   4613  C  CG  . LYS B 1 110 ? 228.768 252.742 198.642 1.00 79.51  0  110 LYS B CG  1 
ATOM   4614  C  CD  . LYS B 1 110 ? 228.342 251.333 199.024 1.00 79.51  0  110 LYS B CD  1 
ATOM   4615  C  CE  . LYS B 1 110 ? 229.207 250.775 200.142 1.00 79.51  0  110 LYS B CE  1 
ATOM   4616  N  NZ  . LYS B 1 110 ? 228.820 249.384 200.501 1.00 79.51  1  110 LYS B NZ  1 
ATOM   4617  N  N   . TRP B 1 111 ? 232.384 254.786 199.662 1.00 75.12  0  111 TRP B N   1 
ATOM   4618  C  CA  . TRP B 1 111 ? 232.755 255.219 201.002 1.00 75.12  0  111 TRP B CA  1 
ATOM   4619  C  C   . TRP B 1 111 ? 232.974 256.723 201.114 1.00 75.12  0  111 TRP B C   1 
ATOM   4620  O  O   . TRP B 1 111 ? 232.947 257.253 202.230 1.00 75.12  0  111 TRP B O   1 
ATOM   4621  C  CB  . TRP B 1 111 ? 234.004 254.462 201.455 1.00 75.12  0  111 TRP B CB  1 
ATOM   4622  C  CG  . TRP B 1 111 ? 233.758 252.989 201.585 1.00 75.12  0  111 TRP B CG  1 
ATOM   4623  C  CD1 . TRP B 1 111 ? 233.351 252.326 202.703 1.00 75.12  0  111 TRP B CD1 1 
ATOM   4624  C  CD2 . TRP B 1 111 ? 233.875 252.000 200.554 1.00 75.12  0  111 TRP B CD2 1 
ATOM   4625  N  NE1 . TRP B 1 111 ? 233.218 250.986 202.438 1.00 75.12  0  111 TRP B NE1 1 
ATOM   4626  C  CE2 . TRP B 1 111 ? 233.532 250.760 201.125 1.00 75.12  0  111 TRP B CE2 1 
ATOM   4627  C  CE3 . TRP B 1 111 ? 234.241 252.043 199.206 1.00 75.12  0  111 TRP B CE3 1 
ATOM   4628  C  CZ2 . TRP B 1 111 ? 233.547 249.573 200.397 1.00 75.12  0  111 TRP B CZ2 1 
ATOM   4629  C  CZ3 . TRP B 1 111 ? 234.254 250.864 198.484 1.00 75.12  0  111 TRP B CZ3 1 
ATOM   4630  C  CH2 . TRP B 1 111 ? 233.908 249.646 199.081 1.00 75.12  0  111 TRP B CH2 1 
ATOM   4631  N  N   . CYS B 1 112 ? 233.185 257.421 200.002 1.00 81.00  0  112 CYS B N   1 
ATOM   4632  C  CA  . CYS B 1 112 ? 233.291 258.875 200.020 1.00 81.00  0  112 CYS B CA  1 
ATOM   4633  C  C   . CYS B 1 112 ? 231.950 259.576 199.854 1.00 81.00  0  112 CYS B C   1 
ATOM   4634  O  O   . CYS B 1 112 ? 231.917 260.808 199.784 1.00 81.00  0  112 CYS B O   1 
ATOM   4635  C  CB  . CYS B 1 112 ? 234.256 259.357 198.934 1.00 81.00  0  112 CYS B CB  1 
ATOM   4636  S  SG  . CYS B 1 112 ? 235.991 259.233 199.396 1.00 81.00  0  112 CYS B SG  1 
ATOM   4637  N  N   . ARG B 1 113 ? 230.857 258.831 199.783 1.00 82.32  0  113 ARG B N   1 
ATOM   4638  C  CA  . ARG B 1 113 ? 229.544 259.439 199.678 1.00 82.32  0  113 ARG B CA  1 
ATOM   4639  C  C   . ARG B 1 113 ? 229.114 259.999 201.033 1.00 82.32  0  113 ARG B C   1 
ATOM   4640  O  O   . ARG B 1 113 ? 229.519 259.483 202.079 1.00 82.32  0  113 ARG B O   1 
ATOM   4641  C  CB  . ARG B 1 113 ? 228.529 258.412 199.187 1.00 82.32  0  113 ARG B CB  1 
ATOM   4642  C  CG  . ARG B 1 113 ? 228.900 257.792 197.854 1.00 82.32  0  113 ARG B CG  1 
ATOM   4643  C  CD  . ARG B 1 113 ? 227.945 256.680 197.469 1.00 82.32  0  113 ARG B CD  1 
ATOM   4644  N  NE  . ARG B 1 113 ? 228.329 256.060 196.206 1.00 82.32  0  113 ARG B NE  1 
ATOM   4645  C  CZ  . ARG B 1 113 ? 227.679 255.046 195.645 1.00 82.32  0  113 ARG B CZ  1 
ATOM   4646  N  NH1 . ARG B 1 113 ? 226.608 254.536 196.238 1.00 82.32  1  113 ARG B NH1 1 
ATOM   4647  N  NH2 . ARG B 1 113 ? 228.099 254.544 194.492 1.00 82.32  0  113 ARG B NH2 1 
ATOM   4648  N  N   . PRO B 1 114 ? 228.305 261.067 201.045 1.00 87.16  0  114 PRO B N   1 
ATOM   4649  C  CA  . PRO B 1 114 ? 227.830 261.606 202.331 1.00 87.16  0  114 PRO B CA  1 
ATOM   4650  C  C   . PRO B 1 114 ? 226.847 260.702 203.054 1.00 87.16  0  114 PRO B C   1 
ATOM   4651  O  O   . PRO B 1 114 ? 226.651 260.875 204.263 1.00 87.16  0  114 PRO B O   1 
ATOM   4652  C  CB  . PRO B 1 114 ? 227.174 262.936 201.936 1.00 87.16  0  114 PRO B CB  1 
ATOM   4653  C  CG  . PRO B 1 114 ? 226.827 262.774 200.495 1.00 87.16  0  114 PRO B CG  1 
ATOM   4654  C  CD  . PRO B 1 114 ? 227.921 261.933 199.916 1.00 87.16  0  114 PRO B CD  1 
ATOM   4655  N  N   . THR B 1 115 ? 226.227 259.745 202.365 1.00 87.41  0  115 THR B N   1 
ATOM   4656  C  CA  . THR B 1 115 ? 225.329 258.797 203.009 1.00 87.41  0  115 THR B CA  1 
ATOM   4657  C  C   . THR B 1 115 ? 226.061 257.609 203.618 1.00 87.41  0  115 THR B C   1 
ATOM   4658  O  O   . THR B 1 115 ? 225.411 256.740 204.211 1.00 87.41  0  115 THR B O   1 
ATOM   4659  C  CB  . THR B 1 115 ? 224.284 258.294 202.010 1.00 87.41  0  115 THR B CB  1 
ATOM   4660  O  OG1 . THR B 1 115 ? 223.359 257.430 202.679 1.00 87.41  0  115 THR B OG1 1 
ATOM   4661  C  CG2 . THR B 1 115 ? 224.956 257.530 200.880 1.00 87.41  0  115 THR B CG2 1 
ATOM   4662  N  N   . SER B 1 116 ? 227.383 257.546 203.484 1.00 82.55  0  116 SER B N   1 
ATOM   4663  C  CA  . SER B 1 116 ? 228.148 256.457 204.072 1.00 82.55  0  116 SER B CA  1 
ATOM   4664  C  C   . SER B 1 116 ? 228.270 256.640 205.579 1.00 82.55  0  116 SER B C   1 
ATOM   4665  O  O   . SER B 1 116 ? 228.550 257.738 206.068 1.00 82.55  0  116 SER B O   1 
ATOM   4666  C  CB  . SER B 1 116 ? 229.537 256.380 203.438 1.00 82.55  0  116 SER B CB  1 
ATOM   4667  O  OG  . SER B 1 116 ? 230.452 255.720 204.295 1.00 82.55  0  116 SER B OG  1 
ATOM   4668  N  N   . LEU B 1 117 ? 228.057 255.551 206.318 1.00 79.41  0  117 LEU B N   1 
ATOM   4669  C  CA  . LEU B 1 117 ? 228.143 255.599 207.772 1.00 79.41  0  117 LEU B CA  1 
ATOM   4670  C  C   . LEU B 1 117 ? 229.580 255.665 208.267 1.00 79.41  0  117 LEU B C   1 
ATOM   4671  O  O   . LEU B 1 117 ? 229.814 256.129 209.388 1.00 79.41  0  117 LEU B O   1 
ATOM   4672  C  CB  . LEU B 1 117 ? 227.442 254.387 208.403 1.00 79.41  0  117 LEU B CB  1 
ATOM   4673  C  CG  . LEU B 1 117 ? 228.096 252.996 208.458 1.00 79.41  0  117 LEU B CG  1 
ATOM   4674  C  CD1 . LEU B 1 117 ? 227.292 252.095 209.382 1.00 79.41  0  117 LEU B CD1 1 
ATOM   4675  C  CD2 . LEU B 1 117 ? 228.246 252.327 207.095 1.00 79.41  0  117 LEU B CD2 1 
ATOM   4676  N  N   . ASN B 1 118 ? 230.539 255.212 207.466 1.00 76.11  0  118 ASN B N   1 
ATOM   4677  C  CA  . ASN B 1 118 ? 231.954 255.210 207.825 1.00 76.11  0  118 ASN B CA  1 
ATOM   4678  C  C   . ASN B 1 118 ? 232.661 256.216 206.922 1.00 76.11  0  118 ASN B C   1 
ATOM   4679  O  O   . ASN B 1 118 ? 232.893 255.946 205.740 1.00 76.11  0  118 ASN B O   1 
ATOM   4680  C  CB  . ASN B 1 118 ? 232.546 253.812 207.684 1.00 76.11  0  118 ASN B CB  1 
ATOM   4681  C  CG  . ASN B 1 118 ? 234.040 253.781 207.928 1.00 76.11  0  118 ASN B CG  1 
ATOM   4682  O  OD1 . ASN B 1 118 ? 234.562 254.513 208.769 1.00 76.11  0  118 ASN B OD1 1 
ATOM   4683  N  ND2 . ASN B 1 118 ? 234.740 252.927 207.190 1.00 76.11  0  118 ASN B ND2 1 
ATOM   4684  N  N   . VAL B 1 119 ? 233.004 257.374 207.482 1.00 76.02  0  119 VAL B N   1 
ATOM   4685  C  CA  . VAL B 1 119 ? 233.695 258.398 206.711 1.00 76.02  0  119 VAL B CA  1 
ATOM   4686  C  C   . VAL B 1 119 ? 235.179 258.061 206.608 1.00 76.02  0  119 VAL B C   1 
ATOM   4687  O  O   . VAL B 1 119 ? 235.729 257.279 207.388 1.00 76.02  0  119 VAL B O   1 
ATOM   4688  C  CB  . VAL B 1 119 ? 233.476 259.794 207.324 1.00 76.02  0  119 VAL B CB  1 
ATOM   4689  C  CG1 . VAL B 1 119 ? 231.990 260.066 207.499 1.00 76.02  0  119 VAL B CG1 1 
ATOM   4690  C  CG2 . VAL B 1 119 ? 234.201 259.919 208.656 1.00 76.02  0  119 VAL B CG2 1 
ATOM   4691  N  N   . VAL B 1 120 ? 235.830 258.649 205.608 1.00 75.43  0  120 VAL B N   1 
ATOM   4692  C  CA  . VAL B 1 120 ? 237.249 258.438 205.364 1.00 75.43  0  120 VAL B CA  1 
ATOM   4693  C  C   . VAL B 1 120 ? 237.967 259.776 205.471 1.00 75.43  0  120 VAL B C   1 
ATOM   4694  O  O   . VAL B 1 120 ? 237.370 260.843 205.287 1.00 75.43  0  120 VAL B O   1 
ATOM   4695  C  CB  . VAL B 1 120 ? 237.510 257.782 203.989 1.00 75.43  0  120 VAL B CB  1 
ATOM   4696  C  CG1 . VAL B 1 120 ? 236.865 256.407 203.918 1.00 75.43  0  120 VAL B CG1 1 
ATOM   4697  C  CG2 . VAL B 1 120 ? 236.994 258.661 202.869 1.00 75.43  0  120 VAL B CG2 1 
ATOM   4698  N  N   . ARG B 1 121 ? 239.258 259.715 205.794 1.00 79.47  0  121 ARG B N   1 
ATOM   4699  C  CA  . ARG B 1 121 ? 240.119 260.895 205.871 1.00 79.47  0  121 ARG B CA  1 
ATOM   4700  C  C   . ARG B 1 121 ? 241.339 260.632 204.996 1.00 79.47  0  121 ARG B C   1 
ATOM   4701  O  O   . ARG B 1 121 ? 242.252 259.904 205.397 1.00 79.47  0  121 ARG B O   1 
ATOM   4702  C  CB  . ARG B 1 121 ? 240.530 261.204 207.309 1.00 79.47  0  121 ARG B CB  1 
ATOM   4703  C  CG  . ARG B 1 121 ? 239.381 261.336 208.296 1.00 79.47  0  121 ARG B CG  1 
ATOM   4704  C  CD  . ARG B 1 121 ? 238.465 262.489 207.934 1.00 79.47  0  121 ARG B CD  1 
ATOM   4705  N  NE  . ARG B 1 121 ? 237.281 262.527 208.786 1.00 79.47  0  121 ARG B NE  1 
ATOM   4706  C  CZ  . ARG B 1 121 ? 236.214 263.282 208.548 1.00 79.47  0  121 ARG B CZ  1 
ATOM   4707  N  NH1 . ARG B 1 121 ? 236.178 264.064 207.478 1.00 79.47  1  121 ARG B NH1 1 
ATOM   4708  N  NH2 . ARG B 1 121 ? 235.181 263.253 209.379 1.00 79.47  0  121 ARG B NH2 1 
ATOM   4709  N  N   . ILE B 1 122 ? 241.357 261.220 203.805 1.00 82.67  0  122 ILE B N   1 
ATOM   4710  C  CA  . ILE B 1 122 ? 242.480 261.054 202.889 1.00 82.67  0  122 ILE B CA  1 
ATOM   4711  C  C   . ILE B 1 122 ? 243.613 261.965 203.343 1.00 82.67  0  122 ILE B C   1 
ATOM   4712  O  O   . ILE B 1 122 ? 243.456 263.190 203.396 1.00 82.67  0  122 ILE B O   1 
ATOM   4713  C  CB  . ILE B 1 122 ? 242.070 261.368 201.445 1.00 82.67  0  122 ILE B CB  1 
ATOM   4714  C  CG1 . ILE B 1 122 ? 240.742 260.692 201.105 1.00 82.67  0  122 ILE B CG1 1 
ATOM   4715  C  CG2 . ILE B 1 122 ? 243.156 260.921 200.479 1.00 82.67  0  122 ILE B CG2 1 
ATOM   4716  C  CD1 . ILE B 1 122 ? 240.193 261.093 199.754 1.00 82.67  0  122 ILE B CD1 1 
ATOM   4717  N  N   . ILE B 1 123 ? 244.757 261.371 203.670 1.00 85.40  0  123 ILE B N   1 
ATOM   4718  C  CA  . ILE B 1 123 ? 245.936 262.107 204.110 1.00 85.40  0  123 ILE B CA  1 
ATOM   4719  C  C   . ILE B 1 123 ? 247.056 261.828 203.120 1.00 85.40  0  123 ILE B C   1 
ATOM   4720  O  O   . ILE B 1 123 ? 247.473 260.675 202.953 1.00 85.40  0  123 ILE B O   1 
ATOM   4721  C  CB  . ILE B 1 123 ? 246.346 261.725 205.540 1.00 85.40  0  123 ILE B CB  1 
ATOM   4722  C  CG1 . ILE B 1 123 ? 245.266 262.171 206.527 1.00 85.40  0  123 ILE B CG1 1 
ATOM   4723  C  CG2 . ILE B 1 123 ? 247.692 262.341 205.891 1.00 85.40  0  123 ILE B CG2 1 
ATOM   4724  C  CD1 . ILE B 1 123 ? 245.576 261.860 207.968 1.00 85.40  0  123 ILE B CD1 1 
ATOM   4725  N  N   . THR B 1 124 ? 247.541 262.881 202.466 1.00 95.71  0  124 THR B N   1 
ATOM   4726  C  CA  . THR B 1 124 ? 248.510 262.764 201.383 1.00 95.71  0  124 THR B CA  1 
ATOM   4727  C  C   . THR B 1 124 ? 249.788 263.494 201.764 1.00 95.71  0  124 THR B C   1 
ATOM   4728  O  O   . THR B 1 124 ? 249.755 264.695 202.057 1.00 95.71  0  124 THR B O   1 
ATOM   4729  C  CB  . THR B 1 124 ? 247.944 263.337 200.082 1.00 95.71  0  124 THR B CB  1 
ATOM   4730  O  OG1 . THR B 1 124 ? 246.608 262.858 199.882 1.00 95.71  0  124 THR B OG1 1 
ATOM   4731  C  CG2 . THR B 1 124 ? 248.813 262.946 198.901 1.00 95.71  0  124 THR B CG2 1 
ATOM   4732  N  N   . SER B 1 125 ? 250.907 262.771 201.752 1.00 94.84  0  125 SER B N   1 
ATOM   4733  C  CA  . SER B 1 125 ? 252.222 263.359 201.962 1.00 94.84  0  125 SER B CA  1 
ATOM   4734  C  C   . SER B 1 125 ? 253.268 262.420 201.380 1.00 94.84  0  125 SER B C   1 
ATOM   4735  O  O   . SER B 1 125 ? 253.202 261.207 201.587 1.00 94.84  0  125 SER B O   1 
ATOM   4736  C  CB  . SER B 1 125 ? 252.507 263.616 203.447 1.00 94.84  0  125 SER B CB  1 
ATOM   4737  O  OG  . SER B 1 125 ? 253.900 263.690 203.692 1.00 94.84  0  125 SER B OG  1 
ATOM   4738  N  N   . GLU B 1 126 ? 254.224 262.988 200.651 1.00 93.53  0  126 GLU B N   1 
ATOM   4739  C  CA  . GLU B 1 126 ? 255.307 262.222 200.052 1.00 93.53  0  126 GLU B CA  1 
ATOM   4740  C  C   . GLU B 1 126 ? 256.524 262.116 200.962 1.00 93.53  0  126 GLU B C   1 
ATOM   4741  O  O   . GLU B 1 126 ? 257.578 261.650 200.518 1.00 93.53  0  126 GLU B O   1 
ATOM   4742  C  CB  . GLU B 1 126 ? 255.712 262.842 198.712 1.00 93.53  0  126 GLU B CB  1 
ATOM   4743  N  N   . LEU B 1 127 ? 256.401 262.535 202.223 1.00 92.17  0  127 LEU B N   1 
ATOM   4744  C  CA  . LEU B 1 127 ? 257.542 262.520 203.131 1.00 92.17  0  127 LEU B CA  1 
ATOM   4745  C  C   . LEU B 1 127 ? 257.743 261.153 203.774 1.00 92.17  0  127 LEU B C   1 
ATOM   4746  O  O   . LEU B 1 127 ? 258.883 260.694 203.908 1.00 92.17  0  127 LEU B O   1 
ATOM   4747  C  CB  . LEU B 1 127 ? 257.366 263.592 204.207 1.00 92.17  0  127 LEU B CB  1 
ATOM   4748  N  N   . TYR B 1 128 ? 256.663 260.491 204.180 1.00 90.06  0  128 TYR B N   1 
ATOM   4749  C  CA  . TYR B 1 128 ? 256.796 259.227 204.886 1.00 90.06  0  128 TYR B CA  1 
ATOM   4750  C  C   . TYR B 1 128 ? 256.994 258.071 203.913 1.00 90.06  0  128 TYR B C   1 
ATOM   4751  O  O   . TYR B 1 128 ? 256.456 258.062 202.801 1.00 90.06  0  128 TYR B O   1 
ATOM   4752  C  CB  . TYR B 1 128 ? 255.577 258.969 205.780 1.00 90.06  0  128 TYR B CB  1 
ATOM   4753  C  CG  . TYR B 1 128 ? 254.222 259.007 205.101 1.00 90.06  0  128 TYR B CG  1 
ATOM   4754  C  CD1 . TYR B 1 128 ? 253.463 260.171 205.094 1.00 90.06  0  128 TYR B CD1 1 
ATOM   4755  C  CD2 . TYR B 1 128 ? 253.683 257.868 204.511 1.00 90.06  0  128 TYR B CD2 1 
ATOM   4756  C  CE1 . TYR B 1 128 ? 252.217 260.206 204.491 1.00 90.06  0  128 TYR B CE1 1 
ATOM   4757  C  CE2 . TYR B 1 128 ? 252.442 257.897 203.902 1.00 90.06  0  128 TYR B CE2 1 
ATOM   4758  C  CZ  . TYR B 1 128 ? 251.714 259.069 203.896 1.00 90.06  0  128 TYR B CZ  1 
ATOM   4759  O  OH  . TYR B 1 128 ? 250.477 259.101 203.295 1.00 90.06  0  128 TYR B OH  1 
ATOM   4760  N  N   . ARG B 1 129 ? 257.784 257.083 204.348 1.00 89.97  0  129 ARG B N   1 
ATOM   4761  C  CA  . ARG B 1 129 ? 258.030 255.886 203.554 1.00 89.97  0  129 ARG B CA  1 
ATOM   4762  C  C   . ARG B 1 129 ? 258.072 254.633 204.422 1.00 89.97  0  129 ARG B C   1 
ATOM   4763  O  O   . ARG B 1 129 ? 258.754 253.661 204.078 1.00 89.97  0  129 ARG B O   1 
ATOM   4764  C  CB  . ARG B 1 129 ? 259.332 256.013 202.760 1.00 89.97  0  129 ARG B CB  1 
ATOM   4765  N  N   . SER B 1 130 ? 257.353 254.636 205.543 1.00 90.32  0  130 SER B N   1 
ATOM   4766  C  CA  . SER B 1 130 ? 257.347 253.499 206.453 1.00 90.32  0  130 SER B CA  1 
ATOM   4767  C  C   . SER B 1 130 ? 256.073 253.543 207.282 1.00 90.32  0  130 SER B C   1 
ATOM   4768  O  O   . SER B 1 130 ? 255.446 254.595 207.429 1.00 90.32  0  130 SER B O   1 
ATOM   4769  C  CB  . SER B 1 130 ? 258.580 253.498 207.359 1.00 90.32  0  130 SER B CB  1 
ATOM   4770  O  OG  . SER B 1 130 ? 258.599 252.352 208.189 1.00 90.32  0  130 SER B OG  1 
ATOM   4771  N  N   . LEU B 1 131 ? 255.694 252.379 207.822 1.00 85.47  0  131 LEU B N   1 
ATOM   4772  C  CA  . LEU B 1 131 ? 254.513 252.308 208.680 1.00 85.47  0  131 LEU B CA  1 
ATOM   4773  C  C   . LEU B 1 131 ? 254.750 253.010 210.010 1.00 85.47  0  131 LEU B C   1 
ATOM   4774  O  O   . LEU B 1 131 ? 253.818 253.595 210.577 1.00 85.47  0  131 LEU B O   1 
ATOM   4775  C  CB  . LEU B 1 131 ? 254.106 250.847 208.896 1.00 85.47  0  131 LEU B CB  1 
ATOM   4776  C  CG  . LEU B 1 131 ? 252.815 250.506 209.656 1.00 85.47  0  131 LEU B CG  1 
ATOM   4777  C  CD1 . LEU B 1 131 ? 252.151 249.309 209.016 1.00 85.47  0  131 LEU B CD1 1 
ATOM   4778  C  CD2 . LEU B 1 131 ? 253.070 250.198 211.127 1.00 85.47  0  131 LEU B CD2 1 
ATOM   4779  N  N   . GLY B 1 132 ? 255.980 252.949 210.528 1.00 90.23  0  132 GLY B N   1 
ATOM   4780  C  CA  . GLY B 1 132 ? 256.308 253.698 211.728 1.00 90.23  0  132 GLY B CA  1 
ATOM   4781  C  C   . GLY B 1 132 ? 256.257 255.193 211.511 1.00 90.23  0  132 GLY B C   1 
ATOM   4782  O  O   . GLY B 1 132 ? 255.877 255.941 212.415 1.00 90.23  0  132 GLY B O   1 
ATOM   4783  N  N   . ASP B 1 133 ? 256.613 255.644 210.306 1.00 90.82  0  133 ASP B N   1 
ATOM   4784  C  CA  . ASP B 1 133 ? 256.457 257.051 209.961 1.00 90.82  0  133 ASP B CA  1 
ATOM   4785  C  C   . ASP B 1 133 ? 254.985 257.440 209.892 1.00 90.82  0  133 ASP B C   1 
ATOM   4786  O  O   . ASP B 1 133 ? 254.612 258.542 210.310 1.00 90.82  0  133 ASP B O   1 
ATOM   4787  C  CB  . ASP B 1 133 ? 257.163 257.341 208.639 1.00 90.82  0  133 ASP B CB  1 
ATOM   4788  C  CG  . ASP B 1 133 ? 258.665 257.164 208.729 1.00 90.82  0  133 ASP B CG  1 
ATOM   4789  O  OD1 . ASP B 1 133 ? 259.227 257.391 209.820 1.00 90.82  0  133 ASP B OD1 1 
ATOM   4790  O  OD2 . ASP B 1 133 ? 259.284 256.797 207.708 1.00 90.82  -1 133 ASP B OD2 1 
ATOM   4791  N  N   . VAL B 1 134 ? 254.134 256.530 209.404 1.00 85.67  0  134 VAL B N   1 
ATOM   4792  C  CA  . VAL B 1 134 ? 252.688 256.756 209.394 1.00 85.67  0  134 VAL B CA  1 
ATOM   4793  C  C   . VAL B 1 134 ? 252.155 256.892 210.818 1.00 85.67  0  134 VAL B C   1 
ATOM   4794  O  O   . VAL B 1 134 ? 251.393 257.817 211.130 1.00 85.67  0  134 VAL B O   1 
ATOM   4795  C  CB  . VAL B 1 134 ? 251.977 255.622 208.630 1.00 85.67  0  134 VAL B CB  1 
ATOM   4796  C  CG1 . VAL B 1 134 ? 250.472 255.713 208.797 1.00 85.67  0  134 VAL B CG1 1 
ATOM   4797  C  CG2 . VAL B 1 134 ? 252.336 255.676 207.156 1.00 85.67  0  134 VAL B CG2 1 
ATOM   4798  N  N   . LEU B 1 135 ? 252.583 255.998 211.712 1.00 88.49  0  135 LEU B N   1 
ATOM   4799  C  CA  . LEU B 1 135 ? 252.087 256.043 213.084 1.00 88.49  0  135 LEU B CA  1 
ATOM   4800  C  C   . LEU B 1 135 ? 252.641 257.237 213.858 1.00 88.49  0  135 LEU B C   1 
ATOM   4801  O  O   . LEU B 1 135 ? 251.949 257.784 214.726 1.00 88.49  0  135 LEU B O   1 
ATOM   4802  C  CB  . LEU B 1 135 ? 252.402 254.730 213.798 1.00 88.49  0  135 LEU B CB  1 
ATOM   4803  C  CG  . LEU B 1 135 ? 251.452 253.595 213.401 1.00 88.49  0  135 LEU B CG  1 
ATOM   4804  C  CD1 . LEU B 1 135 ? 251.815 252.297 214.091 1.00 88.49  0  135 LEU B CD1 1 
ATOM   4805  C  CD2 . LEU B 1 135 ? 250.008 253.971 213.700 1.00 88.49  0  135 LEU B CD2 1 
ATOM   4806  N  N   . ARG B 1 136 ? 253.854 257.694 213.537 1.00 91.79  0  136 ARG B N   1 
ATOM   4807  C  CA  . ARG B 1 136 ? 254.344 258.889 214.215 1.00 91.79  0  136 ARG B CA  1 
ATOM   4808  C  C   . ARG B 1 136 ? 253.721 260.160 213.646 1.00 91.79  0  136 ARG B C   1 
ATOM   4809  O  O   . ARG B 1 136 ? 253.582 261.143 214.378 1.00 91.79  0  136 ARG B O   1 
ATOM   4810  C  CB  . ARG B 1 136 ? 255.875 258.950 214.187 1.00 91.79  0  136 ARG B CB  1 
ATOM   4811  C  CG  . ARG B 1 136 ? 256.517 259.305 212.869 1.00 91.79  0  136 ARG B CG  1 
ATOM   4812  C  CD  . ARG B 1 136 ? 258.033 259.248 212.986 1.00 91.79  0  136 ARG B CD  1 
ATOM   4813  N  NE  . ARG B 1 136 ? 258.472 258.179 213.882 1.00 91.79  0  136 ARG B NE  1 
ATOM   4814  C  CZ  . ARG B 1 136 ? 258.964 257.012 213.477 1.00 91.79  0  136 ARG B CZ  1 
ATOM   4815  N  NH1 . ARG B 1 136 ? 259.087 256.752 212.184 1.00 91.79  1  136 ARG B NH1 1 
ATOM   4816  N  NH2 . ARG B 1 136 ? 259.336 256.104 214.369 1.00 91.79  0  136 ARG B NH2 1 
ATOM   4817  N  N   . ASP B 1 137 ? 253.292 260.160 212.377 1.00 91.03  0  137 ASP B N   1 
ATOM   4818  C  CA  . ASP B 1 137 ? 252.463 261.272 211.910 1.00 91.03  0  137 ASP B CA  1 
ATOM   4819  C  C   . ASP B 1 137 ? 251.070 261.236 212.528 1.00 91.03  0  137 ASP B C   1 
ATOM   4820  O  O   . ASP B 1 137 ? 250.454 262.292 212.718 1.00 91.03  0  137 ASP B O   1 
ATOM   4821  C  CB  . ASP B 1 137 ? 252.353 261.285 210.384 1.00 91.03  0  137 ASP B CB  1 
ATOM   4822  C  CG  . ASP B 1 137 ? 253.697 261.403 209.701 1.00 91.03  0  137 ASP B CG  1 
ATOM   4823  O  OD1 . ASP B 1 137 ? 253.856 260.828 208.602 1.00 91.03  0  137 ASP B OD1 1 
ATOM   4824  O  OD2 . ASP B 1 137 ? 254.594 262.062 210.261 1.00 91.03  -1 137 ASP B OD2 1 
ATOM   4825  N  N   . VAL B 1 138 ? 250.558 260.040 212.837 1.00 89.79  0  138 VAL B N   1 
ATOM   4826  C  CA  . VAL B 1 138 ? 249.302 259.928 213.582 1.00 89.79  0  138 VAL B CA  1 
ATOM   4827  C  C   . VAL B 1 138 ? 249.461 260.508 214.985 1.00 89.79  0  138 VAL B C   1 
ATOM   4828  O  O   . VAL B 1 138 ? 248.596 261.251 215.470 1.00 89.79  0  138 VAL B O   1 
ATOM   4829  C  CB  . VAL B 1 138 ? 248.834 258.457 213.614 1.00 89.79  0  138 VAL B CB  1 
ATOM   4830  C  CG1 . VAL B 1 138 ? 247.760 258.230 214.671 1.00 89.79  0  138 VAL B CG1 1 
ATOM   4831  C  CG2 . VAL B 1 138 ? 248.300 258.047 212.256 1.00 89.79  0  138 VAL B CG2 1 
ATOM   4832  N  N   . ASP B 1 139 ? 250.585 260.206 215.641 1.00 94.94  0  139 ASP B N   1 
ATOM   4833  C  CA  . ASP B 1 139 ? 250.857 260.764 216.965 1.00 94.94  0  139 ASP B CA  1 
ATOM   4834  C  C   . ASP B 1 139 ? 251.093 262.271 216.913 1.00 94.94  0  139 ASP B C   1 
ATOM   4835  O  O   . ASP B 1 139 ? 250.714 262.994 217.842 1.00 94.94  0  139 ASP B O   1 
ATOM   4836  C  CB  . ASP B 1 139 ? 252.062 260.066 217.590 1.00 94.94  0  139 ASP B CB  1 
ATOM   4837  C  CG  . ASP B 1 139 ? 252.140 260.272 219.087 1.00 94.94  0  139 ASP B CG  1 
ATOM   4838  O  OD1 . ASP B 1 139 ? 251.315 259.679 219.812 1.00 94.94  0  139 ASP B OD1 1 
ATOM   4839  O  OD2 . ASP B 1 139 ? 253.026 261.027 219.541 1.00 94.94  -1 139 ASP B OD2 1 
ATOM   4840  N  N   . ALA B 1 140 ? 251.722 262.763 215.842 1.00 92.79  0  140 ALA B N   1 
ATOM   4841  C  CA  . ALA B 1 140 ? 251.954 264.198 215.712 1.00 92.79  0  140 ALA B CA  1 
ATOM   4842  C  C   . ALA B 1 140 ? 250.673 264.954 215.388 1.00 92.79  0  140 ALA B C   1 
ATOM   4843  O  O   . ALA B 1 140 ? 250.523 266.113 215.789 1.00 92.79  0  140 ALA B O   1 
ATOM   4844  C  CB  . ALA B 1 140 ? 253.011 264.463 214.640 1.00 92.79  0  140 ALA B CB  1 
ATOM   4845  N  N   . LYS B 1 141 ? 249.745 264.325 214.669 1.00 92.21  0  141 LYS B N   1 
ATOM   4846  C  CA  . LYS B 1 141 ? 248.469 264.955 214.364 1.00 92.21  0  141 LYS B CA  1 
ATOM   4847  C  C   . LYS B 1 141 ? 247.426 264.736 215.450 1.00 92.21  0  141 LYS B C   1 
ATOM   4848  O  O   . LYS B 1 141 ? 246.459 265.505 215.512 1.00 92.21  0  141 LYS B O   1 
ATOM   4849  C  CB  . LYS B 1 141 ? 247.927 264.438 213.028 1.00 92.21  0  141 LYS B CB  1 
ATOM   4850  C  CG  . LYS B 1 141 ? 248.666 264.967 211.810 1.00 92.21  0  141 LYS B CG  1 
ATOM   4851  C  CD  . LYS B 1 141 ? 248.085 264.400 210.526 1.00 92.21  0  141 LYS B CD  1 
ATOM   4852  C  CE  . LYS B 1 141 ? 248.819 264.929 209.304 1.00 92.21  0  141 LYS B CE  1 
ATOM   4853  N  NZ  . LYS B 1 141 ? 250.253 264.529 209.300 1.00 92.21  1  141 LYS B NZ  1 
ATOM   4854  N  N   . ALA B 1 142 ? 247.620 263.713 216.294 1.00 89.21  0  142 ALA B N   1 
ATOM   4855  C  CA  . ALA B 1 142 ? 246.715 263.319 217.382 1.00 89.21  0  142 ALA B CA  1 
ATOM   4856  C  C   . ALA B 1 142 ? 245.295 263.064 216.868 1.00 89.21  0  142 ALA B C   1 
ATOM   4857  O  O   . ALA B 1 142 ? 244.325 263.705 217.277 1.00 89.21  0  142 ALA B O   1 
ATOM   4858  C  CB  . ALA B 1 142 ? 246.722 264.351 218.518 1.00 89.21  0  142 ALA B CB  1 
ATOM   4859  N  N   . LEU B 1 143 ? 245.195 262.104 215.951 1.00 84.93  0  143 LEU B N   1 
ATOM   4860  C  CA  . LEU B 1 143 ? 243.925 261.774 215.318 1.00 84.93  0  143 LEU B CA  1 
ATOM   4861  C  C   . LEU B 1 143 ? 243.115 260.785 216.148 1.00 84.93  0  143 LEU B C   1 
ATOM   4862  O  O   . LEU B 1 143 ? 241.922 260.998 216.385 1.00 84.93  0  143 LEU B O   1 
ATOM   4863  C  CB  . LEU B 1 143 ? 244.172 261.204 213.918 1.00 84.93  0  143 LEU B CB  1 
ATOM   4864  C  CG  . LEU B 1 143 ? 245.001 262.070 212.972 1.00 84.93  0  143 LEU B CG  1 
ATOM   4865  C  CD1 . LEU B 1 143 ? 245.314 261.311 211.695 1.00 84.93  0  143 LEU B CD1 1 
ATOM   4866  C  CD2 . LEU B 1 143 ? 244.275 263.370 212.663 1.00 84.93  0  143 LEU B CD2 1 
ATOM   4867  N  N   . VAL B 1 144 ? 243.749 259.704 216.595 1.00 81.15  0  144 VAL B N   1 
ATOM   4868  C  CA  . VAL B 1 144 ? 243.031 258.651 217.297 1.00 81.15  0  144 VAL B CA  1 
ATOM   4869  C  C   . VAL B 1 144 ? 242.853 259.029 218.764 1.00 81.15  0  144 VAL B C   1 
ATOM   4870  O  O   . VAL B 1 144 ? 243.552 259.889 219.307 1.00 81.15  0  144 VAL B O   1 
ATOM   4871  C  CB  . VAL B 1 144 ? 243.761 257.305 217.146 1.00 81.15  0  144 VAL B CB  1 
ATOM   4872  C  CG1 . VAL B 1 144 ? 243.904 256.957 215.674 1.00 81.15  0  144 VAL B CG1 1 
ATOM   4873  C  CG2 . VAL B 1 144 ? 245.122 257.356 217.820 1.00 81.15  0  144 VAL B CG2 1 
ATOM   4874  N  N   . ARG B 1 145 ? 241.889 258.377 219.413 1.00 85.11  0  145 ARG B N   1 
ATOM   4875  C  CA  . ARG B 1 145 ? 241.577 258.643 220.811 1.00 85.11  0  145 ARG B CA  1 
ATOM   4876  C  C   . ARG B 1 145 ? 241.875 257.448 221.707 1.00 85.11  0  145 ARG B C   1 
ATOM   4877  O  O   . ARG B 1 145 ? 242.668 257.564 222.646 1.00 85.11  0  145 ARG B O   1 
ATOM   4878  C  CB  . ARG B 1 145 ? 240.107 259.061 220.948 1.00 85.11  0  145 ARG B CB  1 
ATOM   4879  C  CG  . ARG B 1 145 ? 239.746 260.321 220.179 1.00 85.11  0  145 ARG B CG  1 
ATOM   4880  C  CD  . ARG B 1 145 ? 240.180 261.568 220.933 1.00 85.11  0  145 ARG B CD  1 
ATOM   4881  N  NE  . ARG B 1 145 ? 241.471 262.070 220.471 1.00 85.11  0  145 ARG B NE  1 
ATOM   4882  C  CZ  . ARG B 1 145 ? 242.037 263.190 220.910 1.00 85.11  0  145 ARG B CZ  1 
ATOM   4883  N  NH1 . ARG B 1 145 ? 241.426 263.929 221.825 1.00 85.11  1  145 ARG B NH1 1 
ATOM   4884  N  NH2 . ARG B 1 145 ? 243.214 263.571 220.434 1.00 85.11  0  145 ARG B NH2 1 
ATOM   4885  N  N   . SER B 1 146 ? 241.270 256.293 221.429 1.00 81.62  0  146 SER B N   1 
ATOM   4886  C  CA  . SER B 1 146 ? 241.438 255.113 222.269 1.00 81.62  0  146 SER B CA  1 
ATOM   4887  C  C   . SER B 1 146 ? 241.043 253.877 221.477 1.00 81.62  0  146 SER B C   1 
ATOM   4888  O  O   . SER B 1 146 ? 239.948 253.838 220.906 1.00 81.62  0  146 SER B O   1 
ATOM   4889  C  CB  . SER B 1 146 ? 240.590 255.212 223.544 1.00 81.62  0  146 SER B CB  1 
ATOM   4890  O  OG  . SER B 1 146 ? 239.210 255.090 223.248 1.00 81.62  0  146 SER B OG  1 
ATOM   4891  N  N   . ASP B 1 147 ? 241.941 252.883 221.456 1.00 79.11  0  147 ASP B N   1 
ATOM   4892  C  CA  . ASP B 1 147 ? 241.720 251.555 220.871 1.00 79.11  0  147 ASP B CA  1 
ATOM   4893  C  C   . ASP B 1 147 ? 241.359 251.637 219.386 1.00 79.11  0  147 ASP B C   1 
ATOM   4894  O  O   . ASP B 1 147 ? 240.270 251.254 218.955 1.00 79.11  0  147 ASP B O   1 
ATOM   4895  C  CB  . ASP B 1 147 ? 240.659 250.776 221.659 1.00 79.11  0  147 ASP B CB  1 
ATOM   4896  C  CG  . ASP B 1 147 ? 241.164 250.315 223.011 1.00 79.11  0  147 ASP B CG  1 
ATOM   4897  O  OD1 . ASP B 1 147 ? 240.350 250.224 223.953 1.00 79.11  0  147 ASP B OD1 1 
ATOM   4898  O  OD2 . ASP B 1 147 ? 242.376 250.042 223.129 1.00 79.11  -1 147 ASP B OD2 1 
ATOM   4899  N  N   . PHE B 1 148 ? 242.303 252.150 218.606 1.00 72.99  0  148 PHE B N   1 
ATOM   4900  C  CA  . PHE B 1 148 ? 242.116 252.296 217.173 1.00 72.99  0  148 PHE B CA  1 
ATOM   4901  C  C   . PHE B 1 148 ? 242.652 251.075 216.437 1.00 72.99  0  148 PHE B C   1 
ATOM   4902  O  O   . PHE B 1 148 ? 243.550 250.378 216.915 1.00 72.99  0  148 PHE B O   1 
ATOM   4903  C  CB  . PHE B 1 148 ? 242.794 253.568 216.658 1.00 72.99  0  148 PHE B CB  1 
ATOM   4904  C  CG  . PHE B 1 148 ? 244.287 253.452 216.494 1.00 72.99  0  148 PHE B CG  1 
ATOM   4905  C  CD1 . PHE B 1 148 ? 245.123 253.436 217.600 1.00 72.99  0  148 PHE B CD1 1 
ATOM   4906  C  CD2 . PHE B 1 148 ? 244.856 253.384 215.230 1.00 72.99  0  148 PHE B CD2 1 
ATOM   4907  C  CE1 . PHE B 1 148 ? 246.494 253.339 217.450 1.00 72.99  0  148 PHE B CE1 1 
ATOM   4908  C  CE2 . PHE B 1 148 ? 246.227 253.284 215.076 1.00 72.99  0  148 PHE B CE2 1 
ATOM   4909  C  CZ  . PHE B 1 148 ? 247.045 253.263 216.187 1.00 72.99  0  148 PHE B CZ  1 
ATOM   4910  N  N   . LEU B 1 149 ? 242.088 250.826 215.262 1.00 69.80  0  149 LEU B N   1 
ATOM   4911  C  CA  . LEU B 1 149 ? 242.447 249.672 214.456 1.00 69.80  0  149 LEU B CA  1 
ATOM   4912  C  C   . LEU B 1 149 ? 243.604 250.025 213.528 1.00 69.80  0  149 LEU B C   1 
ATOM   4913  O  O   . LEU B 1 149 ? 243.766 251.175 213.117 1.00 69.80  0  149 LEU B O   1 
ATOM   4914  C  CB  . LEU B 1 149 ? 241.226 249.200 213.659 1.00 69.80  0  149 LEU B CB  1 
ATOM   4915  C  CG  . LEU B 1 149 ? 241.165 247.851 212.938 1.00 69.80  0  149 LEU B CG  1 
ATOM   4916  C  CD1 . LEU B 1 149 ? 239.738 247.346 212.969 1.00 69.80  0  149 LEU B CD1 1 
ATOM   4917  C  CD2 . LEU B 1 149 ? 241.626 247.962 211.502 1.00 69.80  0  149 LEU B CD2 1 
ATOM   4918  N  N   . LEU B 1 150 ? 244.412 249.020 213.204 1.00 68.88  0  150 LEU B N   1 
ATOM   4919  C  CA  . LEU B 1 150 ? 245.539 249.168 212.289 1.00 68.88  0  150 LEU B CA  1 
ATOM   4920  C  C   . LEU B 1 150 ? 245.402 248.136 211.184 1.00 68.88  0  150 LEU B C   1 
ATOM   4921  O  O   . LEU B 1 150 ? 245.321 246.936 211.467 1.00 68.88  0  150 LEU B O   1 
ATOM   4922  C  CB  . LEU B 1 150 ? 246.870 248.993 213.026 1.00 68.88  0  150 LEU B CB  1 
ATOM   4923  C  CG  . LEU B 1 150 ? 248.147 248.802 212.201 1.00 68.88  0  150 LEU B CG  1 
ATOM   4924  C  CD1 . LEU B 1 150 ? 248.454 250.009 211.335 1.00 68.88  0  150 LEU B CD1 1 
ATOM   4925  C  CD2 . LEU B 1 150 ? 249.320 248.489 213.115 1.00 68.88  0  150 LEU B CD2 1 
ATOM   4926  N  N   . VAL B 1 151 ? 245.378 248.588 209.930 1.00 70.32  0  151 VAL B N   1 
ATOM   4927  C  CA  . VAL B 1 151 ? 245.229 247.663 208.814 1.00 70.32  0  151 VAL B CA  1 
ATOM   4928  C  C   . VAL B 1 151 ? 246.042 248.193 207.637 1.00 70.32  0  151 VAL B C   1 
ATOM   4929  O  O   . VAL B 1 151 ? 246.223 249.403 207.476 1.00 70.32  0  151 VAL B O   1 
ATOM   4930  C  CB  . VAL B 1 151 ? 243.727 247.458 208.469 1.00 70.32  0  151 VAL B CB  1 
ATOM   4931  C  CG1 . VAL B 1 151 ? 243.069 248.748 207.980 1.00 70.32  0  151 VAL B CG1 1 
ATOM   4932  C  CG2 . VAL B 1 151 ? 243.499 246.295 207.510 1.00 70.32  0  151 VAL B CG2 1 
ATOM   4933  N  N   . TYR B 1 152 ? 246.585 247.272 206.846 1.00 73.25  0  152 TYR B N   1 
ATOM   4934  C  CA  . TYR B 1 152 ? 247.196 247.627 205.578 1.00 73.25  0  152 TYR B CA  1 
ATOM   4935  C  C   . TYR B 1 152 ? 246.115 247.906 204.537 1.00 73.25  0  152 TYR B C   1 
ATOM   4936  O  O   . TYR B 1 152 ? 244.927 247.648 204.746 1.00 73.25  0  152 TYR B O   1 
ATOM   4937  C  CB  . TYR B 1 152 ? 248.121 246.512 205.093 1.00 73.25  0  152 TYR B CB  1 
ATOM   4938  C  CG  . TYR B 1 152 ? 249.536 246.603 205.613 1.00 73.25  0  152 TYR B CG  1 
ATOM   4939  C  CD1 . TYR B 1 152 ? 249.869 246.102 206.867 1.00 73.25  0  152 TYR B CD1 1 
ATOM   4940  C  CD2 . TYR B 1 152 ? 250.540 247.183 204.848 1.00 73.25  0  152 TYR B CD2 1 
ATOM   4941  C  CE1 . TYR B 1 152 ? 251.165 246.179 207.345 1.00 73.25  0  152 TYR B CE1 1 
ATOM   4942  C  CE2 . TYR B 1 152 ? 251.839 247.265 205.317 1.00 73.25  0  152 TYR B CE2 1 
ATOM   4943  C  CZ  . TYR B 1 152 ? 252.145 246.760 206.565 1.00 73.25  0  152 TYR B CZ  1 
ATOM   4944  O  OH  . TYR B 1 152 ? 253.435 246.842 207.036 1.00 73.25  0  152 TYR B OH  1 
ATOM   4945  N  N   . GLY B 1 153 ? 246.539 248.432 203.395 1.00 76.41  0  153 GLY B N   1 
ATOM   4946  C  CA  . GLY B 1 153 ? 245.617 248.706 202.316 1.00 76.41  0  153 GLY B CA  1 
ATOM   4947  C  C   . GLY B 1 153 ? 245.361 247.537 201.396 1.00 76.41  0  153 GLY B C   1 
ATOM   4948  O  O   . GLY B 1 153 ? 244.680 247.700 200.378 1.00 76.41  0  153 GLY B O   1 
ATOM   4949  N  N   . ASP B 1 154 ? 245.881 246.359 201.723 1.00 75.92  0  154 ASP B N   1 
ATOM   4950  C  CA  . ASP B 1 154 ? 245.738 245.178 200.882 1.00 75.92  0  154 ASP B CA  1 
ATOM   4951  C  C   . ASP B 1 154 ? 245.388 243.959 201.733 1.00 75.92  0  154 ASP B C   1 
ATOM   4952  O  O   . ASP B 1 154 ? 245.935 242.870 201.561 1.00 75.92  0  154 ASP B O   1 
ATOM   4953  C  CB  . ASP B 1 154 ? 247.008 244.973 200.053 1.00 75.92  0  154 ASP B CB  1 
ATOM   4954  C  CG  . ASP B 1 154 ? 248.287 245.051 200.881 1.00 75.92  0  154 ASP B CG  1 
ATOM   4955  O  OD1 . ASP B 1 154 ? 248.419 244.341 201.900 1.00 75.92  0  154 ASP B OD1 1 
ATOM   4956  O  OD2 . ASP B 1 154 ? 249.177 245.840 200.500 1.00 75.92  -1 154 ASP B OD2 1 
ATOM   4957  N  N   . VAL B 1 155 ? 244.446 244.135 202.656 1.00 70.80  0  155 VAL B N   1 
ATOM   4958  C  CA  . VAL B 1 155 ? 244.027 243.087 203.580 1.00 70.80  0  155 VAL B CA  1 
ATOM   4959  C  C   . VAL B 1 155 ? 242.606 242.669 203.227 1.00 70.80  0  155 VAL B C   1 
ATOM   4960  O  O   . VAL B 1 155 ? 241.701 243.510 203.164 1.00 70.80  0  155 VAL B O   1 
ATOM   4961  C  CB  . VAL B 1 155 ? 244.121 243.559 205.041 1.00 70.80  0  155 VAL B CB  1 
ATOM   4962  C  CG1 . VAL B 1 155 ? 243.454 242.567 205.976 1.00 70.80  0  155 VAL B CG1 1 
ATOM   4963  C  CG2 . VAL B 1 155 ? 245.573 243.764 205.436 1.00 70.80  0  155 VAL B CG2 1 
ATOM   4964  N  N   . ILE B 1 156 ? 242.412 241.373 202.999 1.00 66.24  0  156 ILE B N   1 
ATOM   4965  C  CA  . ILE B 1 156 ? 241.121 240.808 202.626 1.00 66.24  0  156 ILE B CA  1 
ATOM   4966  C  C   . ILE B 1 156 ? 240.610 240.005 203.812 1.00 66.24  0  156 ILE B C   1 
ATOM   4967  O  O   . ILE B 1 156 ? 241.252 239.036 204.238 1.00 66.24  0  156 ILE B O   1 
ATOM   4968  C  CB  . ILE B 1 156 ? 241.226 239.934 201.369 1.00 66.24  0  156 ILE B CB  1 
ATOM   4969  C  CG1 . ILE B 1 156 ? 242.122 240.612 200.334 1.00 66.24  0  156 ILE B CG1 1 
ATOM   4970  C  CG2 . ILE B 1 156 ? 239.845 239.654 200.797 1.00 66.24  0  156 ILE B CG2 1 
ATOM   4971  C  CD1 . ILE B 1 156 ? 241.574 241.905 199.813 1.00 66.24  0  156 ILE B CD1 1 
ATOM   4972  N  N   . SER B 1 157 ? 239.451 240.396 204.335 1.00 65.32  0  157 SER B N   1 
ATOM   4973  C  CA  . SER B 1 157 ? 238.963 239.809 205.572 1.00 65.32  0  157 SER B CA  1 
ATOM   4974  C  C   . SER B 1 157 ? 237.462 240.026 205.685 1.00 65.32  0  157 SER B C   1 
ATOM   4975  O  O   . SER B 1 157 ? 236.886 240.883 205.011 1.00 65.32  0  157 SER B O   1 
ATOM   4976  C  CB  . SER B 1 157 ? 239.681 240.410 206.782 1.00 65.32  0  157 SER B CB  1 
ATOM   4977  O  OG  . SER B 1 157 ? 239.488 239.622 207.936 1.00 65.32  0  157 SER B OG  1 
ATOM   4978  N  N   . ASN B 1 158 ? 236.836 239.224 206.552 1.00 62.85  0  158 ASN B N   1 
ATOM   4979  C  CA  . ASN B 1 158 ? 235.426 239.388 206.883 1.00 62.85  0  158 ASN B CA  1 
ATOM   4980  C  C   . ASN B 1 158 ? 235.174 239.133 208.365 1.00 62.85  0  158 ASN B C   1 
ATOM   4981  O  O   . ASN B 1 158 ? 234.062 238.759 208.753 1.00 62.85  0  158 ASN B O   1 
ATOM   4982  C  CB  . ASN B 1 158 ? 234.546 238.465 206.038 1.00 62.85  0  158 ASN B CB  1 
ATOM   4983  C  CG  . ASN B 1 158 ? 234.844 236.998 206.272 1.00 62.85  0  158 ASN B CG  1 
ATOM   4984  O  OD1 . ASN B 1 158 ? 235.975 236.623 206.569 1.00 62.85  0  158 ASN B OD1 1 
ATOM   4985  N  ND2 . ASN B 1 158 ? 233.824 236.161 206.152 1.00 62.85  0  158 ASN B ND2 1 
ATOM   4986  N  N   . ILE B 1 159 ? 236.184 239.340 209.205 1.00 64.42  0  159 ILE B N   1 
ATOM   4987  C  CA  . ILE B 1 159 ? 236.078 239.002 210.619 1.00 64.42  0  159 ILE B CA  1 
ATOM   4988  C  C   . ILE B 1 159 ? 235.399 240.144 211.361 1.00 64.42  0  159 ILE B C   1 
ATOM   4989  O  O   . ILE B 1 159 ? 235.755 241.315 211.188 1.00 64.42  0  159 ILE B O   1 
ATOM   4990  C  CB  . ILE B 1 159 ? 237.463 238.710 211.219 1.00 64.42  0  159 ILE B CB  1 
ATOM   4991  C  CG1 . ILE B 1 159 ? 238.259 237.778 210.313 1.00 64.42  0  159 ILE B CG1 1 
ATOM   4992  C  CG2 . ILE B 1 159 ? 237.323 238.067 212.585 1.00 64.42  0  159 ILE B CG2 1 
ATOM   4993  C  CD1 . ILE B 1 159 ? 239.709 237.636 210.709 1.00 64.42  0  159 ILE B CD1 1 
ATOM   4994  N  N   . ASN B 1 160 ? 234.417 239.804 212.190 1.00 71.14  0  160 ASN B N   1 
ATOM   4995  C  CA  . ASN B 1 160 ? 233.860 240.741 213.154 1.00 71.14  0  160 ASN B CA  1 
ATOM   4996  C  C   . ASN B 1 160 ? 234.654 240.601 214.446 1.00 71.14  0  160 ASN B C   1 
ATOM   4997  O  O   . ASN B 1 160 ? 234.641 239.538 215.075 1.00 71.14  0  160 ASN B O   1 
ATOM   4998  C  CB  . ASN B 1 160 ? 232.376 240.466 213.392 1.00 71.14  0  160 ASN B CB  1 
ATOM   4999  C  CG  . ASN B 1 160 ? 231.707 241.553 214.207 1.00 71.14  0  160 ASN B CG  1 
ATOM   5000  O  OD1 . ASN B 1 160 ? 232.117 242.712 214.172 1.00 71.14  0  160 ASN B OD1 1 
ATOM   5001  N  ND2 . ASN B 1 160 ? 230.671 241.182 214.950 1.00 71.14  0  160 ASN B ND2 1 
ATOM   5002  N  N   . ILE B 1 161 ? 235.345 241.669 214.838 1.00 70.87  0  161 ILE B N   1 
ATOM   5003  C  CA  . ILE B 1 161 ? 236.296 241.584 215.939 1.00 70.87  0  161 ILE B CA  1 
ATOM   5004  C  C   . ILE B 1 161 ? 235.786 242.368 217.138 1.00 70.87  0  161 ILE B C   1 
ATOM   5005  O  O   . ILE B 1 161 ? 236.576 242.896 217.930 1.00 70.87  0  161 ILE B O   1 
ATOM   5006  C  CB  . ILE B 1 161 ? 237.693 242.067 215.508 1.00 70.87  0  161 ILE B CB  1 
ATOM   5007  C  CG1 . ILE B 1 161 ? 237.624 243.471 214.909 1.00 70.87  0  161 ILE B CG1 1 
ATOM   5008  C  CG2 . ILE B 1 161 ? 238.291 241.099 214.509 1.00 70.87  0  161 ILE B CG2 1 
ATOM   5009  C  CD1 . ILE B 1 161 ? 238.950 243.982 214.400 1.00 70.87  0  161 ILE B CD1 1 
ATOM   5010  N  N   . THR B 1 162 ? 234.459 242.442 217.281 1.00 75.54  0  162 THR B N   1 
ATOM   5011  C  CA  . THR B 1 162 ? 233.873 243.082 218.454 1.00 75.54  0  162 THR B CA  1 
ATOM   5012  C  C   . THR B 1 162 ? 234.176 242.292 219.720 1.00 75.54  0  162 THR B C   1 
ATOM   5013  O  O   . THR B 1 162 ? 234.337 242.884 220.794 1.00 75.54  0  162 THR B O   1 
ATOM   5014  C  CB  . THR B 1 162 ? 232.363 243.237 218.276 1.00 75.54  0  162 THR B CB  1 
ATOM   5015  O  OG1 . THR B 1 162 ? 231.792 241.972 217.918 1.00 75.54  0  162 THR B OG1 1 
ATOM   5016  C  CG2 . THR B 1 162 ? 232.058 244.253 217.187 1.00 75.54  0  162 THR B CG2 1 
ATOM   5017  N  N   . ARG B 1 163 ? 234.275 240.964 219.605 1.00 80.19  0  163 ARG B N   1 
ATOM   5018  C  CA  . ARG B 1 163 ? 234.672 240.136 220.738 1.00 80.19  0  163 ARG B CA  1 
ATOM   5019  C  C   . ARG B 1 163 ? 236.117 240.410 221.134 1.00 80.19  0  163 ARG B C   1 
ATOM   5020  O  O   . ARG B 1 163 ? 236.422 240.568 222.323 1.00 80.19  0  163 ARG B O   1 
ATOM   5021  C  CB  . ARG B 1 163 ? 234.486 238.660 220.391 1.00 80.19  0  163 ARG B CB  1 
ATOM   5022  C  CG  . ARG B 1 163 ? 234.685 237.707 221.554 1.00 80.19  0  163 ARG B CG  1 
ATOM   5023  C  CD  . ARG B 1 163 ? 234.751 236.270 221.063 1.00 80.19  0  163 ARG B CD  1 
ATOM   5024  N  NE  . ARG B 1 163 ? 233.723 235.988 220.066 1.00 80.19  0  163 ARG B NE  1 
ATOM   5025  C  CZ  . ARG B 1 163 ? 233.671 234.874 219.342 1.00 80.19  0  163 ARG B CZ  1 
ATOM   5026  N  NH1 . ARG B 1 163 ? 234.592 233.934 219.502 1.00 80.19  1  163 ARG B NH1 1 
ATOM   5027  N  NH2 . ARG B 1 163 ? 232.700 234.702 218.455 1.00 80.19  0  163 ARG B NH2 1 
ATOM   5028  N  N   . ALA B 1 164 ? 237.015 240.492 220.146 1.00 76.03  0  164 ALA B N   1 
ATOM   5029  C  CA  . ALA B 1 164 ? 238.409 240.819 220.424 1.00 76.03  0  164 ALA B CA  1 
ATOM   5030  C  C   . ALA B 1 164 ? 238.566 242.255 220.905 1.00 76.03  0  164 ALA B C   1 
ATOM   5031  O  O   . ALA B 1 164 ? 239.440 242.535 221.734 1.00 76.03  0  164 ALA B O   1 
ATOM   5032  C  CB  . ALA B 1 164 ? 239.264 240.580 219.181 1.00 76.03  0  164 ALA B CB  1 
ATOM   5033  N  N   . LEU B 1 165 ? 237.719 243.168 220.419 1.00 77.89  0  165 LEU B N   1 
ATOM   5034  C  CA  . LEU B 1 165 ? 237.757 244.549 220.892 1.00 77.89  0  165 LEU B CA  1 
ATOM   5035  C  C   . LEU B 1 165 ? 237.315 244.647 222.347 1.00 77.89  0  165 LEU B C   1 
ATOM   5036  O  O   . LEU B 1 165 ? 237.929 245.372 223.138 1.00 77.89  0  165 LEU B O   1 
ATOM   5037  C  CB  . LEU B 1 165 ? 236.883 245.433 220.004 1.00 77.89  0  165 LEU B CB  1 
ATOM   5038  C  CG  . LEU B 1 165 ? 236.852 246.924 220.333 1.00 77.89  0  165 LEU B CG  1 
ATOM   5039  C  CD1 . LEU B 1 165 ? 238.248 247.518 220.252 1.00 77.89  0  165 LEU B CD1 1 
ATOM   5040  C  CD2 . LEU B 1 165 ? 235.900 247.651 219.399 1.00 77.89  0  165 LEU B CD2 1 
ATOM   5041  N  N   . GLU B 1 166 ? 236.269 243.904 222.725 1.00 82.23  0  166 GLU B N   1 
ATOM   5042  C  CA  . GLU B 1 166 ? 235.843 243.890 224.121 1.00 82.23  0  166 GLU B CA  1 
ATOM   5043  C  C   . GLU B 1 166 ? 236.859 243.190 225.014 1.00 82.23  0  166 GLU B C   1 
ATOM   5044  O  O   . GLU B 1 166 ? 237.041 243.593 226.169 1.00 82.23  0  166 GLU B O   1 
ATOM   5045  C  CB  . GLU B 1 166 ? 234.471 243.229 224.256 1.00 82.23  0  166 GLU B CB  1 
ATOM   5046  C  CG  . GLU B 1 166 ? 233.322 244.056 223.699 1.00 82.23  0  166 GLU B CG  1 
ATOM   5047  C  CD  . GLU B 1 166 ? 233.407 245.519 224.092 1.00 82.23  0  166 GLU B CD  1 
ATOM   5048  O  OE1 . GLU B 1 166 ? 233.364 245.816 225.305 1.00 82.23  0  166 GLU B OE1 1 
ATOM   5049  O  OE2 . GLU B 1 166 ? 233.517 246.372 223.187 1.00 82.23  -1 166 GLU B OE2 1 
ATOM   5050  N  N   . GLU B 1 167 ? 237.538 242.160 224.494 1.00 80.58  0  167 GLU B N   1 
ATOM   5051  C  CA  . GLU B 1 167 ? 238.601 241.504 225.251 1.00 80.58  0  167 GLU B CA  1 
ATOM   5052  C  C   . GLU B 1 167 ? 239.779 242.444 225.487 1.00 80.58  0  167 GLU B C   1 
ATOM   5053  O  O   . GLU B 1 167 ? 240.323 242.496 226.597 1.00 80.58  0  167 GLU B O   1 
ATOM   5054  C  CB  . GLU B 1 167 ? 239.063 240.241 224.525 1.00 80.58  0  167 GLU B CB  1 
ATOM   5055  C  CG  . GLU B 1 167 ? 238.150 239.044 224.722 1.00 80.58  0  167 GLU B CG  1 
ATOM   5056  C  CD  . GLU B 1 167 ? 238.505 237.887 223.809 1.00 80.58  0  167 GLU B CD  1 
ATOM   5057  O  OE1 . GLU B 1 167 ? 239.429 238.042 222.984 1.00 80.58  0  167 GLU B OE1 1 
ATOM   5058  O  OE2 . GLU B 1 167 ? 237.859 236.824 223.916 1.00 80.58  -1 167 GLU B OE2 1 
ATOM   5059  N  N   . HIS B 1 168 ? 240.170 243.205 224.460 1.00 79.37  0  168 HIS B N   1 
ATOM   5060  C  CA  . HIS B 1 168 ? 241.230 244.198 224.614 1.00 79.37  0  168 HIS B CA  1 
ATOM   5061  C  C   . HIS B 1 168 ? 240.818 245.313 225.569 1.00 79.37  0  168 HIS B C   1 
ATOM   5062  O  O   . HIS B 1 168 ? 241.637 245.785 226.368 1.00 79.37  0  168 HIS B O   1 
ATOM   5063  C  CB  . HIS B 1 168 ? 241.601 244.775 223.249 1.00 79.37  0  168 HIS B CB  1 
ATOM   5064  C  CG  . HIS B 1 168 ? 242.773 245.703 223.283 1.00 79.37  0  168 HIS B CG  1 
ATOM   5065  N  ND1 . HIS B 1 168 ? 243.943 245.400 223.945 1.00 79.37  0  168 HIS B ND1 1 
ATOM   5066  C  CD2 . HIS B 1 168 ? 242.958 246.927 222.734 1.00 79.37  0  168 HIS B CD2 1 
ATOM   5067  C  CE1 . HIS B 1 168 ? 244.798 246.397 223.803 1.00 79.37  0  168 HIS B CE1 1 
ATOM   5068  N  NE2 . HIS B 1 168 ? 244.224 247.337 223.073 1.00 79.37  0  168 HIS B NE2 1 
ATOM   5069  N  N   . ARG B 1 169 ? 239.544 245.716 225.528 1.00 79.25  0  169 ARG B N   1 
ATOM   5070  C  CA  . ARG B 1 169 ? 239.068 246.769 226.419 1.00 79.25  0  169 ARG B CA  1 
ATOM   5071  C  C   . ARG B 1 169 ? 239.037 246.307 227.872 1.00 79.25  0  169 ARG B C   1 
ATOM   5072  O  O   . ARG B 1 169 ? 239.428 247.060 228.772 1.00 79.25  0  169 ARG B O   1 
ATOM   5073  C  CB  . ARG B 1 169 ? 237.687 247.246 225.969 1.00 79.25  0  169 ARG B CB  1 
ATOM   5074  C  CG  . ARG B 1 169 ? 237.736 248.264 224.840 1.00 79.25  0  169 ARG B CG  1 
ATOM   5075  C  CD  . ARG B 1 169 ? 236.374 248.448 224.194 1.00 79.25  0  169 ARG B CD  1 
ATOM   5076  N  NE  . ARG B 1 169 ? 236.407 249.451 223.133 1.00 79.25  0  169 ARG B NE  1 
ATOM   5077  C  CZ  . ARG B 1 169 ? 235.388 249.712 222.322 1.00 79.25  0  169 ARG B CZ  1 
ATOM   5078  N  NH1 . ARG B 1 169 ? 234.250 249.043 222.447 1.00 79.25  1  169 ARG B NH1 1 
ATOM   5079  N  NH2 . ARG B 1 169 ? 235.505 250.642 221.384 1.00 79.25  0  169 ARG B NH2 1 
ATOM   5080  N  N   . LEU B 1 170 ? 238.610 245.064 228.125 1.00 81.65  0  170 LEU B N   1 
ATOM   5081  C  CA  . LEU B 1 170 ? 238.619 244.569 229.500 1.00 81.65  0  170 LEU B CA  1 
ATOM   5082  C  C   . LEU B 1 170 ? 240.038 244.301 229.991 1.00 81.65  0  170 LEU B C   1 
ATOM   5083  O  O   . LEU B 1 170 ? 240.322 244.496 231.179 1.00 81.65  0  170 LEU B O   1 
ATOM   5084  C  CB  . LEU B 1 170 ? 237.739 243.319 229.640 1.00 81.65  0  170 LEU B CB  1 
ATOM   5085  C  CG  . LEU B 1 170 ? 238.014 241.978 228.951 1.00 81.65  0  170 LEU B CG  1 
ATOM   5086  C  CD1 . LEU B 1 170 ? 238.852 241.032 229.807 1.00 81.65  0  170 LEU B CD1 1 
ATOM   5087  C  CD2 . LEU B 1 170 ? 236.697 241.312 228.579 1.00 81.65  0  170 LEU B CD2 1 
ATOM   5088  N  N   . ARG B 1 171 ? 240.941 243.871 229.102 1.00 81.25  0  171 ARG B N   1 
ATOM   5089  C  CA  . ARG B 1 171 ? 242.336 243.692 229.497 1.00 81.25  0  171 ARG B CA  1 
ATOM   5090  C  C   . ARG B 1 171 ? 243.015 245.024 229.787 1.00 81.25  0  171 ARG B C   1 
ATOM   5091  O  O   . ARG B 1 171 ? 243.932 245.083 230.613 1.00 81.25  0  171 ARG B O   1 
ATOM   5092  C  CB  . ARG B 1 171 ? 243.096 242.924 228.419 1.00 81.25  0  171 ARG B CB  1 
ATOM   5093  C  CG  . ARG B 1 171 ? 242.869 241.424 228.472 1.00 81.25  0  171 ARG B CG  1 
ATOM   5094  C  CD  . ARG B 1 171 ? 243.854 240.691 227.589 1.00 81.25  0  171 ARG B CD  1 
ATOM   5095  N  NE  . ARG B 1 171 ? 243.875 241.234 226.235 1.00 81.25  0  171 ARG B NE  1 
ATOM   5096  C  CZ  . ARG B 1 171 ? 243.221 240.703 225.209 1.00 81.25  0  171 ARG B CZ  1 
ATOM   5097  N  NH1 . ARG B 1 171 ? 242.491 239.609 225.378 1.00 81.25  1  171 ARG B NH1 1 
ATOM   5098  N  NH2 . ARG B 1 171 ? 243.296 241.266 224.012 1.00 81.25  0  171 ARG B NH2 1 
ATOM   5099  N  N   . ARG B 1 172 ? 242.586 246.098 229.123 1.00 81.92  0  172 ARG B N   1 
ATOM   5100  C  CA  . ARG B 1 172 ? 243.087 247.419 229.479 1.00 81.92  0  172 ARG B CA  1 
ATOM   5101  C  C   . ARG B 1 172 ? 242.444 247.941 230.757 1.00 81.92  0  172 ARG B C   1 
ATOM   5102  O  O   . ARG B 1 172 ? 243.080 248.694 231.502 1.00 81.92  0  172 ARG B O   1 
ATOM   5103  C  CB  . ARG B 1 172 ? 242.840 248.405 228.339 1.00 81.92  0  172 ARG B CB  1 
ATOM   5104  C  CG  . ARG B 1 172 ? 243.760 248.224 227.155 1.00 81.92  0  172 ARG B CG  1 
ATOM   5105  C  CD  . ARG B 1 172 ? 243.580 249.356 226.167 1.00 81.92  0  172 ARG B CD  1 
ATOM   5106  N  NE  . ARG B 1 172 ? 243.747 250.665 226.793 1.00 81.92  0  172 ARG B NE  1 
ATOM   5107  C  CZ  . ARG B 1 172 ? 244.918 251.269 226.965 1.00 81.92  0  172 ARG B CZ  1 
ATOM   5108  N  NH1 . ARG B 1 172 ? 246.036 250.685 226.557 1.00 81.92  1  172 ARG B NH1 1 
ATOM   5109  N  NH2 . ARG B 1 172 ? 244.972 252.461 227.543 1.00 81.92  0  172 ARG B NH2 1 
ATOM   5110  N  N   . LYS B 1 173 ? 241.194 247.557 231.023 1.00 83.27  0  173 LYS B N   1 
ATOM   5111  C  CA  . LYS B 1 173 ? 240.495 248.060 232.199 1.00 83.27  0  173 LYS B CA  1 
ATOM   5112  C  C   . LYS B 1 173 ? 240.969 247.387 233.484 1.00 83.27  0  173 LYS B C   1 
ATOM   5113  O  O   . LYS B 1 173 ? 241.065 248.047 234.525 1.00 83.27  0  173 LYS B O   1 
ATOM   5114  C  CB  . LYS B 1 173 ? 238.986 247.881 232.026 1.00 83.27  0  173 LYS B CB  1 
ATOM   5115  C  CG  . LYS B 1 173 ? 238.323 249.004 231.243 1.00 83.27  0  173 LYS B CG  1 
ATOM   5116  C  CD  . LYS B 1 173 ? 236.939 248.607 230.760 1.00 83.27  0  173 LYS B CD  1 
ATOM   5117  C  CE  . LYS B 1 173 ? 236.353 249.663 229.837 1.00 83.27  0  173 LYS B CE  1 
ATOM   5118  N  NZ  . LYS B 1 173 ? 235.037 249.247 229.278 1.00 83.27  1  173 LYS B NZ  1 
ATOM   5119  N  N   . LEU B 1 174 ? 241.267 246.085 233.444 1.00 84.95  0  174 LEU B N   1 
ATOM   5120  C  CA  . LEU B 1 174 ? 241.713 245.415 234.663 1.00 84.95  0  174 LEU B CA  1 
ATOM   5121  C  C   . LEU B 1 174 ? 243.176 245.714 234.974 1.00 84.95  0  174 LEU B C   1 
ATOM   5122  O  O   . LEU B 1 174 ? 243.517 246.051 236.113 1.00 84.95  0  174 LEU B O   1 
ATOM   5123  C  CB  . LEU B 1 174 ? 241.501 243.902 234.563 1.00 84.95  0  174 LEU B CB  1 
ATOM   5124  C  CG  . LEU B 1 174 ? 240.111 243.350 234.247 1.00 84.95  0  174 LEU B CG  1 
ATOM   5125  C  CD1 . LEU B 1 174 ? 240.130 241.830 234.289 1.00 84.95  0  174 LEU B CD1 1 
ATOM   5126  C  CD2 . LEU B 1 174 ? 239.079 243.902 235.216 1.00 84.95  0  174 LEU B CD2 1 
ATOM   5127  N  N   . GLU B 1 175 ? 244.054 245.601 233.980 1.00 87.40  0  175 GLU B N   1 
ATOM   5128  C  CA  . GLU B 1 175 ? 245.488 245.700 234.217 1.00 87.40  0  175 GLU B CA  1 
ATOM   5129  C  C   . GLU B 1 175 ? 246.021 247.122 234.093 1.00 87.40  0  175 GLU B C   1 
ATOM   5130  O  O   . GLU B 1 175 ? 247.245 247.303 234.111 1.00 87.40  0  175 GLU B O   1 
ATOM   5131  C  CB  . GLU B 1 175 ? 246.249 244.773 233.267 1.00 87.40  0  175 GLU B CB  1 
ATOM   5132  C  CG  . GLU B 1 175 ? 246.041 243.298 233.562 1.00 87.40  0  175 GLU B CG  1 
ATOM   5133  C  CD  . GLU B 1 175 ? 247.156 242.429 233.017 1.00 87.40  0  175 GLU B CD  1 
ATOM   5134  O  OE1 . GLU B 1 175 ? 247.942 241.891 233.827 1.00 87.40  0  175 GLU B OE1 1 
ATOM   5135  O  OE2 . GLU B 1 175 ? 247.251 242.287 231.781 1.00 87.40  -1 175 GLU B OE2 1 
ATOM   5136  N  N   . LYS B 1 176 ? 245.130 248.115 233.969 1.00 84.68  0  176 LYS B N   1 
ATOM   5137  C  CA  . LYS B 1 176 ? 245.452 249.549 233.983 1.00 84.68  0  176 LYS B CA  1 
ATOM   5138  C  C   . LYS B 1 176 ? 246.436 249.922 232.869 1.00 84.68  0  176 LYS B C   1 
ATOM   5139  O  O   . LYS B 1 176 ? 247.573 250.331 233.122 1.00 84.68  0  176 LYS B O   1 
ATOM   5140  C  CB  . LYS B 1 176 ? 245.976 249.986 235.357 1.00 84.68  0  176 LYS B CB  1 
ATOM   5141  N  N   . ASN B 1 177 ? 245.965 249.743 231.626 1.00 82.49  0  177 ASN B N   1 
ATOM   5142  C  CA  . ASN B 1 177 ? 246.672 250.128 230.396 1.00 82.49  0  177 ASN B CA  1 
ATOM   5143  C  C   . ASN B 1 177 ? 248.014 249.409 230.259 1.00 82.49  0  177 ASN B C   1 
ATOM   5144  O  O   . ASN B 1 177 ? 249.013 249.992 229.833 1.00 82.49  0  177 ASN B O   1 
ATOM   5145  C  CB  . ASN B 1 177 ? 246.853 251.647 230.296 1.00 82.49  0  177 ASN B CB  1 
ATOM   5146  N  N   . VAL B 1 178 ? 248.037 248.131 230.629 1.00 81.95  0  178 VAL B N   1 
ATOM   5147  C  CA  . VAL B 1 178 ? 249.227 247.308 230.442 1.00 81.95  0  178 VAL B CA  1 
ATOM   5148  C  C   . VAL B 1 178 ? 249.223 246.638 229.075 1.00 81.95  0  178 VAL B C   1 
ATOM   5149  O  O   . VAL B 1 178 ? 250.249 246.603 228.392 1.00 81.95  0  178 VAL B O   1 
ATOM   5150  C  CB  . VAL B 1 178 ? 249.335 246.270 231.577 1.00 81.95  0  178 VAL B CB  1 
ATOM   5151  N  N   . SER B 1 179 ? 248.078 246.101 228.660 1.00 82.08  0  179 SER B N   1 
ATOM   5152  C  CA  . SER B 1 179 ? 247.937 245.540 227.324 1.00 82.08  0  179 SER B CA  1 
ATOM   5153  C  C   . SER B 1 179 ? 247.826 246.664 226.304 1.00 82.08  0  179 SER B C   1 
ATOM   5154  O  O   . SER B 1 179 ? 246.981 247.555 226.440 1.00 82.08  0  179 SER B O   1 
ATOM   5155  C  CB  . SER B 1 179 ? 246.707 244.637 227.253 1.00 82.08  0  179 SER B CB  1 
ATOM   5156  O  OG  . SER B 1 179 ? 246.750 243.808 226.105 1.00 82.08  0  179 SER B OG  1 
ATOM   5157  N  N   . VAL B 1 180 ? 248.678 246.622 225.279 1.00 79.59  0  180 VAL B N   1 
ATOM   5158  C  CA  . VAL B 1 180 ? 248.816 247.720 224.335 1.00 79.59  0  180 VAL B CA  1 
ATOM   5159  C  C   . VAL B 1 180 ? 248.393 247.320 222.923 1.00 79.59  0  180 VAL B C   1 
ATOM   5160  O  O   . VAL B 1 180 ? 247.781 248.120 222.206 1.00 79.59  0  180 VAL B O   1 
ATOM   5161  C  CB  . VAL B 1 180 ? 250.261 248.296 224.360 1.00 79.59  0  180 VAL B CB  1 
ATOM   5162  C  CG1 . VAL B 1 180 ? 251.328 247.257 223.989 1.00 79.59  0  180 VAL B CG1 1 
ATOM   5163  C  CG2 . VAL B 1 180 ? 250.381 249.564 223.531 1.00 79.59  0  180 VAL B CG2 1 
ATOM   5164  N  N   . MET B 1 181 ? 248.666 246.082 222.513 1.00 78.00  0  181 MET B N   1 
ATOM   5165  C  CA  . MET B 1 181 ? 248.376 245.625 221.161 1.00 78.00  0  181 MET B CA  1 
ATOM   5166  C  C   . MET B 1 181 ? 247.733 244.249 221.229 1.00 78.00  0  181 MET B C   1 
ATOM   5167  O  O   . MET B 1 181 ? 248.194 243.383 221.978 1.00 78.00  0  181 MET B O   1 
ATOM   5168  C  CB  . MET B 1 181 ? 249.652 245.579 220.307 1.00 78.00  0  181 MET B CB  1 
ATOM   5169  C  CG  . MET B 1 181 ? 249.460 245.010 218.907 1.00 78.00  0  181 MET B CG  1 
ATOM   5170  S  SD  . MET B 1 181 ? 250.860 245.299 217.809 1.00 78.00  0  181 MET B SD  1 
ATOM   5171  C  CE  . MET B 1 181 ? 250.657 247.040 217.449 1.00 78.00  0  181 MET B CE  1 
ATOM   5172  N  N   . THR B 1 182 ? 246.663 244.058 220.466 1.00 73.37  0  182 THR B N   1 
ATOM   5173  C  CA  . THR B 1 182 ? 246.007 242.761 220.330 1.00 73.37  0  182 THR B CA  1 
ATOM   5174  C  C   . THR B 1 182 ? 246.176 242.306 218.885 1.00 73.37  0  182 THR B C   1 
ATOM   5175  O  O   . THR B 1 182 ? 245.432 242.735 217.998 1.00 73.37  0  182 THR B O   1 
ATOM   5176  C  CB  . THR B 1 182 ? 244.536 242.838 220.724 1.00 73.37  0  182 THR B CB  1 
ATOM   5177  O  OG1 . THR B 1 182 ? 244.426 243.351 222.057 1.00 73.37  0  182 THR B OG1 1 
ATOM   5178  C  CG2 . THR B 1 182 ? 243.893 241.459 220.659 1.00 73.37  0  182 THR B CG2 1 
ATOM   5179  N  N   . MET B 1 183 ? 247.166 241.451 218.651 1.00 76.19  0  183 MET B N   1 
ATOM   5180  C  CA  . MET B 1 183 ? 247.356 240.887 217.324 1.00 76.19  0  183 MET B CA  1 
ATOM   5181  C  C   . MET B 1 183 ? 246.273 239.855 217.040 1.00 76.19  0  183 MET B C   1 
ATOM   5182  O  O   . MET B 1 183 ? 245.744 239.214 217.949 1.00 76.19  0  183 MET B O   1 
ATOM   5183  C  CB  . MET B 1 183 ? 248.742 240.256 217.200 1.00 76.19  0  183 MET B CB  1 
ATOM   5184  C  CG  . MET B 1 183 ? 249.882 241.246 217.367 1.00 76.19  0  183 MET B CG  1 
ATOM   5185  S  SD  . MET B 1 183 ? 251.482 240.458 217.635 1.00 76.19  0  183 MET B SD  1 
ATOM   5186  C  CE  . MET B 1 183 ? 251.778 239.722 216.032 1.00 76.19  0  183 MET B CE  1 
ATOM   5187  N  N   . ILE B 1 184 ? 245.924 239.719 215.764 1.00 71.53  0  184 ILE B N   1 
ATOM   5188  C  CA  . ILE B 1 184 ? 244.865 238.819 215.321 1.00 71.53  0  184 ILE B CA  1 
ATOM   5189  C  C   . ILE B 1 184 ? 245.469 237.820 214.345 1.00 71.53  0  184 ILE B C   1 
ATOM   5190  O  O   . ILE B 1 184 ? 246.204 238.207 213.430 1.00 71.53  0  184 ILE B O   1 
ATOM   5191  C  CB  . ILE B 1 184 ? 243.696 239.590 214.678 1.00 71.53  0  184 ILE B CB  1 
ATOM   5192  C  CG1 . ILE B 1 184 ? 243.164 240.650 215.646 1.00 71.53  0  184 ILE B CG1 1 
ATOM   5193  C  CG2 . ILE B 1 184 ? 242.577 238.642 214.266 1.00 71.53  0  184 ILE B CG2 1 
ATOM   5194  C  CD1 . ILE B 1 184 ? 241.947 241.388 215.153 1.00 71.53  0  184 ILE B CD1 1 
ATOM   5195  N  N   . PHE B 1 185 ? 245.176 236.539 214.554 1.00 71.73  0  185 PHE B N   1 
ATOM   5196  C  CA  . PHE B 1 185 ? 245.646 235.477 213.681 1.00 71.73  0  185 PHE B CA  1 
ATOM   5197  C  C   . PHE B 1 185 ? 244.479 234.576 213.307 1.00 71.73  0  185 PHE B C   1 
ATOM   5198  O  O   . PHE B 1 185 ? 243.433 234.574 213.961 1.00 71.73  0  185 PHE B O   1 
ATOM   5199  C  CB  . PHE B 1 185 ? 246.753 234.649 214.343 1.00 71.73  0  185 PHE B CB  1 
ATOM   5200  C  CG  . PHE B 1 185 ? 248.078 235.349 214.404 1.00 71.73  0  185 PHE B CG  1 
ATOM   5201  C  CD1 . PHE B 1 185 ? 248.404 236.146 215.488 1.00 71.73  0  185 PHE B CD1 1 
ATOM   5202  C  CD2 . PHE B 1 185 ? 248.998 235.208 213.377 1.00 71.73  0  185 PHE B CD2 1 
ATOM   5203  C  CE1 . PHE B 1 185 ? 249.625 236.791 215.549 1.00 71.73  0  185 PHE B CE1 1 
ATOM   5204  C  CE2 . PHE B 1 185 ? 250.221 235.850 213.431 1.00 71.73  0  185 PHE B CE2 1 
ATOM   5205  C  CZ  . PHE B 1 185 ? 250.534 236.642 214.518 1.00 71.73  0  185 PHE B CZ  1 
ATOM   5206  N  N   . LYS B 1 186 ? 244.667 233.809 212.237 1.00 68.84  0  186 LYS B N   1 
ATOM   5207  C  CA  . LYS B 1 186 ? 243.672 232.853 211.774 1.00 68.84  0  186 LYS B CA  1 
ATOM   5208  C  C   . LYS B 1 186 ? 244.228 231.443 211.907 1.00 68.84  0  186 LYS B C   1 
ATOM   5209  O  O   . LYS B 1 186 ? 245.403 231.204 211.619 1.00 68.84  0  186 LYS B O   1 
ATOM   5210  C  CB  . LYS B 1 186 ? 243.276 233.132 210.319 1.00 68.84  0  186 LYS B CB  1 
ATOM   5211  C  CG  . LYS B 1 186 ? 242.122 232.284 209.807 1.00 68.84  0  186 LYS B CG  1 
ATOM   5212  C  CD  . LYS B 1 186 ? 241.785 232.615 208.366 1.00 68.84  0  186 LYS B CD  1 
ATOM   5213  C  CE  . LYS B 1 186 ? 240.871 231.562 207.765 1.00 68.84  0  186 LYS B CE  1 
ATOM   5214  N  NZ  . LYS B 1 186 ? 239.687 231.296 208.624 1.00 68.84  1  186 LYS B NZ  1 
ATOM   5215  N  N   . GLU B 1 187 ? 243.389 230.517 212.363 1.00 69.49  0  187 GLU B N   1 
ATOM   5216  C  CA  . GLU B 1 187 ? 243.781 229.115 212.433 1.00 69.49  0  187 GLU B CA  1 
ATOM   5217  C  C   . GLU B 1 187 ? 243.909 228.549 211.024 1.00 69.49  0  187 GLU B C   1 
ATOM   5218  O  O   . GLU B 1 187 ? 242.944 228.559 210.252 1.00 69.49  0  187 GLU B O   1 
ATOM   5219  C  CB  . GLU B 1 187 ? 242.764 228.318 213.243 1.00 69.49  0  187 GLU B CB  1 
ATOM   5220  C  CG  . GLU B 1 187 ? 242.803 228.601 214.733 1.00 69.49  0  187 GLU B CG  1 
ATOM   5221  C  CD  . GLU B 1 187 ? 242.528 227.366 215.566 1.00 69.49  0  187 GLU B CD  1 
ATOM   5222  O  OE1 . GLU B 1 187 ? 242.897 227.358 216.759 1.00 69.49  0  187 GLU B OE1 1 
ATOM   5223  O  OE2 . GLU B 1 187 ? 241.943 226.403 215.028 1.00 69.49  -1 187 GLU B OE2 1 
ATOM   5224  N  N   . SER B 1 188 ? 245.099 228.058 210.688 1.00 67.06  0  188 SER B N   1 
ATOM   5225  C  CA  . SER B 1 188 ? 245.372 227.567 209.347 1.00 67.06  0  188 SER B CA  1 
ATOM   5226  C  C   . SER B 1 188 ? 246.323 226.384 209.435 1.00 67.06  0  188 SER B C   1 
ATOM   5227  O  O   . SER B 1 188 ? 246.851 226.060 210.499 1.00 67.06  0  188 SER B O   1 
ATOM   5228  C  CB  . SER B 1 188 ? 245.963 228.666 208.459 1.00 67.06  0  188 SER B CB  1 
ATOM   5229  O  OG  . SER B 1 188 ? 246.664 228.108 207.362 1.00 67.06  0  188 SER B OG  1 
ATOM   5230  N  N   . SER B 1 189 ? 246.526 225.749 208.319 1.00 70.81  0  189 SER B N   1 
ATOM   5231  C  CA  . SER B 1 189 ? 247.474 224.652 208.258 1.00 70.81  0  189 SER B CA  1 
ATOM   5232  C  C   . SER B 1 189 ? 248.795 225.130 207.668 1.00 70.81  0  189 SER B C   1 
ATOM   5233  O  O   . SER B 1 189 ? 248.808 226.000 206.793 1.00 70.81  0  189 SER B O   1 
ATOM   5234  C  CB  . SER B 1 189 ? 246.917 223.507 207.408 1.00 70.81  0  189 SER B CB  1 
ATOM   5235  O  OG  . SER B 1 189 ? 247.599 222.292 207.666 1.00 70.81  0  189 SER B OG  1 
ATOM   5236  N  N   . PRO B 1 190 ? 249.928 224.592 208.137 1.00 70.07  0  190 PRO B N   1 
ATOM   5237  C  CA  . PRO B 1 190 ? 251.224 225.012 207.576 1.00 70.07  0  190 PRO B CA  1 
ATOM   5238  C  C   . PRO B 1 190 ? 251.447 224.563 206.143 1.00 70.07  0  190 PRO B C   1 
ATOM   5239  O  O   . PRO B 1 190 ? 252.286 225.155 205.452 1.00 70.07  0  190 PRO B O   1 
ATOM   5240  C  CB  . PRO B 1 190 ? 252.246 224.366 208.523 1.00 70.07  0  190 PRO B CB  1 
ATOM   5241  C  CG  . PRO B 1 190 ? 251.482 224.056 209.768 1.00 70.07  0  190 PRO B CG  1 
ATOM   5242  C  CD  . PRO B 1 190 ? 250.097 223.727 209.316 1.00 70.07  0  190 PRO B CD  1 
ATOM   5243  N  N   . SER B 1 191 ? 250.730 223.545 205.675 1.00 72.88  0  191 SER B N   1 
ATOM   5244  C  CA  . SER B 1 191 ? 250.837 223.075 204.302 1.00 72.88  0  191 SER B CA  1 
ATOM   5245  C  C   . SER B 1 191 ? 249.842 223.752 203.369 1.00 72.88  0  191 SER B C   1 
ATOM   5246  O  O   . SER B 1 191 ? 249.728 223.347 202.209 1.00 72.88  0  191 SER B O   1 
ATOM   5247  C  CB  . SER B 1 191 ? 250.647 221.557 204.249 1.00 72.88  0  191 SER B CB  1 
ATOM   5248  O  OG  . SER B 1 191 ? 249.272 221.217 204.287 1.00 72.88  0  191 SER B OG  1 
ATOM   5249  N  N   . HIS B 1 192 ? 249.125 224.767 203.845 1.00 69.82  0  192 HIS B N   1 
ATOM   5250  C  CA  . HIS B 1 192 ? 248.127 225.423 203.015 1.00 69.82  0  192 HIS B CA  1 
ATOM   5251  C  C   . HIS B 1 192 ? 248.805 226.313 201.974 1.00 69.82  0  192 HIS B C   1 
ATOM   5252  O  O   . HIS B 1 192 ? 249.842 226.920 202.257 1.00 69.82  0  192 HIS B O   1 
ATOM   5253  C  CB  . HIS B 1 192 ? 247.181 226.259 203.877 1.00 69.82  0  192 HIS B CB  1 
ATOM   5254  C  CG  . HIS B 1 192 ? 245.843 226.497 203.250 1.00 69.82  0  192 HIS B CG  1 
ATOM   5255  N  ND1 . HIS B 1 192 ? 245.622 227.491 202.322 1.00 69.82  0  192 HIS B ND1 1 
ATOM   5256  C  CD2 . HIS B 1 192 ? 244.657 225.866 203.414 1.00 69.82  0  192 HIS B CD2 1 
ATOM   5257  C  CE1 . HIS B 1 192 ? 244.359 227.460 201.938 1.00 69.82  0  192 HIS B CE1 1 
ATOM   5258  N  NE2 . HIS B 1 192 ? 243.750 226.486 202.589 1.00 69.82  0  192 HIS B NE2 1 
ATOM   5259  N  N   . PRO B 1 193 ? 248.249 226.406 200.760 1.00 72.34  0  193 PRO B N   1 
ATOM   5260  C  CA  . PRO B 1 193 ? 248.837 227.296 199.744 1.00 72.34  0  193 PRO B CA  1 
ATOM   5261  C  C   . PRO B 1 193 ? 248.642 228.782 200.011 1.00 72.34  0  193 PRO B C   1 
ATOM   5262  O  O   . PRO B 1 193 ? 249.184 229.594 199.249 1.00 72.34  0  193 PRO B O   1 
ATOM   5263  C  CB  . PRO B 1 193 ? 248.119 226.877 198.453 1.00 72.34  0  193 PRO B CB  1 
ATOM   5264  C  CG  . PRO B 1 193 ? 247.619 225.500 198.721 1.00 72.34  0  193 PRO B CG  1 
ATOM   5265  C  CD  . PRO B 1 193 ? 247.263 225.484 200.173 1.00 72.34  0  193 PRO B CD  1 
ATOM   5266  N  N   . THR B 1 194 ? 247.888 229.169 201.042 1.00 72.27  0  194 THR B N   1 
ATOM   5267  C  CA  . THR B 1 194 ? 247.756 230.585 201.369 1.00 72.27  0  194 THR B CA  1 
ATOM   5268  C  C   . THR B 1 194 ? 249.051 231.129 201.957 1.00 72.27  0  194 THR B C   1 
ATOM   5269  O  O   . THR B 1 194 ? 249.660 232.049 201.403 1.00 72.27  0  194 THR B O   1 
ATOM   5270  C  CB  . THR B 1 194 ? 246.591 230.800 202.337 1.00 72.27  0  194 THR B CB  1 
ATOM   5271  O  OG1 . THR B 1 194 ? 245.362 230.442 201.695 1.00 72.27  0  194 THR B OG1 1 
ATOM   5272  C  CG2 . THR B 1 194 ? 246.519 232.257 202.765 1.00 72.27  0  194 THR B CG2 1 
ATOM   5273  N  N   . ARG B 1 195 ? 249.494 230.561 203.074 1.00 75.94  0  195 ARG B N   1 
ATOM   5274  C  CA  . ARG B 1 195 ? 250.734 230.988 203.708 1.00 75.94  0  195 ARG B CA  1 
ATOM   5275  C  C   . ARG B 1 195 ? 251.933 230.382 202.978 1.00 75.94  0  195 ARG B C   1 
ATOM   5276  O  O   . ARG B 1 195 ? 252.047 229.157 202.850 1.00 75.94  0  195 ARG B O   1 
ATOM   5277  C  CB  . ARG B 1 195 ? 250.699 230.640 205.200 1.00 75.94  0  195 ARG B CB  1 
ATOM   5278  C  CG  . ARG B 1 195 ? 250.345 229.197 205.550 1.00 75.94  0  195 ARG B CG  1 
ATOM   5279  C  CD  . ARG B 1 195 ? 250.228 228.994 207.052 1.00 75.94  0  195 ARG B CD  1 
ATOM   5280  N  NE  . ARG B 1 195 ? 251.503 229.135 207.746 1.00 75.94  0  195 ARG B NE  1 
ATOM   5281  C  CZ  . ARG B 1 195 ? 251.620 229.273 209.062 1.00 75.94  0  195 ARG B CZ  1 
ATOM   5282  N  NH1 . ARG B 1 195 ? 250.538 229.290 209.828 1.00 75.94  1  195 ARG B NH1 1 
ATOM   5283  N  NH2 . ARG B 1 195 ? 252.820 229.395 209.613 1.00 75.94  0  195 ARG B NH2 1 
ATOM   5284  N  N   . CYS B 1 196 ? 252.797 231.246 202.449 1.00 86.88  0  196 CYS B N   1 
ATOM   5285  C  CA  . CYS B 1 196 ? 253.996 230.809 201.753 1.00 86.88  0  196 CYS B CA  1 
ATOM   5286  C  C   . CYS B 1 196 ? 255.177 230.766 202.719 1.00 86.88  0  196 CYS B C   1 
ATOM   5287  O  O   . CYS B 1 196 ? 255.077 231.158 203.883 1.00 86.88  0  196 CYS B O   1 
ATOM   5288  C  CB  . CYS B 1 196 ? 254.303 231.728 200.571 1.00 86.88  0  196 CYS B CB  1 
ATOM   5289  S  SG  . CYS B 1 196 ? 254.305 233.488 200.967 1.00 86.88  0  196 CYS B SG  1 
ATOM   5290  N  N   . HIS B 1 197 ? 256.325 230.302 202.218 1.00 93.66  0  197 HIS B N   1 
ATOM   5291  C  CA  . HIS B 1 197 ? 257.520 230.200 203.047 1.00 93.66  0  197 HIS B CA  1 
ATOM   5292  C  C   . HIS B 1 197 ? 258.137 231.560 203.347 1.00 93.66  0  197 HIS B C   1 
ATOM   5293  O  O   . HIS B 1 197 ? 258.919 231.674 204.297 1.00 93.66  0  197 HIS B O   1 
ATOM   5294  C  CB  . HIS B 1 197 ? 258.554 229.301 202.369 1.00 93.66  0  197 HIS B CB  1 
ATOM   5295  C  CG  . HIS B 1 197 ? 258.025 227.955 201.984 1.00 93.66  0  197 HIS B CG  1 
ATOM   5296  N  ND1 . HIS B 1 197 ? 257.842 226.938 202.897 1.00 93.66  0  197 HIS B ND1 1 
ATOM   5297  C  CD2 . HIS B 1 197 ? 257.640 227.457 200.785 1.00 93.66  0  197 HIS B CD2 1 
ATOM   5298  C  CE1 . HIS B 1 197 ? 257.368 225.872 202.276 1.00 93.66  0  197 HIS B CE1 1 
ATOM   5299  N  NE2 . HIS B 1 197 ? 257.236 226.161 200.994 1.00 93.66  0  197 HIS B NE2 1 
ATOM   5300  N  N   . GLU B 1 198 ? 257.806 232.588 202.565 1.00 93.77  0  198 GLU B N   1 
ATOM   5301  C  CA  . GLU B 1 198 ? 258.332 233.923 202.812 1.00 93.77  0  198 GLU B CA  1 
ATOM   5302  C  C   . GLU B 1 198 ? 257.556 234.669 203.889 1.00 93.77  0  198 GLU B C   1 
ATOM   5303  O  O   . GLU B 1 198 ? 258.084 235.632 204.456 1.00 93.77  0  198 GLU B O   1 
ATOM   5304  C  CB  . GLU B 1 198 ? 258.330 234.748 201.520 1.00 93.77  0  198 GLU B CB  1 
ATOM   5305  C  CG  . GLU B 1 198 ? 259.304 234.264 200.450 1.00 93.77  0  198 GLU B CG  1 
ATOM   5306  C  CD  . GLU B 1 198 ? 258.717 233.192 199.551 1.00 93.77  0  198 GLU B CD  1 
ATOM   5307  O  OE1 . GLU B 1 198 ? 257.521 232.869 199.707 1.00 93.77  0  198 GLU B OE1 1 
ATOM   5308  O  OE2 . GLU B 1 198 ? 259.454 232.672 198.686 1.00 93.77  -1 198 GLU B OE2 1 
ATOM   5309  N  N   . ASP B 1 199 ? 256.325 234.246 204.191 1.00 88.44  0  199 ASP B N   1 
ATOM   5310  C  CA  . ASP B 1 199 ? 255.486 234.949 205.155 1.00 88.44  0  199 ASP B CA  1 
ATOM   5311  C  C   . ASP B 1 199 ? 254.961 234.024 206.248 1.00 88.44  0  199 ASP B C   1 
ATOM   5312  O  O   . ASP B 1 199 ? 253.970 234.357 206.907 1.00 88.44  0  199 ASP B O   1 
ATOM   5313  C  CB  . ASP B 1 199 ? 254.315 235.640 204.450 1.00 88.44  0  199 ASP B CB  1 
ATOM   5314  C  CG  . ASP B 1 199 ? 254.620 237.080 204.086 1.00 88.44  0  199 ASP B CG  1 
ATOM   5315  O  OD1 . ASP B 1 199 ? 253.665 237.846 203.842 1.00 88.44  0  199 ASP B OD1 1 
ATOM   5316  O  OD2 . ASP B 1 199 ? 255.813 237.447 204.045 1.00 88.44  -1 199 ASP B OD2 1 
ATOM   5317  N  N   . ASN B 1 200 ? 255.594 232.871 206.450 1.00 84.66  0  200 ASN B N   1 
ATOM   5318  C  CA  . ASN B 1 200 ? 255.192 231.981 207.531 1.00 84.66  0  200 ASN B CA  1 
ATOM   5319  C  C   . ASN B 1 200 ? 255.634 232.559 208.868 1.00 84.66  0  200 ASN B C   1 
ATOM   5320  O  O   . ASN B 1 200 ? 256.759 233.044 209.011 1.00 84.66  0  200 ASN B O   1 
ATOM   5321  C  CB  . ASN B 1 200 ? 255.786 230.587 207.338 1.00 84.66  0  200 ASN B CB  1 
ATOM   5322  C  CG  . ASN B 1 200 ? 254.859 229.654 206.587 1.00 84.66  0  200 ASN B CG  1 
ATOM   5323  O  OD1 . ASN B 1 200 ? 253.639 229.739 206.713 1.00 84.66  0  200 ASN B OD1 1 
ATOM   5324  N  ND2 . ASN B 1 200 ? 255.437 228.756 205.799 1.00 84.66  0  200 ASN B ND2 1 
ATOM   5325  N  N   . VAL B 1 201 ? 254.741 232.507 209.850 1.00 75.44  0  201 VAL B N   1 
ATOM   5326  C  CA  . VAL B 1 201 ? 254.950 233.148 211.142 1.00 75.44  0  201 VAL B CA  1 
ATOM   5327  C  C   . VAL B 1 201 ? 254.787 232.096 212.229 1.00 75.44  0  201 VAL B C   1 
ATOM   5328  O  O   . VAL B 1 201 ? 253.762 231.407 212.282 1.00 75.44  0  201 VAL B O   1 
ATOM   5329  C  CB  . VAL B 1 201 ? 253.965 234.317 211.351 1.00 75.44  0  201 VAL B CB  1 
ATOM   5330  C  CG1 . VAL B 1 201 ? 253.839 234.682 212.821 1.00 75.44  0  201 VAL B CG1 1 
ATOM   5331  C  CG2 . VAL B 1 201 ? 254.397 235.525 210.534 1.00 75.44  0  201 VAL B CG2 1 
ATOM   5332  N  N   . VAL B 1 202 ? 255.798 231.964 213.086 1.00 70.72  0  202 VAL B N   1 
ATOM   5333  C  CA  . VAL B 1 202 ? 255.729 231.089 214.248 1.00 70.72  0  202 VAL B CA  1 
ATOM   5334  C  C   . VAL B 1 202 ? 255.814 231.950 215.505 1.00 70.72  0  202 VAL B C   1 
ATOM   5335  O  O   . VAL B 1 202 ? 256.674 232.835 215.616 1.00 70.72  0  202 VAL B O   1 
ATOM   5336  C  CB  . VAL B 1 202 ? 256.813 229.988 214.203 1.00 70.72  0  202 VAL B CB  1 
ATOM   5337  C  CG1 . VAL B 1 202 ? 258.220 230.550 214.005 1.00 70.72  0  202 VAL B CG1 1 
ATOM   5338  C  CG2 . VAL B 1 202 ? 256.756 229.116 215.452 1.00 70.72  0  202 VAL B CG2 1 
ATOM   5339  N  N   . VAL B 1 203 ? 254.874 231.734 216.424 1.00 69.88  0  203 VAL B N   1 
ATOM   5340  C  CA  . VAL B 1 203 ? 254.809 232.495 217.660 1.00 69.88  0  203 VAL B CA  1 
ATOM   5341  C  C   . VAL B 1 203 ? 254.896 231.530 218.832 1.00 69.88  0  203 VAL B C   1 
ATOM   5342  O  O   . VAL B 1 203 ? 254.817 230.313 218.678 1.00 69.88  0  203 VAL B O   1 
ATOM   5343  C  CB  . VAL B 1 203 ? 253.534 233.357 217.763 1.00 69.88  0  203 VAL B CB  1 
ATOM   5344  C  CG1 . VAL B 1 203 ? 253.388 234.268 216.556 1.00 69.88  0  203 VAL B CG1 1 
ATOM   5345  C  CG2 . VAL B 1 203 ? 252.311 232.474 217.912 1.00 69.88  0  203 VAL B CG2 1 
ATOM   5346  N  N   . ALA B 1 204 ? 255.065 232.101 220.017 1.00 72.86  0  204 ALA B N   1 
ATOM   5347  C  CA  . ALA B 1 204 ? 255.034 231.352 221.267 1.00 72.86  0  204 ALA B CA  1 
ATOM   5348  C  C   . ALA B 1 204 ? 254.261 232.208 222.255 1.00 72.86  0  204 ALA B C   1 
ATOM   5349  O  O   . ALA B 1 204 ? 254.752 233.261 222.675 1.00 72.86  0  204 ALA B O   1 
ATOM   5350  C  CB  . ALA B 1 204 ? 256.440 231.045 221.779 1.00 72.86  0  204 ALA B CB  1 
ATOM   5351  N  N   . VAL B 1 205 ? 253.046 231.779 222.592 1.00 77.80  0  205 VAL B N   1 
ATOM   5352  C  CA  . VAL B 1 205 ? 252.125 232.603 223.364 1.00 77.80  0  205 VAL B CA  1 
ATOM   5353  C  C   . VAL B 1 205 ? 251.744 231.857 224.633 1.00 77.80  0  205 VAL B C   1 
ATOM   5354  O  O   . VAL B 1 205 ? 252.231 230.751 224.887 1.00 77.80  0  205 VAL B O   1 
ATOM   5355  C  CB  . VAL B 1 205 ? 250.868 232.954 222.547 1.00 77.80  0  205 VAL B CB  1 
ATOM   5356  C  CG1 . VAL B 1 205 ? 251.234 233.766 221.314 1.00 77.80  0  205 VAL B CG1 1 
ATOM   5357  C  CG2 . VAL B 1 205 ? 250.124 231.689 222.155 1.00 77.80  0  205 VAL B CG2 1 
ATOM   5358  N  N   . ASP B 1 206 ? 250.879 232.459 225.437 1.00 85.99  0  206 ASP B N   1 
ATOM   5359  C  CA  . ASP B 1 206 ? 250.342 231.832 226.633 1.00 85.99  0  206 ASP B CA  1 
ATOM   5360  C  C   . ASP B 1 206 ? 249.030 231.133 226.283 1.00 85.99  0  206 ASP B C   1 
ATOM   5361  O  O   . ASP B 1 206 ? 248.352 231.470 225.310 1.00 85.99  0  206 ASP B O   1 
ATOM   5362  C  CB  . ASP B 1 206 ? 250.182 232.863 227.760 1.00 85.99  0  206 ASP B CB  1 
ATOM   5363  C  CG  . ASP B 1 206 ? 249.878 232.231 229.131 1.00 85.99  0  206 ASP B CG  1 
ATOM   5364  O  OD1 . ASP B 1 206 ? 249.798 232.982 230.118 1.00 85.99  0  206 ASP B OD1 1 
ATOM   5365  O  OD2 . ASP B 1 206 ? 249.648 231.012 229.235 1.00 85.99  -1 206 ASP B OD2 1 
ATOM   5366  N  N   . SER B 1 207 ? 248.688 230.133 227.090 1.00 88.72  0  207 SER B N   1 
ATOM   5367  C  CA  . SER B 1 207 ? 247.521 229.300 226.837 1.00 88.72  0  207 SER B CA  1 
ATOM   5368  C  C   . SER B 1 207 ? 246.256 229.819 227.507 1.00 88.72  0  207 SER B C   1 
ATOM   5369  O  O   . SER B 1 207 ? 245.168 229.676 226.937 1.00 88.72  0  207 SER B O   1 
ATOM   5370  C  CB  . SER B 1 207 ? 247.791 227.863 227.293 1.00 88.72  0  207 SER B CB  1 
ATOM   5371  O  OG  . SER B 1 207 ? 248.423 227.839 228.559 1.00 88.72  0  207 SER B OG  1 
ATOM   5372  N  N   . THR B 1 208 ? 246.355 230.424 228.693 1.00 90.49  0  208 THR B N   1 
ATOM   5373  C  CA  . THR B 1 208 ? 245.151 230.791 229.425 1.00 90.49  0  208 THR B CA  1 
ATOM   5374  C  C   . THR B 1 208 ? 244.809 232.274 229.350 1.00 90.49  0  208 THR B C   1 
ATOM   5375  O  O   . THR B 1 208 ? 243.646 232.629 229.569 1.00 90.49  0  208 THR B O   1 
ATOM   5376  C  CB  . THR B 1 208 ? 245.284 230.385 230.899 1.00 90.49  0  208 THR B CB  1 
ATOM   5377  O  OG1 . THR B 1 208 ? 246.100 231.338 231.591 1.00 90.49  0  208 THR B OG1 1 
ATOM   5378  C  CG2 . THR B 1 208 ? 245.911 229.003 231.021 1.00 90.49  0  208 THR B CG2 1 
ATOM   5379  N  N   . THR B 1 209 ? 245.772 233.150 229.049 1.00 84.92  0  209 THR B N   1 
ATOM   5380  C  CA  . THR B 1 209 ? 245.487 234.573 228.896 1.00 84.92  0  209 THR B CA  1 
ATOM   5381  C  C   . THR B 1 209 ? 246.009 235.112 227.569 1.00 84.92  0  209 THR B C   1 
ATOM   5382  O  O   . THR B 1 209 ? 246.029 236.333 227.385 1.00 84.92  0  209 THR B O   1 
ATOM   5383  C  CB  . THR B 1 209 ? 246.044 235.405 230.061 1.00 84.92  0  209 THR B CB  1 
ATOM   5384  O  OG1 . THR B 1 209 ? 245.760 236.790 229.830 1.00 84.92  0  209 THR B OG1 1 
ATOM   5385  C  CG2 . THR B 1 209 ? 247.528 235.248 230.174 1.00 84.92  0  209 THR B CG2 1 
ATOM   5386  N  N   . ASN B 1 210 ? 246.419 234.219 226.653 1.00 80.79  0  210 ASN B N   1 
ATOM   5387  C  CA  . ASN B 1 210 ? 246.848 234.428 225.263 1.00 80.79  0  210 ASN B CA  1 
ATOM   5388  C  C   . ASN B 1 210 ? 247.706 235.664 224.991 1.00 80.79  0  210 ASN B C   1 
ATOM   5389  O  O   . ASN B 1 210 ? 247.518 236.347 223.979 1.00 80.79  0  210 ASN B O   1 
ATOM   5390  C  CB  . ASN B 1 210 ? 245.631 234.404 224.311 1.00 80.79  0  210 ASN B CB  1 
ATOM   5391  C  CG  . ASN B 1 210 ? 244.536 235.410 224.669 1.00 80.79  0  210 ASN B CG  1 
ATOM   5392  O  OD1 . ASN B 1 210 ? 244.782 236.603 224.841 1.00 80.79  0  210 ASN B OD1 1 
ATOM   5393  N  ND2 . ASN B 1 210 ? 243.310 234.914 224.785 1.00 80.79  0  210 ASN B ND2 1 
ATOM   5394  N  N   . ARG B 1 211 ? 248.667 235.941 225.869 1.00 79.97  0  211 ARG B N   1 
ATOM   5395  C  CA  . ARG B 1 211 ? 249.626 237.014 225.644 1.00 79.97  0  211 ARG B CA  1 
ATOM   5396  C  C   . ARG B 1 211 ? 250.828 236.489 224.869 1.00 79.97  0  211 ARG B C   1 
ATOM   5397  O  O   . ARG B 1 211 ? 251.311 235.381 225.120 1.00 79.97  0  211 ARG B O   1 
ATOM   5398  C  CB  . ARG B 1 211 ? 250.086 237.631 226.968 1.00 79.97  0  211 ARG B CB  1 
ATOM   5399  C  CG  . ARG B 1 211 ? 250.466 236.631 228.047 1.00 79.97  0  211 ARG B CG  1 
ATOM   5400  C  CD  . ARG B 1 211 ? 250.793 237.345 229.348 1.00 79.97  0  211 ARG B CD  1 
ATOM   5401  N  NE  . ARG B 1 211 ? 251.891 238.294 229.184 1.00 79.97  0  211 ARG B NE  1 
ATOM   5402  C  CZ  . ARG B 1 211 ? 253.140 238.072 229.582 1.00 79.97  0  211 ARG B CZ  1 
ATOM   5403  N  NH1 . ARG B 1 211 ? 253.456 236.929 230.176 1.00 79.97  1  211 ARG B NH1 1 
ATOM   5404  N  NH2 . ARG B 1 211 ? 254.073 238.994 229.389 1.00 79.97  0  211 ARG B NH2 1 
ATOM   5405  N  N   . VAL B 1 212 ? 251.298 237.287 223.916 1.00 73.56  0  212 VAL B N   1 
ATOM   5406  C  CA  . VAL B 1 212 ? 252.396 236.880 223.047 1.00 73.56  0  212 VAL B CA  1 
ATOM   5407  C  C   . VAL B 1 212 ? 253.711 237.032 223.798 1.00 73.56  0  212 VAL B C   1 
ATOM   5408  O  O   . VAL B 1 212 ? 253.977 238.074 224.408 1.00 73.56  0  212 VAL B O   1 
ATOM   5409  C  CB  . VAL B 1 212 ? 252.399 237.707 221.752 1.00 73.56  0  212 VAL B CB  1 
ATOM   5410  C  CG1 . VAL B 1 212 ? 253.429 237.167 220.772 1.00 73.56  0  212 VAL B CG1 1 
ATOM   5411  C  CG2 . VAL B 1 212 ? 251.017 237.717 221.125 1.00 73.56  0  212 VAL B CG2 1 
ATOM   5412  N  N   . LEU B 1 213 ? 254.536 235.988 223.760 1.00 75.30  0  213 LEU B N   1 
ATOM   5413  C  CA  . LEU B 1 213 ? 255.859 236.003 224.370 1.00 75.30  0  213 LEU B CA  1 
ATOM   5414  C  C   . LEU B 1 213 ? 256.984 235.993 223.350 1.00 75.30  0  213 LEU B C   1 
ATOM   5415  O  O   . LEU B 1 213 ? 258.022 236.616 223.578 1.00 75.30  0  213 LEU B O   1 
ATOM   5416  C  CB  . LEU B 1 213 ? 256.022 234.806 225.314 1.00 75.30  0  213 LEU B CB  1 
ATOM   5417  C  CG  . LEU B 1 213 ? 254.859 234.529 226.267 1.00 75.30  0  213 LEU B CG  1 
ATOM   5418  C  CD1 . LEU B 1 213 ? 255.123 233.272 227.078 1.00 75.30  0  213 LEU B CD1 1 
ATOM   5419  C  CD2 . LEU B 1 213 ? 254.622 235.719 227.180 1.00 75.30  0  213 LEU B CD2 1 
ATOM   5420  N  N   . HIS B 1 214 ? 256.805 235.299 222.229 1.00 75.85  0  214 HIS B N   1 
ATOM   5421  C  CA  . HIS B 1 214 ? 257.789 235.302 221.157 1.00 75.85  0  214 HIS B CA  1 
ATOM   5422  C  C   . HIS B 1 214 ? 257.070 235.328 219.817 1.00 75.85  0  214 HIS B C   1 
ATOM   5423  O  O   . HIS B 1 214 ? 255.961 234.809 219.683 1.00 75.85  0  214 HIS B O   1 
ATOM   5424  C  CB  . HIS B 1 214 ? 258.722 234.087 221.230 1.00 75.85  0  214 HIS B CB  1 
ATOM   5425  C  CG  . HIS B 1 214 ? 259.983 234.249 220.440 1.00 75.85  0  214 HIS B CG  1 
ATOM   5426  N  ND1 . HIS B 1 214 ? 260.974 235.138 220.795 1.00 75.85  0  214 HIS B ND1 1 
ATOM   5427  C  CD2 . HIS B 1 214 ? 260.412 233.639 219.310 1.00 75.85  0  214 HIS B CD2 1 
ATOM   5428  C  CE1 . HIS B 1 214 ? 261.960 235.067 219.920 1.00 75.85  0  214 HIS B CE1 1 
ATOM   5429  N  NE2 . HIS B 1 214 ? 261.644 234.165 219.009 1.00 75.85  0  214 HIS B NE2 1 
ATOM   5430  N  N   . PHE B 1 215 ? 257.730 235.911 218.819 1.00 74.12  0  215 PHE B N   1 
ATOM   5431  C  CA  . PHE B 1 215 ? 257.122 236.129 217.508 1.00 74.12  0  215 PHE B CA  1 
ATOM   5432  C  C   . PHE B 1 215 ? 258.240 236.225 216.484 1.00 74.12  0  215 PHE B C   1 
ATOM   5433  O  O   . PHE B 1 215 ? 259.089 237.115 216.591 1.00 74.12  0  215 PHE B O   1 
ATOM   5434  C  CB  . PHE B 1 215 ? 256.269 237.406 217.526 1.00 74.12  0  215 PHE B CB  1 
ATOM   5435  C  CG  . PHE B 1 215 ? 255.943 237.959 216.162 1.00 74.12  0  215 PHE B CG  1 
ATOM   5436  C  CD1 . PHE B 1 215 ? 254.923 237.411 215.402 1.00 74.12  0  215 PHE B CD1 1 
ATOM   5437  C  CD2 . PHE B 1 215 ? 256.628 239.061 215.661 1.00 74.12  0  215 PHE B CD2 1 
ATOM   5438  C  CE1 . PHE B 1 215 ? 254.612 237.930 214.156 1.00 74.12  0  215 PHE B CE1 1 
ATOM   5439  C  CE2 . PHE B 1 215 ? 256.324 239.580 214.415 1.00 74.12  0  215 PHE B CE2 1 
ATOM   5440  C  CZ  . PHE B 1 215 ? 255.314 239.013 213.664 1.00 74.12  0  215 PHE B CZ  1 
ATOM   5441  N  N   . GLN B 1 216 ? 258.249 235.329 215.497 1.00 73.76  0  216 GLN B N   1 
ATOM   5442  C  CA  . GLN B 1 216 ? 259.282 235.375 214.473 1.00 73.76  0  216 GLN B CA  1 
ATOM   5443  C  C   . GLN B 1 216 ? 258.750 234.769 213.183 1.00 73.76  0  216 GLN B C   1 
ATOM   5444  O  O   . GLN B 1 216 ? 257.650 234.211 213.135 1.00 73.76  0  216 GLN B O   1 
ATOM   5445  C  CB  . GLN B 1 216 ? 260.558 234.655 214.925 1.00 73.76  0  216 GLN B CB  1 
ATOM   5446  C  CG  . GLN B 1 216 ? 260.332 233.256 215.459 1.00 73.76  0  216 GLN B CG  1 
ATOM   5447  C  CD  . GLN B 1 216 ? 261.609 232.615 215.963 1.00 73.76  0  216 GLN B CD  1 
ATOM   5448  O  OE1 . GLN B 1 216 ? 262.667 233.242 215.980 1.00 73.76  0  216 GLN B OE1 1 
ATOM   5449  N  NE2 . GLN B 1 216 ? 261.516 231.356 216.376 1.00 73.76  0  216 GLN B NE2 1 
ATOM   5450  N  N   . LYS B 1 217 ? 259.551 234.895 212.132 1.00 76.30  0  217 LYS B N   1 
ATOM   5451  C  CA  . LYS B 1 217 ? 259.244 234.361 210.815 1.00 76.30  0  217 LYS B CA  1 
ATOM   5452  C  C   . LYS B 1 217 ? 260.220 233.245 210.468 1.00 76.30  0  217 LYS B C   1 
ATOM   5453  O  O   . LYS B 1 217 ? 261.244 233.050 211.129 1.00 76.30  0  217 LYS B O   1 
ATOM   5454  C  CB  . LYS B 1 217 ? 259.289 235.466 209.755 1.00 76.30  0  217 LYS B CB  1 
ATOM   5455  C  CG  . LYS B 1 217 ? 258.270 236.571 209.974 1.00 76.30  0  217 LYS B CG  1 
ATOM   5456  C  CD  . LYS B 1 217 ? 258.396 237.654 208.917 1.00 76.30  0  217 LYS B CD  1 
ATOM   5457  C  CE  . LYS B 1 217 ? 257.390 238.767 209.148 1.00 76.30  0  217 LYS B CE  1 
ATOM   5458  N  NZ  . LYS B 1 217 ? 255.989 238.280 209.025 1.00 76.30  1  217 LYS B NZ  1 
ATOM   5459  N  N   . THR B 1 218 ? 259.890 232.506 209.412 1.00 80.93  0  218 THR B N   1 
ATOM   5460  C  CA  . THR B 1 218 ? 260.677 231.360 208.972 1.00 80.93  0  218 THR B CA  1 
ATOM   5461  C  C   . THR B 1 218 ? 261.392 231.650 207.656 1.00 80.93  0  218 THR B C   1 
ATOM   5462  O  O   . THR B 1 218 ? 261.510 230.780 206.792 1.00 80.93  0  218 THR B O   1 
ATOM   5463  C  CB  . THR B 1 218 ? 259.800 230.122 208.817 1.00 80.93  0  218 THR B CB  1 
ATOM   5464  O  OG1 . THR B 1 218 ? 259.017 230.247 207.625 1.00 80.93  0  218 THR B OG1 1 
ATOM   5465  C  CG2 . THR B 1 218 ? 258.859 229.984 210.003 1.00 80.93  0  218 THR B CG2 1 
ATOM   5466  N  N   . GLN B 1 219 ? 261.869 232.883 207.487 1.00 84.36  0  219 GLN B N   1 
ATOM   5467  C  CA  . GLN B 1 219 ? 262.496 233.288 206.235 1.00 84.36  0  219 GLN B CA  1 
ATOM   5468  C  C   . GLN B 1 219 ? 263.886 232.678 206.123 1.00 84.36  0  219 GLN B C   1 
ATOM   5469  O  O   . GLN B 1 219 ? 264.885 233.313 206.478 1.00 84.36  0  219 GLN B O   1 
ATOM   5470  C  CB  . GLN B 1 219 ? 262.568 234.813 206.137 1.00 84.36  0  219 GLN B CB  1 
ATOM   5471  N  N   . GLY B 1 220 ? 263.953 231.445 205.630 1.00 86.01  0  220 GLY B N   1 
ATOM   5472  C  CA  . GLY B 1 220 ? 265.212 230.741 205.489 1.00 86.01  0  220 GLY B CA  1 
ATOM   5473  C  C   . GLY B 1 220 ? 265.744 230.236 206.813 1.00 86.01  0  220 GLY B C   1 
ATOM   5474  O  O   . GLY B 1 220 ? 266.868 230.561 207.205 1.00 86.01  0  220 GLY B O   1 
ATOM   5475  N  N   . LEU B 1 221 ? 264.940 229.436 207.512 1.00 83.87  0  221 LEU B N   1 
ATOM   5476  C  CA  . LEU B 1 221 ? 265.319 228.889 208.812 1.00 83.87  0  221 LEU B CA  1 
ATOM   5477  C  C   . LEU B 1 221 ? 264.753 227.480 208.918 1.00 83.87  0  221 LEU B C   1 
ATOM   5478  O  O   . LEU B 1 221 ? 263.532 227.303 208.970 1.00 83.87  0  221 LEU B O   1 
ATOM   5479  C  CB  . LEU B 1 221 ? 264.812 229.769 209.954 1.00 83.87  0  221 LEU B CB  1 
ATOM   5480  N  N   . ARG B 1 222 ? 265.635 226.482 208.949 1.00 81.62  0  222 ARG B N   1 
ATOM   5481  C  CA  . ARG B 1 222 ? 265.217 225.098 209.123 1.00 81.62  0  222 ARG B CA  1 
ATOM   5482  C  C   . ARG B 1 222 ? 265.087 224.696 210.584 1.00 81.62  0  222 ARG B C   1 
ATOM   5483  O  O   . ARG B 1 222 ? 264.367 223.739 210.888 1.00 81.62  0  222 ARG B O   1 
ATOM   5484  C  CB  . ARG B 1 222 ? 266.202 224.155 208.424 1.00 81.62  0  222 ARG B CB  1 
ATOM   5485  N  N   . ARG B 1 223 ? 265.762 225.401 211.489 1.00 82.03  0  223 ARG B N   1 
ATOM   5486  C  CA  . ARG B 1 223 ? 265.704 225.125 212.917 1.00 82.03  0  223 ARG B CA  1 
ATOM   5487  C  C   . ARG B 1 223 ? 265.404 226.419 213.657 1.00 82.03  0  223 ARG B C   1 
ATOM   5488  O  O   . ARG B 1 223 ? 266.093 227.425 213.457 1.00 82.03  0  223 ARG B O   1 
ATOM   5489  C  CB  . ARG B 1 223 ? 267.019 224.517 213.416 1.00 82.03  0  223 ARG B CB  1 
ATOM   5490  N  N   . PHE B 1 224 ? 264.381 226.393 214.505 1.00 80.94  0  224 PHE B N   1 
ATOM   5491  C  CA  . PHE B 1 224 ? 263.920 227.580 215.208 1.00 80.94  0  224 PHE B CA  1 
ATOM   5492  C  C   . PHE B 1 224 ? 264.392 227.559 216.655 1.00 80.94  0  224 PHE B C   1 
ATOM   5493  O  O   . PHE B 1 224 ? 264.386 226.513 217.309 1.00 80.94  0  224 PHE B O   1 
ATOM   5494  C  CB  . PHE B 1 224 ? 262.395 227.682 215.159 1.00 80.94  0  224 PHE B CB  1 
ATOM   5495  C  CG  . PHE B 1 224 ? 261.823 227.455 213.793 1.00 80.94  0  224 PHE B CG  1 
ATOM   5496  C  CD1 . PHE B 1 224 ? 262.097 228.337 212.760 1.00 80.94  0  224 PHE B CD1 1 
ATOM   5497  C  CD2 . PHE B 1 224 ? 261.014 226.359 213.539 1.00 80.94  0  224 PHE B CD2 1 
ATOM   5498  C  CE1 . PHE B 1 224 ? 261.576 228.131 211.498 1.00 80.94  0  224 PHE B CE1 1 
ATOM   5499  C  CE2 . PHE B 1 224 ? 260.485 226.146 212.278 1.00 80.94  0  224 PHE B CE2 1 
ATOM   5500  C  CZ  . PHE B 1 224 ? 260.766 227.034 211.256 1.00 80.94  0  224 PHE B CZ  1 
ATOM   5501  N  N   . ALA B 1 225 ? 264.800 228.726 217.147 1.00 83.37  0  225 ALA B N   1 
ATOM   5502  C  CA  . ALA B 1 225 ? 265.288 228.892 218.508 1.00 83.37  0  225 ALA B CA  1 
ATOM   5503  C  C   . ALA B 1 225 ? 264.371 229.844 219.259 1.00 83.37  0  225 ALA B C   1 
ATOM   5504  O  O   . ALA B 1 225 ? 264.090 230.949 218.782 1.00 83.37  0  225 ALA B O   1 
ATOM   5505  C  CB  . ALA B 1 225 ? 266.725 229.418 218.519 1.00 83.37  0  225 ALA B CB  1 
ATOM   5506  N  N   . PHE B 1 226 ? 263.908 229.416 220.428 1.00 83.18  0  226 PHE B N   1 
ATOM   5507  C  CA  . PHE B 1 226 ? 263.059 230.219 221.288 1.00 83.18  0  226 PHE B CA  1 
ATOM   5508  C  C   . PHE B 1 226 ? 263.792 230.559 222.583 1.00 83.18  0  226 PHE B C   1 
ATOM   5509  O  O   . PHE B 1 226 ? 264.594 229.757 223.069 1.00 83.18  0  226 PHE B O   1 
ATOM   5510  C  CB  . PHE B 1 226 ? 261.754 229.480 221.613 1.00 83.18  0  226 PHE B CB  1 
ATOM   5511  C  CG  . PHE B 1 226 ? 260.844 229.322 220.432 1.00 83.18  0  226 PHE B CG  1 
ATOM   5512  C  CD1 . PHE B 1 226 ? 260.931 228.205 219.615 1.00 83.18  0  226 PHE B CD1 1 
ATOM   5513  C  CD2 . PHE B 1 226 ? 259.906 230.298 220.131 1.00 83.18  0  226 PHE B CD2 1 
ATOM   5514  C  CE1 . PHE B 1 226 ? 260.096 228.061 218.523 1.00 83.18  0  226 PHE B CE1 1 
ATOM   5515  C  CE2 . PHE B 1 226 ? 259.067 230.161 219.040 1.00 83.18  0  226 PHE B CE2 1 
ATOM   5516  C  CZ  . PHE B 1 226 ? 259.164 229.042 218.235 1.00 83.18  0  226 PHE B CZ  1 
ATOM   5517  N  N   . PRO B 1 227 ? 263.557 231.741 223.153 1.00 86.35  0  227 PRO B N   1 
ATOM   5518  C  CA  . PRO B 1 227 ? 264.281 232.141 224.367 1.00 86.35  0  227 PRO B CA  1 
ATOM   5519  C  C   . PRO B 1 227 ? 263.834 231.347 225.586 1.00 86.35  0  227 PRO B C   1 
ATOM   5520  O  O   . PRO B 1 227 ? 262.814 230.656 225.590 1.00 86.35  0  227 PRO B O   1 
ATOM   5521  C  CB  . PRO B 1 227 ? 263.941 233.628 224.518 1.00 86.35  0  227 PRO B CB  1 
ATOM   5522  C  CG  . PRO B 1 227 ? 263.436 234.052 223.176 1.00 86.35  0  227 PRO B CG  1 
ATOM   5523  C  CD  . PRO B 1 227 ? 262.752 232.850 222.616 1.00 86.35  0  227 PRO B CD  1 
ATOM   5524  N  N   . LEU B 1 228 ? 264.634 231.465 226.646 1.00 91.24  0  228 LEU B N   1 
ATOM   5525  C  CA  . LEU B 1 228 ? 264.407 230.721 227.876 1.00 91.24  0  228 LEU B CA  1 
ATOM   5526  C  C   . LEU B 1 228 ? 263.705 231.533 228.953 1.00 91.24  0  228 LEU B C   1 
ATOM   5527  O  O   . LEU B 1 228 ? 263.171 230.944 229.899 1.00 91.24  0  228 LEU B O   1 
ATOM   5528  C  CB  . LEU B 1 228 ? 265.741 230.208 228.433 1.00 91.24  0  228 LEU B CB  1 
ATOM   5529  C  CG  . LEU B 1 228 ? 265.736 228.850 229.134 1.00 91.24  0  228 LEU B CG  1 
ATOM   5530  C  CD1 . LEU B 1 228 ? 265.356 227.752 228.157 1.00 91.24  0  228 LEU B CD1 1 
ATOM   5531  C  CD2 . LEU B 1 228 ? 267.092 228.568 229.762 1.00 91.24  0  228 LEU B CD2 1 
ATOM   5532  N  N   . SER B 1 229 ? 263.688 232.861 228.836 1.00 92.72  0  229 SER B N   1 
ATOM   5533  C  CA  . SER B 1 229 ? 263.063 233.705 229.846 1.00 92.72  0  229 SER B CA  1 
ATOM   5534  C  C   . SER B 1 229 ? 261.541 233.687 229.781 1.00 92.72  0  229 SER B C   1 
ATOM   5535  O  O   . SER B 1 229 ? 260.896 234.149 230.729 1.00 92.72  0  229 SER B O   1 
ATOM   5536  C  CB  . SER B 1 229 ? 263.563 235.145 229.710 1.00 92.72  0  229 SER B CB  1 
ATOM   5537  N  N   . LEU B 1 230 ? 260.958 233.164 228.696 1.00 90.24  0  230 LEU B N   1 
ATOM   5538  C  CA  . LEU B 1 230 ? 259.504 233.098 228.589 1.00 90.24  0  230 LEU B CA  1 
ATOM   5539  C  C   . LEU B 1 230 ? 258.913 232.081 229.556 1.00 90.24  0  230 LEU B C   1 
ATOM   5540  O  O   . LEU B 1 230 ? 257.760 232.225 229.977 1.00 90.24  0  230 LEU B O   1 
ATOM   5541  C  CB  . LEU B 1 230 ? 259.101 232.754 227.155 1.00 90.24  0  230 LEU B CB  1 
ATOM   5542  C  CG  . LEU B 1 230 ? 259.928 233.391 226.037 1.00 90.24  0  230 LEU B CG  1 
ATOM   5543  C  CD1 . LEU B 1 230 ? 259.575 232.768 224.697 1.00 90.24  0  230 LEU B CD1 1 
ATOM   5544  C  CD2 . LEU B 1 230 ? 259.728 234.899 226.000 1.00 90.24  0  230 LEU B CD2 1 
ATOM   5545  N  N   . PHE B 1 231 ? 259.682 231.054 229.918 1.00 92.21  0  231 PHE B N   1 
ATOM   5546  C  CA  . PHE B 1 231 ? 259.216 230.078 230.894 1.00 92.21  0  231 PHE B CA  1 
ATOM   5547  C  C   . PHE B 1 231 ? 259.393 230.579 232.320 1.00 92.21  0  231 PHE B C   1 
ATOM   5548  O  O   . PHE B 1 231 ? 258.565 230.277 233.186 1.00 92.21  0  231 PHE B O   1 
ATOM   5549  C  CB  . PHE B 1 231 ? 259.953 228.754 230.702 1.00 92.21  0  231 PHE B CB  1 
ATOM   5550  C  CG  . PHE B 1 231 ? 260.023 228.307 229.272 1.00 92.21  0  231 PHE B CG  1 
ATOM   5551  C  CD1 . PHE B 1 231 ? 258.865 228.131 228.533 1.00 92.21  0  231 PHE B CD1 1 
ATOM   5552  C  CD2 . PHE B 1 231 ? 261.246 228.077 228.664 1.00 92.21  0  231 PHE B CD2 1 
ATOM   5553  C  CE1 . PHE B 1 231 ? 258.922 227.722 227.213 1.00 92.21  0  231 PHE B CE1 1 
ATOM   5554  C  CE2 . PHE B 1 231 ? 261.312 227.670 227.345 1.00 92.21  0  231 PHE B CE2 1 
ATOM   5555  C  CZ  . PHE B 1 231 ? 260.148 227.492 226.618 1.00 92.21  0  231 PHE B CZ  1 
ATOM   5556  N  N   . GLN B 1 232 ? 260.460 231.340 232.580 1.00 98.20  0  232 GLN B N   1 
ATOM   5557  C  CA  . GLN B 1 232 ? 260.670 231.885 233.916 1.00 98.20  0  232 GLN B CA  1 
ATOM   5558  C  C   . GLN B 1 232 ? 259.725 233.044 234.202 1.00 98.20  0  232 GLN B C   1 
ATOM   5559  O  O   . GLN B 1 232 ? 259.338 233.255 235.357 1.00 98.20  0  232 GLN B O   1 
ATOM   5560  C  CB  . GLN B 1 232 ? 262.123 232.330 234.081 1.00 98.20  0  232 GLN B CB  1 
ATOM   5561  N  N   . GLY B 1 233 ? 259.345 233.805 233.172 1.00 101.39 0  233 GLY B N   1 
ATOM   5562  C  CA  . GLY B 1 233 ? 258.399 234.887 233.375 1.00 101.39 0  233 GLY B CA  1 
ATOM   5563  C  C   . GLY B 1 233 ? 256.971 234.418 233.544 1.00 101.39 0  233 GLY B C   1 
ATOM   5564  O  O   . GLY B 1 233 ? 256.167 235.099 234.187 1.00 101.39 0  233 GLY B O   1 
ATOM   5565  N  N   . SER B 1 234 ? 256.633 233.259 232.979 1.00 99.93  0  234 SER B N   1 
ATOM   5566  C  CA  . SER B 1 234 ? 255.280 232.705 233.063 1.00 99.93  0  234 SER B CA  1 
ATOM   5567  C  C   . SER B 1 234 ? 255.404 231.201 233.291 1.00 99.93  0  234 SER B C   1 
ATOM   5568  O  O   . SER B 1 234 ? 255.664 230.445 232.350 1.00 99.93  0  234 SER B O   1 
ATOM   5569  C  CB  . SER B 1 234 ? 254.477 233.014 231.805 1.00 99.93  0  234 SER B CB  1 
ATOM   5570  N  N   . SER B 1 235 ? 255.216 230.774 234.540 1.00 102.25 0  235 SER B N   1 
ATOM   5571  C  CA  . SER B 1 235 ? 255.283 229.368 234.915 1.00 102.25 0  235 SER B CA  1 
ATOM   5572  C  C   . SER B 1 235 ? 253.910 228.707 234.952 1.00 102.25 0  235 SER B C   1 
ATOM   5573  O  O   . SER B 1 235 ? 253.762 227.627 235.534 1.00 102.25 0  235 SER B O   1 
ATOM   5574  C  CB  . SER B 1 235 ? 255.977 229.217 236.270 1.00 102.25 0  235 SER B CB  1 
ATOM   5575  N  N   . ASP B 1 236 ? 252.906 229.332 234.342 1.00 98.66  0  236 ASP B N   1 
ATOM   5576  C  CA  . ASP B 1 236 ? 251.545 228.812 234.352 1.00 98.66  0  236 ASP B CA  1 
ATOM   5577  C  C   . ASP B 1 236 ? 251.147 228.139 233.049 1.00 98.66  0  236 ASP B C   1 
ATOM   5578  O  O   . ASP B 1 236 ? 250.315 227.226 233.067 1.00 98.66  0  236 ASP B O   1 
ATOM   5579  C  CB  . ASP B 1 236 ? 250.549 229.937 234.652 1.00 98.66  0  236 ASP B CB  1 
ATOM   5580  N  N   . GLY B 1 237 ? 251.707 228.569 231.923 1.00 92.20  0  237 GLY B N   1 
ATOM   5581  C  CA  . GLY B 1 237 ? 251.348 227.987 230.647 1.00 92.20  0  237 GLY B CA  1 
ATOM   5582  C  C   . GLY B 1 237 ? 252.004 228.666 229.463 1.00 92.20  0  237 GLY B C   1 
ATOM   5583  O  O   . GLY B 1 237 ? 252.193 229.885 229.472 1.00 92.20  0  237 GLY B O   1 
ATOM   5584  N  N   . VAL B 1 238 ? 252.444 227.879 228.485 1.00 82.53  0  238 VAL B N   1 
ATOM   5585  C  CA  . VAL B 1 238 ? 253.128 228.397 227.303 1.00 82.53  0  238 VAL B CA  1 
ATOM   5586  C  C   . VAL B 1 238 ? 252.921 227.397 226.169 1.00 82.53  0  238 VAL B C   1 
ATOM   5587  O  O   . VAL B 1 238 ? 252.966 226.181 226.379 1.00 82.53  0  238 VAL B O   1 
ATOM   5588  C  CB  . VAL B 1 238 ? 254.622 228.688 227.602 1.00 82.53  0  238 VAL B CB  1 
ATOM   5589  C  CG1 . VAL B 1 238 ? 255.327 227.471 228.189 1.00 82.53  0  238 VAL B CG1 1 
ATOM   5590  C  CG2 . VAL B 1 238 ? 255.358 229.230 226.370 1.00 82.53  0  238 VAL B CG2 1 
ATOM   5591  N  N   . GLU B 1 239 ? 252.654 227.911 224.968 1.00 77.09  0  239 GLU B N   1 
ATOM   5592  C  CA  . GLU B 1 239 ? 252.361 227.078 223.808 1.00 77.09  0  239 GLU B CA  1 
ATOM   5593  C  C   . GLU B 1 239 ? 252.975 227.708 222.568 1.00 77.09  0  239 GLU B C   1 
ATOM   5594  O  O   . GLU B 1 239 ? 252.792 228.902 222.318 1.00 77.09  0  239 GLU B O   1 
ATOM   5595  C  CB  . GLU B 1 239 ? 250.850 226.905 223.613 1.00 77.09  0  239 GLU B CB  1 
ATOM   5596  C  CG  . GLU B 1 239 ? 250.473 225.881 222.554 1.00 77.09  0  239 GLU B CG  1 
ATOM   5597  C  CD  . GLU B 1 239 ? 248.974 225.683 222.440 1.00 77.09  0  239 GLU B CD  1 
ATOM   5598  O  OE1 . GLU B 1 239 ? 248.227 226.336 223.198 1.00 77.09  0  239 GLU B OE1 1 
ATOM   5599  O  OE2 . GLU B 1 239 ? 248.544 224.872 221.593 1.00 77.09  -1 239 GLU B OE2 1 
ATOM   5600  N  N   . VAL B 1 240 ? 253.681 226.897 221.789 1.00 70.47  0  240 VAL B N   1 
ATOM   5601  C  CA  . VAL B 1 240 ? 254.278 227.333 220.533 1.00 70.47  0  240 VAL B CA  1 
ATOM   5602  C  C   . VAL B 1 240 ? 253.287 227.067 219.410 1.00 70.47  0  240 VAL B C   1 
ATOM   5603  O  O   . VAL B 1 240 ? 252.786 225.946 219.268 1.00 70.47  0  240 VAL B O   1 
ATOM   5604  C  CB  . VAL B 1 240 ? 255.611 226.612 220.281 1.00 70.47  0  240 VAL B CB  1 
ATOM   5605  C  CG1 . VAL B 1 240 ? 256.217 227.052 218.963 1.00 70.47  0  240 VAL B CG1 1 
ATOM   5606  C  CG2 . VAL B 1 240 ? 256.573 226.878 221.427 1.00 70.47  0  240 VAL B CG2 1 
ATOM   5607  N  N   . ARG B 1 241 ? 253.003 228.091 218.608 1.00 68.98  0  241 ARG B N   1 
ATOM   5608  C  CA  . ARG B 1 241 ? 251.984 228.017 217.570 1.00 68.98  0  241 ARG B CA  1 
ATOM   5609  C  C   . ARG B 1 241 ? 252.623 228.268 216.212 1.00 68.98  0  241 ARG B C   1 
ATOM   5610  O  O   . ARG B 1 241 ? 253.265 229.304 215.999 1.00 68.98  0  241 ARG B O   1 
ATOM   5611  C  CB  . ARG B 1 241 ? 250.867 229.029 217.827 1.00 68.98  0  241 ARG B CB  1 
ATOM   5612  C  CG  . ARG B 1 241 ? 250.174 228.873 219.167 1.00 68.98  0  241 ARG B CG  1 
ATOM   5613  C  CD  . ARG B 1 241 ? 249.278 227.650 219.183 1.00 68.98  0  241 ARG B CD  1 
ATOM   5614  N  NE  . ARG B 1 241 ? 248.235 227.726 218.164 1.00 68.98  0  241 ARG B NE  1 
ATOM   5615  C  CZ  . ARG B 1 241 ? 247.045 228.286 218.353 1.00 68.98  0  241 ARG B CZ  1 
ATOM   5616  N  NH1 . ARG B 1 241 ? 246.741 228.825 219.526 1.00 68.98  1  241 ARG B NH1 1 
ATOM   5617  N  NH2 . ARG B 1 241 ? 246.157 228.309 217.369 1.00 68.98  0  241 ARG B NH2 1 
ATOM   5618  N  N   . TYR B 1 242 ? 252.445 227.310 215.303 1.00 68.23  0  242 TYR B N   1 
ATOM   5619  C  CA  . TYR B 1 242 ? 252.795 227.452 213.899 1.00 68.23  0  242 TYR B CA  1 
ATOM   5620  C  C   . TYR B 1 242 ? 251.567 227.459 212.998 1.00 68.23  0  242 TYR B C   1 
ATOM   5621  O  O   . TYR B 1 242 ? 251.696 227.710 211.795 1.00 68.23  0  242 TYR B O   1 
ATOM   5622  C  CB  . TYR B 1 242 ? 253.747 226.317 213.481 1.00 68.23  0  242 TYR B CB  1 
ATOM   5623  C  CG  . TYR B 1 242 ? 254.490 226.542 212.183 1.00 68.23  0  242 TYR B CG  1 
ATOM   5624  C  CD1 . TYR B 1 242 ? 255.080 227.767 211.900 1.00 68.23  0  242 TYR B CD1 1 
ATOM   5625  C  CD2 . TYR B 1 242 ? 254.604 225.525 211.243 1.00 68.23  0  242 TYR B CD2 1 
ATOM   5626  C  CE1 . TYR B 1 242 ? 255.761 227.976 210.713 1.00 68.23  0  242 TYR B CE1 1 
ATOM   5627  C  CE2 . TYR B 1 242 ? 255.283 225.723 210.054 1.00 68.23  0  242 TYR B CE2 1 
ATOM   5628  C  CZ  . TYR B 1 242 ? 255.859 226.950 209.796 1.00 68.23  0  242 TYR B CZ  1 
ATOM   5629  O  OH  . TYR B 1 242 ? 256.534 227.151 208.615 1.00 68.23  0  242 TYR B OH  1 
ATOM   5630  N  N   . ASP B 1 243 ? 250.377 227.221 213.556 1.00 70.76  0  243 ASP B N   1 
ATOM   5631  C  CA  . ASP B 1 243 ? 249.133 227.128 212.802 1.00 70.76  0  243 ASP B CA  1 
ATOM   5632  C  C   . ASP B 1 243 ? 248.435 228.471 212.640 1.00 70.76  0  243 ASP B C   1 
ATOM   5633  O  O   . ASP B 1 243 ? 247.210 228.508 212.459 1.00 70.76  0  243 ASP B O   1 
ATOM   5634  C  CB  . ASP B 1 243 ? 248.191 226.132 213.478 1.00 70.76  0  243 ASP B CB  1 
ATOM   5635  C  CG  . ASP B 1 243 ? 247.906 226.491 214.922 1.00 70.76  0  243 ASP B CG  1 
ATOM   5636  O  OD1 . ASP B 1 243 ? 248.771 227.128 215.558 1.00 70.76  0  243 ASP B OD1 1 
ATOM   5637  O  OD2 . ASP B 1 243 ? 246.817 226.137 215.420 1.00 70.76  -1 243 ASP B OD2 1 
ATOM   5638  N  N   . LEU B 1 244 ? 249.170 229.577 212.697 1.00 70.49  0  244 LEU B N   1 
ATOM   5639  C  CA  . LEU B 1 244 ? 248.574 230.907 212.744 1.00 70.49  0  244 LEU B CA  1 
ATOM   5640  C  C   . LEU B 1 244 ? 248.965 231.692 211.499 1.00 70.49  0  244 LEU B C   1 
ATOM   5641  O  O   . LEU B 1 244 ? 250.125 232.089 211.345 1.00 70.49  0  244 LEU B O   1 
ATOM   5642  C  CB  . LEU B 1 244 ? 249.005 231.640 214.012 1.00 70.49  0  244 LEU B CB  1 
ATOM   5643  C  CG  . LEU B 1 244 ? 248.431 231.057 215.303 1.00 70.49  0  244 LEU B CG  1 
ATOM   5644  C  CD1 . LEU B 1 244 ? 248.850 231.895 216.486 1.00 70.49  0  244 LEU B CD1 1 
ATOM   5645  C  CD2 . LEU B 1 244 ? 246.915 230.957 215.227 1.00 70.49  0  244 LEU B CD2 1 
ATOM   5646  N  N   . LEU B 1 245 ? 247.995 231.910 210.617 1.00 69.37  0  245 LEU B N   1 
ATOM   5647  C  CA  . LEU B 1 245 ? 248.170 232.805 209.484 1.00 69.37  0  245 LEU B CA  1 
ATOM   5648  C  C   . LEU B 1 245 ? 247.974 234.244 209.940 1.00 69.37  0  245 LEU B C   1 
ATOM   5649  O  O   . LEU B 1 245 ? 246.997 234.558 210.629 1.00 69.37  0  245 LEU B O   1 
ATOM   5650  C  CB  . LEU B 1 245 ? 247.179 232.454 208.374 1.00 69.37  0  245 LEU B CB  1 
ATOM   5651  C  CG  . LEU B 1 245 ? 247.050 233.439 207.212 1.00 69.37  0  245 LEU B CG  1 
ATOM   5652  C  CD1 . LEU B 1 245 ? 248.277 233.380 206.318 1.00 69.37  0  245 LEU B CD1 1 
ATOM   5653  C  CD2 . LEU B 1 245 ? 245.787 233.157 206.416 1.00 69.37  0  245 LEU B CD2 1 
ATOM   5654  N  N   . ASP B 1 246 ? 248.910 235.112 209.564 1.00 77.36  0  246 ASP B N   1 
ATOM   5655  C  CA  . ASP B 1 246 ? 248.852 236.513 209.953 1.00 77.36  0  246 ASP B CA  1 
ATOM   5656  C  C   . ASP B 1 246 ? 247.976 237.295 208.983 1.00 77.36  0  246 ASP B C   1 
ATOM   5657  O  O   . ASP B 1 246 ? 248.164 237.225 207.765 1.00 77.36  0  246 ASP B O   1 
ATOM   5658  C  CB  . ASP B 1 246 ? 250.256 237.111 209.995 1.00 77.36  0  246 ASP B CB  1 
ATOM   5659  C  CG  . ASP B 1 246 ? 250.341 238.338 210.877 1.00 77.36  0  246 ASP B CG  1 
ATOM   5660  O  OD1 . ASP B 1 246 ? 249.332 238.670 211.535 1.00 77.36  0  246 ASP B OD1 1 
ATOM   5661  O  OD2 . ASP B 1 246 ? 251.415 238.972 210.912 1.00 77.36  -1 246 ASP B OD2 1 
ATOM   5662  N  N   . CYS B 1 247 ? 247.018 238.043 209.529 1.00 77.88  0  247 CYS B N   1 
ATOM   5663  C  CA  . CYS B 1 247 ? 246.116 238.858 208.731 1.00 77.88  0  247 CYS B CA  1 
ATOM   5664  C  C   . CYS B 1 247 ? 246.405 240.351 208.815 1.00 77.88  0  247 CYS B C   1 
ATOM   5665  O  O   . CYS B 1 247 ? 245.819 241.113 208.037 1.00 77.88  0  247 CYS B O   1 
ATOM   5666  C  CB  . CYS B 1 247 ? 244.662 238.592 209.146 1.00 77.88  0  247 CYS B CB  1 
ATOM   5667  S  SG  . CYS B 1 247 ? 244.312 238.937 210.882 1.00 77.88  0  247 CYS B SG  1 
ATOM   5668  N  N   . HIS B 1 248 ? 247.282 240.773 209.739 1.00 77.45  0  248 HIS B N   1 
ATOM   5669  C  CA  . HIS B 1 248 ? 247.749 242.160 209.891 1.00 77.45  0  248 HIS B CA  1 
ATOM   5670  C  C   . HIS B 1 248 ? 246.602 243.133 210.169 1.00 77.45  0  248 HIS B C   1 
ATOM   5671  O  O   . HIS B 1 248 ? 246.568 244.244 209.638 1.00 77.45  0  248 HIS B O   1 
ATOM   5672  C  CB  . HIS B 1 248 ? 248.568 242.619 208.678 1.00 77.45  0  248 HIS B CB  1 
ATOM   5673  C  CG  . HIS B 1 248 ? 249.888 241.926 208.538 1.00 77.45  0  248 HIS B CG  1 
ATOM   5674  N  ND1 . HIS B 1 248 ? 251.090 242.598 208.577 1.00 77.45  0  248 HIS B ND1 1 
ATOM   5675  C  CD2 . HIS B 1 248 ? 250.194 240.620 208.351 1.00 77.45  0  248 HIS B CD2 1 
ATOM   5676  C  CE1 . HIS B 1 248 ? 252.079 241.736 208.421 1.00 77.45  0  248 HIS B CE1 1 
ATOM   5677  N  NE2 . HIS B 1 248 ? 251.562 240.529 208.282 1.00 77.45  0  248 HIS B NE2 1 
ATOM   5678  N  N   . ILE B 1 249 ? 245.657 242.712 211.007 1.00 72.49  0  249 ILE B N   1 
ATOM   5679  C  CA  . ILE B 1 249 ? 244.558 243.567 211.446 1.00 72.49  0  249 ILE B CA  1 
ATOM   5680  C  C   . ILE B 1 249 ? 244.715 243.749 212.951 1.00 72.49  0  249 ILE B C   1 
ATOM   5681  O  O   . ILE B 1 249 ? 243.732 243.754 213.699 1.00 72.49  0  249 ILE B O   1 
ATOM   5682  C  CB  . ILE B 1 249 ? 243.178 242.982 211.086 1.00 72.49  0  249 ILE B CB  1 
ATOM   5683  C  CG1 . ILE B 1 249 ? 243.226 242.279 209.737 1.00 72.49  0  249 ILE B CG1 1 
ATOM   5684  C  CG2 . ILE B 1 249 ? 242.140 244.089 210.944 1.00 72.49  0  249 ILE B CG2 1 
ATOM   5685  C  CD1 . ILE B 1 249 ? 242.012 241.451 209.466 1.00 72.49  0  249 ILE B CD1 1 
ATOM   5686  N  N   . SER B 1 250 ? 245.962 243.847 213.403 1.00 74.17  0  250 SER B N   1 
ATOM   5687  C  CA  . SER B 1 250 ? 246.280 243.919 214.826 1.00 74.17  0  250 SER B CA  1 
ATOM   5688  C  C   . SER B 1 250 ? 245.761 245.228 215.405 1.00 74.17  0  250 SER B C   1 
ATOM   5689  O  O   . SER B 1 250 ? 246.342 246.293 215.188 1.00 74.17  0  250 SER B O   1 
ATOM   5690  C  CB  . SER B 1 250 ? 247.784 243.792 215.031 1.00 74.17  0  250 SER B CB  1 
ATOM   5691  O  OG  . SER B 1 250 ? 248.430 245.039 214.851 1.00 74.17  0  250 SER B OG  1 
ATOM   5692  N  N   . ILE B 1 251 ? 244.646 245.149 216.136 1.00 74.62  0  251 ILE B N   1 
ATOM   5693  C  CA  . ILE B 1 251 ? 244.125 246.314 216.837 1.00 74.62  0  251 ILE B CA  1 
ATOM   5694  C  C   . ILE B 1 251 ? 245.042 246.647 218.007 1.00 74.62  0  251 ILE B C   1 
ATOM   5695  O  O   . ILE B 1 251 ? 245.740 245.779 218.550 1.00 74.62  0  251 ILE B O   1 
ATOM   5696  C  CB  . ILE B 1 251 ? 242.677 246.080 217.305 1.00 74.62  0  251 ILE B CB  1 
ATOM   5697  C  CG1 . ILE B 1 251 ? 242.597 244.867 218.232 1.00 74.62  0  251 ILE B CG1 1 
ATOM   5698  C  CG2 . ILE B 1 251 ? 241.755 245.895 216.112 1.00 74.62  0  251 ILE B CG2 1 
ATOM   5699  C  CD1 . ILE B 1 251 ? 241.207 244.591 218.762 1.00 74.62  0  251 ILE B CD1 1 
ATOM   5700  N  N   . CYS B 1 252 ? 245.048 247.916 218.399 1.00 78.13  0  252 CYS B N   1 
ATOM   5701  C  CA  . CYS B 1 252 ? 246.079 248.392 219.307 1.00 78.13  0  252 CYS B CA  1 
ATOM   5702  C  C   . CYS B 1 252 ? 245.613 249.652 220.017 1.00 78.13  0  252 CYS B C   1 
ATOM   5703  O  O   . CYS B 1 252 ? 244.659 250.313 219.601 1.00 78.13  0  252 CYS B O   1 
ATOM   5704  C  CB  . CYS B 1 252 ? 247.388 248.648 218.553 1.00 78.13  0  252 CYS B CB  1 
ATOM   5705  S  SG  . CYS B 1 252 ? 247.210 249.815 217.191 1.00 78.13  0  252 CYS B SG  1 
ATOM   5706  N  N   . SER B 1 253 ? 246.308 249.966 221.102 1.00 80.40  0  253 SER B N   1 
ATOM   5707  C  CA  . SER B 1 253 ? 246.124 251.206 221.828 1.00 80.40  0  253 SER B CA  1 
ATOM   5708  C  C   . SER B 1 253 ? 246.785 252.347 221.065 1.00 80.40  0  253 SER B C   1 
ATOM   5709  O  O   . SER B 1 253 ? 247.619 252.112 220.190 1.00 80.40  0  253 SER B O   1 
ATOM   5710  C  CB  . SER B 1 253 ? 246.742 251.081 223.220 1.00 80.40  0  253 SER B CB  1 
ATOM   5711  O  OG  . SER B 1 253 ? 245.886 250.376 224.094 1.00 80.40  0  253 SER B OG  1 
ATOM   5712  N  N   . PRO B 1 254 ? 246.444 253.603 221.380 1.00 81.29  0  254 PRO B N   1 
ATOM   5713  C  CA  . PRO B 1 254 ? 247.227 254.729 220.843 1.00 81.29  0  254 PRO B CA  1 
ATOM   5714  C  C   . PRO B 1 254 ? 248.636 254.847 221.415 1.00 81.29  0  254 PRO B C   1 
ATOM   5715  O  O   . PRO B 1 254 ? 249.385 255.728 220.977 1.00 81.29  0  254 PRO B O   1 
ATOM   5716  C  CB  . PRO B 1 254 ? 246.379 255.957 221.215 1.00 81.29  0  254 PRO B CB  1 
ATOM   5717  C  CG  . PRO B 1 254 ? 245.457 255.488 222.289 1.00 81.29  0  254 PRO B CG  1 
ATOM   5718  C  CD  . PRO B 1 254 ? 245.169 254.065 221.957 1.00 81.29  0  254 PRO B CD  1 
ATOM   5719  N  N   . GLN B 1 255 ? 249.023 253.998 222.371 1.00 85.49  0  255 GLN B N   1 
ATOM   5720  C  CA  . GLN B 1 255 ? 250.371 254.025 222.922 1.00 85.49  0  255 GLN B CA  1 
ATOM   5721  C  C   . GLN B 1 255 ? 251.411 253.455 221.965 1.00 85.49  0  255 GLN B C   1 
ATOM   5722  O  O   . GLN B 1 255 ? 252.607 253.685 222.175 1.00 85.49  0  255 GLN B O   1 
ATOM   5723  C  CB  . GLN B 1 255 ? 250.413 253.254 224.241 1.00 85.49  0  255 GLN B CB  1 
ATOM   5724  C  CG  . GLN B 1 255 ? 249.381 253.701 225.260 1.00 85.49  0  255 GLN B CG  1 
ATOM   5725  C  CD  . GLN B 1 255 ? 249.449 252.896 226.542 1.00 85.49  0  255 GLN B CD  1 
ATOM   5726  O  OE1 . GLN B 1 255 ? 250.484 252.317 226.870 1.00 85.49  0  255 GLN B OE1 1 
ATOM   5727  N  NE2 . GLN B 1 255 ? 248.342 252.854 227.275 1.00 85.49  0  255 GLN B NE2 1 
ATOM   5728  N  N   . VAL B 1 256 ? 250.996 252.710 220.933 1.00 87.37  0  256 VAL B N   1 
ATOM   5729  C  CA  . VAL B 1 256 ? 251.970 252.234 219.952 1.00 87.37  0  256 VAL B CA  1 
ATOM   5730  C  C   . VAL B 1 256 ? 252.496 253.394 219.117 1.00 87.37  0  256 VAL B C   1 
ATOM   5731  O  O   . VAL B 1 256 ? 253.651 253.373 218.679 1.00 87.37  0  256 VAL B O   1 
ATOM   5732  C  CB  . VAL B 1 256 ? 251.391 251.110 219.064 1.00 87.37  0  256 VAL B CB  1 
ATOM   5733  C  CG1 . VAL B 1 256 ? 250.973 249.925 219.905 1.00 87.37  0  256 VAL B CG1 1 
ATOM   5734  C  CG2 . VAL B 1 256 ? 250.225 251.592 218.217 1.00 87.37  0  256 VAL B CG2 1 
ATOM   5735  N  N   . ALA B 1 257 ? 251.692 254.445 218.928 1.00 92.66  0  257 ALA B N   1 
ATOM   5736  C  CA  . ALA B 1 257 ? 252.183 255.635 218.247 1.00 92.66  0  257 ALA B CA  1 
ATOM   5737  C  C   . ALA B 1 257 ? 253.191 256.376 219.114 1.00 92.66  0  257 ALA B C   1 
ATOM   5738  O  O   . ALA B 1 257 ? 254.187 256.904 218.605 1.00 92.66  0  257 ALA B O   1 
ATOM   5739  C  CB  . ALA B 1 257 ? 251.011 256.539 217.871 1.00 92.66  0  257 ALA B CB  1 
ATOM   5740  N  N   . GLN B 1 258 ? 252.970 256.378 220.433 1.00 98.05  0  258 GLN B N   1 
ATOM   5741  C  CA  . GLN B 1 258 ? 253.948 256.939 221.360 1.00 98.05  0  258 GLN B CA  1 
ATOM   5742  C  C   . GLN B 1 258 ? 255.246 256.141 221.342 1.00 98.05  0  258 GLN B C   1 
ATOM   5743  O  O   . GLN B 1 258 ? 256.338 256.721 221.326 1.00 98.05  0  258 GLN B O   1 
ATOM   5744  C  CB  . GLN B 1 258 ? 253.364 256.974 222.772 1.00 98.05  0  258 GLN B CB  1 
ATOM   5745  C  CG  . GLN B 1 258 ? 251.954 257.535 222.852 1.00 98.05  0  258 GLN B CG  1 
ATOM   5746  C  CD  . GLN B 1 258 ? 251.925 259.049 222.864 1.00 98.05  0  258 GLN B CD  1 
ATOM   5747  O  OE1 . GLN B 1 258 ? 252.931 259.698 223.146 1.00 98.05  0  258 GLN B OE1 1 
ATOM   5748  N  NE2 . GLN B 1 258 ? 250.766 259.621 222.558 1.00 98.05  0  258 GLN B NE2 1 
ATOM   5749  N  N   . LEU B 1 259 ? 255.145 254.808 221.314 1.00 93.29  0  259 LEU B N   1 
ATOM   5750  C  CA  . LEU B 1 259 ? 256.336 253.963 221.263 1.00 93.29  0  259 LEU B CA  1 
ATOM   5751  C  C   . LEU B 1 259 ? 257.058 254.075 219.925 1.00 93.29  0  259 LEU B C   1 
ATOM   5752  O  O   . LEU B 1 259 ? 258.272 253.856 219.859 1.00 93.29  0  259 LEU B O   1 
ATOM   5753  C  CB  . LEU B 1 259 ? 255.963 252.507 221.540 1.00 93.29  0  259 LEU B CB  1 
ATOM   5754  C  CG  . LEU B 1 259 ? 255.498 252.156 222.956 1.00 93.29  0  259 LEU B CG  1 
ATOM   5755  C  CD1 . LEU B 1 259 ? 255.441 250.649 223.141 1.00 93.29  0  259 LEU B CD1 1 
ATOM   5756  C  CD2 . LEU B 1 259 ? 256.402 252.788 224.004 1.00 93.29  0  259 LEU B CD2 1 
ATOM   5757  N  N   . PHE B 1 260 ? 256.335 254.408 218.855 1.00 92.78  0  260 PHE B N   1 
ATOM   5758  C  CA  . PHE B 1 260 ? 256.986 254.644 217.574 1.00 92.78  0  260 PHE B CA  1 
ATOM   5759  C  C   . PHE B 1 260 ? 257.635 256.021 217.513 1.00 92.78  0  260 PHE B C   1 
ATOM   5760  O  O   . PHE B 1 260 ? 258.628 256.198 216.799 1.00 92.78  0  260 PHE B O   1 
ATOM   5761  C  CB  . PHE B 1 260 ? 255.980 254.478 216.434 1.00 92.78  0  260 PHE B CB  1 
ATOM   5762  C  CG  . PHE B 1 260 ? 255.988 253.108 215.815 1.00 92.78  0  260 PHE B CG  1 
ATOM   5763  C  CD1 . PHE B 1 260 ? 257.063 252.683 215.052 1.00 92.78  0  260 PHE B CD1 1 
ATOM   5764  C  CD2 . PHE B 1 260 ? 254.918 252.245 215.995 1.00 92.78  0  260 PHE B CD2 1 
ATOM   5765  C  CE1 . PHE B 1 260 ? 257.066 251.423 214.474 1.00 92.78  0  260 PHE B CE1 1 
ATOM   5766  C  CE2 . PHE B 1 260 ? 254.920 250.983 215.427 1.00 92.78  0  260 PHE B CE2 1 
ATOM   5767  C  CZ  . PHE B 1 260 ? 255.994 250.574 214.665 1.00 92.78  0  260 PHE B CZ  1 
ATOM   5768  N  N   . THR B 1 261 ? 257.096 257.003 218.240 1.00 98.02  0  261 THR B N   1 
ATOM   5769  C  CA  . THR B 1 261 ? 257.797 258.280 218.355 1.00 98.02  0  261 THR B CA  1 
ATOM   5770  C  C   . THR B 1 261 ? 259.025 258.180 219.251 1.00 98.02  0  261 THR B C   1 
ATOM   5771  O  O   . THR B 1 261 ? 260.002 258.904 219.031 1.00 98.02  0  261 THR B O   1 
ATOM   5772  C  CB  . THR B 1 261 ? 256.869 259.383 218.869 1.00 98.02  0  261 THR B CB  1 
ATOM   5773  O  OG1 . THR B 1 261 ? 256.353 259.029 220.158 1.00 98.02  0  261 THR B OG1 1 
ATOM   5774  C  CG2 . THR B 1 261 ? 255.750 259.669 217.883 1.00 98.02  0  261 THR B CG2 1 
ATOM   5775  N  N   . ASP B 1 262 ? 258.999 257.315 220.268 1.00 101.20 0  262 ASP B N   1 
ATOM   5776  C  CA  . ASP B 1 262 ? 260.193 257.135 221.093 1.00 101.20 0  262 ASP B CA  1 
ATOM   5777  C  C   . ASP B 1 262 ? 261.278 256.384 220.331 1.00 101.20 0  262 ASP B C   1 
ATOM   5778  O  O   . ASP B 1 262 ? 262.410 256.865 220.207 1.00 101.20 0  262 ASP B O   1 
ATOM   5779  C  CB  . ASP B 1 262 ? 259.851 256.408 222.395 1.00 101.20 0  262 ASP B CB  1 
ATOM   5780  C  CG  . ASP B 1 262 ? 258.754 257.093 223.173 1.00 101.20 0  262 ASP B CG  1 
ATOM   5781  O  OD1 . ASP B 1 262 ? 258.658 258.335 223.093 1.00 101.20 0  262 ASP B OD1 1 
ATOM   5782  O  OD2 . ASP B 1 262 ? 257.985 256.391 223.863 1.00 101.20 -1 262 ASP B OD2 1 
ATOM   5783  N  N   . ASN B 1 263 ? 260.952 255.205 219.811 1.00 98.72  0  263 ASN B N   1 
ATOM   5784  C  CA  . ASN B 1 263 ? 261.925 254.382 219.097 1.00 98.72  0  263 ASN B CA  1 
ATOM   5785  C  C   . ASN B 1 263 ? 261.809 254.685 217.609 1.00 98.72  0  263 ASN B C   1 
ATOM   5786  O  O   . ASN B 1 263 ? 260.871 254.242 216.942 1.00 98.72  0  263 ASN B O   1 
ATOM   5787  C  CB  . ASN B 1 263 ? 261.697 252.904 219.387 1.00 98.72  0  263 ASN B CB  1 
ATOM   5788  C  CG  . ASN B 1 263 ? 261.465 252.629 220.857 1.00 98.72  0  263 ASN B CG  1 
ATOM   5789  O  OD1 . ASN B 1 263 ? 260.426 252.095 221.243 1.00 98.72  0  263 ASN B OD1 1 
ATOM   5790  N  ND2 . ASN B 1 263 ? 262.436 252.991 221.688 1.00 98.72  0  263 ASN B ND2 1 
ATOM   5791  N  N   . PHE B 1 264 ? 262.769 255.447 217.085 1.00 104.38 0  264 PHE B N   1 
ATOM   5792  C  CA  . PHE B 1 264 ? 262.801 255.753 215.662 1.00 104.38 0  264 PHE B CA  1 
ATOM   5793  C  C   . PHE B 1 264 ? 263.330 254.596 214.827 1.00 104.38 0  264 PHE B C   1 
ATOM   5794  O  O   . PHE B 1 264 ? 263.107 254.572 213.612 1.00 104.38 0  264 PHE B O   1 
ATOM   5795  C  CB  . PHE B 1 264 ? 263.657 256.995 215.410 1.00 104.38 0  264 PHE B CB  1 
ATOM   5796  C  CG  . PHE B 1 264 ? 263.143 258.235 216.083 1.00 104.38 0  264 PHE B CG  1 
ATOM   5797  C  CD1 . PHE B 1 264 ? 262.156 259.004 215.485 1.00 104.38 0  264 PHE B CD1 1 
ATOM   5798  C  CD2 . PHE B 1 264 ? 263.645 258.631 217.314 1.00 104.38 0  264 PHE B CD2 1 
ATOM   5799  C  CE1 . PHE B 1 264 ? 261.680 260.149 216.101 1.00 104.38 0  264 PHE B CE1 1 
ATOM   5800  C  CE2 . PHE B 1 264 ? 263.174 259.775 217.936 1.00 104.38 0  264 PHE B CE2 1 
ATOM   5801  C  CZ  . PHE B 1 264 ? 262.191 260.536 217.327 1.00 104.38 0  264 PHE B CZ  1 
ATOM   5802  N  N   . ASP B 1 265 ? 264.023 253.641 215.450 1.00 104.28 0  265 ASP B N   1 
ATOM   5803  C  CA  . ASP B 1 265 ? 264.599 252.522 214.717 1.00 104.28 0  265 ASP B CA  1 
ATOM   5804  C  C   . ASP B 1 265 ? 263.565 251.480 214.321 1.00 104.28 0  265 ASP B C   1 
ATOM   5805  O  O   . ASP B 1 265 ? 263.833 250.677 213.420 1.00 104.28 0  265 ASP B O   1 
ATOM   5806  C  CB  . ASP B 1 265 ? 265.697 251.859 215.550 1.00 104.28 0  265 ASP B CB  1 
ATOM   5807  C  CG  . ASP B 1 265 ? 265.209 251.436 216.919 1.00 104.28 0  265 ASP B CG  1 
ATOM   5808  O  OD1 . ASP B 1 265 ? 264.437 252.199 217.537 1.00 104.28 0  265 ASP B OD1 1 
ATOM   5809  O  OD2 . ASP B 1 265 ? 265.587 250.337 217.371 1.00 104.28 -1 265 ASP B OD2 1 
ATOM   5810  N  N   . TYR B 1 266 ? 262.403 251.465 214.972 1.00 97.14  0  266 TYR B N   1 
ATOM   5811  C  CA  . TYR B 1 266 ? 261.340 250.531 214.615 1.00 97.14  0  266 TYR B CA  1 
ATOM   5812  C  C   . TYR B 1 266 ? 260.730 250.966 213.289 1.00 97.14  0  266 TYR B C   1 
ATOM   5813  O  O   . TYR B 1 266 ? 260.033 251.984 213.219 1.00 97.14  0  266 TYR B O   1 
ATOM   5814  C  CB  . TYR B 1 266 ? 260.281 250.475 215.712 1.00 97.14  0  266 TYR B CB  1 
ATOM   5815  C  CG  . TYR B 1 266 ? 260.725 249.824 217.005 1.00 97.14  0  266 TYR B CG  1 
ATOM   5816  C  CD1 . TYR B 1 266 ? 261.870 249.034 217.062 1.00 97.14  0  266 TYR B CD1 1 
ATOM   5817  C  CD2 . TYR B 1 266 ? 259.990 249.997 218.171 1.00 97.14  0  266 TYR B CD2 1 
ATOM   5818  C  CE1 . TYR B 1 266 ? 262.273 248.444 218.247 1.00 97.14  0  266 TYR B CE1 1 
ATOM   5819  C  CE2 . TYR B 1 266 ? 260.384 249.412 219.359 1.00 97.14  0  266 TYR B CE2 1 
ATOM   5820  C  CZ  . TYR B 1 266 ? 261.524 248.637 219.391 1.00 97.14  0  266 TYR B CZ  1 
ATOM   5821  O  OH  . TYR B 1 266 ? 261.915 248.054 220.574 1.00 97.14  0  266 TYR B OH  1 
ATOM   5822  N  N   . GLN B 1 267 ? 260.990 250.195 212.236 1.00 94.52  0  267 GLN B N   1 
ATOM   5823  C  CA  . GLN B 1 267 ? 260.585 250.574 210.889 1.00 94.52  0  267 GLN B CA  1 
ATOM   5824  C  C   . GLN B 1 267 ? 259.159 250.148 210.560 1.00 94.52  0  267 GLN B C   1 
ATOM   5825  O  O   . GLN B 1 267 ? 258.396 250.936 209.992 1.00 94.52  0  267 GLN B O   1 
ATOM   5826  C  CB  . GLN B 1 267 ? 261.554 249.979 209.865 1.00 94.52  0  267 GLN B CB  1 
ATOM   5827  C  CG  . GLN B 1 267 ? 261.534 250.681 208.519 1.00 94.52  0  267 GLN B CG  1 
ATOM   5828  C  CD  . GLN B 1 267 ? 262.265 252.010 208.553 1.00 94.52  0  267 GLN B CD  1 
ATOM   5829  O  OE1 . GLN B 1 267 ? 261.648 253.073 208.523 1.00 94.52  0  267 GLN B OE1 1 
ATOM   5830  N  NE2 . GLN B 1 267 ? 263.590 251.953 208.615 1.00 94.52  0  267 GLN B NE2 1 
ATOM   5831  N  N   . THR B 1 268 ? 258.774 248.926 210.914 1.00 88.61  0  268 THR B N   1 
ATOM   5832  C  CA  . THR B 1 268 ? 257.473 248.361 210.549 1.00 88.61  0  268 THR B CA  1 
ATOM   5833  C  C   . THR B 1 268 ? 256.926 247.636 211.774 1.00 88.61  0  268 THR B C   1 
ATOM   5834  O  O   . THR B 1 268 ? 257.310 247.914 212.914 1.00 88.61  0  268 THR B O   1 
ATOM   5835  C  CB  . THR B 1 268 ? 257.545 247.383 209.354 1.00 88.61  0  268 THR B CB  1 
ATOM   5836  O  OG1 . THR B 1 268 ? 258.144 246.150 209.776 1.00 88.61  0  268 THR B OG1 1 
ATOM   5837  C  CG2 . THR B 1 268 ? 258.287 247.938 208.128 1.00 88.61  0  268 THR B CG2 1 
ATOM   5838  N  N   . ARG B 1 269 ? 255.967 246.738 211.549 1.00 82.75  0  269 ARG B N   1 
ATOM   5839  C  CA  . ARG B 1 269 ? 255.268 246.104 212.660 1.00 82.75  0  269 ARG B CA  1 
ATOM   5840  C  C   . ARG B 1 269 ? 256.104 245.003 213.305 1.00 82.75  0  269 ARG B C   1 
ATOM   5841  O  O   . ARG B 1 269 ? 256.158 244.906 214.538 1.00 82.75  0  269 ARG B O   1 
ATOM   5842  C  CB  . ARG B 1 269 ? 253.926 245.547 212.183 1.00 82.75  0  269 ARG B CB  1 
ATOM   5843  C  CG  . ARG B 1 269 ? 252.967 245.194 213.307 1.00 82.75  0  269 ARG B CG  1 
ATOM   5844  C  CD  . ARG B 1 269 ? 251.618 244.761 212.761 1.00 82.75  0  269 ARG B CD  1 
ATOM   5845  N  NE  . ARG B 1 269 ? 251.719 243.548 211.957 1.00 82.75  0  269 ARG B NE  1 
ATOM   5846  C  CZ  . ARG B 1 269 ? 251.496 242.324 212.423 1.00 82.75  0  269 ARG B CZ  1 
ATOM   5847  N  NH1 . ARG B 1 269 ? 251.153 242.148 213.690 1.00 82.75  1  269 ARG B NH1 1 
ATOM   5848  N  NH2 . ARG B 1 269 ? 251.612 241.276 211.621 1.00 82.75  0  269 ARG B NH2 1 
ATOM   5849  N  N   . ASP B 1 270 ? 256.767 244.174 212.491 1.00 89.67  0  270 ASP B N   1 
ATOM   5850  C  CA  . ASP B 1 270 ? 257.360 242.946 213.014 1.00 89.67  0  270 ASP B CA  1 
ATOM   5851  C  C   . ASP B 1 270 ? 258.625 243.216 213.823 1.00 89.67  0  270 ASP B C   1 
ATOM   5852  O  O   . ASP B 1 270 ? 258.842 242.586 214.864 1.00 89.67  0  270 ASP B O   1 
ATOM   5853  C  CB  . ASP B 1 270 ? 257.596 241.949 211.865 1.00 89.67  0  270 ASP B CB  1 
ATOM   5854  C  CG  . ASP B 1 270 ? 258.552 242.462 210.766 1.00 89.67  0  270 ASP B CG  1 
ATOM   5855  O  OD1 . ASP B 1 270 ? 258.209 242.248 209.584 1.00 89.67  0  270 ASP B OD1 1 
ATOM   5856  O  OD2 . ASP B 1 270 ? 259.639 243.021 211.030 1.00 89.67  -1 270 ASP B OD2 1 
ATOM   5857  N  N   . ASP B 1 271 ? 259.456 244.167 213.386 1.00 92.28  0  271 ASP B N   1 
ATOM   5858  C  CA  . ASP B 1 271 ? 260.615 244.528 214.196 1.00 92.28  0  271 ASP B CA  1 
ATOM   5859  C  C   . ASP B 1 271 ? 260.209 245.323 215.432 1.00 92.28  0  271 ASP B C   1 
ATOM   5860  O  O   . ASP B 1 271 ? 260.904 245.267 216.451 1.00 92.28  0  271 ASP B O   1 
ATOM   5861  C  CB  . ASP B 1 271 ? 261.654 245.283 213.359 1.00 92.28  0  271 ASP B CB  1 
ATOM   5862  C  CG  . ASP B 1 271 ? 261.093 246.514 212.678 1.00 92.28  0  271 ASP B CG  1 
ATOM   5863  O  OD1 . ASP B 1 271 ? 259.866 246.714 212.704 1.00 92.28  0  271 ASP B OD1 1 
ATOM   5864  O  OD2 . ASP B 1 271 ? 261.891 247.292 212.115 1.00 92.28  -1 271 ASP B OD2 1 
ATOM   5865  N  N   . PHE B 1 272 ? 259.070 246.024 215.376 1.00 87.20  0  272 PHE B N   1 
ATOM   5866  C  CA  . PHE B 1 272 ? 258.523 246.660 216.572 1.00 87.20  0  272 PHE B CA  1 
ATOM   5867  C  C   . PHE B 1 272 ? 258.102 245.623 217.607 1.00 87.20  0  272 PHE B C   1 
ATOM   5868  O  O   . PHE B 1 272 ? 258.389 245.781 218.800 1.00 87.20  0  272 PHE B O   1 
ATOM   5869  C  CB  . PHE B 1 272 ? 257.340 247.557 216.197 1.00 87.20  0  272 PHE B CB  1 
ATOM   5870  C  CG  . PHE B 1 272 ? 256.376 247.811 217.328 1.00 87.20  0  272 PHE B CG  1 
ATOM   5871  C  CD1 . PHE B 1 272 ? 256.723 248.645 218.382 1.00 87.20  0  272 PHE B CD1 1 
ATOM   5872  C  CD2 . PHE B 1 272 ? 255.115 247.231 217.326 1.00 87.20  0  272 PHE B CD2 1 
ATOM   5873  C  CE1 . PHE B 1 272 ? 255.837 248.883 219.420 1.00 87.20  0  272 PHE B CE1 1 
ATOM   5874  C  CE2 . PHE B 1 272 ? 254.224 247.464 218.361 1.00 87.20  0  272 PHE B CE2 1 
ATOM   5875  C  CZ  . PHE B 1 272 ? 254.587 248.292 219.407 1.00 87.20  0  272 PHE B CZ  1 
ATOM   5876  N  N   . VAL B 1 273 ? 257.435 244.552 217.168 1.00 84.28  0  273 VAL B N   1 
ATOM   5877  C  CA  . VAL B 1 273 ? 257.037 243.494 218.095 1.00 84.28  0  273 VAL B CA  1 
ATOM   5878  C  C   . VAL B 1 273 ? 258.264 242.740 218.605 1.00 84.28  0  273 VAL B C   1 
ATOM   5879  O  O   . VAL B 1 273 ? 258.358 242.413 219.795 1.00 84.28  0  273 VAL B O   1 
ATOM   5880  C  CB  . VAL B 1 273 ? 256.015 242.557 217.421 1.00 84.28  0  273 VAL B CB  1 
ATOM   5881  C  CG1 . VAL B 1 273 ? 255.668 241.377 218.317 1.00 84.28  0  273 VAL B CG1 1 
ATOM   5882  C  CG2 . VAL B 1 273 ? 254.752 243.324 217.073 1.00 84.28  0  273 VAL B CG2 1 
ATOM   5883  N  N   . ARG B 1 274 ? 259.246 242.502 217.727 1.00 89.77  0  274 ARG B N   1 
ATOM   5884  C  CA  . ARG B 1 274 ? 260.463 241.799 218.127 1.00 89.77  0  274 ARG B CA  1 
ATOM   5885  C  C   . ARG B 1 274 ? 261.322 242.630 219.073 1.00 89.77  0  274 ARG B C   1 
ATOM   5886  O  O   . ARG B 1 274 ? 262.069 242.067 219.880 1.00 89.77  0  274 ARG B O   1 
ATOM   5887  C  CB  . ARG B 1 274 ? 261.270 241.403 216.891 1.00 89.77  0  274 ARG B CB  1 
ATOM   5888  C  CG  . ARG B 1 274 ? 260.744 240.168 216.179 1.00 89.77  0  274 ARG B CG  1 
ATOM   5889  C  CD  . ARG B 1 274 ? 261.707 239.695 215.104 1.00 89.77  0  274 ARG B CD  1 
ATOM   5890  N  NE  . ARG B 1 274 ? 261.580 240.470 213.873 1.00 89.77  0  274 ARG B NE  1 
ATOM   5891  C  CZ  . ARG B 1 274 ? 262.447 241.397 213.480 1.00 89.77  0  274 ARG B CZ  1 
ATOM   5892  N  NH1 . ARG B 1 274 ? 263.512 241.670 214.221 1.00 89.77  1  274 ARG B NH1 1 
ATOM   5893  N  NH2 . ARG B 1 274 ? 262.250 242.051 212.343 1.00 89.77  0  274 ARG B NH2 1 
ATOM   5894  N  N   . GLY B 1 275 ? 261.234 243.960 218.994 1.00 90.19  0  275 GLY B N   1 
ATOM   5895  C  CA  . GLY B 1 275 ? 261.934 244.796 219.952 1.00 90.19  0  275 GLY B CA  1 
ATOM   5896  C  C   . GLY B 1 275 ? 261.174 244.994 221.244 1.00 90.19  0  275 GLY B C   1 
ATOM   5897  O  O   . GLY B 1 275 ? 261.788 245.166 222.302 1.00 90.19  0  275 GLY B O   1 
ATOM   5898  N  N   . LEU B 1 276 ? 259.840 244.977 221.186 1.00 87.67  0  276 LEU B N   1 
ATOM   5899  C  CA  . LEU B 1 276 ? 259.050 245.099 222.405 1.00 87.67  0  276 LEU B CA  1 
ATOM   5900  C  C   . LEU B 1 276 ? 259.094 243.816 223.225 1.00 87.67  0  276 LEU B C   1 
ATOM   5901  O  O   . LEU B 1 276 ? 259.028 243.866 224.458 1.00 87.67  0  276 LEU B O   1 
ATOM   5902  C  CB  . LEU B 1 276 ? 257.607 245.469 222.056 1.00 87.67  0  276 LEU B CB  1 
ATOM   5903  C  CG  . LEU B 1 276 ? 256.633 245.774 223.197 1.00 87.67  0  276 LEU B CG  1 
ATOM   5904  C  CD1 . LEU B 1 276 ? 257.233 246.780 224.165 1.00 87.67  0  276 LEU B CD1 1 
ATOM   5905  C  CD2 . LEU B 1 276 ? 255.312 246.285 222.648 1.00 87.67  0  276 LEU B CD2 1 
ATOM   5906  N  N   . LEU B 1 277 ? 259.220 242.663 222.564 1.00 87.55  0  277 LEU B N   1 
ATOM   5907  C  CA  . LEU B 1 277 ? 259.258 241.398 223.288 1.00 87.55  0  277 LEU B CA  1 
ATOM   5908  C  C   . LEU B 1 277 ? 260.600 241.158 223.968 1.00 87.55  0  277 LEU B C   1 
ATOM   5909  O  O   . LEU B 1 277 ? 260.656 240.434 224.969 1.00 87.55  0  277 LEU B O   1 
ATOM   5910  C  CB  . LEU B 1 277 ? 258.932 240.241 222.343 1.00 87.55  0  277 LEU B CB  1 
ATOM   5911  C  CG  . LEU B 1 277 ? 257.452 240.090 221.989 1.00 87.55  0  277 LEU B CG  1 
ATOM   5912  C  CD1 . LEU B 1 277 ? 257.261 239.053 220.897 1.00 87.55  0  277 LEU B CD1 1 
ATOM   5913  C  CD2 . LEU B 1 277 ? 256.644 239.734 223.223 1.00 87.55  0  277 LEU B CD2 1 
ATOM   5914  N  N   . VAL B 1 278 ? 261.686 241.737 223.451 1.00 91.63  0  278 VAL B N   1 
ATOM   5915  C  CA  . VAL B 1 278 ? 262.984 241.562 224.094 1.00 91.63  0  278 VAL B CA  1 
ATOM   5916  C  C   . VAL B 1 278 ? 263.287 242.661 225.107 1.00 91.63  0  278 VAL B C   1 
ATOM   5917  O  O   . VAL B 1 278 ? 264.148 242.466 225.977 1.00 91.63  0  278 VAL B O   1 
ATOM   5918  C  CB  . VAL B 1 278 ? 264.119 241.477 223.056 1.00 91.63  0  278 VAL B CB  1 
ATOM   5919  C  CG1 . VAL B 1 278 ? 263.887 240.307 222.112 1.00 91.63  0  278 VAL B CG1 1 
ATOM   5920  C  CG2 . VAL B 1 278 ? 264.254 242.781 222.279 1.00 91.63  0  278 VAL B CG2 1 
ATOM   5921  N  N   . ASN B 1 279 ? 262.611 243.809 225.022 1.00 97.15  0  279 ASN B N   1 
ATOM   5922  C  CA  . ASN B 1 279 ? 262.784 244.888 225.991 1.00 97.15  0  279 ASN B CA  1 
ATOM   5923  C  C   . ASN B 1 279 ? 261.613 244.815 226.966 1.00 97.15  0  279 ASN B C   1 
ATOM   5924  O  O   . ASN B 1 279 ? 260.668 245.601 226.913 1.00 97.15  0  279 ASN B O   1 
ATOM   5925  C  CB  . ASN B 1 279 ? 262.868 246.240 225.290 1.00 97.15  0  279 ASN B CB  1 
ATOM   5926  N  N   . GLU B 1 280 ? 261.688 243.843 227.875 1.00 104.76 0  280 GLU B N   1 
ATOM   5927  C  CA  . GLU B 1 280 ? 260.637 243.631 228.859 1.00 104.76 0  280 GLU B CA  1 
ATOM   5928  C  C   . GLU B 1 280 ? 260.969 244.184 230.236 1.00 104.76 0  280 GLU B C   1 
ATOM   5929  O  O   . GLU B 1 280 ? 260.053 244.369 231.045 1.00 104.76 0  280 GLU B O   1 
ATOM   5930  C  CB  . GLU B 1 280 ? 260.318 242.134 228.982 1.00 104.76 0  280 GLU B CB  1 
ATOM   5931  C  CG  . GLU B 1 280 ? 259.453 241.551 227.858 1.00 104.76 0  280 GLU B CG  1 
ATOM   5932  C  CD  . GLU B 1 280 ? 257.948 241.764 228.037 1.00 104.76 0  280 GLU B CD  1 
ATOM   5933  O  OE1 . GLU B 1 280 ? 257.509 242.842 228.493 1.00 104.76 0  280 GLU B OE1 1 
ATOM   5934  O  OE2 . GLU B 1 280 ? 257.190 240.828 227.706 1.00 104.76 -1 280 GLU B OE2 1 
ATOM   5935  N  N   . GLU B 1 281 ? 262.246 244.451 230.525 1.00 109.62 0  281 GLU B N   1 
ATOM   5936  C  CA  . GLU B 1 281 ? 262.597 245.016 231.823 1.00 109.62 0  281 GLU B CA  1 
ATOM   5937  C  C   . GLU B 1 281 ? 262.185 246.479 231.931 1.00 109.62 0  281 GLU B C   1 
ATOM   5938  O  O   . GLU B 1 281 ? 261.864 246.951 233.027 1.00 109.62 0  281 GLU B O   1 
ATOM   5939  C  CB  . GLU B 1 281 ? 264.098 244.864 232.078 1.00 109.62 0  281 GLU B CB  1 
ATOM   5940  C  CG  . GLU B 1 281 ? 264.990 245.340 230.936 1.00 109.62 0  281 GLU B CG  1 
ATOM   5941  C  CD  . GLU B 1 281 ? 265.464 244.205 230.048 1.00 109.62 0  281 GLU B CD  1 
ATOM   5942  O  OE1 . GLU B 1 281 ? 264.848 243.119 230.089 1.00 109.62 0  281 GLU B OE1 1 
ATOM   5943  O  OE2 . GLU B 1 281 ? 266.452 244.399 229.309 1.00 109.62 -1 281 GLU B OE2 1 
ATOM   5944  N  N   . ILE B 1 282 ? 262.183 247.207 230.818 1.00 104.93 0  282 ILE B N   1 
ATOM   5945  C  CA  . ILE B 1 282 ? 261.670 248.568 230.770 1.00 104.93 0  282 ILE B CA  1 
ATOM   5946  C  C   . ILE B 1 282 ? 260.622 248.636 229.664 1.00 104.93 0  282 ILE B C   1 
ATOM   5947  O  O   . ILE B 1 282 ? 260.810 248.057 228.587 1.00 104.93 0  282 ILE B O   1 
ATOM   5948  C  CB  . ILE B 1 282 ? 262.808 249.604 230.582 1.00 104.93 0  282 ILE B CB  1 
ATOM   5949  C  CG1 . ILE B 1 282 ? 262.255 251.031 230.579 1.00 104.93 0  282 ILE B CG1 1 
ATOM   5950  C  CG2 . ILE B 1 282 ? 263.678 249.305 229.354 1.00 104.93 0  282 ILE B CG2 1 
ATOM   5951  C  CD1 . ILE B 1 282 ? 261.512 251.370 231.856 1.00 104.93 0  282 ILE B CD1 1 
ATOM   5952  N  N   . LEU B 1 283 ? 259.505 249.314 229.958 1.00 101.50 0  283 LEU B N   1 
ATOM   5953  C  CA  . LEU B 1 283 ? 258.342 249.486 229.074 1.00 101.50 0  283 LEU B CA  1 
ATOM   5954  C  C   . LEU B 1 283 ? 257.827 248.127 228.577 1.00 101.50 0  283 LEU B C   1 
ATOM   5955  O  O   . LEU B 1 283 ? 257.950 247.751 227.413 1.00 101.50 0  283 LEU B O   1 
ATOM   5956  C  CB  . LEU B 1 283 ? 258.658 250.503 227.957 1.00 101.50 0  283 LEU B CB  1 
ATOM   5957  C  CG  . LEU B 1 283 ? 259.620 250.484 226.749 1.00 101.50 0  283 LEU B CG  1 
ATOM   5958  C  CD1 . LEU B 1 283 ? 258.974 250.059 225.426 1.00 101.50 0  283 LEU B CD1 1 
ATOM   5959  C  CD2 . LEU B 1 283 ? 260.302 251.839 226.598 1.00 101.50 0  283 LEU B CD2 1 
ATOM   5960  N  N   . GLY B 1 284 ? 257.298 247.376 229.550 1.00 96.59  0  284 GLY B N   1 
ATOM   5961  C  CA  . GLY B 1 284 ? 256.859 246.002 229.367 1.00 96.59  0  284 GLY B CA  1 
ATOM   5962  C  C   . GLY B 1 284 ? 255.848 245.797 228.260 1.00 96.59  0  284 GLY B C   1 
ATOM   5963  O  O   . GLY B 1 284 ? 256.200 245.234 227.217 1.00 96.59  0  284 GLY B O   1 
ATOM   5964  N  N   . ASN B 1 285 ? 254.616 246.279 228.473 1.00 89.03  0  285 ASN B N   1 
ATOM   5965  C  CA  . ASN B 1 285 ? 253.597 246.489 227.436 1.00 89.03  0  285 ASN B CA  1 
ATOM   5966  C  C   . ASN B 1 285 ? 253.280 245.191 226.685 1.00 89.03  0  285 ASN B C   1 
ATOM   5967  O  O   . ASN B 1 285 ? 253.582 245.032 225.500 1.00 89.03  0  285 ASN B O   1 
ATOM   5968  C  CB  . ASN B 1 285 ? 254.039 247.597 226.472 1.00 89.03  0  285 ASN B CB  1 
ATOM   5969  C  CG  . ASN B 1 285 ? 254.046 248.965 227.122 1.00 89.03  0  285 ASN B CG  1 
ATOM   5970  O  OD1 . ASN B 1 285 ? 253.215 249.262 227.979 1.00 89.03  0  285 ASN B OD1 1 
ATOM   5971  N  ND2 . ASN B 1 285 ? 254.991 249.807 226.718 1.00 89.03  0  285 ASN B ND2 1 
ATOM   5972  N  N   . GLN B 1 286 ? 252.694 244.255 227.431 1.00 83.50  0  286 GLN B N   1 
ATOM   5973  C  CA  . GLN B 1 286 ? 252.488 242.899 226.935 1.00 83.50  0  286 GLN B CA  1 
ATOM   5974  C  C   . GLN B 1 286 ? 251.474 242.872 225.794 1.00 83.50  0  286 GLN B C   1 
ATOM   5975  O  O   . GLN B 1 286 ? 250.401 243.478 225.879 1.00 83.50  0  286 GLN B O   1 
ATOM   5976  C  CB  . GLN B 1 286 ? 252.043 241.984 228.076 1.00 83.50  0  286 GLN B CB  1 
ATOM   5977  C  CG  . GLN B 1 286 ? 250.965 242.567 228.975 1.00 83.50  0  286 GLN B CG  1 
ATOM   5978  C  CD  . GLN B 1 286 ? 250.607 241.647 230.122 1.00 83.50  0  286 GLN B CD  1 
ATOM   5979  O  OE1 . GLN B 1 286 ? 251.170 240.562 230.261 1.00 83.50  0  286 GLN B OE1 1 
ATOM   5980  N  NE2 . GLN B 1 286 ? 249.665 242.076 230.953 1.00 83.50  0  286 GLN B NE2 1 
ATOM   5981  N  N   . ILE B 1 287 ? 251.834 242.184 224.716 1.00 78.61  0  287 ILE B N   1 
ATOM   5982  C  CA  . ILE B 1 287 ? 250.994 242.079 223.530 1.00 78.61  0  287 ILE B CA  1 
ATOM   5983  C  C   . ILE B 1 287 ? 250.148 240.820 223.643 1.00 78.61  0  287 ILE B C   1 
ATOM   5984  O  O   . ILE B 1 287 ? 250.674 239.725 223.872 1.00 78.61  0  287 ILE B O   1 
ATOM   5985  C  CB  . ILE B 1 287 ? 251.852 242.055 222.254 1.00 78.61  0  287 ILE B CB  1 
ATOM   5986  C  CG1 . ILE B 1 287 ? 252.679 243.335 222.139 1.00 78.61  0  287 ILE B CG1 1 
ATOM   5987  C  CG2 . ILE B 1 287 ? 250.987 241.867 221.020 1.00 78.61  0  287 ILE B CG2 1 
ATOM   5988  C  CD1 . ILE B 1 287 ? 253.621 243.344 220.956 1.00 78.61  0  287 ILE B CD1 1 
ATOM   5989  N  N   . HIS B 1 288 ? 248.838 240.971 223.485 1.00 78.10  0  288 HIS B N   1 
ATOM   5990  C  CA  . HIS B 1 288 ? 247.917 239.848 223.530 1.00 78.10  0  288 HIS B CA  1 
ATOM   5991  C  C   . HIS B 1 288 ? 247.520 239.428 222.120 1.00 78.10  0  288 HIS B C   1 
ATOM   5992  O  O   . HIS B 1 288 ? 247.842 240.085 221.128 1.00 78.10  0  288 HIS B O   1 
ATOM   5993  C  CB  . HIS B 1 288 ? 246.684 240.201 224.363 1.00 78.10  0  288 HIS B CB  1 
ATOM   5994  C  CG  . HIS B 1 288 ? 246.950 240.238 225.834 1.00 78.10  0  288 HIS B CG  1 
ATOM   5995  N  ND1 . HIS B 1 288 ? 247.265 241.399 226.504 1.00 78.10  0  288 HIS B ND1 1 
ATOM   5996  C  CD2 . HIS B 1 288 ? 246.961 239.253 226.763 1.00 78.10  0  288 HIS B CD2 1 
ATOM   5997  C  CE1 . HIS B 1 288 ? 247.451 241.131 227.784 1.00 78.10  0  288 HIS B CE1 1 
ATOM   5998  N  NE2 . HIS B 1 288 ? 247.272 239.835 227.967 1.00 78.10  0  288 HIS B NE2 1 
ATOM   5999  N  N   . MET B 1 289 ? 246.801 238.311 222.042 1.00 75.11  0  289 MET B N   1 
ATOM   6000  C  CA  . MET B 1 289 ? 246.516 237.679 220.766 1.00 75.11  0  289 MET B CA  1 
ATOM   6001  C  C   . MET B 1 289 ? 245.094 237.141 220.749 1.00 75.11  0  289 MET B C   1 
ATOM   6002  O  O   . MET B 1 289 ? 244.573 236.674 221.765 1.00 75.11  0  289 MET B O   1 
ATOM   6003  C  CB  . MET B 1 289 ? 247.507 236.545 220.486 1.00 75.11  0  289 MET B CB  1 
ATOM   6004  C  CG  . MET B 1 289 ? 247.646 236.181 219.026 1.00 75.11  0  289 MET B CG  1 
ATOM   6005  S  SD  . MET B 1 289 ? 248.666 234.717 218.815 1.00 75.11  0  289 MET B SD  1 
ATOM   6006  C  CE  . MET B 1 289 ? 247.710 233.512 219.730 1.00 75.11  0  289 MET B CE  1 
ATOM   6007  N  N   . HIS B 1 290 ? 244.475 237.218 219.576 1.00 72.04  0  290 HIS B N   1 
ATOM   6008  C  CA  . HIS B 1 290 ? 243.156 236.663 219.321 1.00 72.04  0  290 HIS B CA  1 
ATOM   6009  C  C   . HIS B 1 290 ? 243.252 235.745 218.113 1.00 72.04  0  290 HIS B C   1 
ATOM   6010  O  O   . HIS B 1 290 ? 244.001 236.025 217.171 1.00 72.04  0  290 HIS B O   1 
ATOM   6011  C  CB  . HIS B 1 290 ? 242.123 237.767 219.074 1.00 72.04  0  290 HIS B CB  1 
ATOM   6012  C  CG  . HIS B 1 290 ? 240.727 237.260 218.891 1.00 72.04  0  290 HIS B CG  1 
ATOM   6013  N  ND1 . HIS B 1 290 ? 240.087 237.267 217.671 1.00 72.04  0  290 HIS B ND1 1 
ATOM   6014  C  CD2 . HIS B 1 290 ? 239.848 236.732 219.774 1.00 72.04  0  290 HIS B CD2 1 
ATOM   6015  C  CE1 . HIS B 1 290 ? 238.873 236.765 217.810 1.00 72.04  0  290 HIS B CE1 1 
ATOM   6016  N  NE2 . HIS B 1 290 ? 238.703 236.432 219.077 1.00 72.04  0  290 HIS B NE2 1 
ATOM   6017  N  N   . VAL B 1 291 ? 242.511 234.641 218.150 1.00 69.70  0  291 VAL B N   1 
ATOM   6018  C  CA  . VAL B 1 291 ? 242.518 233.655 217.078 1.00 69.70  0  291 VAL B CA  1 
ATOM   6019  C  C   . VAL B 1 291 ? 241.122 233.560 216.478 1.00 69.70  0  291 VAL B C   1 
ATOM   6020  O  O   . VAL B 1 291 ? 240.115 233.660 217.189 1.00 69.70  0  291 VAL B O   1 
ATOM   6021  C  CB  . VAL B 1 291 ? 243.012 232.277 217.569 1.00 69.70  0  291 VAL B CB  1 
ATOM   6022  C  CG1 . VAL B 1 291 ? 244.507 232.322 217.825 1.00 69.70  0  291 VAL B CG1 1 
ATOM   6023  C  CG2 . VAL B 1 291 ? 242.282 231.855 218.837 1.00 69.70  0  291 VAL B CG2 1 
ATOM   6024  N  N   . THR B 1 292 ? 241.069 233.401 215.158 1.00 69.54  0  292 THR B N   1 
ATOM   6025  C  CA  . THR B 1 292 ? 239.823 233.244 214.421 1.00 69.54  0  292 THR B CA  1 
ATOM   6026  C  C   . THR B 1 292 ? 239.829 231.885 213.739 1.00 69.54  0  292 THR B C   1 
ATOM   6027  O  O   . THR B 1 292 ? 240.767 231.561 213.003 1.00 69.54  0  292 THR B O   1 
ATOM   6028  C  CB  . THR B 1 292 ? 239.635 234.352 213.377 1.00 69.54  0  292 THR B CB  1 
ATOM   6029  O  OG1 . THR B 1 292 ? 240.459 234.080 212.236 1.00 69.54  0  292 THR B OG1 1 
ATOM   6030  C  CG2 . THR B 1 292 ? 239.996 235.715 213.950 1.00 69.54  0  292 THR B CG2 1 
ATOM   6031  N  N   . ALA B 1 293 ? 238.782 231.098 213.976 1.00 64.81  0  293 ALA B N   1 
ATOM   6032  C  CA  . ALA B 1 293 ? 238.668 229.773 213.389 1.00 64.81  0  293 ALA B CA  1 
ATOM   6033  C  C   . ALA B 1 293 ? 237.490 229.620 212.440 1.00 64.81  0  293 ALA B C   1 
ATOM   6034  O  O   . ALA B 1 293 ? 237.445 228.632 211.698 1.00 64.81  0  293 ALA B O   1 
ATOM   6035  C  CB  . ALA B 1 293 ? 238.561 228.706 214.489 1.00 64.81  0  293 ALA B CB  1 
ATOM   6036  N  N   . LYS B 1 294 ? 236.543 230.556 212.434 1.00 64.94  0  294 LYS B N   1 
ATOM   6037  C  CA  . LYS B 1 294 ? 235.371 230.465 211.577 1.00 64.94  0  294 LYS B CA  1 
ATOM   6038  C  C   . LYS B 1 294 ? 235.275 231.597 210.566 1.00 64.94  0  294 LYS B C   1 
ATOM   6039  O  O   . LYS B 1 294 ? 234.330 231.615 209.769 1.00 64.94  0  294 LYS B O   1 
ATOM   6040  C  CB  . LYS B 1 294 ? 234.093 230.431 212.426 1.00 64.94  0  294 LYS B CB  1 
ATOM   6041  N  N   . GLU B 1 295 ? 236.214 232.540 210.573 1.00 65.35  0  295 GLU B N   1 
ATOM   6042  C  CA  . GLU B 1 295 ? 236.195 233.668 209.656 1.00 65.35  0  295 GLU B CA  1 
ATOM   6043  C  C   . GLU B 1 295 ? 237.543 233.775 208.955 1.00 65.35  0  295 GLU B C   1 
ATOM   6044  O  O   . GLU B 1 295 ? 238.565 233.299 209.453 1.00 65.35  0  295 GLU B O   1 
ATOM   6045  C  CB  . GLU B 1 295 ? 235.868 234.977 210.387 1.00 65.35  0  295 GLU B CB  1 
ATOM   6046  C  CG  . GLU B 1 295 ? 234.482 235.015 211.011 1.00 65.35  0  295 GLU B CG  1 
ATOM   6047  C  CD  . GLU B 1 295 ? 234.463 235.734 212.344 1.00 65.35  0  295 GLU B CD  1 
ATOM   6048  O  OE1 . GLU B 1 295 ? 233.577 236.590 212.547 1.00 65.35  0  295 GLU B OE1 1 
ATOM   6049  O  OE2 . GLU B 1 295 ? 235.331 235.438 213.192 1.00 65.35  -1 295 GLU B OE2 1 
ATOM   6050  N  N   . TYR B 1 296 ? 237.533 234.417 207.790 1.00 63.74  0  296 TYR B N   1 
ATOM   6051  C  CA  . TYR B 1 296 ? 238.704 234.500 206.928 1.00 63.74  0  296 TYR B CA  1 
ATOM   6052  C  C   . TYR B 1 296 ? 239.408 235.839 207.091 1.00 63.74  0  296 TYR B C   1 
ATOM   6053  O  O   . TYR B 1 296 ? 238.764 236.885 207.198 1.00 63.74  0  296 TYR B O   1 
ATOM   6054  C  CB  . TYR B 1 296 ? 238.314 234.301 205.462 1.00 63.74  0  296 TYR B CB  1 
ATOM   6055  C  CG  . TYR B 1 296 ? 239.480 234.003 204.546 1.00 63.74  0  296 TYR B CG  1 
ATOM   6056  C  CD1 . TYR B 1 296 ? 240.135 235.024 203.867 1.00 63.74  0  296 TYR B CD1 1 
ATOM   6057  C  CD2 . TYR B 1 296 ? 239.923 232.700 204.356 1.00 63.74  0  296 TYR B CD2 1 
ATOM   6058  C  CE1 . TYR B 1 296 ? 241.200 234.758 203.029 1.00 63.74  0  296 TYR B CE1 1 
ATOM   6059  C  CE2 . TYR B 1 296 ? 240.987 232.424 203.518 1.00 63.74  0  296 TYR B CE2 1 
ATOM   6060  C  CZ  . TYR B 1 296 ? 241.620 233.456 202.858 1.00 63.74  0  296 TYR B CZ  1 
ATOM   6061  O  OH  . TYR B 1 296 ? 242.679 233.183 202.025 1.00 63.74  0  296 TYR B OH  1 
ATOM   6062  N  N   . GLY B 1 297 ? 240.736 235.800 207.093 1.00 67.98  0  297 GLY B N   1 
ATOM   6063  C  CA  . GLY B 1 297 ? 241.525 237.014 207.099 1.00 67.98  0  297 GLY B CA  1 
ATOM   6064  C  C   . GLY B 1 297 ? 242.936 236.784 206.601 1.00 67.98  0  297 GLY B C   1 
ATOM   6065  O  O   . GLY B 1 297 ? 243.640 235.909 207.113 1.00 67.98  0  297 GLY B O   1 
ATOM   6066  N  N   . ALA B 1 298 ? 243.366 237.572 205.619 1.00 69.91  0  298 ALA B N   1 
ATOM   6067  C  CA  . ALA B 1 298 ? 244.700 237.442 205.049 1.00 69.91  0  298 ALA B CA  1 
ATOM   6068  C  C   . ALA B 1 298 ? 245.065 238.762 204.384 1.00 69.91  0  298 ALA B C   1 
ATOM   6069  O  O   . ALA B 1 298 ? 244.293 239.723 204.403 1.00 69.91  0  298 ALA B O   1 
ATOM   6070  C  CB  . ALA B 1 298 ? 244.773 236.281 204.051 1.00 69.91  0  298 ALA B CB  1 
ATOM   6071  N  N   . ARG B 1 299 ? 246.255 238.801 203.791 1.00 73.48  0  299 ARG B N   1 
ATOM   6072  C  CA  . ARG B 1 299 ? 246.690 239.930 202.984 1.00 73.48  0  299 ARG B CA  1 
ATOM   6073  C  C   . ARG B 1 299 ? 247.470 239.388 201.796 1.00 73.48  0  299 ARG B C   1 
ATOM   6074  O  O   . ARG B 1 299 ? 247.611 238.174 201.626 1.00 73.48  0  299 ARG B O   1 
ATOM   6075  C  CB  . ARG B 1 299 ? 247.519 240.917 203.816 1.00 73.48  0  299 ARG B CB  1 
ATOM   6076  C  CG  . ARG B 1 299 ? 248.899 240.412 204.206 1.00 73.48  0  299 ARG B CG  1 
ATOM   6077  C  CD  . ARG B 1 299 ? 249.676 241.471 204.970 1.00 73.48  0  299 ARG B CD  1 
ATOM   6078  N  NE  . ARG B 1 299 ? 249.769 242.734 204.244 1.00 73.48  0  299 ARG B NE  1 
ATOM   6079  C  CZ  . ARG B 1 299 ? 250.831 243.112 203.539 1.00 73.48  0  299 ARG B CZ  1 
ATOM   6080  N  NH1 . ARG B 1 299 ? 251.894 242.324 203.466 1.00 73.48  1  299 ARG B NH1 1 
ATOM   6081  N  NH2 . ARG B 1 299 ? 250.830 244.279 202.910 1.00 73.48  0  299 ARG B NH2 1 
ATOM   6082  N  N   . VAL B 1 300 ? 247.972 240.287 200.956 1.00 72.77  0  300 VAL B N   1 
ATOM   6083  C  CA  . VAL B 1 300 ? 248.795 239.889 199.823 1.00 72.77  0  300 VAL B CA  1 
ATOM   6084  C  C   . VAL B 1 300 ? 250.203 240.434 200.020 1.00 72.77  0  300 VAL B C   1 
ATOM   6085  O  O   . VAL B 1 300 ? 250.413 241.490 200.630 1.00 72.77  0  300 VAL B O   1 
ATOM   6086  C  CB  . VAL B 1 300 ? 248.197 240.335 198.468 1.00 72.77  0  300 VAL B CB  1 
ATOM   6087  C  CG1 . VAL B 1 300 ? 246.814 239.731 198.279 1.00 72.77  0  300 VAL B CG1 1 
ATOM   6088  C  CG2 . VAL B 1 300 ? 248.130 241.847 198.356 1.00 72.77  0  300 VAL B CG2 1 
ATOM   6089  N  N   . SER B 1 301 ? 251.181 239.666 199.545 1.00 75.96  0  301 SER B N   1 
ATOM   6090  C  CA  . SER B 1 301 ? 252.572 240.108 199.549 1.00 75.96  0  301 SER B CA  1 
ATOM   6091  C  C   . SER B 1 301 ? 253.311 239.834 198.250 1.00 75.96  0  301 SER B C   1 
ATOM   6092  O  O   . SER B 1 301 ? 254.281 240.542 197.963 1.00 75.96  0  301 SER B O   1 
ATOM   6093  C  CB  . SER B 1 301 ? 253.341 239.453 200.702 1.00 75.96  0  301 SER B CB  1 
ATOM   6094  O  OG  . SER B 1 301 ? 252.593 239.501 201.905 1.00 75.96  0  301 SER B OG  1 
ATOM   6095  N  N   . ASN B 1 302 ? 252.899 238.854 197.455 1.00 77.01  0  302 ASN B N   1 
ATOM   6096  C  CA  . ASN B 1 302 ? 253.534 238.557 196.178 1.00 77.01  0  302 ASN B CA  1 
ATOM   6097  C  C   . ASN B 1 302 ? 252.476 237.943 195.267 1.00 77.01  0  302 ASN B C   1 
ATOM   6098  O  O   . ASN B 1 302 ? 251.274 238.060 195.529 1.00 77.01  0  302 ASN B O   1 
ATOM   6099  C  CB  . ASN B 1 302 ? 254.772 237.662 196.382 1.00 77.01  0  302 ASN B CB  1 
ATOM   6100  C  CG  . ASN B 1 302 ? 254.528 236.524 197.358 1.00 77.01  0  302 ASN B CG  1 
ATOM   6101  O  OD1 . ASN B 1 302 ? 253.440 235.954 197.415 1.00 77.01  0  302 ASN B OD1 1 
ATOM   6102  N  ND2 . ASN B 1 302 ? 255.548 236.191 198.140 1.00 77.01  0  302 ASN B ND2 1 
ATOM   6103  N  N   . LEU B 1 303 ? 252.921 237.289 194.191 1.00 79.01  0  303 LEU B N   1 
ATOM   6104  C  CA  . LEU B 1 303 ? 251.980 236.641 193.283 1.00 79.01  0  303 LEU B CA  1 
ATOM   6105  C  C   . LEU B 1 303 ? 251.354 235.398 193.906 1.00 79.01  0  303 LEU B C   1 
ATOM   6106  O  O   . LEU B 1 303 ? 250.238 235.020 193.534 1.00 79.01  0  303 LEU B O   1 
ATOM   6107  C  CB  . LEU B 1 303 ? 252.669 236.283 191.960 1.00 79.01  0  303 LEU B CB  1 
ATOM   6108  C  CG  . LEU B 1 303 ? 253.625 235.086 191.841 1.00 79.01  0  303 LEU B CG  1 
ATOM   6109  C  CD1 . LEU B 1 303 ? 253.752 234.678 190.384 1.00 79.01  0  303 LEU B CD1 1 
ATOM   6110  C  CD2 . LEU B 1 303 ? 255.008 235.372 192.416 1.00 79.01  0  303 LEU B CD2 1 
ATOM   6111  N  N   . HIS B 1 304 ? 252.041 234.767 194.863 1.00 77.59  0  304 HIS B N   1 
ATOM   6112  C  CA  . HIS B 1 304 ? 251.509 233.562 195.495 1.00 77.59  0  304 HIS B CA  1 
ATOM   6113  C  C   . HIS B 1 304 ? 250.342 233.889 196.420 1.00 77.59  0  304 HIS B C   1 
ATOM   6114  O  O   . HIS B 1 304 ? 249.296 233.227 196.372 1.00 77.59  0  304 HIS B O   1 
ATOM   6115  C  CB  . HIS B 1 304 ? 252.618 232.842 196.262 1.00 77.59  0  304 HIS B CB  1 
ATOM   6116  C  CG  . HIS B 1 304 ? 252.262 231.446 196.671 1.00 77.59  0  304 HIS B CG  1 
ATOM   6117  N  ND1 . HIS B 1 304 ? 253.007 230.726 197.579 1.00 77.59  0  304 HIS B ND1 1 
ATOM   6118  C  CD2 . HIS B 1 304 ? 251.243 230.638 196.294 1.00 77.59  0  304 HIS B CD2 1 
ATOM   6119  C  CE1 . HIS B 1 304 ? 252.461 229.534 197.747 1.00 77.59  0  304 HIS B CE1 1 
ATOM   6120  N  NE2 . HIS B 1 304 ? 251.390 229.455 196.978 1.00 77.59  0  304 HIS B NE2 1 
ATOM   6121  N  N   . MET B 1 305 ? 250.505 234.910 197.270 1.00 74.38  0  305 MET B N   1 
ATOM   6122  C  CA  . MET B 1 305 ? 249.406 235.352 198.124 1.00 74.38  0  305 MET B CA  1 
ATOM   6123  C  C   . MET B 1 305 ? 248.262 235.929 197.302 1.00 74.38  0  305 MET B C   1 
ATOM   6124  O  O   . MET B 1 305 ? 247.093 235.735 197.649 1.00 74.38  0  305 MET B O   1 
ATOM   6125  C  CB  . MET B 1 305 ? 249.895 236.383 199.141 1.00 74.38  0  305 MET B CB  1 
ATOM   6126  C  CG  . MET B 1 305 ? 251.211 236.046 199.811 1.00 74.38  0  305 MET B CG  1 
ATOM   6127  S  SD  . MET B 1 305 ? 251.025 234.973 201.245 1.00 74.38  0  305 MET B SD  1 
ATOM   6128  C  CE  . MET B 1 305 ? 249.998 235.979 202.309 1.00 74.38  0  305 MET B CE  1 
ATOM   6129  N  N   . TYR B 1 306 ? 248.582 236.620 196.201 1.00 70.41  0  306 TYR B N   1 
ATOM   6130  C  CA  . TYR B 1 306 ? 247.550 237.136 195.305 1.00 70.41  0  306 TYR B CA  1 
ATOM   6131  C  C   . TYR B 1 306 ? 246.738 236.007 194.686 1.00 70.41  0  306 TYR B C   1 
ATOM   6132  O  O   . TYR B 1 306 ? 245.502 236.064 194.664 1.00 70.41  0  306 TYR B O   1 
ATOM   6133  C  CB  . TYR B 1 306 ? 248.187 237.998 194.213 1.00 70.41  0  306 TYR B CB  1 
ATOM   6134  C  CG  . TYR B 1 306 ? 247.208 238.560 193.202 1.00 70.41  0  306 TYR B CG  1 
ATOM   6135  C  CD1 . TYR B 1 306 ? 246.450 239.688 193.492 1.00 70.41  0  306 TYR B CD1 1 
ATOM   6136  C  CD2 . TYR B 1 306 ? 247.056 237.972 191.949 1.00 70.41  0  306 TYR B CD2 1 
ATOM   6137  C  CE1 . TYR B 1 306 ? 245.560 240.208 192.568 1.00 70.41  0  306 TYR B CE1 1 
ATOM   6138  C  CE2 . TYR B 1 306 ? 246.165 238.482 191.022 1.00 70.41  0  306 TYR B CE2 1 
ATOM   6139  C  CZ  . TYR B 1 306 ? 245.422 239.600 191.337 1.00 70.41  0  306 TYR B CZ  1 
ATOM   6140  O  OH  . TYR B 1 306 ? 244.537 240.112 190.417 1.00 70.41  0  306 TYR B OH  1 
ATOM   6141  N  N   . SER B 1 307 ? 247.416 234.952 194.222 1.00 68.87  0  307 SER B N   1 
ATOM   6142  C  CA  . SER B 1 307 ? 246.729 233.817 193.614 1.00 68.87  0  307 SER B CA  1 
ATOM   6143  C  C   . SER B 1 307 ? 245.889 233.057 194.634 1.00 68.87  0  307 SER B C   1 
ATOM   6144  O  O   . SER B 1 307 ? 244.752 232.668 194.340 1.00 68.87  0  307 SER B O   1 
ATOM   6145  C  CB  . SER B 1 307 ? 247.744 232.884 192.955 1.00 68.87  0  307 SER B CB  1 
ATOM   6146  O  OG  . SER B 1 307 ? 248.465 233.552 191.935 1.00 68.87  0  307 SER B OG  1 
ATOM   6147  N  N   . ALA B 1 308 ? 246.419 232.869 195.846 1.00 65.54  0  308 ALA B N   1 
ATOM   6148  C  CA  . ALA B 1 308 ? 245.692 232.123 196.870 1.00 65.54  0  308 ALA B CA  1 
ATOM   6149  C  C   . ALA B 1 308 ? 244.475 232.892 197.375 1.00 65.54  0  308 ALA B C   1 
ATOM   6150  O  O   . ALA B 1 308 ? 243.389 232.315 197.521 1.00 65.54  0  308 ALA B O   1 
ATOM   6151  C  CB  . ALA B 1 308 ? 246.628 231.782 198.026 1.00 65.54  0  308 ALA B CB  1 
ATOM   6152  N  N   . VAL B 1 309 ? 244.626 234.195 197.628 1.00 63.87  0  309 VAL B N   1 
ATOM   6153  C  CA  . VAL B 1 309 ? 243.496 235.007 198.066 1.00 63.87  0  309 VAL B CA  1 
ATOM   6154  C  C   . VAL B 1 309 ? 242.466 235.179 196.949 1.00 63.87  0  309 VAL B C   1 
ATOM   6155  O  O   . VAL B 1 309 ? 241.259 235.182 197.217 1.00 63.87  0  309 VAL B O   1 
ATOM   6156  C  CB  . VAL B 1 309 ? 244.021 236.349 198.620 1.00 63.87  0  309 VAL B CB  1 
ATOM   6157  C  CG1 . VAL B 1 309 ? 242.902 237.323 198.908 1.00 63.87  0  309 VAL B CG1 1 
ATOM   6158  C  CG2 . VAL B 1 309 ? 244.786 236.105 199.913 1.00 63.87  0  309 VAL B CG2 1 
ATOM   6159  N  N   . CYS B 1 310 ? 242.899 235.245 195.684 1.00 65.32  0  310 CYS B N   1 
ATOM   6160  C  CA  . CYS B 1 310 ? 241.940 235.299 194.582 1.00 65.32  0  310 CYS B CA  1 
ATOM   6161  C  C   . CYS B 1 310 ? 241.162 233.994 194.444 1.00 65.32  0  310 CYS B C   1 
ATOM   6162  O  O   . CYS B 1 310 ? 239.943 234.014 194.233 1.00 65.32  0  310 CYS B O   1 
ATOM   6163  C  CB  . CYS B 1 310 ? 242.658 235.634 193.277 1.00 65.32  0  310 CYS B CB  1 
ATOM   6164  S  SG  . CYS B 1 310 ? 241.562 236.241 191.977 1.00 65.32  0  310 CYS B SG  1 
ATOM   6165  N  N   . ALA B 1 311 ? 241.845 232.852 194.579 1.00 62.48  0  311 ALA B N   1 
ATOM   6166  C  CA  . ALA B 1 311 ? 241.160 231.563 194.549 1.00 62.48  0  311 ALA B CA  1 
ATOM   6167  C  C   . ALA B 1 311 ? 240.244 231.366 195.752 1.00 62.48  0  311 ALA B C   1 
ATOM   6168  O  O   . ALA B 1 311 ? 239.257 230.628 195.659 1.00 62.48  0  311 ALA B O   1 
ATOM   6169  C  CB  . ALA B 1 311 ? 242.182 230.429 194.473 1.00 62.48  0  311 ALA B CB  1 
ATOM   6170  N  N   . ASP B 1 312 ? 240.543 232.010 196.882 1.00 62.01  0  312 ASP B N   1 
ATOM   6171  C  CA  . ASP B 1 312 ? 239.644 231.931 198.030 1.00 62.01  0  312 ASP B CA  1 
ATOM   6172  C  C   . ASP B 1 312 ? 238.441 232.864 197.897 1.00 62.01  0  312 ASP B C   1 
ATOM   6173  O  O   . ASP B 1 312 ? 237.343 232.523 198.350 1.00 62.01  0  312 ASP B O   1 
ATOM   6174  C  CB  . ASP B 1 312 ? 240.413 232.231 199.316 1.00 62.01  0  312 ASP B CB  1 
ATOM   6175  C  CG  . ASP B 1 312 ? 241.372 231.119 199.691 1.00 62.01  0  312 ASP B CG  1 
ATOM   6176  O  OD1 . ASP B 1 312 ? 241.319 230.048 199.050 1.00 62.01  0  312 ASP B OD1 1 
ATOM   6177  O  OD2 . ASP B 1 312 ? 242.180 231.313 200.622 1.00 62.01  -1 312 ASP B OD2 1 
ATOM   6178  N  N   . VAL B 1 313 ? 238.624 234.041 197.294 1.00 58.59  0  313 VAL B N   1 
ATOM   6179  C  CA  . VAL B 1 313 ? 237.498 234.941 197.048 1.00 58.59  0  313 VAL B CA  1 
ATOM   6180  C  C   . VAL B 1 313 ? 236.557 234.354 195.998 1.00 58.59  0  313 VAL B C   1 
ATOM   6181  O  O   . VAL B 1 313 ? 235.328 234.442 196.131 1.00 58.59  0  313 VAL B O   1 
ATOM   6182  C  CB  . VAL B 1 313 ? 238.016 236.342 196.654 1.00 58.59  0  313 VAL B CB  1 
ATOM   6183  C  CG1 . VAL B 1 313 ? 236.904 237.236 196.122 1.00 58.59  0  313 VAL B CG1 1 
ATOM   6184  C  CG2 . VAL B 1 313 ? 238.648 237.021 197.852 1.00 58.59  0  313 VAL B CG2 1 
ATOM   6185  N  N   . ILE B 1 314 ? 237.111 233.709 194.967 1.00 61.09  0  314 ILE B N   1 
ATOM   6186  C  CA  . ILE B 1 314 ? 236.275 233.074 193.949 1.00 61.09  0  314 ILE B CA  1 
ATOM   6187  C  C   . ILE B 1 314 ? 235.521 231.878 194.533 1.00 61.09  0  314 ILE B C   1 
ATOM   6188  O  O   . ILE B 1 314 ? 234.338 231.669 194.238 1.00 61.09  0  314 ILE B O   1 
ATOM   6189  C  CB  . ILE B 1 314 ? 237.139 232.689 192.730 1.00 61.09  0  314 ILE B CB  1 
ATOM   6190  C  CG1 . ILE B 1 314 ? 237.581 233.945 191.980 1.00 61.09  0  314 ILE B CG1 1 
ATOM   6191  C  CG2 . ILE B 1 314 ? 236.387 231.802 191.760 1.00 61.09  0  314 ILE B CG2 1 
ATOM   6192  C  CD1 . ILE B 1 314 ? 236.436 234.796 191.491 1.00 61.09  0  314 ILE B CD1 1 
ATOM   6193  N  N   . ARG B 1 315 ? 236.156 231.126 195.432 1.00 62.11  0  315 ARG B N   1 
ATOM   6194  C  CA  . ARG B 1 315 ? 235.508 229.994 196.082 1.00 62.11  0  315 ARG B CA  1 
ATOM   6195  C  C   . ARG B 1 315 ? 234.751 230.383 197.354 1.00 62.11  0  315 ARG B C   1 
ATOM   6196  O  O   . ARG B 1 315 ? 234.527 229.517 198.209 1.00 62.11  0  315 ARG B O   1 
ATOM   6197  C  CB  . ARG B 1 315 ? 236.536 228.905 196.392 1.00 62.11  0  315 ARG B CB  1 
ATOM   6198  C  CG  . ARG B 1 315 ? 237.042 228.176 195.162 1.00 62.11  0  315 ARG B CG  1 
ATOM   6199  C  CD  . ARG B 1 315 ? 238.011 227.069 195.534 1.00 62.11  0  315 ARG B CD  1 
ATOM   6200  N  NE  . ARG B 1 315 ? 239.158 227.577 196.279 1.00 62.11  0  315 ARG B NE  1 
ATOM   6201  C  CZ  . ARG B 1 315 ? 240.159 226.819 196.713 1.00 62.11  0  315 ARG B CZ  1 
ATOM   6202  N  NH1 . ARG B 1 315 ? 240.157 225.515 196.477 1.00 62.11  1  315 ARG B NH1 1 
ATOM   6203  N  NH2 . ARG B 1 315 ? 241.164 227.366 197.384 1.00 62.11  0  315 ARG B NH2 1 
ATOM   6204  N  N   . ARG B 1 316 ? 234.384 231.664 197.493 1.00 62.81  0  316 ARG B N   1 
ATOM   6205  C  CA  . ARG B 1 316 ? 233.465 232.180 198.519 1.00 62.81  0  316 ARG B CA  1 
ATOM   6206  C  C   . ARG B 1 316 ? 233.972 231.967 199.942 1.00 62.81  0  316 ARG B C   1 
ATOM   6207  O  O   . ARG B 1 316 ? 233.179 231.848 200.878 1.00 62.81  0  316 ARG B O   1 
ATOM   6208  C  CB  . ARG B 1 316 ? 232.059 231.586 198.378 1.00 62.81  0  316 ARG B CB  1 
ATOM   6209  C  CG  . ARG B 1 316 ? 231.466 231.704 196.994 1.00 62.81  0  316 ARG B CG  1 
ATOM   6210  C  CD  . ARG B 1 316 ? 230.071 231.122 196.961 1.00 62.81  0  316 ARG B CD  1 
ATOM   6211  N  NE  . ARG B 1 316 ? 229.137 231.934 197.732 1.00 62.81  0  316 ARG B NE  1 
ATOM   6212  C  CZ  . ARG B 1 316 ? 228.319 232.832 197.197 1.00 62.81  0  316 ARG B CZ  1 
ATOM   6213  N  NH1 . ARG B 1 316 ? 228.321 233.025 195.886 1.00 62.81  1  316 ARG B NH1 1 
ATOM   6214  N  NH2 . ARG B 1 316 ? 227.499 233.532 197.967 1.00 62.81  0  316 ARG B NH2 1 
ATOM   6215  N  N   . TRP B 1 317 ? 235.291 231.933 200.131 1.00 60.18  0  317 TRP B N   1 
ATOM   6216  C  CA  . TRP B 1 317 ? 235.833 231.773 201.475 1.00 60.18  0  317 TRP B CA  1 
ATOM   6217  C  C   . TRP B 1 317 ? 235.740 233.050 202.297 1.00 60.18  0  317 TRP B C   1 
ATOM   6218  O  O   . TRP B 1 317 ? 235.891 232.995 203.522 1.00 60.18  0  317 TRP B O   1 
ATOM   6219  C  CB  . TRP B 1 317 ? 237.290 231.314 201.408 1.00 60.18  0  317 TRP B CB  1 
ATOM   6220  C  CG  . TRP B 1 317 ? 237.436 229.882 201.022 1.00 60.18  0  317 TRP B CG  1 
ATOM   6221  C  CD1 . TRP B 1 317 ? 237.402 229.373 199.761 1.00 60.18  0  317 TRP B CD1 1 
ATOM   6222  C  CD2 . TRP B 1 317 ? 237.653 228.772 201.899 1.00 60.18  0  317 TRP B CD2 1 
ATOM   6223  N  NE1 . TRP B 1 317 ? 237.576 228.012 199.794 1.00 60.18  0  317 TRP B NE1 1 
ATOM   6224  C  CE2 . TRP B 1 317 ? 237.734 227.618 201.096 1.00 60.18  0  317 TRP B CE2 1 
ATOM   6225  C  CE3 . TRP B 1 317 ? 237.785 228.642 203.284 1.00 60.18  0  317 TRP B CE3 1 
ATOM   6226  C  CZ2 . TRP B 1 317 ? 237.940 226.351 201.632 1.00 60.18  0  317 TRP B CZ2 1 
ATOM   6227  C  CZ3 . TRP B 1 317 ? 237.990 227.382 203.814 1.00 60.18  0  317 TRP B CZ3 1 
ATOM   6228  C  CH2 . TRP B 1 317 ? 238.064 226.254 202.990 1.00 60.18  0  317 TRP B CH2 1 
ATOM   6229  N  N   . VAL B 1 318 ? 235.495 234.193 201.657 1.00 63.21  0  318 VAL B N   1 
ATOM   6230  C  CA  . VAL B 1 318 ? 235.465 235.474 202.351 1.00 63.21  0  318 VAL B CA  1 
ATOM   6231  C  C   . VAL B 1 318 ? 234.029 235.989 202.263 1.00 63.21  0  318 VAL B C   1 
ATOM   6232  O  O   . VAL B 1 318 ? 233.791 237.188 202.091 1.00 63.21  0  318 VAL B O   1 
ATOM   6233  C  CB  . VAL B 1 318 ? 236.486 236.468 201.753 1.00 63.21  0  318 VAL B CB  1 
ATOM   6234  C  CG1 . VAL B 1 318 ? 236.875 237.572 202.761 1.00 63.21  0  318 VAL B CG1 1 
ATOM   6235  C  CG2 . VAL B 1 318 ? 237.721 235.743 201.240 1.00 63.21  0  318 VAL B CG2 1 
ATOM   6236  N  N   . TYR B 1 319 ? 233.065 235.072 202.307 1.00 61.23  0  319 TYR B N   1 
ATOM   6237  C  CA  . TYR B 1 319 ? 231.663 235.457 202.404 1.00 61.23  0  319 TYR B CA  1 
ATOM   6238  C  C   . TYR B 1 319 ? 231.433 236.211 203.713 1.00 61.23  0  319 TYR B C   1 
ATOM   6239  O  O   . TYR B 1 319 ? 231.943 235.796 204.760 1.00 61.23  0  319 TYR B O   1 
ATOM   6240  C  CB  . TYR B 1 319 ? 230.777 234.209 202.333 1.00 61.23  0  319 TYR B CB  1 
ATOM   6241  C  CG  . TYR B 1 319 ? 229.290 234.474 202.275 1.00 61.23  0  319 TYR B CG  1 
ATOM   6242  C  CD1 . TYR B 1 319 ? 228.667 234.779 201.071 1.00 61.23  0  319 TYR B CD1 1 
ATOM   6243  C  CD2 . TYR B 1 319 ? 228.508 234.412 203.423 1.00 61.23  0  319 TYR B CD2 1 
ATOM   6244  C  CE1 . TYR B 1 319 ? 227.307 235.022 201.012 1.00 61.23  0  319 TYR B CE1 1 
ATOM   6245  C  CE2 . TYR B 1 319 ? 227.147 234.653 203.373 1.00 61.23  0  319 TYR B CE2 1 
ATOM   6246  C  CZ  . TYR B 1 319 ? 226.553 234.956 202.166 1.00 61.23  0  319 TYR B CZ  1 
ATOM   6247  O  OH  . TYR B 1 319 ? 225.199 235.197 202.112 1.00 61.23  0  319 TYR B OH  1 
ATOM   6248  N  N   . PRO B 1 320 ? 230.664 237.317 203.707 1.00 65.85  0  320 PRO B N   1 
ATOM   6249  C  CA  . PRO B 1 320 ? 229.757 237.904 202.711 1.00 65.85  0  320 PRO B CA  1 
ATOM   6250  C  C   . PRO B 1 320 ? 230.399 238.708 201.582 1.00 65.85  0  320 PRO B C   1 
ATOM   6251  O  O   . PRO B 1 320 ? 229.675 239.087 200.661 1.00 65.85  0  320 PRO B O   1 
ATOM   6252  C  CB  . PRO B 1 320 ? 228.871 238.836 203.555 1.00 65.85  0  320 PRO B CB  1 
ATOM   6253  C  CG  . PRO B 1 320 ? 229.311 238.647 204.991 1.00 65.85  0  320 PRO B CG  1 
ATOM   6254  C  CD  . PRO B 1 320 ? 230.698 238.139 204.924 1.00 65.85  0  320 PRO B CD  1 
ATOM   6255  N  N   . LEU B 1 321 ? 231.702 238.977 201.647 1.00 70.05  0  321 LEU B N   1 
ATOM   6256  C  CA  . LEU B 1 321 ? 232.349 239.752 200.593 1.00 70.05  0  321 LEU B CA  1 
ATOM   6257  C  C   . LEU B 1 321 ? 232.473 238.885 199.346 1.00 70.05  0  321 LEU B C   1 
ATOM   6258  O  O   . LEU B 1 321 ? 233.437 238.129 199.192 1.00 70.05  0  321 LEU B O   1 
ATOM   6259  C  CB  . LEU B 1 321 ? 233.717 240.269 201.048 1.00 70.05  0  321 LEU B CB  1 
ATOM   6260  C  CG  . LEU B 1 321 ? 233.771 241.650 201.711 1.00 70.05  0  321 LEU B CG  1 
ATOM   6261  C  CD1 . LEU B 1 321 ? 233.208 241.627 203.126 1.00 70.05  0  321 LEU B CD1 1 
ATOM   6262  C  CD2 . LEU B 1 321 ? 235.195 242.172 201.723 1.00 70.05  0  321 LEU B CD2 1 
ATOM   6263  N  N   . THR B 1 322 ? 231.491 238.997 198.453 1.00 72.72  0  322 THR B N   1 
ATOM   6264  C  CA  . THR B 1 322 ? 231.288 238.102 197.328 1.00 72.72  0  322 THR B CA  1 
ATOM   6265  C  C   . THR B 1 322 ? 231.158 238.939 196.062 1.00 72.72  0  322 THR B C   1 
ATOM   6266  O  O   . THR B 1 322 ? 230.598 240.041 196.115 1.00 72.72  0  322 THR B O   1 
ATOM   6267  C  CB  . THR B 1 322 ? 230.018 237.265 197.552 1.00 72.72  0  322 THR B CB  1 
ATOM   6268  O  OG1 . THR B 1 322 ? 229.897 236.959 198.942 1.00 72.72  0  322 THR B OG1 1 
ATOM   6269  C  CG2 . THR B 1 322 ? 230.085 235.955 196.800 1.00 72.72  0  322 THR B CG2 1 
ATOM   6270  N  N   . PRO B 1 323 ? 231.700 238.475 194.924 1.00 73.54  0  323 PRO B N   1 
ATOM   6271  C  CA  . PRO B 1 323 ? 231.603 239.280 193.690 1.00 73.54  0  323 PRO B CA  1 
ATOM   6272  C  C   . PRO B 1 323 ? 230.189 239.493 193.170 1.00 73.54  0  323 PRO B C   1 
ATOM   6273  O  O   . PRO B 1 323 ? 229.892 240.584 192.669 1.00 73.54  0  323 PRO B O   1 
ATOM   6274  C  CB  . PRO B 1 323 ? 232.453 238.482 192.695 1.00 73.54  0  323 PRO B CB  1 
ATOM   6275  C  CG  . PRO B 1 323 ? 233.454 237.800 193.536 1.00 73.54  0  323 PRO B CG  1 
ATOM   6276  C  CD  . PRO B 1 323 ? 232.739 237.434 194.805 1.00 73.54  0  323 PRO B CD  1 
ATOM   6277  N  N   . GLU B 1 324 ? 229.306 238.499 193.260 1.00 74.20  0  324 GLU B N   1 
ATOM   6278  C  CA  . GLU B 1 324 ? 227.937 238.725 192.814 1.00 74.20  0  324 GLU B CA  1 
ATOM   6279  C  C   . GLU B 1 324 ? 227.100 239.458 193.853 1.00 74.20  0  324 GLU B C   1 
ATOM   6280  O  O   . GLU B 1 324 ? 226.008 239.934 193.520 1.00 74.20  0  324 GLU B O   1 
ATOM   6281  C  CB  . GLU B 1 324 ? 227.259 237.402 192.441 1.00 74.20  0  324 GLU B CB  1 
ATOM   6282  C  CG  . GLU B 1 324 ? 226.573 236.694 193.593 1.00 74.20  0  324 GLU B CG  1 
ATOM   6283  C  CD  . GLU B 1 324 ? 227.456 235.654 194.229 1.00 74.20  0  324 GLU B CD  1 
ATOM   6284  O  OE1 . GLU B 1 324 ? 228.639 235.576 193.843 1.00 74.20  0  324 GLU B OE1 1 
ATOM   6285  O  OE2 . GLU B 1 324 ? 226.974 234.920 195.115 1.00 74.20  -1 324 GLU B OE2 1 
ATOM   6286  N  N   . ALA B 1 325 ? 227.586 239.566 195.092 1.00 74.66  0  325 ALA B N   1 
ATOM   6287  C  CA  . ALA B 1 325 ? 226.862 240.313 196.111 1.00 74.66  0  325 ALA B CA  1 
ATOM   6288  C  C   . ALA B 1 325 ? 226.908 241.811 195.846 1.00 74.66  0  325 ALA B C   1 
ATOM   6289  O  O   . ALA B 1 325 ? 225.969 242.525 196.221 1.00 74.66  0  325 ALA B O   1 
ATOM   6290  C  CB  . ALA B 1 325 ? 227.430 240.004 197.496 1.00 74.66  0  325 ALA B CB  1 
ATOM   6291  N  N   . ASN B 1 326 ? 227.982 242.286 195.200 1.00 76.35  0  326 ASN B N   1 
ATOM   6292  C  CA  . ASN B 1 326 ? 228.192 243.681 194.795 1.00 76.35  0  326 ASN B CA  1 
ATOM   6293  C  C   . ASN B 1 326 ? 228.131 244.621 196.004 1.00 76.35  0  326 ASN B C   1 
ATOM   6294  O  O   . ASN B 1 326 ? 227.229 245.449 196.149 1.00 76.35  0  326 ASN B O   1 
ATOM   6295  C  CB  . ASN B 1 326 ? 227.196 244.103 193.705 1.00 76.35  0  326 ASN B CB  1 
ATOM   6296  C  CG  . ASN B 1 326 ? 227.709 245.254 192.865 1.00 76.35  0  326 ASN B CG  1 
ATOM   6297  O  OD1 . ASN B 1 326 ? 228.911 245.382 192.635 1.00 76.35  0  326 ASN B OD1 1 
ATOM   6298  N  ND2 . ASN B 1 326 ? 226.796 246.099 192.399 1.00 76.35  0  326 ASN B ND2 1 
ATOM   6299  N  N   . PHE B 1 327 ? 229.119 244.441 196.888 1.00 75.71  0  327 PHE B N   1 
ATOM   6300  C  CA  . PHE B 1 327 ? 229.174 245.220 198.122 1.00 75.71  0  327 PHE B CA  1 
ATOM   6301  C  C   . PHE B 1 327 ? 229.455 246.694 197.853 1.00 75.71  0  327 PHE B C   1 
ATOM   6302  O  O   . PHE B 1 327 ? 229.037 247.555 198.636 1.00 75.71  0  327 PHE B O   1 
ATOM   6303  C  CB  . PHE B 1 327 ? 230.220 244.634 199.077 1.00 75.71  0  327 PHE B CB  1 
ATOM   6304  C  CG  . PHE B 1 327 ? 231.559 244.351 198.440 1.00 75.71  0  327 PHE B CG  1 
ATOM   6305  C  CD1 . PHE B 1 327 ? 232.528 245.342 198.356 1.00 75.71  0  327 PHE B CD1 1 
ATOM   6306  C  CD2 . PHE B 1 327 ? 231.861 243.084 197.959 1.00 75.71  0  327 PHE B CD2 1 
ATOM   6307  C  CE1 . PHE B 1 327 ? 233.759 245.083 197.782 1.00 75.71  0  327 PHE B CE1 1 
ATOM   6308  C  CE2 . PHE B 1 327 ? 233.090 242.820 197.383 1.00 75.71  0  327 PHE B CE2 1 
ATOM   6309  C  CZ  . PHE B 1 327 ? 234.039 243.821 197.296 1.00 75.71  0  327 PHE B CZ  1 
ATOM   6310  N  N   . THR B 1 328 ? 230.155 247.003 196.768 1.00 77.51  0  328 THR B N   1 
ATOM   6311  C  CA  . THR B 1 328 ? 230.275 248.375 196.305 1.00 77.51  0  328 THR B CA  1 
ATOM   6312  C  C   . THR B 1 328 ? 229.215 248.652 195.243 1.00 77.51  0  328 THR B C   1 
ATOM   6313  O  O   . THR B 1 328 ? 228.803 247.759 194.497 1.00 77.51  0  328 THR B O   1 
ATOM   6314  C  CB  . THR B 1 328 ? 231.683 248.658 195.767 1.00 77.51  0  328 THR B CB  1 
ATOM   6315  O  OG1 . THR B 1 328 ? 231.775 250.025 195.345 1.00 77.51  0  328 THR B OG1 1 
ATOM   6316  C  CG2 . THR B 1 328 ? 232.051 247.727 194.617 1.00 77.51  0  328 THR B CG2 1 
ATOM   6317  N  N   . ASP B 1 329 ? 228.740 249.893 195.212 1.00 82.03  0  329 ASP B N   1 
ATOM   6318  C  CA  . ASP B 1 329 ? 227.652 250.276 194.315 1.00 82.03  0  329 ASP B CA  1 
ATOM   6319  C  C   . ASP B 1 329 ? 228.252 250.671 192.972 1.00 82.03  0  329 ASP B C   1 
ATOM   6320  O  O   . ASP B 1 329 ? 228.728 251.795 192.795 1.00 82.03  0  329 ASP B O   1 
ATOM   6321  C  CB  . ASP B 1 329 ? 226.826 251.405 194.919 1.00 82.03  0  329 ASP B CB  1 
ATOM   6322  C  CG  . ASP B 1 329 ? 226.136 250.997 196.205 1.00 82.03  0  329 ASP B CG  1 
ATOM   6323  O  OD1 . ASP B 1 329 ? 226.292 249.830 196.621 1.00 82.03  0  329 ASP B OD1 1 
ATOM   6324  O  OD2 . ASP B 1 329 ? 225.436 251.843 196.800 1.00 82.03  -1 329 ASP B OD2 1 
ATOM   6325  N  N   . SER B 1 330 ? 228.227 249.740 192.022 1.00 83.96  0  330 SER B N   1 
ATOM   6326  C  CA  . SER B 1 330 ? 228.724 249.989 190.677 1.00 83.96  0  330 SER B CA  1 
ATOM   6327  C  C   . SER B 1 330 ? 227.989 249.073 189.713 1.00 83.96  0  330 SER B C   1 
ATOM   6328  O  O   . SER B 1 330 ? 227.859 247.874 189.974 1.00 83.96  0  330 SER B O   1 
ATOM   6329  C  CB  . SER B 1 330 ? 230.236 249.757 190.590 1.00 83.96  0  330 SER B CB  1 
ATOM   6330  O  OG  . SER B 1 330 ? 230.526 248.397 190.325 1.00 83.96  0  330 SER B OG  1 
ATOM   6331  N  N   . THR B 1 331 ? 227.512 249.639 188.603 1.00 87.88  0  331 THR B N   1 
ATOM   6332  C  CA  . THR B 1 331 ? 226.729 248.866 187.648 1.00 87.88  0  331 THR B CA  1 
ATOM   6333  C  C   . THR B 1 331 ? 227.594 247.971 186.772 1.00 87.88  0  331 THR B C   1 
ATOM   6334  O  O   . THR B 1 331 ? 227.081 247.004 186.199 1.00 87.88  0  331 THR B O   1 
ATOM   6335  C  CB  . THR B 1 331 ? 225.900 249.799 186.762 1.00 87.88  0  331 THR B CB  1 
ATOM   6336  O  OG1 . THR B 1 331 ? 226.746 250.400 185.775 1.00 87.88  0  331 THR B OG1 1 
ATOM   6337  C  CG2 . THR B 1 331 ? 225.251 250.890 187.600 1.00 87.88  0  331 THR B CG2 1 
ATOM   6338  N  N   . THR B 1 332 ? 228.887 248.269 186.656 1.00 87.88  0  332 THR B N   1 
ATOM   6339  C  CA  . THR B 1 332 ? 229.789 247.496 185.813 1.00 87.88  0  332 THR B CA  1 
ATOM   6340  C  C   . THR B 1 332 ? 230.311 246.239 186.495 1.00 87.88  0  332 THR B C   1 
ATOM   6341  O  O   . THR B 1 332 ? 231.062 245.482 185.869 1.00 87.88  0  332 THR B O   1 
ATOM   6342  C  CB  . THR B 1 332 ? 230.972 248.363 185.372 1.00 87.88  0  332 THR B CB  1 
ATOM   6343  O  OG1 . THR B 1 332 ? 231.756 247.651 184.407 1.00 87.88  0  332 THR B OG1 1 
ATOM   6344  C  CG2 . THR B 1 332 ? 231.847 248.716 186.567 1.00 87.88  0  332 THR B CG2 1 
ATOM   6345  N  N   . GLN B 1 333 ? 229.940 245.996 187.753 1.00 84.99  0  333 GLN B N   1 
ATOM   6346  C  CA  . GLN B 1 333 ? 230.384 244.815 188.483 1.00 84.99  0  333 GLN B CA  1 
ATOM   6347  C  C   . GLN B 1 333 ? 229.226 243.965 188.989 1.00 84.99  0  333 GLN B C   1 
ATOM   6348  O  O   . GLN B 1 333 ? 229.442 243.083 189.830 1.00 84.99  0  333 GLN B O   1 
ATOM   6349  C  CB  . GLN B 1 333 ? 231.284 245.221 189.654 1.00 84.99  0  333 GLN B CB  1 
ATOM   6350  C  CG  . GLN B 1 333 ? 232.556 245.940 189.237 1.00 84.99  0  333 GLN B CG  1 
ATOM   6351  C  CD  . GLN B 1 333 ? 233.269 246.582 190.408 1.00 84.99  0  333 GLN B CD  1 
ATOM   6352  O  OE1 . GLN B 1 333 ? 232.715 246.691 191.500 1.00 84.99  0  333 GLN B OE1 1 
ATOM   6353  N  NE2 . GLN B 1 333 ? 234.502 247.020 190.183 1.00 84.99  0  333 GLN B NE2 1 
ATOM   6354  N  N   . SER B 1 334 ? 228.006 244.209 188.513 1.00 83.01  0  334 SER B N   1 
ATOM   6355  C  CA  . SER B 1 334 ? 226.877 243.372 188.892 1.00 83.01  0  334 SER B CA  1 
ATOM   6356  C  C   . SER B 1 334 ? 226.989 242.018 188.203 1.00 83.01  0  334 SER B C   1 
ATOM   6357  O  O   . SER B 1 334 ? 227.302 241.933 187.014 1.00 83.01  0  334 SER B O   1 
ATOM   6358  C  CB  . SER B 1 334 ? 225.559 244.050 188.522 1.00 83.01  0  334 SER B CB  1 
ATOM   6359  O  OG  . SER B 1 334 ? 225.230 243.818 187.163 1.00 83.01  0  334 SER B OG  1 
ATOM   6360  N  N   . CYS B 1 335 ? 226.741 240.953 188.959 1.00 78.21  0  335 CYS B N   1 
ATOM   6361  C  CA  . CYS B 1 335 ? 227.028 239.608 188.487 1.00 78.21  0  335 CYS B CA  1 
ATOM   6362  C  C   . CYS B 1 335 ? 225.927 238.653 188.929 1.00 78.21  0  335 CYS B C   1 
ATOM   6363  O  O   . CYS B 1 335 ? 225.082 238.988 189.762 1.00 78.21  0  335 CYS B O   1 
ATOM   6364  C  CB  . CYS B 1 335 ? 228.394 239.148 189.004 1.00 78.21  0  335 CYS B CB  1 
ATOM   6365  S  SG  . CYS B 1 335 ? 228.901 237.538 188.436 1.00 78.21  0  335 CYS B SG  1 
ATOM   6366  N  N   . THR B 1 336 ? 225.943 237.447 188.356 1.00 71.74  0  336 THR B N   1 
ATOM   6367  C  CA  . THR B 1 336 ? 225.073 236.365 188.794 1.00 71.74  0  336 THR B CA  1 
ATOM   6368  C  C   . THR B 1 336 ? 225.899 235.105 189.027 1.00 71.74  0  336 THR B C   1 
ATOM   6369  O  O   . THR B 1 336 ? 226.966 234.916 188.431 1.00 71.74  0  336 THR B O   1 
ATOM   6370  C  CB  . THR B 1 336 ? 223.930 236.087 187.791 1.00 71.74  0  336 THR B CB  1 
ATOM   6371  O  OG1 . THR B 1 336 ? 223.038 235.109 188.340 1.00 71.74  0  336 THR B OG1 1 
ATOM   6372  C  CG2 . THR B 1 336 ? 224.458 235.591 186.452 1.00 71.74  0  336 THR B CG2 1 
ATOM   6373  N  N   . HIS B 1 337 ? 225.400 234.252 189.920 1.00 67.35  0  337 HIS B N   1 
ATOM   6374  C  CA  . HIS B 1 337 ? 226.130 233.087 190.411 1.00 67.35  0  337 HIS B CA  1 
ATOM   6375  C  C   . HIS B 1 337 ? 225.389 231.822 189.999 1.00 67.35  0  337 HIS B C   1 
ATOM   6376  O  O   . HIS B 1 337 ? 224.314 231.525 190.531 1.00 67.35  0  337 HIS B O   1 
ATOM   6377  C  CB  . HIS B 1 337 ? 226.293 233.157 191.929 1.00 67.35  0  337 HIS B CB  1 
ATOM   6378  C  CG  . HIS B 1 337 ? 226.789 231.887 192.546 1.00 67.35  0  337 HIS B CG  1 
ATOM   6379  N  ND1 . HIS B 1 337 ? 228.125 231.554 192.591 1.00 67.35  0  337 HIS B ND1 1 
ATOM   6380  C  CD2 . HIS B 1 337 ? 226.129 230.874 193.154 1.00 67.35  0  337 HIS B CD2 1 
ATOM   6381  C  CE1 . HIS B 1 337 ? 228.267 230.388 193.194 1.00 67.35  0  337 HIS B CE1 1 
ATOM   6382  N  NE2 . HIS B 1 337 ? 227.070 229.953 193.544 1.00 67.35  0  337 HIS B NE2 1 
ATOM   6383  N  N   . SER B 1 338 ? 225.960 231.081 189.054 1.00 62.25  0  338 SER B N   1 
ATOM   6384  C  CA  . SER B 1 338 ? 225.435 229.788 188.649 1.00 62.25  0  338 SER B CA  1 
ATOM   6385  C  C   . SER B 1 338 ? 226.102 228.691 189.479 1.00 62.25  0  338 SER B C   1 
ATOM   6386  O  O   . SER B 1 338 ? 226.763 228.957 190.486 1.00 62.25  0  338 SER B O   1 
ATOM   6387  C  CB  . SER B 1 338 ? 225.642 229.579 187.151 1.00 62.25  0  338 SER B CB  1 
ATOM   6388  O  OG  . SER B 1 338 ? 224.779 230.412 186.396 1.00 62.25  0  338 SER B OG  1 
ATOM   6389  N  N   . ARG B 1 339 ? 225.927 227.439 189.064 1.00 61.05  0  339 ARG B N   1 
ATOM   6390  C  CA  . ARG B 1 339 ? 226.529 226.316 189.766 1.00 61.05  0  339 ARG B CA  1 
ATOM   6391  C  C   . ARG B 1 339 ? 228.033 226.259 189.507 1.00 61.05  0  339 ARG B C   1 
ATOM   6392  O  O   . ARG B 1 339 ? 228.551 226.881 188.576 1.00 61.05  0  339 ARG B O   1 
ATOM   6393  C  CB  . ARG B 1 339 ? 225.876 225.004 189.335 1.00 61.05  0  339 ARG B CB  1 
ATOM   6394  C  CG  . ARG B 1 339 ? 224.375 225.100 189.126 1.00 61.05  0  339 ARG B CG  1 
ATOM   6395  C  CD  . ARG B 1 339 ? 223.799 223.766 188.688 1.00 61.05  0  339 ARG B CD  1 
ATOM   6396  N  NE  . ARG B 1 339 ? 224.004 222.732 189.695 1.00 61.05  0  339 ARG B NE  1 
ATOM   6397  C  CZ  . ARG B 1 339 ? 223.063 222.303 190.529 1.00 61.05  0  339 ARG B CZ  1 
ATOM   6398  N  NH1 . ARG B 1 339 ? 221.843 222.820 190.476 1.00 61.05  1  339 ARG B NH1 1 
ATOM   6399  N  NH2 . ARG B 1 339 ? 223.341 221.357 191.415 1.00 61.05  0  339 ARG B NH2 1 
ATOM   6400  N  N   . HIS B 1 340 ? 228.725 225.500 190.369 1.00 62.72  0  340 HIS B N   1 
ATOM   6401  C  CA  . HIS B 1 340 ? 230.182 225.293 190.339 1.00 62.72  0  340 HIS B CA  1 
ATOM   6402  C  C   . HIS B 1 340 ? 230.965 226.601 190.440 1.00 62.72  0  340 HIS B C   1 
ATOM   6403  O  O   . HIS B 1 340 ? 232.048 226.721 189.859 1.00 62.72  0  340 HIS B O   1 
ATOM   6404  C  CB  . HIS B 1 340 ? 230.624 224.504 189.100 1.00 62.72  0  340 HIS B CB  1 
ATOM   6405  C  CG  . HIS B 1 340 ? 229.912 223.200 188.924 1.00 62.72  0  340 HIS B CG  1 
ATOM   6406  N  ND1 . HIS B 1 340 ? 229.692 222.635 187.687 1.00 62.72  0  340 HIS B ND1 1 
ATOM   6407  C  CD2 . HIS B 1 340 ? 229.379 222.346 189.829 1.00 62.72  0  340 HIS B CD2 1 
ATOM   6408  C  CE1 . HIS B 1 340 ? 229.049 221.491 187.837 1.00 62.72  0  340 HIS B CE1 1 
ATOM   6409  N  NE2 . HIS B 1 340 ? 228.848 221.292 189.127 1.00 62.72  0  340 HIS B NE2 1 
ATOM   6410  N  N   . ASN B 1 341 ? 230.407 227.568 191.184 1.00 63.65  0  341 ASN B N   1 
ATOM   6411  C  CA  . ASN B 1 341 ? 230.989 228.899 191.411 1.00 63.65  0  341 ASN B CA  1 
ATOM   6412  C  C   . ASN B 1 341 ? 231.276 229.639 190.105 1.00 63.65  0  341 ASN B C   1 
ATOM   6413  O  O   . ASN B 1 341 ? 232.299 230.312 189.965 1.00 63.65  0  341 ASN B O   1 
ATOM   6414  C  CB  . ASN B 1 341 ? 232.247 228.821 192.281 1.00 63.65  0  341 ASN B CB  1 
ATOM   6415  C  CG  . ASN B 1 341 ? 231.958 228.319 193.679 1.00 63.65  0  341 ASN B CG  1 
ATOM   6416  O  OD1 . ASN B 1 341 ? 230.889 228.571 194.232 1.00 63.65  0  341 ASN B OD1 1 
ATOM   6417  N  ND2 . ASN B 1 341 ? 232.913 227.602 194.259 1.00 63.65  0  341 ASN B ND2 1 
ATOM   6418  N  N   . ILE B 1 342 ? 230.374 229.511 189.139 1.00 62.51  0  342 ILE B N   1 
ATOM   6419  C  CA  . ILE B 1 342 ? 230.492 230.221 187.872 1.00 62.51  0  342 ILE B CA  1 
ATOM   6420  C  C   . ILE B 1 342 ? 229.867 231.598 188.040 1.00 62.51  0  342 ILE B C   1 
ATOM   6421  O  O   . ILE B 1 342 ? 228.685 231.720 188.378 1.00 62.51  0  342 ILE B O   1 
ATOM   6422  C  CB  . ILE B 1 342 ? 229.825 229.443 186.729 1.00 62.51  0  342 ILE B CB  1 
ATOM   6423  C  CG1 . ILE B 1 342 ? 230.643 228.201 186.383 1.00 62.51  0  342 ILE B CG1 1 
ATOM   6424  C  CG2 . ILE B 1 342 ? 229.672 230.321 185.497 1.00 62.51  0  342 ILE B CG2 1 
ATOM   6425  C  CD1 . ILE B 1 342 ? 229.927 227.252 185.457 1.00 62.51  0  342 ILE B CD1 1 
ATOM   6426  N  N   . TYR B 1 343 ? 230.661 232.638 187.822 1.00 64.92  0  343 TYR B N   1 
ATOM   6427  C  CA  . TYR B 1 343 ? 230.211 234.015 187.963 1.00 64.92  0  343 TYR B CA  1 
ATOM   6428  C  C   . TYR B 1 343 ? 230.091 234.636 186.580 1.00 64.92  0  343 TYR B C   1 
ATOM   6429  O  O   . TYR B 1 343 ? 231.082 234.717 185.846 1.00 64.92  0  343 TYR B O   1 
ATOM   6430  C  CB  . TYR B 1 343 ? 231.178 234.807 188.837 1.00 64.92  0  343 TYR B CB  1 
ATOM   6431  C  CG  . TYR B 1 343 ? 231.447 234.176 190.177 1.00 64.92  0  343 TYR B CG  1 
ATOM   6432  C  CD1 . TYR B 1 343 ? 230.481 234.185 191.174 1.00 64.92  0  343 TYR B CD1 1 
ATOM   6433  C  CD2 . TYR B 1 343 ? 232.668 233.574 190.448 1.00 64.92  0  343 TYR B CD2 1 
ATOM   6434  C  CE1 . TYR B 1 343 ? 230.723 233.609 192.403 1.00 64.92  0  343 TYR B CE1 1 
ATOM   6435  C  CE2 . TYR B 1 343 ? 232.919 232.997 191.673 1.00 64.92  0  343 TYR B CE2 1 
ATOM   6436  C  CZ  . TYR B 1 343 ? 231.942 233.018 192.646 1.00 64.92  0  343 TYR B CZ  1 
ATOM   6437  O  OH  . TYR B 1 343 ? 232.187 232.444 193.868 1.00 64.92  0  343 TYR B OH  1 
ATOM   6438  N  N   . ARG B 1 344 ? 228.886 235.069 186.221 1.00 74.43  0  344 ARG B N   1 
ATOM   6439  C  CA  . ARG B 1 344 ? 228.625 235.611 184.894 1.00 74.43  0  344 ARG B CA  1 
ATOM   6440  C  C   . ARG B 1 344 ? 228.139 237.048 185.004 1.00 74.43  0  344 ARG B C   1 
ATOM   6441  O  O   . ARG B 1 344 ? 227.174 237.330 185.722 1.00 74.43  0  344 ARG B O   1 
ATOM   6442  C  CB  . ARG B 1 344 ? 227.599 234.758 184.143 1.00 74.43  0  344 ARG B CB  1 
ATOM   6443  C  CG  . ARG B 1 344 ? 227.277 235.270 182.751 1.00 74.43  0  344 ARG B CG  1 
ATOM   6444  C  CD  . ARG B 1 344 ? 226.594 234.205 181.912 1.00 74.43  0  344 ARG B CD  1 
ATOM   6445  N  NE  . ARG B 1 344 ? 226.207 234.712 180.599 1.00 74.43  0  344 ARG B NE  1 
ATOM   6446  C  CZ  . ARG B 1 344 ? 225.764 233.949 179.605 1.00 74.43  0  344 ARG B CZ  1 
ATOM   6447  N  NH1 . ARG B 1 344 ? 225.650 232.639 179.772 1.00 74.43  1  344 ARG B NH1 1 
ATOM   6448  N  NH2 . ARG B 1 344 ? 225.435 234.497 178.443 1.00 74.43  0  344 ARG B NH2 1 
ATOM   6449  N  N   . GLY B 1 345 ? 228.805 237.951 184.292 1.00 73.75  0  345 GLY B N   1 
ATOM   6450  C  CA  . GLY B 1 345 ? 228.391 239.331 184.234 1.00 73.75  0  345 GLY B CA  1 
ATOM   6451  C  C   . GLY B 1 345 ? 227.342 239.559 183.164 1.00 73.75  0  345 GLY B C   1 
ATOM   6452  O  O   . GLY B 1 345 ? 226.813 238.613 182.572 1.00 73.75  0  345 GLY B O   1 
ATOM   6453  N  N   . PRO B 1 346 ? 227.006 240.819 182.905 1.00 76.58  0  346 PRO B N   1 
ATOM   6454  C  CA  . PRO B 1 346 ? 226.076 241.129 181.817 1.00 76.58  0  346 PRO B CA  1 
ATOM   6455  C  C   . PRO B 1 346 ? 226.779 241.274 180.477 1.00 76.58  0  346 PRO B C   1 
ATOM   6456  O  O   . PRO B 1 346 ? 227.923 241.728 180.389 1.00 76.58  0  346 PRO B O   1 
ATOM   6457  C  CB  . PRO B 1 346 ? 225.463 242.464 182.262 1.00 76.58  0  346 PRO B CB  1 
ATOM   6458  C  CG  . PRO B 1 346 ? 226.537 243.112 183.060 1.00 76.58  0  346 PRO B CG  1 
ATOM   6459  C  CD  . PRO B 1 346 ? 227.336 242.009 183.709 1.00 76.58  0  346 PRO B CD  1 
ATOM   6460  N  N   . GLU B 1 347 ? 226.056 240.855 179.430 1.00 78.84  0  347 GLU B N   1 
ATOM   6461  C  CA  . GLU B 1 347 ? 226.457 240.969 178.022 1.00 78.84  0  347 GLU B CA  1 
ATOM   6462  C  C   . GLU B 1 347 ? 227.781 240.250 177.746 1.00 78.84  0  347 GLU B C   1 
ATOM   6463  O  O   . GLU B 1 347 ? 228.791 240.857 177.384 1.00 78.84  0  347 GLU B O   1 
ATOM   6464  C  CB  . GLU B 1 347 ? 226.519 242.438 177.581 1.00 78.84  0  347 GLU B CB  1 
ATOM   6465  N  N   . VAL B 1 348 ? 227.757 238.933 177.926 1.00 79.36  0  348 VAL B N   1 
ATOM   6466  C  CA  . VAL B 1 348 ? 228.939 238.113 177.678 1.00 79.36  0  348 VAL B CA  1 
ATOM   6467  C  C   . VAL B 1 348 ? 228.934 237.539 176.266 1.00 79.36  0  348 VAL B C   1 
ATOM   6468  O  O   . VAL B 1 348 ? 229.976 237.520 175.604 1.00 79.36  0  348 VAL B O   1 
ATOM   6469  C  CB  . VAL B 1 348 ? 229.037 237.000 178.740 1.00 79.36  0  348 VAL B CB  1 
ATOM   6470  C  CG1 . VAL B 1 348 ? 230.383 236.299 178.661 1.00 79.36  0  348 VAL B CG1 1 
ATOM   6471  C  CG2 . VAL B 1 348 ? 228.823 237.577 180.125 1.00 79.36  0  348 VAL B CG2 1 
ATOM   6472  N  N   . SER B 1 349 ? 227.760 237.094 175.800 1.00 87.44  0  349 SER B N   1 
ATOM   6473  C  CA  . SER B 1 349 ? 227.537 236.458 174.494 1.00 87.44  0  349 SER B CA  1 
ATOM   6474  C  C   . SER B 1 349 ? 228.448 235.237 174.319 1.00 87.44  0  349 SER B C   1 
ATOM   6475  O  O   . SER B 1 349 ? 229.367 235.209 173.497 1.00 87.44  0  349 SER B O   1 
ATOM   6476  C  CB  . SER B 1 349 ? 227.704 237.453 173.335 1.00 87.44  0  349 SER B CB  1 
ATOM   6477  O  OG  . SER B 1 349 ? 229.047 237.885 173.196 1.00 87.44  0  349 SER B OG  1 
ATOM   6478  N  N   . LEU B 1 350 ? 228.165 234.232 175.144 1.00 87.97  0  350 LEU B N   1 
ATOM   6479  C  CA  . LEU B 1 350 ? 228.957 233.011 175.173 1.00 87.97  0  350 LEU B CA  1 
ATOM   6480  C  C   . LEU B 1 350 ? 228.746 232.201 173.896 1.00 87.97  0  350 LEU B C   1 
ATOM   6481  O  O   . LEU B 1 350 ? 227.652 232.170 173.326 1.00 87.97  0  350 LEU B O   1 
ATOM   6482  C  CB  . LEU B 1 350 ? 228.586 232.178 176.399 1.00 87.97  0  350 LEU B CB  1 
ATOM   6483  C  CG  . LEU B 1 350 ? 229.553 231.075 176.826 1.00 87.97  0  350 LEU B CG  1 
ATOM   6484  C  CD1 . LEU B 1 350 ? 230.851 231.679 177.340 1.00 87.97  0  350 LEU B CD1 1 
ATOM   6485  C  CD2 . LEU B 1 350 ? 228.919 230.180 177.879 1.00 87.97  0  350 LEU B CD2 1 
ATOM   6486  N  N   . GLY B 1 351 ? 229.814 231.538 173.448 1.00 85.13  0  351 GLY B N   1 
ATOM   6487  C  CA  . GLY B 1 351 ? 229.804 230.817 172.196 1.00 85.13  0  351 GLY B CA  1 
ATOM   6488  C  C   . GLY B 1 351 ? 229.580 229.321 172.367 1.00 85.13  0  351 GLY B C   1 
ATOM   6489  O  O   . GLY B 1 351 ? 229.508 228.784 173.470 1.00 85.13  0  351 GLY B O   1 
ATOM   6490  N  N   . HIS B 1 352 ? 229.471 228.647 171.225 1.00 84.99  0  352 HIS B N   1 
ATOM   6491  C  CA  . HIS B 1 352 ? 229.228 227.212 171.201 1.00 84.99  0  352 HIS B CA  1 
ATOM   6492  C  C   . HIS B 1 352 ? 230.505 226.444 171.513 1.00 84.99  0  352 HIS B C   1 
ATOM   6493  O  O   . HIS B 1 352 ? 231.588 226.788 171.033 1.00 84.99  0  352 HIS B O   1 
ATOM   6494  C  CB  . HIS B 1 352 ? 228.687 226.784 169.836 1.00 84.99  0  352 HIS B CB  1 
ATOM   6495  C  CG  . HIS B 1 352 ? 227.400 227.448 169.461 1.00 84.99  0  352 HIS B CG  1 
ATOM   6496  N  ND1 . HIS B 1 352 ? 226.168 226.902 169.751 1.00 84.99  0  352 HIS B ND1 1 
ATOM   6497  C  CD2 . HIS B 1 352 ? 227.152 228.613 168.817 1.00 84.99  0  352 HIS B CD2 1 
ATOM   6498  C  CE1 . HIS B 1 352 ? 225.217 227.702 169.303 1.00 84.99  0  352 HIS B CE1 1 
ATOM   6499  N  NE2 . HIS B 1 352 ? 225.787 228.747 168.732 1.00 84.99  0  352 HIS B NE2 1 
ATOM   6500  N  N   . GLY B 1 353 ? 230.372 225.397 172.324 1.00 84.80  0  353 GLY B N   1 
ATOM   6501  C  CA  . GLY B 1 353 ? 231.493 224.546 172.656 1.00 84.80  0  353 GLY B CA  1 
ATOM   6502  C  C   . GLY B 1 353 ? 232.385 225.049 173.768 1.00 84.80  0  353 GLY B C   1 
ATOM   6503  O  O   . GLY B 1 353 ? 233.318 224.335 174.159 1.00 84.80  0  353 GLY B O   1 
ATOM   6504  N  N   . SER B 1 354 ? 232.141 226.250 174.286 1.00 83.50  0  354 SER B N   1 
ATOM   6505  C  CA  . SER B 1 354 ? 232.949 226.772 175.378 1.00 83.50  0  354 SER B CA  1 
ATOM   6506  C  C   . SER B 1 354 ? 232.581 226.079 176.682 1.00 83.50  0  354 SER B C   1 
ATOM   6507  O  O   . SER B 1 354 ? 231.402 225.898 176.997 1.00 83.50  0  354 SER B O   1 
ATOM   6508  C  CB  . SER B 1 354 ? 232.753 228.279 175.515 1.00 83.50  0  354 SER B CB  1 
ATOM   6509  O  OG  . SER B 1 354 ? 231.662 228.558 176.371 1.00 83.50  0  354 SER B OG  1 
ATOM   6510  N  N   . ILE B 1 355 ? 233.598 225.690 177.445 1.00 78.94  0  355 ILE B N   1 
ATOM   6511  C  CA  . ILE B 1 355 ? 233.416 224.916 178.667 1.00 78.94  0  355 ILE B CA  1 
ATOM   6512  C  C   . ILE B 1 355 ? 233.878 225.758 179.847 1.00 78.94  0  355 ILE B C   1 
ATOM   6513  O  O   . ILE B 1 355 ? 235.047 226.156 179.915 1.00 78.94  0  355 ILE B O   1 
ATOM   6514  C  CB  . ILE B 1 355 ? 234.181 223.585 178.615 1.00 78.94  0  355 ILE B CB  1 
ATOM   6515  C  CG1 . ILE B 1 355 ? 233.681 222.728 177.451 1.00 78.94  0  355 ILE B CG1 1 
ATOM   6516  C  CG2 . ILE B 1 355 ? 234.039 222.838 179.932 1.00 78.94  0  355 ILE B CG2 1 
ATOM   6517  C  CD1 . ILE B 1 355 ? 234.499 221.477 177.219 1.00 78.94  0  355 ILE B CD1 1 
ATOM   6518  N  N   . LEU B 1 356 ? 232.959 226.026 180.771 1.00 76.21  0  356 LEU B N   1 
ATOM   6519  C  CA  . LEU B 1 356 ? 233.266 226.639 182.060 1.00 76.21  0  356 LEU B CA  1 
ATOM   6520  C  C   . LEU B 1 356 ? 232.904 225.617 183.128 1.00 76.21  0  356 LEU B C   1 
ATOM   6521  O  O   . LEU B 1 356 ? 231.719 225.373 183.378 1.00 76.21  0  356 LEU B O   1 
ATOM   6522  C  CB  . LEU B 1 356 ? 232.489 227.940 182.260 1.00 76.21  0  356 LEU B CB  1 
ATOM   6523  C  CG  . LEU B 1 356 ? 232.360 228.891 181.069 1.00 76.21  0  356 LEU B CG  1 
ATOM   6524  C  CD1 . LEU B 1 356 ? 231.477 230.073 181.433 1.00 76.21  0  356 LEU B CD1 1 
ATOM   6525  C  CD2 . LEU B 1 356 ? 233.722 229.366 180.603 1.00 76.21  0  356 LEU B CD2 1 
ATOM   6526  N  N   . GLU B 1 357 ? 233.912 225.009 183.747 1.00 74.17  0  357 GLU B N   1 
ATOM   6527  C  CA  . GLU B 1 357 ? 233.659 223.883 184.637 1.00 74.17  0  357 GLU B CA  1 
ATOM   6528  C  C   . GLU B 1 357 ? 233.744 224.236 186.116 1.00 74.17  0  357 GLU B C   1 
ATOM   6529  O  O   . GLU B 1 357 ? 232.972 223.693 186.911 1.00 74.17  0  357 GLU B O   1 
ATOM   6530  C  CB  . GLU B 1 357 ? 234.622 222.731 184.326 1.00 74.17  0  357 GLU B CB  1 
ATOM   6531  C  CG  . GLU B 1 357 ? 236.083 223.121 184.237 1.00 74.17  0  357 GLU B CG  1 
ATOM   6532  C  CD  . GLU B 1 357 ? 237.009 221.927 184.353 1.00 74.17  0  357 GLU B CD  1 
ATOM   6533  O  OE1 . GLU B 1 357 ? 236.556 220.795 184.084 1.00 74.17  0  357 GLU B OE1 1 
ATOM   6534  O  OE2 . GLU B 1 357 ? 238.188 222.120 184.715 1.00 74.17  -1 357 GLU B OE2 1 
ATOM   6535  N  N   . GLU B 1 358 ? 234.646 225.136 186.512 1.00 71.69  0  358 GLU B N   1 
ATOM   6536  C  CA  . GLU B 1 358 ? 234.864 225.392 187.931 1.00 71.69  0  358 GLU B CA  1 
ATOM   6537  C  C   . GLU B 1 358 ? 235.543 226.739 188.121 1.00 71.69  0  358 GLU B C   1 
ATOM   6538  O  O   . GLU B 1 358 ? 236.563 227.011 187.477 1.00 71.69  0  358 GLU B O   1 
ATOM   6539  C  CB  . GLU B 1 358 ? 235.720 224.282 188.558 1.00 71.69  0  358 GLU B CB  1 
ATOM   6540  C  CG  . GLU B 1 358 ? 235.946 224.430 190.052 1.00 71.69  0  358 GLU B CG  1 
ATOM   6541  C  CD  . GLU B 1 358 ? 237.194 223.711 190.524 1.00 71.69  0  358 GLU B CD  1 
ATOM   6542  O  OE1 . GLU B 1 358 ? 237.879 223.091 189.683 1.00 71.69  0  358 GLU B OE1 1 
ATOM   6543  O  OE2 . GLU B 1 358 ? 237.492 223.766 191.736 1.00 71.69  -1 358 GLU B OE2 1 
ATOM   6544  N  N   . ASN B 1 359 ? 234.958 227.572 188.992 1.00 68.06  0  359 ASN B N   1 
ATOM   6545  C  CA  . ASN B 1 359 ? 235.580 228.776 189.557 1.00 68.06  0  359 ASN B CA  1 
ATOM   6546  C  C   . ASN B 1 359 ? 235.927 229.809 188.480 1.00 68.06  0  359 ASN B C   1 
ATOM   6547  O  O   . ASN B 1 359 ? 237.063 230.268 188.363 1.00 68.06  0  359 ASN B O   1 
ATOM   6548  C  CB  . ASN B 1 359 ? 236.820 228.406 190.382 1.00 68.06  0  359 ASN B CB  1 
ATOM   6549  C  CG  . ASN B 1 359 ? 236.479 227.621 191.630 1.00 68.06  0  359 ASN B CG  1 
ATOM   6550  O  OD1 . ASN B 1 359 ? 235.396 227.767 192.194 1.00 68.06  0  359 ASN B OD1 1 
ATOM   6551  N  ND2 . ASN B 1 359 ? 237.407 226.780 192.070 1.00 68.06  0  359 ASN B ND2 1 
ATOM   6552  N  N   . VAL B 1 360 ? 234.918 230.193 187.705 1.00 65.39  0  360 VAL B N   1 
ATOM   6553  C  CA  . VAL B 1 360 ? 235.104 231.072 186.557 1.00 65.39  0  360 VAL B CA  1 
ATOM   6554  C  C   . VAL B 1 360 ? 234.298 232.344 186.778 1.00 65.39  0  360 VAL B C   1 
ATOM   6555  O  O   . VAL B 1 360 ? 233.097 232.282 187.065 1.00 65.39  0  360 VAL B O   1 
ATOM   6556  C  CB  . VAL B 1 360 ? 234.686 230.375 185.248 1.00 65.39  0  360 VAL B CB  1 
ATOM   6557  C  CG1 . VAL B 1 360 ? 234.720 231.342 184.079 1.00 65.39  0  360 VAL B CG1 1 
ATOM   6558  C  CG2 . VAL B 1 360 ? 235.583 229.181 184.978 1.00 65.39  0  360 VAL B CG2 1 
ATOM   6559  N  N   . LEU B 1 361 ? 234.958 233.494 186.645 1.00 64.10  0  361 LEU B N   1 
ATOM   6560  C  CA  . LEU B 1 361 ? 234.302 234.793 186.708 1.00 64.10  0  361 LEU B CA  1 
ATOM   6561  C  C   . LEU B 1 361 ? 234.471 235.496 185.370 1.00 64.10  0  361 LEU B C   1 
ATOM   6562  O  O   . LEU B 1 361 ? 235.571 235.514 184.809 1.00 64.10  0  361 LEU B O   1 
ATOM   6563  C  CB  . LEU B 1 361 ? 234.862 235.654 187.847 1.00 64.10  0  361 LEU B CB  1 
ATOM   6564  C  CG  . LEU B 1 361 ? 234.103 236.944 188.193 1.00 64.10  0  361 LEU B CG  1 
ATOM   6565  C  CD1 . LEU B 1 361 ? 234.126 237.132 189.685 1.00 64.10  0  361 LEU B CD1 1 
ATOM   6566  C  CD2 . LEU B 1 361 ? 234.655 238.195 187.520 1.00 64.10  0  361 LEU B CD2 1 
ATOM   6567  N  N   . LEU B 1 362 ? 233.383 236.075 184.869 1.00 70.44  0  362 LEU B N   1 
ATOM   6568  C  CA  . LEU B 1 362 ? 233.374 236.791 183.602 1.00 70.44  0  362 LEU B CA  1 
ATOM   6569  C  C   . LEU B 1 362 ? 232.895 238.215 183.841 1.00 70.44  0  362 LEU B C   1 
ATOM   6570  O  O   . LEU B 1 362 ? 231.830 238.424 184.431 1.00 70.44  0  362 LEU B O   1 
ATOM   6571  C  CB  . LEU B 1 362 ? 232.478 236.090 182.578 1.00 70.44  0  362 LEU B CB  1 
ATOM   6572  C  CG  . LEU B 1 362 ? 232.754 234.601 182.369 1.00 70.44  0  362 LEU B CG  1 
ATOM   6573  C  CD1 . LEU B 1 362 ? 231.790 234.003 181.356 1.00 70.44  0  362 LEU B CD1 1 
ATOM   6574  C  CD2 . LEU B 1 362 ? 234.195 234.386 181.943 1.00 70.44  0  362 LEU B CD2 1 
ATOM   6575  N  N   . GLY B 1 363 ? 233.678 239.189 183.382 1.00 73.12  0  363 GLY B N   1 
ATOM   6576  C  CA  . GLY B 1 363 ? 233.330 240.581 183.550 1.00 73.12  0  363 GLY B CA  1 
ATOM   6577  C  C   . GLY B 1 363 ? 232.260 241.039 182.577 1.00 73.12  0  363 GLY B C   1 
ATOM   6578  O  O   . GLY B 1 363 ? 231.819 240.311 181.688 1.00 73.12  0  363 GLY B O   1 
ATOM   6579  N  N   . SER B 1 364 ? 231.839 242.288 182.760 1.00 77.20  0  364 SER B N   1 
ATOM   6580  C  CA  . SER B 1 364 ? 230.808 242.881 181.916 1.00 77.20  0  364 SER B CA  1 
ATOM   6581  C  C   . SER B 1 364 ? 231.396 243.242 180.558 1.00 77.20  0  364 SER B C   1 
ATOM   6582  O  O   . SER B 1 364 ? 232.374 243.992 180.476 1.00 77.20  0  364 SER B O   1 
ATOM   6583  C  CB  . SER B 1 364 ? 230.216 244.115 182.591 1.00 77.20  0  364 SER B CB  1 
ATOM   6584  O  OG  . SER B 1 364 ? 231.232 244.927 183.152 1.00 77.20  0  364 SER B OG  1 
ATOM   6585  N  N   . GLY B 1 365 ? 230.797 242.714 179.494 1.00 78.92  0  365 GLY B N   1 
ATOM   6586  C  CA  . GLY B 1 365 ? 231.268 242.985 178.152 1.00 78.92  0  365 GLY B CA  1 
ATOM   6587  C  C   . GLY B 1 365 ? 232.394 242.101 177.670 1.00 78.92  0  365 GLY B C   1 
ATOM   6588  O  O   . GLY B 1 365 ? 232.990 242.401 176.629 1.00 78.92  0  365 GLY B O   1 
ATOM   6589  N  N   . THR B 1 366 ? 232.709 241.026 178.388 1.00 78.20  0  366 THR B N   1 
ATOM   6590  C  CA  . THR B 1 366 ? 233.778 240.122 177.981 1.00 78.20  0  366 THR B CA  1 
ATOM   6591  C  C   . THR B 1 366 ? 233.304 239.258 176.819 1.00 78.20  0  366 THR B C   1 
ATOM   6592  O  O   . THR B 1 366 ? 232.346 238.491 176.959 1.00 78.20  0  366 THR B O   1 
ATOM   6593  C  CB  . THR B 1 366 ? 234.213 239.247 179.155 1.00 78.20  0  366 THR B CB  1 
ATOM   6594  O  OG1 . THR B 1 366 ? 234.815 240.065 180.166 1.00 78.20  0  366 THR B OG1 1 
ATOM   6595  C  CG2 . THR B 1 366 ? 235.215 238.201 178.694 1.00 78.20  0  366 THR B CG2 1 
ATOM   6596  N  N   . VAL B 1 367 ? 233.973 239.380 175.678 1.00 79.52  0  367 VAL B N   1 
ATOM   6597  C  CA  . VAL B 1 367 ? 233.619 238.627 174.480 1.00 79.52  0  367 VAL B CA  1 
ATOM   6598  C  C   . VAL B 1 367 ? 234.385 237.311 174.496 1.00 79.52  0  367 VAL B C   1 
ATOM   6599  O  O   . VAL B 1 367 ? 235.618 237.302 174.565 1.00 79.52  0  367 VAL B O   1 
ATOM   6600  C  CB  . VAL B 1 367 ? 233.925 239.431 173.208 1.00 79.52  0  367 VAL B CB  1 
ATOM   6601  C  CG1 . VAL B 1 367 ? 233.648 238.594 171.968 1.00 79.52  0  367 VAL B CG1 1 
ATOM   6602  C  CG2 . VAL B 1 367 ? 233.109 240.715 173.186 1.00 79.52  0  367 VAL B CG2 1 
ATOM   6603  N  N   . ILE B 1 368 ? 233.657 236.199 174.433 1.00 82.26  0  368 ILE B N   1 
ATOM   6604  C  CA  . ILE B 1 368 ? 234.241 234.864 174.468 1.00 82.26  0  368 ILE B CA  1 
ATOM   6605  C  C   . ILE B 1 368 ? 233.845 234.135 173.192 1.00 82.26  0  368 ILE B C   1 
ATOM   6606  O  O   . ILE B 1 368 ? 232.660 234.084 172.843 1.00 82.26  0  368 ILE B O   1 
ATOM   6607  C  CB  . ILE B 1 368 ? 233.787 234.083 175.717 1.00 82.26  0  368 ILE B CB  1 
ATOM   6608  C  CG1 . ILE B 1 368 ? 234.351 234.736 176.979 1.00 82.26  0  368 ILE B CG1 1 
ATOM   6609  C  CG2 . ILE B 1 368 ? 234.211 232.620 175.639 1.00 82.26  0  368 ILE B CG2 1 
ATOM   6610  C  CD1 . ILE B 1 368 ? 234.002 234.003 178.248 1.00 82.26  0  368 ILE B CD1 1 
ATOM   6611  N  N   . GLY B 1 369 ? 234.836 233.575 172.500 1.00 84.47  0  369 GLY B N   1 
ATOM   6612  C  CA  . GLY B 1 369 ? 234.596 232.852 171.267 1.00 84.47  0  369 GLY B CA  1 
ATOM   6613  C  C   . GLY B 1 369 ? 234.058 231.448 171.458 1.00 84.47  0  369 GLY B C   1 
ATOM   6614  O  O   . GLY B 1 369 ? 233.255 231.195 172.361 1.00 84.47  0  369 GLY B O   1 
ATOM   6615  N  N   . SER B 1 370 ? 234.493 230.524 170.608 1.00 85.09  0  370 SER B N   1 
ATOM   6616  C  CA  . SER B 1 370 ? 233.982 229.163 170.592 1.00 85.09  0  370 SER B CA  1 
ATOM   6617  C  C   . SER B 1 370 ? 235.058 228.173 171.021 1.00 85.09  0  370 SER B C   1 
ATOM   6618  O  O   . SER B 1 370 ? 236.255 228.429 170.861 1.00 85.09  0  370 SER B O   1 
ATOM   6619  C  CB  . SER B 1 370 ? 233.467 228.795 169.197 1.00 85.09  0  370 SER B CB  1 
ATOM   6620  O  OG  . SER B 1 370 ? 232.679 229.839 168.653 1.00 85.09  0  370 SER B OG  1 
ATOM   6621  N  N   . ASN B 1 371 ? 234.598 227.045 171.582 1.00 86.35  0  371 ASN B N   1 
ATOM   6622  C  CA  . ASN B 1 371 ? 235.430 225.891 171.957 1.00 86.35  0  371 ASN B CA  1 
ATOM   6623  C  C   . ASN B 1 371 ? 236.511 226.255 172.975 1.00 86.35  0  371 ASN B C   1 
ATOM   6624  O  O   . ASN B 1 371 ? 237.629 225.737 172.932 1.00 86.35  0  371 ASN B O   1 
ATOM   6625  C  CB  . ASN B 1 371 ? 236.047 225.221 170.725 1.00 86.35  0  371 ASN B CB  1 
ATOM   6626  C  CG  . ASN B 1 371 ? 235.060 225.073 169.585 1.00 86.35  0  371 ASN B CG  1 
ATOM   6627  O  OD1 . ASN B 1 371 ? 234.172 224.221 169.624 1.00 86.35  0  371 ASN B OD1 1 
ATOM   6628  N  ND2 . ASN B 1 371 ? 235.211 225.904 168.560 1.00 86.35  0  371 ASN B ND2 1 
ATOM   6629  N  N   . CYS B 1 372 ? 236.179 227.149 173.898 1.00 85.76  0  372 CYS B N   1 
ATOM   6630  C  CA  . CYS B 1 372 ? 237.104 227.538 174.949 1.00 85.76  0  372 CYS B CA  1 
ATOM   6631  C  C   . CYS B 1 372 ? 236.990 226.593 176.143 1.00 85.76  0  372 CYS B C   1 
ATOM   6632  O  O   . CYS B 1 372 ? 236.036 225.823 176.273 1.00 85.76  0  372 CYS B O   1 
ATOM   6633  C  CB  . CYS B 1 372 ? 236.838 228.979 175.384 1.00 85.76  0  372 CYS B CB  1 
ATOM   6634  S  SG  . CYS B 1 372 ? 236.454 230.104 174.024 1.00 85.76  0  372 CYS B SG  1 
ATOM   6635  N  N   . PHE B 1 373 ? 237.987 226.656 177.025 1.00 76.56  0  373 PHE B N   1 
ATOM   6636  C  CA  . PHE B 1 373 ? 237.997 225.840 178.239 1.00 76.56  0  373 PHE B CA  1 
ATOM   6637  C  C   . PHE B 1 373 ? 238.613 226.679 179.353 1.00 76.56  0  373 PHE B C   1 
ATOM   6638  O  O   . PHE B 1 373 ? 239.837 226.789 179.451 1.00 76.56  0  373 PHE B O   1 
ATOM   6639  C  CB  . PHE B 1 373 ? 238.767 224.542 178.033 1.00 76.56  0  373 PHE B CB  1 
ATOM   6640  C  CG  . PHE B 1 373 ? 238.903 223.715 179.277 1.00 76.56  0  373 PHE B CG  1 
ATOM   6641  C  CD1 . PHE B 1 373 ? 237.797 223.084 179.828 1.00 76.56  0  373 PHE B CD1 1 
ATOM   6642  C  CD2 . PHE B 1 373 ? 240.134 223.567 179.897 1.00 76.56  0  373 PHE B CD2 1 
ATOM   6643  C  CE1 . PHE B 1 373 ? 237.917 222.319 180.975 1.00 76.56  0  373 PHE B CE1 1 
ATOM   6644  C  CE2 . PHE B 1 373 ? 240.263 222.804 181.045 1.00 76.56  0  373 PHE B CE2 1 
ATOM   6645  C  CZ  . PHE B 1 373 ? 239.152 222.180 181.583 1.00 76.56  0  373 PHE B CZ  1 
ATOM   6646  N  N   . ILE B 1 374 ? 237.760 227.256 180.195 1.00 73.85  0  374 ILE B N   1 
ATOM   6647  C  CA  . ILE B 1 374 ? 238.176 228.165 181.256 1.00 73.85  0  374 ILE B CA  1 
ATOM   6648  C  C   . ILE B 1 374 ? 237.897 227.499 182.595 1.00 73.85  0  374 ILE B C   1 
ATOM   6649  O  O   . ILE B 1 374 ? 236.803 226.960 182.806 1.00 73.85  0  374 ILE B O   1 
ATOM   6650  C  CB  . ILE B 1 374 ? 237.445 229.513 181.145 1.00 73.85  0  374 ILE B CB  1 
ATOM   6651  C  CG1 . ILE B 1 374 ? 237.486 230.028 179.705 1.00 73.85  0  374 ILE B CG1 1 
ATOM   6652  C  CG2 . ILE B 1 374 ? 238.046 230.524 182.087 1.00 73.85  0  374 ILE B CG2 1 
ATOM   6653  C  CD1 . ILE B 1 374 ? 236.759 231.341 179.500 1.00 73.85  0  374 ILE B CD1 1 
ATOM   6654  N  N   . THR B 1 375 ? 238.880 227.527 183.497 1.00 70.37  0  375 THR B N   1 
ATOM   6655  C  CA  . THR B 1 375 ? 238.701 226.969 184.831 1.00 70.37  0  375 THR B CA  1 
ATOM   6656  C  C   . THR B 1 375 ? 239.623 227.672 185.819 1.00 70.37  0  375 THR B C   1 
ATOM   6657  O  O   . THR B 1 375 ? 240.762 228.012 185.482 1.00 70.37  0  375 THR B O   1 
ATOM   6658  C  CB  . THR B 1 375 ? 238.938 225.451 184.858 1.00 70.37  0  375 THR B CB  1 
ATOM   6659  O  OG1 . THR B 1 375 ? 238.964 224.992 186.216 1.00 70.37  0  375 THR B OG1 1 
ATOM   6660  C  CG2 . THR B 1 375 ? 240.226 225.072 184.158 1.00 70.37  0  375 THR B CG2 1 
ATOM   6661  N  N   . ASN B 1 376 ? 239.095 227.908 187.027 1.00 69.74  0  376 ASN B N   1 
ATOM   6662  C  CA  . ASN B 1 376 ? 239.821 228.479 188.171 1.00 69.74  0  376 ASN B CA  1 
ATOM   6663  C  C   . ASN B 1 376 ? 240.425 229.850 187.870 1.00 69.74  0  376 ASN B C   1 
ATOM   6664  O  O   . ASN B 1 376 ? 241.464 230.215 188.423 1.00 69.74  0  376 ASN B O   1 
ATOM   6665  C  CB  . ASN B 1 376 ? 240.907 227.524 188.681 1.00 69.74  0  376 ASN B CB  1 
ATOM   6666  C  CG  . ASN B 1 376 ? 240.339 226.220 189.199 1.00 69.74  0  376 ASN B CG  1 
ATOM   6667  O  OD1 . ASN B 1 376 ? 240.031 226.092 190.384 1.00 69.74  0  376 ASN B OD1 1 
ATOM   6668  N  ND2 . ASN B 1 376 ? 240.198 225.241 188.314 1.00 69.74  0  376 ASN B ND2 1 
ATOM   6669  N  N   . SER B 1 377 ? 239.776 230.633 187.010 1.00 67.05  0  377 SER B N   1 
ATOM   6670  C  CA  . SER B 1 377 ? 240.331 231.898 186.554 1.00 67.05  0  377 SER B CA  1 
ATOM   6671  C  C   . SER B 1 377 ? 239.287 232.997 186.681 1.00 67.05  0  377 SER B C   1 
ATOM   6672  O  O   . SER B 1 377 ? 238.082 232.738 186.730 1.00 67.05  0  377 SER B O   1 
ATOM   6673  C  CB  . SER B 1 377 ? 240.810 231.818 185.100 1.00 67.05  0  377 SER B CB  1 
ATOM   6674  O  OG  . SER B 1 377 ? 239.806 232.275 184.216 1.00 67.05  0  377 SER B OG  1 
ATOM   6675  N  N   . VAL B 1 378 ? 239.769 234.236 186.737 1.00 64.75  0  378 VAL B N   1 
ATOM   6676  C  CA  . VAL B 1 378 ? 238.922 235.421 186.743 1.00 64.75  0  378 VAL B CA  1 
ATOM   6677  C  C   . VAL B 1 378 ? 239.225 236.227 185.482 1.00 64.75  0  378 VAL B C   1 
ATOM   6678  O  O   . VAL B 1 378 ? 240.391 236.387 185.101 1.00 64.75  0  378 VAL B O   1 
ATOM   6679  C  CB  . VAL B 1 378 ? 239.114 236.246 188.036 1.00 64.75  0  378 VAL B CB  1 
ATOM   6680  C  CG1 . VAL B 1 378 ? 240.578 236.554 188.306 1.00 64.75  0  378 VAL B CG1 1 
ATOM   6681  C  CG2 . VAL B 1 378 ? 238.304 237.532 188.007 1.00 64.75  0  378 VAL B CG2 1 
ATOM   6682  N  N   . ILE B 1 379 ? 238.172 236.674 184.799 1.00 68.00  0  379 ILE B N   1 
ATOM   6683  C  CA  . ILE B 1 379 ? 238.294 237.475 183.587 1.00 68.00  0  379 ILE B CA  1 
ATOM   6684  C  C   . ILE B 1 379 ? 237.717 238.855 183.866 1.00 68.00  0  379 ILE B C   1 
ATOM   6685  O  O   . ILE B 1 379 ? 236.667 238.981 184.506 1.00 68.00  0  379 ILE B O   1 
ATOM   6686  C  CB  . ILE B 1 379 ? 237.580 236.814 182.388 1.00 68.00  0  379 ILE B CB  1 
ATOM   6687  C  CG1 . ILE B 1 379 ? 237.843 235.306 182.363 1.00 68.00  0  379 ILE B CG1 1 
ATOM   6688  C  CG2 . ILE B 1 379 ? 238.032 237.442 181.079 1.00 68.00  0  379 ILE B CG2 1 
ATOM   6689  C  CD1 . ILE B 1 379 ? 239.288 234.934 182.100 1.00 68.00  0  379 ILE B CD1 1 
ATOM   6690  N  N   . GLY B 1 380 ? 238.405 239.890 183.383 1.00 74.21  0  380 GLY B N   1 
ATOM   6691  C  CA  . GLY B 1 380 ? 237.978 241.249 183.606 1.00 74.21  0  380 GLY B CA  1 
ATOM   6692  C  C   . GLY B 1 380 ? 236.816 241.646 182.721 1.00 74.21  0  380 GLY B C   1 
ATOM   6693  O  O   . GLY B 1 380 ? 236.291 240.859 181.922 1.00 74.21  0  380 GLY B O   1 
ATOM   6694  N  N   . PRO B 1 381 ? 236.383 242.898 182.870 1.00 76.35  0  381 PRO B N   1 
ATOM   6695  C  CA  . PRO B 1 381 ? 235.330 243.419 181.993 1.00 76.35  0  381 PRO B CA  1 
ATOM   6696  C  C   . PRO B 1 381 ? 235.889 243.952 180.683 1.00 76.35  0  381 PRO B C   1 
ATOM   6697  O  O   . PRO B 1 381 ? 236.970 244.545 180.635 1.00 76.35  0  381 PRO B O   1 
ATOM   6698  C  CB  . PRO B 1 381 ? 234.704 244.541 182.828 1.00 76.35  0  381 PRO B CB  1 
ATOM   6699  C  CG  . PRO B 1 381 ? 235.811 245.015 183.697 1.00 76.35  0  381 PRO B CG  1 
ATOM   6700  C  CD  . PRO B 1 381 ? 236.695 243.827 183.971 1.00 76.35  0  381 PRO B CD  1 
ATOM   6701  N  N   . GLY B 1 382 ? 235.135 243.729 179.611 1.00 79.35  0  382 GLY B N   1 
ATOM   6702  C  CA  . GLY B 1 382 ? 235.504 244.233 178.299 1.00 79.35  0  382 GLY B CA  1 
ATOM   6703  C  C   . GLY B 1 382 ? 236.680 243.532 177.654 1.00 79.35  0  382 GLY B C   1 
ATOM   6704  O  O   . GLY B 1 382 ? 237.556 244.196 177.085 1.00 79.35  0  382 GLY B O   1 
ATOM   6705  N  N   . CYS B 1 383 ? 236.723 242.208 177.727 1.00 79.04  0  383 CYS B N   1 
ATOM   6706  C  CA  . CYS B 1 383 ? 237.799 241.426 177.139 1.00 79.04  0  383 CYS B CA  1 
ATOM   6707  C  C   . CYS B 1 383 ? 237.330 240.748 175.856 1.00 79.04  0  383 CYS B C   1 
ATOM   6708  O  O   . CYS B 1 383 ? 236.138 240.691 175.546 1.00 79.04  0  383 CYS B O   1 
ATOM   6709  C  CB  . CYS B 1 383 ? 238.313 240.384 178.135 1.00 79.04  0  383 CYS B CB  1 
ATOM   6710  S  SG  . CYS B 1 383 ? 238.714 241.055 179.759 1.00 79.04  0  383 CYS B SG  1 
ATOM   6711  N  N   . HIS B 1 384 ? 238.298 240.230 175.103 1.00 80.14  0  384 HIS B N   1 
ATOM   6712  C  CA  . HIS B 1 384 ? 238.035 239.537 173.848 1.00 80.14  0  384 HIS B CA  1 
ATOM   6713  C  C   . HIS B 1 384 ? 238.859 238.260 173.828 1.00 80.14  0  384 HIS B C   1 
ATOM   6714  O  O   . HIS B 1 384 ? 240.092 238.315 173.811 1.00 80.14  0  384 HIS B O   1 
ATOM   6715  C  CB  . HIS B 1 384 ? 238.367 240.421 172.642 1.00 80.14  0  384 HIS B CB  1 
ATOM   6716  C  CG  . HIS B 1 384 ? 237.529 241.658 172.552 1.00 80.14  0  384 HIS B CG  1 
ATOM   6717  N  ND1 . HIS B 1 384 ? 237.750 242.767 173.341 1.00 80.14  0  384 HIS B ND1 1 
ATOM   6718  C  CD2 . HIS B 1 384 ? 236.467 241.960 171.768 1.00 80.14  0  384 HIS B CD2 1 
ATOM   6719  C  CE1 . HIS B 1 384 ? 236.861 243.698 173.047 1.00 80.14  0  384 HIS B CE1 1 
ATOM   6720  N  NE2 . HIS B 1 384 ? 236.071 243.234 172.095 1.00 80.14  0  384 HIS B NE2 1 
ATOM   6721  N  N   . ILE B 1 385 ? 238.177 237.119 173.831 1.00 82.92  0  385 ILE B N   1 
ATOM   6722  C  CA  . ILE B 1 385 ? 238.814 235.809 173.872 1.00 82.92  0  385 ILE B CA  1 
ATOM   6723  C  C   . ILE B 1 385 ? 238.607 235.128 172.525 1.00 82.92  0  385 ILE B C   1 
ATOM   6724  O  O   . ILE B 1 385 ? 237.525 235.218 171.933 1.00 82.92  0  385 ILE B O   1 
ATOM   6725  C  CB  . ILE B 1 385 ? 238.253 234.954 175.025 1.00 82.92  0  385 ILE B CB  1 
ATOM   6726  C  CG1 . ILE B 1 385 ? 238.058 235.808 176.282 1.00 82.92  0  385 ILE B CG1 1 
ATOM   6727  C  CG2 . ILE B 1 385 ? 239.182 233.801 175.337 1.00 82.92  0  385 ILE B CG2 1 
ATOM   6728  C  CD1 . ILE B 1 385 ? 239.351 236.293 176.919 1.00 82.92  0  385 ILE B CD1 1 
ATOM   6729  N  N   . GLY B 1 386 ? 239.645 234.445 172.044 1.00 86.79  0  386 GLY B N   1 
ATOM   6730  C  CA  . GLY B 1 386 ? 239.594 233.806 170.742 1.00 86.79  0  386 GLY B CA  1 
ATOM   6731  C  C   . GLY B 1 386 ? 238.900 232.459 170.715 1.00 86.79  0  386 GLY B C   1 
ATOM   6732  O  O   . GLY B 1 386 ? 237.863 232.273 171.356 1.00 86.79  0  386 GLY B O   1 
ATOM   6733  N  N   . ASP B 1 387 ? 239.470 231.508 169.978 1.00 87.35  0  387 ASP B N   1 
ATOM   6734  C  CA  . ASP B 1 387 ? 238.872 230.196 169.778 1.00 87.35  0  387 ASP B CA  1 
ATOM   6735  C  C   . ASP B 1 387 ? 239.897 229.113 170.073 1.00 87.35  0  387 ASP B C   1 
ATOM   6736  O  O   . ASP B 1 387 ? 241.083 229.282 169.773 1.00 87.35  0  387 ASP B O   1 
ATOM   6737  C  CB  . ASP B 1 387 ? 238.345 230.038 168.347 1.00 87.35  0  387 ASP B CB  1 
ATOM   6738  C  CG  . ASP B 1 387 ? 237.179 230.959 168.051 1.00 87.35  0  387 ASP B CG  1 
ATOM   6739  O  OD1 . ASP B 1 387 ? 236.355 231.186 168.962 1.00 87.35  0  387 ASP B OD1 1 
ATOM   6740  O  OD2 . ASP B 1 387 ? 237.085 231.456 166.910 1.00 87.35  -1 387 ASP B OD2 1 
ATOM   6741  N  N   . ASN B 1 388 ? 239.416 227.998 170.646 1.00 88.28  0  388 ASN B N   1 
ATOM   6742  C  CA  . ASN B 1 388 ? 240.239 226.851 171.059 1.00 88.28  0  388 ASN B CA  1 
ATOM   6743  C  C   . ASN B 1 388 ? 241.347 227.284 172.020 1.00 88.28  0  388 ASN B C   1 
ATOM   6744  O  O   . ASN B 1 388 ? 242.531 227.010 171.814 1.00 88.28  0  388 ASN B O   1 
ATOM   6745  C  CB  . ASN B 1 388 ? 240.808 226.092 169.854 1.00 88.28  0  388 ASN B CB  1 
ATOM   6746  C  CG  . ASN B 1 388 ? 239.763 225.813 168.790 1.00 88.28  0  388 ASN B CG  1 
ATOM   6747  O  OD1 . ASN B 1 388 ? 239.248 226.729 168.149 1.00 88.28  0  388 ASN B OD1 1 
ATOM   6748  N  ND2 . ASN B 1 388 ? 239.443 224.539 168.598 1.00 88.28  0  388 ASN B ND2 1 
ATOM   6749  N  N   . VAL B 1 389 ? 240.941 227.972 173.081 1.00 82.80  0  389 VAL B N   1 
ATOM   6750  C  CA  . VAL B 1 389 ? 241.852 228.507 174.082 1.00 82.80  0  389 VAL B CA  1 
ATOM   6751  C  C   . VAL B 1 389 ? 241.591 227.793 175.405 1.00 82.80  0  389 VAL B C   1 
ATOM   6752  O  O   . VAL B 1 389 ? 240.474 227.336 175.678 1.00 82.80  0  389 VAL B O   1 
ATOM   6753  C  CB  . VAL B 1 389 ? 241.632 230.042 174.160 1.00 82.80  0  389 VAL B CB  1 
ATOM   6754  C  CG1 . VAL B 1 389 ? 240.175 230.355 174.435 1.00 82.80  0  389 VAL B CG1 1 
ATOM   6755  C  CG2 . VAL B 1 389 ? 242.536 230.750 175.175 1.00 82.80  0  389 VAL B CG2 1 
ATOM   6756  N  N   . VAL B 1 390 ? 242.644 227.656 176.212 1.00 79.66  0  390 VAL B N   1 
ATOM   6757  C  CA  . VAL B 1 390 ? 242.541 227.113 177.558 1.00 79.66  0  390 VAL B CA  1 
ATOM   6758  C  C   . VAL B 1 390 ? 242.989 228.179 178.547 1.00 79.66  0  390 VAL B C   1 
ATOM   6759  O  O   . VAL B 1 390 ? 243.881 228.987 178.265 1.00 79.66  0  390 VAL B O   1 
ATOM   6760  C  CB  . VAL B 1 390 ? 243.360 225.814 177.729 1.00 79.66  0  390 VAL B CB  1 
ATOM   6761  C  CG1 . VAL B 1 390 ? 242.689 224.669 176.991 1.00 79.66  0  390 VAL B CG1 1 
ATOM   6762  C  CG2 . VAL B 1 390 ? 244.782 226.000 177.223 1.00 79.66  0  390 VAL B CG2 1 
ATOM   6763  N  N   . LEU B 1 391 ? 242.341 228.193 179.709 1.00 75.40  0  391 LEU B N   1 
ATOM   6764  C  CA  . LEU B 1 391 ? 242.639 229.146 180.777 1.00 75.40  0  391 LEU B CA  1 
ATOM   6765  C  C   . LEU B 1 391 ? 242.688 228.378 182.093 1.00 75.40  0  391 LEU B C   1 
ATOM   6766  O  O   . LEU B 1 391 ? 241.646 228.012 182.648 1.00 75.40  0  391 LEU B O   1 
ATOM   6767  C  CB  . LEU B 1 391 ? 241.612 230.274 180.824 1.00 75.40  0  391 LEU B CB  1 
ATOM   6768  C  CG  . LEU B 1 391 ? 241.652 231.269 179.661 1.00 75.40  0  391 LEU B CG  1 
ATOM   6769  C  CD1 . LEU B 1 391 ? 240.504 232.258 179.743 1.00 75.40  0  391 LEU B CD1 1 
ATOM   6770  C  CD2 . LEU B 1 391 ? 242.985 231.997 179.628 1.00 75.40  0  391 LEU B CD2 1 
ATOM   6771  N  N   . ASP B 1 392 ? 243.901 228.124 182.583 1.00 77.11  0  392 ASP B N   1 
ATOM   6772  C  CA  . ASP B 1 392 ? 244.124 227.309 183.773 1.00 77.11  0  392 ASP B CA  1 
ATOM   6773  C  C   . ASP B 1 392 ? 244.738 228.208 184.835 1.00 77.11  0  392 ASP B C   1 
ATOM   6774  O  O   . ASP B 1 392 ? 245.923 228.548 184.743 1.00 77.11  0  392 ASP B O   1 
ATOM   6775  C  CB  . ASP B 1 392 ? 245.053 226.132 183.474 1.00 77.11  0  392 ASP B CB  1 
ATOM   6776  C  CG  . ASP B 1 392 ? 244.335 224.958 182.848 1.00 77.11  0  392 ASP B CG  1 
ATOM   6777  O  OD1 . ASP B 1 392 ? 243.117 225.060 182.609 1.00 77.11  0  392 ASP B OD1 1 
ATOM   6778  O  OD2 . ASP B 1 392 ? 244.991 223.925 182.600 1.00 77.11  -1 392 ASP B OD2 1 
ATOM   6779  N  N   . GLN B 1 393 ? 243.927 228.588 185.831 1.00 74.39  0  393 GLN B N   1 
ATOM   6780  C  CA  . GLN B 1 393 ? 244.348 229.360 187.010 1.00 74.39  0  393 GLN B CA  1 
ATOM   6781  C  C   . GLN B 1 393 ? 244.962 230.711 186.642 1.00 74.39  0  393 GLN B C   1 
ATOM   6782  O  O   . GLN B 1 393 ? 245.858 231.204 187.331 1.00 74.39  0  393 GLN B O   1 
ATOM   6783  C  CB  . GLN B 1 393 ? 245.307 228.556 187.896 1.00 74.39  0  393 GLN B CB  1 
ATOM   6784  C  CG  . GLN B 1 393 ? 244.715 227.263 188.427 1.00 74.39  0  393 GLN B CG  1 
ATOM   6785  C  CD  . GLN B 1 393 ? 245.612 226.586 189.442 1.00 74.39  0  393 GLN B CD  1 
ATOM   6786  O  OE1 . GLN B 1 393 ? 246.601 227.161 189.896 1.00 74.39  0  393 GLN B OE1 1 
ATOM   6787  N  NE2 . GLN B 1 393 ? 245.271 225.355 189.806 1.00 74.39  0  393 GLN B NE2 1 
ATOM   6788  N  N   . THR B 1 394 ? 244.482 231.325 185.567 1.00 72.30  0  394 THR B N   1 
ATOM   6789  C  CA  . THR B 1 394 ? 245.003 232.605 185.116 1.00 72.30  0  394 THR B CA  1 
ATOM   6790  C  C   . THR B 1 394 ? 244.237 233.753 185.765 1.00 72.30  0  394 THR B C   1 
ATOM   6791  O  O   . THR B 1 394 ? 243.218 233.560 186.427 1.00 72.30  0  394 THR B O   1 
ATOM   6792  C  CB  . THR B 1 394 ? 244.923 232.705 183.595 1.00 72.30  0  394 THR B CB  1 
ATOM   6793  O  OG1 . THR B 1 394 ? 243.584 233.035 183.208 1.00 72.30  0  394 THR B OG1 1 
ATOM   6794  C  CG2 . THR B 1 394 ? 245.303 231.376 182.967 1.00 72.30  0  394 THR B CG2 1 
ATOM   6795  N  N   . TYR B 1 395 ? 244.759 234.969 185.596 1.00 70.71  0  395 TYR B N   1 
ATOM   6796  C  CA  . TYR B 1 395 ? 244.140 236.170 186.168 1.00 70.71  0  395 TYR B CA  1 
ATOM   6797  C  C   . TYR B 1 395 ? 244.157 237.264 185.102 1.00 70.71  0  395 TYR B C   1 
ATOM   6798  O  O   . TYR B 1 395 ? 245.136 238.002 184.963 1.00 70.71  0  395 TYR B O   1 
ATOM   6799  C  CB  . TYR B 1 395 ? 244.847 236.593 187.452 1.00 70.71  0  395 TYR B CB  1 
ATOM   6800  C  CG  . TYR B 1 395 ? 244.891 235.481 188.477 1.00 70.71  0  395 TYR B CG  1 
ATOM   6801  C  CD1 . TYR B 1 395 ? 243.753 235.132 189.191 1.00 70.71  0  395 TYR B CD1 1 
ATOM   6802  C  CD2 . TYR B 1 395 ? 246.051 234.748 188.693 1.00 70.71  0  395 TYR B CD2 1 
ATOM   6803  C  CE1 . TYR B 1 395 ? 243.770 234.105 190.111 1.00 70.71  0  395 TYR B CE1 1 
ATOM   6804  C  CE2 . TYR B 1 395 ? 246.081 233.715 189.616 1.00 70.71  0  395 TYR B CE2 1 
ATOM   6805  C  CZ  . TYR B 1 395 ? 244.934 233.401 190.321 1.00 70.71  0  395 TYR B CZ  1 
ATOM   6806  O  OH  . TYR B 1 395 ? 244.942 232.377 191.238 1.00 70.71  0  395 TYR B OH  1 
ATOM   6807  N  N   . LEU B 1 396 ? 243.063 237.358 184.352 1.00 70.83  0  396 LEU B N   1 
ATOM   6808  C  CA  . LEU B 1 396 ? 242.925 238.304 183.253 1.00 70.83  0  396 LEU B CA  1 
ATOM   6809  C  C   . LEU B 1 396 ? 242.165 239.532 183.734 1.00 70.83  0  396 LEU B C   1 
ATOM   6810  O  O   . LEU B 1 396 ? 241.063 239.411 184.278 1.00 70.83  0  396 LEU B O   1 
ATOM   6811  C  CB  . LEU B 1 396 ? 242.193 237.662 182.073 1.00 70.83  0  396 LEU B CB  1 
ATOM   6812  C  CG  . LEU B 1 396 ? 243.019 237.111 180.908 1.00 70.83  0  396 LEU B CG  1 
ATOM   6813  C  CD1 . LEU B 1 396 ? 243.955 236.006 181.370 1.00 70.83  0  396 LEU B CD1 1 
ATOM   6814  C  CD2 . LEU B 1 396 ? 242.104 236.604 179.806 1.00 70.83  0  396 LEU B CD2 1 
ATOM   6815  N  N   . TRP B 1 397 ? 242.751 240.707 183.532 1.00 73.79  0  397 TRP B N   1 
ATOM   6816  C  CA  . TRP B 1 397 ? 242.146 241.956 183.960 1.00 73.79  0  397 TRP B CA  1 
ATOM   6817  C  C   . TRP B 1 397 ? 241.400 242.586 182.784 1.00 73.79  0  397 TRP B C   1 
ATOM   6818  O  O   . TRP B 1 397 ? 241.175 241.948 181.751 1.00 73.79  0  397 TRP B O   1 
ATOM   6819  C  CB  . TRP B 1 397 ? 243.208 242.887 184.551 1.00 73.79  0  397 TRP B CB  1 
ATOM   6820  C  CG  . TRP B 1 397 ? 243.783 242.389 185.852 1.00 73.79  0  397 TRP B CG  1 
ATOM   6821  C  CD1 . TRP B 1 397 ? 243.383 241.291 186.561 1.00 73.79  0  397 TRP B CD1 1 
ATOM   6822  C  CD2 . TRP B 1 397 ? 244.856 242.975 186.599 1.00 73.79  0  397 TRP B CD2 1 
ATOM   6823  N  NE1 . TRP B 1 397 ? 244.144 241.155 187.694 1.00 73.79  0  397 TRP B NE1 1 
ATOM   6824  C  CE2 . TRP B 1 397 ? 245.054 242.176 187.742 1.00 73.79  0  397 TRP B CE2 1 
ATOM   6825  C  CE3 . TRP B 1 397 ? 245.667 244.098 186.413 1.00 73.79  0  397 TRP B CE3 1 
ATOM   6826  C  CZ2 . TRP B 1 397 ? 246.030 242.463 188.692 1.00 73.79  0  397 TRP B CZ2 1 
ATOM   6827  C  CZ3 . TRP B 1 397 ? 246.638 244.378 187.355 1.00 73.79  0  397 TRP B CZ3 1 
ATOM   6828  C  CH2 . TRP B 1 397 ? 246.811 243.564 188.479 1.00 73.79  0  397 TRP B CH2 1 
ATOM   6829  N  N   . GLN B 1 398 ? 240.991 243.842 182.944 1.00 79.52  0  398 GLN B N   1 
ATOM   6830  C  CA  . GLN B 1 398 ? 240.149 244.493 181.950 1.00 79.52  0  398 GLN B CA  1 
ATOM   6831  C  C   . GLN B 1 398 ? 240.939 244.861 180.698 1.00 79.52  0  398 GLN B C   1 
ATOM   6832  O  O   . GLN B 1 398 ? 242.136 245.152 180.750 1.00 79.52  0  398 GLN B O   1 
ATOM   6833  C  CB  . GLN B 1 398 ? 239.504 245.749 182.537 1.00 79.52  0  398 GLN B CB  1 
ATOM   6834  C  CG  . GLN B 1 398 ? 240.483 246.724 183.167 1.00 79.52  0  398 GLN B CG  1 
ATOM   6835  C  CD  . GLN B 1 398 ? 239.798 247.953 183.733 1.00 79.52  0  398 GLN B CD  1 
ATOM   6836  O  OE1 . GLN B 1 398 ? 238.570 248.022 183.789 1.00 79.52  0  398 GLN B OE1 1 
ATOM   6837  N  NE2 . GLN B 1 398 ? 240.590 248.931 184.155 1.00 79.52  0  398 GLN B NE2 1 
ATOM   6838  N  N   . GLY B 1 399 ? 240.250 244.834 179.560 1.00 81.26  0  399 GLY B N   1 
ATOM   6839  C  CA  . GLY B 1 399 ? 240.800 245.335 178.319 1.00 81.26  0  399 GLY B CA  1 
ATOM   6840  C  C   . GLY B 1 399 ? 241.744 244.411 177.585 1.00 81.26  0  399 GLY B C   1 
ATOM   6841  O  O   . GLY B 1 399 ? 242.351 244.839 176.597 1.00 81.26  0  399 GLY B O   1 
ATOM   6842  N  N   . VAL B 1 400 ? 241.892 243.160 178.022 1.00 79.91  0  400 VAL B N   1 
ATOM   6843  C  CA  . VAL B 1 400 ? 242.818 242.244 177.363 1.00 79.91  0  400 VAL B CA  1 
ATOM   6844  C  C   . VAL B 1 400 ? 242.208 241.738 176.063 1.00 79.91  0  400 VAL B C   1 
ATOM   6845  O  O   . VAL B 1 400 ? 241.003 241.884 175.827 1.00 79.91  0  400 VAL B O   1 
ATOM   6846  C  CB  . VAL B 1 400 ? 243.207 241.068 178.278 1.00 79.91  0  400 VAL B CB  1 
ATOM   6847  C  CG1 . VAL B 1 400 ? 243.692 241.577 179.616 1.00 79.91  0  400 VAL B CG1 1 
ATOM   6848  C  CG2 . VAL B 1 400 ? 242.040 240.117 178.454 1.00 79.91  0  400 VAL B CG2 1 
ATOM   6849  N  N   . ARG B 1 401 ? 243.040 241.147 175.209 1.00 83.06  0  401 ARG B N   1 
ATOM   6850  C  CA  . ARG B 1 401 ? 242.589 240.579 173.942 1.00 83.06  0  401 ARG B CA  1 
ATOM   6851  C  C   . ARG B 1 401 ? 243.417 239.333 173.663 1.00 83.06  0  401 ARG B C   1 
ATOM   6852  O  O   . ARG B 1 401 ? 244.611 239.433 173.366 1.00 83.06  0  401 ARG B O   1 
ATOM   6853  C  CB  . ARG B 1 401 ? 242.722 241.589 172.802 1.00 83.06  0  401 ARG B CB  1 
ATOM   6854  C  CG  . ARG B 1 401 ? 242.229 241.076 171.460 1.00 83.06  0  401 ARG B CG  1 
ATOM   6855  C  CD  . ARG B 1 401 ? 242.172 242.194 170.433 1.00 83.06  0  401 ARG B CD  1 
ATOM   6856  N  NE  . ARG B 1 401 ? 241.349 243.310 170.887 1.00 83.06  0  401 ARG B NE  1 
ATOM   6857  C  CZ  . ARG B 1 401 ? 240.043 243.415 170.663 1.00 83.06  0  401 ARG B CZ  1 
ATOM   6858  N  NH1 . ARG B 1 401 ? 239.407 242.468 169.987 1.00 83.06  1  401 ARG B NH1 1 
ATOM   6859  N  NH2 . ARG B 1 401 ? 239.374 244.467 171.114 1.00 83.06  0  401 ARG B NH2 1 
ATOM   6860  N  N   . VAL B 1 402 ? 242.787 238.166 173.760 1.00 83.42  0  402 VAL B N   1 
ATOM   6861  C  CA  . VAL B 1 402 ? 243.444 236.885 173.531 1.00 83.42  0  402 VAL B CA  1 
ATOM   6862  C  C   . VAL B 1 402 ? 242.963 236.333 172.197 1.00 83.42  0  402 VAL B C   1 
ATOM   6863  O  O   . VAL B 1 402 ? 241.754 236.194 171.976 1.00 83.42  0  402 VAL B O   1 
ATOM   6864  C  CB  . VAL B 1 402 ? 243.161 235.895 174.673 1.00 83.42  0  402 VAL B CB  1 
ATOM   6865  C  CG1 . VAL B 1 402 ? 243.874 234.578 174.421 1.00 83.42  0  402 VAL B CG1 1 
ATOM   6866  C  CG2 . VAL B 1 402 ? 243.590 236.490 176.004 1.00 83.42  0  402 VAL B CG2 1 
ATOM   6867  N  N   . ALA B 1 403 ? 243.905 236.020 171.312 1.00 88.61  0  403 ALA B N   1 
ATOM   6868  C  CA  . ALA B 1 403 ? 243.569 235.504 169.992 1.00 88.61  0  403 ALA B CA  1 
ATOM   6869  C  C   . ALA B 1 403 ? 243.321 233.998 170.070 1.00 88.61  0  403 ALA B C   1 
ATOM   6870  O  O   . ALA B 1 403 ? 243.318 233.393 171.145 1.00 88.61  0  403 ALA B O   1 
ATOM   6871  C  CB  . ALA B 1 403 ? 244.667 235.855 168.992 1.00 88.61  0  403 ALA B CB  1 
ATOM   6872  N  N   . ALA B 1 404 ? 243.116 233.376 168.914 1.00 90.86  0  404 ALA B N   1 
ATOM   6873  C  CA  . ALA B 1 404 ? 242.755 231.968 168.852 1.00 90.86  0  404 ALA B CA  1 
ATOM   6874  C  C   . ALA B 1 404 ? 243.971 231.068 169.040 1.00 90.86  0  404 ALA B C   1 
ATOM   6875  O  O   . ALA B 1 404 ? 245.101 231.432 168.702 1.00 90.86  0  404 ALA B O   1 
ATOM   6876  C  CB  . ALA B 1 404 ? 242.077 231.649 167.520 1.00 90.86  0  404 ALA B CB  1 
ATOM   6877  N  N   . GLY B 1 405 ? 243.726 229.881 169.593 1.00 91.73  0  405 GLY B N   1 
ATOM   6878  C  CA  . GLY B 1 405 ? 244.769 228.882 169.734 1.00 91.73  0  405 GLY B CA  1 
ATOM   6879  C  C   . GLY B 1 405 ? 245.809 229.161 170.794 1.00 91.73  0  405 GLY B C   1 
ATOM   6880  O  O   . GLY B 1 405 ? 246.867 228.528 170.789 1.00 91.73  0  405 GLY B O   1 
ATOM   6881  N  N   . ALA B 1 406 ? 245.542 230.090 171.706 1.00 87.82  0  406 ALA B N   1 
ATOM   6882  C  CA  . ALA B 1 406 ? 246.489 230.440 172.753 1.00 87.82  0  406 ALA B CA  1 
ATOM   6883  C  C   . ALA B 1 406 ? 246.333 229.511 173.950 1.00 87.82  0  406 ALA B C   1 
ATOM   6884  O  O   . ALA B 1 406 ? 245.221 229.116 174.304 1.00 87.82  0  406 ALA B O   1 
ATOM   6885  C  CB  . ALA B 1 406 ? 246.295 231.892 173.187 1.00 87.82  0  406 ALA B CB  1 
ATOM   6886  N  N   . GLN B 1 407 ? 247.460 229.135 174.550 1.00 86.69  0  407 GLN B N   1 
ATOM   6887  C  CA  . GLN B 1 407 ? 247.478 228.270 175.727 1.00 86.69  0  407 GLN B CA  1 
ATOM   6888  C  C   . GLN B 1 407 ? 248.059 229.068 176.888 1.00 86.69  0  407 GLN B C   1 
ATOM   6889  O  O   . GLN B 1 407 ? 249.268 229.315 176.931 1.00 86.69  0  407 GLN B O   1 
ATOM   6890  C  CB  . GLN B 1 407 ? 248.291 227.002 175.471 1.00 86.69  0  407 GLN B CB  1 
ATOM   6891  C  CG  . GLN B 1 407 ? 248.004 226.333 174.137 1.00 86.69  0  407 GLN B CG  1 
ATOM   6892  C  CD  . GLN B 1 407 ? 246.642 225.671 174.098 1.00 86.69  0  407 GLN B CD  1 
ATOM   6893  O  OE1 . GLN B 1 407 ? 245.665 226.260 173.635 1.00 86.69  0  407 GLN B OE1 1 
ATOM   6894  N  NE2 . GLN B 1 407 ? 246.568 224.440 174.589 1.00 86.69  0  407 GLN B NE2 1 
ATOM   6895  N  N   . ILE B 1 408 ? 247.203 229.469 177.825 1.00 80.57  0  408 ILE B N   1 
ATOM   6896  C  CA  . ILE B 1 408 ? 247.607 230.283 178.967 1.00 80.57  0  408 ILE B CA  1 
ATOM   6897  C  C   . ILE B 1 408 ? 247.340 229.485 180.236 1.00 80.57  0  408 ILE B C   1 
ATOM   6898  O  O   . ILE B 1 408 ? 246.210 229.037 180.467 1.00 80.57  0  408 ILE B O   1 
ATOM   6899  C  CB  . ILE B 1 408 ? 246.863 231.628 179.004 1.00 80.57  0  408 ILE B CB  1 
ATOM   6900  C  CG1 . ILE B 1 408 ? 247.006 232.367 177.674 1.00 80.57  0  408 ILE B CG1 1 
ATOM   6901  C  CG2 . ILE B 1 408 ? 247.406 232.502 180.107 1.00 80.57  0  408 ILE B CG2 1 
ATOM   6902  C  CD1 . ILE B 1 408 ? 245.735 232.396 176.862 1.00 80.57  0  408 ILE B CD1 1 
ATOM   6903  N  N   . HIS B 1 409 ? 248.375 229.307 181.055 1.00 80.48  0  409 HIS B N   1 
ATOM   6904  C  CA  . HIS B 1 409 ? 248.287 228.520 182.280 1.00 80.48  0  409 HIS B CA  1 
ATOM   6905  C  C   . HIS B 1 409 ? 248.940 229.292 183.417 1.00 80.48  0  409 HIS B C   1 
ATOM   6906  O  O   . HIS B 1 409 ? 250.133 229.603 183.339 1.00 80.48  0  409 HIS B O   1 
ATOM   6907  C  CB  . HIS B 1 409 ? 248.961 227.154 182.116 1.00 80.48  0  409 HIS B CB  1 
ATOM   6908  C  CG  . HIS B 1 409 ? 248.359 226.303 181.041 1.00 80.48  0  409 HIS B CG  1 
ATOM   6909  N  ND1 . HIS B 1 409 ? 248.583 226.526 179.700 1.00 80.48  0  409 HIS B ND1 1 
ATOM   6910  C  CD2 . HIS B 1 409 ? 247.545 225.223 181.111 1.00 80.48  0  409 HIS B CD2 1 
ATOM   6911  C  CE1 . HIS B 1 409 ? 247.931 225.623 178.990 1.00 80.48  0  409 HIS B CE1 1 
ATOM   6912  N  NE2 . HIS B 1 409 ? 247.293 224.821 179.822 1.00 80.48  0  409 HIS B NE2 1 
ATOM   6913  N  N   . GLN B 1 410 ? 248.150 229.599 184.458 1.00 77.69  0  410 GLN B N   1 
ATOM   6914  C  CA  . GLN B 1 410 ? 248.627 230.162 185.733 1.00 77.69  0  410 GLN B CA  1 
ATOM   6915  C  C   . GLN B 1 410 ? 249.362 231.489 185.550 1.00 77.69  0  410 GLN B C   1 
ATOM   6916  O  O   . GLN B 1 410 ? 250.400 231.733 186.166 1.00 77.69  0  410 GLN B O   1 
ATOM   6917  C  CB  . GLN B 1 410 ? 249.502 229.160 186.490 1.00 77.69  0  410 GLN B CB  1 
ATOM   6918  C  CG  . GLN B 1 410 ? 248.824 227.832 186.777 1.00 77.69  0  410 GLN B CG  1 
ATOM   6919  C  CD  . GLN B 1 410 ? 249.647 226.947 187.691 1.00 77.69  0  410 GLN B CD  1 
ATOM   6920  O  OE1 . GLN B 1 410 ? 250.568 227.412 188.361 1.00 77.69  0  410 GLN B OE1 1 
ATOM   6921  N  NE2 . GLN B 1 410 ? 249.318 225.661 187.721 1.00 77.69  0  410 GLN B NE2 1 
ATOM   6922  N  N   . SER B 1 411 ? 248.824 232.351 184.698 1.00 78.05  0  411 SER B N   1 
ATOM   6923  C  CA  . SER B 1 411 ? 249.474 233.604 184.356 1.00 78.05  0  411 SER B CA  1 
ATOM   6924  C  C   . SER B 1 411 ? 248.720 234.779 184.968 1.00 78.05  0  411 SER B C   1 
ATOM   6925  O  O   . SER B 1 411 ? 247.715 234.617 185.665 1.00 78.05  0  411 SER B O   1 
ATOM   6926  C  CB  . SER B 1 411 ? 249.565 233.753 182.838 1.00 78.05  0  411 SER B CB  1 
ATOM   6927  O  OG  . SER B 1 411 ? 250.618 232.966 182.314 1.00 78.05  0  411 SER B OG  1 
ATOM   6928  N  N   . LEU B 1 412 ? 249.226 235.980 184.695 1.00 75.24  0  412 LEU B N   1 
ATOM   6929  C  CA  . LEU B 1 412 ? 248.607 237.221 185.150 1.00 75.24  0  412 LEU B CA  1 
ATOM   6930  C  C   . LEU B 1 412 ? 248.688 238.225 184.010 1.00 75.24  0  412 LEU B C   1 
ATOM   6931  O  O   . LEU B 1 412 ? 249.784 238.649 183.631 1.00 75.24  0  412 LEU B O   1 
ATOM   6932  C  CB  . LEU B 1 412 ? 249.294 237.756 186.406 1.00 75.24  0  412 LEU B CB  1 
ATOM   6933  C  CG  . LEU B 1 412 ? 248.940 239.179 186.844 1.00 75.24  0  412 LEU B CG  1 
ATOM   6934  C  CD1 . LEU B 1 412 ? 247.475 239.282 187.231 1.00 75.24  0  412 LEU B CD1 1 
ATOM   6935  C  CD2 . LEU B 1 412 ? 249.830 239.619 187.994 1.00 75.24  0  412 LEU B CD2 1 
ATOM   6936  N  N   . LEU B 1 413 ? 247.536 238.597 183.462 1.00 74.39  0  413 LEU B N   1 
ATOM   6937  C  CA  . LEU B 1 413 ? 247.453 239.533 182.349 1.00 74.39  0  413 LEU B CA  1 
ATOM   6938  C  C   . LEU B 1 413 ? 246.840 240.831 182.854 1.00 74.39  0  413 LEU B C   1 
ATOM   6939  O  O   . LEU B 1 413 ? 245.705 240.836 183.343 1.00 74.39  0  413 LEU B O   1 
ATOM   6940  C  CB  . LEU B 1 413 ? 246.633 238.957 181.193 1.00 74.39  0  413 LEU B CB  1 
ATOM   6941  C  CG  . LEU B 1 413 ? 247.316 238.021 180.186 1.00 74.39  0  413 LEU B CG  1 
ATOM   6942  C  CD1 . LEU B 1 413 ? 247.613 236.636 180.752 1.00 74.39  0  413 LEU B CD1 1 
ATOM   6943  C  CD2 . LEU B 1 413 ? 246.472 237.911 178.925 1.00 74.39  0  413 LEU B CD2 1 
ATOM   6944  N  N   . CYS B 1 414 ? 247.587 241.923 182.735 1.00 79.38  0  414 CYS B N   1 
ATOM   6945  C  CA  . CYS B 1 414 ? 247.167 243.204 183.279 1.00 79.38  0  414 CYS B CA  1 
ATOM   6946  C  C   . CYS B 1 414 ? 246.349 243.976 182.245 1.00 79.38  0  414 CYS B C   1 
ATOM   6947  O  O   . CYS B 1 414 ? 245.900 243.424 181.237 1.00 79.38  0  414 CYS B O   1 
ATOM   6948  C  CB  . CYS B 1 414 ? 248.376 243.996 183.764 1.00 79.38  0  414 CYS B CB  1 
ATOM   6949  S  SG  . CYS B 1 414 ? 249.271 243.208 185.122 1.00 79.38  0  414 CYS B SG  1 
ATOM   6950  N  N   . ASP B 1 415 ? 246.147 245.268 182.500 1.00 79.71  0  415 ASP B N   1 
ATOM   6951  C  CA  . ASP B 1 415 ? 245.173 246.060 181.760 1.00 79.71  0  415 ASP B CA  1 
ATOM   6952  C  C   . ASP B 1 415 ? 245.620 246.330 180.328 1.00 79.71  0  415 ASP B C   1 
ATOM   6953  O  O   . ASP B 1 415 ? 246.811 246.516 180.056 1.00 79.71  0  415 ASP B O   1 
ATOM   6954  C  CB  . ASP B 1 415 ? 244.921 247.384 182.479 1.00 79.71  0  415 ASP B CB  1 
ATOM   6955  C  CG  . ASP B 1 415 ? 244.435 247.192 183.901 1.00 79.71  0  415 ASP B CG  1 
ATOM   6956  O  OD1 . ASP B 1 415 ? 243.675 246.232 184.146 1.00 79.71  0  415 ASP B OD1 1 
ATOM   6957  O  OD2 . ASP B 1 415 ? 244.812 248.000 184.775 1.00 79.71  -1 415 ASP B OD2 1 
ATOM   6958  N  N   . ASN B 1 416 ? 244.637 246.329 179.415 1.00 82.66  0  416 ASN B N   1 
ATOM   6959  C  CA  . ASN B 1 416 ? 244.789 246.686 177.997 1.00 82.66  0  416 ASN B CA  1 
ATOM   6960  C  C   . ASN B 1 416 ? 245.789 245.793 177.264 1.00 82.66  0  416 ASN B C   1 
ATOM   6961  O  O   . ASN B 1 416 ? 246.421 246.221 176.297 1.00 82.66  0  416 ASN B O   1 
ATOM   6962  C  CB  . ASN B 1 416 ? 245.163 248.163 177.825 1.00 82.66  0  416 ASN B CB  1 
ATOM   6963  C  CG  . ASN B 1 416 ? 244.411 249.069 178.781 1.00 82.66  0  416 ASN B CG  1 
ATOM   6964  O  OD1 . ASN B 1 416 ? 243.188 249.189 178.709 1.00 82.66  0  416 ASN B OD1 1 
ATOM   6965  N  ND2 . ASN B 1 416 ? 245.141 249.711 179.685 1.00 82.66  0  416 ASN B ND2 1 
ATOM   6966  N  N   . ALA B 1 417 ? 245.922 244.543 177.699 1.00 85.21  0  417 ALA B N   1 
ATOM   6967  C  CA  . ALA B 1 417 ? 246.908 243.640 177.128 1.00 85.21  0  417 ALA B CA  1 
ATOM   6968  C  C   . ALA B 1 417 ? 246.447 243.123 175.767 1.00 85.21  0  417 ALA B C   1 
ATOM   6969  O  O   . ALA B 1 417 ? 245.276 243.227 175.394 1.00 85.21  0  417 ALA B O   1 
ATOM   6970  C  CB  . ALA B 1 417 ? 247.172 242.469 178.072 1.00 85.21  0  417 ALA B CB  1 
ATOM   6971  N  N   . GLU B 1 418 ? 247.398 242.577 175.013 1.00 88.70  0  418 GLU B N   1 
ATOM   6972  C  CA  . GLU B 1 418 ? 247.114 241.955 173.726 1.00 88.70  0  418 GLU B CA  1 
ATOM   6973  C  C   . GLU B 1 418 ? 247.935 240.682 173.603 1.00 88.70  0  418 GLU B C   1 
ATOM   6974  O  O   . GLU B 1 418 ? 249.131 240.683 173.905 1.00 88.70  0  418 GLU B O   1 
ATOM   6975  C  CB  . GLU B 1 418 ? 247.431 242.898 172.557 1.00 88.70  0  418 GLU B CB  1 
ATOM   6976  C  CG  . GLU B 1 418 ? 246.447 244.046 172.376 1.00 88.70  0  418 GLU B CG  1 
ATOM   6977  C  CD  . GLU B 1 418 ? 245.454 243.791 171.261 1.00 88.70  0  418 GLU B CD  1 
ATOM   6978  O  OE1 . GLU B 1 418 ? 245.644 242.816 170.504 1.00 88.70  0  418 GLU B OE1 1 
ATOM   6979  O  OE2 . GLU B 1 418 ? 244.481 244.566 171.141 1.00 88.70  -1 418 GLU B OE2 1 
ATOM   6980  N  N   . VAL B 1 419 ? 247.291 239.598 173.178 1.00 89.14  0  419 VAL B N   1 
ATOM   6981  C  CA  . VAL B 1 419 ? 247.948 238.312 172.977 1.00 89.14  0  419 VAL B CA  1 
ATOM   6982  C  C   . VAL B 1 419 ? 247.609 237.822 171.576 1.00 89.14  0  419 VAL B C   1 
ATOM   6983  O  O   . VAL B 1 419 ? 246.430 237.745 171.211 1.00 89.14  0  419 VAL B O   1 
ATOM   6984  C  CB  . VAL B 1 419 ? 247.517 237.274 174.035 1.00 89.14  0  419 VAL B CB  1 
ATOM   6985  C  CG1 . VAL B 1 419 ? 248.091 235.908 173.716 1.00 89.14  0  419 VAL B CG1 1 
ATOM   6986  C  CG2 . VAL B 1 419 ? 247.953 237.703 175.429 1.00 89.14  0  419 VAL B CG2 1 
ATOM   6987  N  N   . LYS B 1 420 ? 248.636 237.495 170.794 1.00 94.19  0  420 LYS B N   1 
ATOM   6988  C  CA  . LYS B 1 420 ? 248.446 237.029 169.427 1.00 94.19  0  420 LYS B CA  1 
ATOM   6989  C  C   . LYS B 1 420 ? 248.175 235.524 169.429 1.00 94.19  0  420 LYS B C   1 
ATOM   6990  O  O   . LYS B 1 420 ? 247.997 234.898 170.477 1.00 94.19  0  420 LYS B O   1 
ATOM   6991  C  CB  . LYS B 1 420 ? 249.651 237.399 168.567 1.00 94.19  0  420 LYS B CB  1 
ATOM   6992  C  CG  . LYS B 1 420 ? 249.927 238.893 168.504 1.00 94.19  0  420 LYS B CG  1 
ATOM   6993  C  CD  . LYS B 1 420 ? 248.737 239.651 167.939 1.00 94.19  0  420 LYS B CD  1 
ATOM   6994  C  CE  . LYS B 1 420 ? 249.015 241.144 167.874 1.00 94.19  0  420 LYS B CE  1 
ATOM   6995  N  NZ  . LYS B 1 420 ? 247.868 241.897 167.297 1.00 94.19  1  420 LYS B NZ  1 
ATOM   6996  N  N   . GLU B 1 421 ? 248.143 234.925 168.243 1.00 95.90  0  421 GLU B N   1 
ATOM   6997  C  CA  . GLU B 1 421 ? 247.780 233.525 168.100 1.00 95.90  0  421 GLU B CA  1 
ATOM   6998  C  C   . GLU B 1 421 ? 249.017 232.631 168.150 1.00 95.90  0  421 GLU B C   1 
ATOM   6999  O  O   . GLU B 1 421 ? 250.154 233.095 168.034 1.00 95.90  0  421 GLU B O   1 
ATOM   7000  C  CB  . GLU B 1 421 ? 247.022 233.308 166.789 1.00 95.90  0  421 GLU B CB  1 
ATOM   7001  N  N   . ARG B 1 422 ? 248.761 231.326 168.335 1.00 98.53  0  422 ARG B N   1 
ATOM   7002  C  CA  . ARG B 1 422 ? 249.771 230.256 168.323 1.00 98.53  0  422 ARG B CA  1 
ATOM   7003  C  C   . ARG B 1 422 ? 250.857 230.475 169.379 1.00 98.53  0  422 ARG B C   1 
ATOM   7004  O  O   . ARG B 1 422 ? 252.052 230.501 169.079 1.00 98.53  0  422 ARG B O   1 
ATOM   7005  C  CB  . ARG B 1 422 ? 250.384 230.084 166.929 1.00 98.53  0  422 ARG B CB  1 
ATOM   7006  N  N   . VAL B 1 423 ? 250.430 230.634 170.629 1.00 94.51  0  423 VAL B N   1 
ATOM   7007  C  CA  . VAL B 1 423 ? 251.332 230.916 171.738 1.00 94.51  0  423 VAL B CA  1 
ATOM   7008  C  C   . VAL B 1 423 ? 250.968 229.999 172.904 1.00 94.51  0  423 VAL B C   1 
ATOM   7009  O  O   . VAL B 1 423 ? 249.788 229.719 173.144 1.00 94.51  0  423 VAL B O   1 
ATOM   7010  C  CB  . VAL B 1 423 ? 251.282 232.419 172.123 1.00 94.51  0  423 VAL B CB  1 
ATOM   7011  C  CG1 . VAL B 1 423 ? 249.863 232.875 172.435 1.00 94.51  0  423 VAL B CG1 1 
ATOM   7012  C  CG2 . VAL B 1 423 ? 252.244 232.760 173.260 1.00 94.51  0  423 VAL B CG2 1 
ATOM   7013  N  N   . THR B 1 424 ? 251.987 229.485 173.593 1.00 93.03  0  424 THR B N   1 
ATOM   7014  C  CA  . THR B 1 424 ? 251.807 228.627 174.759 1.00 93.03  0  424 THR B CA  1 
ATOM   7015  C  C   . THR B 1 424 ? 252.519 229.259 175.946 1.00 93.03  0  424 THR B C   1 
ATOM   7016  O  O   . THR B 1 424 ? 253.735 229.475 175.902 1.00 93.03  0  424 THR B O   1 
ATOM   7017  C  CB  . THR B 1 424 ? 252.345 227.219 174.496 1.00 93.03  0  424 THR B CB  1 
ATOM   7018  O  OG1 . THR B 1 424 ? 251.581 226.600 173.453 1.00 93.03  0  424 THR B OG1 1 
ATOM   7019  C  CG2 . THR B 1 424 ? 252.255 226.369 175.755 1.00 93.03  0  424 THR B CG2 1 
ATOM   7020  N  N   . LEU B 1 425 ? 251.764 229.553 177.000 1.00 86.71  0  425 LEU B N   1 
ATOM   7021  C  CA  . LEU B 1 425 ? 252.296 230.169 178.207 1.00 86.71  0  425 LEU B CA  1 
ATOM   7022  C  C   . LEU B 1 425 ? 252.488 229.130 179.305 1.00 86.71  0  425 LEU B C   1 
ATOM   7023  O  O   . LEU B 1 425 ? 251.769 228.131 179.380 1.00 86.71  0  425 LEU B O   1 
ATOM   7024  C  CB  . LEU B 1 425 ? 251.379 231.287 178.716 1.00 86.71  0  425 LEU B CB  1 
ATOM   7025  C  CG  . LEU B 1 425 ? 251.451 232.681 178.078 1.00 86.71  0  425 LEU B CG  1 
ATOM   7026  C  CD1 . LEU B 1 425 ? 250.758 232.743 176.722 1.00 86.71  0  425 LEU B CD1 1 
ATOM   7027  C  CD2 . LEU B 1 425 ? 250.879 233.729 179.021 1.00 86.71  0  425 LEU B CD2 1 
ATOM   7028  N  N   . LYS B 1 426 ? 253.472 229.383 180.159 1.00 87.98  0  426 LYS B N   1 
ATOM   7029  C  CA  . LYS B 1 426 ? 253.835 228.536 181.282 1.00 87.98  0  426 LYS B CA  1 
ATOM   7030  C  C   . LYS B 1 426 ? 253.365 229.170 182.589 1.00 87.98  0  426 LYS B C   1 
ATOM   7031  O  O   . LYS B 1 426 ? 252.991 230.348 182.607 1.00 87.98  0  426 LYS B O   1 
ATOM   7032  C  CB  . LYS B 1 426 ? 255.358 228.322 181.303 1.00 87.98  0  426 LYS B CB  1 
ATOM   7033  C  CG  . LYS B 1 426 ? 255.896 227.559 180.101 1.00 87.98  0  426 LYS B CG  1 
ATOM   7034  C  CD  . LYS B 1 426 ? 255.079 226.308 179.807 1.00 87.98  0  426 LYS B CD  1 
ATOM   7035  C  CE  . LYS B 1 426 ? 255.960 225.181 179.293 1.00 87.98  0  426 LYS B CE  1 
ATOM   7036  N  NZ  . LYS B 1 426 ? 256.801 224.598 180.374 1.00 87.98  1  426 LYS B NZ  1 
ATOM   7037  N  N   . PRO B 1 427 ? 253.303 228.401 183.687 1.00 86.08  0  427 PRO B N   1 
ATOM   7038  C  CA  . PRO B 1 427 ? 252.942 228.996 184.983 1.00 86.08  0  427 PRO B CA  1 
ATOM   7039  C  C   . PRO B 1 427 ? 253.915 230.069 185.454 1.00 86.08  0  427 PRO B C   1 
ATOM   7040  O  O   . PRO B 1 427 ? 255.095 230.071 185.094 1.00 86.08  0  427 PRO B O   1 
ATOM   7041  C  CB  . PRO B 1 427 ? 252.948 227.794 185.931 1.00 86.08  0  427 PRO B CB  1 
ATOM   7042  C  CG  . PRO B 1 427 ? 252.529 226.671 185.074 1.00 86.08  0  427 PRO B CG  1 
ATOM   7043  C  CD  . PRO B 1 427 ? 253.129 226.934 183.716 1.00 86.08  0  427 PRO B CD  1 
ATOM   7044  N  N   . ARG B 1 428 ? 253.372 230.991 186.260 1.00 86.04  0  428 ARG B N   1 
ATOM   7045  C  CA  . ARG B 1 428 ? 254.079 232.135 186.849 1.00 86.04  0  428 ARG B CA  1 
ATOM   7046  C  C   . ARG B 1 428 ? 254.692 233.042 185.779 1.00 86.04  0  428 ARG B C   1 
ATOM   7047  O  O   . ARG B 1 428 ? 255.867 233.409 185.839 1.00 86.04  0  428 ARG B O   1 
ATOM   7048  C  CB  . ARG B 1 428 ? 255.137 231.678 187.860 1.00 86.04  0  428 ARG B CB  1 
ATOM   7049  C  CG  . ARG B 1 428 ? 254.568 230.920 189.046 1.00 86.04  0  428 ARG B CG  1 
ATOM   7050  C  CD  . ARG B 1 428 ? 255.672 230.435 189.968 1.00 86.04  0  428 ARG B CD  1 
ATOM   7051  N  NE  . ARG B 1 428 ? 256.544 229.469 189.306 1.00 86.04  0  428 ARG B NE  1 
ATOM   7052  C  CZ  . ARG B 1 428 ? 257.587 228.885 189.885 1.00 86.04  0  428 ARG B CZ  1 
ATOM   7053  N  NH1 . ARG B 1 428 ? 258.325 228.017 189.206 1.00 86.04  1  428 ARG B NH1 1 
ATOM   7054  N  NH2 . ARG B 1 428 ? 257.892 229.166 191.144 1.00 86.04  0  428 ARG B NH2 1 
ATOM   7055  N  N   . SER B 1 429 ? 253.877 233.407 184.794 1.00 84.46  0  429 SER B N   1 
ATOM   7056  C  CA  . SER B 1 429 ? 254.269 234.336 183.740 1.00 84.46  0  429 SER B CA  1 
ATOM   7057  C  C   . SER B 1 429 ? 253.430 235.599 183.884 1.00 84.46  0  429 SER B C   1 
ATOM   7058  O  O   . SER B 1 429 ? 252.197 235.533 183.867 1.00 84.46  0  429 SER B O   1 
ATOM   7059  C  CB  . SER B 1 429 ? 254.100 233.716 182.353 1.00 84.46  0  429 SER B CB  1 
ATOM   7060  O  OG  . SER B 1 429 ? 252.747 233.714 181.949 1.00 84.46  0  429 SER B OG  1 
ATOM   7061  N  N   . VAL B 1 430 ? 254.096 236.742 184.024 1.00 84.53  0  430 VAL B N   1 
ATOM   7062  C  CA  . VAL B 1 430 ? 253.441 238.022 184.270 1.00 84.53  0  430 VAL B CA  1 
ATOM   7063  C  C   . VAL B 1 430 ? 253.710 238.938 183.085 1.00 84.53  0  430 VAL B C   1 
ATOM   7064  O  O   . VAL B 1 430 ? 254.847 239.029 182.610 1.00 84.53  0  430 VAL B O   1 
ATOM   7065  C  CB  . VAL B 1 430 ? 253.932 238.668 185.581 1.00 84.53  0  430 VAL B CB  1 
ATOM   7066  C  CG1 . VAL B 1 430 ? 253.079 239.876 185.942 1.00 84.53  0  430 VAL B CG1 1 
ATOM   7067  C  CG2 . VAL B 1 430 ? 253.929 237.654 186.716 1.00 84.53  0  430 VAL B CG2 1 
ATOM   7068  N  N   . LEU B 1 431 ? 252.664 239.606 182.603 1.00 82.90  0  431 LEU B N   1 
ATOM   7069  C  CA  . LEU B 1 431 ? 252.812 240.656 181.603 1.00 82.90  0  431 LEU B CA  1 
ATOM   7070  C  C   . LEU B 1 431 ? 251.927 241.828 182.003 1.00 82.90  0  431 LEU B C   1 
ATOM   7071  O  O   . LEU B 1 431 ? 250.737 241.651 182.276 1.00 82.90  0  431 LEU B O   1 
ATOM   7072  C  CB  . LEU B 1 431 ? 252.486 240.130 180.193 1.00 82.90  0  431 LEU B CB  1 
ATOM   7073  C  CG  . LEU B 1 431 ? 251.147 239.496 179.795 1.00 82.90  0  431 LEU B CG  1 
ATOM   7074  C  CD1 . LEU B 1 431 ? 250.157 240.516 179.246 1.00 82.90  0  431 LEU B CD1 1 
ATOM   7075  C  CD2 . LEU B 1 431 ? 251.372 238.372 178.793 1.00 82.90  0  431 LEU B CD2 1 
ATOM   7076  N  N   . THR B 1 432 ? 252.530 243.014 182.088 1.00 90.10  0  432 THR B N   1 
ATOM   7077  C  CA  . THR B 1 432 ? 251.892 244.189 182.669 1.00 90.10  0  432 THR B CA  1 
ATOM   7078  C  C   . THR B 1 432 ? 251.781 245.308 181.645 1.00 90.10  0  432 THR B C   1 
ATOM   7079  O  O   . THR B 1 432 ? 252.750 245.599 180.935 1.00 90.10  0  432 THR B O   1 
ATOM   7080  C  CB  . THR B 1 432 ? 252.666 244.708 183.891 1.00 90.10  0  432 THR B CB  1 
ATOM   7081  O  OG1 . THR B 1 432 ? 253.768 245.513 183.453 1.00 90.10  0  432 THR B OG1 1 
ATOM   7082  C  CG2 . THR B 1 432 ? 253.189 243.564 184.754 1.00 90.10  0  432 THR B CG2 1 
ATOM   7083  N  N   . SER B 1 433 ? 250.597 245.932 181.594 1.00 90.15  0  433 SER B N   1 
ATOM   7084  C  CA  . SER B 1 433 ? 250.335 247.206 180.914 1.00 90.15  0  433 SER B CA  1 
ATOM   7085  C  C   . SER B 1 433 ? 250.626 247.130 179.411 1.00 90.15  0  433 SER B C   1 
ATOM   7086  O  O   . SER B 1 433 ? 251.595 247.703 178.904 1.00 90.15  0  433 SER B O   1 
ATOM   7087  C  CB  . SER B 1 433 ? 251.125 248.345 181.573 1.00 90.15  0  433 SER B CB  1 
ATOM   7088  O  OG  . SER B 1 433 ? 251.022 248.282 182.984 1.00 90.15  0  433 SER B OG  1 
ATOM   7089  N  N   . GLN B 1 434 ? 249.771 246.352 178.732 1.00 90.03  0  434 GLN B N   1 
ATOM   7090  C  CA  . GLN B 1 434 ? 249.699 246.275 177.265 1.00 90.03  0  434 GLN B CA  1 
ATOM   7091  C  C   . GLN B 1 434 ? 250.977 245.699 176.655 1.00 90.03  0  434 GLN B C   1 
ATOM   7092  O  O   . GLN B 1 434 ? 251.589 246.289 175.762 1.00 90.03  0  434 GLN B O   1 
ATOM   7093  C  CB  . GLN B 1 434 ? 249.359 247.637 176.645 1.00 90.03  0  434 GLN B CB  1 
ATOM   7094  N  N   . VAL B 1 435 ? 251.379 244.532 177.144 1.00 92.36  0  435 VAL B N   1 
ATOM   7095  C  CA  . VAL B 1 435 ? 252.484 243.787 176.553 1.00 92.36  0  435 VAL B CA  1 
ATOM   7096  C  C   . VAL B 1 435 ? 251.915 242.872 175.476 1.00 92.36  0  435 VAL B C   1 
ATOM   7097  O  O   . VAL B 1 435 ? 251.029 242.054 175.746 1.00 92.36  0  435 VAL B O   1 
ATOM   7098  C  CB  . VAL B 1 435 ? 253.252 242.988 177.618 1.00 92.36  0  435 VAL B CB  1 
ATOM   7099  C  CG1 . VAL B 1 435 ? 254.098 241.892 176.980 1.00 92.36  0  435 VAL B CG1 1 
ATOM   7100  C  CG2 . VAL B 1 435 ? 254.127 243.915 178.429 1.00 92.36  0  435 VAL B CG2 1 
ATOM   7101  N  N   . VAL B 1 436 ? 252.408 243.026 174.253 1.00 95.64  0  436 VAL B N   1 
ATOM   7102  C  CA  . VAL B 1 436 ? 251.989 242.199 173.130 1.00 95.64  0  436 VAL B CA  1 
ATOM   7103  C  C   . VAL B 1 436 ? 252.974 241.047 172.987 1.00 95.64  0  436 VAL B C   1 
ATOM   7104  O  O   . VAL B 1 436 ? 254.190 241.260 172.965 1.00 95.64  0  436 VAL B O   1 
ATOM   7105  C  CB  . VAL B 1 436 ? 251.906 243.028 171.838 1.00 95.64  0  436 VAL B CB  1 
ATOM   7106  C  CG1 . VAL B 1 436 ? 251.455 242.164 170.668 1.00 95.64  0  436 VAL B CG1 1 
ATOM   7107  C  CG2 . VAL B 1 436 ? 250.967 244.208 172.028 1.00 95.64  0  436 VAL B CG2 1 
ATOM   7108  N  N   . VAL B 1 437 ? 252.456 239.826 172.904 1.00 97.02  0  437 VAL B N   1 
ATOM   7109  C  CA  . VAL B 1 437 ? 253.277 238.633 172.730 1.00 97.02  0  437 VAL B CA  1 
ATOM   7110  C  C   . VAL B 1 437 ? 253.077 238.140 171.305 1.00 97.02  0  437 VAL B C   1 
ATOM   7111  O  O   . VAL B 1 437 ? 251.952 237.815 170.906 1.00 97.02  0  437 VAL B O   1 
ATOM   7112  C  CB  . VAL B 1 437 ? 252.922 237.544 173.753 1.00 97.02  0  437 VAL B CB  1 
ATOM   7113  C  CG1 . VAL B 1 437 ? 253.684 236.265 173.448 1.00 97.02  0  437 VAL B CG1 1 
ATOM   7114  C  CG2 . VAL B 1 437 ? 253.225 238.026 175.162 1.00 97.02  0  437 VAL B CG2 1 
ATOM   7115  N  N   . GLY B 1 438 ? 254.166 238.085 170.541 1.00 101.61 0  438 GLY B N   1 
ATOM   7116  C  CA  . GLY B 1 438 ? 254.114 237.732 169.141 1.00 101.61 0  438 GLY B CA  1 
ATOM   7117  C  C   . GLY B 1 438 ? 253.784 236.274 168.891 1.00 101.61 0  438 GLY B C   1 
ATOM   7118  O  O   . GLY B 1 438 ? 253.829 235.437 169.799 1.00 101.61 0  438 GLY B O   1 
ATOM   7119  N  N   . PRO B 1 439 ? 253.440 235.944 167.647 1.00 104.16 0  439 PRO B N   1 
ATOM   7120  C  CA  . PRO B 1 439 ? 253.058 234.564 167.331 1.00 104.16 0  439 PRO B CA  1 
ATOM   7121  C  C   . PRO B 1 439 ? 254.263 233.639 167.280 1.00 104.16 0  439 PRO B C   1 
ATOM   7122  O  O   . PRO B 1 439 ? 255.387 234.065 166.999 1.00 104.16 0  439 PRO B O   1 
ATOM   7123  C  CB  . PRO B 1 439 ? 252.394 234.682 165.951 1.00 104.16 0  439 PRO B CB  1 
ATOM   7124  C  CG  . PRO B 1 439 ? 252.165 236.155 165.736 1.00 104.16 0  439 PRO B CG  1 
ATOM   7125  C  CD  . PRO B 1 439 ? 253.248 236.840 166.497 1.00 104.16 0  439 PRO B CD  1 
ATOM   7126  N  N   . ASN B 1 440 ? 253.992 232.355 167.562 1.00 106.57 0  440 ASN B N   1 
ATOM   7127  C  CA  . ASN B 1 440 ? 254.975 231.262 167.544 1.00 106.57 0  440 ASN B CA  1 
ATOM   7128  C  C   . ASN B 1 440 ? 256.142 231.538 168.491 1.00 106.57 0  440 ASN B C   1 
ATOM   7129  O  O   . ASN B 1 440 ? 257.303 231.269 168.174 1.00 106.57 0  440 ASN B O   1 
ATOM   7130  C  CB  . ASN B 1 440 ? 255.476 230.974 166.125 1.00 106.57 0  440 ASN B CB  1 
ATOM   7131  N  N   . ILE B 1 441 ? 255.828 232.081 169.665 1.00 103.00 0  441 ILE B N   1 
ATOM   7132  C  CA  . ILE B 1 441 ? 256.840 232.421 170.657 1.00 103.00 0  441 ILE B CA  1 
ATOM   7133  C  C   . ILE B 1 441 ? 256.365 231.985 172.035 1.00 103.00 0  441 ILE B C   1 
ATOM   7134  O  O   . ILE B 1 441 ? 255.560 232.672 172.672 1.00 103.00 0  441 ILE B O   1 
ATOM   7135  C  CB  . ILE B 1 441 ? 257.158 233.926 170.635 1.00 103.00 0  441 ILE B CB  1 
ATOM   7136  N  N   . THR B 1 442 ? 256.860 230.845 172.505 1.00 98.50  0  442 THR B N   1 
ATOM   7137  C  CA  . THR B 1 442 ? 256.526 230.383 173.841 1.00 98.50  0  442 THR B CA  1 
ATOM   7138  C  C   . THR B 1 442 ? 257.424 231.048 174.879 1.00 98.50  0  442 THR B C   1 
ATOM   7139  O  O   . THR B 1 442 ? 258.574 231.407 174.607 1.00 98.50  0  442 THR B O   1 
ATOM   7140  C  CB  . THR B 1 442 ? 256.634 228.857 173.934 1.00 98.50  0  442 THR B CB  1 
ATOM   7141  O  OG1 . THR B 1 442 ? 256.342 228.433 175.272 1.00 98.50  0  442 THR B OG1 1 
ATOM   7142  C  CG2 . THR B 1 442 ? 258.023 228.369 173.529 1.00 98.50  0  442 THR B CG2 1 
ATOM   7143  N  N   . LEU B 1 443 ? 256.874 231.241 176.059 1.00 94.79  0  443 LEU B N   1 
ATOM   7144  C  CA  . LEU B 1 443 ? 257.581 231.853 177.169 1.00 94.79  0  443 LEU B CA  1 
ATOM   7145  C  C   . LEU B 1 443 ? 258.069 230.785 178.141 1.00 94.79  0  443 LEU B C   1 
ATOM   7146  O  O   . LEU B 1 443 ? 257.486 229.702 178.221 1.00 94.79  0  443 LEU B O   1 
ATOM   7147  C  CB  . LEU B 1 443 ? 256.665 232.837 177.906 1.00 94.79  0  443 LEU B CB  1 
ATOM   7148  C  CG  . LEU B 1 443 ? 256.171 234.040 177.100 1.00 94.79  0  443 LEU B CG  1 
ATOM   7149  C  CD1 . LEU B 1 443 ? 255.351 234.971 177.978 1.00 94.79  0  443 LEU B CD1 1 
ATOM   7150  C  CD2 . LEU B 1 443 ? 257.339 234.784 176.472 1.00 94.79  0  443 LEU B CD2 1 
ATOM   7151  N  N   . PRO B 1 444 ? 259.151 231.041 178.890 1.00 94.13  0  444 PRO B N   1 
ATOM   7152  C  CA  . PRO B 1 444 ? 259.570 230.077 179.918 1.00 94.13  0  444 PRO B CA  1 
ATOM   7153  C  C   . PRO B 1 444 ? 258.715 230.148 181.175 1.00 94.13  0  444 PRO B C   1 
ATOM   7154  O  O   . PRO B 1 444 ? 257.712 230.869 181.215 1.00 94.13  0  444 PRO B O   1 
ATOM   7155  C  CB  . PRO B 1 444 ? 261.022 230.478 180.204 1.00 94.13  0  444 PRO B CB  1 
ATOM   7156  C  CG  . PRO B 1 444 ? 261.084 231.921 179.854 1.00 94.13  0  444 PRO B CG  1 
ATOM   7157  C  CD  . PRO B 1 444 ? 260.153 232.103 178.692 1.00 94.13  0  444 PRO B CD  1 
ATOM   7158  N  N   . GLU B 1 445 ? 259.101 229.391 182.205 1.00 92.77  0  445 GLU B N   1 
ATOM   7159  C  CA  . GLU B 1 445 ? 258.361 229.405 183.463 1.00 92.77  0  445 GLU B CA  1 
ATOM   7160  C  C   . GLU B 1 445 ? 258.536 230.736 184.184 1.00 92.77  0  445 GLU B C   1 
ATOM   7161  O  O   . GLU B 1 445 ? 257.564 231.461 184.424 1.00 92.77  0  445 GLU B O   1 
ATOM   7162  C  CB  . GLU B 1 445 ? 258.812 228.243 184.349 1.00 92.77  0  445 GLU B CB  1 
ATOM   7163  N  N   . GLY B 1 446 ? 259.773 231.082 184.528 1.00 95.68  0  446 GLY B N   1 
ATOM   7164  C  CA  . GLY B 1 446 ? 260.031 232.381 185.114 1.00 95.68  0  446 GLY B CA  1 
ATOM   7165  C  C   . GLY B 1 446 ? 260.239 233.439 184.052 1.00 95.68  0  446 GLY B C   1 
ATOM   7166  O  O   . GLY B 1 446 ? 261.330 233.555 183.486 1.00 95.68  0  446 GLY B O   1 
ATOM   7167  N  N   . SER B 1 447 ? 259.198 234.220 183.773 1.00 92.15  0  447 SER B N   1 
ATOM   7168  C  CA  . SER B 1 447 ? 259.253 235.222 182.714 1.00 92.15  0  447 SER B CA  1 
ATOM   7169  C  C   . SER B 1 447 ? 258.282 236.340 183.050 1.00 92.15  0  447 SER B C   1 
ATOM   7170  O  O   . SER B 1 447 ? 257.071 236.111 183.111 1.00 92.15  0  447 SER B O   1 
ATOM   7171  C  CB  . SER B 1 447 ? 258.914 234.607 181.355 1.00 92.15  0  447 SER B CB  1 
ATOM   7172  O  OG  . SER B 1 447 ? 257.514 234.610 181.131 1.00 92.15  0  447 SER B OG  1 
ATOM   7173  N  N   . VAL B 1 448 ? 258.809 237.542 183.265 1.00 90.82  0  448 VAL B N   1 
ATOM   7174  C  CA  . VAL B 1 448 ? 258.002 238.725 183.541 1.00 90.82  0  448 VAL B CA  1 
ATOM   7175  C  C   . VAL B 1 448 ? 258.357 239.782 182.505 1.00 90.82  0  448 VAL B C   1 
ATOM   7176  O  O   . VAL B 1 448 ? 259.516 240.203 182.414 1.00 90.82  0  448 VAL B O   1 
ATOM   7177  C  CB  . VAL B 1 448 ? 258.226 239.259 184.964 1.00 90.82  0  448 VAL B CB  1 
ATOM   7178  C  CG1 . VAL B 1 448 ? 257.446 240.540 185.165 1.00 90.82  0  448 VAL B CG1 1 
ATOM   7179  C  CG2 . VAL B 1 448 ? 257.819 238.222 186.001 1.00 90.82  0  448 VAL B CG2 1 
ATOM   7180  N  N   . ILE B 1 449 ? 257.364 240.209 181.727 1.00 91.24  0  449 ILE B N   1 
ATOM   7181  C  CA  . ILE B 1 449 ? 257.562 241.164 180.644 1.00 91.24  0  449 ILE B CA  1 
ATOM   7182  C  C   . ILE B 1 449 ? 256.797 242.439 180.968 1.00 91.24  0  449 ILE B C   1 
ATOM   7183  O  O   . ILE B 1 449 ? 255.668 242.387 181.465 1.00 91.24  0  449 ILE B O   1 
ATOM   7184  C  CB  . ILE B 1 449 ? 257.106 240.590 179.285 1.00 91.24  0  449 ILE B CB  1 
ATOM   7185  C  CG1 . ILE B 1 449 ? 257.426 239.096 179.191 1.00 91.24  0  449 ILE B CG1 1 
ATOM   7186  C  CG2 . ILE B 1 449 ? 257.768 241.340 178.142 1.00 91.24  0  449 ILE B CG2 1 
ATOM   7187  C  CD1 . ILE B 1 449 ? 256.971 238.452 177.901 1.00 91.24  0  449 ILE B CD1 1 
ATOM   7188  N  N   . SER B 1 450 ? 257.416 243.584 180.684 1.00 96.74  0  450 SER B N   1 
ATOM   7189  C  CA  . SER B 1 450 ? 256.782 244.880 180.882 1.00 96.74  0  450 SER B CA  1 
ATOM   7190  C  C   . SER B 1 450 ? 257.405 245.883 179.921 1.00 96.74  0  450 SER B C   1 
ATOM   7191  O  O   . SER B 1 450 ? 258.255 245.539 179.096 1.00 96.74  0  450 SER B O   1 
ATOM   7192  C  CB  . SER B 1 450 ? 256.915 245.351 182.330 1.00 96.74  0  450 SER B CB  1 
ATOM   7193  O  OG  . SER B 1 450 ? 255.970 246.365 182.625 1.00 96.74  0  450 SER B OG  1 
ATOM   7194  N  N   . LEU B 1 451 ? 256.974 247.139 180.036 1.00 97.35  0  451 LEU B N   1 
ATOM   7195  C  CA  . LEU B 1 451 ? 257.531 248.202 179.209 1.00 97.35  0  451 LEU B CA  1 
ATOM   7196  C  C   . LEU B 1 451 ? 258.823 248.772 179.778 1.00 97.35  0  451 LEU B C   1 
ATOM   7197  O  O   . LEU B 1 451 ? 259.578 249.411 179.038 1.00 97.35  0  451 LEU B O   1 
ATOM   7198  C  CB  . LEU B 1 451 ? 256.506 249.324 179.023 1.00 97.35  0  451 LEU B CB  1 
ATOM   7199  C  CG  . LEU B 1 451 ? 255.650 249.285 177.751 1.00 97.35  0  451 LEU B CG  1 
ATOM   7200  C  CD1 . LEU B 1 451 ? 254.696 248.101 177.737 1.00 97.35  0  451 LEU B CD1 1 
ATOM   7201  C  CD2 . LEU B 1 451 ? 254.885 250.591 177.587 1.00 97.35  0  451 LEU B CD2 1 
ATOM   7202  N  N   . HIS B 1 452 ? 259.091 248.560 181.064 1.00 100.60 0  452 HIS B N   1 
ATOM   7203  C  CA  . HIS B 1 452 ? 260.344 248.998 181.665 1.00 100.60 0  452 HIS B CA  1 
ATOM   7204  C  C   . HIS B 1 452 ? 261.397 247.914 181.484 1.00 100.60 0  452 HIS B C   1 
ATOM   7205  O  O   . HIS B 1 452 ? 261.162 246.769 181.895 1.00 100.60 0  452 HIS B O   1 
ATOM   7206  C  CB  . HIS B 1 452 ? 260.156 249.301 183.141 1.00 100.60 0  452 HIS B CB  1 
ATOM   7207  C  CG  . HIS B 1 452 ? 258.916 250.083 183.446 1.00 100.60 0  452 HIS B CG  1 
ATOM   7208  N  ND1 . HIS B 1 452 ? 258.842 251.451 183.290 1.00 100.60 0  452 HIS B ND1 1 
ATOM   7209  C  CD2 . HIS B 1 452 ? 257.702 249.690 183.898 1.00 100.60 0  452 HIS B CD2 1 
ATOM   7210  C  CE1 . HIS B 1 452 ? 257.636 251.866 183.633 1.00 100.60 0  452 HIS B CE1 1 
ATOM   7211  N  NE2 . HIS B 1 452 ? 256.924 250.817 184.005 1.00 100.60 0  452 HIS B NE2 1 
ATOM   7212  N  N   . PRO B 1 453 ? 262.535 248.209 180.858 1.00 100.77 0  453 PRO B N   1 
ATOM   7213  C  CA  . PRO B 1 453 ? 263.581 247.182 180.661 1.00 100.77 0  453 PRO B CA  1 
ATOM   7214  C  C   . PRO B 1 453 ? 264.212 246.675 181.956 1.00 100.77 0  453 PRO B C   1 
ATOM   7215  O  O   . PRO B 1 453 ? 264.222 245.451 182.154 1.00 100.77 0  453 PRO B O   1 
ATOM   7216  C  CB  . PRO B 1 453 ? 264.605 247.884 179.749 1.00 100.77 0  453 PRO B CB  1 
ATOM   7217  C  CG  . PRO B 1 453 ? 263.808 248.929 179.038 1.00 100.77 0  453 PRO B CG  1 
ATOM   7218  C  CD  . PRO B 1 453 ? 262.769 249.400 180.020 1.00 100.77 0  453 PRO B CD  1 
ATOM   7219  N  N   . PRO B 1 454 ? 264.759 247.510 182.866 1.00 100.28 0  454 PRO B N   1 
ATOM   7220  C  CA  . PRO B 1 454 ? 265.548 246.904 183.953 1.00 100.28 0  454 PRO B CA  1 
ATOM   7221  C  C   . PRO B 1 454 ? 264.719 246.316 185.087 1.00 100.28 0  454 PRO B C   1 
ATOM   7222  O  O   . PRO B 1 454 ? 265.268 245.554 185.895 1.00 100.28 0  454 PRO B O   1 
ATOM   7223  C  CB  . PRO B 1 454 ? 266.402 248.071 184.453 1.00 100.28 0  454 PRO B CB  1 
ATOM   7224  C  CG  . PRO B 1 454 ? 265.516 249.210 184.338 1.00 100.28 0  454 PRO B CG  1 
ATOM   7225  C  CD  . PRO B 1 454 ? 264.658 248.972 183.118 1.00 100.28 0  454 PRO B CD  1 
ATOM   7226  N  N   . ASP B 1 455 ? 263.426 246.637 185.175 1.00 100.79 0  455 ASP B N   1 
ATOM   7227  C  CA  . ASP B 1 455 ? 262.591 246.089 186.238 1.00 100.79 0  455 ASP B CA  1 
ATOM   7228  C  C   . ASP B 1 455 ? 262.056 244.710 185.875 1.00 100.79 0  455 ASP B C   1 
ATOM   7229  O  O   . ASP B 1 455 ? 261.984 243.823 186.733 1.00 100.79 0  455 ASP B O   1 
ATOM   7230  C  CB  . ASP B 1 455 ? 261.438 247.045 186.546 1.00 100.79 0  455 ASP B CB  1 
ATOM   7231  N  N   . ALA B 1 456 ? 261.680 244.512 184.615 1.00 98.66  0  456 ALA B N   1 
ATOM   7232  C  CA  . ALA B 1 456 ? 261.186 243.229 184.148 1.00 98.66  0  456 ALA B CA  1 
ATOM   7233  C  C   . ALA B 1 456 ? 262.331 242.417 183.546 1.00 98.66  0  456 ALA B C   1 
ATOM   7234  O  O   . ALA B 1 456 ? 263.483 242.856 183.501 1.00 98.66  0  456 ALA B O   1 
ATOM   7235  C  CB  . ALA B 1 456 ? 260.058 243.430 183.139 1.00 98.66  0  456 ALA B CB  1 
ATOM   7236  N  N   . GLU B 1 457 ? 262.012 241.208 183.078 1.00 96.42  0  457 GLU B N   1 
ATOM   7237  C  CA  . GLU B 1 457 ? 263.029 240.383 182.435 1.00 96.42  0  457 GLU B CA  1 
ATOM   7238  C  C   . GLU B 1 457 ? 263.351 240.890 181.035 1.00 96.42  0  457 GLU B C   1 
ATOM   7239  O  O   . GLU B 1 457 ? 264.516 240.883 180.621 1.00 96.42  0  457 GLU B O   1 
ATOM   7240  C  CB  . GLU B 1 457 ? 262.573 238.925 182.387 1.00 96.42  0  457 GLU B CB  1 
ATOM   7241  N  N   . GLU B 1 458 ? 262.340 241.348 180.300 1.00 99.22  0  458 GLU B N   1 
ATOM   7242  C  CA  . GLU B 1 458 ? 262.534 241.873 178.955 1.00 99.22  0  458 GLU B CA  1 
ATOM   7243  C  C   . GLU B 1 458 ? 261.367 242.793 178.619 1.00 99.22  0  458 GLU B C   1 
ATOM   7244  O  O   . GLU B 1 458 ? 260.438 242.969 179.412 1.00 99.22  0  458 GLU B O   1 
ATOM   7245  C  CB  . GLU B 1 458 ? 262.658 240.742 177.928 1.00 99.22  0  458 GLU B CB  1 
ATOM   7246  N  N   . ASP B 1 459 ? 261.428 243.384 177.428 1.00 105.71 0  459 ASP B N   1 
ATOM   7247  C  CA  . ASP B 1 459 ? 260.360 244.217 176.893 1.00 105.71 0  459 ASP B CA  1 
ATOM   7248  C  C   . ASP B 1 459 ? 259.932 243.680 175.534 1.00 105.71 0  459 ASP B C   1 
ATOM   7249  O  O   . ASP B 1 459 ? 260.777 243.351 174.694 1.00 105.71 0  459 ASP B O   1 
ATOM   7250  C  CB  . ASP B 1 459 ? 260.787 245.691 176.809 1.00 105.71 0  459 ASP B CB  1 
ATOM   7251  C  CG  . ASP B 1 459 ? 262.130 245.888 176.121 1.00 105.71 0  459 ASP B CG  1 
ATOM   7252  O  OD1 . ASP B 1 459 ? 262.844 244.896 175.870 1.00 105.71 0  459 ASP B OD1 1 
ATOM   7253  O  OD2 . ASP B 1 459 ? 262.473 247.053 175.830 1.00 105.71 -1 459 ASP B OD2 1 
ATOM   7254  N  N   . GLU B 1 460 ? 258.625 243.568 175.329 1.00 108.68 0  460 GLU B N   1 
ATOM   7255  C  CA  . GLU B 1 460 ? 258.075 242.935 174.141 1.00 108.68 0  460 GLU B CA  1 
ATOM   7256  C  C   . GLU B 1 460 ? 257.519 243.981 173.178 1.00 108.68 0  460 GLU B C   1 
ATOM   7257  O  O   . GLU B 1 460 ? 257.486 245.181 173.464 1.00 108.68 0  460 GLU B O   1 
ATOM   7258  C  CB  . GLU B 1 460 ? 256.999 241.920 174.530 1.00 108.68 0  460 GLU B CB  1 
ATOM   7259  N  N   . ASP B 1 461 ? 257.072 243.496 172.024 1.00 110.00 0  461 ASP B N   1 
ATOM   7260  C  CA  . ASP B 1 461 ? 256.592 244.322 170.923 1.00 110.00 0  461 ASP B CA  1 
ATOM   7261  C  C   . ASP B 1 461 ? 255.678 243.451 170.064 1.00 110.00 0  461 ASP B C   1 
ATOM   7262  O  O   . ASP B 1 461 ? 255.193 242.411 170.525 1.00 110.00 0  461 ASP B O   1 
ATOM   7263  C  CB  . ASP B 1 461 ? 257.774 244.915 170.137 1.00 110.00 0  461 ASP B CB  1 
ATOM   7264  N  N   . ASP B 1 462 ? 255.418 243.891 168.826 1.00 113.11 0  462 ASP B N   1 
ATOM   7265  C  CA  . ASP B 1 462 ? 254.665 243.068 167.881 1.00 113.11 0  462 ASP B CA  1 
ATOM   7266  C  C   . ASP B 1 462 ? 255.392 241.766 167.561 1.00 113.11 0  462 ASP B C   1 
ATOM   7267  O  O   . ASP B 1 462 ? 254.748 240.736 167.326 1.00 113.11 0  462 ASP B O   1 
ATOM   7268  C  CB  . ASP B 1 462 ? 254.396 243.854 166.598 1.00 113.11 0  462 ASP B CB  1 
ATOM   7269  N  N   . GLY B 1 463 ? 256.721 241.791 167.548 1.00 113.30 0  463 GLY B N   1 
ATOM   7270  C  CA  . GLY B 1 463 ? 257.532 240.587 167.527 1.00 113.30 0  463 GLY B CA  1 
ATOM   7271  C  C   . GLY B 1 463 ? 258.174 240.382 168.890 1.00 113.30 0  463 GLY B C   1 
ATOM   7272  O  O   . GLY B 1 463 ? 258.698 241.325 169.485 1.00 113.30 0  463 GLY B O   1 
ATOM   7273  N  N   . GLU B 1 464 ? 258.119 239.139 169.374 1.00 112.35 0  464 GLU B N   1 
ATOM   7274  C  CA  . GLU B 1 464 ? 258.613 238.845 170.714 1.00 112.35 0  464 GLU B CA  1 
ATOM   7275  C  C   . GLU B 1 464 ? 260.134 238.827 170.787 1.00 112.35 0  464 GLU B C   1 
ATOM   7276  O  O   . GLU B 1 464 ? 260.690 239.000 171.877 1.00 112.35 0  464 GLU B O   1 
ATOM   7277  C  CB  . GLU B 1 464 ? 258.055 237.509 171.202 1.00 112.35 0  464 GLU B CB  1 
ATOM   7278  N  N   . PHE B 1 465 ? 260.817 238.617 169.664 1.00 107.23 0  465 PHE B N   1 
ATOM   7279  C  CA  . PHE B 1 465 ? 262.277 238.636 169.632 1.00 107.23 0  465 PHE B CA  1 
ATOM   7280  C  C   . PHE B 1 465 ? 262.738 240.086 169.704 1.00 107.23 0  465 PHE B C   1 
ATOM   7281  O  O   . PHE B 1 465 ? 262.721 240.802 168.699 1.00 107.23 0  465 PHE B O   1 
ATOM   7282  C  CB  . PHE B 1 465 ? 262.797 237.948 168.376 1.00 107.23 0  465 PHE B CB  1 
ATOM   7283  N  N   . SER B 1 466 ? 263.147 240.506 170.905 1.00 106.58 0  466 SER B N   1 
ATOM   7284  C  CA  . SER B 1 466 ? 263.615 241.864 171.227 1.00 106.58 0  466 SER B CA  1 
ATOM   7285  C  C   . SER B 1 466 ? 262.617 242.957 170.842 1.00 106.58 0  466 SER B C   1 
ATOM   7286  O  O   . SER B 1 466 ? 262.464 243.950 171.554 1.00 106.58 0  466 SER B O   1 
ATOM   7287  C  CB  . SER B 1 466 ? 264.971 242.141 170.566 1.00 106.58 0  466 SER B CB  1 
ATOM   7288  N  N   . ASP B 1 549 ? 295.709 237.021 225.380 1.00 197.03 0  549 ASP B N   1 
ATOM   7289  C  CA  . ASP B 1 549 ? 295.359 238.236 226.106 1.00 197.03 0  549 ASP B CA  1 
ATOM   7290  C  C   . ASP B 1 549 ? 296.012 239.460 225.471 1.00 197.03 0  549 ASP B C   1 
ATOM   7291  O  O   . ASP B 1 549 ? 295.326 240.348 224.965 1.00 197.03 0  549 ASP B O   1 
ATOM   7292  C  CB  . ASP B 1 549 ? 295.772 238.122 227.575 1.00 197.03 0  549 ASP B CB  1 
ATOM   7293  N  N   . ILE B 1 550 ? 297.345 239.500 225.502 1.00 199.20 0  550 ILE B N   1 
ATOM   7294  C  CA  . ILE B 1 550 ? 298.067 240.627 224.922 1.00 199.20 0  550 ILE B CA  1 
ATOM   7295  C  C   . ILE B 1 550 ? 298.126 240.554 223.403 1.00 199.20 0  550 ILE B C   1 
ATOM   7296  O  O   . ILE B 1 550 ? 298.291 241.591 222.748 1.00 199.20 0  550 ILE B O   1 
ATOM   7297  C  CB  . ILE B 1 550 ? 299.492 240.716 225.493 1.00 199.20 0  550 ILE B CB  1 
ATOM   7298  N  N   . LYS B 1 551 ? 297.992 239.357 222.823 1.00 201.83 0  551 LYS B N   1 
ATOM   7299  C  CA  . LYS B 1 551 ? 298.045 239.224 221.370 1.00 201.83 0  551 LYS B CA  1 
ATOM   7300  C  C   . LYS B 1 551 ? 296.796 239.800 220.713 1.00 201.83 0  551 LYS B C   1 
ATOM   7301  O  O   . LYS B 1 551 ? 296.882 240.432 219.654 1.00 201.83 0  551 LYS B O   1 
ATOM   7302  C  CB  . LYS B 1 551 ? 298.227 237.756 220.983 1.00 201.83 0  551 LYS B CB  1 
ATOM   7303  N  N   . VAL B 1 552 ? 295.632 239.610 221.341 1.00 200.52 0  552 VAL B N   1 
ATOM   7304  C  CA  . VAL B 1 552 ? 294.394 240.172 220.809 1.00 200.52 0  552 VAL B CA  1 
ATOM   7305  C  C   . VAL B 1 552 ? 294.399 241.691 220.931 1.00 200.52 0  552 VAL B C   1 
ATOM   7306  O  O   . VAL B 1 552 ? 293.918 242.400 220.039 1.00 200.52 0  552 VAL B O   1 
ATOM   7307  C  CB  . VAL B 1 552 ? 293.178 239.551 221.519 1.00 200.52 0  552 VAL B CB  1 
ATOM   7308  N  N   . PHE B 1 553 ? 294.968 242.214 222.022 1.00 200.86 0  553 PHE B N   1 
ATOM   7309  C  CA  . PHE B 1 553 ? 295.082 243.661 222.184 1.00 200.86 0  553 PHE B CA  1 
ATOM   7310  C  C   . PHE B 1 553 ? 296.074 244.254 221.191 1.00 200.86 0  553 PHE B C   1 
ATOM   7311  O  O   . PHE B 1 553 ? 295.851 245.351 220.665 1.00 200.86 0  553 PHE B O   1 
ATOM   7312  C  CB  . PHE B 1 553 ? 295.490 243.997 223.618 1.00 200.86 0  553 PHE B CB  1 
ATOM   7313  N  N   . GLN B 1 554 ? 297.163 243.531 220.906 1.00 202.39 0  554 GLN B N   1 
ATOM   7314  C  CA  . GLN B 1 554 ? 298.123 243.989 219.905 1.00 202.39 0  554 GLN B CA  1 
ATOM   7315  C  C   . GLN B 1 554 ? 297.520 243.963 218.505 1.00 202.39 0  554 GLN B C   1 
ATOM   7316  O  O   . GLN B 1 554 ? 297.763 244.873 217.704 1.00 202.39 0  554 GLN B O   1 
ATOM   7317  C  CB  . GLN B 1 554 ? 299.387 243.132 219.962 1.00 202.39 0  554 GLN B CB  1 
ATOM   7318  N  N   . ASN B 1 555 ? 296.709 242.943 218.205 1.00 202.64 0  555 ASN B N   1 
ATOM   7319  C  CA  . ASN B 1 555 ? 296.037 242.880 216.910 1.00 202.64 0  555 ASN B CA  1 
ATOM   7320  C  C   . ASN B 1 555 ? 294.984 243.974 216.777 1.00 202.64 0  555 ASN B C   1 
ATOM   7321  O  O   . ASN B 1 555 ? 294.814 244.548 215.695 1.00 202.64 0  555 ASN B O   1 
ATOM   7322  C  CB  . ASN B 1 555 ? 295.408 241.501 216.713 1.00 202.64 0  555 ASN B CB  1 
ATOM   7323  N  N   . GLU B 1 556 ? 294.285 244.293 217.872 1.00 202.93 0  556 GLU B N   1 
ATOM   7324  C  CA  . GLU B 1 556 ? 293.309 245.378 217.843 1.00 202.93 0  556 GLU B CA  1 
ATOM   7325  C  C   . GLU B 1 556 ? 293.988 246.734 217.687 1.00 202.93 0  556 GLU B C   1 
ATOM   7326  O  O   . GLU B 1 556 ? 293.479 247.609 216.977 1.00 202.93 0  556 GLU B O   1 
ATOM   7327  C  CB  . GLU B 1 556 ? 292.454 245.349 219.110 1.00 202.93 0  556 GLU B CB  1 
ATOM   7328  N  N   . VAL B 1 557 ? 295.151 246.916 218.321 1.00 204.96 0  557 VAL B N   1 
ATOM   7329  C  CA  . VAL B 1 557 ? 295.896 248.164 218.176 1.00 204.96 0  557 VAL B CA  1 
ATOM   7330  C  C   . VAL B 1 557 ? 296.456 248.297 216.764 1.00 204.96 0  557 VAL B C   1 
ATOM   7331  O  O   . VAL B 1 557 ? 296.477 249.394 216.194 1.00 204.96 0  557 VAL B O   1 
ATOM   7332  C  CB  . VAL B 1 557 ? 297.009 248.247 219.237 1.00 204.96 0  557 VAL B CB  1 
ATOM   7333  N  N   . LEU B 1 558 ? 296.890 247.180 216.170 1.00 206.17 0  558 LEU B N   1 
ATOM   7334  C  CA  . LEU B 1 558 ? 297.378 247.208 214.794 1.00 206.17 0  558 LEU B CA  1 
ATOM   7335  C  C   . LEU B 1 558 ? 296.249 247.489 213.809 1.00 206.17 0  558 LEU B C   1 
ATOM   7336  O  O   . LEU B 1 558 ? 296.440 248.225 212.834 1.00 206.17 0  558 LEU B O   1 
ATOM   7337  C  CB  . LEU B 1 558 ? 298.071 245.888 214.456 1.00 206.17 0  558 LEU B CB  1 
ATOM   7338  N  N   . GLY B 1 559 ? 295.062 246.929 214.059 1.00 206.31 0  559 GLY B N   1 
ATOM   7339  C  CA  . GLY B 1 559 ? 293.917 247.228 213.214 1.00 206.31 0  559 GLY B CA  1 
ATOM   7340  C  C   . GLY B 1 559 ? 293.449 248.666 213.345 1.00 206.31 0  559 GLY B C   1 
ATOM   7341  O  O   . GLY B 1 559 ? 293.054 249.290 212.356 1.00 206.31 0  559 GLY B O   1 
ATOM   7342  N  N   . THR B 1 560 ? 293.513 249.220 214.561 1.00 206.75 0  560 THR B N   1 
ATOM   7343  C  CA  . THR B 1 560 ? 293.160 250.622 214.760 1.00 206.75 0  560 THR B CA  1 
ATOM   7344  C  C   . THR B 1 560 ? 294.174 251.549 214.100 1.00 206.75 0  560 THR B C   1 
ATOM   7345  O  O   . THR B 1 560 ? 293.798 252.580 213.529 1.00 206.75 0  560 THR B O   1 
ATOM   7346  C  CB  . THR B 1 560 ? 293.047 250.931 216.253 1.00 206.75 0  560 THR B CB  1 
ATOM   7347  N  N   . LEU B 1 561 ? 295.460 251.185 214.142 1.00 209.79 0  561 LEU B N   1 
ATOM   7348  C  CA  . LEU B 1 561 ? 296.481 251.980 213.467 1.00 209.79 0  561 LEU B CA  1 
ATOM   7349  C  C   . LEU B 1 561 ? 296.338 251.897 211.951 1.00 209.79 0  561 LEU B C   1 
ATOM   7350  O  O   . LEU B 1 561 ? 296.533 252.896 211.249 1.00 209.79 0  561 LEU B O   1 
ATOM   7351  C  CB  . LEU B 1 561 ? 297.874 251.524 213.901 1.00 209.79 0  561 LEU B CB  1 
ATOM   7352  N  N   . GLN B 1 562 ? 295.970 250.720 211.432 1.00 208.74 0  562 GLN B N   1 
ATOM   7353  C  CA  . GLN B 1 562 ? 295.740 250.574 209.998 1.00 208.74 0  562 GLN B CA  1 
ATOM   7354  C  C   . GLN B 1 562 ? 294.510 251.356 209.550 1.00 208.74 0  562 GLN B C   1 
ATOM   7355  O  O   . GLN B 1 562 ? 294.514 251.959 208.471 1.00 208.74 0  562 GLN B O   1 
ATOM   7356  C  CB  . GLN B 1 562 ? 295.597 249.096 209.637 1.00 208.74 0  562 GLN B CB  1 
ATOM   7357  N  N   . LYS B 1 563 ? 293.458 251.376 210.376 1.00 209.48 0  563 LYS B N   1 
ATOM   7358  C  CA  . LYS B 1 563 ? 292.269 252.157 210.046 1.00 209.48 0  563 LYS B CA  1 
ATOM   7359  C  C   . LYS B 1 563 ? 292.549 253.654 210.115 1.00 209.48 0  563 LYS B C   1 
ATOM   7360  O  O   . LYS B 1 563 ? 292.044 254.423 209.287 1.00 209.48 0  563 LYS B O   1 
ATOM   7361  C  CB  . LYS B 1 563 ? 291.120 251.782 210.982 1.00 209.48 0  563 LYS B CB  1 
ATOM   7362  N  N   . GLY B 1 564 ? 293.362 254.085 211.083 1.00 210.97 0  564 GLY B N   1 
ATOM   7363  C  CA  . GLY B 1 564 ? 293.732 255.487 211.162 1.00 210.97 0  564 GLY B CA  1 
ATOM   7364  C  C   . GLY B 1 564 ? 294.670 255.922 210.055 1.00 210.97 0  564 GLY B C   1 
ATOM   7365  O  O   . GLY B 1 564 ? 294.668 257.092 209.661 1.00 210.97 0  564 GLY B O   1 
ATOM   7366  N  N   . LYS B 1 565 ? 295.485 254.998 209.540 1.00 211.11 0  565 LYS B N   1 
ATOM   7367  C  CA  . LYS B 1 565 ? 296.342 255.318 208.406 1.00 211.11 0  565 LYS B CA  1 
ATOM   7368  C  C   . LYS B 1 565 ? 295.580 255.290 207.087 1.00 211.11 0  565 LYS B C   1 
ATOM   7369  O  O   . LYS B 1 565 ? 295.916 256.045 206.167 1.00 211.11 0  565 LYS B O   1 
ATOM   7370  C  CB  . LYS B 1 565 ? 297.524 254.349 208.349 1.00 211.11 0  565 LYS B CB  1 
ATOM   7371  N  N   . GLU B 1 566 ? 294.559 254.437 206.973 1.00 208.24 0  566 GLU B N   1 
ATOM   7372  C  CA  . GLU B 1 566 ? 293.794 254.352 205.734 1.00 208.24 0  566 GLU B CA  1 
ATOM   7373  C  C   . GLU B 1 566 ? 292.778 255.482 205.623 1.00 208.24 0  566 GLU B C   1 
ATOM   7374  O  O   . GLU B 1 566 ? 292.692 256.148 204.585 1.00 208.24 0  566 GLU B O   1 
ATOM   7375  C  CB  . GLU B 1 566 ? 293.097 252.993 205.642 1.00 208.24 0  566 GLU B CB  1 
ATOM   7376  N  N   . GLU B 1 567 ? 292.001 255.715 206.679 1.00 208.19 0  567 GLU B N   1 
ATOM   7377  C  CA  . GLU B 1 567 ? 290.948 256.722 206.658 1.00 208.19 0  567 GLU B CA  1 
ATOM   7378  C  C   . GLU B 1 567 ? 291.445 258.116 207.015 1.00 208.19 0  567 GLU B C   1 
ATOM   7379  O  O   . GLU B 1 567 ? 290.639 259.055 207.008 1.00 208.19 0  567 GLU B O   1 
ATOM   7380  C  CB  . GLU B 1 567 ? 289.819 256.321 207.613 1.00 208.19 0  567 GLU B CB  1 
ATOM   7381  N  N   . ASN B 1 568 ? 292.743 258.257 207.318 1.00 206.87 0  568 ASN B N   1 
ATOM   7382  C  CA  . ASN B 1 568 ? 293.397 259.515 207.703 1.00 206.87 0  568 ASN B CA  1 
ATOM   7383  C  C   . ASN B 1 568 ? 292.721 260.147 208.924 1.00 206.87 0  568 ASN B C   1 
ATOM   7384  O  O   . ASN B 1 568 ? 292.260 261.290 208.899 1.00 206.87 0  568 ASN B O   1 
ATOM   7385  C  CB  . ASN B 1 568 ? 293.460 260.499 206.526 1.00 206.87 0  568 ASN B CB  1 
ATOM   7386  N  N   . ILE B 1 569 ? 292.669 259.366 210.002 1.00 204.44 0  569 ILE B N   1 
ATOM   7387  C  CA  . ILE B 1 569 ? 292.041 259.823 211.234 1.00 204.44 0  569 ILE B CA  1 
ATOM   7388  C  C   . ILE B 1 569 ? 292.954 260.817 211.945 1.00 204.44 0  569 ILE B C   1 
ATOM   7389  O  O   . ILE B 1 569 ? 294.171 260.843 211.746 1.00 204.44 0  569 ILE B O   1 
ATOM   7390  C  CB  . ILE B 1 569 ? 291.688 258.636 212.148 1.00 204.44 0  569 ILE B CB  1 
ATOM   7391  N  N   . SER B 1 570 ? 292.349 261.648 212.789 1.00 199.40 0  570 SER B N   1 
ATOM   7392  C  CA  . SER B 1 570 ? 293.098 262.647 213.532 1.00 199.40 0  570 SER B CA  1 
ATOM   7393  C  C   . SER B 1 570 ? 293.829 262.003 214.708 1.00 199.40 0  570 SER B C   1 
ATOM   7394  O  O   . SER B 1 570 ? 293.634 260.829 215.035 1.00 199.40 0  570 SER B O   1 
ATOM   7395  C  CB  . SER B 1 570 ? 292.169 263.757 214.022 1.00 199.40 0  570 SER B CB  1 
ATOM   7396  N  N   . CYS B 1 571 ? 294.687 262.796 215.352 1.00 196.66 0  571 CYS B N   1 
ATOM   7397  C  CA  . CYS B 1 571 ? 295.450 262.296 216.490 1.00 196.66 0  571 CYS B CA  1 
ATOM   7398  C  C   . CYS B 1 571 ? 294.598 262.175 217.746 1.00 196.66 0  571 CYS B C   1 
ATOM   7399  O  O   . CYS B 1 571 ? 294.849 261.291 218.573 1.00 196.66 0  571 CYS B O   1 
ATOM   7400  C  CB  . CYS B 1 571 ? 296.650 263.206 216.758 1.00 196.66 0  571 CYS B CB  1 
ATOM   7401  N  N   . ASP B 1 572 ? 293.590 263.039 217.900 1.00 193.62 0  572 ASP B N   1 
ATOM   7402  C  CA  . ASP B 1 572 ? 292.744 262.993 219.089 1.00 193.62 0  572 ASP B CA  1 
ATOM   7403  C  C   . ASP B 1 572 ? 291.840 261.766 219.081 1.00 193.62 0  572 ASP B C   1 
ATOM   7404  O  O   . ASP B 1 572 ? 291.691 261.093 220.108 1.00 193.62 0  572 ASP B O   1 
ATOM   7405  C  CB  . ASP B 1 572 ? 291.913 264.272 219.191 1.00 193.62 0  572 ASP B CB  1 
ATOM   7406  N  N   . ASN B 1 573 ? 291.242 261.451 217.927 1.00 193.28 0  573 ASN B N   1 
ATOM   7407  C  CA  . ASN B 1 573 ? 290.411 260.256 217.821 1.00 193.28 0  573 ASN B CA  1 
ATOM   7408  C  C   . ASN B 1 573 ? 291.242 258.984 217.925 1.00 193.28 0  573 ASN B C   1 
ATOM   7409  O  O   . ASN B 1 573 ? 290.777 257.989 218.494 1.00 193.28 0  573 ASN B O   1 
ATOM   7410  C  CB  . ASN B 1 573 ? 289.629 260.275 216.509 1.00 193.28 0  573 ASN B CB  1 
ATOM   7411  N  N   . LEU B 1 574 ? 292.476 259.007 217.414 1.00 193.86 0  574 LEU B N   1 
ATOM   7412  C  CA  . LEU B 1 574 ? 293.361 257.854 217.548 1.00 193.86 0  574 LEU B CA  1 
ATOM   7413  C  C   . LEU B 1 574 ? 293.792 257.651 218.996 1.00 193.86 0  574 LEU B C   1 
ATOM   7414  O  O   . LEU B 1 574 ? 293.875 256.511 219.468 1.00 193.86 0  574 LEU B O   1 
ATOM   7415  C  CB  . LEU B 1 574 ? 294.581 258.020 216.643 1.00 193.86 0  574 LEU B CB  1 
ATOM   7416  N  N   . VAL B 1 575 ? 294.044 258.745 219.720 1.00 191.84 0  575 VAL B N   1 
ATOM   7417  C  CA  . VAL B 1 575 ? 294.403 258.641 221.132 1.00 191.84 0  575 VAL B CA  1 
ATOM   7418  C  C   . VAL B 1 575 ? 293.210 258.175 221.957 1.00 191.84 0  575 VAL B C   1 
ATOM   7419  O  O   . VAL B 1 575 ? 293.365 257.406 222.915 1.00 191.84 0  575 VAL B O   1 
ATOM   7420  C  CB  . VAL B 1 575 ? 294.956 259.984 221.643 1.00 191.84 0  575 VAL B CB  1 
ATOM   7421  N  N   . LEU B 1 576 ? 292.000 258.607 221.584 1.00 192.03 0  576 LEU B N   1 
ATOM   7422  C  CA  . LEU B 1 576 ? 290.798 258.147 222.274 1.00 192.03 0  576 LEU B CA  1 
ATOM   7423  C  C   . LEU B 1 576 ? 290.540 256.666 222.014 1.00 192.03 0  576 LEU B C   1 
ATOM   7424  O  O   . LEU B 1 576 ? 290.147 255.932 222.928 1.00 192.03 0  576 LEU B O   1 
ATOM   7425  C  CB  . LEU B 1 576 ? 289.594 258.985 221.845 1.00 192.03 0  576 LEU B CB  1 
ATOM   7426  N  N   . GLU B 1 577 ? 290.781 256.206 220.782 1.00 191.38 0  577 GLU B N   1 
ATOM   7427  C  CA  . GLU B 1 577 ? 290.627 254.787 220.476 1.00 191.38 0  577 GLU B CA  1 
ATOM   7428  C  C   . GLU B 1 577 ? 291.694 253.945 221.165 1.00 191.38 0  577 GLU B C   1 
ATOM   7429  O  O   . GLU B 1 577 ? 291.409 252.823 221.598 1.00 191.38 0  577 GLU B O   1 
ATOM   7430  C  CB  . GLU B 1 577 ? 290.670 254.567 218.964 1.00 191.38 0  577 GLU B CB  1 
ATOM   7431  N  N   . ILE B 1 578 ? 292.913 254.478 221.300 1.00 190.78 0  578 ILE B N   1 
ATOM   7432  C  CA  . ILE B 1 578 ? 293.971 253.761 222.006 1.00 190.78 0  578 ILE B CA  1 
ATOM   7433  C  C   . ILE B 1 578 ? 293.661 253.679 223.496 1.00 190.78 0  578 ILE B C   1 
ATOM   7434  O  O   . ILE B 1 578 ? 293.908 252.650 224.137 1.00 190.78 0  578 ILE B O   1 
ATOM   7435  C  CB  . ILE B 1 578 ? 295.333 254.429 221.747 1.00 190.78 0  578 ILE B CB  1 
ATOM   7436  N  N   . ASN B 1 579 ? 293.096 254.749 224.066 1.00 190.48 0  579 ASN B N   1 
ATOM   7437  C  CA  . ASN B 1 579 ? 292.700 254.723 225.471 1.00 190.48 0  579 ASN B CA  1 
ATOM   7438  C  C   . ASN B 1 579 ? 291.525 253.779 225.699 1.00 190.48 0  579 ASN B C   1 
ATOM   7439  O  O   . ASN B 1 579 ? 291.462 253.097 226.729 1.00 190.48 0  579 ASN B O   1 
ATOM   7440  C  CB  . ASN B 1 579 ? 292.355 256.135 225.945 1.00 190.48 0  579 ASN B CB  1 
ATOM   7441  N  N   . SER B 1 580 ? 290.599 253.708 224.737 1.00 189.60 0  580 SER B N   1 
ATOM   7442  C  CA  . SER B 1 580 ? 289.485 252.769 224.837 1.00 189.60 0  580 SER B CA  1 
ATOM   7443  C  C   . SER B 1 580 ? 289.963 251.324 224.733 1.00 189.60 0  580 SER B C   1 
ATOM   7444  O  O   . SER B 1 580 ? 289.469 250.450 225.453 1.00 189.60 0  580 SER B O   1 
ATOM   7445  C  CB  . SER B 1 580 ? 288.447 253.070 223.757 1.00 189.60 0  580 SER B CB  1 
ATOM   7446  N  N   . LEU B 1 581 ? 290.940 251.061 223.859 1.00 190.99 0  581 LEU B N   1 
ATOM   7447  C  CA  . LEU B 1 581 ? 291.500 249.717 223.751 1.00 190.99 0  581 LEU B CA  1 
ATOM   7448  C  C   . LEU B 1 581 ? 292.304 249.343 224.992 1.00 190.99 0  581 LEU B C   1 
ATOM   7449  O  O   . LEU B 1 581 ? 292.295 248.181 225.416 1.00 190.99 0  581 LEU B O   1 
ATOM   7450  C  CB  . LEU B 1 581 ? 292.368 249.611 222.497 1.00 190.99 0  581 LEU B CB  1 
ATOM   7451  N  N   . LYS B 1 582 ? 292.996 250.316 225.595 1.00 192.34 0  582 LYS B N   1 
ATOM   7452  C  CA  . LYS B 1 582 ? 293.729 250.050 226.829 1.00 192.34 0  582 LYS B CA  1 
ATOM   7453  C  C   . LYS B 1 582 ? 292.790 249.829 228.008 1.00 192.34 0  582 LYS B C   1 
ATOM   7454  O  O   . LYS B 1 582 ? 293.109 249.053 228.915 1.00 192.34 0  582 LYS B O   1 
ATOM   7455  C  CB  . LYS B 1 582 ? 294.692 251.199 227.126 1.00 192.34 0  582 LYS B CB  1 
ATOM   7456  N  N   . TYR B 1 583 ? 291.636 250.500 228.015 1.00 190.98 0  583 TYR B N   1 
ATOM   7457  C  CA  . TYR B 1 583 ? 290.651 250.257 229.063 1.00 190.98 0  583 TYR B CA  1 
ATOM   7458  C  C   . TYR B 1 583 ? 289.930 248.931 228.856 1.00 190.98 0  583 TYR B C   1 
ATOM   7459  O  O   . TYR B 1 583 ? 289.561 248.270 229.834 1.00 190.98 0  583 TYR B O   1 
ATOM   7460  C  CB  . TYR B 1 583 ? 289.645 251.407 229.117 1.00 190.98 0  583 TYR B CB  1 
ATOM   7461  N  N   . ALA B 1 584 ? 289.727 248.525 227.601 1.00 192.10 0  584 ALA B N   1 
ATOM   7462  C  CA  . ALA B 1 584 ? 289.051 247.260 227.330 1.00 192.10 0  584 ALA B CA  1 
ATOM   7463  C  C   . ALA B 1 584 ? 289.960 246.071 227.614 1.00 192.10 0  584 ALA B C   1 
ATOM   7464  O  O   . ALA B 1 584 ? 289.519 245.072 228.195 1.00 192.10 0  584 ALA B O   1 
ATOM   7465  C  CB  . ALA B 1 584 ? 288.560 247.228 225.884 1.00 192.10 0  584 ALA B CB  1 
ATOM   7466  N  N   . TYR B 1 585 ? 291.230 246.155 227.213 1.00 196.68 0  585 TYR B N   1 
ATOM   7467  C  CA  . TYR B 1 585 ? 292.161 245.059 227.452 1.00 196.68 0  585 TYR B CA  1 
ATOM   7468  C  C   . TYR B 1 585 ? 292.653 245.006 228.892 1.00 196.68 0  585 TYR B C   1 
ATOM   7469  O  O   . TYR B 1 585 ? 293.173 243.962 229.306 1.00 196.68 0  585 TYR B O   1 
ATOM   7470  C  CB  . TYR B 1 585 ? 293.358 245.171 226.505 1.00 196.68 0  585 TYR B CB  1 
ATOM   7471  N  N   . ASN B 1 586 ? 292.500 246.107 229.642 1.00 198.39 0  586 ASN B N   1 
ATOM   7472  C  CA  . ASN B 1 586 ? 292.914 246.243 231.047 1.00 198.39 0  586 ASN B CA  1 
ATOM   7473  C  C   . ASN B 1 586 ? 294.404 245.964 231.247 1.00 198.39 0  586 ASN B C   1 
ATOM   7474  O  O   . ASN B 1 586 ? 294.814 245.431 232.281 1.00 198.39 0  586 ASN B O   1 
ATOM   7475  C  CB  . ASN B 1 586 ? 292.073 245.359 231.976 1.00 198.39 0  586 ASN B CB  1 
ATOM   7476  N  N   . ILE B 1 587 ? 295.223 246.322 230.260 1.00 205.70 0  587 ILE B N   1 
ATOM   7477  C  CA  . ILE B 1 587 ? 296.666 246.130 230.339 1.00 205.70 0  587 ILE B CA  1 
ATOM   7478  C  C   . ILE B 1 587 ? 297.287 247.295 231.097 1.00 205.70 0  587 ILE B C   1 
ATOM   7479  O  O   . ILE B 1 587 ? 296.635 248.319 231.328 1.00 205.70 0  587 ILE B O   1 
ATOM   7480  C  CB  . ILE B 1 587 ? 297.288 245.987 228.938 1.00 205.70 0  587 ILE B CB  1 
ATOM   7481  N  N   . SER B 1 588 ? 298.550 247.146 231.489 1.00 215.89 0  588 SER B N   1 
ATOM   7482  C  CA  . SER B 1 588 ? 299.271 248.217 232.155 1.00 215.89 0  588 SER B CA  1 
ATOM   7483  C  C   . SER B 1 588 ? 299.685 249.289 231.147 1.00 215.89 0  588 SER B C   1 
ATOM   7484  O  O   . SER B 1 588 ? 299.547 249.128 229.932 1.00 215.89 0  588 SER B O   1 
ATOM   7485  C  CB  . SER B 1 588 ? 300.495 247.666 232.884 1.00 215.89 0  588 SER B CB  1 
ATOM   7486  N  N   . LEU B 1 589 ? 300.204 250.401 231.673 1.00 221.98 0  589 LEU B N   1 
ATOM   7487  C  CA  . LEU B 1 589 ? 300.609 251.509 230.813 1.00 221.98 0  589 LEU B CA  1 
ATOM   7488  C  C   . LEU B 1 589 ? 301.887 251.183 230.049 1.00 221.98 0  589 LEU B C   1 
ATOM   7489  O  O   . LEU B 1 589 ? 301.997 251.486 228.854 1.00 221.98 0  589 LEU B O   1 
ATOM   7490  C  CB  . LEU B 1 589 ? 300.789 252.779 231.643 1.00 221.98 0  589 LEU B CB  1 
ATOM   7491  N  N   . LYS B 1 590 ? 302.863 250.566 230.723 1.00 226.75 0  590 LYS B N   1 
ATOM   7492  C  CA  . LYS B 1 590 ? 304.104 250.181 230.057 1.00 226.75 0  590 LYS B CA  1 
ATOM   7493  C  C   . LYS B 1 590 ? 303.871 249.056 229.056 1.00 226.75 0  590 LYS B C   1 
ATOM   7494  O  O   . LYS B 1 590 ? 304.501 249.027 227.992 1.00 226.75 0  590 LYS B O   1 
ATOM   7495  C  CB  . LYS B 1 590 ? 305.149 249.771 231.093 1.00 226.75 0  590 LYS B CB  1 
ATOM   7496  N  N   . GLU B 1 591 ? 302.953 248.136 229.368 1.00 227.33 0  591 GLU B N   1 
ATOM   7497  C  CA  . GLU B 1 591 ? 302.621 247.068 228.429 1.00 227.33 0  591 GLU B CA  1 
ATOM   7498  C  C   . GLU B 1 591 ? 301.892 247.612 227.206 1.00 227.33 0  591 GLU B C   1 
ATOM   7499  O  O   . GLU B 1 591 ? 302.129 247.153 226.082 1.00 227.33 0  591 GLU B O   1 
ATOM   7500  C  CB  . GLU B 1 591 ? 301.779 246.000 229.127 1.00 227.33 0  591 GLU B CB  1 
ATOM   7501  N  N   . VAL B 1 592 ? 301.025 248.610 227.400 1.00 229.16 0  592 VAL B N   1 
ATOM   7502  C  CA  . VAL B 1 592 ? 300.333 249.228 226.272 1.00 229.16 0  592 VAL B CA  1 
ATOM   7503  C  C   . VAL B 1 592 ? 301.306 250.038 225.424 1.00 229.16 0  592 VAL B C   1 
ATOM   7504  O  O   . VAL B 1 592 ? 301.193 250.073 224.193 1.00 229.16 0  592 VAL B O   1 
ATOM   7505  C  CB  . VAL B 1 592 ? 299.161 250.094 226.769 1.00 229.16 0  592 VAL B CB  1 
ATOM   7506  N  N   . MET B 1 593 ? 302.290 250.680 226.064 1.00 230.68 0  593 MET B N   1 
ATOM   7507  C  CA  . MET B 1 593 ? 303.312 251.411 225.319 1.00 230.68 0  593 MET B CA  1 
ATOM   7508  C  C   . MET B 1 593 ? 304.206 250.463 224.526 1.00 230.68 0  593 MET B C   1 
ATOM   7509  O  O   . MET B 1 593 ? 304.577 250.762 223.384 1.00 230.68 0  593 MET B O   1 
ATOM   7510  C  CB  . MET B 1 593 ? 304.146 252.265 226.272 1.00 230.68 0  593 MET B CB  1 
ATOM   7511  N  N   . GLN B 1 594 ? 304.543 249.308 225.109 1.00 233.10 0  594 GLN B N   1 
ATOM   7512  C  CA  . GLN B 1 594 ? 305.334 248.310 224.393 1.00 233.10 0  594 GLN B CA  1 
ATOM   7513  C  C   . GLN B 1 594 ? 304.547 247.701 223.238 1.00 233.10 0  594 GLN B C   1 
ATOM   7514  O  O   . GLN B 1 594 ? 305.113 247.433 222.172 1.00 233.10 0  594 GLN B O   1 
ATOM   7515  C  CB  . GLN B 1 594 ? 305.800 247.220 225.358 1.00 233.10 0  594 GLN B CB  1 
ATOM   7516  N  N   . VAL B 1 595 ? 303.238 247.501 223.421 1.00 234.38 0  595 VAL B N   1 
ATOM   7517  C  CA  . VAL B 1 595 ? 302.403 246.970 222.347 1.00 234.38 0  595 VAL B CA  1 
ATOM   7518  C  C   . VAL B 1 595 ? 302.252 247.993 221.226 1.00 234.38 0  595 VAL B C   1 
ATOM   7519  O  O   . VAL B 1 595 ? 302.243 247.636 220.041 1.00 234.38 0  595 VAL B O   1 
ATOM   7520  C  CB  . VAL B 1 595 ? 301.036 246.530 222.901 1.00 234.38 0  595 VAL B CB  1 
ATOM   7521  N  N   . LEU B 1 596 ? 302.156 249.280 221.577 1.00 236.12 0  596 LEU B N   1 
ATOM   7522  C  CA  . LEU B 1 596 ? 302.072 250.327 220.563 1.00 236.12 0  596 LEU B CA  1 
ATOM   7523  C  C   . LEU B 1 596 ? 303.386 250.470 219.802 1.00 236.12 0  596 LEU B C   1 
ATOM   7524  O  O   . LEU B 1 596 ? 303.381 250.678 218.583 1.00 236.12 0  596 LEU B O   1 
ATOM   7525  C  CB  . LEU B 1 596 ? 301.680 251.655 221.211 1.00 236.12 0  596 LEU B CB  1 
ATOM   7526  N  N   . SER B 1 597 ? 304.518 250.339 220.502 1.00 237.75 0  597 SER B N   1 
ATOM   7527  C  CA  . SER B 1 597 ? 305.817 250.376 219.835 1.00 237.75 0  597 SER B CA  1 
ATOM   7528  C  C   . SER B 1 597 ? 306.014 249.161 218.935 1.00 237.75 0  597 SER B C   1 
ATOM   7529  O  O   . SER B 1 597 ? 306.581 249.279 217.842 1.00 237.75 0  597 SER B O   1 
ATOM   7530  C  CB  . SER B 1 597 ? 306.936 250.465 220.872 1.00 237.75 0  597 SER B CB  1 
ATOM   7531  N  N   . HIS B 1 598 ? 305.527 247.992 219.365 1.00 237.19 0  598 HIS B N   1 
ATOM   7532  C  CA  . HIS B 1 598 ? 305.614 246.796 218.534 1.00 237.19 0  598 HIS B CA  1 
ATOM   7533  C  C   . HIS B 1 598 ? 304.718 246.906 217.306 1.00 237.19 0  598 HIS B C   1 
ATOM   7534  O  O   . HIS B 1 598 ? 305.092 246.450 216.220 1.00 237.19 0  598 HIS B O   1 
ATOM   7535  C  CB  . HIS B 1 598 ? 305.251 245.559 219.355 1.00 237.19 0  598 HIS B CB  1 
ATOM   7536  N  N   . VAL B 1 599 ? 303.546 247.531 217.451 1.00 237.80 0  599 VAL B N   1 
ATOM   7537  C  CA  . VAL B 1 599 ? 302.659 247.727 216.307 1.00 237.80 0  599 VAL B CA  1 
ATOM   7538  C  C   . VAL B 1 599 ? 303.249 248.744 215.336 1.00 237.80 0  599 VAL B C   1 
ATOM   7539  O  O   . VAL B 1 599 ? 303.139 248.589 214.112 1.00 237.80 0  599 VAL B O   1 
ATOM   7540  C  CB  . VAL B 1 599 ? 301.257 248.148 216.785 1.00 237.80 0  599 VAL B CB  1 
ATOM   7541  N  N   . VAL B 1 600 ? 303.899 249.788 215.861 1.00 239.04 0  600 VAL B N   1 
ATOM   7542  C  CA  . VAL B 1 600 ? 304.525 250.788 215.002 1.00 239.04 0  600 VAL B CA  1 
ATOM   7543  C  C   . VAL B 1 600 ? 305.750 250.215 214.300 1.00 239.04 0  600 VAL B C   1 
ATOM   7544  O  O   . VAL B 1 600 ? 306.074 250.616 213.176 1.00 239.04 0  600 VAL B O   1 
ATOM   7545  C  CB  . VAL B 1 600 ? 304.883 252.044 215.818 1.00 239.04 0  600 VAL B CB  1 
ATOM   7546  N  N   . LEU B 1 601 ? 306.448 249.273 214.939 1.00 241.32 0  601 LEU B N   1 
ATOM   7547  C  CA  . LEU B 1 601 ? 307.564 248.607 214.277 1.00 241.32 0  601 LEU B CA  1 
ATOM   7548  C  C   . LEU B 1 601 ? 307.091 247.559 213.277 1.00 241.32 0  601 LEU B C   1 
ATOM   7549  O  O   . LEU B 1 601 ? 307.782 247.301 212.285 1.00 241.32 0  601 LEU B O   1 
ATOM   7550  C  CB  . LEU B 1 601 ? 308.483 247.964 215.315 1.00 241.32 0  601 LEU B CB  1 
ATOM   7551  N  N   . GLU B 1 602 ? 305.928 246.950 213.514 1.00 244.75 0  602 GLU B N   1 
ATOM   7552  C  CA  . GLU B 1 602 ? 305.415 245.933 212.608 1.00 244.75 0  602 GLU B CA  1 
ATOM   7553  C  C   . GLU B 1 602 ? 304.710 246.532 211.400 1.00 244.75 0  602 GLU B C   1 
ATOM   7554  O  O   . GLU B 1 602 ? 304.621 245.864 210.364 1.00 244.75 0  602 GLU B O   1 
ATOM   7555  C  CB  . GLU B 1 602 ? 304.459 244.997 213.351 1.00 244.75 0  602 GLU B CB  1 
ATOM   7556  N  N   . PHE B 1 603 ? 304.190 247.762 211.519 1.00 248.15 0  603 PHE B N   1 
ATOM   7557  C  CA  . PHE B 1 603 ? 303.584 248.418 210.360 1.00 248.15 0  603 PHE B CA  1 
ATOM   7558  C  C   . PHE B 1 603 ? 304.628 248.748 209.304 1.00 248.15 0  603 PHE B C   1 
ATOM   7559  O  O   . PHE B 1 603 ? 304.378 248.497 208.111 1.00 248.15 0  603 PHE B O   1 
ATOM   7560  C  CB  . PHE B 1 603 ? 302.816 249.664 210.809 1.00 248.15 0  603 PHE B CB  1 
ATOM   7561  N  N   . PRO B 1 604 ? 305.797 249.297 209.651 1.00 251.31 0  604 PRO B N   1 
ATOM   7562  C  CA  . PRO B 1 604 ? 306.862 249.451 208.648 1.00 251.31 0  604 PRO B CA  1 
ATOM   7563  C  C   . PRO B 1 604 ? 307.467 248.132 208.203 1.00 251.31 0  604 PRO B C   1 
ATOM   7564  O  O   . PRO B 1 604 ? 308.036 248.070 207.106 1.00 251.31 0  604 PRO B O   1 
ATOM   7565  C  CB  . PRO B 1 604 ? 307.897 250.328 209.365 1.00 251.31 0  604 PRO B CB  1 
ATOM   7566  N  N   . LEU B 1 605 ? 307.365 247.077 209.015 1.00 250.33 0  605 LEU B N   1 
ATOM   7567  C  CA  . LEU B 1 605 ? 307.805 245.757 208.580 1.00 250.33 0  605 LEU B CA  1 
ATOM   7568  C  C   . LEU B 1 605 ? 306.781 245.084 207.675 1.00 250.33 0  605 LEU B C   1 
ATOM   7569  O  O   . LEU B 1 605 ? 307.153 244.236 206.856 1.00 250.33 0  605 LEU B O   1 
ATOM   7570  C  CB  . LEU B 1 605 ? 308.094 244.873 209.794 1.00 250.33 0  605 LEU B CB  1 
ATOM   7571  N  N   . GLN B 1 606 ? 305.502 245.434 207.805 1.00 251.97 0  606 GLN B N   1 
ATOM   7572  C  CA  . GLN B 1 606 ? 304.475 244.915 206.911 1.00 251.97 0  606 GLN B CA  1 
ATOM   7573  C  C   . GLN B 1 606 ? 304.267 245.791 205.683 1.00 251.97 0  606 GLN B C   1 
ATOM   7574  O  O   . GLN B 1 606 ? 303.561 245.374 204.758 1.00 251.97 0  606 GLN B O   1 
ATOM   7575  C  CB  . GLN B 1 606 ? 303.143 244.759 207.653 1.00 251.97 0  606 GLN B CB  1 
ATOM   7576  N  N   . GLN B 1 607 ? 304.852 246.992 205.659 1.00 254.95 0  607 GLN B N   1 
ATOM   7577  C  CA  . GLN B 1 607 ? 304.790 247.827 204.463 1.00 254.95 0  607 GLN B CA  1 
ATOM   7578  C  C   . GLN B 1 607 ? 305.609 247.238 203.321 1.00 254.95 0  607 GLN B C   1 
ATOM   7579  O  O   . GLN B 1 607 ? 305.287 247.462 202.149 1.00 254.95 0  607 GLN B O   1 
ATOM   7580  C  CB  . GLN B 1 607 ? 305.269 249.243 204.785 1.00 254.95 0  607 GLN B CB  1 
ATOM   7581  N  N   . MET B 1 608 ? 306.662 246.490 203.639 1.00 258.00 0  608 MET B N   1 
ATOM   7582  C  CA  . MET B 1 608 ? 307.465 245.781 202.653 1.00 258.00 0  608 MET B CA  1 
ATOM   7583  C  C   . MET B 1 608 ? 307.268 244.283 202.838 1.00 258.00 0  608 MET B C   1 
ATOM   7584  O  O   . MET B 1 608 ? 307.312 243.783 203.967 1.00 258.00 0  608 MET B O   1 
ATOM   7585  C  CB  . MET B 1 608 ? 308.946 246.144 202.785 1.00 258.00 0  608 MET B CB  1 
ATOM   7586  N  N   . ASP B 1 609 ? 307.045 243.574 201.730 1.00 260.42 0  609 ASP B N   1 
ATOM   7587  C  CA  . ASP B 1 609 ? 306.778 242.140 201.805 1.00 260.42 0  609 ASP B CA  1 
ATOM   7588  C  C   . ASP B 1 609 ? 308.048 241.359 202.124 1.00 260.42 0  609 ASP B C   1 
ATOM   7589  O  O   . ASP B 1 609 ? 308.135 240.684 203.157 1.00 260.42 0  609 ASP B O   1 
ATOM   7590  C  CB  . ASP B 1 609 ? 306.159 241.656 200.492 1.00 260.42 0  609 ASP B CB  1 
ATOM   7591  N  N   . SER B 1 610 ? 309.046 241.439 201.249 1.00 260.94 0  610 SER B N   1 
ATOM   7592  C  CA  . SER B 1 610 ? 310.307 240.746 201.480 1.00 260.94 0  610 SER B CA  1 
ATOM   7593  C  C   . SER B 1 610 ? 311.463 241.543 200.891 1.00 260.94 0  610 SER B C   1 
ATOM   7594  O  O   . SER B 1 610 ? 312.266 240.999 200.122 1.00 260.94 0  610 SER B O   1 
ATOM   7595  C  CB  . SER B 1 610 ? 310.266 239.340 200.878 1.00 260.94 0  610 SER B CB  1 
ATOM   7596  N  N   . PRO B 1 611 ? 311.583 242.830 201.222 1.00 262.03 0  611 PRO B N   1 
ATOM   7597  C  CA  . PRO B 1 611 ? 312.698 243.622 200.684 1.00 262.03 0  611 PRO B CA  1 
ATOM   7598  C  C   . PRO B 1 611 ? 314.007 243.331 201.398 1.00 262.03 0  611 PRO B C   1 
ATOM   7599  O  O   . PRO B 1 611 ? 315.068 243.310 200.762 1.00 262.03 0  611 PRO B O   1 
ATOM   7600  C  CB  . PRO B 1 611 ? 312.241 245.069 200.910 1.00 262.03 0  611 PRO B CB  1 
ATOM   7601  N  N   . LEU B 1 612 ? 313.917 243.100 202.717 1.00 262.92 0  612 LEU B N   1 
ATOM   7602  C  CA  . LEU B 1 612 ? 315.059 242.829 203.605 1.00 262.92 0  612 LEU B CA  1 
ATOM   7603  C  C   . LEU B 1 612 ? 316.113 243.934 203.536 1.00 262.92 0  612 LEU B C   1 
ATOM   7604  O  O   . LEU B 1 612 ? 317.317 243.671 203.538 1.00 262.92 0  612 LEU B O   1 
ATOM   7605  C  CB  . LEU B 1 612 ? 315.683 241.459 203.317 1.00 262.92 0  612 LEU B CB  1 
ATOM   7606  N  N   . ASP B 1 613 ? 315.655 245.182 203.477 1.00 262.00 0  613 ASP B N   1 
ATOM   7607  C  CA  . ASP B 1 613 ? 316.538 246.331 203.358 1.00 262.00 0  613 ASP B CA  1 
ATOM   7608  C  C   . ASP B 1 613 ? 316.168 247.372 204.405 1.00 262.00 0  613 ASP B C   1 
ATOM   7609  O  O   . ASP B 1 613 ? 315.071 247.358 204.969 1.00 262.00 0  613 ASP B O   1 
ATOM   7610  C  CB  . ASP B 1 613 ? 316.470 246.951 201.955 1.00 262.00 0  613 ASP B CB  1 
ATOM   7611  N  N   . SER B 1 614 ? 317.107 248.283 204.658 1.00 261.22 0  614 SER B N   1 
ATOM   7612  C  CA  . SER B 1 614 ? 316.908 249.332 205.648 1.00 261.22 0  614 SER B CA  1 
ATOM   7613  C  C   . SER B 1 614 ? 316.282 250.592 205.068 1.00 261.22 0  614 SER B C   1 
ATOM   7614  O  O   . SER B 1 614 ? 315.683 251.368 205.821 1.00 261.22 0  614 SER B O   1 
ATOM   7615  C  CB  . SER B 1 614 ? 318.243 249.692 206.308 1.00 261.22 0  614 SER B CB  1 
ATOM   7616  N  N   . SER B 1 615 ? 316.391 250.801 203.753 1.00 261.28 0  615 SER B N   1 
ATOM   7617  C  CA  . SER B 1 615 ? 315.893 252.032 203.142 1.00 261.28 0  615 SER B CA  1 
ATOM   7618  C  C   . SER B 1 615 ? 314.369 252.063 203.119 1.00 261.28 0  615 SER B C   1 
ATOM   7619  O  O   . SER B 1 615 ? 313.755 253.074 203.481 1.00 261.28 0  615 SER B O   1 
ATOM   7620  C  CB  . SER B 1 615 ? 316.458 252.179 201.729 1.00 261.28 0  615 SER B CB  1 
ATOM   7621  N  N   . ARG B 1 616 ? 313.743 250.956 202.705 1.00 260.96 0  616 ARG B N   1 
ATOM   7622  C  CA  . ARG B 1 616 ? 312.285 250.895 202.657 1.00 260.96 0  616 ARG B CA  1 
ATOM   7623  C  C   . ARG B 1 616 ? 311.685 250.895 204.058 1.00 260.96 0  616 ARG B C   1 
ATOM   7624  O  O   . ARG B 1 616 ? 310.639 251.514 204.290 1.00 260.96 0  616 ARG B O   1 
ATOM   7625  C  CB  . ARG B 1 616 ? 311.836 249.658 201.880 1.00 260.96 0  616 ARG B CB  1 
ATOM   7626  N  N   . TYR B 1 617 ? 312.348 250.228 205.007 1.00 260.19 0  617 TYR B N   1 
ATOM   7627  C  CA  . TYR B 1 617 ? 311.880 250.230 206.390 1.00 260.19 0  617 TYR B CA  1 
ATOM   7628  C  C   . TYR B 1 617 ? 312.009 251.614 207.017 1.00 260.19 0  617 TYR B C   1 
ATOM   7629  O  O   . TYR B 1 617 ? 311.120 252.047 207.760 1.00 260.19 0  617 TYR B O   1 
ATOM   7630  C  CB  . TYR B 1 617 ? 312.654 249.196 207.208 1.00 260.19 0  617 TYR B CB  1 
ATOM   7631  N  N   . CYS B 1 618 ? 313.091 252.335 206.703 1.00 259.78 0  618 CYS B N   1 
ATOM   7632  C  CA  . CYS B 1 618 ? 313.253 253.692 207.216 1.00 259.78 0  618 CYS B CA  1 
ATOM   7633  C  C   . CYS B 1 618 ? 312.249 254.649 206.583 1.00 259.78 0  618 CYS B C   1 
ATOM   7634  O  O   . CYS B 1 618 ? 311.718 255.535 207.263 1.00 259.78 0  618 CYS B O   1 
ATOM   7635  C  CB  . CYS B 1 618 ? 314.682 254.176 206.975 1.00 259.78 0  618 CYS B CB  1 
ATOM   7636  N  N   . ALA B 1 619 ? 311.957 254.472 205.290 1.00 257.86 0  619 ALA B N   1 
ATOM   7637  C  CA  . ALA B 1 619 ? 310.968 255.319 204.630 1.00 257.86 0  619 ALA B CA  1 
ATOM   7638  C  C   . ALA B 1 619 ? 309.554 255.017 205.109 1.00 257.86 0  619 ALA B C   1 
ATOM   7639  O  O   . ALA B 1 619 ? 308.698 255.909 205.106 1.00 257.86 0  619 ALA B O   1 
ATOM   7640  C  CB  . ALA B 1 619 ? 311.062 255.153 203.114 1.00 257.86 0  619 ALA B CB  1 
ATOM   7641  N  N   . LEU B 1 620 ? 309.287 253.776 205.521 1.00 255.36 0  620 LEU B N   1 
ATOM   7642  C  CA  . LEU B 1 620 ? 307.982 253.448 206.081 1.00 255.36 0  620 LEU B CA  1 
ATOM   7643  C  C   . LEU B 1 620 ? 307.857 253.881 207.537 1.00 255.36 0  620 LEU B C   1 
ATOM   7644  O  O   . LEU B 1 620 ? 306.749 254.180 207.995 1.00 255.36 0  620 LEU B O   1 
ATOM   7645  C  CB  . LEU B 1 620 ? 307.718 251.947 205.953 1.00 255.36 0  620 LEU B CB  1 
ATOM   7646  N  N   . LEU B 1 621 ? 308.968 253.919 208.275 1.00 253.05 0  621 LEU B N   1 
ATOM   7647  C  CA  . LEU B 1 621 ? 308.935 254.299 209.681 1.00 253.05 0  621 LEU B CA  1 
ATOM   7648  C  C   . LEU B 1 621 ? 309.053 255.800 209.908 1.00 253.05 0  621 LEU B C   1 
ATOM   7649  O  O   . LEU B 1 621 ? 308.673 256.276 210.983 1.00 253.05 0  621 LEU B O   1 
ATOM   7650  C  CB  . LEU B 1 621 ? 310.056 253.586 210.445 1.00 253.05 0  621 LEU B CB  1 
ATOM   7651  N  N   . LEU B 1 622 ? 309.575 256.556 208.933 1.00 250.88 0  622 LEU B N   1 
ATOM   7652  C  CA  . LEU B 1 622 ? 309.691 258.001 209.122 1.00 250.88 0  622 LEU B CA  1 
ATOM   7653  C  C   . LEU B 1 622 ? 308.341 258.696 209.026 1.00 250.88 0  622 LEU B C   1 
ATOM   7654  O  O   . LEU B 1 622 ? 308.016 259.499 209.920 1.00 250.88 0  622 LEU B O   1 
ATOM   7655  C  CB  . LEU B 1 622 ? 310.693 258.577 208.118 1.00 250.88 0  622 LEU B CB  1 
ATOM   7656  N  N   . PRO B 1 623 ? 307.515 258.450 208.004 1.00 248.16 0  623 PRO B N   1 
ATOM   7657  C  CA  . PRO B 1 623 ? 306.207 259.121 207.954 1.00 248.16 0  623 PRO B CA  1 
ATOM   7658  C  C   . PRO B 1 623 ? 305.221 258.586 208.976 1.00 248.16 0  623 PRO B C   1 
ATOM   7659  O  O   . PRO B 1 623 ? 304.329 259.329 209.404 1.00 248.16 0  623 PRO B O   1 
ATOM   7660  C  CB  . PRO B 1 623 ? 305.733 258.861 206.518 1.00 248.16 0  623 PRO B CB  1 
ATOM   7661  N  N   . LEU B 1 624 ? 305.364 257.322 209.388 1.00 245.75 0  624 LEU B N   1 
ATOM   7662  C  CA  . LEU B 1 624 ? 304.502 256.778 210.432 1.00 245.75 0  624 LEU B CA  1 
ATOM   7663  C  C   . LEU B 1 624 ? 304.803 257.414 211.783 1.00 245.75 0  624 LEU B C   1 
ATOM   7664  O  O   . LEU B 1 624 ? 303.884 257.715 212.551 1.00 245.75 0  624 LEU B O   1 
ATOM   7665  C  CB  . LEU B 1 624 ? 304.660 255.259 210.504 1.00 245.75 0  624 LEU B CB  1 
ATOM   7666  N  N   . LEU B 1 625 ? 306.083 257.632 212.089 1.00 245.67 0  625 LEU B N   1 
ATOM   7667  C  CA  . LEU B 1 625 ? 306.443 258.339 213.311 1.00 245.67 0  625 LEU B CA  1 
ATOM   7668  C  C   . LEU B 1 625 ? 306.200 259.838 213.210 1.00 245.67 0  625 LEU B C   1 
ATOM   7669  O  O   . LEU B 1 625 ? 306.037 260.496 214.242 1.00 245.67 0  625 LEU B O   1 
ATOM   7670  C  CB  . LEU B 1 625 ? 307.910 258.079 213.664 1.00 245.67 0  625 LEU B CB  1 
ATOM   7671  N  N   . LYS B 1 626 ? 306.174 260.390 211.995 1.00 243.31 0  626 LYS B N   1 
ATOM   7672  C  CA  . LYS B 1 626 ? 305.893 261.812 211.835 1.00 243.31 0  626 LYS B CA  1 
ATOM   7673  C  C   . LYS B 1 626 ? 304.405 262.111 211.974 1.00 243.31 0  626 LYS B C   1 
ATOM   7674  O  O   . LYS B 1 626 ? 304.028 263.146 212.535 1.00 243.31 0  626 LYS B O   1 
ATOM   7675  C  CB  . LYS B 1 626 ? 306.410 262.301 210.482 1.00 243.31 0  626 LYS B CB  1 
ATOM   7676  N  N   . ALA B 1 627 ? 303.545 261.221 211.472 1.00 241.12 0  627 ALA B N   1 
ATOM   7677  C  CA  . ALA B 1 627 ? 302.107 261.455 211.551 1.00 241.12 0  627 ALA B CA  1 
ATOM   7678  C  C   . ALA B 1 627 ? 301.543 261.064 212.912 1.00 241.12 0  627 ALA B C   1 
ATOM   7679  O  O   . ALA B 1 627 ? 300.689 261.771 213.458 1.00 241.12 0  627 ALA B O   1 
ATOM   7680  C  CB  . ALA B 1 627 ? 301.389 260.690 210.439 1.00 241.12 0  627 ALA B CB  1 
ATOM   7681  N  N   . TRP B 1 628 ? 302.007 259.947 213.476 1.00 235.34 0  628 TRP B N   1 
ATOM   7682  C  CA  . TRP B 1 628 ? 301.522 259.446 214.757 1.00 235.34 0  628 TRP B CA  1 
ATOM   7683  C  C   . TRP B 1 628 ? 302.404 259.887 215.921 1.00 235.34 0  628 TRP B C   1 
ATOM   7684  O  O   . TRP B 1 628 ? 302.537 259.156 216.909 1.00 235.34 0  628 TRP B O   1 
ATOM   7685  C  CB  . TRP B 1 628 ? 301.411 257.920 214.728 1.00 235.34 0  628 TRP B CB  1 
ATOM   7686  C  CG  . TRP B 1 628 ? 300.495 257.376 213.662 1.00 235.34 0  628 TRP B CG  1 
ATOM   7687  C  CD1 . TRP B 1 628 ? 300.760 257.267 212.325 1.00 235.34 0  628 TRP B CD1 1 
ATOM   7688  C  CD2 . TRP B 1 628 ? 299.174 256.853 213.850 1.00 235.34 0  628 TRP B CD2 1 
ATOM   7689  N  NE1 . TRP B 1 628 ? 299.685 256.718 211.672 1.00 235.34 0  628 TRP B NE1 1 
ATOM   7690  C  CE2 . TRP B 1 628 ? 298.698 256.454 212.585 1.00 235.34 0  628 TRP B CE2 1 
ATOM   7691  C  CE3 . TRP B 1 628 ? 298.346 256.688 214.965 1.00 235.34 0  628 TRP B CE3 1 
ATOM   7692  C  CZ2 . TRP B 1 628 ? 297.432 255.900 212.404 1.00 235.34 0  628 TRP B CZ2 1 
ATOM   7693  C  CZ3 . TRP B 1 628 ? 297.090 256.137 214.783 1.00 235.34 0  628 TRP B CZ3 1 
ATOM   7694  C  CH2 . TRP B 1 628 ? 296.645 255.750 213.512 1.00 235.34 0  628 TRP B CH2 1 
ATOM   7695  N  N   . SER B 1 629 ? 303.021 261.065 215.817 1.00 239.93 0  629 SER B N   1 
ATOM   7696  C  CA  . SER B 1 629 ? 303.910 261.584 216.849 1.00 239.93 0  629 SER B CA  1 
ATOM   7697  C  C   . SER B 1 629 ? 303.117 261.989 218.085 1.00 239.93 0  629 SER B C   1 
ATOM   7698  O  O   . SER B 1 629 ? 303.617 261.864 219.212 1.00 239.93 0  629 SER B O   1 
ATOM   7699  C  CB  . SER B 1 629 ? 304.710 262.776 216.318 1.00 239.93 0  629 SER B CB  1 
ATOM   7700  N  N   . PRO B 1 630 ? 301.880 262.471 217.919 1.00 239.70 0  630 PRO B N   1 
ATOM   7701  C  CA  . PRO B 1 630 ? 301.104 262.873 219.104 1.00 239.70 0  630 PRO B CA  1 
ATOM   7702  C  C   . PRO B 1 630 ? 300.616 261.692 219.923 1.00 239.70 0  630 PRO B C   1 
ATOM   7703  O  O   . PRO B 1 630 ? 300.612 261.764 221.158 1.00 239.70 0  630 PRO B O   1 
ATOM   7704  C  CB  . PRO B 1 630 ? 299.942 263.675 218.503 1.00 239.70 0  630 PRO B CB  1 
ATOM   7705  N  N   . VAL B 1 631 ? 300.223 260.596 219.269 1.00 241.41 0  631 VAL B N   1 
ATOM   7706  C  CA  . VAL B 1 631 ? 299.824 259.396 219.998 1.00 241.41 0  631 VAL B CA  1 
ATOM   7707  C  C   . VAL B 1 631 ? 301.027 258.753 220.677 1.00 241.41 0  631 VAL B C   1 
ATOM   7708  O  O   . VAL B 1 631 ? 300.906 258.204 221.780 1.00 241.41 0  631 VAL B O   1 
ATOM   7709  C  CB  . VAL B 1 631 ? 299.115 258.407 219.056 1.00 241.41 0  631 VAL B CB  1 
ATOM   7710  N  N   . PHE B 1 632 ? 302.203 258.822 220.046 1.00 242.19 0  632 PHE B N   1 
ATOM   7711  C  CA  . PHE B 1 632 ? 303.412 258.299 220.673 1.00 242.19 0  632 PHE B CA  1 
ATOM   7712  C  C   . PHE B 1 632 ? 303.865 259.173 221.835 1.00 242.19 0  632 PHE B C   1 
ATOM   7713  O  O   . PHE B 1 632 ? 304.453 258.665 222.797 1.00 242.19 0  632 PHE B O   1 
ATOM   7714  C  CB  . PHE B 1 632 ? 304.529 258.173 219.637 1.00 242.19 0  632 PHE B CB  1 
ATOM   7715  N  N   . ARG B 1 633 ? 303.604 260.481 221.769 1.00 243.20 0  633 ARG B N   1 
ATOM   7716  C  CA  . ARG B 1 633 ? 303.924 261.355 222.891 1.00 243.20 0  633 ARG B CA  1 
ATOM   7717  C  C   . ARG B 1 633 ? 302.930 261.194 224.034 1.00 243.20 0  633 ARG B C   1 
ATOM   7718  O  O   . ARG B 1 633 ? 303.309 261.328 225.203 1.00 243.20 0  633 ARG B O   1 
ATOM   7719  C  CB  . ARG B 1 633 ? 303.965 262.812 222.430 1.00 243.20 0  633 ARG B CB  1 
ATOM   7720  N  N   . ASN B 1 634 ? 301.663 260.912 223.719 1.00 244.05 0  634 ASN B N   1 
ATOM   7721  C  CA  . ASN B 1 634 ? 300.671 260.688 224.764 1.00 244.05 0  634 ASN B CA  1 
ATOM   7722  C  C   . ASN B 1 634 ? 300.843 259.324 225.420 1.00 244.05 0  634 ASN B C   1 
ATOM   7723  O  O   . ASN B 1 634 ? 300.565 259.174 226.615 1.00 244.05 0  634 ASN B O   1 
ATOM   7724  C  CB  . ASN B 1 634 ? 299.262 260.827 224.191 1.00 244.05 0  634 ASN B CB  1 
ATOM   7725  N  N   . TYR B 1 635 ? 301.293 258.322 224.661 1.00 245.19 0  635 TYR B N   1 
ATOM   7726  C  CA  . TYR B 1 635 ? 301.519 256.998 225.231 1.00 245.19 0  635 TYR B CA  1 
ATOM   7727  C  C   . TYR B 1 635 ? 302.792 256.966 226.070 1.00 245.19 0  635 TYR B C   1 
ATOM   7728  O  O   . TYR B 1 635 ? 302.760 256.585 227.245 1.00 245.19 0  635 TYR B O   1 
ATOM   7729  C  CB  . TYR B 1 635 ? 301.582 255.951 224.118 1.00 245.19 0  635 TYR B CB  1 
ATOM   7730  N  N   . ILE B 1 636 ? 303.918 257.360 225.484 1.00 249.79 0  636 ILE B N   1 
ATOM   7731  C  CA  . ILE B 1 636 ? 305.202 257.395 226.174 1.00 249.79 0  636 ILE B CA  1 
ATOM   7732  C  C   . ILE B 1 636 ? 305.420 258.830 226.640 1.00 249.79 0  636 ILE B C   1 
ATOM   7733  O  O   . ILE B 1 636 ? 305.742 259.715 225.842 1.00 249.79 0  636 ILE B O   1 
ATOM   7734  C  CB  . ILE B 1 636 ? 306.343 256.908 225.277 1.00 249.79 0  636 ILE B CB  1 
ATOM   7735  N  N   . LYS B 1 637 ? 305.245 259.064 227.939 1.00 254.30 0  637 LYS B N   1 
ATOM   7736  C  CA  . LYS B 1 637 ? 305.384 260.395 228.517 1.00 254.30 0  637 LYS B CA  1 
ATOM   7737  C  C   . LYS B 1 637 ? 306.487 260.472 229.559 1.00 254.30 0  637 LYS B C   1 
ATOM   7738  O  O   . LYS B 1 637 ? 307.303 261.401 229.523 1.00 254.30 0  637 LYS B O   1 
ATOM   7739  C  CB  . LYS B 1 637 ? 304.048 260.841 229.135 1.00 254.30 0  637 LYS B CB  1 
ATOM   7740  N  N   . ARG B 1 638 ? 306.539 259.522 230.490 1.00 259.17 0  638 ARG B N   1 
ATOM   7741  C  CA  . ARG B 1 638 ? 307.517 259.559 231.565 1.00 259.17 0  638 ARG B CA  1 
ATOM   7742  C  C   . ARG B 1 638 ? 308.862 259.016 231.085 1.00 259.17 0  638 ARG B C   1 
ATOM   7743  O  O   . ARG B 1 638 ? 309.012 258.551 229.951 1.00 259.17 0  638 ARG B O   1 
ATOM   7744  C  CB  . ARG B 1 638 ? 307.008 258.774 232.771 1.00 259.17 0  638 ARG B CB  1 
ATOM   7745  N  N   . ALA B 1 639 ? 309.862 259.082 231.968 1.00 262.19 0  639 ALA B N   1 
ATOM   7746  C  CA  . ALA B 1 639 ? 311.181 258.550 231.640 1.00 262.19 0  639 ALA B CA  1 
ATOM   7747  C  C   . ALA B 1 639 ? 311.192 257.027 231.649 1.00 262.19 0  639 ALA B C   1 
ATOM   7748  O  O   . ALA B 1 639 ? 311.929 256.410 230.871 1.00 262.19 0  639 ALA B O   1 
ATOM   7749  C  CB  . ALA B 1 639 ? 312.226 259.095 232.613 1.00 262.19 0  639 ALA B CB  1 
ATOM   7750  N  N   . ALA B 1 640 ? 310.389 256.407 232.519 1.00 263.92 0  640 ALA B N   1 
ATOM   7751  C  CA  . ALA B 1 640 ? 310.258 254.953 232.504 1.00 263.92 0  640 ALA B CA  1 
ATOM   7752  C  C   . ALA B 1 640 ? 309.541 254.478 231.247 1.00 263.92 0  640 ALA B C   1 
ATOM   7753  O  O   . ALA B 1 640 ? 309.877 253.424 230.694 1.00 263.92 0  640 ALA B O   1 
ATOM   7754  C  CB  . ALA B 1 640 ? 309.523 254.478 233.756 1.00 263.92 0  640 ALA B CB  1 
ATOM   7755  N  N   . ASP B 1 641 ? 308.564 255.256 230.769 1.00 265.01 0  641 ASP B N   1 
ATOM   7756  C  CA  . ASP B 1 641 ? 307.926 254.949 229.493 1.00 265.01 0  641 ASP B CA  1 
ATOM   7757  C  C   . ASP B 1 641 ? 308.891 255.122 228.327 1.00 265.01 0  641 ASP B C   1 
ATOM   7758  O  O   . ASP B 1 641 ? 308.837 254.352 227.362 1.00 265.01 0  641 ASP B O   1 
ATOM   7759  C  CB  . ASP B 1 641 ? 306.692 255.829 229.297 1.00 265.01 0  641 ASP B CB  1 
ATOM   7760  N  N   . HIS B 1 642 ? 309.798 256.100 228.414 1.00 266.02 0  642 HIS B N   1 
ATOM   7761  C  CA  . HIS B 1 642 ? 310.816 256.267 227.379 1.00 266.02 0  642 HIS B CA  1 
ATOM   7762  C  C   . HIS B 1 642 ? 311.818 255.118 227.398 1.00 266.02 0  642 HIS B C   1 
ATOM   7763  O  O   . HIS B 1 642 ? 312.268 254.663 226.340 1.00 266.02 0  642 HIS B O   1 
ATOM   7764  C  CB  . HIS B 1 642 ? 311.530 257.606 227.557 1.00 266.02 0  642 HIS B CB  1 
ATOM   7765  N  N   . LEU B 1 643 ? 312.159 254.620 228.591 1.00 267.08 0  643 LEU B N   1 
ATOM   7766  C  CA  . LEU B 1 643 ? 313.051 253.468 228.690 1.00 267.08 0  643 LEU B CA  1 
ATOM   7767  C  C   . LEU B 1 643 ? 312.380 252.199 228.177 1.00 267.08 0  643 LEU B C   1 
ATOM   7768  O  O   . LEU B 1 643 ? 313.027 251.366 227.530 1.00 267.08 0  643 LEU B O   1 
ATOM   7769  C  CB  . LEU B 1 643 ? 313.513 253.284 230.136 1.00 267.08 0  643 LEU B CB  1 
ATOM   7770  N  N   . GLU B 1 644 ? 311.078 252.044 228.439 1.00 265.96 0  644 GLU B N   1 
ATOM   7771  C  CA  . GLU B 1 644 ? 310.340 250.903 227.904 1.00 265.96 0  644 GLU B CA  1 
ATOM   7772  C  C   . GLU B 1 644 ? 310.205 250.988 226.388 1.00 265.96 0  644 GLU B C   1 
ATOM   7773  O  O   . GLU B 1 644 ? 310.269 249.965 225.696 1.00 265.96 0  644 GLU B O   1 
ATOM   7774  C  CB  . GLU B 1 644 ? 308.963 250.814 228.562 1.00 265.96 0  644 GLU B CB  1 
ATOM   7775  N  N   . ALA B 1 645 ? 310.047 252.203 225.851 1.00 265.66 0  645 ALA B N   1 
ATOM   7776  C  CA  . ALA B 1 645 ? 309.999 252.378 224.403 1.00 265.66 0  645 ALA B CA  1 
ATOM   7777  C  C   . ALA B 1 645 ? 311.354 252.100 223.764 1.00 265.66 0  645 ALA B C   1 
ATOM   7778  O  O   . ALA B 1 645 ? 311.423 251.532 222.669 1.00 265.66 0  645 ALA B O   1 
ATOM   7779  C  CB  . ALA B 1 645 ? 309.523 253.790 224.061 1.00 265.66 0  645 ALA B CB  1 
ATOM   7780  N  N   . LEU B 1 646 ? 312.443 252.475 224.444 1.00 264.28 0  646 LEU B N   1 
ATOM   7781  C  CA  . LEU B 1 646 ? 313.780 252.163 223.947 1.00 264.28 0  646 LEU B CA  1 
ATOM   7782  C  C   . LEU B 1 646 ? 314.052 250.663 223.985 1.00 264.28 0  646 LEU B C   1 
ATOM   7783  O  O   . LEU B 1 646 ? 314.674 250.117 223.066 1.00 264.28 0  646 LEU B O   1 
ATOM   7784  C  CB  . LEU B 1 646 ? 314.831 252.921 224.757 1.00 264.28 0  646 LEU B CB  1 
ATOM   7785  N  N   . ALA B 1 647 ? 313.578 249.979 225.032 1.00 263.22 0  647 ALA B N   1 
ATOM   7786  C  CA  . ALA B 1 647 ? 313.727 248.527 225.107 1.00 263.22 0  647 ALA B CA  1 
ATOM   7787  C  C   . ALA B 1 647 ? 312.891 247.824 224.042 1.00 263.22 0  647 ALA B C   1 
ATOM   7788  O  O   . ALA B 1 647 ? 313.331 246.825 223.460 1.00 263.22 0  647 ALA B O   1 
ATOM   7789  C  CB  . ALA B 1 647 ? 313.346 248.032 226.501 1.00 263.22 0  647 ALA B CB  1 
ATOM   7790  N  N   . ALA B 1 648 ? 311.693 248.345 223.757 1.00 261.89 0  648 ALA B N   1 
ATOM   7791  C  CA  . ALA B 1 648 ? 310.867 247.776 222.696 1.00 261.89 0  648 ALA B CA  1 
ATOM   7792  C  C   . ALA B 1 648 ? 311.476 248.026 221.321 1.00 261.89 0  648 ALA B C   1 
ATOM   7793  O  O   . ALA B 1 648 ? 311.393 247.166 220.437 1.00 261.89 0  648 ALA B O   1 
ATOM   7794  C  CB  . ALA B 1 648 ? 309.452 248.347 222.769 1.00 261.89 0  648 ALA B CB  1 
ATOM   7795  N  N   . ILE B 1 649 ? 312.114 249.185 221.131 1.00 262.74 0  649 ILE B N   1 
ATOM   7796  C  CA  . ILE B 1 649 ? 312.790 249.468 219.867 1.00 262.74 0  649 ILE B CA  1 
ATOM   7797  C  C   . ILE B 1 649 ? 314.020 248.583 219.705 1.00 262.74 0  649 ILE B C   1 
ATOM   7798  O  O   . ILE B 1 649 ? 314.337 248.138 218.595 1.00 262.74 0  649 ILE B O   1 
ATOM   7799  C  CB  . ILE B 1 649 ? 313.150 250.962 219.779 1.00 262.74 0  649 ILE B CB  1 
ATOM   7800  N  N   . GLU B 1 650 ? 314.717 248.292 220.808 1.00 263.78 0  650 GLU B N   1 
ATOM   7801  C  CA  . GLU B 1 650 ? 315.859 247.383 220.751 1.00 263.78 0  650 GLU B CA  1 
ATOM   7802  C  C   . GLU B 1 650 ? 315.418 245.953 220.458 1.00 263.78 0  650 GLU B C   1 
ATOM   7803  O  O   . GLU B 1 650 ? 316.080 245.239 219.694 1.00 263.78 0  650 GLU B O   1 
ATOM   7804  C  CB  . GLU B 1 650 ? 316.645 247.445 222.060 1.00 263.78 0  650 GLU B CB  1 
ATOM   7805  N  N   . ASP B 1 651 ? 314.291 245.525 221.036 1.00 262.74 0  651 ASP B N   1 
ATOM   7806  C  CA  . ASP B 1 651 ? 313.761 244.196 220.739 1.00 262.74 0  651 ASP B CA  1 
ATOM   7807  C  C   . ASP B 1 651 ? 313.253 244.098 219.305 1.00 262.74 0  651 ASP B C   1 
ATOM   7808  O  O   . ASP B 1 651 ? 313.393 243.045 218.670 1.00 262.74 0  651 ASP B O   1 
ATOM   7809  C  CB  . ASP B 1 651 ? 312.645 243.844 221.722 1.00 262.74 0  651 ASP B CB  1 
ATOM   7810  N  N   . PHE B 1 652 ? 312.681 245.182 218.774 1.00 263.56 0  652 PHE B N   1 
ATOM   7811  C  CA  . PHE B 1 652 ? 312.254 245.189 217.380 1.00 263.56 0  652 PHE B CA  1 
ATOM   7812  C  C   . PHE B 1 652 ? 313.442 245.202 216.427 1.00 263.56 0  652 PHE B C   1 
ATOM   7813  O  O   . PHE B 1 652 ? 313.374 244.602 215.350 1.00 263.56 0  652 PHE B O   1 
ATOM   7814  C  CB  . PHE B 1 652 ? 311.347 246.391 217.115 1.00 263.56 0  652 PHE B CB  1 
ATOM   7815  N  N   . PHE B 1 653 ? 314.533 245.878 216.801 1.00 264.50 0  653 PHE B N   1 
ATOM   7816  C  CA  . PHE B 1 653 ? 315.743 245.839 215.987 1.00 264.50 0  653 PHE B CA  1 
ATOM   7817  C  C   . PHE B 1 653 ? 316.419 244.476 216.057 1.00 264.50 0  653 PHE B C   1 
ATOM   7818  O  O   . PHE B 1 653 ? 317.060 244.054 215.089 1.00 264.50 0  653 PHE B O   1 
ATOM   7819  C  CB  . PHE B 1 653 ? 316.710 246.936 216.429 1.00 264.50 0  653 PHE B CB  1 
ATOM   7820  N  N   . LEU B 1 654 ? 316.295 243.782 217.192 1.00 264.18 0  654 LEU B N   1 
ATOM   7821  C  CA  . LEU B 1 654 ? 316.801 242.417 217.281 1.00 264.18 0  654 LEU B CA  1 
ATOM   7822  C  C   . LEU B 1 654 ? 315.940 241.447 216.482 1.00 264.18 0  654 LEU B C   1 
ATOM   7823  O  O   . LEU B 1 654 ? 316.457 240.462 215.942 1.00 264.18 0  654 LEU B O   1 
ATOM   7824  C  CB  . LEU B 1 654 ? 316.878 241.978 218.743 1.00 264.18 0  654 LEU B CB  1 
ATOM   7825  N  N   . GLU B 1 655 ? 314.633 241.703 216.395 1.00 264.11 0  655 GLU B N   1 
ATOM   7826  C  CA  . GLU B 1 655 ? 313.750 240.848 215.610 1.00 264.11 0  655 GLU B CA  1 
ATOM   7827  C  C   . GLU B 1 655 ? 313.749 241.202 214.127 1.00 264.11 0  655 GLU B C   1 
ATOM   7828  O  O   . GLU B 1 655 ? 313.315 240.384 213.310 1.00 264.11 0  655 GLU B O   1 
ATOM   7829  C  CB  . GLU B 1 655 ? 312.322 240.923 216.156 1.00 264.11 0  655 GLU B CB  1 
ATOM   7830  N  N   . HIS B 1 656 ? 314.220 242.393 213.765 1.00 265.33 0  656 HIS B N   1 
ATOM   7831  C  CA  . HIS B 1 656 ? 314.277 242.861 212.382 1.00 265.33 0  656 HIS B CA  1 
ATOM   7832  C  C   . HIS B 1 656 ? 315.687 243.326 212.045 1.00 265.33 0  656 HIS B C   1 
ATOM   7833  O  O   . HIS B 1 656 ? 315.905 244.436 211.554 1.00 265.33 0  656 HIS B O   1 
ATOM   7834  C  CB  . HIS B 1 656 ? 313.263 243.974 212.129 1.00 265.33 0  656 HIS B CB  1 
ATOM   7835  N  N   . GLU B 1 657 ? 316.672 242.468 212.330 1.00 265.97 0  657 GLU B N   1 
ATOM   7836  C  CA  . GLU B 1 657 ? 318.079 242.811 212.140 1.00 265.97 0  657 GLU B CA  1 
ATOM   7837  C  C   . GLU B 1 657 ? 318.471 242.950 210.672 1.00 265.97 0  657 GLU B C   1 
ATOM   7838  O  O   . GLU B 1 657 ? 319.515 243.547 210.384 1.00 265.97 0  657 GLU B O   1 
ATOM   7839  C  CB  . GLU B 1 657 ? 318.967 241.762 212.811 1.00 265.97 0  657 GLU B CB  1 
ATOM   7840  N  N   . ALA B 1 658 ? 317.667 242.415 209.745 1.00 266.20 0  658 ALA B N   1 
ATOM   7841  C  CA  . ALA B 1 658 ? 317.940 242.596 208.321 1.00 266.20 0  658 ALA B CA  1 
ATOM   7842  C  C   . ALA B 1 658 ? 317.792 244.053 207.899 1.00 266.20 0  658 ALA B C   1 
ATOM   7843  O  O   . ALA B 1 658 ? 318.463 244.497 206.961 1.00 266.20 0  658 ALA B O   1 
ATOM   7844  C  CB  . ALA B 1 658 ? 317.015 241.706 207.491 1.00 266.20 0  658 ALA B CB  1 
ATOM   7845  N  N   . LEU B 1 659 ? 316.924 244.806 208.576 1.00 263.99 0  659 LEU B N   1 
ATOM   7846  C  CA  . LEU B 1 659 ? 316.861 246.256 208.442 1.00 263.99 0  659 LEU B CA  1 
ATOM   7847  C  C   . LEU B 1 659 ? 317.565 246.960 209.598 1.00 263.99 0  659 LEU B C   1 
ATOM   7848  O  O   . LEU B 1 659 ? 317.218 248.098 209.938 1.00 263.99 0  659 LEU B O   1 
ATOM   7849  C  CB  . LEU B 1 659 ? 315.408 246.718 208.340 1.00 263.99 0  659 LEU B CB  1 
ATOM   7850  N  N   . GLY B 1 660 ? 318.561 246.299 210.199 1.00 263.09 0  660 GLY B N   1 
ATOM   7851  C  CA  . GLY B 1 660 ? 319.247 246.822 211.370 1.00 263.09 0  660 GLY B CA  1 
ATOM   7852  C  C   . GLY B 1 660 ? 320.053 248.079 211.119 1.00 263.09 0  660 GLY B C   1 
ATOM   7853  O  O   . GLY B 1 660 ? 320.329 248.823 212.068 1.00 263.09 0  660 GLY B O   1 
ATOM   7854  N  N   . ILE B 1 661 ? 320.422 248.342 209.861 1.00 261.71 0  661 ILE B N   1 
ATOM   7855  C  CA  . ILE B 1 661 ? 321.061 249.605 209.511 1.00 261.71 0  661 ILE B CA  1 
ATOM   7856  C  C   . ILE B 1 661 ? 320.107 250.780 209.680 1.00 261.71 0  661 ILE B C   1 
ATOM   7857  O  O   . ILE B 1 661 ? 320.555 251.913 209.885 1.00 261.71 0  661 ILE B O   1 
ATOM   7858  C  CB  . ILE B 1 661 ? 321.606 249.554 208.072 1.00 261.71 0  661 ILE B CB  1 
ATOM   7859  N  N   . SER B 1 662 ? 318.796 250.539 209.601 1.00 261.67 0  662 SER B N   1 
ATOM   7860  C  CA  . SER B 1 662 ? 317.817 251.562 209.938 1.00 261.67 0  662 SER B CA  1 
ATOM   7861  C  C   . SER B 1 662 ? 317.550 251.648 211.435 1.00 261.67 0  662 SER B C   1 
ATOM   7862  O  O   . SER B 1 662 ? 316.811 252.545 211.859 1.00 261.67 0  662 SER B O   1 
ATOM   7863  C  CB  . SER B 1 662 ? 316.503 251.302 209.198 1.00 261.67 0  662 SER B CB  1 
ATOM   7864  N  N   . MET B 1 663 ? 318.133 250.745 212.234 1.00 260.21 0  663 MET B N   1 
ATOM   7865  C  CA  . MET B 1 663 ? 317.909 250.753 213.678 1.00 260.21 0  663 MET B CA  1 
ATOM   7866  C  C   . MET B 1 663 ? 318.509 251.988 214.337 1.00 260.21 0  663 MET B C   1 
ATOM   7867  O  O   . MET B 1 663 ? 317.980 252.472 215.344 1.00 260.21 0  663 MET B O   1 
ATOM   7868  C  CB  . MET B 1 663 ? 318.485 249.485 214.306 1.00 260.21 0  663 MET B CB  1 
ATOM   7869  N  N   . ALA B 1 664 ? 319.607 252.509 213.788 1.00 259.01 0  664 ALA B N   1 
ATOM   7870  C  CA  . ALA B 1 664 ? 320.101 253.809 214.220 1.00 259.01 0  664 ALA B CA  1 
ATOM   7871  C  C   . ALA B 1 664 ? 319.275 254.943 213.628 1.00 259.01 0  664 ALA B C   1 
ATOM   7872  O  O   . ALA B 1 664 ? 319.174 256.013 214.240 1.00 259.01 0  664 ALA B O   1 
ATOM   7873  C  CB  . ALA B 1 664 ? 321.573 253.971 213.837 1.00 259.01 0  664 ALA B CB  1 
ATOM   7874  N  N   . LYS B 1 665 ? 318.671 254.719 212.454 1.00 259.76 0  665 LYS B N   1 
ATOM   7875  C  CA  . LYS B 1 665 ? 317.866 255.752 211.810 1.00 259.76 0  665 LYS B CA  1 
ATOM   7876  C  C   . LYS B 1 665 ? 316.583 256.030 212.583 1.00 259.76 0  665 LYS B C   1 
ATOM   7877  O  O   . LYS B 1 665 ? 316.064 257.151 212.537 1.00 259.76 0  665 LYS B O   1 
ATOM   7878  C  CB  . LYS B 1 665 ? 317.542 255.347 210.372 1.00 259.76 0  665 LYS B CB  1 
ATOM   7879  N  N   . VAL B 1 666 ? 316.060 255.029 213.293 1.00 259.07 0  666 VAL B N   1 
ATOM   7880  C  CA  . VAL B 1 666 ? 314.966 255.285 214.220 1.00 259.07 0  666 VAL B CA  1 
ATOM   7881  C  C   . VAL B 1 666 ? 315.479 256.014 215.453 1.00 259.07 0  666 VAL B C   1 
ATOM   7882  O  O   . VAL B 1 666 ? 314.752 256.813 216.057 1.00 259.07 0  666 VAL B O   1 
ATOM   7883  C  CB  . VAL B 1 666 ? 314.258 253.970 214.594 1.00 259.07 0  666 VAL B CB  1 
ATOM   7884  N  N   . LEU B 1 667 ? 316.737 255.765 215.838 1.00 259.06 0  667 LEU B N   1 
ATOM   7885  C  CA  . LEU B 1 667 ? 317.310 256.424 217.008 1.00 259.06 0  667 LEU B CA  1 
ATOM   7886  C  C   . LEU B 1 667 ? 317.535 257.910 216.761 1.00 259.06 0  667 LEU B C   1 
ATOM   7887  O  O   . LEU B 1 667 ? 317.485 258.709 217.703 1.00 259.06 0  667 LEU B O   1 
ATOM   7888  C  CB  . LEU B 1 667 ? 318.623 255.748 217.404 1.00 259.06 0  667 LEU B CB  1 
ATOM   7889  N  N   . MET B 1 668 ? 317.781 258.296 215.509 1.00 259.49 0  668 MET B N   1 
ATOM   7890  C  CA  . MET B 1 668 ? 317.794 259.704 215.142 1.00 259.49 0  668 MET B CA  1 
ATOM   7891  C  C   . MET B 1 668 ? 316.396 260.255 214.895 1.00 259.49 0  668 MET B C   1 
ATOM   7892  O  O   . MET B 1 668 ? 316.243 261.474 214.766 1.00 259.49 0  668 MET B O   1 
ATOM   7893  C  CB  . MET B 1 668 ? 318.658 259.916 213.895 1.00 259.49 0  668 MET B CB  1 
ATOM   7894  N  N   . ALA B 1 669 ? 315.380 259.392 214.829 1.00 259.39 0  669 ALA B N   1 
ATOM   7895  C  CA  . ALA B 1 669 ? 314.014 259.840 214.592 1.00 259.39 0  669 ALA B CA  1 
ATOM   7896  C  C   . ALA B 1 669 ? 313.261 260.106 215.889 1.00 259.39 0  669 ALA B C   1 
ATOM   7897  O  O   . ALA B 1 669 ? 312.540 261.106 215.989 1.00 259.39 0  669 ALA B O   1 
ATOM   7898  C  CB  . ALA B 1 669 ? 313.258 258.807 213.753 1.00 259.39 0  669 ALA B CB  1 
ATOM   7899  N  N   . PHE B 1 670 ? 313.430 259.232 216.887 1.00 259.68 0  670 PHE B N   1 
ATOM   7900  C  CA  . PHE B 1 670 ? 312.742 259.401 218.164 1.00 259.68 0  670 PHE B CA  1 
ATOM   7901  C  C   . PHE B 1 670 ? 313.264 260.608 218.932 1.00 259.68 0  670 PHE B C   1 
ATOM   7902  O  O   . PHE B 1 670 ? 312.523 261.210 219.717 1.00 259.68 0  670 PHE B O   1 
ATOM   7903  C  CB  . PHE B 1 670 ? 312.881 258.133 219.007 1.00 259.68 0  670 PHE B CB  1 
ATOM   7904  N  N   . TYR B 1 671 ? 314.528 260.974 218.721 1.00 259.75 0  671 TYR B N   1 
ATOM   7905  C  CA  . TYR B 1 671 ? 315.054 262.219 219.260 1.00 259.75 0  671 TYR B CA  1 
ATOM   7906  C  C   . TYR B 1 671 ? 314.651 263.430 218.430 1.00 259.75 0  671 TYR B C   1 
ATOM   7907  O  O   . TYR B 1 671 ? 314.799 264.561 218.904 1.00 259.75 0  671 TYR B O   1 
ATOM   7908  C  CB  . TYR B 1 671 ? 316.580 262.148 219.361 1.00 259.75 0  671 TYR B CB  1 
ATOM   7909  N  N   . GLN B 1 672 ? 314.149 263.223 217.211 1.00 258.39 0  672 GLN B N   1 
ATOM   7910  C  CA  . GLN B 1 672 ? 313.726 264.331 216.365 1.00 258.39 0  672 GLN B CA  1 
ATOM   7911  C  C   . GLN B 1 672 ? 312.251 264.663 216.549 1.00 258.39 0  672 GLN B C   1 
ATOM   7912  O  O   . GLN B 1 672 ? 311.871 265.838 216.504 1.00 258.39 0  672 GLN B O   1 
ATOM   7913  C  CB  . GLN B 1 672 ? 314.009 264.011 214.895 1.00 258.39 0  672 GLN B CB  1 
ATOM   7914  N  N   . LEU B 1 673 ? 311.411 263.649 216.755 1.00 259.00 0  673 LEU B N   1 
ATOM   7915  C  CA  . LEU B 1 673 ? 309.985 263.842 216.972 1.00 259.00 0  673 LEU B CA  1 
ATOM   7916  C  C   . LEU B 1 673 ? 309.623 263.932 218.451 1.00 259.00 0  673 LEU B C   1 
ATOM   7917  O  O   . LEU B 1 673 ? 308.440 263.794 218.791 1.00 259.00 0  673 LEU B O   1 
ATOM   7918  C  CB  . LEU B 1 673 ? 309.193 262.715 216.305 1.00 259.00 0  673 LEU B CB  1 
ATOM   7919  N  N   . GLU B 1 674 ? 310.621 264.145 219.322 1.00 259.21 0  674 GLU B N   1 
ATOM   7920  C  CA  . GLU B 1 674 ? 310.463 264.292 220.777 1.00 259.21 0  674 GLU B CA  1 
ATOM   7921  C  C   . GLU B 1 674 ? 309.805 263.072 221.421 1.00 259.21 0  674 GLU B C   1 
ATOM   7922  O  O   . GLU B 1 674 ? 309.064 263.198 222.399 1.00 259.21 0  674 GLU B O   1 
ATOM   7923  C  CB  . GLU B 1 674 ? 309.696 265.571 221.139 1.00 259.21 0  674 GLU B CB  1 
ATOM   7924  N  N   . ILE B 1 675 ? 310.071 261.882 220.884 1.00 259.25 0  675 ILE B N   1 
ATOM   7925  C  CA  . ILE B 1 675 ? 309.548 260.647 221.457 1.00 259.25 0  675 ILE B CA  1 
ATOM   7926  C  C   . ILE B 1 675 ? 310.477 260.167 222.564 1.00 259.25 0  675 ILE B C   1 
ATOM   7927  O  O   . ILE B 1 675 ? 310.064 260.028 223.720 1.00 259.25 0  675 ILE B O   1 
ATOM   7928  C  CB  . ILE B 1 675 ? 309.369 259.563 220.379 1.00 259.25 0  675 ILE B CB  1 
ATOM   7929  N  N   . LEU B 1 676 ? 311.736 259.911 222.219 1.00 258.24 0  676 LEU B N   1 
ATOM   7930  C  CA  . LEU B 1 676 ? 312.759 259.532 223.183 1.00 258.24 0  676 LEU B CA  1 
ATOM   7931  C  C   . LEU B 1 676 ? 313.725 260.691 223.378 1.00 258.24 0  676 LEU B C   1 
ATOM   7932  O  O   . LEU B 1 676 ? 314.230 261.254 222.401 1.00 258.24 0  676 LEU B O   1 
ATOM   7933  C  CB  . LEU B 1 676 ? 313.513 258.283 222.721 1.00 258.24 0  676 LEU B CB  1 
ATOM   7934  N  N   . ALA B 1 677 ? 313.977 261.045 224.635 1.00 258.13 0  677 ALA B N   1 
ATOM   7935  C  CA  . ALA B 1 677 ? 314.852 262.161 224.952 1.00 258.13 0  677 ALA B CA  1 
ATOM   7936  C  C   . ALA B 1 677 ? 316.316 261.775 224.742 1.00 258.13 0  677 ALA B C   1 
ATOM   7937  O  O   . ALA B 1 677 ? 316.659 260.608 224.534 1.00 258.13 0  677 ALA B O   1 
ATOM   7938  C  CB  . ALA B 1 677 ? 314.624 262.628 226.389 1.00 258.13 0  677 ALA B CB  1 
ATOM   7939  N  N   . GLY B 1 678 ? 317.186 262.786 224.794 1.00 256.99 0  678 GLY B N   1 
ATOM   7940  C  CA  . GLY B 1 678 ? 318.609 262.532 224.638 1.00 256.99 0  678 GLY B CA  1 
ATOM   7941  C  C   . GLY B 1 678 ? 319.216 261.834 225.841 1.00 256.99 0  678 GLY B C   1 
ATOM   7942  O  O   . GLY B 1 678 ? 320.106 260.990 225.696 1.00 256.99 0  678 GLY B O   1 
ATOM   7943  N  N   . GLU B 1 679 ? 318.738 262.170 227.043 1.00 256.91 0  679 GLU B N   1 
ATOM   7944  C  CA  . GLU B 1 679 ? 319.204 261.489 228.247 1.00 256.91 0  679 GLU B CA  1 
ATOM   7945  C  C   . GLU B 1 679 ? 318.714 260.048 228.293 1.00 256.91 0  679 GLU B C   1 
ATOM   7946  O  O   . GLU B 1 679 ? 319.446 259.152 228.729 1.00 256.91 0  679 GLU B O   1 
ATOM   7947  C  CB  . GLU B 1 679 ? 318.748 262.252 229.491 1.00 256.91 0  679 GLU B CB  1 
ATOM   7948  N  N   . THR B 1 680 ? 317.487 259.802 227.825 1.00 258.26 0  680 THR B N   1 
ATOM   7949  C  CA  . THR B 1 680 ? 316.977 258.435 227.757 1.00 258.26 0  680 THR B CA  1 
ATOM   7950  C  C   . THR B 1 680 ? 317.716 257.621 226.701 1.00 258.26 0  680 THR B C   1 
ATOM   7951  O  O   . THR B 1 680 ? 317.967 256.426 226.896 1.00 258.26 0  680 THR B O   1 
ATOM   7952  C  CB  . THR B 1 680 ? 315.476 258.446 227.470 1.00 258.26 0  680 THR B CB  1 
ATOM   7953  N  N   . ILE B 1 681 ? 318.101 258.261 225.593 1.00 258.28 0  681 ILE B N   1 
ATOM   7954  C  CA  . ILE B 1 681 ? 318.876 257.574 224.564 1.00 258.28 0  681 ILE B CA  1 
ATOM   7955  C  C   . ILE B 1 681 ? 320.283 257.268 225.066 1.00 258.28 0  681 ILE B C   1 
ATOM   7956  O  O   . ILE B 1 681 ? 320.843 256.206 224.771 1.00 258.28 0  681 ILE B O   1 
ATOM   7957  C  CB  . ILE B 1 681 ? 318.906 258.408 223.270 1.00 258.28 0  681 ILE B CB  1 
ATOM   7958  N  N   . LEU B 1 682 ? 320.863 258.179 225.854 1.00 257.42 0  682 LEU B N   1 
ATOM   7959  C  CA  . LEU B 1 682 ? 322.180 257.930 226.434 1.00 257.42 0  682 LEU B CA  1 
ATOM   7960  C  C   . LEU B 1 682 ? 322.124 256.833 227.492 1.00 257.42 0  682 LEU B C   1 
ATOM   7961  O  O   . LEU B 1 682 ? 323.059 256.032 227.612 1.00 257.42 0  682 LEU B O   1 
ATOM   7962  C  CB  . LEU B 1 682 ? 322.745 259.220 227.028 1.00 257.42 0  682 LEU B CB  1 
ATOM   7963  N  N   . SER B 1 683 ? 321.031 256.773 228.258 1.00 254.89 0  683 SER B N   1 
ATOM   7964  C  CA  . SER B 1 683 ? 320.870 255.706 229.241 1.00 254.89 0  683 SER B CA  1 
ATOM   7965  C  C   . SER B 1 683 ? 320.609 254.359 228.577 1.00 254.89 0  683 SER B C   1 
ATOM   7966  O  O   . SER B 1 683 ? 321.020 253.320 229.107 1.00 254.89 0  683 SER B O   1 
ATOM   7967  C  CB  . SER B 1 683 ? 319.737 256.050 230.208 1.00 254.89 0  683 SER B CB  1 
ATOM   7968  N  N   . TRP B 1 684 ? 319.927 254.354 227.428 1.00 255.16 0  684 TRP B N   1 
ATOM   7969  C  CA  . TRP B 1 684 ? 319.721 253.107 226.699 1.00 255.16 0  684 TRP B CA  1 
ATOM   7970  C  C   . TRP B 1 684 ? 321.003 252.642 226.017 1.00 255.16 0  684 TRP B C   1 
ATOM   7971  O  O   . TRP B 1 684 ? 321.258 251.436 225.919 1.00 255.16 0  684 TRP B O   1 
ATOM   7972  C  CB  . TRP B 1 684 ? 318.600 253.278 225.674 1.00 255.16 0  684 TRP B CB  1 
ATOM   7973  N  N   . PHE B 1 685 ? 321.821 253.583 225.536 1.00 254.96 0  685 PHE B N   1 
ATOM   7974  C  CA  . PHE B 1 685 ? 323.094 253.211 224.927 1.00 254.96 0  685 PHE B CA  1 
ATOM   7975  C  C   . PHE B 1 685 ? 324.115 252.777 225.971 1.00 254.96 0  685 PHE B C   1 
ATOM   7976  O  O   . PHE B 1 685 ? 324.970 251.931 225.685 1.00 254.96 0  685 PHE B O   1 
ATOM   7977  C  CB  . PHE B 1 685 ? 323.642 254.376 224.102 1.00 254.96 0  685 PHE B CB  1 
ATOM   7978  N  N   . SER B 1 686 ? 324.044 253.338 227.181 1.00 253.04 0  686 SER B N   1 
ATOM   7979  C  CA  . SER B 1 686 ? 324.966 252.942 228.239 1.00 253.04 0  686 SER B CA  1 
ATOM   7980  C  C   . SER B 1 686 ? 324.590 251.601 228.855 1.00 253.04 0  686 SER B C   1 
ATOM   7981  O  O   . SER B 1 686 ? 325.468 250.884 229.347 1.00 253.04 0  686 SER B O   1 
ATOM   7982  C  CB  . SER B 1 686 ? 325.017 254.021 229.322 1.00 253.04 0  686 SER B CB  1 
ATOM   7983  N  N   . GLN B 1 687 ? 323.307 251.248 228.840 1.00 249.55 0  687 GLN B N   1 
ATOM   7984  C  CA  . GLN B 1 687 ? 322.861 249.981 229.402 1.00 249.55 0  687 GLN B CA  1 
ATOM   7985  C  C   . GLN B 1 687 ? 323.152 248.845 228.430 1.00 249.55 0  687 GLN B C   1 
ATOM   7986  O  O   . GLN B 1 687 ? 322.749 248.893 227.264 1.00 249.55 0  687 GLN B O   1 
ATOM   7987  C  CB  . GLN B 1 687 ? 321.368 250.035 229.722 1.00 249.55 0  687 GLN B CB  1 
ATOM   7988  N  N   . ARG B 1 688 ? 323.854 247.825 228.913 1.00 241.12 0  688 ARG B N   1 
ATOM   7989  C  CA  . ARG B 1 688 ? 324.199 246.672 228.090 1.00 241.12 0  688 ARG B CA  1 
ATOM   7990  C  C   . ARG B 1 688 ? 322.997 245.753 227.901 1.00 241.12 0  688 ARG B C   1 
ATOM   7991  O  O   . ARG B 1 688 ? 323.027 244.587 228.295 1.00 241.12 0  688 ARG B O   1 
ATOM   7992  C  CB  . ARG B 1 688 ? 325.362 245.898 228.712 1.00 241.12 0  688 ARG B CB  1 
ATOM   7993  N  N   . ASP B 1 692 ? 326.107 241.265 225.910 1.00 225.80 0  692 ASP B N   1 
ATOM   7994  C  CA  . ASP B 1 692 ? 324.880 240.636 225.437 1.00 225.80 0  692 ASP B CA  1 
ATOM   7995  C  C   . ASP B 1 692 ? 324.686 240.870 223.943 1.00 225.80 0  692 ASP B C   1 
ATOM   7996  O  O   . ASP B 1 692 ? 325.522 241.495 223.289 1.00 225.80 0  692 ASP B O   1 
ATOM   7997  C  CB  . ASP B 1 692 ? 323.672 241.163 226.214 1.00 225.80 0  692 ASP B CB  1 
ATOM   7998  N  N   . LYS B 1 693 ? 323.575 240.358 223.406 1.00 226.92 0  693 LYS B N   1 
ATOM   7999  C  CA  . LYS B 1 693 ? 323.287 240.543 221.988 1.00 226.92 0  693 LYS B CA  1 
ATOM   8000  C  C   . LYS B 1 693 ? 322.841 241.970 221.695 1.00 226.92 0  693 LYS B C   1 
ATOM   8001  O  O   . LYS B 1 693 ? 323.188 242.532 220.649 1.00 226.92 0  693 LYS B O   1 
ATOM   8002  C  CB  . LYS B 1 693 ? 322.224 239.544 221.534 1.00 226.92 0  693 LYS B CB  1 
ATOM   8003  N  N   . GLY B 1 694 ? 322.074 242.572 222.607 1.00 229.10 0  694 GLY B N   1 
ATOM   8004  C  CA  . GLY B 1 694 ? 321.639 243.945 222.407 1.00 229.10 0  694 GLY B CA  1 
ATOM   8005  C  C   . GLY B 1 694 ? 322.768 244.948 222.547 1.00 229.10 0  694 GLY B C   1 
ATOM   8006  O  O   . GLY B 1 694 ? 322.805 245.957 221.838 1.00 229.10 0  694 GLY B O   1 
ATOM   8007  N  N   . GLN B 1 695 ? 323.711 244.679 223.455 1.00 228.19 0  695 GLN B N   1 
ATOM   8008  C  CA  . GLN B 1 695 ? 324.877 245.546 223.589 1.00 228.19 0  695 GLN B CA  1 
ATOM   8009  C  C   . GLN B 1 695 ? 325.815 245.413 222.397 1.00 228.19 0  695 GLN B C   1 
ATOM   8010  O  O   . GLN B 1 695 ? 326.465 246.391 222.011 1.00 228.19 0  695 GLN B O   1 
ATOM   8011  C  CB  . GLN B 1 695 ? 325.620 245.231 224.887 1.00 228.19 0  695 GLN B CB  1 
ATOM   8012  N  N   . GLN B 1 696 ? 325.900 244.219 221.805 1.00 229.61 0  696 GLN B N   1 
ATOM   8013  C  CA  . GLN B 1 696 ? 326.701 244.050 220.598 1.00 229.61 0  696 GLN B CA  1 
ATOM   8014  C  C   . GLN B 1 696 ? 326.020 244.667 219.384 1.00 229.61 0  696 GLN B C   1 
ATOM   8015  O  O   . GLN B 1 696 ? 326.701 245.156 218.475 1.00 229.61 0  696 GLN B O   1 
ATOM   8016  C  CB  . GLN B 1 696 ? 326.979 242.566 220.355 1.00 229.61 0  696 GLN B CB  1 
ATOM   8017  N  N   . LEU B 1 697 ? 324.685 244.654 219.349 1.00 228.69 0  697 LEU B N   1 
ATOM   8018  C  CA  . LEU B 1 697 ? 323.969 245.292 218.249 1.00 228.69 0  697 LEU B CA  1 
ATOM   8019  C  C   . LEU B 1 697 ? 323.992 246.810 218.369 1.00 228.69 0  697 LEU B C   1 
ATOM   8020  O  O   . LEU B 1 697 ? 323.975 247.510 217.350 1.00 228.69 0  697 LEU B O   1 
ATOM   8021  C  CB  . LEU B 1 697 ? 322.527 244.786 218.197 1.00 228.69 0  697 LEU B CB  1 
ATOM   8022  N  N   . ARG B 1 698 ? 324.032 247.336 219.594 1.00 229.59 0  698 ARG B N   1 
ATOM   8023  C  CA  . ARG B 1 698 ? 324.109 248.776 219.800 1.00 229.59 0  698 ARG B CA  1 
ATOM   8024  C  C   . ARG B 1 698 ? 325.525 249.321 219.669 1.00 229.59 0  698 ARG B C   1 
ATOM   8025  O  O   . ARG B 1 698 ? 325.697 250.544 219.624 1.00 229.59 0  698 ARG B O   1 
ATOM   8026  C  CB  . ARG B 1 698 ? 323.546 249.140 221.176 1.00 229.59 0  698 ARG B CB  1 
ATOM   8027  N  N   . LYS B 1 699 ? 326.537 248.455 219.609 1.00 230.61 0  699 LYS B N   1 
ATOM   8028  C  CA  . LYS B 1 699 ? 327.923 248.876 219.463 1.00 230.61 0  699 LYS B CA  1 
ATOM   8029  C  C   . LYS B 1 699 ? 328.378 248.909 218.007 1.00 230.61 0  699 LYS B C   1 
ATOM   8030  O  O   . LYS B 1 699 ? 329.582 248.818 217.742 1.00 230.61 0  699 LYS B O   1 
ATOM   8031  C  CB  . LYS B 1 699 ? 328.840 247.961 220.277 1.00 230.61 0  699 LYS B CB  1 
ATOM   8032  N  N   . ASN B 1 700 ? 327.449 249.037 217.064 1.00 233.21 0  700 ASN B N   1 
ATOM   8033  C  CA  . ASN B 1 700 ? 327.796 249.090 215.654 1.00 233.21 0  700 ASN B CA  1 
ATOM   8034  C  C   . ASN B 1 700 ? 328.294 250.486 215.283 1.00 233.21 0  700 ASN B C   1 
ATOM   8035  O  O   . ASN B 1 700 ? 328.287 251.417 216.094 1.00 233.21 0  700 ASN B O   1 
ATOM   8036  C  CB  . ASN B 1 700 ? 326.597 248.686 214.798 1.00 233.21 0  700 ASN B CB  1 
ATOM   8037  N  N   . GLN B 1 701 ? 328.735 250.633 214.032 1.00 235.42 0  701 GLN B N   1 
ATOM   8038  C  CA  . GLN B 1 701 ? 329.240 251.923 213.574 1.00 235.42 0  701 GLN B CA  1 
ATOM   8039  C  C   . GLN B 1 701 ? 328.111 252.915 213.329 1.00 235.42 0  701 GLN B C   1 
ATOM   8040  O  O   . GLN B 1 701 ? 328.289 254.119 213.548 1.00 235.42 0  701 GLN B O   1 
ATOM   8041  C  CB  . GLN B 1 701 ? 330.072 251.743 212.305 1.00 235.42 0  701 GLN B CB  1 
ATOM   8042  N  N   . GLN B 1 702 ? 326.945 252.431 212.889 1.00 238.01 0  702 GLN B N   1 
ATOM   8043  C  CA  . GLN B 1 702 ? 325.821 253.323 212.618 1.00 238.01 0  702 GLN B CA  1 
ATOM   8044  C  C   . GLN B 1 702 ? 325.228 253.876 213.908 1.00 238.01 0  702 GLN B C   1 
ATOM   8045  O  O   . GLN B 1 702 ? 324.896 255.066 213.983 1.00 238.01 0  702 GLN B O   1 
ATOM   8046  C  CB  . GLN B 1 702 ? 324.754 252.588 211.807 1.00 238.01 0  702 GLN B CB  1 
ATOM   8047  N  N   . LEU B 1 703 ? 325.105 253.033 214.938 1.00 237.67 0  703 LEU B N   1 
ATOM   8048  C  CA  . LEU B 1 703 ? 324.584 253.494 216.221 1.00 237.67 0  703 LEU B CA  1 
ATOM   8049  C  C   . LEU B 1 703 ? 325.563 254.438 216.909 1.00 237.67 0  703 LEU B C   1 
ATOM   8050  O  O   . LEU B 1 703 ? 325.149 255.419 217.538 1.00 237.67 0  703 LEU B O   1 
ATOM   8051  C  CB  . LEU B 1 703 ? 324.268 252.298 217.120 1.00 237.67 0  703 LEU B CB  1 
ATOM   8052  N  N   . GLN B 1 704 ? 326.867 254.172 216.776 1.00 237.71 0  704 GLN B N   1 
ATOM   8053  C  CA  . GLN B 1 704 ? 327.871 255.069 217.340 1.00 237.71 0  704 GLN B CA  1 
ATOM   8054  C  C   . GLN B 1 704 ? 327.901 256.402 216.601 1.00 237.71 0  704 GLN B C   1 
ATOM   8055  O  O   . GLN B 1 704 ? 328.075 257.457 217.222 1.00 237.71 0  704 GLN B O   1 
ATOM   8056  C  CB  . GLN B 1 704 ? 329.247 254.405 217.306 1.00 237.71 0  704 GLN B CB  1 
ATOM   8057  N  N   . ARG B 1 705 ? 327.703 256.376 215.278 1.00 239.20 0  705 ARG B N   1 
ATOM   8058  C  CA  . ARG B 1 705 ? 327.643 257.616 214.509 1.00 239.20 0  705 ARG B CA  1 
ATOM   8059  C  C   . ARG B 1 705 ? 326.391 258.417 214.845 1.00 239.20 0  705 ARG B C   1 
ATOM   8060  O  O   . ARG B 1 705 ? 326.440 259.650 214.919 1.00 239.20 0  705 ARG B O   1 
ATOM   8061  C  CB  . ARG B 1 705 ? 327.700 257.308 213.013 1.00 239.20 0  705 ARG B CB  1 
ATOM   8062  N  N   . PHE B 1 706 ? 325.267 257.731 215.079 1.00 240.49 0  706 PHE B N   1 
ATOM   8063  C  CA  . PHE B 1 706 ? 324.043 258.420 215.480 1.00 240.49 0  706 PHE B CA  1 
ATOM   8064  C  C   . PHE B 1 706 ? 324.169 259.006 216.882 1.00 240.49 0  706 PHE B C   1 
ATOM   8065  O  O   . PHE B 1 706 ? 323.672 260.108 217.144 1.00 240.49 0  706 PHE B O   1 
ATOM   8066  C  CB  . PHE B 1 706 ? 322.853 257.464 215.401 1.00 240.49 0  706 PHE B CB  1 
ATOM   8067  N  N   . ILE B 1 707 ? 324.852 258.297 217.786 1.00 239.01 0  707 ILE B N   1 
ATOM   8068  C  CA  . ILE B 1 707 ? 325.067 258.812 219.136 1.00 239.01 0  707 ILE B CA  1 
ATOM   8069  C  C   . ILE B 1 707 ? 326.017 260.004 219.114 1.00 239.01 0  707 ILE B C   1 
ATOM   8070  O  O   . ILE B 1 707 ? 325.831 260.974 219.859 1.00 239.01 0  707 ILE B O   1 
ATOM   8071  C  CB  . ILE B 1 707 ? 325.585 257.692 220.057 1.00 239.01 0  707 ILE B CB  1 
ATOM   8072  N  N   . GLN B 1 708 ? 327.033 259.964 218.244 1.00 238.15 0  708 GLN B N   1 
ATOM   8073  C  CA  . GLN B 1 708 ? 327.945 261.096 218.111 1.00 238.15 0  708 GLN B CA  1 
ATOM   8074  C  C   . GLN B 1 708 ? 327.249 262.300 217.485 1.00 238.15 0  708 GLN B C   1 
ATOM   8075  O  O   . GLN B 1 708 ? 327.503 263.443 217.883 1.00 238.15 0  708 GLN B O   1 
ATOM   8076  C  CB  . GLN B 1 708 ? 329.165 260.692 217.284 1.00 238.15 0  708 GLN B CB  1 
ATOM   8077  N  N   . TRP B 1 709 ? 326.348 262.061 216.527 1.00 238.72 0  709 TRP B N   1 
ATOM   8078  C  CA  . TRP B 1 709 ? 325.585 263.154 215.933 1.00 238.72 0  709 TRP B CA  1 
ATOM   8079  C  C   . TRP B 1 709 ? 324.605 263.756 216.934 1.00 238.72 0  709 TRP B C   1 
ATOM   8080  O  O   . TRP B 1 709 ? 324.403 264.976 216.953 1.00 238.72 0  709 TRP B O   1 
ATOM   8081  C  CB  . TRP B 1 709 ? 324.846 262.663 214.688 1.00 238.72 0  709 TRP B CB  1 
ATOM   8082  N  N   . LEU B 1 710 ? 324.009 262.920 217.790 1.00 239.31 0  710 LEU B N   1 
ATOM   8083  C  CA  . LEU B 1 710 ? 323.114 263.428 218.827 1.00 239.31 0  710 LEU B CA  1 
ATOM   8084  C  C   . LEU B 1 710 ? 323.880 264.211 219.888 1.00 239.31 0  710 LEU B C   1 
ATOM   8085  O  O   . LEU B 1 710 ? 323.389 265.229 220.390 1.00 239.31 0  710 LEU B O   1 
ATOM   8086  C  CB  . LEU B 1 710 ? 322.341 262.275 219.464 1.00 239.31 0  710 LEU B CB  1 
ATOM   8087  N  N   . LYS B 1 711 ? 325.091 263.759 220.233 1.00 239.11 0  711 LYS B N   1 
ATOM   8088  C  CA  . LYS B 1 711 ? 325.909 264.492 221.193 1.00 239.11 0  711 LYS B CA  1 
ATOM   8089  C  C   . LYS B 1 711 ? 326.445 265.792 220.603 1.00 239.11 0  711 LYS B C   1 
ATOM   8090  O  O   . LYS B 1 711 ? 326.672 266.758 221.340 1.00 239.11 0  711 LYS B O   1 
ATOM   8091  C  CB  . LYS B 1 711 ? 327.063 263.615 221.678 1.00 239.11 0  711 LYS B CB  1 
ATOM   8092  N  N   . GLU B 1 712 ? 326.653 265.837 219.285 1.00 239.44 0  712 GLU B N   1 
ATOM   8093  C  CA  . GLU B 1 712 ? 327.090 267.073 218.647 1.00 239.44 0  712 GLU B CA  1 
ATOM   8094  C  C   . GLU B 1 712 ? 325.940 268.062 218.494 1.00 239.44 0  712 GLU B C   1 
ATOM   8095  O  O   . GLU B 1 712 ? 326.138 269.274 218.632 1.00 239.44 0  712 GLU B O   1 
ATOM   8096  C  CB  . GLU B 1 712 ? 327.717 266.769 217.285 1.00 239.44 0  712 GLU B CB  1 
ATOM   8097  N  N   . ALA B 1 713 ? 324.733 267.567 218.209 1.00 239.79 0  713 ALA B N   1 
ATOM   8098  C  CA  . ALA B 1 713 ? 323.579 268.442 218.056 1.00 239.79 0  713 ALA B CA  1 
ATOM   8099  C  C   . ALA B 1 713 ? 322.999 268.895 219.389 1.00 239.79 0  713 ALA B C   1 
ATOM   8100  O  O   . ALA B 1 713 ? 322.354 269.949 219.440 1.00 239.79 0  713 ALA B O   1 
ATOM   8101  C  CB  . ALA B 1 713 ? 322.493 267.744 217.234 1.00 239.79 0  713 ALA B CB  1 
ATOM   8102  N  N   . GLU B 1 714 ? 323.206 268.130 220.462 1.00 238.43 0  714 GLU B N   1 
ATOM   8103  C  CA  . GLU B 1 714 ? 322.694 268.529 221.769 1.00 238.43 0  714 GLU B CA  1 
ATOM   8104  C  C   . GLU B 1 714 ? 323.533 269.649 222.374 1.00 238.43 0  714 GLU B C   1 
ATOM   8105  O  O   . GLU B 1 714 ? 322.991 270.645 222.866 1.00 238.43 0  714 GLU B O   1 
ATOM   8106  C  CB  . GLU B 1 714 ? 322.651 267.322 222.707 1.00 238.43 0  714 GLU B CB  1 
ATOM   8107  N  N   . GLU B 1 715 ? 324.854 269.502 222.347 1.00 236.81 0  715 GLU B N   1 
ATOM   8108  C  CA  . GLU B 1 715 ? 325.748 270.515 222.895 1.00 236.81 0  715 GLU B CA  1 
ATOM   8109  C  C   . GLU B 1 715 ? 326.838 269.877 223.751 1.00 236.81 0  715 GLU B C   1 
ATOM   8110  O  O   . GLU B 1 715 ? 326.962 268.654 223.805 1.00 236.81 0  715 GLU B O   1 
ATOM   8111  N  N   . GLY C 2 25  ? 213.814 262.660 203.542 1.00 120.35 0  8   GLY C N   1 
ATOM   8112  C  CA  . GLY C 2 25  ? 214.965 263.359 203.003 1.00 120.35 0  8   GLY C CA  1 
ATOM   8113  C  C   . GLY C 2 25  ? 216.287 262.728 203.393 1.00 120.35 0  8   GLY C C   1 
ATOM   8114  O  O   . GLY C 2 25  ? 216.692 261.714 202.825 1.00 120.35 0  8   GLY C O   1 
ATOM   8115  N  N   . SER C 2 26  ? 216.964 263.332 204.372 1.00 118.92 0  9   SER C N   1 
ATOM   8116  C  CA  . SER C 2 26  ? 218.249 262.811 204.823 1.00 118.92 0  9   SER C CA  1 
ATOM   8117  C  C   . SER C 2 26  ? 218.067 261.603 205.734 1.00 118.92 0  9   SER C C   1 
ATOM   8118  O  O   . SER C 2 26  ? 218.779 260.601 205.592 1.00 118.92 0  9   SER C O   1 
ATOM   8119  C  CB  . SER C 2 26  ? 219.038 263.909 205.538 1.00 118.92 0  9   SER C CB  1 
ATOM   8120  O  OG  . SER C 2 26  ? 218.698 263.970 206.912 1.00 118.92 0  9   SER C OG  1 
ATOM   8121  N  N   . GLU C 2 27  ? 217.128 261.702 206.686 1.00 116.64 0  10  GLU C N   1 
ATOM   8122  C  CA  . GLU C 2 27  ? 216.827 260.600 207.600 1.00 116.64 0  10  GLU C CA  1 
ATOM   8123  C  C   . GLU C 2 27  ? 216.321 259.380 206.840 1.00 116.64 0  10  GLU C C   1 
ATOM   8124  O  O   . GLU C 2 27  ? 216.718 258.242 207.134 1.00 116.64 0  10  GLU C O   1 
ATOM   8125  C  CB  . GLU C 2 27  ? 215.798 261.059 208.636 1.00 116.64 0  10  GLU C CB  1 
ATOM   8126  C  CG  . GLU C 2 27  ? 215.240 259.957 209.522 1.00 116.64 0  10  GLU C CG  1 
ATOM   8127  C  CD  . GLU C 2 27  ? 216.058 259.751 210.781 1.00 116.64 0  10  GLU C CD  1 
ATOM   8128  O  OE1 . GLU C 2 27  ? 216.843 260.656 211.135 1.00 116.64 0  10  GLU C OE1 1 
ATOM   8129  O  OE2 . GLU C 2 27  ? 215.916 258.685 211.416 1.00 116.64 -1 10  GLU C OE2 1 
ATOM   8130  N  N   . LEU C 2 28  ? 215.468 259.615 205.837 1.00 112.92 0  11  LEU C N   1 
ATOM   8131  C  CA  . LEU C 2 28  ? 214.962 258.550 204.976 1.00 112.92 0  11  LEU C CA  1 
ATOM   8132  C  C   . LEU C 2 28  ? 216.094 257.873 204.216 1.00 112.92 0  11  LEU C C   1 
ATOM   8133  O  O   . LEU C 2 28  ? 216.142 256.639 204.131 1.00 112.92 0  11  LEU C O   1 
ATOM   8134  C  CB  . LEU C 2 28  ? 213.936 259.140 204.006 1.00 112.92 0  11  LEU C CB  1 
ATOM   8135  C  CG  . LEU C 2 28  ? 213.179 258.297 202.981 1.00 112.92 0  11  LEU C CG  1 
ATOM   8136  C  CD1 . LEU C 2 28  ? 211.766 258.805 202.907 1.00 112.92 0  11  LEU C CD1 1 
ATOM   8137  C  CD2 . LEU C 2 28  ? 213.821 258.397 201.604 1.00 112.92 0  11  LEU C CD2 1 
ATOM   8138  N  N   . SER C 2 29  ? 217.027 258.669 203.685 1.00 112.17 0  12  SER C N   1 
ATOM   8139  C  CA  . SER C 2 29  ? 218.130 258.122 202.903 1.00 112.17 0  12  SER C CA  1 
ATOM   8140  C  C   . SER C 2 29  ? 219.086 257.311 203.769 1.00 112.17 0  12  SER C C   1 
ATOM   8141  O  O   . SER C 2 29  ? 219.516 256.224 203.364 1.00 112.17 0  12  SER C O   1 
ATOM   8142  C  CB  . SER C 2 29  ? 218.879 259.250 202.193 1.00 112.17 0  12  SER C CB  1 
ATOM   8143  O  OG  . SER C 2 29  ? 219.623 258.754 201.094 1.00 112.17 0  12  SER C OG  1 
ATOM   8144  N  N   . GLU C 2 30  ? 219.406 257.798 204.976 1.00 111.05 0  13  GLU C N   1 
ATOM   8145  C  CA  . GLU C 2 30  ? 220.327 257.038 205.819 1.00 111.05 0  13  GLU C CA  1 
ATOM   8146  C  C   . GLU C 2 30  ? 219.668 255.789 206.391 1.00 111.05 0  13  GLU C C   1 
ATOM   8147  O  O   . GLU C 2 30  ? 220.338 254.763 206.540 1.00 111.05 0  13  GLU C O   1 
ATOM   8148  C  CB  . GLU C 2 30  ? 220.910 257.913 206.939 1.00 111.05 0  13  GLU C CB  1 
ATOM   8149  C  CG  . GLU C 2 30  ? 219.928 258.598 207.885 1.00 111.05 0  13  GLU C CG  1 
ATOM   8150  C  CD  . GLU C 2 30  ? 219.484 257.722 209.044 1.00 111.05 0  13  GLU C CD  1 
ATOM   8151  O  OE1 . GLU C 2 30  ? 220.205 256.757 209.373 1.00 111.05 0  13  GLU C OE1 1 
ATOM   8152  O  OE2 . GLU C 2 30  ? 218.413 257.998 209.623 1.00 111.05 -1 13  GLU C OE2 1 
ATOM   8153  N  N   . ARG C 2 31  ? 218.357 255.831 206.665 1.00 106.11 0  14  ARG C N   1 
ATOM   8154  C  CA  . ARG C 2 31  ? 217.678 254.627 207.136 1.00 106.11 0  14  ARG C CA  1 
ATOM   8155  C  C   . ARG C 2 31  ? 217.555 253.589 206.028 1.00 106.11 0  14  ARG C C   1 
ATOM   8156  O  O   . ARG C 2 31  ? 217.730 252.389 206.276 1.00 106.11 0  14  ARG C O   1 
ATOM   8157  C  CB  . ARG C 2 31  ? 216.302 254.978 207.700 1.00 106.11 0  14  ARG C CB  1 
ATOM   8158  C  CG  . ARG C 2 31  ? 215.690 253.866 208.536 1.00 106.11 0  14  ARG C CG  1 
ATOM   8159  C  CD  . ARG C 2 31  ? 214.543 254.377 209.387 1.00 106.11 0  14  ARG C CD  1 
ATOM   8160  N  NE  . ARG C 2 31  ? 214.063 253.367 210.326 1.00 106.11 0  14  ARG C NE  1 
ATOM   8161  C  CZ  . ARG C 2 31  ? 213.120 252.473 210.045 1.00 106.11 0  14  ARG C CZ  1 
ATOM   8162  N  NH1 . ARG C 2 31  ? 212.549 252.460 208.849 1.00 106.11 1  14  ARG C NH1 1 
ATOM   8163  N  NH2 . ARG C 2 31  ? 212.747 251.591 210.962 1.00 106.11 0  14  ARG C NH2 1 
ATOM   8164  N  N   . ILE C 2 32  ? 217.289 254.035 204.795 1.00 104.84 0  15  ILE C N   1 
ATOM   8165  C  CA  . ILE C 2 32  ? 217.206 253.120 203.660 1.00 104.84 0  15  ILE C CA  1 
ATOM   8166  C  C   . ILE C 2 32  ? 218.571 252.505 203.365 1.00 104.84 0  15  ILE C C   1 
ATOM   8167  O  O   . ILE C 2 32  ? 218.680 251.294 203.127 1.00 104.84 0  15  ILE C O   1 
ATOM   8168  C  CB  . ILE C 2 32  ? 216.621 253.867 202.445 1.00 104.84 0  15  ILE C CB  1 
ATOM   8169  C  CG1 . ILE C 2 32  ? 215.095 253.863 202.516 1.00 104.84 0  15  ILE C CG1 1 
ATOM   8170  C  CG2 . ILE C 2 32  ? 217.078 253.265 201.117 1.00 104.84 0  15  ILE C CG2 1 
ATOM   8171  C  CD1 . ILE C 2 32  ? 214.446 254.698 201.451 1.00 104.84 0  15  ILE C CD1 1 
ATOM   8172  N  N   . GLU C 2 33  ? 219.637 253.310 203.438 1.00 104.91 0  16  GLU C N   1 
ATOM   8173  C  CA  . GLU C 2 33  ? 220.978 252.790 203.189 1.00 104.91 0  16  GLU C CA  1 
ATOM   8174  C  C   . GLU C 2 33  ? 221.430 251.846 204.297 1.00 104.91 0  16  GLU C C   1 
ATOM   8175  O  O   . GLU C 2 33  ? 222.086 250.835 204.021 1.00 104.91 0  16  GLU C O   1 
ATOM   8176  C  CB  . GLU C 2 33  ? 221.967 253.943 203.020 1.00 104.91 0  16  GLU C CB  1 
ATOM   8177  C  CG  . GLU C 2 33  ? 221.885 254.628 201.663 1.00 104.91 0  16  GLU C CG  1 
ATOM   8178  C  CD  . GLU C 2 33  ? 222.152 253.684 200.505 1.00 104.91 0  16  GLU C CD  1 
ATOM   8179  O  OE1 . GLU C 2 33  ? 221.435 253.776 199.487 1.00 104.91 0  16  GLU C OE1 1 
ATOM   8180  O  OE2 . GLU C 2 33  ? 223.086 252.860 200.606 1.00 104.91 -1 16  GLU C OE2 1 
ATOM   8181  N  N   . SER C 2 34  ? 221.074 252.145 205.552 1.00 102.72 0  17  SER C N   1 
ATOM   8182  C  CA  . SER C 2 34  ? 221.398 251.240 206.651 1.00 102.72 0  17  SER C CA  1 
ATOM   8183  C  C   . SER C 2 34  ? 220.631 249.929 206.532 1.00 102.72 0  17  SER C C   1 
ATOM   8184  O  O   . SER C 2 34  ? 221.174 248.862 206.840 1.00 102.72 0  17  SER C O   1 
ATOM   8185  C  CB  . SER C 2 34  ? 221.103 251.915 207.989 1.00 102.72 0  17  SER C CB  1 
ATOM   8186  O  OG  . SER C 2 34  ? 219.735 251.786 208.333 1.00 102.72 0  17  SER C OG  1 
ATOM   8187  N  N   . PHE C 2 35  ? 219.379 249.989 206.061 1.00 100.23 0  18  PHE C N   1 
ATOM   8188  C  CA  . PHE C 2 35  ? 218.602 248.777 205.815 1.00 100.23 0  18  PHE C CA  1 
ATOM   8189  C  C   . PHE C 2 35  ? 219.214 247.938 204.696 1.00 100.23 0  18  PHE C C   1 
ATOM   8190  O  O   . PHE C 2 35  ? 219.292 246.706 204.807 1.00 100.23 0  18  PHE C O   1 
ATOM   8191  C  CB  . PHE C 2 35  ? 217.158 249.152 205.486 1.00 100.23 0  18  PHE C CB  1 
ATOM   8192  C  CG  . PHE C 2 35  ? 216.212 247.989 205.486 1.00 100.23 0  18  PHE C CG  1 
ATOM   8193  C  CD1 . PHE C 2 35  ? 215.830 247.392 206.677 1.00 100.23 0  18  PHE C CD1 1 
ATOM   8194  C  CD2 . PHE C 2 35  ? 215.689 247.505 204.297 1.00 100.23 0  18  PHE C CD2 1 
ATOM   8195  C  CE1 . PHE C 2 35  ? 214.953 246.323 206.682 1.00 100.23 0  18  PHE C CE1 1 
ATOM   8196  C  CE2 . PHE C 2 35  ? 214.810 246.438 204.295 1.00 100.23 0  18  PHE C CE2 1 
ATOM   8197  C  CZ  . PHE C 2 35  ? 214.444 245.846 205.491 1.00 100.23 0  18  PHE C CZ  1 
ATOM   8198  N  N   . VAL C 2 36  ? 219.676 248.596 203.627 1.00 100.83 0  19  VAL C N   1 
ATOM   8199  C  CA  . VAL C 2 36  ? 220.304 247.890 202.512 1.00 100.83 0  19  VAL C CA  1 
ATOM   8200  C  C   . VAL C 2 36  ? 221.616 247.243 202.953 1.00 100.83 0  19  VAL C C   1 
ATOM   8201  O  O   . VAL C 2 36  ? 221.891 246.085 202.616 1.00 100.83 0  19  VAL C O   1 
ATOM   8202  C  CB  . VAL C 2 36  ? 220.495 248.851 201.321 1.00 100.83 0  19  VAL C CB  1 
ATOM   8203  C  CG1 . VAL C 2 36  ? 221.445 248.273 200.278 1.00 100.83 0  19  VAL C CG1 1 
ATOM   8204  C  CG2 . VAL C 2 36  ? 219.153 249.152 200.673 1.00 100.83 0  19  VAL C CG2 1 
ATOM   8205  N  N   . GLU C 2 37  ? 222.412 247.945 203.769 1.00 99.86  0  20  GLU C N   1 
ATOM   8206  C  CA  . GLU C 2 37  ? 223.672 247.359 204.222 1.00 99.86  0  20  GLU C CA  1 
ATOM   8207  C  C   . GLU C 2 37  ? 223.455 246.249 205.247 1.00 99.86  0  20  GLU C C   1 
ATOM   8208  O  O   . GLU C 2 37  ? 224.206 245.265 205.249 1.00 99.86  0  20  GLU C O   1 
ATOM   8209  C  CB  . GLU C 2 37  ? 224.602 248.434 204.794 1.00 99.86  0  20  GLU C CB  1 
ATOM   8210  C  CG  . GLU C 2 37  ? 225.034 249.516 203.803 1.00 99.86  0  20  GLU C CG  1 
ATOM   8211  C  CD  . GLU C 2 37  ? 225.761 248.975 202.580 1.00 99.86  0  20  GLU C CD  1 
ATOM   8212  O  OE1 . GLU C 2 37  ? 226.506 247.978 202.703 1.00 99.86  0  20  GLU C OE1 1 
ATOM   8213  O  OE2 . GLU C 2 37  ? 225.583 249.552 201.487 1.00 99.86  -1 20  GLU C OE2 1 
ATOM   8214  N  N   . THR C 2 38  ? 222.433 246.358 206.102 1.00 99.11  0  21  THR C N   1 
ATOM   8215  C  CA  . THR C 2 38  ? 222.213 245.293 207.072 1.00 99.11  0  21  THR C CA  1 
ATOM   8216  C  C   . THR C 2 38  ? 221.488 244.102 206.461 1.00 99.11  0  21  THR C C   1 
ATOM   8217  O  O   . THR C 2 38  ? 221.474 243.029 207.071 1.00 99.11  0  21  THR C O   1 
ATOM   8218  C  CB  . THR C 2 38  ? 221.441 245.804 208.299 1.00 99.11  0  21  THR C CB  1 
ATOM   8219  O  OG1 . THR C 2 38  ? 221.537 244.837 209.352 1.00 99.11  0  21  THR C OG1 1 
ATOM   8220  C  CG2 . THR C 2 38  ? 219.970 246.015 207.985 1.00 99.11  0  21  THR C CG2 1 
ATOM   8221  N  N   . LEU C 2 39  ? 220.887 244.263 205.277 1.00 98.41  0  22  LEU C N   1 
ATOM   8222  C  CA  . LEU C 2 39  ? 220.425 243.111 204.518 1.00 98.41  0  22  LEU C CA  1 
ATOM   8223  C  C   . LEU C 2 39  ? 221.510 242.536 203.620 1.00 98.41  0  22  LEU C C   1 
ATOM   8224  O  O   . LEU C 2 39  ? 221.439 241.356 203.258 1.00 98.41  0  22  LEU C O   1 
ATOM   8225  C  CB  . LEU C 2 39  ? 219.209 243.483 203.663 1.00 98.41  0  22  LEU C CB  1 
ATOM   8226  C  CG  . LEU C 2 39  ? 217.849 243.617 204.352 1.00 98.41  0  22  LEU C CG  1 
ATOM   8227  C  CD1 . LEU C 2 39  ? 216.734 243.504 203.324 1.00 98.41  0  22  LEU C CD1 1 
ATOM   8228  C  CD2 . LEU C 2 39  ? 217.666 242.590 205.463 1.00 98.41  0  22  LEU C CD2 1 
ATOM   8229  N  N   . LYS C 2 40  ? 222.508 243.344 203.256 1.00 93.32  0  23  LYS C N   1 
ATOM   8230  C  CA  . LYS C 2 40  ? 223.586 242.879 202.392 1.00 93.32  0  23  LYS C CA  1 
ATOM   8231  C  C   . LYS C 2 40  ? 224.649 242.116 203.173 1.00 93.32  0  23  LYS C C   1 
ATOM   8232  O  O   . LYS C 2 40  ? 225.165 241.102 202.690 1.00 93.32  0  23  LYS C O   1 
ATOM   8233  C  CB  . LYS C 2 40  ? 224.220 244.067 201.668 1.00 93.32  0  23  LYS C CB  1 
ATOM   8234  C  CG  . LYS C 2 40  ? 224.554 243.814 200.209 1.00 93.32  0  23  LYS C CG  1 
ATOM   8235  C  CD  . LYS C 2 40  ? 224.619 245.120 199.435 1.00 93.32  0  23  LYS C CD  1 
ATOM   8236  C  CE  . LYS C 2 40  ? 224.384 244.900 197.951 1.00 93.32  0  23  LYS C CE  1 
ATOM   8237  N  NZ  . LYS C 2 40  ? 224.053 246.170 197.248 1.00 93.32  1  23  LYS C NZ  1 
ATOM   8238  N  N   . ARG C 2 41  ? 224.993 242.588 204.374 1.00 90.94  0  24  ARG C N   1 
ATOM   8239  C  CA  . ARG C 2 41  ? 226.093 241.980 205.117 1.00 90.94  0  24  ARG C CA  1 
ATOM   8240  C  C   . ARG C 2 41  ? 225.677 240.660 205.757 1.00 90.94  0  24  ARG C C   1 
ATOM   8241  O  O   . ARG C 2 41  ? 226.195 239.597 205.405 1.00 90.94  0  24  ARG C O   1 
ATOM   8242  C  CB  . ARG C 2 41  ? 226.608 242.956 206.179 1.00 90.94  0  24  ARG C CB  1 
ATOM   8243  C  CG  . ARG C 2 41  ? 227.331 244.164 205.608 1.00 90.94  0  24  ARG C CG  1 
ATOM   8244  C  CD  . ARG C 2 41  ? 227.576 245.218 206.673 1.00 90.94  0  24  ARG C CD  1 
ATOM   8245  N  NE  . ARG C 2 41  ? 227.774 246.542 206.091 1.00 90.94  0  24  ARG C NE  1 
ATOM   8246  C  CZ  . ARG C 2 41  ? 228.036 247.637 206.796 1.00 90.94  0  24  ARG C CZ  1 
ATOM   8247  N  NH1 . ARG C 2 41  ? 228.136 247.570 208.116 1.00 90.94  1  24  ARG C NH1 1 
ATOM   8248  N  NH2 . ARG C 2 41  ? 228.200 248.800 206.180 1.00 90.94  0  24  ARG C NH2 1 
ATOM   8249  N  N   . GLY C 2 42  ? 224.727 240.703 206.684 1.00 101.03 0  25  GLY C N   1 
ATOM   8250  C  CA  . GLY C 2 42  ? 224.327 239.493 207.373 1.00 101.03 0  25  GLY C CA  1 
ATOM   8251  C  C   . GLY C 2 42  ? 222.845 239.432 207.662 1.00 101.03 0  25  GLY C C   1 
ATOM   8252  O  O   . GLY C 2 42  ? 222.054 240.142 207.034 1.00 101.03 0  25  GLY C O   1 
ATOM   8253  N  N   . GLY C 2 43  ? 222.453 238.587 208.611 1.00 101.51 0  26  GLY C N   1 
ATOM   8254  C  CA  . GLY C 2 43  ? 221.062 238.529 209.005 1.00 101.51 0  26  GLY C CA  1 
ATOM   8255  C  C   . GLY C 2 43  ? 220.749 239.526 210.098 1.00 101.51 0  26  GLY C C   1 
ATOM   8256  O  O   . GLY C 2 43  ? 220.964 239.253 211.283 1.00 101.51 0  26  GLY C O   1 
ATOM   8257  N  N   . GLY C 2 44  ? 220.241 240.690 209.708 1.00 101.69 0  27  GLY C N   1 
ATOM   8258  C  CA  . GLY C 2 44  ? 219.880 241.718 210.651 1.00 101.69 0  27  GLY C CA  1 
ATOM   8259  C  C   . GLY C 2 44  ? 218.523 242.310 210.335 1.00 101.69 0  27  GLY C C   1 
ATOM   8260  O  O   . GLY C 2 44  ? 218.320 242.917 209.279 1.00 101.69 0  27  GLY C O   1 
ATOM   8261  N  N   . PRO C 2 45  ? 217.554 242.148 211.250 1.00 103.19 0  28  PRO C N   1 
ATOM   8262  C  CA  . PRO C 2 45  ? 217.618 241.410 212.519 1.00 103.19 0  28  PRO C CA  1 
ATOM   8263  C  C   . PRO C 2 45  ? 217.447 239.894 212.364 1.00 103.19 0  28  PRO C C   1 
ATOM   8264  O  O   . PRO C 2 45  ? 217.563 239.374 211.254 1.00 103.19 0  28  PRO C O   1 
ATOM   8265  C  CB  . PRO C 2 45  ? 216.462 242.007 213.320 1.00 103.19 0  28  PRO C CB  1 
ATOM   8266  C  CG  . PRO C 2 45  ? 215.491 242.439 212.289 1.00 103.19 0  28  PRO C CG  1 
ATOM   8267  C  CD  . PRO C 2 45  ? 216.280 242.867 211.096 1.00 103.19 0  28  PRO C CD  1 
ATOM   8268  N  N   . ARG C 2 46  ? 217.168 239.200 213.470 1.00 100.65 0  29  ARG C N   1 
ATOM   8269  C  CA  . ARG C 2 46  ? 217.275 237.744 213.482 1.00 100.65 0  29  ARG C CA  1 
ATOM   8270  C  C   . ARG C 2 46  ? 216.038 237.072 212.892 1.00 100.65 0  29  ARG C C   1 
ATOM   8271  O  O   . ARG C 2 46  ? 216.122 236.381 211.872 1.00 100.65 0  29  ARG C O   1 
ATOM   8272  C  CB  . ARG C 2 46  ? 217.527 237.251 214.911 1.00 100.65 0  29  ARG C CB  1 
ATOM   8273  C  CG  . ARG C 2 46  ? 218.997 237.037 215.250 1.00 100.65 0  29  ARG C CG  1 
ATOM   8274  C  CD  . ARG C 2 46  ? 219.721 238.353 215.491 1.00 100.65 0  29  ARG C CD  1 
ATOM   8275  N  NE  . ARG C 2 46  ? 221.172 238.198 215.454 1.00 100.65 0  29  ARG C NE  1 
ATOM   8276  C  CZ  . ARG C 2 46  ? 222.032 239.207 215.536 1.00 100.65 0  29  ARG C CZ  1 
ATOM   8277  N  NH1 . ARG C 2 46  ? 221.589 240.451 215.659 1.00 100.65 1  29  ARG C NH1 1 
ATOM   8278  N  NH2 . ARG C 2 46  ? 223.336 238.972 215.493 1.00 100.65 0  29  ARG C NH2 1 
ATOM   8279  N  N   . SER C 2 47  ? 214.882 237.263 213.520 1.00 95.63  0  30  SER C N   1 
ATOM   8280  C  CA  . SER C 2 47  ? 213.672 236.576 213.093 1.00 95.63  0  30  SER C CA  1 
ATOM   8281  C  C   . SER C 2 47  ? 212.989 237.348 211.970 1.00 95.63  0  30  SER C C   1 
ATOM   8282  O  O   . SER C 2 47  ? 213.243 238.536 211.751 1.00 95.63  0  30  SER C O   1 
ATOM   8283  C  CB  . SER C 2 47  ? 212.707 236.380 214.263 1.00 95.63  0  30  SER C CB  1 
ATOM   8284  O  OG  . SER C 2 47  ? 212.350 237.614 214.854 1.00 95.63  0  30  SER C OG  1 
ATOM   8285  N  N   . SER C 2 48  ? 212.108 236.649 211.252 1.00 91.42  0  31  SER C N   1 
ATOM   8286  C  CA  . SER C 2 48  ? 211.454 237.240 210.092 1.00 91.42  0  31  SER C CA  1 
ATOM   8287  C  C   . SER C 2 48  ? 210.313 238.173 210.472 1.00 91.42  0  31  SER C C   1 
ATOM   8288  O  O   . SER C 2 48  ? 209.983 239.074 209.690 1.00 91.42  0  31  SER C O   1 
ATOM   8289  C  CB  . SER C 2 48  ? 210.934 236.138 209.167 1.00 91.42  0  31  SER C CB  1 
ATOM   8290  O  OG  . SER C 2 48  ? 211.999 235.354 208.658 1.00 91.42  0  31  SER C OG  1 
ATOM   8291  N  N   . GLU C 2 49  ? 209.727 237.994 211.659 1.00 94.02  0  32  GLU C N   1 
ATOM   8292  C  CA  . GLU C 2 49  ? 208.592 238.816 212.067 1.00 94.02  0  32  GLU C CA  1 
ATOM   8293  C  C   . GLU C 2 49  ? 209.022 240.250 212.357 1.00 94.02  0  32  GLU C C   1 
ATOM   8294  O  O   . GLU C 2 49  ? 208.360 241.203 211.926 1.00 94.02  0  32  GLU C O   1 
ATOM   8295  C  CB  . GLU C 2 49  ? 207.921 238.193 213.291 1.00 94.02  0  32  GLU C CB  1 
ATOM   8296  C  CG  . GLU C 2 49  ? 206.470 238.594 213.488 1.00 94.02  0  32  GLU C CG  1 
ATOM   8297  C  CD  . GLU C 2 49  ? 205.818 237.862 214.646 1.00 94.02  0  32  GLU C CD  1 
ATOM   8298  O  OE1 . GLU C 2 49  ? 206.502 237.041 215.292 1.00 94.02  0  32  GLU C OE1 1 
ATOM   8299  O  OE2 . GLU C 2 49  ? 204.621 238.104 214.911 1.00 94.02  -1 32  GLU C OE2 1 
ATOM   8300  N  N   . GLU C 2 50  ? 210.145 240.424 213.059 1.00 97.82  0  33  GLU C N   1 
ATOM   8301  C  CA  . GLU C 2 50  ? 210.601 241.770 213.389 1.00 97.82  0  33  GLU C CA  1 
ATOM   8302  C  C   . GLU C 2 50  ? 211.160 242.492 212.167 1.00 97.82  0  33  GLU C C   1 
ATOM   8303  O  O   . GLU C 2 50  ? 211.005 243.714 212.049 1.00 97.82  0  33  GLU C O   1 
ATOM   8304  C  CB  . GLU C 2 50  ? 211.631 241.721 214.521 1.00 97.82  0  33  GLU C CB  1 
ATOM   8305  C  CG  . GLU C 2 50  ? 212.850 240.863 214.245 1.00 97.82  0  33  GLU C CG  1 
ATOM   8306  C  CD  . GLU C 2 50  ? 213.550 240.413 215.510 1.00 97.82  0  33  GLU C CD  1 
ATOM   8307  O  OE1 . GLU C 2 50  ? 213.343 241.049 216.565 1.00 97.82  0  33  GLU C OE1 1 
ATOM   8308  O  OE2 . GLU C 2 50  ? 214.314 239.427 215.446 1.00 97.82  -1 33  GLU C OE2 1 
ATOM   8309  N  N   . MET C 2 51  ? 211.760 241.762 211.221 1.00 95.83  0  34  MET C N   1 
ATOM   8310  C  CA  . MET C 2 51  ? 212.222 242.429 210.011 1.00 95.83  0  34  MET C CA  1 
ATOM   8311  C  C   . MET C 2 51  ? 211.063 242.743 209.074 1.00 95.83  0  34  MET C C   1 
ATOM   8312  O  O   . MET C 2 51  ? 211.125 243.736 208.343 1.00 95.83  0  34  MET C O   1 
ATOM   8313  C  CB  . MET C 2 51  ? 213.297 241.602 209.296 1.00 95.83  0  34  MET C CB  1 
ATOM   8314  C  CG  . MET C 2 51  ? 212.828 240.344 208.596 1.00 95.83  0  34  MET C CG  1 
ATOM   8315  S  SD  . MET C 2 51  ? 214.137 239.603 207.607 1.00 95.83  0  34  MET C SD  1 
ATOM   8316  C  CE  . MET C 2 51  ? 214.199 240.758 206.239 1.00 95.83  0  34  MET C CE  1 
ATOM   8317  N  N   . ALA C 2 52  ? 209.980 241.959 209.123 1.00 92.83  0  35  ALA C N   1 
ATOM   8318  C  CA  . ALA C 2 52  ? 208.778 242.332 208.384 1.00 92.83  0  35  ALA C CA  1 
ATOM   8319  C  C   . ALA C 2 52  ? 208.115 243.557 209.003 1.00 92.83  0  35  ALA C C   1 
ATOM   8320  O  O   . ALA C 2 52  ? 207.606 244.425 208.281 1.00 92.83  0  35  ALA C O   1 
ATOM   8321  C  CB  . ALA C 2 52  ? 207.804 241.156 208.334 1.00 92.83  0  35  ALA C CB  1 
ATOM   8322  N  N   . ARG C 2 53  ? 208.142 243.654 210.339 1.00 95.28  0  36  ARG C N   1 
ATOM   8323  C  CA  . ARG C 2 53  ? 207.628 244.844 211.014 1.00 95.28  0  36  ARG C CA  1 
ATOM   8324  C  C   . ARG C 2 53  ? 208.446 246.082 210.666 1.00 95.28  0  36  ARG C C   1 
ATOM   8325  O  O   . ARG C 2 53  ? 207.881 247.149 210.397 1.00 95.28  0  36  ARG C O   1 
ATOM   8326  C  CB  . ARG C 2 53  ? 207.612 244.632 212.528 1.00 95.28  0  36  ARG C CB  1 
ATOM   8327  C  CG  . ARG C 2 53  ? 206.396 243.890 213.041 1.00 95.28  0  36  ARG C CG  1 
ATOM   8328  C  CD  . ARG C 2 53  ? 206.232 244.068 214.542 1.00 95.28  0  36  ARG C CD  1 
ATOM   8329  N  NE  . ARG C 2 53  ? 207.114 243.184 215.299 1.00 95.28  0  36  ARG C NE  1 
ATOM   8330  C  CZ  . ARG C 2 53  ? 208.224 243.581 215.913 1.00 95.28  0  36  ARG C CZ  1 
ATOM   8331  N  NH1 . ARG C 2 53  ? 208.594 244.853 215.860 1.00 95.28  1  36  ARG C NH1 1 
ATOM   8332  N  NH2 . ARG C 2 53  ? 208.966 242.707 216.578 1.00 95.28  0  36  ARG C NH2 1 
ATOM   8333  N  N   . GLU C 2 54  ? 209.776 245.957 210.635 1.00 96.95  0  37  GLU C N   1 
ATOM   8334  C  CA  . GLU C 2 54  ? 210.587 247.117 210.286 1.00 96.95  0  37  GLU C CA  1 
ATOM   8335  C  C   . GLU C 2 54  ? 210.535 247.432 208.794 1.00 96.95  0  37  GLU C C   1 
ATOM   8336  O  O   . GLU C 2 54  ? 210.705 248.595 208.420 1.00 96.95  0  37  GLU C O   1 
ATOM   8337  C  CB  . GLU C 2 54  ? 212.032 246.923 210.763 1.00 96.95  0  37  GLU C CB  1 
ATOM   8338  C  CG  . GLU C 2 54  ? 212.958 246.173 209.825 1.00 96.95  0  37  GLU C CG  1 
ATOM   8339  C  CD  . GLU C 2 54  ? 214.253 245.777 210.505 1.00 96.95  0  37  GLU C CD  1 
ATOM   8340  O  OE1 . GLU C 2 54  ? 215.306 245.778 209.835 1.00 96.95  0  37  GLU C OE1 1 
ATOM   8341  O  OE2 . GLU C 2 54  ? 214.218 245.473 211.716 1.00 96.95  -1 37  GLU C OE2 1 
ATOM   8342  N  N   . THR C 2 55  ? 210.227 246.448 207.942 1.00 92.40  0  38  THR C N   1 
ATOM   8343  C  CA  . THR C 2 55  ? 210.011 246.733 206.526 1.00 92.40  0  38  THR C CA  1 
ATOM   8344  C  C   . THR C 2 55  ? 208.704 247.487 206.308 1.00 92.40  0  38  THR C C   1 
ATOM   8345  O  O   . THR C 2 55  ? 208.651 248.432 205.509 1.00 92.40  0  38  THR C O   1 
ATOM   8346  C  CB  . THR C 2 55  ? 210.026 245.434 205.722 1.00 92.40  0  38  THR C CB  1 
ATOM   8347  O  OG1 . THR C 2 55  ? 211.177 244.662 206.086 1.00 92.40  0  38  THR C OG1 1 
ATOM   8348  C  CG2 . THR C 2 55  ? 210.067 245.730 204.231 1.00 92.40  0  38  THR C CG2 1 
ATOM   8349  N  N   . LEU C 2 56  ? 207.642 247.095 207.022 1.00 94.64  0  39  LEU C N   1 
ATOM   8350  C  CA  . LEU C 2 56  ? 206.388 247.842 206.951 1.00 94.64  0  39  LEU C CA  1 
ATOM   8351  C  C   . LEU C 2 56  ? 206.531 249.237 207.550 1.00 94.64  0  39  LEU C C   1 
ATOM   8352  O  O   . LEU C 2 56  ? 205.928 250.194 207.045 1.00 94.64  0  39  LEU C O   1 
ATOM   8353  C  CB  . LEU C 2 56  ? 205.273 247.074 207.664 1.00 94.64  0  39  LEU C CB  1 
ATOM   8354  C  CG  . LEU C 2 56  ? 204.345 246.178 206.836 1.00 94.64  0  39  LEU C CG  1 
ATOM   8355  C  CD1 . LEU C 2 56  ? 203.604 246.989 205.786 1.00 94.64  0  39  LEU C CD1 1 
ATOM   8356  C  CD2 . LEU C 2 56  ? 205.092 245.028 206.188 1.00 94.64  0  39  LEU C CD2 1 
ATOM   8357  N  N   . GLY C 2 57  ? 207.344 249.373 208.603 1.00 97.92  0  40  GLY C N   1 
ATOM   8358  C  CA  . GLY C 2 57  ? 207.629 250.690 209.148 1.00 97.92  0  40  GLY C CA  1 
ATOM   8359  C  C   . GLY C 2 57  ? 208.432 251.557 208.198 1.00 97.92  0  40  GLY C C   1 
ATOM   8360  O  O   . GLY C 2 57  ? 208.204 252.765 208.104 1.00 97.92  0  40  GLY C O   1 
ATOM   8361  N  N   . LEU C 2 58  ? 209.367 250.948 207.462 1.00 97.94  0  41  LEU C N   1 
ATOM   8362  C  CA  . LEU C 2 58  ? 210.116 251.679 206.447 1.00 97.94  0  41  LEU C CA  1 
ATOM   8363  C  C   . LEU C 2 58  ? 209.210 252.112 205.301 1.00 97.94  0  41  LEU C C   1 
ATOM   8364  O  O   . LEU C 2 58  ? 209.351 253.223 204.781 1.00 97.94  0  41  LEU C O   1 
ATOM   8365  C  CB  . LEU C 2 58  ? 211.267 250.817 205.929 1.00 97.94  0  41  LEU C CB  1 
ATOM   8366  C  CG  . LEU C 2 58  ? 212.183 251.431 204.871 1.00 97.94  0  41  LEU C CG  1 
ATOM   8367  C  CD1 . LEU C 2 58  ? 212.831 252.696 205.402 1.00 97.94  0  41  LEU C CD1 1 
ATOM   8368  C  CD2 . LEU C 2 58  ? 213.237 250.428 204.430 1.00 97.94  0  41  LEU C CD2 1 
ATOM   8369  N  N   . LEU C 2 59  ? 208.246 251.266 204.928 1.00 97.01  0  42  LEU C N   1 
ATOM   8370  C  CA  . LEU C 2 59  ? 207.339 251.619 203.839 1.00 97.01  0  42  LEU C CA  1 
ATOM   8371  C  C   . LEU C 2 59  ? 206.380 252.734 204.252 1.00 97.01  0  42  LEU C C   1 
ATOM   8372  O  O   . LEU C 2 59  ? 206.124 253.663 203.471 1.00 97.01  0  42  LEU C O   1 
ATOM   8373  C  CB  . LEU C 2 59  ? 206.576 250.379 203.377 1.00 97.01  0  42  LEU C CB  1 
ATOM   8374  C  CG  . LEU C 2 59  ? 207.408 249.437 202.504 1.00 97.01  0  42  LEU C CG  1 
ATOM   8375  C  CD1 . LEU C 2 59  ? 206.912 248.008 202.613 1.00 97.01  0  42  LEU C CD1 1 
ATOM   8376  C  CD2 . LEU C 2 59  ? 207.403 249.898 201.057 1.00 97.01  0  42  LEU C CD2 1 
ATOM   8377  N  N   . ARG C 2 60  ? 205.867 252.688 205.486 1.00 99.35  0  43  ARG C N   1 
ATOM   8378  C  CA  . ARG C 2 60  ? 205.022 253.791 205.933 1.00 99.35  0  43  ARG C CA  1 
ATOM   8379  C  C   . ARG C 2 60  ? 205.832 255.072 206.138 1.00 99.35  0  43  ARG C C   1 
ATOM   8380  O  O   . ARG C 2 60  ? 205.337 256.166 205.836 1.00 99.35  0  43  ARG C O   1 
ATOM   8381  C  CB  . ARG C 2 60  ? 204.236 253.405 207.195 1.00 99.35  0  43  ARG C CB  1 
ATOM   8382  C  CG  . ARG C 2 60  ? 205.028 253.293 208.483 1.00 99.35  0  43  ARG C CG  1 
ATOM   8383  C  CD  . ARG C 2 60  ? 204.129 253.356 209.699 1.00 99.35  0  43  ARG C CD  1 
ATOM   8384  N  NE  . ARG C 2 60  ? 203.158 252.268 209.715 1.00 99.35  0  43  ARG C NE  1 
ATOM   8385  C  CZ  . ARG C 2 60  ? 202.322 252.034 210.720 1.00 99.35  0  43  ARG C CZ  1 
ATOM   8386  N  NH1 . ARG C 2 60  ? 201.467 251.024 210.652 1.00 99.35  1  43  ARG C NH1 1 
ATOM   8387  N  NH2 . ARG C 2 60  ? 202.339 252.811 211.794 1.00 99.35  0  43  ARG C NH2 1 
ATOM   8388  N  N   . GLN C 2 61  ? 207.104 254.955 206.539 1.00 102.51 0  44  GLN C N   1 
ATOM   8389  C  CA  . GLN C 2 61  ? 207.937 256.141 206.692 1.00 102.51 0  44  GLN C CA  1 
ATOM   8390  C  C   . GLN C 2 61  ? 208.305 256.757 205.350 1.00 102.51 0  44  GLN C C   1 
ATOM   8391  O  O   . GLN C 2 61  ? 208.460 257.978 205.262 1.00 102.51 0  44  GLN C O   1 
ATOM   8392  C  CB  . GLN C 2 61  ? 209.196 255.798 207.486 1.00 102.51 0  44  GLN C CB  1 
ATOM   8393  C  CG  . GLN C 2 61  ? 209.883 257.004 208.100 1.00 102.51 0  44  GLN C CG  1 
ATOM   8394  C  CD  . GLN C 2 61  ? 211.146 256.632 208.847 1.00 102.51 0  44  GLN C CD  1 
ATOM   8395  O  OE1 . GLN C 2 61  ? 211.446 255.454 209.031 1.00 102.51 0  44  GLN C OE1 1 
ATOM   8396  N  NE2 . GLN C 2 61  ? 211.896 257.639 209.278 1.00 102.51 0  44  GLN C NE2 1 
ATOM   8397  N  N   . ILE C 2 62  ? 208.449 255.946 204.295 1.00 104.96 0  45  ILE C N   1 
ATOM   8398  C  CA  . ILE C 2 62  ? 208.745 256.516 202.982 1.00 104.96 0  45  ILE C CA  1 
ATOM   8399  C  C   . ILE C 2 62  ? 207.492 256.949 202.233 1.00 104.96 0  45  ILE C C   1 
ATOM   8400  O  O   . ILE C 2 62  ? 207.611 257.624 201.199 1.00 104.96 0  45  ILE C O   1 
ATOM   8401  C  CB  . ILE C 2 62  ? 209.552 255.565 202.071 1.00 104.96 0  45  ILE C CB  1 
ATOM   8402  C  CG1 . ILE C 2 62  ? 208.727 254.333 201.702 1.00 104.96 0  45  ILE C CG1 1 
ATOM   8403  C  CG2 . ILE C 2 62  ? 210.892 255.202 202.705 1.00 104.96 0  45  ILE C CG2 1 
ATOM   8404  C  CD1 . ILE C 2 62  ? 209.473 253.295 200.909 1.00 104.96 0  45  ILE C CD1 1 
ATOM   8405  N  N   . ILE C 2 63  ? 206.294 256.589 202.705 1.00 103.74 0  46  ILE C N   1 
ATOM   8406  C  CA  . ILE C 2 63  ? 205.092 257.157 202.094 1.00 103.74 0  46  ILE C CA  1 
ATOM   8407  C  C   . ILE C 2 63  ? 204.508 258.355 202.847 1.00 103.74 0  46  ILE C C   1 
ATOM   8408  O  O   . ILE C 2 63  ? 203.683 259.079 202.270 1.00 103.74 0  46  ILE C O   1 
ATOM   8409  C  CB  . ILE C 2 63  ? 203.984 256.104 201.873 1.00 103.74 0  46  ILE C CB  1 
ATOM   8410  C  CG1 . ILE C 2 63  ? 203.410 255.623 203.202 1.00 103.74 0  46  ILE C CG1 1 
ATOM   8411  C  CG2 . ILE C 2 63  ? 204.474 254.971 200.976 1.00 103.74 0  46  ILE C CG2 1 
ATOM   8412  C  CD1 . ILE C 2 63  ? 202.254 254.672 203.059 1.00 103.74 0  46  ILE C CD1 1 
ATOM   8413  N  N   . THR C 2 64  ? 204.899 258.593 204.107 1.00 108.27 0  47  THR C N   1 
ATOM   8414  C  CA  . THR C 2 64  ? 204.354 259.777 204.778 1.00 108.27 0  47  THR C CA  1 
ATOM   8415  C  C   . THR C 2 64  ? 205.087 261.076 204.455 1.00 108.27 0  47  THR C C   1 
ATOM   8416  O  O   . THR C 2 64  ? 204.542 262.150 204.731 1.00 108.27 0  47  THR C O   1 
ATOM   8417  C  CB  . THR C 2 64  ? 204.323 259.616 206.305 1.00 108.27 0  47  THR C CB  1 
ATOM   8418  O  OG1 . THR C 2 64  ? 205.650 259.428 206.815 1.00 108.27 0  47  THR C OG1 1 
ATOM   8419  C  CG2 . THR C 2 64  ? 203.373 258.524 206.757 1.00 108.27 0  47  THR C CG2 1 
ATOM   8420  N  N   . ASP C 2 65  ? 206.292 261.029 203.886 1.00 110.98 0  48  ASP C N   1 
ATOM   8421  C  CA  . ASP C 2 65  ? 207.064 262.251 203.675 1.00 110.98 0  48  ASP C CA  1 
ATOM   8422  C  C   . ASP C 2 65  ? 207.407 262.489 202.206 1.00 110.98 0  48  ASP C C   1 
ATOM   8423  O  O   . ASP C 2 65  ? 208.461 263.048 201.894 1.00 110.98 0  48  ASP C O   1 
ATOM   8424  C  CB  . ASP C 2 65  ? 208.335 262.240 204.527 1.00 110.98 0  48  ASP C CB  1 
ATOM   8425  C  CG  . ASP C 2 65  ? 209.163 260.981 204.340 1.00 110.98 0  48  ASP C CG  1 
ATOM   8426  O  OD1 . ASP C 2 65  ? 210.162 260.824 205.072 1.00 110.98 0  48  ASP C OD1 1 
ATOM   8427  O  OD2 . ASP C 2 65  ? 208.821 260.145 203.478 1.00 110.98 -1 48  ASP C OD2 1 
ATOM   8428  N  N   . HIS C 2 66  ? 206.536 262.074 201.295 1.00 112.86 0  49  HIS C N   1 
ATOM   8429  C  CA  . HIS C 2 66  ? 206.764 262.255 199.871 1.00 112.86 0  49  HIS C CA  1 
ATOM   8430  C  C   . HIS C 2 66  ? 205.591 263.000 199.251 1.00 112.86 0  49  HIS C C   1 
ATOM   8431  O  O   . HIS C 2 66  ? 204.534 263.170 199.864 1.00 112.86 0  49  HIS C O   1 
ATOM   8432  C  CB  . HIS C 2 66  ? 206.975 260.908 199.169 1.00 112.86 0  49  HIS C CB  1 
ATOM   8433  C  CG  . HIS C 2 66  ? 208.411 260.497 199.069 1.00 112.86 0  49  HIS C CG  1 
ATOM   8434  N  ND1 . HIS C 2 66  ? 209.059 259.810 200.072 1.00 112.86 0  49  HIS C ND1 1 
ATOM   8435  C  CD2 . HIS C 2 66  ? 209.324 260.677 198.086 1.00 112.86 0  49  HIS C CD2 1 
ATOM   8436  C  CE1 . HIS C 2 66  ? 210.310 259.584 199.712 1.00 112.86 0  49  HIS C CE1 1 
ATOM   8437  N  NE2 . HIS C 2 66  ? 210.497 260.099 198.510 1.00 112.86 0  49  HIS C NE2 1 
ATOM   8438  N  N   . ARG C 2 67  ? 205.792 263.455 198.018 1.00 118.80 0  50  ARG C N   1 
ATOM   8439  C  CA  . ARG C 2 67  ? 204.778 264.192 197.279 1.00 118.80 0  50  ARG C CA  1 
ATOM   8440  C  C   . ARG C 2 67  ? 204.497 263.472 195.970 1.00 118.80 0  50  ARG C C   1 
ATOM   8441  O  O   . ARG C 2 67  ? 205.428 263.121 195.237 1.00 118.80 0  50  ARG C O   1 
ATOM   8442  C  CB  . ARG C 2 67  ? 205.230 265.631 197.011 1.00 118.80 0  50  ARG C CB  1 
ATOM   8443  C  CG  . ARG C 2 67  ? 204.170 266.509 196.366 1.00 118.80 0  50  ARG C CG  1 
ATOM   8444  C  CD  . ARG C 2 67  ? 202.925 266.587 197.235 1.00 118.80 0  50  ARG C CD  1 
ATOM   8445  N  NE  . ARG C 2 67  ? 203.194 267.235 198.515 1.00 118.80 0  50  ARG C NE  1 
ATOM   8446  C  CZ  . ARG C 2 67  ? 202.300 267.359 199.492 1.00 118.80 0  50  ARG C CZ  1 
ATOM   8447  N  NH1 . ARG C 2 67  ? 201.075 266.878 199.336 1.00 118.80 1  50  ARG C NH1 1 
ATOM   8448  N  NH2 . ARG C 2 67  ? 202.632 267.962 200.625 1.00 118.80 0  50  ARG C NH2 1 
ATOM   8449  N  N   . TRP C 2 68  ? 203.218 263.251 195.683 1.00 111.97 0  51  TRP C N   1 
ATOM   8450  C  CA  . TRP C 2 68  ? 202.814 262.590 194.453 1.00 111.97 0  51  TRP C CA  1 
ATOM   8451  C  C   . TRP C 2 68  ? 201.438 263.092 194.048 1.00 111.97 0  51  TRP C C   1 
ATOM   8452  O  O   . TRP C 2 68  ? 200.602 263.413 194.897 1.00 111.97 0  51  TRP C O   1 
ATOM   8453  C  CB  . TRP C 2 68  ? 202.805 261.063 194.606 1.00 111.97 0  51  TRP C CB  1 
ATOM   8454  C  CG  . TRP C 2 68  ? 201.798 260.554 195.594 1.00 111.97 0  51  TRP C CG  1 
ATOM   8455  C  CD1 . TRP C 2 68  ? 200.537 260.106 195.324 1.00 111.97 0  51  TRP C CD1 1 
ATOM   8456  C  CD2 . TRP C 2 68  ? 201.973 260.430 197.010 1.00 111.97 0  51  TRP C CD2 1 
ATOM   8457  N  NE1 . TRP C 2 68  ? 199.914 259.717 196.484 1.00 111.97 0  51  TRP C NE1 1 
ATOM   8458  C  CE2 . TRP C 2 68  ? 200.774 259.905 197.534 1.00 111.97 0  51  TRP C CE2 1 
ATOM   8459  C  CE3 . TRP C 2 68  ? 203.026 260.712 197.886 1.00 111.97 0  51  TRP C CE3 1 
ATOM   8460  C  CZ2 . TRP C 2 68  ? 200.600 259.656 198.894 1.00 111.97 0  51  TRP C CZ2 1 
ATOM   8461  C  CZ3 . TRP C 2 68  ? 202.850 260.464 199.237 1.00 111.97 0  51  TRP C CZ3 1 
ATOM   8462  C  CH2 . TRP C 2 68  ? 201.647 259.942 199.727 1.00 111.97 0  51  TRP C CH2 1 
ATOM   8463  N  N   . SER C 2 69  ? 201.214 263.158 192.738 1.00 111.87 0  52  SER C N   1 
ATOM   8464  C  CA  . SER C 2 69  ? 199.924 263.545 192.183 1.00 111.87 0  52  SER C CA  1 
ATOM   8465  C  C   . SER C 2 69  ? 199.094 262.348 191.746 1.00 111.87 0  52  SER C C   1 
ATOM   8466  O  O   . SER C 2 69  ? 197.886 262.310 191.996 1.00 111.87 0  52  SER C O   1 
ATOM   8467  C  CB  . SER C 2 69  ? 200.120 264.493 190.995 1.00 111.87 0  52  SER C CB  1 
ATOM   8468  O  OG  . SER C 2 69  ? 201.158 264.036 190.145 1.00 111.87 0  52  SER C OG  1 
ATOM   8469  N  N   . ASN C 2 70  ? 199.719 261.370 191.099 1.00 107.91 0  53  ASN C N   1 
ATOM   8470  C  CA  . ASN C 2 70  ? 199.063 260.144 190.677 1.00 107.91 0  53  ASN C CA  1 
ATOM   8471  C  C   . ASN C 2 70  ? 199.624 258.962 191.457 1.00 107.91 0  53  ASN C C   1 
ATOM   8472  O  O   . ASN C 2 70  ? 200.737 259.009 191.988 1.00 107.91 0  53  ASN C O   1 
ATOM   8473  C  CB  . ASN C 2 70  ? 199.239 259.919 189.170 1.00 107.91 0  53  ASN C CB  1 
ATOM   8474  C  CG  . ASN C 2 70  ? 198.160 259.028 188.583 1.00 107.91 0  53  ASN C CG  1 
ATOM   8475  O  OD1 . ASN C 2 70  ? 197.112 258.819 189.193 1.00 107.91 0  53  ASN C OD1 1 
ATOM   8476  N  ND2 . ASN C 2 70  ? 198.413 258.500 187.391 1.00 107.91 0  53  ASN C ND2 1 
ATOM   8477  N  N   . ALA C 2 71  ? 198.829 257.891 191.522 1.00 105.32 0  54  ALA C N   1 
ATOM   8478  C  CA  . ALA C 2 71  ? 199.251 256.679 192.214 1.00 105.32 0  54  ALA C CA  1 
ATOM   8479  C  C   . ALA C 2 71  ? 200.333 255.919 191.458 1.00 105.32 0  54  ALA C C   1 
ATOM   8480  O  O   . ALA C 2 71  ? 201.068 255.141 192.077 1.00 105.32 0  54  ALA C O   1 
ATOM   8481  C  CB  . ALA C 2 71  ? 198.048 255.767 192.456 1.00 105.32 0  54  ALA C CB  1 
ATOM   8482  N  N   . GLY C 2 72  ? 200.447 256.122 190.143 1.00 107.02 0  55  GLY C N   1 
ATOM   8483  C  CA  . GLY C 2 72  ? 201.468 255.429 189.375 1.00 107.02 0  55  GLY C CA  1 
ATOM   8484  C  C   . GLY C 2 72  ? 202.875 255.904 189.678 1.00 107.02 0  55  GLY C C   1 
ATOM   8485  O  O   . GLY C 2 72  ? 203.831 255.131 189.563 1.00 107.02 0  55  GLY C O   1 
ATOM   8486  N  N   . GLU C 2 73  ? 203.021 257.169 190.081 1.00 108.27 0  56  GLU C N   1 
ATOM   8487  C  CA  . GLU C 2 73  ? 204.328 257.676 190.489 1.00 108.27 0  56  GLU C CA  1 
ATOM   8488  C  C   . GLU C 2 73  ? 204.794 257.019 191.783 1.00 108.27 0  56  GLU C C   1 
ATOM   8489  O  O   . GLU C 2 73  ? 205.961 256.622 191.900 1.00 108.27 0  56  GLU C O   1 
ATOM   8490  C  CB  . GLU C 2 73  ? 204.276 259.195 190.644 1.00 108.27 0  56  GLU C CB  1 
ATOM   8491  C  CG  . GLU C 2 73  ? 205.618 259.836 190.945 1.00 108.27 0  56  GLU C CG  1 
ATOM   8492  C  CD  . GLU C 2 73  ? 205.547 261.349 190.960 1.00 108.27 0  56  GLU C CD  1 
ATOM   8493  O  OE1 . GLU C 2 73  ? 204.429 261.892 190.837 1.00 108.27 0  56  GLU C OE1 1 
ATOM   8494  O  OE2 . GLU C 2 73  ? 206.608 261.994 191.095 1.00 108.27 -1 56  GLU C OE2 1 
ATOM   8495  N  N   . LEU C 2 74  ? 203.888 256.871 192.755 1.00 104.56 0  57  LEU C N   1 
ATOM   8496  C  CA  . LEU C 2 74  ? 204.226 256.140 193.971 1.00 104.56 0  57  LEU C CA  1 
ATOM   8497  C  C   . LEU C 2 74  ? 204.435 254.659 193.681 1.00 104.56 0  57  LEU C C   1 
ATOM   8498  O  O   . LEU C 2 74  ? 205.254 254.014 194.344 1.00 104.56 0  57  LEU C O   1 
ATOM   8499  C  CB  . LEU C 2 74  ? 203.134 256.332 195.027 1.00 104.56 0  57  LEU C CB  1 
ATOM   8500  C  CG  . LEU C 2 74  ? 203.458 255.995 196.490 1.00 104.56 0  57  LEU C CG  1 
ATOM   8501  C  CD1 . LEU C 2 74  ? 202.802 256.999 197.412 1.00 104.56 0  57  LEU C CD1 1 
ATOM   8502  C  CD2 . LEU C 2 74  ? 203.018 254.600 196.883 1.00 104.56 0  57  LEU C CD2 1 
ATOM   8503  N  N   . MET C 2 75  ? 203.723 254.117 192.683 1.00 102.55 0  58  MET C N   1 
ATOM   8504  C  CA  . MET C 2 75  ? 203.935 252.736 192.262 1.00 102.55 0  58  MET C CA  1 
ATOM   8505  C  C   . MET C 2 75  ? 205.346 252.535 191.717 1.00 102.55 0  58  MET C C   1 
ATOM   8506  O  O   . MET C 2 75  ? 206.034 251.578 192.087 1.00 102.55 0  58  MET C O   1 
ATOM   8507  C  CB  . MET C 2 75  ? 202.895 252.338 191.214 1.00 102.55 0  58  MET C CB  1 
ATOM   8508  C  CG  . MET C 2 75  ? 201.574 251.853 191.789 1.00 102.55 0  58  MET C CG  1 
ATOM   8509  S  SD  . MET C 2 75  ? 200.308 251.611 190.527 1.00 102.55 0  58  MET C SD  1 
ATOM   8510  C  CE  . MET C 2 75  ? 198.890 251.212 191.544 1.00 102.55 0  58  MET C CE  1 
ATOM   8511  N  N   . GLU C 2 76  ? 205.808 253.453 190.862 1.00 104.64 0  59  GLU C N   1 
ATOM   8512  C  CA  . GLU C 2 76  ? 207.151 253.345 190.300 1.00 104.64 0  59  GLU C CA  1 
ATOM   8513  C  C   . GLU C 2 76  ? 208.213 253.612 191.363 1.00 104.64 0  59  GLU C C   1 
ATOM   8514  O  O   . GLU C 2 76  ? 209.291 253.009 191.320 1.00 104.64 0  59  GLU C O   1 
ATOM   8515  C  CB  . GLU C 2 76  ? 207.287 254.297 189.099 1.00 104.64 0  59  GLU C CB  1 
ATOM   8516  C  CG  . GLU C 2 76  ? 208.535 254.152 188.192 1.00 104.64 0  59  GLU C CG  1 
ATOM   8517  C  CD  . GLU C 2 76  ? 209.821 254.737 188.757 1.00 104.64 0  59  GLU C CD  1 
ATOM   8518  O  OE1 . GLU C 2 76  ? 209.744 255.663 189.593 1.00 104.64 0  59  GLU C OE1 1 
ATOM   8519  O  OE2 . GLU C 2 76  ? 210.908 254.265 188.363 1.00 104.64 -1 59  GLU C OE2 1 
ATOM   8520  N  N   . LEU C 2 77  ? 207.920 254.481 192.334 1.00 101.98 0  60  LEU C N   1 
ATOM   8521  C  CA  . LEU C 2 77  ? 208.872 254.764 193.406 1.00 101.98 0  60  LEU C CA  1 
ATOM   8522  C  C   . LEU C 2 77  ? 209.052 253.559 194.328 1.00 101.98 0  60  LEU C C   1 
ATOM   8523  O  O   . LEU C 2 77  ? 210.187 253.178 194.668 1.00 101.98 0  60  LEU C O   1 
ATOM   8524  C  CB  . LEU C 2 77  ? 208.391 255.996 194.179 1.00 101.98 0  60  LEU C CB  1 
ATOM   8525  C  CG  . LEU C 2 77  ? 209.133 256.607 195.365 1.00 101.98 0  60  LEU C CG  1 
ATOM   8526  C  CD1 . LEU C 2 77  ? 209.258 258.108 195.181 1.00 101.98 0  60  LEU C CD1 1 
ATOM   8527  C  CD2 . LEU C 2 77  ? 208.350 256.326 196.620 1.00 101.98 0  60  LEU C CD2 1 
ATOM   8528  N  N   . ILE C 2 78  ? 207.938 252.931 194.719 1.00 97.34  0  61  ILE C N   1 
ATOM   8529  C  CA  . ILE C 2 78  ? 207.980 251.694 195.500 1.00 97.34  0  61  ILE C CA  1 
ATOM   8530  C  C   . ILE C 2 78  ? 208.618 250.566 194.692 1.00 97.34  0  61  ILE C C   1 
ATOM   8531  O  O   . ILE C 2 78  ? 209.364 249.747 195.242 1.00 97.34  0  61  ILE C O   1 
ATOM   8532  C  CB  . ILE C 2 78  ? 206.552 251.353 195.986 1.00 97.34  0  61  ILE C CB  1 
ATOM   8533  C  CG1 . ILE C 2 78  ? 206.094 252.366 197.037 1.00 97.34  0  61  ILE C CG1 1 
ATOM   8534  C  CG2 . ILE C 2 78  ? 206.462 249.969 196.592 1.00 97.34  0  61  ILE C CG2 1 
ATOM   8535  C  CD1 . ILE C 2 78  ? 206.954 252.389 198.274 1.00 97.34  0  61  ILE C CD1 1 
ATOM   8536  N  N   . ARG C 2 79  ? 208.395 250.546 193.370 1.00 98.48  0  62  ARG C N   1 
ATOM   8537  C  CA  . ARG C 2 79  ? 209.022 249.547 192.506 1.00 98.48  0  62  ARG C CA  1 
ATOM   8538  C  C   . ARG C 2 79  ? 210.538 249.713 192.453 1.00 98.48  0  62  ARG C C   1 
ATOM   8539  O  O   . ARG C 2 79  ? 211.273 248.720 192.484 1.00 98.48  0  62  ARG C O   1 
ATOM   8540  C  CB  . ARG C 2 79  ? 208.440 249.637 191.095 1.00 98.48  0  62  ARG C CB  1 
ATOM   8541  C  CG  . ARG C 2 79  ? 207.219 248.770 190.836 1.00 98.48  0  62  ARG C CG  1 
ATOM   8542  C  CD  . ARG C 2 79  ? 206.725 248.989 189.415 1.00 98.48  0  62  ARG C CD  1 
ATOM   8543  N  NE  . ARG C 2 79  ? 205.342 248.563 189.227 1.00 98.48  0  62  ARG C NE  1 
ATOM   8544  C  CZ  . ARG C 2 79  ? 204.985 247.377 188.746 1.00 98.48  0  62  ARG C CZ  1 
ATOM   8545  N  NH1 . ARG C 2 79  ? 205.910 246.490 188.403 1.00 98.48  1  62  ARG C NH1 1 
ATOM   8546  N  NH2 . ARG C 2 79  ? 203.702 247.078 188.606 1.00 98.48  0  62  ARG C NH2 1 
ATOM   8547  N  N   . ARG C 2 80  ? 211.020 250.957 192.374 1.00 103.26 0  63  ARG C N   1 
ATOM   8548  C  CA  . ARG C 2 80  ? 212.459 251.205 192.333 1.00 103.26 0  63  ARG C CA  1 
ATOM   8549  C  C   . ARG C 2 80  ? 213.121 250.842 193.659 1.00 103.26 0  63  ARG C C   1 
ATOM   8550  O  O   . ARG C 2 80  ? 214.189 250.211 193.676 1.00 103.26 0  63  ARG C O   1 
ATOM   8551  C  CB  . ARG C 2 80  ? 212.739 252.667 191.977 1.00 103.26 0  63  ARG C CB  1 
ATOM   8552  C  CG  . ARG C 2 80  ? 214.224 253.006 191.919 1.00 103.26 0  63  ARG C CG  1 
ATOM   8553  C  CD  . ARG C 2 80  ? 214.488 254.482 191.656 1.00 103.26 0  63  ARG C CD  1 
ATOM   8554  N  NE  . ARG C 2 80  ? 214.099 254.891 190.310 1.00 103.26 0  63  ARG C NE  1 
ATOM   8555  C  CZ  . ARG C 2 80  ? 213.139 255.771 190.049 1.00 103.26 0  63  ARG C CZ  1 
ATOM   8556  N  NH1 . ARG C 2 80  ? 212.851 256.088 188.794 1.00 103.26 1  63  ARG C NH1 1 
ATOM   8557  N  NH2 . ARG C 2 80  ? 212.473 256.341 191.044 1.00 103.26 0  63  ARG C NH2 1 
ATOM   8558  N  N   . GLU C 2 81  ? 212.491 251.212 194.781 1.00 99.82  0  64  GLU C N   1 
ATOM   8559  C  CA  . GLU C 2 81  ? 213.062 250.843 196.075 1.00 99.82  0  64  GLU C CA  1 
ATOM   8560  C  C   . GLU C 2 81  ? 212.987 249.340 196.328 1.00 99.82  0  64  GLU C C   1 
ATOM   8561  O  O   . GLU C 2 81  ? 213.892 248.776 196.952 1.00 99.82  0  64  GLU C O   1 
ATOM   8562  C  CB  . GLU C 2 81  ? 212.382 251.608 197.206 1.00 99.82  0  64  GLU C CB  1 
ATOM   8563  C  CG  . GLU C 2 81  ? 212.661 253.094 197.168 1.00 99.82  0  64  GLU C CG  1 
ATOM   8564  C  CD  . GLU C 2 81  ? 211.715 253.881 198.037 1.00 99.82  0  64  GLU C CD  1 
ATOM   8565  O  OE1 . GLU C 2 81  ? 210.587 254.152 197.589 1.00 99.82  0  64  GLU C OE1 1 
ATOM   8566  O  OE2 . GLU C 2 81  ? 212.108 254.249 199.161 1.00 99.82  -1 64  GLU C OE2 1 
ATOM   8567  N  N   . GLY C 2 82  ? 211.953 248.667 195.818 1.00 98.28  0  65  GLY C N   1 
ATOM   8568  C  CA  . GLY C 2 82  ? 211.910 247.220 195.918 1.00 98.28  0  65  GLY C CA  1 
ATOM   8569  C  C   . GLY C 2 82  ? 212.933 246.530 195.039 1.00 98.28  0  65  GLY C C   1 
ATOM   8570  O  O   . GLY C 2 82  ? 213.475 245.490 195.422 1.00 98.28  0  65  GLY C O   1 
ATOM   8571  N  N   . ARG C 2 83  ? 213.215 247.098 193.861 1.00 98.82  0  66  ARG C N   1 
ATOM   8572  C  CA  . ARG C 2 83  ? 214.297 246.592 193.020 1.00 98.82  0  66  ARG C CA  1 
ATOM   8573  C  C   . ARG C 2 83  ? 215.642 246.732 193.718 1.00 98.82  0  66  ARG C C   1 
ATOM   8574  O  O   . ARG C 2 83  ? 216.474 245.819 193.665 1.00 98.82  0  66  ARG C O   1 
ATOM   8575  C  CB  . ARG C 2 83  ? 214.311 247.329 191.681 1.00 98.82  0  66  ARG C CB  1 
ATOM   8576  C  CG  . ARG C 2 83  ? 213.326 246.794 190.658 1.00 98.82  0  66  ARG C CG  1 
ATOM   8577  C  CD  . ARG C 2 83  ? 213.291 247.682 189.424 1.00 98.82  0  66  ARG C CD  1 
ATOM   8578  N  NE  . ARG C 2 83  ? 212.151 247.381 188.563 1.00 98.82  0  66  ARG C NE  1 
ATOM   8579  C  CZ  . ARG C 2 83  ? 212.164 246.471 187.594 1.00 98.82  0  66  ARG C CZ  1 
ATOM   8580  N  NH1 . ARG C 2 83  ? 213.263 245.767 187.358 1.00 98.82  1  66  ARG C NH1 1 
ATOM   8581  N  NH2 . ARG C 2 83  ? 211.079 246.264 186.861 1.00 98.82  0  66  ARG C NH2 1 
ATOM   8582  N  N   . ARG C 2 84  ? 215.854 247.860 194.405 1.00 101.12 0  67  ARG C N   1 
ATOM   8583  C  CA  . ARG C 2 84  ? 217.074 248.041 195.191 1.00 101.12 0  67  ARG C CA  1 
ATOM   8584  C  C   . ARG C 2 84  ? 217.143 247.059 196.359 1.00 101.12 0  67  ARG C C   1 
ATOM   8585  O  O   . ARG C 2 84  ? 218.219 246.532 196.672 1.00 101.12 0  67  ARG C O   1 
ATOM   8586  C  CB  . ARG C 2 84  ? 217.161 249.479 195.699 1.00 101.12 0  67  ARG C CB  1 
ATOM   8587  C  CG  . ARG C 2 84  ? 217.424 250.506 194.612 1.00 101.12 0  67  ARG C CG  1 
ATOM   8588  C  CD  . ARG C 2 84  ? 217.641 251.891 195.202 1.00 101.12 0  67  ARG C CD  1 
ATOM   8589  N  NE  . ARG C 2 84  ? 218.933 252.006 195.873 1.00 101.12 0  67  ARG C NE  1 
ATOM   8590  C  CZ  . ARG C 2 84  ? 219.090 252.062 197.192 1.00 101.12 0  67  ARG C CZ  1 
ATOM   8591  N  NH1 . ARG C 2 84  ? 218.033 252.011 197.991 1.00 101.12 1  67  ARG C NH1 1 
ATOM   8592  N  NH2 . ARG C 2 84  ? 220.304 252.167 197.714 1.00 101.12 0  67  ARG C NH2 1 
ATOM   8593  N  N   . MET C 2 85  ? 216.004 246.787 197.003 1.00 96.98  0  68  MET C N   1 
ATOM   8594  C  CA  . MET C 2 85  ? 216.010 245.904 198.165 1.00 96.98  0  68  MET C CA  1 
ATOM   8595  C  C   . MET C 2 85  ? 216.196 244.440 197.776 1.00 96.98  0  68  MET C C   1 
ATOM   8596  O  O   . MET C 2 85  ? 216.797 243.675 198.538 1.00 96.98  0  68  MET C O   1 
ATOM   8597  C  CB  . MET C 2 85  ? 214.725 246.089 198.973 1.00 96.98  0  68  MET C CB  1 
ATOM   8598  C  CG  . MET C 2 85  ? 214.858 247.113 200.092 1.00 96.98  0  68  MET C CG  1 
ATOM   8599  S  SD  . MET C 2 85  ? 213.345 247.366 201.040 1.00 96.98  0  68  MET C SD  1 
ATOM   8600  C  CE  . MET C 2 85  ? 212.380 248.344 199.893 1.00 96.98  0  68  MET C CE  1 
ATOM   8601  N  N   . THR C 2 86  ? 215.695 244.026 196.609 1.00 96.28  0  69  THR C N   1 
ATOM   8602  C  CA  . THR C 2 86  ? 216.012 242.687 196.123 1.00 96.28  0  69  THR C CA  1 
ATOM   8603  C  C   . THR C 2 86  ? 217.402 242.607 195.506 1.00 96.28  0  69  THR C C   1 
ATOM   8604  O  O   . THR C 2 86  ? 217.978 241.514 195.458 1.00 96.28  0  69  THR C O   1 
ATOM   8605  C  CB  . THR C 2 86  ? 214.970 242.200 195.110 1.00 96.28  0  69  THR C CB  1 
ATOM   8606  O  OG1 . THR C 2 86  ? 215.060 242.971 193.904 1.00 96.28  0  69  THR C OG1 1 
ATOM   8607  C  CG2 . THR C 2 86  ? 213.562 242.246 195.687 1.00 96.28  0  69  THR C CG2 1 
ATOM   8608  N  N   . ALA C 2 87  ? 217.953 243.728 195.032 1.00 96.96  0  70  ALA C N   1 
ATOM   8609  C  CA  . ALA C 2 87  ? 219.348 243.738 194.615 1.00 96.96  0  70  ALA C CA  1 
ATOM   8610  C  C   . ALA C 2 87  ? 220.297 243.701 195.805 1.00 96.96  0  70  ALA C C   1 
ATOM   8611  O  O   . ALA C 2 87  ? 221.460 243.318 195.641 1.00 96.96  0  70  ALA C O   1 
ATOM   8612  C  CB  . ALA C 2 87  ? 219.632 244.971 193.757 1.00 96.96  0  70  ALA C CB  1 
ATOM   8613  N  N   . ALA C 2 88  ? 219.829 244.105 196.991 1.00 95.81  0  71  ALA C N   1 
ATOM   8614  C  CA  . ALA C 2 88  ? 220.641 243.969 198.196 1.00 95.81  0  71  ALA C CA  1 
ATOM   8615  C  C   . ALA C 2 88  ? 220.839 242.504 198.571 1.00 95.81  0  71  ALA C C   1 
ATOM   8616  O  O   . ALA C 2 88  ? 221.954 242.089 198.908 1.00 95.81  0  71  ALA C O   1 
ATOM   8617  C  CB  . ALA C 2 88  ? 220.001 244.737 199.351 1.00 95.81  0  71  ALA C CB  1 
ATOM   8618  N  N   . GLN C 2 89  ? 219.773 241.709 198.518 1.00 90.52  0  72  GLN C N   1 
ATOM   8619  C  CA  . GLN C 2 89  ? 219.846 240.280 198.795 1.00 90.52  0  72  GLN C CA  1 
ATOM   8620  C  C   . GLN C 2 89  ? 218.754 239.558 198.016 1.00 90.52  0  72  GLN C C   1 
ATOM   8621  O  O   . GLN C 2 89  ? 217.567 239.698 198.338 1.00 90.52  0  72  GLN C O   1 
ATOM   8622  C  CB  . GLN C 2 89  ? 219.710 240.007 200.294 1.00 90.52  0  72  GLN C CB  1 
ATOM   8623  C  CG  . GLN C 2 89  ? 219.938 238.555 200.677 1.00 90.52  0  72  GLN C CG  1 
ATOM   8624  C  CD  . GLN C 2 89  ? 221.385 238.134 200.537 1.00 90.52  0  72  GLN C CD  1 
ATOM   8625  O  OE1 . GLN C 2 89  ? 221.743 237.395 199.620 1.00 90.52  0  72  GLN C OE1 1 
ATOM   8626  N  NE2 . GLN C 2 89  ? 222.228 238.599 201.452 1.00 90.52  0  72  GLN C NE2 1 
ATOM   8627  N  N   . PRO C 2 90  ? 219.107 238.782 196.987 1.00 87.83  0  73  PRO C N   1 
ATOM   8628  C  CA  . PRO C 2 90  ? 218.074 238.152 196.153 1.00 87.83  0  73  PRO C CA  1 
ATOM   8629  C  C   . PRO C 2 90  ? 217.400 236.954 196.805 1.00 87.83  0  73  PRO C C   1 
ATOM   8630  O  O   . PRO C 2 90  ? 216.240 236.658 196.502 1.00 87.83  0  73  PRO C O   1 
ATOM   8631  C  CB  . PRO C 2 90  ? 218.851 237.738 194.897 1.00 87.83  0  73  PRO C CB  1 
ATOM   8632  C  CG  . PRO C 2 90  ? 220.243 237.519 195.378 1.00 87.83  0  73  PRO C CG  1 
ATOM   8633  C  CD  . PRO C 2 90  ? 220.469 238.496 196.501 1.00 87.83  0  73  PRO C CD  1 
ATOM   8634  N  N   . SER C 2 91  ? 218.103 236.256 197.698 1.00 85.34  0  74  SER C N   1 
ATOM   8635  C  CA  . SER C 2 91  ? 217.515 235.091 198.346 1.00 85.34  0  74  SER C CA  1 
ATOM   8636  C  C   . SER C 2 91  ? 216.583 235.454 199.492 1.00 85.34  0  74  SER C C   1 
ATOM   8637  O  O   . SER C 2 91  ? 215.828 234.590 199.952 1.00 85.34  0  74  SER C O   1 
ATOM   8638  C  CB  . SER C 2 91  ? 218.615 234.166 198.867 1.00 85.34  0  74  SER C CB  1 
ATOM   8639  O  OG  . SER C 2 91  ? 218.999 234.543 200.175 1.00 85.34  0  74  SER C OG  1 
ATOM   8640  N  N   . GLU C 2 92  ? 216.617 236.696 199.963 1.00 91.48  0  75  GLU C N   1 
ATOM   8641  C  CA  . GLU C 2 92  ? 215.759 237.157 201.051 1.00 91.48  0  75  GLU C CA  1 
ATOM   8642  C  C   . GLU C 2 92  ? 214.640 237.968 200.411 1.00 91.48  0  75  GLU C C   1 
ATOM   8643  O  O   . GLU C 2 92  ? 214.796 239.162 200.144 1.00 91.48  0  75  GLU C O   1 
ATOM   8644  C  CB  . GLU C 2 92  ? 216.553 237.970 202.066 1.00 91.48  0  75  GLU C CB  1 
ATOM   8645  C  CG  . GLU C 2 92  ? 215.852 238.165 203.395 1.00 91.48  0  75  GLU C CG  1 
ATOM   8646  C  CD  . GLU C 2 92  ? 216.761 238.789 204.431 1.00 91.48  0  75  GLU C CD  1 
ATOM   8647  O  OE1 . GLU C 2 92  ? 217.663 239.559 204.041 1.00 91.48  0  75  GLU C OE1 1 
ATOM   8648  O  OE2 . GLU C 2 92  ? 216.584 238.500 205.633 1.00 91.48  -1 75  GLU C OE2 1 
ATOM   8649  N  N   . THR C 2 93  ? 213.508 237.314 200.165 1.00 86.69  0  76  THR C N   1 
ATOM   8650  C  CA  . THR C 2 93  ? 212.415 237.910 199.412 1.00 86.69  0  76  THR C CA  1 
ATOM   8651  C  C   . THR C 2 93  ? 211.248 238.337 200.290 1.00 86.69  0  76  THR C C   1 
ATOM   8652  O  O   . THR C 2 93  ? 210.177 238.645 199.759 1.00 86.69  0  76  THR C O   1 
ATOM   8653  C  CB  . THR C 2 93  ? 211.924 236.938 198.339 1.00 86.69  0  76  THR C CB  1 
ATOM   8654  O  OG1 . THR C 2 93  ? 210.784 237.494 197.672 1.00 86.69  0  76  THR C OG1 1 
ATOM   8655  C  CG2 . THR C 2 93  ? 211.540 235.617 198.968 1.00 86.69  0  76  THR C CG2 1 
ATOM   8656  N  N   . THR C 2 94  ? 211.423 238.343 201.616 1.00 84.63  0  77  THR C N   1 
ATOM   8657  C  CA  . THR C 2 94  ? 210.361 238.800 202.510 1.00 84.63  0  77  THR C CA  1 
ATOM   8658  C  C   . THR C 2 94  ? 210.107 240.292 202.327 1.00 84.63  0  77  THR C C   1 
ATOM   8659  O  O   . THR C 2 94  ? 208.949 240.734 202.275 1.00 84.63  0  77  THR C O   1 
ATOM   8660  C  CB  . THR C 2 94  ? 210.731 238.481 203.961 1.00 84.63  0  77  THR C CB  1 
ATOM   8661  O  OG1 . THR C 2 94  ? 210.916 237.068 204.106 1.00 84.63  0  77  THR C OG1 1 
ATOM   8662  C  CG2 . THR C 2 94  ? 209.638 238.934 204.919 1.00 84.63  0  77  THR C CG2 1 
ATOM   8663  N  N   . VAL C 2 95  ? 211.181 241.070 202.171 1.00 85.07  0  78  VAL C N   1 
ATOM   8664  C  CA  . VAL C 2 95  ? 211.050 242.490 201.870 1.00 85.07  0  78  VAL C CA  1 
ATOM   8665  C  C   . VAL C 2 95  ? 210.442 242.691 200.485 1.00 85.07  0  78  VAL C C   1 
ATOM   8666  O  O   . VAL C 2 95  ? 209.636 243.609 200.282 1.00 85.07  0  78  VAL C O   1 
ATOM   8667  C  CB  . VAL C 2 95  ? 212.420 243.185 202.010 1.00 85.07  0  78  VAL C CB  1 
ATOM   8668  C  CG1 . VAL C 2 95  ? 212.790 243.314 203.471 1.00 85.07  0  78  VAL C CG1 1 
ATOM   8669  C  CG2 . VAL C 2 95  ? 213.511 242.408 201.282 1.00 85.07  0  78  VAL C CG2 1 
ATOM   8670  N  N   . GLY C 2 96  ? 210.756 241.801 199.539 1.00 85.23  0  79  GLY C N   1 
ATOM   8671  C  CA  . GLY C 2 96  ? 210.218 241.928 198.194 1.00 85.23  0  79  GLY C CA  1 
ATOM   8672  C  C   . GLY C 2 96  ? 208.730 241.643 198.129 1.00 85.23  0  79  GLY C C   1 
ATOM   8673  O  O   . GLY C 2 96  ? 207.968 242.397 197.515 1.00 85.23  0  79  GLY C O   1 
ATOM   8674  N  N   . ASN C 2 97  ? 208.286 240.567 198.785 1.00 81.31  0  80  ASN C N   1 
ATOM   8675  C  CA  . ASN C 2 97  ? 206.856 240.287 198.778 1.00 81.31  0  80  ASN C CA  1 
ATOM   8676  C  C   . ASN C 2 97  ? 206.079 241.232 199.685 1.00 81.31  0  80  ASN C C   1 
ATOM   8677  O  O   . ASN C 2 97  ? 204.891 241.447 199.445 1.00 81.31  0  80  ASN C O   1 
ATOM   8678  C  CB  . ASN C 2 97  ? 206.572 238.824 199.145 1.00 81.31  0  80  ASN C CB  1 
ATOM   8679  C  CG  . ASN C 2 97  ? 207.180 238.401 200.468 1.00 81.31  0  80  ASN C CG  1 
ATOM   8680  O  OD1 . ASN C 2 97  ? 206.828 238.909 201.532 1.00 81.31  0  80  ASN C OD1 1 
ATOM   8681  N  ND2 . ASN C 2 97  ? 208.085 237.433 200.406 1.00 81.31  0  80  ASN C ND2 1 
ATOM   8682  N  N   . MET C 2 98  ? 206.717 241.848 200.682 1.00 80.96  0  81  MET C N   1 
ATOM   8683  C  CA  . MET C 2 98  ? 205.987 242.858 201.442 1.00 80.96  0  81  MET C CA  1 
ATOM   8684  C  C   . MET C 2 98  ? 205.859 244.167 200.667 1.00 80.96  0  81  MET C C   1 
ATOM   8685  O  O   . MET C 2 98  ? 204.823 244.841 200.766 1.00 80.96  0  81  MET C O   1 
ATOM   8686  C  CB  . MET C 2 98  ? 206.644 243.078 202.802 1.00 80.96  0  81  MET C CB  1 
ATOM   8687  C  CG  . MET C 2 98  ? 206.130 242.107 203.859 1.00 80.96  0  81  MET C CG  1 
ATOM   8688  S  SD  . MET C 2 98  ? 204.331 242.163 204.042 1.00 80.96  0  81  MET C SD  1 
ATOM   8689  C  CE  . MET C 2 98  ? 203.832 240.563 203.401 1.00 80.96  0  81  MET C CE  1 
ATOM   8690  N  N   . VAL C 2 99  ? 206.879 244.518 199.875 1.00 81.52  0  82  VAL C N   1 
ATOM   8691  C  CA  . VAL C 2 99  ? 206.760 245.623 198.924 1.00 81.52  0  82  VAL C CA  1 
ATOM   8692  C  C   . VAL C 2 99  ? 205.667 245.329 197.898 1.00 81.52  0  82  VAL C C   1 
ATOM   8693  O  O   . VAL C 2 99  ? 204.861 246.205 197.554 1.00 81.52  0  82  VAL C O   1 
ATOM   8694  C  CB  . VAL C 2 99  ? 208.133 245.883 198.267 1.00 81.52  0  82  VAL C CB  1 
ATOM   8695  C  CG1 . VAL C 2 99  ? 208.007 246.612 196.944 1.00 81.52  0  82  VAL C CG1 1 
ATOM   8696  C  CG2 . VAL C 2 99  ? 209.018 246.681 199.210 1.00 81.52  0  82  VAL C CG2 1 
ATOM   8697  N  N   . ARG C 2 100 ? 205.583 244.073 197.447 1.00 82.18  0  83  ARG C N   1 
ATOM   8698  C  CA  . ARG C 2 100 ? 204.533 243.666 196.516 1.00 82.18  0  83  ARG C CA  1 
ATOM   8699  C  C   . ARG C 2 100 ? 203.149 243.707 197.161 1.00 82.18  0  83  ARG C C   1 
ATOM   8700  O  O   . ARG C 2 100 ? 202.162 244.031 196.490 1.00 82.18  0  83  ARG C O   1 
ATOM   8701  C  CB  . ARG C 2 100 ? 204.831 242.266 195.990 1.00 82.18  0  83  ARG C CB  1 
ATOM   8702  C  CG  . ARG C 2 100 ? 204.110 241.917 194.711 1.00 82.18  0  83  ARG C CG  1 
ATOM   8703  C  CD  . ARG C 2 100 ? 204.738 240.702 194.062 1.00 82.18  0  83  ARG C CD  1 
ATOM   8704  N  NE  . ARG C 2 100 ? 206.046 240.998 193.482 1.00 82.18  0  83  ARG C NE  1 
ATOM   8705  C  CZ  . ARG C 2 100 ? 207.201 240.568 193.980 1.00 82.18  0  83  ARG C CZ  1 
ATOM   8706  N  NH1 . ARG C 2 100 ? 207.217 239.821 195.075 1.00 82.18  1  83  ARG C NH1 1 
ATOM   8707  N  NH2 . ARG C 2 100 ? 208.341 240.887 193.384 1.00 82.18  0  83  ARG C NH2 1 
ATOM   8708  N  N   . ARG C 2 101 ? 203.062 243.383 198.453 1.00 79.46  0  84  ARG C N   1 
ATOM   8709  C  CA  . ARG C 2 101 ? 201.794 243.455 199.171 1.00 79.46  0  84  ARG C CA  1 
ATOM   8710  C  C   . ARG C 2 101 ? 201.331 244.899 199.326 1.00 79.46  0  84  ARG C C   1 
ATOM   8711  O  O   . ARG C 2 101 ? 200.140 245.194 199.165 1.00 79.46  0  84  ARG C O   1 
ATOM   8712  C  CB  . ARG C 2 101 ? 201.935 242.784 200.537 1.00 79.46  0  84  ARG C CB  1 
ATOM   8713  C  CG  . ARG C 2 101 ? 200.675 242.796 201.383 1.00 79.46  0  84  ARG C CG  1 
ATOM   8714  C  CD  . ARG C 2 101 ? 199.599 241.912 200.781 1.00 79.46  0  84  ARG C CD  1 
ATOM   8715  N  NE  . ARG C 2 101 ? 198.355 241.965 201.542 1.00 79.46  0  84  ARG C NE  1 
ATOM   8716  C  CZ  . ARG C 2 101 ? 198.077 241.174 202.572 1.00 79.46  0  84  ARG C CZ  1 
ATOM   8717  N  NH1 . ARG C 2 101 ? 198.957 240.263 202.967 1.00 79.46  1  84  ARG C NH1 1 
ATOM   8718  N  NH2 . ARG C 2 101 ? 196.920 241.291 203.207 1.00 79.46  0  84  ARG C NH2 1 
ATOM   8719  N  N   . VAL C 2 102 ? 202.263 245.810 199.621 1.00 82.90  0  85  VAL C N   1 
ATOM   8720  C  CA  . VAL C 2 102 ? 201.936 247.235 199.677 1.00 82.90  0  85  VAL C CA  1 
ATOM   8721  C  C   . VAL C 2 102 ? 201.529 247.749 198.294 1.00 82.90  0  85  VAL C C   1 
ATOM   8722  O  O   . VAL C 2 102 ? 200.613 248.576 198.167 1.00 82.90  0  85  VAL C O   1 
ATOM   8723  C  CB  . VAL C 2 102 ? 203.127 248.013 200.274 1.00 82.90  0  85  VAL C CB  1 
ATOM   8724  C  CG1 . VAL C 2 102 ? 202.959 249.523 200.140 1.00 82.90  0  85  VAL C CG1 1 
ATOM   8725  C  CG2 . VAL C 2 102 ? 203.298 247.646 201.735 1.00 82.90  0  85  VAL C CG2 1 
ATOM   8726  N  N   . LEU C 2 103 ? 202.158 247.222 197.237 1.00 87.73  0  86  LEU C N   1 
ATOM   8727  C  CA  . LEU C 2 103 ? 201.781 247.584 195.872 1.00 87.73  0  86  LEU C CA  1 
ATOM   8728  C  C   . LEU C 2 103 ? 200.372 247.108 195.529 1.00 87.73  0  86  LEU C C   1 
ATOM   8729  O  O   . LEU C 2 103 ? 199.601 247.840 194.897 1.00 87.73  0  86  LEU C O   1 
ATOM   8730  C  CB  . LEU C 2 103 ? 202.790 247.008 194.880 1.00 87.73  0  86  LEU C CB  1 
ATOM   8731  C  CG  . LEU C 2 103 ? 204.052 247.833 194.631 1.00 87.73  0  86  LEU C CG  1 
ATOM   8732  C  CD1 . LEU C 2 103 ? 205.060 247.035 193.823 1.00 87.73  0  86  LEU C CD1 1 
ATOM   8733  C  CD2 . LEU C 2 103 ? 203.707 249.136 193.928 1.00 87.73  0  86  LEU C CD2 1 
ATOM   8734  N  N   . LYS C 2 104 ? 200.006 245.897 195.951 1.00 83.71  0  87  LYS C N   1 
ATOM   8735  C  CA  . LYS C 2 104 ? 198.642 245.437 195.705 1.00 83.71  0  87  LYS C CA  1 
ATOM   8736  C  C   . LYS C 2 104 ? 197.632 246.187 196.565 1.00 83.71  0  87  LYS C C   1 
ATOM   8737  O  O   . LYS C 2 104 ? 196.490 246.388 196.135 1.00 83.71  0  87  LYS C O   1 
ATOM   8738  C  CB  . LYS C 2 104 ? 198.519 243.934 195.943 1.00 83.71  0  87  LYS C CB  1 
ATOM   8739  C  CG  . LYS C 2 104 ? 197.459 243.294 195.060 1.00 83.71  0  87  LYS C CG  1 
ATOM   8740  C  CD  . LYS C 2 104 ? 196.740 242.154 195.750 1.00 83.71  0  87  LYS C CD  1 
ATOM   8741  C  CE  . LYS C 2 104 ? 195.725 241.518 194.815 1.00 83.71  0  87  LYS C CE  1 
ATOM   8742  N  NZ  . LYS C 2 104 ? 195.028 240.362 195.440 1.00 83.71  1  87  LYS C NZ  1 
ATOM   8743  N  N   . ILE C 2 105 ? 198.043 246.637 197.755 1.00 88.29  0  88  ILE C N   1 
ATOM   8744  C  CA  . ILE C 2 105 ? 197.158 247.419 198.616 1.00 88.29  0  88  ILE C CA  1 
ATOM   8745  C  C   . ILE C 2 105 ? 196.866 248.781 197.990 1.00 88.29  0  88  ILE C C   1 
ATOM   8746  O  O   . ILE C 2 105 ? 195.706 249.212 197.915 1.00 88.29  0  88  ILE C O   1 
ATOM   8747  C  CB  . ILE C 2 105 ? 197.771 247.549 200.025 1.00 88.29  0  88  ILE C CB  1 
ATOM   8748  C  CG1 . ILE C 2 105 ? 197.494 246.287 200.843 1.00 88.29  0  88  ILE C CG1 1 
ATOM   8749  C  CG2 . ILE C 2 105 ? 197.233 248.769 200.769 1.00 88.29  0  88  ILE C CG2 1 
ATOM   8750  C  CD1 . ILE C 2 105 ? 198.154 246.285 202.205 1.00 88.29  0  88  ILE C CD1 1 
ATOM   8751  N  N   . ILE C 2 106 ? 197.905 249.460 197.490 1.00 93.63  0  89  ILE C N   1 
ATOM   8752  C  CA  . ILE C 2 106 ? 197.674 250.753 196.846 1.00 93.63  0  89  ILE C CA  1 
ATOM   8753  C  C   . ILE C 2 106 ? 196.966 250.573 195.504 1.00 93.63  0  89  ILE C C   1 
ATOM   8754  O  O   . ILE C 2 106 ? 196.204 251.452 195.084 1.00 93.63  0  89  ILE C O   1 
ATOM   8755  C  CB  . ILE C 2 106 ? 198.983 251.564 196.705 1.00 93.63  0  89  ILE C CB  1 
ATOM   8756  C  CG1 . ILE C 2 106 ? 199.937 250.932 195.691 1.00 93.63  0  89  ILE C CG1 1 
ATOM   8757  C  CG2 . ILE C 2 106 ? 199.659 251.741 198.059 1.00 93.63  0  89  ILE C CG2 1 
ATOM   8758  C  CD1 . ILE C 2 106 ? 201.248 251.639 195.534 1.00 93.63  0  89  ILE C CD1 1 
ATOM   8759  N  N   . ARG C 2 107 ? 197.132 249.413 194.853 1.00 94.14  0  90  ARG C N   1 
ATOM   8760  C  CA  . ARG C 2 107 ? 196.415 249.148 193.609 1.00 94.14  0  90  ARG C CA  1 
ATOM   8761  C  C   . ARG C 2 107 ? 194.921 248.965 193.855 1.00 94.14  0  90  ARG C C   1 
ATOM   8762  O  O   . ARG C 2 107 ? 194.093 249.553 193.148 1.00 94.14  0  90  ARG C O   1 
ATOM   8763  C  CB  . ARG C 2 107 ? 197.002 247.921 192.913 1.00 94.14  0  90  ARG C CB  1 
ATOM   8764  C  CG  . ARG C 2 107 ? 196.315 247.573 191.603 1.00 94.14  0  90  ARG C CG  1 
ATOM   8765  C  CD  . ARG C 2 107 ? 197.044 246.460 190.873 1.00 94.14  0  90  ARG C CD  1 
ATOM   8766  N  NE  . ARG C 2 107 ? 198.254 246.939 190.212 1.00 94.14  0  90  ARG C NE  1 
ATOM   8767  C  CZ  . ARG C 2 107 ? 199.485 246.718 190.660 1.00 94.14  0  90  ARG C CZ  1 
ATOM   8768  N  NH1 . ARG C 2 107 ? 199.668 246.025 191.775 1.00 94.14  1  90  ARG C NH1 1 
ATOM   8769  N  NH2 . ARG C 2 107 ? 200.531 247.190 189.997 1.00 94.14  0  90  ARG C NH2 1 
ATOM   8770  N  N   . GLU C 2 108 ? 194.553 248.170 194.867 1.00 101.17 0  91  GLU C N   1 
ATOM   8771  C  CA  . GLU C 2 108 ? 193.132 247.977 195.146 1.00 101.17 0  91  GLU C CA  1 
ATOM   8772  C  C   . GLU C 2 108 ? 192.503 249.233 195.742 1.00 101.17 0  91  GLU C C   1 
ATOM   8773  O  O   . GLU C 2 108 ? 191.315 249.490 195.517 1.00 101.17 0  91  GLU C O   1 
ATOM   8774  C  CB  . GLU C 2 108 ? 192.907 246.762 196.056 1.00 101.17 0  91  GLU C CB  1 
ATOM   8775  C  CG  . GLU C 2 108 ? 193.520 246.833 197.445 1.00 101.17 0  91  GLU C CG  1 
ATOM   8776  C  CD  . GLU C 2 108 ? 192.546 247.328 198.496 1.00 101.17 0  91  GLU C CD  1 
ATOM   8777  O  OE1 . GLU C 2 108 ? 193.000 247.728 199.589 1.00 101.17 0  91  GLU C OE1 1 
ATOM   8778  O  OE2 . GLU C 2 108 ? 191.326 247.315 198.229 1.00 101.17 -1 91  GLU C OE2 1 
ATOM   8779  N  N   . GLU C 2 109 ? 193.282 250.051 196.459 1.00 102.88 0  92  GLU C N   1 
ATOM   8780  C  CA  . GLU C 2 109 ? 192.728 251.300 196.972 1.00 102.88 0  92  GLU C CA  1 
ATOM   8781  C  C   . GLU C 2 109 ? 192.531 252.329 195.865 1.00 102.88 0  92  GLU C C   1 
ATOM   8782  O  O   . GLU C 2 109 ? 191.530 253.056 195.866 1.00 102.88 0  92  GLU C O   1 
ATOM   8783  C  CB  . GLU C 2 109 ? 193.610 251.857 198.086 1.00 102.88 0  92  GLU C CB  1 
ATOM   8784  C  CG  . GLU C 2 109 ? 193.349 251.180 199.408 1.00 102.88 0  92  GLU C CG  1 
ATOM   8785  C  CD  . GLU C 2 109 ? 192.002 251.572 199.980 1.00 102.88 0  92  GLU C CD  1 
ATOM   8786  O  OE1 . GLU C 2 109 ? 191.565 252.720 199.752 1.00 102.88 0  92  GLU C OE1 1 
ATOM   8787  O  OE2 . GLU C 2 109 ? 191.366 250.726 200.637 1.00 102.88 -1 92  GLU C OE2 1 
ATOM   8788  N  N   . TYR C 2 110 ? 193.452 252.389 194.896 1.00 106.42 0  93  TYR C N   1 
ATOM   8789  C  CA  . TYR C 2 110 ? 193.232 253.247 193.737 1.00 106.42 0  93  TYR C CA  1 
ATOM   8790  C  C   . TYR C 2 110 ? 192.083 252.736 192.876 1.00 106.42 0  93  TYR C C   1 
ATOM   8791  O  O   . TYR C 2 110 ? 191.366 253.536 192.266 1.00 106.42 0  93  TYR C O   1 
ATOM   8792  C  CB  . TYR C 2 110 ? 194.515 253.358 192.913 1.00 106.42 0  93  TYR C CB  1 
ATOM   8793  C  CG  . TYR C 2 110 ? 194.390 254.251 191.699 1.00 106.42 0  93  TYR C CG  1 
ATOM   8794  C  CD1 . TYR C 2 110 ? 194.314 255.633 191.835 1.00 106.42 0  93  TYR C CD1 1 
ATOM   8795  C  CD2 . TYR C 2 110 ? 194.351 253.713 190.417 1.00 106.42 0  93  TYR C CD2 1 
ATOM   8796  C  CE1 . TYR C 2 110 ? 194.201 256.456 190.728 1.00 106.42 0  93  TYR C CE1 1 
ATOM   8797  C  CE2 . TYR C 2 110 ? 194.238 254.528 189.303 1.00 106.42 0  93  TYR C CE2 1 
ATOM   8798  C  CZ  . TYR C 2 110 ? 194.163 255.897 189.465 1.00 106.42 0  93  TYR C CZ  1 
ATOM   8799  O  OH  . TYR C 2 110 ? 194.051 256.710 188.361 1.00 106.42 0  93  TYR C OH  1 
ATOM   8800  N  N   . GLY C 2 111 ? 191.877 251.417 192.837 1.00 107.14 0  94  GLY C N   1 
ATOM   8801  C  CA  . GLY C 2 111 ? 190.744 250.878 192.103 1.00 107.14 0  94  GLY C CA  1 
ATOM   8802  C  C   . GLY C 2 111 ? 189.412 251.171 192.768 1.00 107.14 0  94  GLY C C   1 
ATOM   8803  O  O   . GLY C 2 111 ? 188.420 251.450 192.089 1.00 107.14 0  94  GLY C O   1 
ATOM   8804  N  N   . ARG C 2 112 ? 189.365 251.112 194.102 1.00 107.18 0  95  ARG C N   1 
ATOM   8805  C  CA  . ARG C 2 112 ? 188.123 251.415 194.803 1.00 107.18 0  95  ARG C CA  1 
ATOM   8806  C  C   . ARG C 2 112 ? 187.883 252.911 194.969 1.00 107.18 0  95  ARG C C   1 
ATOM   8807  O  O   . ARG C 2 112 ? 186.749 253.310 195.255 1.00 107.18 0  95  ARG C O   1 
ATOM   8808  C  CB  . ARG C 2 112 ? 188.093 250.734 196.174 1.00 107.18 0  95  ARG C CB  1 
ATOM   8809  C  CG  . ARG C 2 112 ? 188.940 251.404 197.242 1.00 107.18 0  95  ARG C CG  1 
ATOM   8810  C  CD  . ARG C 2 112 ? 188.712 250.774 198.608 1.00 107.18 0  95  ARG C CD  1 
ATOM   8811  N  NE  . ARG C 2 112 ? 189.170 249.389 198.673 1.00 107.18 0  95  ARG C NE  1 
ATOM   8812  C  CZ  . ARG C 2 112 ? 188.360 248.339 198.766 1.00 107.18 0  95  ARG C CZ  1 
ATOM   8813  N  NH1 . ARG C 2 112 ? 187.046 248.514 198.806 1.00 107.18 1  95  ARG C NH1 1 
ATOM   8814  N  NH2 . ARG C 2 112 ? 188.863 247.113 198.820 1.00 107.18 0  95  ARG C NH2 1 
ATOM   8815  N  N   . LEU C 2 113 ? 188.911 253.745 194.801 1.00 107.23 0  96  LEU C N   1 
ATOM   8816  C  CA  . LEU C 2 113 ? 188.720 255.188 194.803 1.00 107.23 0  96  LEU C CA  1 
ATOM   8817  C  C   . LEU C 2 113 ? 188.593 255.774 193.404 1.00 107.23 0  96  LEU C C   1 
ATOM   8818  O  O   . LEU C 2 113 ? 188.254 256.954 193.273 1.00 107.23 0  96  LEU C O   1 
ATOM   8819  C  CB  . LEU C 2 113 ? 189.877 255.876 195.539 1.00 107.23 0  96  LEU C CB  1 
ATOM   8820  C  CG  . LEU C 2 113 ? 189.864 255.778 197.066 1.00 107.23 0  96  LEU C CG  1 
ATOM   8821  C  CD1 . LEU C 2 113 ? 191.054 256.511 197.663 1.00 107.23 0  96  LEU C CD1 1 
ATOM   8822  C  CD2 . LEU C 2 113 ? 188.559 256.318 197.628 1.00 107.23 0  96  LEU C CD2 1 
ATOM   8823  N  N   . HIS C 2 114 ? 188.856 254.984 192.363 1.00 115.02 0  97  HIS C N   1 
ATOM   8824  C  CA  . HIS C 2 114 ? 188.738 255.457 190.990 1.00 115.02 0  97  HIS C CA  1 
ATOM   8825  C  C   . HIS C 2 114 ? 187.339 255.244 190.427 1.00 115.02 0  97  HIS C C   1 
ATOM   8826  O  O   . HIS C 2 114 ? 186.833 256.094 189.686 1.00 115.02 0  97  HIS C O   1 
ATOM   8827  C  CB  . HIS C 2 114 ? 189.772 254.756 190.106 1.00 115.02 0  97  HIS C CB  1 
ATOM   8828  C  CG  . HIS C 2 114 ? 189.736 255.186 188.673 1.00 115.02 0  97  HIS C CG  1 
ATOM   8829  N  ND1 . HIS C 2 114 ? 190.225 256.403 188.249 1.00 115.02 0  97  HIS C ND1 1 
ATOM   8830  C  CD2 . HIS C 2 114 ? 189.269 254.562 187.566 1.00 115.02 0  97  HIS C CD2 1 
ATOM   8831  C  CE1 . HIS C 2 114 ? 190.061 256.509 186.943 1.00 115.02 0  97  HIS C CE1 1 
ATOM   8832  N  NE2 . HIS C 2 114 ? 189.483 255.406 186.504 1.00 115.02 0  97  HIS C NE2 1 
ATOM   8833  N  N   . GLY C 2 115 ? 186.704 254.126 190.766 1.00 115.10 0  98  GLY C N   1 
ATOM   8834  C  CA  . GLY C 2 115 ? 185.370 253.827 190.281 1.00 115.10 0  98  GLY C CA  1 
ATOM   8835  C  C   . GLY C 2 115 ? 184.285 254.629 190.973 1.00 115.10 0  98  GLY C C   1 
ATOM   8836  O  O   . GLY C 2 115 ? 183.478 254.081 191.723 1.00 115.10 0  98  GLY C O   1 
ATOM   8837  N  N   . TYR C 2 143 ? 190.344 261.117 196.054 1.00 109.88 0  126 TYR C N   1 
ATOM   8838  C  CA  . TYR C 2 143 ? 191.603 261.355 195.358 1.00 109.88 0  126 TYR C CA  1 
ATOM   8839  C  C   . TYR C 2 143 ? 192.660 261.906 196.308 1.00 109.88 0  126 TYR C C   1 
ATOM   8840  O  O   . TYR C 2 143 ? 193.857 261.777 196.057 1.00 109.88 0  126 TYR C O   1 
ATOM   8841  C  CB  . TYR C 2 143 ? 191.398 262.315 194.184 1.00 109.88 0  126 TYR C CB  1 
ATOM   8842  C  CG  . TYR C 2 143 ? 192.539 262.316 193.189 1.00 109.88 0  126 TYR C CG  1 
ATOM   8843  C  CD1 . TYR C 2 143 ? 192.638 261.327 192.217 1.00 109.88 0  126 TYR C CD1 1 
ATOM   8844  C  CD2 . TYR C 2 143 ? 193.513 263.308 193.219 1.00 109.88 0  126 TYR C CD2 1 
ATOM   8845  C  CE1 . TYR C 2 143 ? 193.680 261.323 191.303 1.00 109.88 0  126 TYR C CE1 1 
ATOM   8846  C  CE2 . TYR C 2 143 ? 194.559 263.313 192.310 1.00 109.88 0  126 TYR C CE2 1 
ATOM   8847  C  CZ  . TYR C 2 143 ? 194.636 262.318 191.355 1.00 109.88 0  126 TYR C CZ  1 
ATOM   8848  O  OH  . TYR C 2 143 ? 195.672 262.318 190.449 1.00 109.88 0  126 TYR C OH  1 
ATOM   8849  N  N   . ALA C 2 144 ? 192.211 262.530 197.400 1.00 108.01 0  127 ALA C N   1 
ATOM   8850  C  CA  . ALA C 2 144 ? 193.115 263.069 198.404 1.00 108.01 0  127 ALA C CA  1 
ATOM   8851  C  C   . ALA C 2 144 ? 193.135 262.280 199.704 1.00 108.01 0  127 ALA C C   1 
ATOM   8852  O  O   . ALA C 2 144 ? 194.085 262.427 200.479 1.00 108.01 0  127 ALA C O   1 
ATOM   8853  C  CB  . ALA C 2 144 ? 192.755 264.529 198.719 1.00 108.01 0  127 ALA C CB  1 
ATOM   8854  N  N   . GLN C 2 145 ? 192.121 261.456 199.964 1.00 107.92 0  128 GLN C N   1 
ATOM   8855  C  CA  . GLN C 2 145 ? 192.041 260.660 201.182 1.00 107.92 0  128 GLN C CA  1 
ATOM   8856  C  C   . GLN C 2 145 ? 192.686 259.284 201.034 1.00 107.92 0  128 GLN C C   1 
ATOM   8857  O  O   . GLN C 2 145 ? 192.441 258.404 201.867 1.00 107.92 0  128 GLN C O   1 
ATOM   8858  C  CB  . GLN C 2 145 ? 190.580 260.509 201.615 1.00 107.92 0  128 GLN C CB  1 
ATOM   8859  C  CG  . GLN C 2 145 ? 189.697 259.774 200.613 1.00 107.92 0  128 GLN C CG  1 
ATOM   8860  C  CD  . GLN C 2 145 ? 188.999 260.711 199.645 1.00 107.92 0  128 GLN C CD  1 
ATOM   8861  O  OE1 . GLN C 2 145 ? 189.121 261.932 199.748 1.00 107.92 0  128 GLN C OE1 1 
ATOM   8862  N  NE2 . GLN C 2 145 ? 188.263 260.142 198.697 1.00 107.92 0  128 GLN C NE2 1 
ATOM   8863  N  N   . LEU C 2 146 ? 193.506 259.082 199.999 1.00 106.55 0  129 LEU C N   1 
ATOM   8864  C  CA  . LEU C 2 146 ? 194.117 257.773 199.787 1.00 106.55 0  129 LEU C CA  1 
ATOM   8865  C  C   . LEU C 2 146 ? 195.246 257.500 200.774 1.00 106.55 0  129 LEU C C   1 
ATOM   8866  O  O   . LEU C 2 146 ? 195.480 256.339 201.130 1.00 106.55 0  129 LEU C O   1 
ATOM   8867  C  CB  . LEU C 2 146 ? 194.632 257.646 198.347 1.00 106.55 0  129 LEU C CB  1 
ATOM   8868  C  CG  . LEU C 2 146 ? 195.957 258.276 197.888 1.00 106.55 0  129 LEU C CG  1 
ATOM   8869  C  CD1 . LEU C 2 146 ? 196.394 257.666 196.564 1.00 106.55 0  129 LEU C CD1 1 
ATOM   8870  C  CD2 . LEU C 2 146 ? 195.902 259.795 197.777 1.00 106.55 0  129 LEU C CD2 1 
ATOM   8871  N  N   . GLN C 2 147 ? 195.932 258.549 201.245 1.00 103.14 0  130 GLN C N   1 
ATOM   8872  C  CA  . GLN C 2 147 ? 197.110 258.355 202.087 1.00 103.14 0  130 GLN C CA  1 
ATOM   8873  C  C   . GLN C 2 147 ? 196.733 257.826 203.464 1.00 103.14 0  130 GLN C C   1 
ATOM   8874  O  O   . GLN C 2 147 ? 197.387 256.912 203.981 1.00 103.14 0  130 GLN C O   1 
ATOM   8875  C  CB  . GLN C 2 147 ? 197.891 259.663 202.212 1.00 103.14 0  130 GLN C CB  1 
ATOM   8876  C  CG  . GLN C 2 147 ? 199.211 259.520 202.954 1.00 103.14 0  130 GLN C CG  1 
ATOM   8877  C  CD  . GLN C 2 147 ? 199.982 260.821 203.035 1.00 103.14 0  130 GLN C CD  1 
ATOM   8878  O  OE1 . GLN C 2 147 ? 199.540 261.851 202.525 1.00 103.14 0  130 GLN C OE1 1 
ATOM   8879  N  NE2 . GLN C 2 147 ? 201.143 260.782 203.678 1.00 103.14 0  130 GLN C NE2 1 
ATOM   8880  N  N   . SER C 2 148 ? 195.668 258.371 204.061 1.00 104.26 0  131 SER C N   1 
ATOM   8881  C  CA  . SER C 2 148 ? 195.178 257.851 205.333 1.00 104.26 0  131 SER C CA  1 
ATOM   8882  C  C   . SER C 2 148 ? 194.645 256.431 205.190 1.00 104.26 0  131 SER C C   1 
ATOM   8883  O  O   . SER C 2 148 ? 194.770 255.630 206.124 1.00 104.26 0  131 SER C O   1 
ATOM   8884  C  CB  . SER C 2 148 ? 194.093 258.769 205.894 1.00 104.26 0  131 SER C CB  1 
ATOM   8885  O  OG  . SER C 2 148 ? 192.815 258.408 205.398 1.00 104.26 0  131 SER C OG  1 
ATOM   8886  N  N   . ASN C 2 149 ? 194.090 256.097 204.019 1.00 103.23 0  132 ASN C N   1 
ATOM   8887  C  CA  . ASN C 2 149 ? 193.644 254.732 203.755 1.00 103.23 0  132 ASN C CA  1 
ATOM   8888  C  C   . ASN C 2 149 ? 194.818 253.763 203.703 1.00 103.23 0  132 ASN C C   1 
ATOM   8889  O  O   . ASN C 2 149 ? 194.738 252.660 204.258 1.00 103.23 0  132 ASN C O   1 
ATOM   8890  C  CB  . ASN C 2 149 ? 192.853 254.681 202.449 1.00 103.23 0  132 ASN C CB  1 
ATOM   8891  C  CG  . ASN C 2 149 ? 191.466 255.274 202.583 1.00 103.23 0  132 ASN C CG  1 
ATOM   8892  O  OD1 . ASN C 2 149 ? 190.818 255.137 203.620 1.00 103.23 0  132 ASN C OD1 1 
ATOM   8893  N  ND2 . ASN C 2 149 ? 191.002 255.938 201.531 1.00 103.23 0  132 ASN C ND2 1 
ATOM   8894  N  N   . ILE C 2 150 ? 195.929 254.167 203.078 1.00 101.02 0  133 ILE C N   1 
ATOM   8895  C  CA  . ILE C 2 150 ? 197.095 253.285 203.039 1.00 101.02 0  133 ILE C CA  1 
ATOM   8896  C  C   . ILE C 2 150 ? 197.751 253.193 204.417 1.00 101.02 0  133 ILE C C   1 
ATOM   8897  O  O   . ILE C 2 150 ? 198.255 252.128 204.797 1.00 101.02 0  133 ILE C O   1 
ATOM   8898  C  CB  . ILE C 2 150 ? 198.090 253.750 201.952 1.00 101.02 0  133 ILE C CB  1 
ATOM   8899  C  CG1 . ILE C 2 150 ? 197.414 253.818 200.584 1.00 101.02 0  133 ILE C CG1 1 
ATOM   8900  C  CG2 . ILE C 2 150 ? 199.266 252.794 201.817 1.00 101.02 0  133 ILE C CG2 1 
ATOM   8901  C  CD1 . ILE C 2 150 ? 196.698 252.549 200.187 1.00 101.02 0  133 ILE C CD1 1 
ATOM   8902  N  N   . ILE C 2 151 ? 197.694 254.268 205.213 1.00 101.51 0  134 ILE C N   1 
ATOM   8903  C  CA  . ILE C 2 151 ? 198.246 254.218 206.568 1.00 101.51 0  134 ILE C CA  1 
ATOM   8904  C  C   . ILE C 2 151 ? 197.435 253.280 207.462 1.00 101.51 0  134 ILE C C   1 
ATOM   8905  O  O   . ILE C 2 151 ? 198.006 252.452 208.184 1.00 101.51 0  134 ILE C O   1 
ATOM   8906  C  CB  . ILE C 2 151 ? 198.351 255.637 207.162 1.00 101.51 0  134 ILE C CB  1 
ATOM   8907  C  CG1 . ILE C 2 151 ? 199.434 256.435 206.434 1.00 101.51 0  134 ILE C CG1 1 
ATOM   8908  C  CG2 . ILE C 2 151 ? 198.653 255.603 208.656 1.00 101.51 0  134 ILE C CG2 1 
ATOM   8909  C  CD1 . ILE C 2 151 ? 200.804 255.806 206.518 1.00 101.51 0  134 ILE C CD1 1 
ATOM   8910  N  N   . GLU C 2 152 ? 196.100 253.346 207.394 1.00 102.45 0  135 GLU C N   1 
ATOM   8911  C  CA  . GLU C 2 152 ? 195.300 252.429 208.207 1.00 102.45 0  135 GLU C CA  1 
ATOM   8912  C  C   . GLU C 2 152 ? 195.352 251.000 207.667 1.00 102.45 0  135 GLU C C   1 
ATOM   8913  O  O   . GLU C 2 152 ? 195.227 250.046 208.446 1.00 102.45 0  135 GLU C O   1 
ATOM   8914  C  CB  . GLU C 2 152 ? 193.859 252.936 208.348 1.00 102.45 0  135 GLU C CB  1 
ATOM   8915  C  CG  . GLU C 2 152 ? 193.034 253.062 207.082 1.00 102.45 0  135 GLU C CG  1 
ATOM   8916  C  CD  . GLU C 2 152 ? 192.275 251.804 206.734 1.00 102.45 0  135 GLU C CD  1 
ATOM   8917  O  OE1 . GLU C 2 152 ? 192.082 250.953 207.628 1.00 102.45 0  135 GLU C OE1 1 
ATOM   8918  O  OE2 . GLU C 2 152 ? 191.858 251.679 205.568 1.00 102.45 -1 135 GLU C OE2 1 
ATOM   8919  N  N   . ALA C 2 153 ? 195.569 250.828 206.357 1.00 98.36  0  136 ALA C N   1 
ATOM   8920  C  CA  . ALA C 2 153 ? 195.751 249.489 205.804 1.00 98.36  0  136 ALA C CA  1 
ATOM   8921  C  C   . ALA C 2 153 ? 197.063 248.871 206.274 1.00 98.36  0  136 ALA C C   1 
ATOM   8922  O  O   . ALA C 2 153 ? 197.106 247.685 206.619 1.00 98.36  0  136 ALA C O   1 
ATOM   8923  C  CB  . ALA C 2 153 ? 195.695 249.538 204.278 1.00 98.36  0  136 ALA C CB  1 
ATOM   8924  N  N   . ILE C 2 154 ? 198.136 249.666 206.317 1.00 95.77  0  137 ILE C N   1 
ATOM   8925  C  CA  . ILE C 2 154 ? 199.416 249.193 206.836 1.00 95.77  0  137 ILE C CA  1 
ATOM   8926  C  C   . ILE C 2 154 ? 199.313 248.934 208.339 1.00 95.77  0  137 ILE C C   1 
ATOM   8927  O  O   . ILE C 2 154 ? 199.906 247.976 208.856 1.00 95.77  0  137 ILE C O   1 
ATOM   8928  C  CB  . ILE C 2 154 ? 200.521 250.208 206.466 1.00 95.77  0  137 ILE C CB  1 
ATOM   8929  C  CG1 . ILE C 2 154 ? 200.843 250.106 204.974 1.00 95.77  0  137 ILE C CG1 1 
ATOM   8930  C  CG2 . ILE C 2 154 ? 201.802 250.006 207.268 1.00 95.77  0  137 ILE C CG2 1 
ATOM   8931  C  CD1 . ILE C 2 154 ? 201.813 251.156 204.485 1.00 95.77  0  137 ILE C CD1 1 
ATOM   8932  N  N   . ASN C 2 155 ? 198.499 249.727 209.043 1.00 99.41  0  138 ASN C N   1 
ATOM   8933  C  CA  . ASN C 2 155 ? 198.285 249.520 210.474 1.00 99.41  0  138 ASN C CA  1 
ATOM   8934  C  C   . ASN C 2 155 ? 197.566 248.202 210.750 1.00 99.41  0  138 ASN C C   1 
ATOM   8935  O  O   . ASN C 2 155 ? 198.009 247.413 211.593 1.00 99.41  0  138 ASN C O   1 
ATOM   8936  C  CB  . ASN C 2 155 ? 197.488 250.690 211.054 1.00 99.41  0  138 ASN C CB  1 
ATOM   8937  C  CG  . ASN C 2 155 ? 198.348 251.903 211.331 1.00 99.41  0  138 ASN C CG  1 
ATOM   8938  O  OD1 . ASN C 2 155 ? 199.443 251.788 211.879 1.00 99.41  0  138 ASN C OD1 1 
ATOM   8939  N  ND2 . ASN C 2 155 ? 197.858 253.077 210.950 1.00 99.41  0  138 ASN C ND2 1 
ATOM   8940  N  N   . GLU C 2 156 ? 196.470 247.933 210.033 1.00 99.15  0  139 GLU C N   1 
ATOM   8941  C  CA  . GLU C 2 156 ? 195.772 246.664 210.229 1.00 99.15  0  139 GLU C CA  1 
ATOM   8942  C  C   . GLU C 2 156 ? 196.574 245.482 209.688 1.00 99.15  0  139 GLU C C   1 
ATOM   8943  O  O   . GLU C 2 156 ? 196.436 244.364 210.197 1.00 99.15  0  139 GLU C O   1 
ATOM   8944  C  CB  . GLU C 2 156 ? 194.374 246.715 209.603 1.00 99.15  0  139 GLU C CB  1 
ATOM   8945  C  CG  . GLU C 2 156 ? 194.326 246.724 208.086 1.00 99.15  0  139 GLU C CG  1 
ATOM   8946  C  CD  . GLU C 2 156 ? 192.910 246.791 207.551 1.00 99.15  0  139 GLU C CD  1 
ATOM   8947  O  OE1 . GLU C 2 156 ? 191.970 246.898 208.366 1.00 99.15  0  139 GLU C OE1 1 
ATOM   8948  O  OE2 . GLU C 2 156 ? 192.736 246.736 206.315 1.00 99.15  -1 139 GLU C OE2 1 
ATOM   8949  N  N   . LEU C 2 157 ? 197.457 245.713 208.710 1.00 90.40  0  140 LEU C N   1 
ATOM   8950  C  CA  . LEU C 2 157 ? 198.379 244.665 208.287 1.00 90.40  0  140 LEU C CA  1 
ATOM   8951  C  C   . LEU C 2 157 ? 199.402 244.359 209.375 1.00 90.40  0  140 LEU C C   1 
ATOM   8952  O  O   . LEU C 2 157 ? 199.789 243.202 209.562 1.00 90.40  0  140 LEU C O   1 
ATOM   8953  C  CB  . LEU C 2 157 ? 199.072 245.074 206.987 1.00 90.40  0  140 LEU C CB  1 
ATOM   8954  C  CG  . LEU C 2 157 ? 200.016 244.059 206.341 1.00 90.40  0  140 LEU C CG  1 
ATOM   8955  C  CD1 . LEU C 2 157 ? 199.292 242.749 206.082 1.00 90.40  0  140 LEU C CD1 1 
ATOM   8956  C  CD2 . LEU C 2 157 ? 200.598 244.615 205.052 1.00 90.40  0  140 LEU C CD2 1 
ATOM   8957  N  N   . LEU C 2 158 ? 199.828 245.379 210.124 1.00 90.96  0  141 LEU C N   1 
ATOM   8958  C  CA  . LEU C 2 158 ? 200.731 245.145 211.248 1.00 90.96  0  141 LEU C CA  1 
ATOM   8959  C  C   . LEU C 2 158 ? 200.023 244.452 212.408 1.00 90.96  0  141 LEU C C   1 
ATOM   8960  O  O   . LEU C 2 158 ? 200.644 243.653 213.121 1.00 90.96  0  141 LEU C O   1 
ATOM   8961  C  CB  . LEU C 2 158 ? 201.349 246.464 211.708 1.00 90.96  0  141 LEU C CB  1 
ATOM   8962  C  CG  . LEU C 2 158 ? 202.585 246.933 210.937 1.00 90.96  0  141 LEU C CG  1 
ATOM   8963  C  CD1 . LEU C 2 158 ? 203.179 248.179 211.573 1.00 90.96  0  141 LEU C CD1 1 
ATOM   8964  C  CD2 . LEU C 2 158 ? 203.625 245.825 210.855 1.00 90.96  0  141 LEU C CD2 1 
ATOM   8965  N  N   . VAL C 2 159 ? 198.735 244.748 212.613 1.00 91.10  0  142 VAL C N   1 
ATOM   8966  C  CA  . VAL C 2 159 ? 197.944 244.020 213.608 1.00 91.10  0  142 VAL C CA  1 
ATOM   8967  C  C   . VAL C 2 159 ? 197.787 242.558 213.197 1.00 91.10  0  142 VAL C C   1 
ATOM   8968  O  O   . VAL C 2 159 ? 197.854 241.651 214.037 1.00 91.10  0  142 VAL C O   1 
ATOM   8969  C  CB  . VAL C 2 159 ? 196.582 244.709 213.834 1.00 91.10  0  142 VAL C CB  1 
ATOM   8970  C  CG1 . VAL C 2 159 ? 195.766 243.976 214.888 1.00 91.10  0  142 VAL C CG1 1 
ATOM   8971  C  CG2 . VAL C 2 159 ? 196.789 246.131 214.308 1.00 91.10  0  142 VAL C CG2 1 
ATOM   8972  N  N   . GLU C 2 160 ? 197.600 242.305 211.897 1.00 90.35  0  143 GLU C N   1 
ATOM   8973  C  CA  . GLU C 2 160 ? 197.525 240.932 211.402 1.00 90.35  0  143 GLU C CA  1 
ATOM   8974  C  C   . GLU C 2 160 ? 198.872 240.226 211.529 1.00 90.35  0  143 GLU C C   1 
ATOM   8975  O  O   . GLU C 2 160 ? 198.928 239.029 211.836 1.00 90.35  0  143 GLU C O   1 
ATOM   8976  C  CB  . GLU C 2 160 ? 197.048 240.929 209.949 1.00 90.35  0  143 GLU C CB  1 
ATOM   8977  C  CG  . GLU C 2 160 ? 196.878 239.544 209.336 1.00 90.35  0  143 GLU C CG  1 
ATOM   8978  C  CD  . GLU C 2 160 ? 195.730 239.479 208.350 1.00 90.35  0  143 GLU C CD  1 
ATOM   8979  O  OE1 . GLU C 2 160 ? 194.797 238.677 208.570 1.00 90.35  0  143 GLU C OE1 1 
ATOM   8980  O  OE2 . GLU C 2 160 ? 195.762 240.233 207.355 1.00 90.35  -1 143 GLU C OE2 1 
ATOM   8981  N  N   . LEU C 2 161 ? 199.967 240.957 211.323 1.00 87.14  0  144 LEU C N   1 
ATOM   8982  C  CA  . LEU C 2 161 ? 201.298 240.370 211.385 1.00 87.14  0  144 LEU C CA  1 
ATOM   8983  C  C   . LEU C 2 161 ? 201.756 240.127 212.817 1.00 87.14  0  144 LEU C C   1 
ATOM   8984  O  O   . LEU C 2 161 ? 202.602 239.255 213.042 1.00 87.14  0  144 LEU C O   1 
ATOM   8985  C  CB  . LEU C 2 161 ? 202.294 241.281 210.656 1.00 87.14  0  144 LEU C CB  1 
ATOM   8986  C  CG  . LEU C 2 161 ? 203.670 240.771 210.217 1.00 87.14  0  144 LEU C CG  1 
ATOM   8987  C  CD1 . LEU C 2 161 ? 204.033 241.395 208.882 1.00 87.14  0  144 LEU C CD1 1 
ATOM   8988  C  CD2 . LEU C 2 161 ? 204.747 241.085 211.240 1.00 87.14  0  144 LEU C CD2 1 
ATOM   8989  N  N   . GLU C 2 162 ? 201.223 240.873 213.787 1.00 90.30  0  145 GLU C N   1 
ATOM   8990  C  CA  . GLU C 2 162 ? 201.600 240.637 215.176 1.00 90.30  0  145 GLU C CA  1 
ATOM   8991  C  C   . GLU C 2 162 ? 200.938 239.386 215.738 1.00 90.30  0  145 GLU C C   1 
ATOM   8992  O  O   . GLU C 2 162 ? 201.490 238.749 216.643 1.00 90.30  0  145 GLU C O   1 
ATOM   8993  C  CB  . GLU C 2 162 ? 201.238 241.855 216.031 1.00 90.30  0  145 GLU C CB  1 
ATOM   8994  C  CG  . GLU C 2 162 ? 202.012 241.967 217.336 1.00 90.30  0  145 GLU C CG  1 
ATOM   8995  C  CD  . GLU C 2 162 ? 201.574 243.153 218.176 1.00 90.30  0  145 GLU C CD  1 
ATOM   8996  O  OE1 . GLU C 2 162 ? 200.798 243.988 217.666 1.00 90.30  0  145 GLU C OE1 1 
ATOM   8997  O  OE2 . GLU C 2 162 ? 202.005 243.251 219.344 1.00 90.30  -1 145 GLU C OE2 1 
ATOM   8998  N  N   . GLY C 2 163 ? 199.772 239.014 215.216 1.00 85.10  0  146 GLY C N   1 
ATOM   8999  C  CA  . GLY C 2 163 ? 199.043 237.877 215.739 1.00 85.10  0  146 GLY C CA  1 
ATOM   9000  C  C   . GLY C 2 163 ? 198.941 236.694 214.798 1.00 85.10  0  146 GLY C C   1 
ATOM   9001  O  O   . GLY C 2 163 ? 197.877 236.075 214.696 1.00 85.10  0  146 GLY C O   1 
ATOM   9002  N  N   . THR C 2 164 ? 200.030 236.362 214.106 1.00 79.91  0  147 THR C N   1 
ATOM   9003  C  CA  . THR C 2 164 ? 200.021 235.191 213.236 1.00 79.91  0  147 THR C CA  1 
ATOM   9004  C  C   . THR C 2 164 ? 200.485 233.933 213.964 1.00 79.91  0  147 THR C C   1 
ATOM   9005  O  O   . THR C 2 164 ? 199.915 232.854 213.756 1.00 79.91  0  147 THR C O   1 
ATOM   9006  C  CB  . THR C 2 164 ? 200.864 235.443 211.975 1.00 79.91  0  147 THR C CB  1 
ATOM   9007  O  OG1 . THR C 2 164 ? 201.003 234.224 211.233 1.00 79.91  0  147 THR C OG1 1 
ATOM   9008  C  CG2 . THR C 2 164 ? 202.238 236.029 212.291 1.00 79.91  0  147 THR C CG2 1 
ATOM   9009  N  N   . MET C 2 165 ? 201.489 234.059 214.836 1.00 76.05  0  148 MET C N   1 
ATOM   9010  C  CA  . MET C 2 165 ? 202.009 232.900 215.550 1.00 76.05  0  148 MET C CA  1 
ATOM   9011  C  C   . MET C 2 165 ? 201.025 232.427 216.609 1.00 76.05  0  148 MET C C   1 
ATOM   9012  O  O   . MET C 2 165 ? 200.905 231.221 216.847 1.00 76.05  0  148 MET C O   1 
ATOM   9013  C  CB  . MET C 2 165 ? 203.364 233.231 216.175 1.00 76.05  0  148 MET C CB  1 
ATOM   9014  C  CG  . MET C 2 165 ? 204.153 232.019 216.641 1.00 76.05  0  148 MET C CG  1 
ATOM   9015  S  SD  . MET C 2 165 ? 205.562 232.470 217.670 1.00 76.05  0  148 MET C SD  1 
ATOM   9016  C  CE  . MET C 2 165 ? 204.731 233.145 219.106 1.00 76.05  0  148 MET C CE  1 
ATOM   9017  N  N   . GLU C 2 166 ? 200.287 233.354 217.227 1.00 80.27  0  149 GLU C N   1 
ATOM   9018  C  CA  . GLU C 2 166 ? 199.262 232.951 218.182 1.00 80.27  0  149 GLU C CA  1 
ATOM   9019  C  C   . GLU C 2 166 ? 198.071 232.313 217.474 1.00 80.27  0  149 GLU C C   1 
ATOM   9020  O  O   . GLU C 2 166 ? 197.417 231.436 218.043 1.00 80.27  0  149 GLU C O   1 
ATOM   9021  C  CB  . GLU C 2 166 ? 198.839 234.146 219.048 1.00 80.27  0  149 GLU C CB  1 
ATOM   9022  C  CG  . GLU C 2 166 ? 198.056 235.266 218.357 1.00 80.27  0  149 GLU C CG  1 
ATOM   9023  C  CD  . GLU C 2 166 ? 196.550 235.080 218.439 1.00 80.27  0  149 GLU C CD  1 
ATOM   9024  O  OE1 . GLU C 2 166 ? 196.079 234.469 219.422 1.00 80.27  0  149 GLU C OE1 1 
ATOM   9025  O  OE2 . GLU C 2 166 ? 195.840 235.551 217.525 1.00 80.27  -1 149 GLU C OE2 1 
ATOM   9026  N  N   . ASN C 2 167 ? 197.805 232.697 216.221 1.00 76.80  0  150 ASN C N   1 
ATOM   9027  C  CA  . ASN C 2 167 ? 196.746 232.041 215.459 1.00 76.80  0  150 ASN C CA  1 
ATOM   9028  C  C   . ASN C 2 167 ? 197.160 230.638 215.032 1.00 76.80  0  150 ASN C C   1 
ATOM   9029  O  O   . ASN C 2 167 ? 196.338 229.710 215.050 1.00 76.80  0  150 ASN C O   1 
ATOM   9030  C  CB  . ASN C 2 167 ? 196.376 232.882 214.238 1.00 76.80  0  150 ASN C CB  1 
ATOM   9031  C  CG  . ASN C 2 167 ? 195.440 234.022 214.578 1.00 76.80  0  150 ASN C CG  1 
ATOM   9032  O  OD1 . ASN C 2 167 ? 194.576 233.892 215.444 1.00 76.80  0  150 ASN C OD1 1 
ATOM   9033  N  ND2 . ASN C 2 167 ? 195.606 235.148 213.895 1.00 76.80  0  150 ASN C ND2 1 
ATOM   9034  N  N   . ILE C 2 168 ? 198.432 230.467 214.653 1.00 70.83  0  151 ILE C N   1 
ATOM   9035  C  CA  . ILE C 2 168 ? 198.954 229.135 214.350 1.00 70.83  0  151 ILE C CA  1 
ATOM   9036  C  C   . ILE C 2 168 ? 198.937 228.260 215.601 1.00 70.83  0  151 ILE C C   1 
ATOM   9037  O  O   . ILE C 2 168 ? 198.571 227.079 215.548 1.00 70.83  0  151 ILE C O   1 
ATOM   9038  C  CB  . ILE C 2 168 ? 200.364 229.250 213.736 1.00 70.83  0  151 ILE C CB  1 
ATOM   9039  C  CG1 . ILE C 2 168 ? 200.290 229.914 212.361 1.00 70.83  0  151 ILE C CG1 1 
ATOM   9040  C  CG2 . ILE C 2 168 ? 201.029 227.895 213.595 1.00 70.83  0  151 ILE C CG2 1 
ATOM   9041  C  CD1 . ILE C 2 168 ? 201.641 230.172 211.732 1.00 70.83  0  151 ILE C CD1 1 
ATOM   9042  N  N   . ALA C 2 169 ? 199.262 228.844 216.758 1.00 69.26  0  152 ALA C N   1 
ATOM   9043  C  CA  . ALA C 2 169 ? 199.183 228.109 218.016 1.00 69.26  0  152 ALA C CA  1 
ATOM   9044  C  C   . ALA C 2 169 ? 197.741 227.797 218.411 1.00 69.26  0  152 ALA C C   1 
ATOM   9045  O  O   . ALA C 2 169 ? 197.486 226.779 219.061 1.00 69.26  0  152 ALA C O   1 
ATOM   9046  C  CB  . ALA C 2 169 ? 199.874 228.903 219.122 1.00 69.26  0  152 ALA C CB  1 
ATOM   9047  N  N   . ALA C 2 170 ? 196.791 228.654 218.036 1.00 70.46  0  153 ALA C N   1 
ATOM   9048  C  CA  . ALA C 2 170 ? 195.393 228.376 218.344 1.00 70.46  0  153 ALA C CA  1 
ATOM   9049  C  C   . ALA C 2 170 ? 194.849 227.251 217.475 1.00 70.46  0  153 ALA C C   1 
ATOM   9050  O  O   . ALA C 2 170 ? 194.083 226.406 217.952 1.00 70.46  0  153 ALA C O   1 
ATOM   9051  C  CB  . ALA C 2 170 ? 194.556 229.642 218.173 1.00 70.46  0  153 ALA C CB  1 
ATOM   9052  N  N   . GLN C 2 171 ? 195.234 227.217 216.202 1.00 69.25  0  154 GLN C N   1 
ATOM   9053  C  CA  . GLN C 2 171 ? 194.795 226.144 215.318 1.00 69.25  0  154 GLN C CA  1 
ATOM   9054  C  C   . GLN C 2 171 ? 195.701 224.919 215.367 1.00 69.25  0  154 GLN C C   1 
ATOM   9055  O  O   . GLN C 2 171 ? 195.455 223.955 214.636 1.00 69.25  0  154 GLN C O   1 
ATOM   9056  C  CB  . GLN C 2 171 ? 194.697 226.653 213.880 1.00 69.25  0  154 GLN C CB  1 
ATOM   9057  C  CG  . GLN C 2 171 ? 196.033 226.942 213.240 1.00 69.25  0  154 GLN C CG  1 
ATOM   9058  C  CD  . GLN C 2 171 ? 195.899 227.272 211.777 1.00 69.25  0  154 GLN C CD  1 
ATOM   9059  O  OE1 . GLN C 2 171 ? 195.701 226.388 210.945 1.00 69.25  0  154 GLN C OE1 1 
ATOM   9060  N  NE2 . GLN C 2 171 ? 195.990 228.555 211.452 1.00 69.25  0  154 GLN C NE2 1 
ATOM   9061  N  N   . ALA C 2 172 ? 196.743 224.938 216.199 1.00 62.45  0  155 ALA C N   1 
ATOM   9062  C  CA  . ALA C 2 172 ? 197.630 223.791 216.342 1.00 62.45  0  155 ALA C CA  1 
ATOM   9063  C  C   . ALA C 2 172 ? 197.005 222.620 217.086 1.00 62.45  0  155 ALA C C   1 
ATOM   9064  O  O   . ALA C 2 172 ? 197.572 221.523 217.052 1.00 62.45  0  155 ALA C O   1 
ATOM   9065  C  CB  . ALA C 2 172 ? 198.902 224.215 217.066 1.00 62.45  0  155 ALA C CB  1 
ATOM   9066  N  N   . LEU C 2 173 ? 195.874 222.823 217.766 1.00 63.40  0  156 LEU C N   1 
ATOM   9067  C  CA  . LEU C 2 173 ? 195.323 221.778 218.621 1.00 63.40  0  156 LEU C CA  1 
ATOM   9068  C  C   . LEU C 2 173 ? 194.697 220.644 217.821 1.00 63.40  0  156 LEU C C   1 
ATOM   9069  O  O   . LEU C 2 173 ? 194.580 219.529 218.339 1.00 63.40  0  156 LEU C O   1 
ATOM   9070  C  CB  . LEU C 2 173 ? 194.283 222.366 219.580 1.00 63.40  0  156 LEU C CB  1 
ATOM   9071  C  CG  . LEU C 2 173 ? 194.725 222.951 220.931 1.00 63.40  0  156 LEU C CG  1 
ATOM   9072  C  CD1 . LEU C 2 173 ? 195.431 221.894 221.773 1.00 63.40  0  156 LEU C CD1 1 
ATOM   9073  C  CD2 . LEU C 2 173 ? 195.579 224.212 220.799 1.00 63.40  0  156 LEU C CD2 1 
ATOM   9074  N  N   . GLU C 2 174 ? 194.300 220.900 216.572 1.00 64.78  0  157 GLU C N   1 
ATOM   9075  C  CA  . GLU C 2 174 ? 193.694 219.889 215.715 1.00 64.78  0  157 GLU C CA  1 
ATOM   9076  C  C   . GLU C 2 174 ? 194.707 219.211 214.801 1.00 64.78  0  157 GLU C C   1 
ATOM   9077  O  O   . GLU C 2 174 ? 194.335 218.718 213.728 1.00 64.78  0  157 GLU C O   1 
ATOM   9078  C  CB  . GLU C 2 174 ? 192.563 220.506 214.892 1.00 64.78  0  157 GLU C CB  1 
ATOM   9079  C  CG  . GLU C 2 174 ? 192.931 221.807 214.200 1.00 64.78  0  157 GLU C CG  1 
ATOM   9080  C  CD  . GLU C 2 174 ? 192.416 223.026 214.939 1.00 64.78  0  157 GLU C CD  1 
ATOM   9081  O  OE1 . GLU C 2 174 ? 192.576 223.086 216.176 1.00 64.78  0  157 GLU C OE1 1 
ATOM   9082  O  OE2 . GLU C 2 174 ? 191.852 223.926 214.282 1.00 64.78  -1 157 GLU C OE2 1 
ATOM   9083  N  N   . HIS C 2 175 ? 195.981 219.172 215.193 1.00 59.09  0  158 HIS C N   1 
ATOM   9084  C  CA  . HIS C 2 175 ? 196.996 218.492 214.400 1.00 59.09  0  158 HIS C CA  1 
ATOM   9085  C  C   . HIS C 2 175 ? 197.958 217.656 215.229 1.00 59.09  0  158 HIS C C   1 
ATOM   9086  O  O   . HIS C 2 175 ? 198.870 217.055 214.655 1.00 59.09  0  158 HIS C O   1 
ATOM   9087  C  CB  . HIS C 2 175 ? 197.803 219.510 213.580 1.00 59.09  0  158 HIS C CB  1 
ATOM   9088  C  CG  . HIS C 2 175 ? 197.004 220.200 212.520 1.00 59.09  0  158 HIS C CG  1 
ATOM   9089  N  ND1 . HIS C 2 175 ? 196.690 219.604 211.319 1.00 59.09  0  158 HIS C ND1 1 
ATOM   9090  C  CD2 . HIS C 2 175 ? 196.455 221.437 212.483 1.00 59.09  0  158 HIS C CD2 1 
ATOM   9091  C  CE1 . HIS C 2 175 ? 195.981 220.444 210.587 1.00 59.09  0  158 HIS C CE1 1 
ATOM   9092  N  NE2 . HIS C 2 175 ? 195.824 221.563 211.269 1.00 59.09  0  158 HIS C NE2 1 
ATOM   9093  N  N   . ILE C 2 176 ? 197.787 217.592 216.547 1.00 57.36  0  159 ILE C N   1 
ATOM   9094  C  CA  . ILE C 2 176 ? 198.684 216.860 217.433 1.00 57.36  0  159 ILE C CA  1 
ATOM   9095  C  C   . ILE C 2 176 ? 197.826 216.004 218.352 1.00 57.36  0  159 ILE C C   1 
ATOM   9096  O  O   . ILE C 2 176 ? 196.945 216.527 219.045 1.00 57.36  0  159 ILE C O   1 
ATOM   9097  C  CB  . ILE C 2 176 ? 199.578 217.804 218.258 1.00 57.36  0  159 ILE C CB  1 
ATOM   9098  C  CG1 . ILE C 2 176 ? 200.581 218.536 217.365 1.00 57.36  0  159 ILE C CG1 1 
ATOM   9099  C  CG2 . ILE C 2 176 ? 200.312 217.038 219.345 1.00 57.36  0  159 ILE C CG2 1 
ATOM   9100  C  CD1 . ILE C 2 176 ? 201.537 217.625 216.650 1.00 57.36  0  159 ILE C CD1 1 
ATOM   9101  N  N   . HIS C 2 177 ? 198.076 214.699 218.359 1.00 57.08  0  160 HIS C N   1 
ATOM   9102  C  CA  . HIS C 2 177 ? 197.412 213.782 219.273 1.00 57.08  0  160 HIS C CA  1 
ATOM   9103  C  C   . HIS C 2 177 ? 198.415 213.239 220.283 1.00 57.08  0  160 HIS C C   1 
ATOM   9104  O  O   . HIS C 2 177 ? 199.623 213.469 220.185 1.00 57.08  0  160 HIS C O   1 
ATOM   9105  C  CB  . HIS C 2 177 ? 196.725 212.644 218.508 1.00 57.08  0  160 HIS C CB  1 
ATOM   9106  C  CG  . HIS C 2 177 ? 197.663 211.762 217.747 1.00 57.08  0  160 HIS C CG  1 
ATOM   9107  N  ND1 . HIS C 2 177 ? 198.315 210.693 218.322 1.00 57.08  0  160 HIS C ND1 1 
ATOM   9108  C  CD2 . HIS C 2 177 ? 198.047 211.782 216.449 1.00 57.08  0  160 HIS C CD2 1 
ATOM   9109  C  CE1 . HIS C 2 177 ? 199.066 210.097 217.413 1.00 57.08  0  160 HIS C CE1 1 
ATOM   9110  N  NE2 . HIS C 2 177 ? 198.919 210.736 216.268 1.00 57.08  0  160 HIS C NE2 1 
ATOM   9111  N  N   . SER C 2 178 ? 197.896 212.509 221.265 1.00 62.09  0  161 SER C N   1 
ATOM   9112  C  CA  . SER C 2 178 ? 198.731 211.979 222.331 1.00 62.09  0  161 SER C CA  1 
ATOM   9113  C  C   . SER C 2 178 ? 199.533 210.779 221.846 1.00 62.09  0  161 SER C C   1 
ATOM   9114  O  O   . SER C 2 178 ? 199.089 210.025 220.974 1.00 62.09  0  161 SER C O   1 
ATOM   9115  C  CB  . SER C 2 178 ? 197.876 211.580 223.533 1.00 62.09  0  161 SER C CB  1 
ATOM   9116  O  OG  . SER C 2 178 ? 196.908 212.573 223.822 1.00 62.09  0  161 SER C OG  1 
ATOM   9117  N  N   . ASN C 2 179 ? 200.725 210.618 222.440 1.00 59.10  0  162 ASN C N   1 
ATOM   9118  C  CA  . ASN C 2 179 ? 201.693 209.561 222.116 1.00 59.10  0  162 ASN C CA  1 
ATOM   9119  C  C   . ASN C 2 179 ? 202.058 209.568 220.632 1.00 59.10  0  162 ASN C C   1 
ATOM   9120  O  O   . ASN C 2 179 ? 201.992 208.550 219.941 1.00 59.10  0  162 ASN C O   1 
ATOM   9121  C  CB  . ASN C 2 179 ? 201.193 208.185 222.564 1.00 59.10  0  162 ASN C CB  1 
ATOM   9122  C  CG  . ASN C 2 179 ? 201.302 207.989 224.062 1.00 59.10  0  162 ASN C CG  1 
ATOM   9123  O  OD1 . ASN C 2 179 ? 200.297 207.926 224.767 1.00 59.10  0  162 ASN C OD1 1 
ATOM   9124  N  ND2 . ASN C 2 179 ? 202.531 207.890 224.555 1.00 59.10  0  162 ASN C ND2 1 
ATOM   9125  N  N   . GLU C 2 180 ? 202.441 210.743 220.146 1.00 55.79  0  163 GLU C N   1 
ATOM   9126  C  CA  . GLU C 2 180 ? 202.839 210.951 218.765 1.00 55.79  0  163 GLU C CA  1 
ATOM   9127  C  C   . GLU C 2 180 ? 204.341 211.191 218.704 1.00 55.79  0  163 GLU C C   1 
ATOM   9128  O  O   . GLU C 2 180 ? 204.968 211.590 219.688 1.00 55.79  0  163 GLU C O   1 
ATOM   9129  C  CB  . GLU C 2 180 ? 202.089 212.143 218.155 1.00 55.79  0  163 GLU C CB  1 
ATOM   9130  C  CG  . GLU C 2 180 ? 201.969 212.122 216.639 1.00 55.79  0  163 GLU C CG  1 
ATOM   9131  C  CD  . GLU C 2 180 ? 201.109 213.247 216.108 1.00 55.79  0  163 GLU C CD  1 
ATOM   9132  O  OE1 . GLU C 2 180 ? 200.902 214.235 216.843 1.00 55.79  0  163 GLU C OE1 1 
ATOM   9133  O  OE2 . GLU C 2 180 ? 200.638 213.144 214.957 1.00 55.79  -1 163 GLU C OE2 1 
ATOM   9134  N  N   . VAL C 2 181 ? 204.922 210.925 217.540 1.00 54.85  0  164 VAL C N   1 
ATOM   9135  C  CA  . VAL C 2 181 ? 206.298 211.303 217.254 1.00 54.85  0  164 VAL C CA  1 
ATOM   9136  C  C   . VAL C 2 181 ? 206.273 212.381 216.178 1.00 54.85  0  164 VAL C C   1 
ATOM   9137  O  O   . VAL C 2 181 ? 205.396 212.392 215.305 1.00 54.85  0  164 VAL C O   1 
ATOM   9138  C  CB  . VAL C 2 181 ? 207.163 210.086 216.862 1.00 54.85  0  164 VAL C CB  1 
ATOM   9139  C  CG1 . VAL C 2 181 ? 207.026 209.019 217.909 1.00 54.85  0  164 VAL C CG1 1 
ATOM   9140  C  CG2 . VAL C 2 181 ? 206.755 209.507 215.549 1.00 54.85  0  164 VAL C CG2 1 
ATOM   9141  N  N   . ILE C 2 182 ? 207.190 213.336 216.295 1.00 53.57  0  165 ILE C N   1 
ATOM   9142  C  CA  . ILE C 2 182 ? 207.210 214.532 215.462 1.00 53.57  0  165 ILE C CA  1 
ATOM   9143  C  C   . ILE C 2 182 ? 208.633 214.730 214.968 1.00 53.57  0  165 ILE C C   1 
ATOM   9144  O  O   . ILE C 2 182 ? 209.574 214.707 215.766 1.00 53.57  0  165 ILE C O   1 
ATOM   9145  C  CB  . ILE C 2 182 ? 206.732 215.773 216.248 1.00 53.57  0  165 ILE C CB  1 
ATOM   9146  C  CG1 . ILE C 2 182 ? 205.243 215.674 216.587 1.00 53.57  0  165 ILE C CG1 1 
ATOM   9147  C  CG2 . ILE C 2 182 ? 207.024 217.064 215.498 1.00 53.57  0  165 ILE C CG2 1 
ATOM   9148  C  CD1 . ILE C 2 182 ? 204.360 215.541 215.384 1.00 53.57  0  165 ILE C CD1 1 
ATOM   9149  N  N   . MET C 2 183 ? 208.797 214.930 213.665 1.00 51.86  0  166 MET C N   1 
ATOM   9150  C  CA  . MET C 2 183 ? 210.101 215.233 213.097 1.00 51.86  0  166 MET C CA  1 
ATOM   9151  C  C   . MET C 2 183 ? 210.153 216.704 212.712 1.00 51.86  0  166 MET C C   1 
ATOM   9152  O  O   . MET C 2 183 ? 209.183 217.252 212.183 1.00 51.86  0  166 MET C O   1 
ATOM   9153  C  CB  . MET C 2 183 ? 210.405 214.361 211.879 1.00 51.86  0  166 MET C CB  1 
ATOM   9154  C  CG  . MET C 2 183 ? 211.885 214.312 211.551 1.00 51.86  0  166 MET C CG  1 
ATOM   9155  S  SD  . MET C 2 183 ? 212.349 213.030 210.379 1.00 51.86  0  166 MET C SD  1 
ATOM   9156  C  CE  . MET C 2 183 ? 214.126 213.052 210.587 1.00 51.86  0  166 MET C CE  1 
ATOM   9157  N  N   . THR C 2 184 ? 211.280 217.345 213.012 1.00 52.98  0  167 THR C N   1 
ATOM   9158  C  CA  . THR C 2 184 ? 211.492 218.746 212.679 1.00 52.98  0  167 THR C CA  1 
ATOM   9159  C  C   . THR C 2 184 ? 212.934 218.945 212.247 1.00 52.98  0  167 THR C C   1 
ATOM   9160  O  O   . THR C 2 184 ? 213.854 218.439 212.897 1.00 52.98  0  167 THR C O   1 
ATOM   9161  C  CB  . THR C 2 184 ? 211.178 219.665 213.868 1.00 52.98  0  167 THR C CB  1 
ATOM   9162  O  OG1 . THR C 2 184 ? 209.962 219.248 214.501 1.00 52.98  0  167 THR C OG1 1 
ATOM   9163  C  CG2 . THR C 2 184 ? 211.038 221.106 213.402 1.00 52.98  0  167 THR C CG2 1 
ATOM   9164  N  N   . ILE C 2 185 ? 213.129 219.675 211.154 1.00 57.31  0  168 ILE C N   1 
ATOM   9165  C  CA  . ILE C 2 185 ? 214.458 220.007 210.666 1.00 57.31  0  168 ILE C CA  1 
ATOM   9166  C  C   . ILE C 2 185 ? 214.672 221.502 210.875 1.00 57.31  0  168 ILE C C   1 
ATOM   9167  O  O   . ILE C 2 185 ? 213.725 222.299 210.852 1.00 57.31  0  168 ILE C O   1 
ATOM   9168  C  CB  . ILE C 2 185 ? 214.633 219.581 209.184 1.00 57.31  0  168 ILE C CB  1 
ATOM   9169  C  CG1 . ILE C 2 185 ? 216.104 219.595 208.753 1.00 57.31  0  168 ILE C CG1 1 
ATOM   9170  C  CG2 . ILE C 2 185 ? 213.766 220.412 208.242 1.00 57.31  0  168 ILE C CG2 1 
ATOM   9171  C  CD1 . ILE C 2 185 ? 216.926 218.482 209.342 1.00 57.31  0  168 ILE C CD1 1 
ATOM   9172  N  N   . GLY C 2 186 ? 215.922 221.874 211.149 1.00 66.27  0  169 GLY C N   1 
ATOM   9173  C  CA  . GLY C 2 186 ? 216.269 223.273 211.288 1.00 66.27  0  169 GLY C CA  1 
ATOM   9174  C  C   . GLY C 2 186 ? 215.760 223.878 212.587 1.00 66.27  0  169 GLY C C   1 
ATOM   9175  O  O   . GLY C 2 186 ? 215.542 223.192 213.590 1.00 66.27  0  169 GLY C O   1 
ATOM   9176  N  N   . PHE C 2 187 ? 215.568 225.194 212.556 1.00 76.02  0  170 PHE C N   1 
ATOM   9177  C  CA  . PHE C 2 187 ? 215.088 225.946 213.707 1.00 76.02  0  170 PHE C CA  1 
ATOM   9178  C  C   . PHE C 2 187 ? 214.267 227.134 213.238 1.00 76.02  0  170 PHE C C   1 
ATOM   9179  O  O   . PHE C 2 187 ? 214.724 227.918 212.402 1.00 76.02  0  170 PHE C O   1 
ATOM   9180  C  CB  . PHE C 2 187 ? 216.239 226.425 214.590 1.00 76.02  0  170 PHE C CB  1 
ATOM   9181  C  CG  . PHE C 2 187 ? 215.865 227.535 215.532 1.00 76.02  0  170 PHE C CG  1 
ATOM   9182  C  CD1 . PHE C 2 187 ? 214.999 227.307 216.589 1.00 76.02  0  170 PHE C CD1 1 
ATOM   9183  C  CD2 . PHE C 2 187 ? 216.394 228.807 215.365 1.00 76.02  0  170 PHE C CD2 1 
ATOM   9184  C  CE1 . PHE C 2 187 ? 214.659 228.329 217.454 1.00 76.02  0  170 PHE C CE1 1 
ATOM   9185  C  CE2 . PHE C 2 187 ? 216.056 229.834 216.230 1.00 76.02  0  170 PHE C CE2 1 
ATOM   9186  C  CZ  . PHE C 2 187 ? 215.188 229.592 217.276 1.00 76.02  0  170 PHE C CZ  1 
ATOM   9187  N  N   . SER C 2 188 ? 213.063 227.257 213.783 1.00 74.47  0  171 SER C N   1 
ATOM   9188  C  CA  . SER C 2 188 ? 212.254 228.450 213.609 1.00 74.47  0  171 SER C CA  1 
ATOM   9189  C  C   . SER C 2 188 ? 211.368 228.587 214.835 1.00 74.47  0  171 SER C C   1 
ATOM   9190  O  O   . SER C 2 188 ? 210.995 227.591 215.460 1.00 74.47  0  171 SER C O   1 
ATOM   9191  C  CB  . SER C 2 188 ? 211.416 228.400 212.326 1.00 74.47  0  171 SER C CB  1 
ATOM   9192  O  OG  . SER C 2 188 ? 210.796 227.139 212.165 1.00 74.47  0  171 SER C OG  1 
ATOM   9193  N  N   . ARG C 2 189 ? 211.044 229.835 215.179 1.00 77.48  0  172 ARG C N   1 
ATOM   9194  C  CA  . ARG C 2 189 ? 210.252 230.095 216.374 1.00 77.48  0  172 ARG C CA  1 
ATOM   9195  C  C   . ARG C 2 189 ? 208.805 229.655 216.208 1.00 77.48  0  172 ARG C C   1 
ATOM   9196  O  O   . ARG C 2 189 ? 208.127 229.417 217.214 1.00 77.48  0  172 ARG C O   1 
ATOM   9197  C  CB  . ARG C 2 189 ? 210.317 231.580 216.732 1.00 77.48  0  172 ARG C CB  1 
ATOM   9198  C  CG  . ARG C 2 189 ? 211.705 232.050 217.138 1.00 77.48  0  172 ARG C CG  1 
ATOM   9199  C  CD  . ARG C 2 189 ? 211.869 233.548 216.940 1.00 77.48  0  172 ARG C CD  1 
ATOM   9200  N  NE  . ARG C 2 189 ? 213.168 234.023 217.409 1.00 77.48  0  172 ARG C NE  1 
ATOM   9201  C  CZ  . ARG C 2 189 ? 214.282 234.001 216.682 1.00 77.48  0  172 ARG C CZ  1 
ATOM   9202  N  NH1 . ARG C 2 189 ? 214.262 233.528 215.443 1.00 77.48  1  172 ARG C NH1 1 
ATOM   9203  N  NH2 . ARG C 2 189 ? 215.418 234.454 217.195 1.00 77.48  0  172 ARG C NH2 1 
ATOM   9204  N  N   . THR C 2 190 ? 208.338 229.519 214.964 1.00 70.46  0  173 THR C N   1 
ATOM   9205  C  CA  . THR C 2 190 ? 206.951 229.147 214.710 1.00 70.46  0  173 THR C CA  1 
ATOM   9206  C  C   . THR C 2 190 ? 206.683 227.710 215.139 1.00 70.46  0  173 THR C C   1 
ATOM   9207  O  O   . THR C 2 190 ? 205.768 227.452 215.928 1.00 70.46  0  173 THR C O   1 
ATOM   9208  C  CB  . THR C 2 190 ? 206.619 229.338 213.230 1.00 70.46  0  173 THR C CB  1 
ATOM   9209  O  OG1 . THR C 2 190 ? 206.910 230.687 212.843 1.00 70.46  0  173 THR C OG1 1 
ATOM   9210  C  CG2 . THR C 2 190 ? 205.150 229.050 212.974 1.00 70.46  0  173 THR C CG2 1 
ATOM   9211  N  N   . VAL C 2 191 ? 207.484 226.761 214.644 1.00 70.32  0  174 VAL C N   1 
ATOM   9212  C  CA  . VAL C 2 191 ? 207.259 225.360 214.990 1.00 70.32  0  174 VAL C CA  1 
ATOM   9213  C  C   . VAL C 2 191 ? 207.681 225.071 216.429 1.00 70.32  0  174 VAL C C   1 
ATOM   9214  O  O   . VAL C 2 191 ? 207.114 224.181 217.078 1.00 70.32  0  174 VAL C O   1 
ATOM   9215  C  CB  . VAL C 2 191 ? 207.965 224.425 213.988 1.00 70.32  0  174 VAL C CB  1 
ATOM   9216  C  CG1 . VAL C 2 191 ? 207.345 224.570 212.610 1.00 70.32  0  174 VAL C CG1 1 
ATOM   9217  C  CG2 . VAL C 2 191 ? 209.459 224.695 213.934 1.00 70.32  0  174 VAL C CG2 1 
ATOM   9218  N  N   . GLU C 2 192 ? 208.637 225.836 216.970 1.00 71.31  0  175 GLU C N   1 
ATOM   9219  C  CA  . GLU C 2 192 ? 209.004 225.672 218.373 1.00 71.31  0  175 GLU C CA  1 
ATOM   9220  C  C   . GLU C 2 192 ? 207.877 226.122 219.294 1.00 71.31  0  175 GLU C C   1 
ATOM   9221  O  O   . GLU C 2 192 ? 207.543 225.419 220.256 1.00 71.31  0  175 GLU C O   1 
ATOM   9222  C  CB  . GLU C 2 192 ? 210.290 226.438 218.687 1.00 71.31  0  175 GLU C CB  1 
ATOM   9223  C  CG  . GLU C 2 192 ? 210.663 226.412 220.167 1.00 71.31  0  175 GLU C CG  1 
ATOM   9224  C  CD  . GLU C 2 192 ? 211.672 227.471 220.552 1.00 71.31  0  175 GLU C CD  1 
ATOM   9225  O  OE1 . GLU C 2 192 ? 212.600 227.722 219.762 1.00 71.31  0  175 GLU C OE1 1 
ATOM   9226  O  OE2 . GLU C 2 192 ? 211.544 228.051 221.650 1.00 71.31  -1 175 GLU C OE2 1 
ATOM   9227  N  N   . ALA C 2 193 ? 207.256 227.268 218.994 1.00 69.95  0  176 ALA C N   1 
ATOM   9228  C  CA  . ALA C 2 193 ? 206.107 227.718 219.776 1.00 69.95  0  176 ALA C CA  1 
ATOM   9229  C  C   . ALA C 2 193 ? 204.911 226.791 219.594 1.00 69.95  0  176 ALA C C   1 
ATOM   9230  O  O   . ALA C 2 193 ? 204.202 226.505 220.567 1.00 69.95  0  176 ALA C O   1 
ATOM   9231  C  CB  . ALA C 2 193 ? 205.740 229.150 219.392 1.00 69.95  0  176 ALA C CB  1 
ATOM   9232  N  N   . PHE C 2 194 ? 204.688 226.327 218.354 1.00 65.92  0  177 PHE C N   1 
ATOM   9233  C  CA  . PHE C 2 194 ? 203.709 225.296 218.002 1.00 65.92  0  177 PHE C CA  1 
ATOM   9234  C  C   . PHE C 2 194 ? 203.797 224.089 218.931 1.00 65.92  0  177 PHE C C   1 
ATOM   9235  O  O   . PHE C 2 194 ? 202.831 223.747 219.624 1.00 65.92  0  177 PHE C O   1 
ATOM   9236  C  CB  . PHE C 2 194 ? 203.971 224.890 216.543 1.00 65.92  0  177 PHE C CB  1 
ATOM   9237  C  CG  . PHE C 2 194 ? 202.875 224.097 215.870 1.00 65.92  0  177 PHE C CG  1 
ATOM   9238  C  CD1 . PHE C 2 194 ? 202.736 222.730 216.076 1.00 65.92  0  177 PHE C CD1 1 
ATOM   9239  C  CD2 . PHE C 2 194 ? 202.057 224.709 214.934 1.00 65.92  0  177 PHE C CD2 1 
ATOM   9240  C  CE1 . PHE C 2 194 ? 201.751 222.009 215.420 1.00 65.92  0  177 PHE C CE1 1 
ATOM   9241  C  CE2 . PHE C 2 194 ? 201.079 223.994 214.265 1.00 65.92  0  177 PHE C CE2 1 
ATOM   9242  C  CZ  . PHE C 2 194 ? 200.924 222.642 214.512 1.00 65.92  0  177 PHE C CZ  1 
ATOM   9243  N  N   . LEU C 2 195 ? 204.976 223.463 218.987 1.00 64.08  0  178 LEU C N   1 
ATOM   9244  C  CA  . LEU C 2 195 ? 205.140 222.265 219.805 1.00 64.08  0  178 LEU C CA  1 
ATOM   9245  C  C   . LEU C 2 195 ? 205.112 222.589 221.297 1.00 64.08  0  178 LEU C C   1 
ATOM   9246  O  O   . LEU C 2 195 ? 204.551 221.819 222.090 1.00 64.08  0  178 LEU C O   1 
ATOM   9247  C  CB  . LEU C 2 195 ? 206.435 221.549 219.425 1.00 64.08  0  178 LEU C CB  1 
ATOM   9248  C  CG  . LEU C 2 195 ? 206.484 221.050 217.978 1.00 64.08  0  178 LEU C CG  1 
ATOM   9249  C  CD1 . LEU C 2 195 ? 207.897 220.656 217.580 1.00 64.08  0  178 LEU C CD1 1 
ATOM   9250  C  CD2 . LEU C 2 195 ? 205.520 219.897 217.764 1.00 64.08  0  178 LEU C CD2 1 
ATOM   9251  N  N   . LYS C 2 196 ? 205.678 223.733 221.701 1.00 66.07  0  179 LYS C N   1 
ATOM   9252  C  CA  . LYS C 2 196 ? 205.776 224.042 223.122 1.00 66.07  0  179 LYS C CA  1 
ATOM   9253  C  C   . LYS C 2 196 ? 204.450 224.475 223.736 1.00 66.07  0  179 LYS C C   1 
ATOM   9254  O  O   . LYS C 2 196 ? 204.322 224.443 224.965 1.00 66.07  0  179 LYS C O   1 
ATOM   9255  C  CB  . LYS C 2 196 ? 206.841 225.115 223.369 1.00 66.07  0  179 LYS C CB  1 
ATOM   9256  C  CG  . LYS C 2 196 ? 206.337 226.550 223.349 1.00 66.07  0  179 LYS C CG  1 
ATOM   9257  C  CD  . LYS C 2 196 ? 207.372 227.503 223.925 1.00 66.07  0  179 LYS C CD  1 
ATOM   9258  C  CE  . LYS C 2 196 ? 208.690 227.405 223.183 1.00 66.07  0  179 LYS C CE  1 
ATOM   9259  N  NZ  . LYS C 2 196 ? 209.737 228.274 223.787 1.00 66.07  1  179 LYS C NZ  1 
ATOM   9260  N  N   . GLU C 2 197 ? 203.459 224.871 222.932 1.00 66.60  0  180 GLU C N   1 
ATOM   9261  C  CA  . GLU C 2 197 ? 202.122 225.014 223.497 1.00 66.60  0  180 GLU C CA  1 
ATOM   9262  C  C   . GLU C 2 197 ? 201.223 223.824 223.194 1.00 66.60  0  180 GLU C C   1 
ATOM   9263  O  O   . GLU C 2 197 ? 200.231 223.628 223.903 1.00 66.60  0  180 GLU C O   1 
ATOM   9264  C  CB  . GLU C 2 197 ? 201.441 226.312 223.027 1.00 66.60  0  180 GLU C CB  1 
ATOM   9265  C  CG  . GLU C 2 197 ? 201.188 226.434 221.543 1.00 66.60  0  180 GLU C CG  1 
ATOM   9266  C  CD  . GLU C 2 197 ? 199.859 225.871 221.106 1.00 66.60  0  180 GLU C CD  1 
ATOM   9267  O  OE1 . GLU C 2 197 ? 198.916 225.843 221.923 1.00 66.60  0  180 GLU C OE1 1 
ATOM   9268  O  OE2 . GLU C 2 197 ? 199.790 225.398 219.961 1.00 66.60  -1 180 GLU C OE2 1 
ATOM   9269  N  N   . ALA C 2 198 ? 201.528 223.033 222.157 1.00 64.69  0  181 ALA C N   1 
ATOM   9270  C  CA  . ALA C 2 198 ? 200.755 221.822 221.924 1.00 64.69  0  181 ALA C CA  1 
ATOM   9271  C  C   . ALA C 2 198 ? 201.073 220.744 222.947 1.00 64.69  0  181 ALA C C   1 
ATOM   9272  O  O   . ALA C 2 198 ? 200.261 219.834 223.144 1.00 64.69  0  181 ALA C O   1 
ATOM   9273  C  CB  . ALA C 2 198 ? 201.007 221.295 220.511 1.00 64.69  0  181 ALA C CB  1 
ATOM   9274  N  N   . ALA C 2 199 ? 202.233 220.825 223.599 1.00 66.09  0  182 ALA C N   1 
ATOM   9275  C  CA  . ALA C 2 199 ? 202.556 219.914 224.689 1.00 66.09  0  182 ALA C CA  1 
ATOM   9276  C  C   . ALA C 2 199 ? 201.952 220.334 226.023 1.00 66.09  0  182 ALA C C   1 
ATOM   9277  O  O   . ALA C 2 199 ? 202.217 219.675 227.034 1.00 66.09  0  182 ALA C O   1 
ATOM   9278  C  CB  . ALA C 2 199 ? 204.072 219.791 224.837 1.00 66.09  0  182 ALA C CB  1 
ATOM   9279  N  N   . ARG C 2 200 ? 201.159 221.409 226.060 1.00 69.46  0  183 ARG C N   1 
ATOM   9280  C  CA  . ARG C 2 200 ? 200.533 221.818 227.312 1.00 69.46  0  183 ARG C CA  1 
ATOM   9281  C  C   . ARG C 2 200 ? 199.371 220.907 227.685 1.00 69.46  0  183 ARG C C   1 
ATOM   9282  O  O   . ARG C 2 200 ? 199.058 220.760 228.872 1.00 69.46  0  183 ARG C O   1 
ATOM   9283  C  CB  . ARG C 2 200 ? 200.053 223.265 227.213 1.00 69.46  0  183 ARG C CB  1 
ATOM   9284  C  CG  . ARG C 2 200 ? 201.170 224.285 227.105 1.00 69.46  0  183 ARG C CG  1 
ATOM   9285  C  CD  . ARG C 2 200 ? 200.613 225.690 226.954 1.00 69.46  0  183 ARG C CD  1 
ATOM   9286  N  NE  . ARG C 2 200 ? 201.664 226.667 226.687 1.00 69.46  0  183 ARG C NE  1 
ATOM   9287  C  CZ  . ARG C 2 200 ? 202.318 227.337 227.630 1.00 69.46  0  183 ARG C CZ  1 
ATOM   9288  N  NH1 . ARG C 2 200 ? 203.258 228.209 227.296 1.00 69.46  1  183 ARG C NH1 1 
ATOM   9289  N  NH2 . ARG C 2 200 ? 202.032 227.134 228.909 1.00 69.46  0  183 ARG C NH2 1 
ATOM   9290  N  N   . LYS C 2 201 ? 198.725 220.291 226.696 1.00 69.57  0  184 LYS C N   1 
ATOM   9291  C  CA  . LYS C 2 201 ? 197.631 219.366 226.943 1.00 69.57  0  184 LYS C CA  1 
ATOM   9292  C  C   . LYS C 2 201 ? 197.852 217.984 226.349 1.00 69.57  0  184 LYS C C   1 
ATOM   9293  O  O   . LYS C 2 201 ? 197.075 217.072 226.652 1.00 69.57  0  184 LYS C O   1 
ATOM   9294  C  CB  . LYS C 2 201 ? 196.313 219.935 226.396 1.00 69.57  0  184 LYS C CB  1 
ATOM   9295  C  CG  . LYS C 2 201 ? 195.832 221.183 227.114 1.00 69.57  0  184 LYS C CG  1 
ATOM   9296  C  CD  . LYS C 2 201 ? 194.486 221.641 226.581 1.00 69.57  0  184 LYS C CD  1 
ATOM   9297  C  CE  . LYS C 2 201 ? 193.988 222.867 227.326 1.00 69.57  0  184 LYS C CE  1 
ATOM   9298  N  NZ  . LYS C 2 201 ? 194.930 224.012 227.199 1.00 69.57  1  184 LYS C NZ  1 
ATOM   9299  N  N   . ARG C 2 202 ? 198.876 217.800 225.521 1.00 63.28  0  185 ARG C N   1 
ATOM   9300  C  CA  . ARG C 2 202 ? 199.164 216.519 224.899 1.00 63.28  0  185 ARG C CA  1 
ATOM   9301  C  C   . ARG C 2 202 ? 200.545 216.035 225.316 1.00 63.28  0  185 ARG C C   1 
ATOM   9302  O  O   . ARG C 2 202 ? 201.432 216.831 225.636 1.00 63.28  0  185 ARG C O   1 
ATOM   9303  C  CB  . ARG C 2 202 ? 199.088 216.609 223.369 1.00 63.28  0  185 ARG C CB  1 
ATOM   9304  C  CG  . ARG C 2 202 ? 197.794 217.205 222.844 1.00 63.28  0  185 ARG C CG  1 
ATOM   9305  C  CD  . ARG C 2 202 ? 196.605 216.325 223.191 1.00 63.28  0  185 ARG C CD  1 
ATOM   9306  N  NE  . ARG C 2 202 ? 195.335 216.986 222.909 1.00 63.28  0  185 ARG C NE  1 
ATOM   9307  C  CZ  . ARG C 2 202 ? 194.711 216.938 221.737 1.00 63.28  0  185 ARG C CZ  1 
ATOM   9308  N  NH1 . ARG C 2 202 ? 195.239 216.257 220.730 1.00 63.28  1  185 ARG C NH1 1 
ATOM   9309  N  NH2 . ARG C 2 202 ? 193.559 217.571 221.570 1.00 63.28  0  185 ARG C NH2 1 
ATOM   9310  N  N   . LYS C 2 203 ? 200.716 214.716 225.307 1.00 66.84  0  186 LYS C N   1 
ATOM   9311  C  CA  . LYS C 2 203 ? 201.997 214.081 225.584 1.00 66.84  0  186 LYS C CA  1 
ATOM   9312  C  C   . LYS C 2 203 ? 202.445 213.373 224.316 1.00 66.84  0  186 LYS C C   1 
ATOM   9313  O  O   . LYS C 2 203 ? 201.784 212.436 223.858 1.00 66.84  0  186 LYS C O   1 
ATOM   9314  C  CB  . LYS C 2 203 ? 201.892 213.095 226.749 1.00 66.84  0  186 LYS C CB  1 
ATOM   9315  C  CG  . LYS C 2 203 ? 201.606 213.746 228.091 1.00 66.84  0  186 LYS C CG  1 
ATOM   9316  C  CD  . LYS C 2 203 ? 202.746 214.659 228.510 1.00 66.84  0  186 LYS C CD  1 
ATOM   9317  C  CE  . LYS C 2 203 ? 202.472 215.303 229.858 1.00 66.84  0  186 LYS C CE  1 
ATOM   9318  N  NZ  . LYS C 2 203 ? 203.572 216.219 230.266 1.00 66.84  1  186 LYS C NZ  1 
ATOM   9319  N  N   . PHE C 2 204 ? 203.561 213.824 223.753 1.00 59.94  0  187 PHE C N   1 
ATOM   9320  C  CA  . PHE C 2 204 ? 204.056 213.297 222.492 1.00 59.94  0  187 PHE C CA  1 
ATOM   9321  C  C   . PHE C 2 204 ? 205.567 213.482 222.457 1.00 59.94  0  187 PHE C C   1 
ATOM   9322  O  O   . PHE C 2 204 ? 206.169 214.006 223.397 1.00 59.94  0  187 PHE C O   1 
ATOM   9323  C  CB  . PHE C 2 204 ? 203.352 213.961 221.297 1.00 59.94  0  187 PHE C CB  1 
ATOM   9324  C  CG  . PHE C 2 204 ? 203.567 215.449 221.194 1.00 59.94  0  187 PHE C CG  1 
ATOM   9325  C  CD1 . PHE C 2 204 ? 202.780 216.335 221.917 1.00 59.94  0  187 PHE C CD1 1 
ATOM   9326  C  CD2 . PHE C 2 204 ? 204.532 215.964 220.342 1.00 59.94  0  187 PHE C CD2 1 
ATOM   9327  C  CE1 . PHE C 2 204 ? 202.970 217.699 221.814 1.00 59.94  0  187 PHE C CE1 1 
ATOM   9328  C  CE2 . PHE C 2 204 ? 204.723 217.329 220.235 1.00 59.94  0  187 PHE C CE2 1 
ATOM   9329  C  CZ  . PHE C 2 204 ? 203.942 218.196 220.971 1.00 59.94  0  187 PHE C CZ  1 
ATOM   9330  N  N   . HIS C 2 205 ? 206.180 213.040 221.363 1.00 58.18  0  188 HIS C N   1 
ATOM   9331  C  CA  . HIS C 2 205 ? 207.626 213.070 221.212 1.00 58.18  0  188 HIS C CA  1 
ATOM   9332  C  C   . HIS C 2 205 ? 208.009 213.914 220.004 1.00 58.18  0  188 HIS C C   1 
ATOM   9333  O  O   . HIS C 2 205 ? 207.276 213.975 219.014 1.00 58.18  0  188 HIS C O   1 
ATOM   9334  C  CB  . HIS C 2 205 ? 208.185 211.653 221.056 1.00 58.18  0  188 HIS C CB  1 
ATOM   9335  C  CG  . HIS C 2 205 ? 207.839 210.742 222.193 1.00 58.18  0  188 HIS C CG  1 
ATOM   9336  N  ND1 . HIS C 2 205 ? 206.595 210.164 222.330 1.00 58.18  0  188 HIS C ND1 1 
ATOM   9337  C  CD2 . HIS C 2 205 ? 208.567 210.321 223.253 1.00 58.18  0  188 HIS C CD2 1 
ATOM   9338  C  CE1 . HIS C 2 205 ? 206.575 209.419 223.421 1.00 58.18  0  188 HIS C CE1 1 
ATOM   9339  N  NE2 . HIS C 2 205 ? 207.760 209.497 223.999 1.00 58.18  0  188 HIS C NE2 1 
ATOM   9340  N  N   . VAL C 2 206 ? 209.164 214.571 220.094 1.00 56.62  0  189 VAL C N   1 
ATOM   9341  C  CA  . VAL C 2 206 ? 209.673 215.419 219.021 1.00 56.62  0  189 VAL C CA  1 
ATOM   9342  C  C   . VAL C 2 206 ? 211.081 214.958 218.676 1.00 56.62  0  189 VAL C C   1 
ATOM   9343  O  O   . VAL C 2 206 ? 211.969 214.972 219.535 1.00 56.62  0  189 VAL C O   1 
ATOM   9344  C  CB  . VAL C 2 206 ? 209.683 216.908 219.408 1.00 56.62  0  189 VAL C CB  1 
ATOM   9345  C  CG1 . VAL C 2 206 ? 210.389 217.724 218.338 1.00 56.62  0  189 VAL C CG1 1 
ATOM   9346  C  CG2 . VAL C 2 206 ? 208.274 217.421 219.615 1.00 56.62  0  189 VAL C CG2 1 
ATOM   9347  N  N   . ILE C 2 207 ? 211.287 214.563 217.426 1.00 53.87  0  190 ILE C N   1 
ATOM   9348  C  CA  . ILE C 2 207 ? 212.604 214.207 216.912 1.00 53.87  0  190 ILE C CA  1 
ATOM   9349  C  C   . ILE C 2 207 ? 213.186 215.437 216.232 1.00 53.87  0  190 ILE C C   1 
ATOM   9350  O  O   . ILE C 2 207 ? 212.617 215.943 215.257 1.00 53.87  0  190 ILE C O   1 
ATOM   9351  C  CB  . ILE C 2 207 ? 212.517 213.028 215.934 1.00 53.87  0  190 ILE C CB  1 
ATOM   9352  C  CG1 . ILE C 2 207 ? 212.074 211.759 216.663 1.00 53.87  0  190 ILE C CG1 1 
ATOM   9353  C  CG2 . ILE C 2 207 ? 213.842 212.823 215.244 1.00 53.87  0  190 ILE C CG2 1 
ATOM   9354  C  CD1 . ILE C 2 207 ? 211.957 210.554 215.761 1.00 53.87  0  190 ILE C CD1 1 
ATOM   9355  N  N   . VAL C 2 208 ? 214.312 215.927 216.738 1.00 56.22  0  191 VAL C N   1 
ATOM   9356  C  CA  . VAL C 2 208 ? 214.980 217.097 216.183 1.00 56.22  0  191 VAL C CA  1 
ATOM   9357  C  C   . VAL C 2 208 ? 216.232 216.620 215.462 1.00 56.22  0  191 VAL C C   1 
ATOM   9358  O  O   . VAL C 2 208 ? 217.163 216.094 216.087 1.00 56.22  0  191 VAL C O   1 
ATOM   9359  C  CB  . VAL C 2 208 ? 215.318 218.134 217.260 1.00 56.22  0  191 VAL C CB  1 
ATOM   9360  C  CG1 . VAL C 2 208 ? 216.161 219.244 216.664 1.00 56.22  0  191 VAL C CG1 1 
ATOM   9361  C  CG2 . VAL C 2 208 ? 214.044 218.703 217.856 1.00 56.22  0  191 VAL C CG2 1 
ATOM   9362  N  N   . ALA C 2 209 ? 216.254 216.799 214.146 1.00 58.46  0  192 ALA C N   1 
ATOM   9363  C  CA  . ALA C 2 209 ? 217.424 216.503 213.334 1.00 58.46  0  192 ALA C CA  1 
ATOM   9364  C  C   . ALA C 2 209 ? 218.186 217.796 213.081 1.00 58.46  0  192 ALA C C   1 
ATOM   9365  O  O   . ALA C 2 209 ? 217.606 218.782 212.613 1.00 58.46  0  192 ALA C O   1 
ATOM   9366  C  CB  . ALA C 2 209 ? 217.024 215.847 212.013 1.00 58.46  0  192 ALA C CB  1 
ATOM   9367  N  N   . GLU C 2 210 ? 219.476 217.792 213.402 1.00 67.06  0  193 GLU C N   1 
ATOM   9368  C  CA  . GLU C 2 210 ? 220.291 218.986 213.250 1.00 67.06  0  193 GLU C CA  1 
ATOM   9369  C  C   . GLU C 2 210 ? 220.608 219.243 211.780 1.00 67.06  0  193 GLU C C   1 
ATOM   9370  O  O   . GLU C 2 210 ? 220.464 218.370 210.920 1.00 67.06  0  193 GLU C O   1 
ATOM   9371  C  CB  . GLU C 2 210 ? 221.590 218.851 214.044 1.00 67.06  0  193 GLU C CB  1 
ATOM   9372  C  CG  . GLU C 2 210 ? 222.554 217.826 213.470 1.00 67.06  0  193 GLU C CG  1 
ATOM   9373  C  CD  . GLU C 2 210 ? 223.805 217.664 214.307 1.00 67.06  0  193 GLU C CD  1 
ATOM   9374  O  OE1 . GLU C 2 210 ? 223.875 218.270 215.396 1.00 67.06  0  193 GLU C OE1 1 
ATOM   9375  O  OE2 . GLU C 2 210 ? 224.719 216.930 213.875 1.00 67.06  -1 193 GLU C OE2 1 
ATOM   9376  N  N   . CYS C 2 211 ? 221.041 220.466 211.497 1.00 70.57  0  194 CYS C N   1 
ATOM   9377  C  CA  . CYS C 2 211 ? 221.443 220.863 210.157 1.00 70.57  0  194 CYS C CA  1 
ATOM   9378  C  C   . CYS C 2 211 ? 222.964 220.865 210.074 1.00 70.57  0  194 CYS C C   1 
ATOM   9379  O  O   . CYS C 2 211 ? 223.644 221.354 210.980 1.00 70.57  0  194 CYS C O   1 
ATOM   9380  C  CB  . CYS C 2 211 ? 220.883 222.239 209.795 1.00 70.57  0  194 CYS C CB  1 
ATOM   9381  S  SG  . CYS C 2 211 ? 219.209 222.212 209.116 1.00 70.57  0  194 CYS C SG  1 
ATOM   9382  N  N   . ALA C 2 212 ? 223.491 220.317 208.986 1.00 71.41  0  195 ALA C N   1 
ATOM   9383  C  CA  . ALA C 2 212 ? 224.932 220.139 208.835 1.00 71.41  0  195 ALA C CA  1 
ATOM   9384  C  C   . ALA C 2 212 ? 225.738 221.417 208.559 1.00 71.41  0  195 ALA C C   1 
ATOM   9385  O  O   . ALA C 2 212 ? 226.866 221.505 209.062 1.00 71.41  0  195 ALA C O   1 
ATOM   9386  C  CB  . ALA C 2 212 ? 225.210 219.092 207.750 1.00 71.41  0  195 ALA C CB  1 
ATOM   9387  N  N   . PRO C 2 213 ? 225.260 222.427 207.745 1.00 75.05  0  196 PRO C N   1 
ATOM   9388  C  CA  . PRO C 2 213 ? 226.015 223.692 207.686 1.00 75.05  0  196 PRO C CA  1 
ATOM   9389  C  C   . PRO C 2 213 ? 226.062 224.434 209.013 1.00 75.05  0  196 PRO C C   1 
ATOM   9390  O  O   . PRO C 2 213 ? 227.139 224.722 209.542 1.00 75.05  0  196 PRO C O   1 
ATOM   9391  C  CB  . PRO C 2 213 ? 225.258 224.504 206.630 1.00 75.05  0  196 PRO C CB  1 
ATOM   9392  C  CG  . PRO C 2 213 ? 224.700 223.496 205.740 1.00 75.05  0  196 PRO C CG  1 
ATOM   9393  C  CD  . PRO C 2 213 ? 224.261 222.393 206.652 1.00 75.05  0  196 PRO C CD  1 
ATOM   9394  N  N   . PHE C 2 214 ? 224.891 224.728 209.567 1.00 76.12  0  197 PHE C N   1 
ATOM   9395  C  CA  . PHE C 2 214 ? 224.770 225.407 210.850 1.00 76.12  0  197 PHE C CA  1 
ATOM   9396  C  C   . PHE C 2 214 ? 223.876 224.567 211.745 1.00 76.12  0  197 PHE C C   1 
ATOM   9397  O  O   . PHE C 2 214 ? 222.690 224.396 211.452 1.00 76.12  0  197 PHE C O   1 
ATOM   9398  C  CB  . PHE C 2 214 ? 224.200 226.820 210.685 1.00 76.12  0  197 PHE C CB  1 
ATOM   9399  C  CG  . PHE C 2 214 ? 225.223 227.841 210.276 1.00 76.12  0  197 PHE C CG  1 
ATOM   9400  C  CD1 . PHE C 2 214 ? 226.084 228.391 211.215 1.00 76.12  0  197 PHE C CD1 1 
ATOM   9401  C  CD2 . PHE C 2 214 ? 225.323 228.253 208.956 1.00 76.12  0  197 PHE C CD2 1 
ATOM   9402  C  CE1 . PHE C 2 214 ? 227.028 229.333 210.845 1.00 76.12  0  197 PHE C CE1 1 
ATOM   9403  C  CE2 . PHE C 2 214 ? 226.265 229.195 208.578 1.00 76.12  0  197 PHE C CE2 1 
ATOM   9404  C  CZ  . PHE C 2 214 ? 227.119 229.735 209.525 1.00 76.12  0  197 PHE C CZ  1 
ATOM   9405  N  N   . CYS C 2 215 ? 224.438 224.070 212.847 1.00 79.34  0  198 CYS C N   1 
ATOM   9406  C  CA  . CYS C 2 215 ? 223.725 223.193 213.779 1.00 79.34  0  198 CYS C CA  1 
ATOM   9407  C  C   . CYS C 2 215 ? 222.749 224.046 214.583 1.00 79.34  0  198 CYS C C   1 
ATOM   9408  O  O   . CYS C 2 215 ? 222.971 224.397 215.744 1.00 79.34  0  198 CYS C O   1 
ATOM   9409  C  CB  . CYS C 2 215 ? 224.704 222.453 214.680 1.00 79.34  0  198 CYS C CB  1 
ATOM   9410  S  SG  . CYS C 2 215 ? 225.369 220.935 213.963 1.00 79.34  0  198 CYS C SG  1 
ATOM   9411  N  N   . GLN C 2 216 ? 221.637 224.383 213.932 1.00 76.95  0  199 GLN C N   1 
ATOM   9412  C  CA  . GLN C 2 216 ? 220.597 225.203 214.523 1.00 76.95  0  199 GLN C CA  1 
ATOM   9413  C  C   . GLN C 2 216 ? 219.534 224.390 215.249 1.00 76.95  0  199 GLN C C   1 
ATOM   9414  O  O   . GLN C 2 216 ? 218.751 224.966 216.009 1.00 76.95  0  199 GLN C O   1 
ATOM   9415  C  CB  . GLN C 2 216 ? 219.924 226.012 213.407 1.00 76.95  0  199 GLN C CB  1 
ATOM   9416  C  CG  . GLN C 2 216 ? 219.607 227.457 213.707 1.00 76.95  0  199 GLN C CG  1 
ATOM   9417  C  CD  . GLN C 2 216 ? 219.087 228.185 212.482 1.00 76.95  0  199 GLN C CD  1 
ATOM   9418  O  OE1 . GLN C 2 216 ? 218.893 227.580 211.426 1.00 76.95  0  199 GLN C OE1 1 
ATOM   9419  N  NE2 . GLN C 2 216 ? 218.848 229.483 212.618 1.00 76.95  0  199 GLN C NE2 1 
ATOM   9420  N  N   . GLY C 2 217 ? 219.523 223.065 215.084 1.00 73.00  0  200 GLY C N   1 
ATOM   9421  C  CA  . GLY C 2 217 ? 218.571 222.233 215.800 1.00 73.00  0  200 GLY C CA  1 
ATOM   9422  C  C   . GLY C 2 217 ? 218.865 222.081 217.277 1.00 73.00  0  200 GLY C C   1 
ATOM   9423  O  O   . GLY C 2 217 ? 217.988 221.652 218.033 1.00 73.00  0  200 GLY C O   1 
ATOM   9424  N  N   . HIS C 2 218 ? 220.078 222.434 217.704 1.00 75.69  0  201 HIS C N   1 
ATOM   9425  C  CA  . HIS C 2 218 ? 220.464 222.272 219.101 1.00 75.69  0  201 HIS C CA  1 
ATOM   9426  C  C   . HIS C 2 218 ? 219.745 223.254 220.019 1.00 75.69  0  201 HIS C C   1 
ATOM   9427  O  O   . HIS C 2 218 ? 219.291 222.869 221.108 1.00 75.69  0  201 HIS C O   1 
ATOM   9428  C  CB  . HIS C 2 218 ? 221.981 222.406 219.234 1.00 75.69  0  201 HIS C CB  1 
ATOM   9429  C  CG  . HIS C 2 218 ? 222.745 221.305 218.562 1.00 75.69  0  201 HIS C CG  1 
ATOM   9430  N  ND1 . HIS C 2 218 ? 224.118 221.315 218.450 1.00 75.69  0  201 HIS C ND1 1 
ATOM   9431  C  CD2 . HIS C 2 218 ? 222.329 220.162 217.964 1.00 75.69  0  201 HIS C CD2 1 
ATOM   9432  C  CE1 . HIS C 2 218 ? 224.516 220.227 217.816 1.00 75.69  0  201 HIS C CE1 1 
ATOM   9433  N  NE2 . HIS C 2 218 ? 223.450 219.510 217.509 1.00 75.69  0  201 HIS C NE2 1 
ATOM   9434  N  N   . GLU C 2 219 ? 219.627 224.528 219.606 1.00 76.70  0  202 GLU C N   1 
ATOM   9435  C  CA  . GLU C 2 219 ? 218.924 225.475 220.469 1.00 76.70  0  202 GLU C CA  1 
ATOM   9436  C  C   . GLU C 2 219 ? 217.432 225.183 220.504 1.00 76.70  0  202 GLU C C   1 
ATOM   9437  O  O   . GLU C 2 219 ? 216.787 225.370 221.542 1.00 76.70  0  202 GLU C O   1 
ATOM   9438  C  CB  . GLU C 2 219 ? 219.071 226.931 219.998 1.00 76.70  0  202 GLU C CB  1 
ATOM   9439  C  CG  . GLU C 2 219 ? 218.985 227.183 218.493 1.00 76.70  0  202 GLU C CG  1 
ATOM   9440  C  CD  . GLU C 2 219 ? 220.315 227.305 217.791 1.00 76.70  0  202 GLU C CD  1 
ATOM   9441  O  OE1 . GLU C 2 219 ? 221.289 226.653 218.219 1.00 76.70  0  202 GLU C OE1 1 
ATOM   9442  O  OE2 . GLU C 2 219 ? 220.386 228.087 216.820 1.00 76.70  -1 202 GLU C OE2 1 
ATOM   9443  N  N   . MET C 2 220 ? 216.882 224.680 219.399 1.00 72.88  0  203 MET C N   1 
ATOM   9444  C  CA  . MET C 2 220 ? 215.493 224.243 219.395 1.00 72.88  0  203 MET C CA  1 
ATOM   9445  C  C   . MET C 2 220 ? 215.286 223.022 220.282 1.00 72.88  0  203 MET C C   1 
ATOM   9446  O  O   . MET C 2 220 ? 214.257 222.913 220.955 1.00 72.88  0  203 MET C O   1 
ATOM   9447  C  CB  . MET C 2 220 ? 215.035 223.981 217.963 1.00 72.88  0  203 MET C CB  1 
ATOM   9448  C  CG  . MET C 2 220 ? 213.540 223.851 217.829 1.00 72.88  0  203 MET C CG  1 
ATOM   9449  S  SD  . MET C 2 220 ? 213.019 223.104 216.285 1.00 72.88  0  203 MET C SD  1 
ATOM   9450  C  CE  . MET C 2 220 ? 211.303 222.802 216.669 1.00 72.88  0  203 MET C CE  1 
ATOM   9451  N  N   . ALA C 2 221 ? 216.262 222.110 220.321 1.00 69.70  0  204 ALA C N   1 
ATOM   9452  C  CA  . ALA C 2 221 ? 216.134 220.940 221.186 1.00 69.70  0  204 ALA C CA  1 
ATOM   9453  C  C   . ALA C 2 221 ? 216.206 221.323 222.660 1.00 69.70  0  204 ALA C C   1 
ATOM   9454  O  O   . ALA C 2 221 ? 215.446 220.795 223.481 1.00 69.70  0  204 ALA C O   1 
ATOM   9455  C  CB  . ALA C 2 221 ? 217.215 219.920 220.847 1.00 69.70  0  204 ALA C CB  1 
ATOM   9456  N  N   . VAL C 2 222 ? 217.097 222.249 223.016 1.00 71.09  0  205 VAL C N   1 
ATOM   9457  C  CA  . VAL C 2 222 ? 217.169 222.651 224.419 1.00 71.09  0  205 VAL C CA  1 
ATOM   9458  C  C   . VAL C 2 222 ? 216.058 223.630 224.790 1.00 71.09  0  205 VAL C C   1 
ATOM   9459  O  O   . VAL C 2 222 ? 215.800 223.832 225.982 1.00 71.09  0  205 VAL C O   1 
ATOM   9460  C  CB  . VAL C 2 222 ? 218.543 223.240 224.782 1.00 71.09  0  205 VAL C CB  1 
ATOM   9461  C  CG1 . VAL C 2 222 ? 219.655 222.292 224.364 1.00 71.09  0  205 VAL C CG1 1 
ATOM   9462  C  CG2 . VAL C 2 222 ? 218.735 224.608 224.154 1.00 71.09  0  205 VAL C CG2 1 
ATOM   9463  N  N   . ASN C 2 223 ? 215.387 224.245 223.808 1.00 71.38  0  206 ASN C N   1 
ATOM   9464  C  CA  . ASN C 2 223 ? 214.217 225.062 224.109 1.00 71.38  0  206 ASN C CA  1 
ATOM   9465  C  C   . ASN C 2 223 ? 212.950 224.226 224.221 1.00 71.38  0  206 ASN C C   1 
ATOM   9466  O  O   . ASN C 2 223 ? 212.040 224.587 224.975 1.00 71.38  0  206 ASN C O   1 
ATOM   9467  C  CB  . ASN C 2 223 ? 214.038 226.144 223.043 1.00 71.38  0  206 ASN C CB  1 
ATOM   9468  C  CG  . ASN C 2 223 ? 214.989 227.308 223.229 1.00 71.38  0  206 ASN C CG  1 
ATOM   9469  O  OD1 . ASN C 2 223 ? 215.267 227.726 224.352 1.00 71.38  0  206 ASN C OD1 1 
ATOM   9470  N  ND2 . ASN C 2 223 ? 215.495 227.840 222.122 1.00 71.38  0  206 ASN C ND2 1 
ATOM   9471  N  N   . LEU C 2 224 ? 212.868 223.119 223.480 1.00 67.56  0  207 LEU C N   1 
ATOM   9472  C  CA  . LEU C 2 224 ? 211.724 222.225 223.599 1.00 67.56  0  207 LEU C CA  1 
ATOM   9473  C  C   . LEU C 2 224 ? 211.852 221.322 224.816 1.00 67.56  0  207 LEU C C   1 
ATOM   9474  O  O   . LEU C 2 224 ? 210.838 220.942 225.411 1.00 67.56  0  207 LEU C O   1 
ATOM   9475  C  CB  . LEU C 2 224 ? 211.570 221.382 222.332 1.00 67.56  0  207 LEU C CB  1 
ATOM   9476  C  CG  . LEU C 2 224 ? 211.077 222.089 221.066 1.00 67.56  0  207 LEU C CG  1 
ATOM   9477  C  CD1 . LEU C 2 224 ? 210.787 221.076 219.977 1.00 67.56  0  207 LEU C CD1 1 
ATOM   9478  C  CD2 . LEU C 2 224 ? 209.860 222.957 221.332 1.00 67.56  0  207 LEU C CD2 1 
ATOM   9479  N  N   . SER C 2 225 ? 213.083 220.967 225.194 1.00 66.80  0  208 SER C N   1 
ATOM   9480  C  CA  . SER C 2 225 ? 213.289 220.107 226.351 1.00 66.80  0  208 SER C CA  1 
ATOM   9481  C  C   . SER C 2 225 ? 213.076 220.847 227.664 1.00 66.80  0  208 SER C C   1 
ATOM   9482  O  O   . SER C 2 225 ? 212.880 220.202 228.699 1.00 66.80  0  208 SER C O   1 
ATOM   9483  C  CB  . SER C 2 225 ? 214.692 219.507 226.320 1.00 66.80  0  208 SER C CB  1 
ATOM   9484  O  OG  . SER C 2 225 ? 214.997 218.889 227.555 1.00 66.80  0  208 SER C OG  1 
ATOM   9485  N  N   . LYS C 2 226 ? 213.118 222.183 227.649 1.00 66.44  0  209 LYS C N   1 
ATOM   9486  C  CA  . LYS C 2 226 ? 212.756 222.944 228.838 1.00 66.44  0  209 LYS C CA  1 
ATOM   9487  C  C   . LYS C 2 226 ? 211.258 222.876 229.105 1.00 66.44  0  209 LYS C C   1 
ATOM   9488  O  O   . LYS C 2 226 ? 210.829 222.995 230.258 1.00 66.44  0  209 LYS C O   1 
ATOM   9489  C  CB  . LYS C 2 226 ? 213.210 224.397 228.693 1.00 66.44  0  209 LYS C CB  1 
ATOM   9490  C  CG  . LYS C 2 226 ? 214.682 224.614 228.999 1.00 66.44  0  209 LYS C CG  1 
ATOM   9491  C  CD  . LYS C 2 226 ? 215.140 226.003 228.585 1.00 66.44  0  209 LYS C CD  1 
ATOM   9492  C  CE  . LYS C 2 226 ? 216.628 226.186 228.836 1.00 66.44  0  209 LYS C CE  1 
ATOM   9493  N  NZ  . LYS C 2 226 ? 217.114 227.518 228.382 1.00 66.44  1  209 LYS C NZ  1 
ATOM   9494  N  N   . ALA C 2 227 ? 210.454 222.690 228.061 1.00 63.42  0  210 ALA C N   1 
ATOM   9495  C  CA  . ALA C 2 227 ? 209.023 222.474 228.214 1.00 63.42  0  210 ALA C CA  1 
ATOM   9496  C  C   . ALA C 2 227 ? 208.669 221.016 228.474 1.00 63.42  0  210 ALA C C   1 
ATOM   9497  O  O   . ALA C 2 227 ? 207.532 220.732 228.864 1.00 63.42  0  210 ALA C O   1 
ATOM   9498  C  CB  . ALA C 2 227 ? 208.278 222.964 226.968 1.00 63.42  0  210 ALA C CB  1 
ATOM   9499  N  N   . GLY C 2 228 ? 209.607 220.093 228.270 1.00 65.04  0  211 GLY C N   1 
ATOM   9500  C  CA  . GLY C 2 228 ? 209.382 218.692 228.570 1.00 65.04  0  211 GLY C CA  1 
ATOM   9501  C  C   . GLY C 2 228 ? 208.518 218.009 227.531 1.00 65.04  0  211 GLY C C   1 
ATOM   9502  O  O   . GLY C 2 228 ? 207.419 217.539 227.839 1.00 65.04  0  211 GLY C O   1 
ATOM   9503  N  N   . ILE C 2 229 ? 209.007 217.946 226.293 1.00 63.26  0  212 ILE C N   1 
ATOM   9504  C  CA  . ILE C 2 229 ? 208.299 217.303 225.193 1.00 63.26  0  212 ILE C CA  1 
ATOM   9505  C  C   . ILE C 2 229 ? 209.003 216.015 224.758 1.00 63.26  0  212 ILE C C   1 
ATOM   9506  O  O   . ILE C 2 229 ? 208.665 215.446 223.711 1.00 63.26  0  212 ILE C O   1 
ATOM   9507  C  CB  . ILE C 2 229 ? 208.117 218.289 224.019 1.00 63.26  0  212 ILE C CB  1 
ATOM   9508  C  CG1 . ILE C 2 229 ? 207.796 219.679 224.560 1.00 63.26  0  212 ILE C CG1 1 
ATOM   9509  C  CG2 . ILE C 2 229 ? 206.876 217.973 223.177 1.00 63.26  0  212 ILE C CG2 1 
ATOM   9510  C  CD1 . ILE C 2 229 ? 207.827 220.763 223.522 1.00 63.26  0  212 ILE C CD1 1 
ATOM   9511  N  N   . GLU C 2 230 ? 209.971 215.534 225.557 1.00 67.58  0  213 GLU C N   1 
ATOM   9512  C  CA  . GLU C 2 230 ? 210.723 214.292 225.306 1.00 67.58  0  213 GLU C CA  1 
ATOM   9513  C  C   . GLU C 2 230 ? 211.422 214.306 223.945 1.00 67.58  0  213 GLU C C   1 
ATOM   9514  O  O   . GLU C 2 230 ? 211.299 213.380 223.141 1.00 67.58  0  213 GLU C O   1 
ATOM   9515  C  CB  . GLU C 2 230 ? 209.819 213.057 225.464 1.00 67.58  0  213 GLU C CB  1 
ATOM   9516  C  CG  . GLU C 2 230 ? 210.499 211.723 225.810 1.00 67.58  0  213 GLU C CG  1 
ATOM   9517  C  CD  . GLU C 2 230 ? 211.503 211.769 226.941 1.00 67.58  0  213 GLU C CD  1 
ATOM   9518  O  OE1 . GLU C 2 230 ? 211.298 212.487 227.942 1.00 67.58  0  213 GLU C OE1 1 
ATOM   9519  O  OE2 . GLU C 2 230 ? 212.520 211.061 226.813 1.00 67.58  -1 213 GLU C OE2 1 
ATOM   9520  N  N   . THR C 2 231 ? 212.145 215.390 223.679 1.00 63.91  0  214 THR C N   1 
ATOM   9521  C  CA  . THR C 2 231 ? 212.761 215.557 222.374 1.00 63.91  0  214 THR C CA  1 
ATOM   9522  C  C   . THR C 2 231 ? 214.029 214.716 222.270 1.00 63.91  0  214 THR C C   1 
ATOM   9523  O  O   . THR C 2 231 ? 214.766 214.536 223.246 1.00 63.91  0  214 THR C O   1 
ATOM   9524  C  CB  . THR C 2 231 ? 213.046 217.036 222.091 1.00 63.91  0  214 THR C CB  1 
ATOM   9525  O  OG1 . THR C 2 231 ? 213.664 217.172 220.805 1.00 63.91  0  214 THR C OG1 1 
ATOM   9526  C  CG2 . THR C 2 231 ? 213.914 217.666 223.162 1.00 63.91  0  214 THR C CG2 1 
ATOM   9527  N  N   . THR C 2 232 ? 214.248 214.159 221.084 1.00 56.77  0  215 THR C N   1 
ATOM   9528  C  CA  . THR C 2 232 ? 215.405 213.321 220.788 1.00 56.77  0  215 THR C CA  1 
ATOM   9529  C  C   . THR C 2 232 ? 216.237 213.994 219.709 1.00 56.77  0  215 THR C C   1 
ATOM   9530  O  O   . THR C 2 232 ? 215.740 214.246 218.606 1.00 56.77  0  215 THR C O   1 
ATOM   9531  C  CB  . THR C 2 232 ? 214.985 211.919 220.342 1.00 56.77  0  215 THR C CB  1 
ATOM   9532  O  OG1 . THR C 2 232 ? 214.582 211.950 218.967 1.00 56.77  0  215 THR C OG1 1 
ATOM   9533  C  CG2 . THR C 2 232 ? 213.840 211.401 221.198 1.00 56.77  0  215 THR C CG2 1 
ATOM   9534  N  N   . VAL C 2 233 ? 217.494 214.276 220.021 1.00 61.41  0  216 VAL C N   1 
ATOM   9535  C  CA  . VAL C 2 233 ? 218.394 214.934 219.084 1.00 61.41  0  216 VAL C CA  1 
ATOM   9536  C  C   . VAL C 2 233 ? 219.096 213.872 218.253 1.00 61.41  0  216 VAL C C   1 
ATOM   9537  O  O   . VAL C 2 233 ? 219.618 212.888 218.792 1.00 61.41  0  216 VAL C O   1 
ATOM   9538  C  CB  . VAL C 2 233 ? 219.418 215.808 219.823 1.00 61.41  0  216 VAL C CB  1 
ATOM   9539  C  CG1 . VAL C 2 233 ? 220.116 216.754 218.856 1.00 61.41  0  216 VAL C CG1 1 
ATOM   9540  C  CG2 . VAL C 2 233 ? 218.760 216.563 220.946 1.00 61.41  0  216 VAL C CG2 1 
ATOM   9541  N  N   . MET C 2 234 ? 219.110 214.068 216.940 1.00 63.79  0  217 MET C N   1 
ATOM   9542  C  CA  . MET C 2 234 ? 219.873 213.218 216.043 1.00 63.79  0  217 MET C CA  1 
ATOM   9543  C  C   . MET C 2 234 ? 220.421 214.077 214.916 1.00 63.79  0  217 MET C C   1 
ATOM   9544  O  O   . MET C 2 234 ? 220.150 215.278 214.833 1.00 63.79  0  217 MET C O   1 
ATOM   9545  C  CB  . MET C 2 234 ? 219.017 212.069 215.500 1.00 63.79  0  217 MET C CB  1 
ATOM   9546  C  CG  . MET C 2 234 ? 217.733 212.521 214.820 1.00 63.79  0  217 MET C CG  1 
ATOM   9547  S  SD  . MET C 2 234 ? 216.835 211.166 214.046 1.00 63.79  0  217 MET C SD  1 
ATOM   9548  C  CE  . MET C 2 234 ? 217.704 211.042 212.494 1.00 63.79  0  217 MET C CE  1 
ATOM   9549  N  N   . THR C 2 235 ? 221.202 213.453 214.043 1.00 62.46  0  218 THR C N   1 
ATOM   9550  C  CA  . THR C 2 235 ? 221.755 214.165 212.907 1.00 62.46  0  218 THR C CA  1 
ATOM   9551  C  C   . THR C 2 235 ? 220.732 214.196 211.777 1.00 62.46  0  218 THR C C   1 
ATOM   9552  O  O   . THR C 2 235 ? 219.610 213.698 211.897 1.00 62.46  0  218 THR C O   1 
ATOM   9553  C  CB  . THR C 2 235 ? 223.055 213.514 212.441 1.00 62.46  0  218 THR C CB  1 
ATOM   9554  O  OG1 . THR C 2 235 ? 222.803 212.155 212.063 1.00 62.46  0  218 THR C OG1 1 
ATOM   9555  C  CG2 . THR C 2 235 ? 224.094 213.541 213.547 1.00 62.46  0  218 THR C CG2 1 
ATOM   9556  N  N   . ASP C 2 236 ? 221.127 214.786 210.657 1.00 60.84  0  219 ASP C N   1 
ATOM   9557  C  CA  . ASP C 2 236 ? 220.356 214.707 209.427 1.00 60.84  0  219 ASP C CA  1 
ATOM   9558  C  C   . ASP C 2 236 ? 220.730 213.490 208.597 1.00 60.84  0  219 ASP C C   1 
ATOM   9559  O  O   . ASP C 2 236 ? 220.338 213.403 207.429 1.00 60.84  0  219 ASP C O   1 
ATOM   9560  C  CB  . ASP C 2 236 ? 220.555 215.983 208.613 1.00 60.84  0  219 ASP C CB  1 
ATOM   9561  C  CG  . ASP C 2 236 ? 222.016 216.333 208.444 1.00 60.84  0  219 ASP C CG  1 
ATOM   9562  O  OD1 . ASP C 2 236 ? 222.838 215.872 209.263 1.00 60.84  0  219 ASP C OD1 1 
ATOM   9563  O  OD2 . ASP C 2 236 ? 222.347 217.075 207.502 1.00 60.84  -1 219 ASP C OD2 1 
ATOM   9564  N  N   . ALA C 2 237 ? 221.484 212.555 209.175 1.00 56.69  0  220 ALA C N   1 
ATOM   9565  C  CA  . ALA C 2 237 ? 222.050 211.439 208.438 1.00 56.69  0  220 ALA C CA  1 
ATOM   9566  C  C   . ALA C 2 237 ? 221.279 210.142 208.608 1.00 56.69  0  220 ALA C C   1 
ATOM   9567  O  O   . ALA C 2 237 ? 221.465 209.227 207.804 1.00 56.69  0  220 ALA C O   1 
ATOM   9568  C  CB  . ALA C 2 237 ? 223.505 211.217 208.864 1.00 56.69  0  220 ALA C CB  1 
ATOM   9569  N  N   . ALA C 2 238 ? 220.427 210.034 209.624 1.00 54.99  0  221 ALA C N   1 
ATOM   9570  C  CA  . ALA C 2 238 ? 219.635 208.832 209.843 1.00 54.99  0  221 ALA C CA  1 
ATOM   9571  C  C   . ALA C 2 238 ? 218.152 209.071 209.579 1.00 54.99  0  221 ALA C C   1 
ATOM   9572  O  O   . ALA C 2 238 ? 217.302 208.374 210.143 1.00 54.99  0  221 ALA C O   1 
ATOM   9573  C  CB  . ALA C 2 238 ? 219.856 208.298 211.257 1.00 54.99  0  221 ALA C CB  1 
ATOM   9574  N  N   . ILE C 2 239 ? 217.846 210.050 208.716 1.00 53.17  0  222 ILE C N   1 
ATOM   9575  C  CA  . ILE C 2 239 ? 216.468 210.478 208.460 1.00 53.17  0  222 ILE C CA  1 
ATOM   9576  C  C   . ILE C 2 239 ? 215.649 209.337 207.868 1.00 53.17  0  222 ILE C C   1 
ATOM   9577  O  O   . ILE C 2 239 ? 214.620 208.933 208.422 1.00 53.17  0  222 ILE C O   1 
ATOM   9578  C  CB  . ILE C 2 239 ? 216.450 211.714 207.544 1.00 53.17  0  222 ILE C CB  1 
ATOM   9579  C  CG1 . ILE C 2 239 ? 217.086 212.912 208.253 1.00 53.17  0  222 ILE C CG1 1 
ATOM   9580  C  CG2 . ILE C 2 239 ? 215.030 212.024 207.090 1.00 53.17  0  222 ILE C CG2 1 
ATOM   9581  C  CD1 . ILE C 2 239 ? 217.034 214.200 207.458 1.00 53.17  0  222 ILE C CD1 1 
ATOM   9582  N  N   . PHE C 2 240 ? 216.125 208.763 206.760 1.00 53.79  0  223 PHE C N   1 
ATOM   9583  C  CA  . PHE C 2 240 ? 215.479 207.566 206.238 1.00 53.79  0  223 PHE C CA  1 
ATOM   9584  C  C   . PHE C 2 240 ? 215.701 206.358 207.141 1.00 53.79  0  223 PHE C C   1 
ATOM   9585  O  O   . PHE C 2 240 ? 214.949 205.382 207.045 1.00 53.79  0  223 PHE C O   1 
ATOM   9586  C  CB  . PHE C 2 240 ? 215.968 207.263 204.824 1.00 53.79  0  223 PHE C CB  1 
ATOM   9587  C  CG  . PHE C 2 240 ? 215.091 206.300 204.077 1.00 53.79  0  223 PHE C CG  1 
ATOM   9588  C  CD1 . PHE C 2 240 ? 213.818 206.674 203.680 1.00 53.79  0  223 PHE C CD1 1 
ATOM   9589  C  CD2 . PHE C 2 240 ? 215.530 205.020 203.788 1.00 53.79  0  223 PHE C CD2 1 
ATOM   9590  C  CE1 . PHE C 2 240 ? 213.003 205.790 202.997 1.00 53.79  0  223 PHE C CE1 1 
ATOM   9591  C  CE2 . PHE C 2 240 ? 214.721 204.130 203.104 1.00 53.79  0  223 PHE C CE2 1 
ATOM   9592  C  CZ  . PHE C 2 240 ? 213.456 204.517 202.709 1.00 53.79  0  223 PHE C CZ  1 
ATOM   9593  N  N   . ALA C 2 241 ? 216.701 206.404 208.025 1.00 54.92  0  224 ALA C N   1 
ATOM   9594  C  CA  . ALA C 2 241 ? 216.832 205.370 209.038 1.00 54.92  0  224 ALA C CA  1 
ATOM   9595  C  C   . ALA C 2 241 ? 215.841 205.545 210.180 1.00 54.92  0  224 ALA C C   1 
ATOM   9596  O  O   . ALA C 2 241 ? 215.672 204.614 210.973 1.00 54.92  0  224 ALA C O   1 
ATOM   9597  C  CB  . ALA C 2 241 ? 218.256 205.345 209.591 1.00 54.92  0  224 ALA C CB  1 
ATOM   9598  N  N   . VAL C 2 242 ? 215.189 206.702 210.285 1.00 51.91  0  225 VAL C N   1 
ATOM   9599  C  CA  . VAL C 2 242 ? 214.172 206.923 211.307 1.00 51.91  0  225 VAL C CA  1 
ATOM   9600  C  C   . VAL C 2 242 ? 212.795 207.165 210.702 1.00 51.91  0  225 VAL C C   1 
ATOM   9601  O  O   . VAL C 2 242 ? 211.800 207.181 211.442 1.00 51.91  0  225 VAL C O   1 
ATOM   9602  C  CB  . VAL C 2 242 ? 214.568 208.089 212.248 1.00 51.91  0  225 VAL C CB  1 
ATOM   9603  C  CG1 . VAL C 2 242 ? 214.253 209.441 211.636 1.00 51.91  0  225 VAL C CG1 1 
ATOM   9604  C  CG2 . VAL C 2 242 ? 213.984 207.937 213.650 1.00 51.91  0  225 VAL C CG2 1 
ATOM   9605  N  N   . MET C 2 243 ? 212.694 207.282 209.375 1.00 52.55  0  226 MET C N   1 
ATOM   9606  C  CA  . MET C 2 243 ? 211.426 207.587 208.719 1.00 52.55  0  226 MET C CA  1 
ATOM   9607  C  C   . MET C 2 243 ? 210.427 206.436 208.791 1.00 52.55  0  226 MET C C   1 
ATOM   9608  O  O   . MET C 2 243 ? 209.228 206.657 208.595 1.00 52.55  0  226 MET C O   1 
ATOM   9609  C  CB  . MET C 2 243 ? 211.682 207.959 207.259 1.00 52.55  0  226 MET C CB  1 
ATOM   9610  C  CG  . MET C 2 243 ? 210.638 208.870 206.671 1.00 52.55  0  226 MET C CG  1 
ATOM   9611  S  SD  . MET C 2 243 ? 210.589 210.435 207.546 1.00 52.55  0  226 MET C SD  1 
ATOM   9612  C  CE  . MET C 2 243 ? 208.834 210.734 207.514 1.00 52.55  0  226 MET C CE  1 
ATOM   9613  N  N   . SER C 2 244 ? 210.888 205.218 209.085 1.00 50.98  0  227 SER C N   1 
ATOM   9614  C  CA  . SER C 2 244 ? 209.989 204.083 209.250 1.00 50.98  0  227 SER C CA  1 
ATOM   9615  C  C   . SER C 2 244 ? 209.158 204.158 210.524 1.00 50.98  0  227 SER C C   1 
ATOM   9616  O  O   . SER C 2 244 ? 208.179 203.415 210.645 1.00 50.98  0  227 SER C O   1 
ATOM   9617  C  CB  . SER C 2 244 ? 210.791 202.781 209.231 1.00 50.98  0  227 SER C CB  1 
ATOM   9618  O  OG  . SER C 2 244 ? 211.978 202.901 209.995 1.00 50.98  0  227 SER C OG  1 
ATOM   9619  N  N   . ARG C 2 245 ? 209.517 205.029 211.467 1.00 49.49  0  228 ARG C N   1 
ATOM   9620  C  CA  . ARG C 2 245 ? 208.755 205.209 212.691 1.00 49.49  0  228 ARG C CA  1 
ATOM   9621  C  C   . ARG C 2 245 ? 208.125 206.587 212.830 1.00 49.49  0  228 ARG C C   1 
ATOM   9622  O  O   . ARG C 2 245 ? 207.299 206.773 213.730 1.00 49.49  0  228 ARG C O   1 
ATOM   9623  C  CB  . ARG C 2 245 ? 209.641 204.942 213.917 1.00 49.49  0  228 ARG C CB  1 
ATOM   9624  C  CG  . ARG C 2 245 ? 210.486 203.688 213.803 1.00 49.49  0  228 ARG C CG  1 
ATOM   9625  C  CD  . ARG C 2 245 ? 209.714 202.445 214.199 1.00 49.49  0  228 ARG C CD  1 
ATOM   9626  N  NE  . ARG C 2 245 ? 210.415 201.225 213.812 1.00 49.49  0  228 ARG C NE  1 
ATOM   9627  C  CZ  . ARG C 2 245 ? 210.225 200.584 212.664 1.00 49.49  0  228 ARG C CZ  1 
ATOM   9628  N  NH1 . ARG C 2 245 ? 209.350 201.046 211.783 1.00 49.49  1  228 ARG C NH1 1 
ATOM   9629  N  NH2 . ARG C 2 245 ? 210.910 199.481 212.396 1.00 49.49  0  228 ARG C NH2 1 
ATOM   9630  N  N   . VAL C 2 246 ? 208.486 207.550 211.986 1.00 49.33  0  229 VAL C N   1 
ATOM   9631  C  CA  . VAL C 2 246 ? 207.945 208.901 212.097 1.00 49.33  0  229 VAL C CA  1 
ATOM   9632  C  C   . VAL C 2 246 ? 206.515 208.921 211.574 1.00 49.33  0  229 VAL C C   1 
ATOM   9633  O  O   . VAL C 2 246 ? 206.245 208.509 210.439 1.00 49.33  0  229 VAL C O   1 
ATOM   9634  C  CB  . VAL C 2 246 ? 208.832 209.909 211.349 1.00 49.33  0  229 VAL C CB  1 
ATOM   9635  C  CG1 . VAL C 2 246 ? 208.170 211.269 211.312 1.00 49.33  0  229 VAL C CG1 1 
ATOM   9636  C  CG2 . VAL C 2 246 ? 210.185 210.016 212.024 1.00 49.33  0  229 VAL C CG2 1 
ATOM   9637  N  N   . ASN C 2 247 ? 205.593 209.401 212.411 1.00 50.37  0  230 ASN C N   1 
ATOM   9638  C  CA  . ASN C 2 247 ? 204.174 209.431 212.075 1.00 50.37  0  230 ASN C CA  1 
ATOM   9639  C  C   . ASN C 2 247 ? 203.837 210.613 211.175 1.00 50.37  0  230 ASN C C   1 
ATOM   9640  O  O   . ASN C 2 247 ? 203.235 210.440 210.109 1.00 50.37  0  230 ASN C O   1 
ATOM   9641  C  CB  . ASN C 2 247 ? 203.342 209.476 213.357 1.00 50.37  0  230 ASN C CB  1 
ATOM   9642  C  CG  . ASN C 2 247 ? 203.632 208.310 214.282 1.00 50.37  0  230 ASN C CG  1 
ATOM   9643  O  OD1 . ASN C 2 247 ? 203.573 208.445 215.503 1.00 50.37  0  230 ASN C OD1 1 
ATOM   9644  N  ND2 . ASN C 2 247 ? 203.938 207.155 213.703 1.00 50.37  0  230 ASN C ND2 1 
ATOM   9645  N  N   . LYS C 2 248 ? 204.206 211.822 211.592 1.00 47.54  0  231 LYS C N   1 
ATOM   9646  C  CA  . LYS C 2 248 ? 204.042 213.006 210.763 1.00 47.54  0  231 LYS C CA  1 
ATOM   9647  C  C   . LYS C 2 248 ? 205.187 213.963 211.047 1.00 47.54  0  231 LYS C C   1 
ATOM   9648  O  O   . LYS C 2 248 ? 205.828 213.900 212.099 1.00 47.54  0  231 LYS C O   1 
ATOM   9649  C  CB  . LYS C 2 248 ? 202.691 213.689 211.004 1.00 47.54  0  231 LYS C CB  1 
ATOM   9650  C  CG  . LYS C 2 248 ? 202.525 214.292 212.385 1.00 47.54  0  231 LYS C CG  1 
ATOM   9651  C  CD  . LYS C 2 248 ? 201.358 215.266 212.430 1.00 47.54  0  231 LYS C CD  1 
ATOM   9652  C  CE  . LYS C 2 248 ? 200.063 214.607 211.981 1.00 47.54  0  231 LYS C CE  1 
ATOM   9653  N  NZ  . LYS C 2 248 ? 198.882 215.478 212.225 1.00 47.54  1  231 LYS C NZ  1 
ATOM   9654  N  N   . VAL C 2 249 ? 205.443 214.852 210.091 1.00 46.05  0  232 VAL C N   1 
ATOM   9655  C  CA  . VAL C 2 249 ? 206.604 215.734 210.125 1.00 46.05  0  232 VAL C CA  1 
ATOM   9656  C  C   . VAL C 2 249 ? 206.123 217.177 210.139 1.00 46.05  0  232 VAL C C   1 
ATOM   9657  O  O   . VAL C 2 249 ? 205.529 217.648 209.161 1.00 46.05  0  232 VAL C O   1 
ATOM   9658  C  CB  . VAL C 2 249 ? 207.538 215.498 208.930 1.00 46.05  0  232 VAL C CB  1 
ATOM   9659  C  CG1 . VAL C 2 249 ? 208.742 216.389 209.040 1.00 46.05  0  232 VAL C CG1 1 
ATOM   9660  C  CG2 . VAL C 2 249 ? 207.960 214.057 208.857 1.00 46.05  0  232 VAL C CG2 1 
ATOM   9661  N  N   . ILE C 2 250 ? 206.419 217.881 211.225 1.00 48.58  0  233 ILE C N   1 
ATOM   9662  C  CA  . ILE C 2 250 ? 206.083 219.290 211.394 1.00 48.58  0  233 ILE C CA  1 
ATOM   9663  C  C   . ILE C 2 250 ? 207.345 220.093 211.112 1.00 48.58  0  233 ILE C C   1 
ATOM   9664  O  O   . ILE C 2 250 ? 208.312 220.023 211.876 1.00 48.58  0  233 ILE C O   1 
ATOM   9665  C  CB  . ILE C 2 250 ? 205.562 219.574 212.809 1.00 48.58  0  233 ILE C CB  1 
ATOM   9666  C  CG1 . ILE C 2 250 ? 204.506 218.547 213.228 1.00 48.58  0  233 ILE C CG1 1 
ATOM   9667  C  CG2 . ILE C 2 250 ? 205.033 220.987 212.912 1.00 48.58  0  233 ILE C CG2 1 
ATOM   9668  C  CD1 . ILE C 2 250 ? 203.172 218.695 212.563 1.00 48.58  0  233 ILE C CD1 1 
ATOM   9669  N  N   . ILE C 2 251 ? 207.360 220.864 210.022 1.00 51.10  0  234 ILE C N   1 
ATOM   9670  C  CA  . ILE C 2 251 ? 208.497 221.715 209.696 1.00 51.10  0  234 ILE C CA  1 
ATOM   9671  C  C   . ILE C 2 251 ? 208.001 223.122 209.389 1.00 51.10  0  234 ILE C C   1 
ATOM   9672  O  O   . ILE C 2 251 ? 206.803 223.376 209.266 1.00 51.10  0  234 ILE C O   1 
ATOM   9673  C  CB  . ILE C 2 251 ? 209.328 221.185 208.507 1.00 51.10  0  234 ILE C CB  1 
ATOM   9674  C  CG1 . ILE C 2 251 ? 208.450 221.030 207.264 1.00 51.10  0  234 ILE C CG1 1 
ATOM   9675  C  CG2 . ILE C 2 251 ? 210.044 219.891 208.864 1.00 51.10  0  234 ILE C CG2 1 
ATOM   9676  C  CD1 . ILE C 2 251 ? 209.235 220.874 205.983 1.00 51.10  0  234 ILE C CD1 1 
ATOM   9677  N  N   . GLY C 2 252 ? 208.961 224.041 209.279 1.00 57.96  0  235 GLY C N   1 
ATOM   9678  C  CA  . GLY C 2 252 ? 208.730 225.358 208.735 1.00 57.96  0  235 GLY C CA  1 
ATOM   9679  C  C   . GLY C 2 252 ? 209.511 225.550 207.445 1.00 57.96  0  235 GLY C C   1 
ATOM   9680  O  O   . GLY C 2 252 ? 210.159 224.631 206.937 1.00 57.96  0  235 GLY C O   1 
ATOM   9681  N  N   . THR C 2 253 ? 209.440 226.772 206.927 1.00 60.18  0  236 THR C N   1 
ATOM   9682  C  CA  . THR C 2 253 ? 210.118 227.096 205.681 1.00 60.18  0  236 THR C CA  1 
ATOM   9683  C  C   . THR C 2 253 ? 210.588 228.541 205.719 1.00 60.18  0  236 THR C C   1 
ATOM   9684  O  O   . THR C 2 253 ? 210.242 229.311 206.618 1.00 60.18  0  236 THR C O   1 
ATOM   9685  C  CB  . THR C 2 253 ? 209.212 226.859 204.467 1.00 60.18  0  236 THR C CB  1 
ATOM   9686  O  OG1 . THR C 2 253 ? 209.989 226.950 203.268 1.00 60.18  0  236 THR C OG1 1 
ATOM   9687  C  CG2 . THR C 2 253 ? 208.107 227.894 204.418 1.00 60.18  0  236 THR C CG2 1 
ATOM   9688  N  N   . LYS C 2 254 ? 211.394 228.898 204.722 1.00 62.62  0  237 LYS C N   1 
ATOM   9689  C  CA  . LYS C 2 254 ? 211.880 230.258 204.537 1.00 62.62  0  237 LYS C CA  1 
ATOM   9690  C  C   . LYS C 2 254 ? 211.038 231.049 203.547 1.00 62.62  0  237 LYS C C   1 
ATOM   9691  O  O   . LYS C 2 254 ? 210.758 232.229 203.780 1.00 62.62  0  237 LYS C O   1 
ATOM   9692  C  CB  . LYS C 2 254 ? 213.338 230.228 204.063 1.00 62.62  0  237 LYS C CB  1 
ATOM   9693  C  CG  . LYS C 2 254 ? 213.978 231.593 203.859 1.00 62.62  0  237 LYS C CG  1 
ATOM   9694  C  CD  . LYS C 2 254 ? 214.171 232.320 205.177 1.00 62.62  0  237 LYS C CD  1 
ATOM   9695  C  CE  . LYS C 2 254 ? 214.899 233.638 204.973 1.00 62.62  0  237 LYS C CE  1 
ATOM   9696  N  NZ  . LYS C 2 254 ? 215.137 234.346 206.260 1.00 62.62  1  237 LYS C NZ  1 
ATOM   9697  N  N   . THR C 2 255 ? 210.609 230.418 202.457 1.00 62.71  0  238 THR C N   1 
ATOM   9698  C  CA  . THR C 2 255 ? 209.875 231.109 201.403 1.00 62.71  0  238 THR C CA  1 
ATOM   9699  C  C   . THR C 2 255 ? 208.991 230.103 200.683 1.00 62.71  0  238 THR C C   1 
ATOM   9700  O  O   . THR C 2 255 ? 209.488 229.085 200.196 1.00 62.71  0  238 THR C O   1 
ATOM   9701  C  CB  . THR C 2 255 ? 210.839 231.785 200.423 1.00 62.71  0  238 THR C CB  1 
ATOM   9702  O  OG1 . THR C 2 255 ? 211.400 232.955 201.031 1.00 62.71  0  238 THR C OG1 1 
ATOM   9703  C  CG2 . THR C 2 255 ? 210.128 232.177 199.138 1.00 62.71  0  238 THR C CG2 1 
ATOM   9704  N  N   . ILE C 2 256 ? 207.691 230.379 200.627 1.00 61.81  0  239 ILE C N   1 
ATOM   9705  C  CA  . ILE C 2 256 ? 206.760 229.587 199.832 1.00 61.81  0  239 ILE C CA  1 
ATOM   9706  C  C   . ILE C 2 256 ? 206.658 230.208 198.447 1.00 61.81  0  239 ILE C C   1 
ATOM   9707  O  O   . ILE C 2 256 ? 206.431 231.417 198.313 1.00 61.81  0  239 ILE C O   1 
ATOM   9708  C  CB  . ILE C 2 256 ? 205.379 229.513 200.502 1.00 61.81  0  239 ILE C CB  1 
ATOM   9709  C  CG1 . ILE C 2 256 ? 205.507 229.103 201.967 1.00 61.81  0  239 ILE C CG1 1 
ATOM   9710  C  CG2 . ILE C 2 256 ? 204.481 228.536 199.760 1.00 61.81  0  239 ILE C CG2 1 
ATOM   9711  C  CD1 . ILE C 2 256 ? 204.183 229.061 202.688 1.00 61.81  0  239 ILE C CD1 1 
ATOM   9712  N  N   . LEU C 2 257 ? 206.822 229.386 197.416 1.00 63.01  0  240 LEU C N   1 
ATOM   9713  C  CA  . LEU C 2 257 ? 206.813 229.867 196.046 1.00 63.01  0  240 LEU C CA  1 
ATOM   9714  C  C   . LEU C 2 257 ? 205.381 229.914 195.513 1.00 63.01  0  240 LEU C C   1 
ATOM   9715  O  O   . LEU C 2 257 ? 204.413 229.632 196.223 1.00 63.01  0  240 LEU C O   1 
ATOM   9716  C  CB  . LEU C 2 257 ? 207.717 228.994 195.178 1.00 63.01  0  240 LEU C CB  1 
ATOM   9717  C  CG  . LEU C 2 257 ? 209.110 228.769 195.771 1.00 63.01  0  240 LEU C CG  1 
ATOM   9718  C  CD1 . LEU C 2 257 ? 209.922 227.819 194.916 1.00 63.01  0  240 LEU C CD1 1 
ATOM   9719  C  CD2 . LEU C 2 257 ? 209.842 230.092 195.936 1.00 63.01  0  240 LEU C CD2 1 
ATOM   9720  N  N   . ALA C 2 258 ? 205.244 230.281 194.237 1.00 65.16  0  241 ALA C N   1 
ATOM   9721  C  CA  . ALA C 2 258 ? 203.924 230.513 193.662 1.00 65.16  0  241 ALA C CA  1 
ATOM   9722  C  C   . ALA C 2 258 ? 203.194 229.222 193.318 1.00 65.16  0  241 ALA C C   1 
ATOM   9723  O  O   . ALA C 2 258 ? 201.960 229.180 193.384 1.00 65.16  0  241 ALA C O   1 
ATOM   9724  C  CB  . ALA C 2 258 ? 204.042 231.390 192.415 1.00 65.16  0  241 ALA C CB  1 
ATOM   9725  N  N   . ASN C 2 259 ? 203.921 228.169 192.951 1.00 59.92  0  242 ASN C N   1 
ATOM   9726  C  CA  . ASN C 2 259 ? 203.316 226.912 192.536 1.00 59.92  0  242 ASN C CA  1 
ATOM   9727  C  C   . ASN C 2 259 ? 203.109 225.942 193.694 1.00 59.92  0  242 ASN C C   1 
ATOM   9728  O  O   . ASN C 2 259 ? 202.869 224.753 193.457 1.00 59.92  0  242 ASN C O   1 
ATOM   9729  C  CB  . ASN C 2 259 ? 204.166 226.256 191.446 1.00 59.92  0  242 ASN C CB  1 
ATOM   9730  C  CG  . ASN C 2 259 ? 205.495 225.746 191.968 1.00 59.92  0  242 ASN C CG  1 
ATOM   9731  O  OD1 . ASN C 2 259 ? 205.642 224.563 192.271 1.00 59.92  0  242 ASN C OD1 1 
ATOM   9732  N  ND2 . ASN C 2 259 ? 206.473 226.638 192.072 1.00 59.92  0  242 ASN C ND2 1 
ATOM   9733  N  N   . GLY C 2 260 ? 203.183 226.420 194.935 1.00 59.68  0  243 GLY C N   1 
ATOM   9734  C  CA  . GLY C 2 260 ? 203.101 225.559 196.093 1.00 59.68  0  243 GLY C CA  1 
ATOM   9735  C  C   . GLY C 2 260 ? 204.428 225.005 196.561 1.00 59.68  0  243 GLY C C   1 
ATOM   9736  O  O   . GLY C 2 260 ? 204.491 224.428 197.654 1.00 59.68  0  243 GLY C O   1 
ATOM   9737  N  N   . ALA C 2 261 ? 205.484 225.161 195.768 1.00 59.32  0  244 ALA C N   1 
ATOM   9738  C  CA  . ALA C 2 261 ? 206.817 224.729 196.150 1.00 59.32  0  244 ALA C CA  1 
ATOM   9739  C  C   . ALA C 2 261 ? 207.382 225.655 197.225 1.00 59.32  0  244 ALA C C   1 
ATOM   9740  O  O   . ALA C 2 261 ? 206.845 226.732 197.500 1.00 59.32  0  244 ALA C O   1 
ATOM   9741  C  CB  . ALA C 2 261 ? 207.733 224.712 194.930 1.00 59.32  0  244 ALA C CB  1 
ATOM   9742  N  N   . LEU C 2 262 ? 208.487 225.235 197.838 1.00 59.28  0  245 LEU C N   1 
ATOM   9743  C  CA  . LEU C 2 262 ? 209.062 226.070 198.883 1.00 59.28  0  245 LEU C CA  1 
ATOM   9744  C  C   . LEU C 2 262 ? 210.574 225.927 198.937 1.00 59.28  0  245 LEU C C   1 
ATOM   9745  O  O   . LEU C 2 262 ? 211.110 224.832 198.759 1.00 59.28  0  245 LEU C O   1 
ATOM   9746  C  CB  . LEU C 2 262 ? 208.454 225.742 200.258 1.00 59.28  0  245 LEU C CB  1 
ATOM   9747  C  CG  . LEU C 2 262 ? 208.453 224.321 200.840 1.00 59.28  0  245 LEU C CG  1 
ATOM   9748  C  CD1 . LEU C 2 262 ? 209.675 224.011 201.700 1.00 59.28  0  245 LEU C CD1 1 
ATOM   9749  C  CD2 . LEU C 2 262 ? 207.191 224.118 201.650 1.00 59.28  0  245 LEU C CD2 1 
ATOM   9750  N  N   . ARG C 2 263 ? 211.253 227.036 199.203 1.00 63.43  0  246 ARG C N   1 
ATOM   9751  C  CA  . ARG C 2 263 ? 212.628 226.959 199.661 1.00 63.43  0  246 ARG C CA  1 
ATOM   9752  C  C   . ARG C 2 263 ? 212.628 226.964 201.184 1.00 63.43  0  246 ARG C C   1 
ATOM   9753  O  O   . ARG C 2 263 ? 211.760 227.564 201.827 1.00 63.43  0  246 ARG C O   1 
ATOM   9754  C  CB  . ARG C 2 263 ? 213.481 228.102 199.092 1.00 63.43  0  246 ARG C CB  1 
ATOM   9755  C  CG  . ARG C 2 263 ? 213.668 229.335 199.966 1.00 63.43  0  246 ARG C CG  1 
ATOM   9756  C  CD  . ARG C 2 263 ? 214.441 230.419 199.232 1.00 63.43  0  246 ARG C CD  1 
ATOM   9757  N  NE  . ARG C 2 263 ? 213.731 230.894 198.050 1.00 63.43  0  246 ARG C NE  1 
ATOM   9758  C  CZ  . ARG C 2 263 ? 214.216 231.792 197.199 1.00 63.43  0  246 ARG C CZ  1 
ATOM   9759  N  NH1 . ARG C 2 263 ? 215.418 232.316 197.398 1.00 63.43  1  246 ARG C NH1 1 
ATOM   9760  N  NH2 . ARG C 2 263 ? 213.500 232.167 196.147 1.00 63.43  0  246 ARG C NH2 1 
ATOM   9761  N  N   . ALA C 2 264 ? 213.569 226.224 201.756 1.00 57.38  0  247 ALA C N   1 
ATOM   9762  C  CA  . ALA C 2 264 ? 213.675 226.125 203.207 1.00 57.38  0  247 ALA C CA  1 
ATOM   9763  C  C   . ALA C 2 264 ? 215.125 225.838 203.559 1.00 57.38  0  247 ALA C C   1 
ATOM   9764  O  O   . ALA C 2 264 ? 216.010 225.917 202.703 1.00 57.38  0  247 ALA C O   1 
ATOM   9765  C  CB  . ALA C 2 264 ? 212.723 225.056 203.756 1.00 57.38  0  247 ALA C CB  1 
ATOM   9766  N  N   . VAL C 2 265 ? 215.368 225.508 204.831 1.00 55.81  0  248 VAL C N   1 
ATOM   9767  C  CA  . VAL C 2 265 ? 216.711 225.146 205.266 1.00 55.81  0  248 VAL C CA  1 
ATOM   9768  C  C   . VAL C 2 265 ? 217.110 223.827 204.612 1.00 55.81  0  248 VAL C C   1 
ATOM   9769  O  O   . VAL C 2 265 ? 216.260 223.005 204.244 1.00 55.81  0  248 VAL C O   1 
ATOM   9770  C  CB  . VAL C 2 265 ? 216.799 225.077 206.803 1.00 55.81  0  248 VAL C CB  1 
ATOM   9771  C  CG1 . VAL C 2 265 ? 216.258 226.359 207.414 1.00 55.81  0  248 VAL C CG1 1 
ATOM   9772  C  CG2 . VAL C 2 265 ? 216.041 223.877 207.354 1.00 55.81  0  248 VAL C CG2 1 
ATOM   9773  N  N   . THR C 2 266 ? 218.409 223.649 204.404 1.00 56.91  0  249 THR C N   1 
ATOM   9774  C  CA  . THR C 2 266 ? 218.866 222.579 203.532 1.00 56.91  0  249 THR C CA  1 
ATOM   9775  C  C   . THR C 2 266 ? 218.765 221.228 204.235 1.00 56.91  0  249 THR C C   1 
ATOM   9776  O  O   . THR C 2 266 ? 218.900 221.119 205.458 1.00 56.91  0  249 THR C O   1 
ATOM   9777  C  CB  . THR C 2 266 ? 220.293 222.861 203.047 1.00 56.91  0  249 THR C CB  1 
ATOM   9778  O  OG1 . THR C 2 266 ? 220.690 221.869 202.091 1.00 56.91  0  249 THR C OG1 1 
ATOM   9779  C  CG2 . THR C 2 266 ? 221.290 222.922 204.204 1.00 56.91  0  249 THR C CG2 1 
ATOM   9780  N  N   . GLY C 2 267 ? 218.467 220.199 203.447 1.00 53.91  0  250 GLY C N   1 
ATOM   9781  C  CA  . GLY C 2 267 ? 218.199 218.878 203.971 1.00 53.91  0  250 GLY C CA  1 
ATOM   9782  C  C   . GLY C 2 267 ? 216.737 218.531 204.122 1.00 53.91  0  250 GLY C C   1 
ATOM   9783  O  O   . GLY C 2 267 ? 216.427 217.389 204.482 1.00 53.91  0  250 GLY C O   1 
ATOM   9784  N  N   . THR C 2 268 ? 215.830 219.469 203.862 1.00 50.11  0  251 THR C N   1 
ATOM   9785  C  CA  . THR C 2 268 ? 214.408 219.185 203.979 1.00 50.11  0  251 THR C CA  1 
ATOM   9786  C  C   . THR C 2 268 ? 213.787 218.709 202.673 1.00 50.11  0  251 THR C C   1 
ATOM   9787  O  O   . THR C 2 268 ? 212.665 218.198 202.696 1.00 50.11  0  251 THR C O   1 
ATOM   9788  C  CB  . THR C 2 268 ? 213.650 220.415 204.495 1.00 50.11  0  251 THR C CB  1 
ATOM   9789  O  OG1 . THR C 2 268 ? 212.350 220.018 204.948 1.00 50.11  0  251 THR C OG1 1 
ATOM   9790  C  CG2 . THR C 2 268 ? 213.491 221.448 203.408 1.00 50.11  0  251 THR C CG2 1 
ATOM   9791  N  N   . HIS C 2 269 ? 214.482 218.855 201.541 1.00 53.70  0  252 HIS C N   1 
ATOM   9792  C  CA  . HIS C 2 269 ? 214.022 218.206 200.319 1.00 53.70  0  252 HIS C CA  1 
ATOM   9793  C  C   . HIS C 2 269 ? 214.208 216.701 200.413 1.00 53.70  0  252 HIS C C   1 
ATOM   9794  O  O   . HIS C 2 269 ? 213.334 215.930 200.000 1.00 53.70  0  252 HIS C O   1 
ATOM   9795  C  CB  . HIS C 2 269 ? 214.773 218.760 199.112 1.00 53.70  0  252 HIS C CB  1 
ATOM   9796  C  CG  . HIS C 2 269 ? 214.499 218.019 197.840 1.00 53.70  0  252 HIS C CG  1 
ATOM   9797  N  ND1 . HIS C 2 269 ? 213.342 218.194 197.113 1.00 53.70  0  252 HIS C ND1 1 
ATOM   9798  C  CD2 . HIS C 2 269 ? 215.232 217.101 197.167 1.00 53.70  0  252 HIS C CD2 1 
ATOM   9799  C  CE1 . HIS C 2 269 ? 213.374 217.416 196.045 1.00 53.70  0  252 HIS C CE1 1 
ATOM   9800  N  NE2 . HIS C 2 269 ? 214.510 216.743 196.054 1.00 53.70  0  252 HIS C NE2 1 
ATOM   9801  N  N   . THR C 2 270 ? 215.343 216.276 200.970 1.00 51.38  0  253 THR C N   1 
ATOM   9802  C  CA  . THR C 2 270 ? 215.581 214.869 201.269 1.00 51.38  0  253 THR C CA  1 
ATOM   9803  C  C   . THR C 2 270 ? 214.571 214.340 202.285 1.00 51.38  0  253 THR C C   1 
ATOM   9804  O  O   . THR C 2 270 ? 214.026 213.238 202.124 1.00 51.38  0  253 THR C O   1 
ATOM   9805  C  CB  . THR C 2 270 ? 217.015 214.721 201.783 1.00 51.38  0  253 THR C CB  1 
ATOM   9806  O  OG1 . THR C 2 270 ? 217.933 214.865 200.692 1.00 51.38  0  253 THR C OG1 1 
ATOM   9807  C  CG2 . THR C 2 270 ? 217.226 213.394 202.431 1.00 51.38  0  253 THR C CG2 1 
ATOM   9808  N  N   . LEU C 2 271 ? 214.291 215.136 203.320 1.00 46.95  0  254 LEU C N   1 
ATOM   9809  C  CA  . LEU C 2 271 ? 213.311 214.762 204.335 1.00 46.95  0  254 LEU C CA  1 
ATOM   9810  C  C   . LEU C 2 271 ? 211.905 214.662 203.752 1.00 46.95  0  254 LEU C C   1 
ATOM   9811  O  O   . LEU C 2 271 ? 211.136 213.765 204.116 1.00 46.95  0  254 LEU C O   1 
ATOM   9812  C  CB  . LEU C 2 271 ? 213.371 215.772 205.482 1.00 46.95  0  254 LEU C CB  1 
ATOM   9813  C  CG  . LEU C 2 271 ? 212.401 215.707 206.656 1.00 46.95  0  254 LEU C CG  1 
ATOM   9814  C  CD1 . LEU C 2 271 ? 213.146 215.933 207.953 1.00 46.95  0  254 LEU C CD1 1 
ATOM   9815  C  CD2 . LEU C 2 271 ? 211.360 216.791 206.477 1.00 46.95  0  254 LEU C CD2 1 
ATOM   9816  N  N   . ALA C 2 272 ? 211.561 215.551 202.817 1.00 48.57  0  255 ALA C N   1 
ATOM   9817  C  CA  . ALA C 2 272 ? 210.258 215.468 202.170 1.00 48.57  0  255 ALA C CA  1 
ATOM   9818  C  C   . ALA C 2 272 ? 210.185 214.302 201.195 1.00 48.57  0  255 ALA C C   1 
ATOM   9819  O  O   . ALA C 2 272 ? 209.111 213.720 201.013 1.00 48.57  0  255 ALA C O   1 
ATOM   9820  C  CB  . ALA C 2 272 ? 209.942 216.778 201.455 1.00 48.57  0  255 ALA C CB  1 
ATOM   9821  N  N   . LEU C 2 273 ? 211.310 213.942 200.569 1.00 49.56  0  256 LEU C N   1 
ATOM   9822  C  CA  . LEU C 2 273 ? 211.351 212.741 199.740 1.00 49.56  0  256 LEU C CA  1 
ATOM   9823  C  C   . LEU C 2 273 ? 211.143 211.486 200.577 1.00 49.56  0  256 LEU C C   1 
ATOM   9824  O  O   . LEU C 2 273 ? 210.428 210.567 200.162 1.00 49.56  0  256 LEU C O   1 
ATOM   9825  C  CB  . LEU C 2 273 ? 212.678 212.662 198.987 1.00 49.56  0  256 LEU C CB  1 
ATOM   9826  C  CG  . LEU C 2 273 ? 212.815 213.532 197.740 1.00 49.56  0  256 LEU C CG  1 
ATOM   9827  C  CD1 . LEU C 2 273 ? 214.252 213.525 197.250 1.00 49.56  0  256 LEU C CD1 1 
ATOM   9828  C  CD2 . LEU C 2 273 ? 211.870 213.054 196.652 1.00 49.56  0  256 LEU C CD2 1 
ATOM   9829  N  N   . ALA C 2 274 ? 211.739 211.445 201.771 1.00 49.43  0  257 ALA C N   1 
ATOM   9830  C  CA  . ALA C 2 274 ? 211.520 210.319 202.676 1.00 49.43  0  257 ALA C CA  1 
ATOM   9831  C  C   . ALA C 2 274 ? 210.087 210.289 203.198 1.00 49.43  0  257 ALA C C   1 
ATOM   9832  O  O   . ALA C 2 274 ? 209.500 209.210 203.361 1.00 49.43  0  257 ALA C O   1 
ATOM   9833  C  CB  . ALA C 2 274 ? 212.517 210.379 203.832 1.00 49.43  0  257 ALA C CB  1 
ATOM   9834  N  N   . ALA C 2 275 ? 209.502 211.465 203.449 1.00 48.06  0  258 ALA C N   1 
ATOM   9835  C  CA  . ALA C 2 275 ? 208.116 211.530 203.900 1.00 48.06  0  258 ALA C CA  1 
ATOM   9836  C  C   . ALA C 2 275 ? 207.140 211.124 202.802 1.00 48.06  0  258 ALA C C   1 
ATOM   9837  O  O   . ALA C 2 275 ? 206.091 210.545 203.096 1.00 48.06  0  258 ALA C O   1 
ATOM   9838  C  CB  . ALA C 2 275 ? 207.793 212.937 204.401 1.00 48.06  0  258 ALA C CB  1 
ATOM   9839  N  N   . LYS C 2 276 ? 207.461 211.421 201.541 1.00 49.47  0  259 LYS C N   1 
ATOM   9840  C  CA  . LYS C 2 276 ? 206.634 210.946 200.438 1.00 49.47  0  259 LYS C CA  1 
ATOM   9841  C  C   . LYS C 2 276 ? 206.850 209.461 200.179 1.00 49.47  0  259 LYS C C   1 
ATOM   9842  O  O   . LYS C 2 276 ? 205.933 208.775 199.711 1.00 49.47  0  259 LYS C O   1 
ATOM   9843  C  CB  . LYS C 2 276 ? 206.930 211.757 199.175 1.00 49.47  0  259 LYS C CB  1 
ATOM   9844  C  CG  . LYS C 2 276 ? 205.901 211.605 198.063 1.00 49.47  0  259 LYS C CG  1 
ATOM   9845  C  CD  . LYS C 2 276 ? 204.492 211.876 198.563 1.00 49.47  0  259 LYS C CD  1 
ATOM   9846  C  CE  . LYS C 2 276 ? 203.480 211.780 197.433 1.00 49.47  0  259 LYS C CE  1 
ATOM   9847  N  NZ  . LYS C 2 276 ? 203.671 212.854 196.420 1.00 49.47  1  259 LYS C NZ  1 
ATOM   9848  N  N   . HIS C 2 277 ? 208.049 208.951 200.473 1.00 48.54  0  260 HIS C N   1 
ATOM   9849  C  CA  . HIS C 2 277 ? 208.296 207.517 200.360 1.00 48.54  0  260 HIS C CA  1 
ATOM   9850  C  C   . HIS C 2 277 ? 207.506 206.735 201.400 1.00 48.54  0  260 HIS C C   1 
ATOM   9851  O  O   . HIS C 2 277 ? 206.945 205.678 201.093 1.00 48.54  0  260 HIS C O   1 
ATOM   9852  C  CB  . HIS C 2 277 ? 209.789 207.225 200.497 1.00 48.54  0  260 HIS C CB  1 
ATOM   9853  C  CG  . HIS C 2 277 ? 210.168 205.830 200.110 1.00 48.54  0  260 HIS C CG  1 
ATOM   9854  N  ND1 . HIS C 2 277 ? 210.524 204.872 201.034 1.00 48.54  0  260 HIS C ND1 1 
ATOM   9855  C  CD2 . HIS C 2 277 ? 210.245 205.231 198.898 1.00 48.54  0  260 HIS C CD2 1 
ATOM   9856  C  CE1 . HIS C 2 277 ? 210.807 203.743 200.409 1.00 48.54  0  260 HIS C CE1 1 
ATOM   9857  N  NE2 . HIS C 2 277 ? 210.645 203.934 199.112 1.00 48.54  0  260 HIS C NE2 1 
ATOM   9858  N  N   . HIS C 2 278 ? 207.436 207.243 202.628 1.00 48.35  0  261 HIS C N   1 
ATOM   9859  C  CA  . HIS C 2 278 ? 206.694 206.569 203.685 1.00 48.35  0  261 HIS C CA  1 
ATOM   9860  C  C   . HIS C 2 278 ? 205.262 207.068 203.825 1.00 48.35  0  261 HIS C C   1 
ATOM   9861  O  O   . HIS C 2 278 ? 204.555 206.600 204.725 1.00 48.35  0  261 HIS C O   1 
ATOM   9862  C  CB  . HIS C 2 278 ? 207.429 206.718 205.019 1.00 48.35  0  261 HIS C CB  1 
ATOM   9863  C  CG  . HIS C 2 278 ? 208.631 205.836 205.142 1.00 48.35  0  261 HIS C CG  1 
ATOM   9864  N  ND1 . HIS C 2 278 ? 208.591 204.606 205.762 1.00 48.35  0  261 HIS C ND1 1 
ATOM   9865  C  CD2 . HIS C 2 278 ? 209.905 206.000 204.714 1.00 48.35  0  261 HIS C CD2 1 
ATOM   9866  C  CE1 . HIS C 2 278 ? 209.789 204.052 205.714 1.00 48.35  0  261 HIS C CE1 1 
ATOM   9867  N  NE2 . HIS C 2 278 ? 210.605 204.879 205.086 1.00 48.35  0  261 HIS C NE2 1 
ATOM   9868  N  N   . SER C 2 279 ? 204.838 208.002 202.960 1.00 46.23  0  262 SER C N   1 
ATOM   9869  C  CA  . SER C 2 279 ? 203.469 208.540 202.898 1.00 46.23  0  262 SER C CA  1 
ATOM   9870  C  C   . SER C 2 279 ? 203.035 209.170 204.220 1.00 46.23  0  262 SER C C   1 
ATOM   9871  O  O   . SER C 2 279 ? 201.869 209.093 204.613 1.00 46.23  0  262 SER C O   1 
ATOM   9872  C  CB  . SER C 2 279 ? 202.462 207.480 202.448 1.00 46.23  0  262 SER C CB  1 
ATOM   9873  O  OG  . SER C 2 279 ? 201.265 208.086 201.995 1.00 46.23  0  262 SER C OG  1 
ATOM   9874  N  N   . THR C 2 280 ? 203.980 209.796 204.911 1.00 44.30  0  263 THR C N   1 
ATOM   9875  C  CA  . THR C 2 280 ? 203.598 210.513 206.119 1.00 44.30  0  263 THR C CA  1 
ATOM   9876  C  C   . THR C 2 280 ? 203.192 211.940 205.763 1.00 44.30  0  263 THR C C   1 
ATOM   9877  O  O   . THR C 2 280 ? 203.759 212.530 204.838 1.00 44.30  0  263 THR C O   1 
ATOM   9878  C  CB  . THR C 2 280 ? 204.751 210.547 207.115 1.00 44.30  0  263 THR C CB  1 
ATOM   9879  O  OG1 . THR C 2 280 ? 205.723 211.505 206.681 1.00 44.30  0  263 THR C OG1 1 
ATOM   9880  C  CG2 . THR C 2 280 ? 205.404 209.178 207.215 1.00 44.30  0  263 THR C CG2 1 
ATOM   9881  N  N   . PRO C 2 281 ? 202.207 212.514 206.455 1.00 44.21  0  264 PRO C N   1 
ATOM   9882  C  CA  . PRO C 2 281 ? 201.802 213.888 206.139 1.00 44.21  0  264 PRO C CA  1 
ATOM   9883  C  C   . PRO C 2 281 ? 202.849 214.898 206.581 1.00 44.21  0  264 PRO C C   1 
ATOM   9884  O  O   . PRO C 2 281 ? 203.422 214.797 207.667 1.00 44.21  0  264 PRO C O   1 
ATOM   9885  C  CB  . PRO C 2 281 ? 200.492 214.060 206.917 1.00 44.21  0  264 PRO C CB  1 
ATOM   9886  C  CG  . PRO C 2 281 ? 200.574 213.064 208.016 1.00 44.21  0  264 PRO C CG  1 
ATOM   9887  C  CD  . PRO C 2 281 ? 201.313 211.892 207.447 1.00 44.21  0  264 PRO C CD  1 
ATOM   9888  N  N   . LEU C 2 282 ? 203.095 215.876 205.715 1.00 45.12  0  265 LEU C N   1 
ATOM   9889  C  CA  . LEU C 2 282 ? 204.075 216.927 205.952 1.00 45.12  0  265 LEU C CA  1 
ATOM   9890  C  C   . LEU C 2 282 ? 203.333 218.228 206.214 1.00 45.12  0  265 LEU C C   1 
ATOM   9891  O  O   . LEU C 2 282 ? 202.515 218.654 205.391 1.00 45.12  0  265 LEU C O   1 
ATOM   9892  C  CB  . LEU C 2 282 ? 205.015 217.062 204.754 1.00 45.12  0  265 LEU C CB  1 
ATOM   9893  C  CG  . LEU C 2 282 ? 206.151 218.079 204.843 1.00 45.12  0  265 LEU C CG  1 
ATOM   9894  C  CD1 . LEU C 2 282 ? 206.995 217.807 206.055 1.00 45.12  0  265 LEU C CD1 1 
ATOM   9895  C  CD2 . LEU C 2 282 ? 207.006 218.008 203.597 1.00 45.12  0  265 LEU C CD2 1 
ATOM   9896  N  N   . ILE C 2 283 ? 203.617 218.857 207.350 1.00 48.13  0  266 ILE C N   1 
ATOM   9897  C  CA  . ILE C 2 283 ? 202.895 220.039 207.800 1.00 48.13  0  266 ILE C CA  1 
ATOM   9898  C  C   . ILE C 2 283 ? 203.884 221.194 207.836 1.00 48.13  0  266 ILE C C   1 
ATOM   9899  O  O   . ILE C 2 283 ? 204.798 221.212 208.672 1.00 48.13  0  266 ILE C O   1 
ATOM   9900  C  CB  . ILE C 2 283 ? 202.249 219.828 209.174 1.00 48.13  0  266 ILE C CB  1 
ATOM   9901  C  CG1 . ILE C 2 283 ? 201.313 218.618 209.153 1.00 48.13  0  266 ILE C CG1 1 
ATOM   9902  C  CG2 . ILE C 2 283 ? 201.511 221.076 209.613 1.00 48.13  0  266 ILE C CG2 1 
ATOM   9903  C  CD1 . ILE C 2 283 ? 200.136 218.768 208.229 1.00 48.13  0  266 ILE C CD1 1 
ATOM   9904  N  N   . VAL C 2 284 ? 203.693 222.164 206.951 1.00 54.54  0  267 VAL C N   1 
ATOM   9905  C  CA  . VAL C 2 284 ? 204.538 223.349 206.882 1.00 54.54  0  267 VAL C CA  1 
ATOM   9906  C  C   . VAL C 2 284 ? 203.821 224.471 207.620 1.00 54.54  0  267 VAL C C   1 
ATOM   9907  O  O   . VAL C 2 284 ? 202.837 225.028 207.122 1.00 54.54  0  267 VAL C O   1 
ATOM   9908  C  CB  . VAL C 2 284 ? 204.844 223.740 205.431 1.00 54.54  0  267 VAL C CB  1 
ATOM   9909  C  CG1 . VAL C 2 284 ? 205.748 224.960 205.392 1.00 54.54  0  267 VAL C CG1 1 
ATOM   9910  C  CG2 . VAL C 2 284 ? 205.481 222.575 204.695 1.00 54.54  0  267 VAL C CG2 1 
ATOM   9911  N  N   . CYS C 2 285 ? 204.311 224.803 208.812 1.00 62.58  0  268 CYS C N   1 
ATOM   9912  C  CA  . CYS C 2 285 ? 203.777 225.917 209.594 1.00 62.58  0  268 CYS C CA  1 
ATOM   9913  C  C   . CYS C 2 285 ? 204.498 227.186 209.164 1.00 62.58  0  268 CYS C C   1 
ATOM   9914  O  O   . CYS C 2 285 ? 205.589 227.492 209.649 1.00 62.58  0  268 CYS C O   1 
ATOM   9915  C  CB  . CYS C 2 285 ? 203.932 225.662 211.087 1.00 62.58  0  268 CYS C CB  1 
ATOM   9916  S  SG  . CYS C 2 285 ? 203.488 223.997 211.587 1.00 62.58  0  268 CYS C SG  1 
ATOM   9917  N  N   . ALA C 2 286 ? 203.884 227.927 208.247 1.00 65.32  0  269 ALA C N   1 
ATOM   9918  C  CA  . ALA C 2 286 ? 204.496 229.125 207.711 1.00 65.32  0  269 ALA C CA  1 
ATOM   9919  C  C   . ALA C 2 286 ? 203.487 230.263 207.677 1.00 65.32  0  269 ALA C C   1 
ATOM   9920  O  O   . ALA C 2 286 ? 202.320 230.056 207.322 1.00 65.32  0  269 ALA C O   1 
ATOM   9921  C  CB  . ALA C 2 286 ? 205.042 228.875 206.302 1.00 65.32  0  269 ALA C CB  1 
ATOM   9922  N  N   . PRO C 2 287 ? 203.908 231.476 208.026 1.00 68.53  0  270 PRO C N   1 
ATOM   9923  C  CA  . PRO C 2 287 ? 202.994 232.624 207.974 1.00 68.53  0  270 PRO C CA  1 
ATOM   9924  C  C   . PRO C 2 287 ? 202.801 233.154 206.562 1.00 68.53  0  270 PRO C C   1 
ATOM   9925  O  O   . PRO C 2 287 ? 203.299 232.571 205.595 1.00 68.53  0  270 PRO C O   1 
ATOM   9926  C  CB  . PRO C 2 287 ? 203.685 233.653 208.874 1.00 68.53  0  270 PRO C CB  1 
ATOM   9927  C  CG  . PRO C 2 287 ? 205.128 233.326 208.739 1.00 68.53  0  270 PRO C CG  1 
ATOM   9928  C  CD  . PRO C 2 287 ? 205.212 231.836 208.611 1.00 68.53  0  270 PRO C CD  1 
ATOM   9929  N  N   . MET C 2 288 ? 202.084 234.268 206.433 1.00 70.19  0  271 MET C N   1 
ATOM   9930  C  CA  . MET C 2 288 ? 201.712 234.789 205.126 1.00 70.19  0  271 MET C CA  1 
ATOM   9931  C  C   . MET C 2 288 ? 202.732 235.755 204.539 1.00 70.19  0  271 MET C C   1 
ATOM   9932  O  O   . MET C 2 288 ? 202.647 236.060 203.345 1.00 70.19  0  271 MET C O   1 
ATOM   9933  C  CB  . MET C 2 288 ? 200.347 235.479 205.202 1.00 70.19  0  271 MET C CB  1 
ATOM   9934  C  CG  . MET C 2 288 ? 199.174 234.517 205.184 1.00 70.19  0  271 MET C CG  1 
ATOM   9935  S  SD  . MET C 2 288 ? 199.115 233.565 203.654 1.00 70.19  0  271 MET C SD  1 
ATOM   9936  C  CE  . MET C 2 288 ? 197.549 232.718 203.837 1.00 70.19  0  271 MET C CE  1 
ATOM   9937  N  N   . PHE C 2 289 ? 203.686 236.246 205.326 1.00 73.19  0  272 PHE C N   1 
ATOM   9938  C  CA  . PHE C 2 289 ? 204.732 237.092 204.768 1.00 73.19  0  272 PHE C CA  1 
ATOM   9939  C  C   . PHE C 2 289 ? 205.903 236.291 204.213 1.00 73.19  0  272 PHE C C   1 
ATOM   9940  O  O   . PHE C 2 289 ? 206.848 236.888 203.687 1.00 73.19  0  272 PHE C O   1 
ATOM   9941  C  CB  . PHE C 2 289 ? 205.227 238.117 205.804 1.00 73.19  0  272 PHE C CB  1 
ATOM   9942  C  CG  . PHE C 2 289 ? 205.669 237.529 207.117 1.00 73.19  0  272 PHE C CG  1 
ATOM   9943  C  CD1 . PHE C 2 289 ? 206.982 237.121 207.307 1.00 73.19  0  272 PHE C CD1 1 
ATOM   9944  C  CD2 . PHE C 2 289 ? 204.785 237.440 208.182 1.00 73.19  0  272 PHE C CD2 1 
ATOM   9945  C  CE1 . PHE C 2 289 ? 207.394 236.600 208.519 1.00 73.19  0  272 PHE C CE1 1 
ATOM   9946  C  CE2 . PHE C 2 289 ? 205.192 236.922 209.399 1.00 73.19  0  272 PHE C CE2 1 
ATOM   9947  C  CZ  . PHE C 2 289 ? 206.500 236.506 209.567 1.00 73.19  0  272 PHE C CZ  1 
ATOM   9948  N  N   . LYS C 2 290 ? 205.865 234.964 204.315 1.00 66.41  0  273 LYS C N   1 
ATOM   9949  C  CA  . LYS C 2 290 ? 206.839 234.099 203.667 1.00 66.41  0  273 LYS C CA  1 
ATOM   9950  C  C   . LYS C 2 290 ? 206.341 233.578 202.326 1.00 66.41  0  273 LYS C C   1 
ATOM   9951  O  O   . LYS C 2 290 ? 206.928 232.642 201.776 1.00 66.41  0  273 LYS C O   1 
ATOM   9952  C  CB  . LYS C 2 290 ? 207.201 232.929 204.583 1.00 66.41  0  273 LYS C CB  1 
ATOM   9953  C  CG  . LYS C 2 290 ? 208.013 233.331 205.802 1.00 66.41  0  273 LYS C CG  1 
ATOM   9954  C  CD  . LYS C 2 290 ? 208.410 232.121 206.625 1.00 66.41  0  273 LYS C CD  1 
ATOM   9955  C  CE  . LYS C 2 290 ? 209.317 232.515 207.778 1.00 66.41  0  273 LYS C CE  1 
ATOM   9956  N  NZ  . LYS C 2 290 ? 209.712 231.339 208.600 1.00 66.41  1  273 LYS C NZ  1 
ATOM   9957  N  N   . LEU C 2 291 ? 205.272 234.161 201.796 1.00 68.12  0  274 LEU C N   1 
ATOM   9958  C  CA  . LEU C 2 291 ? 204.689 233.756 200.525 1.00 68.12  0  274 LEU C CA  1 
ATOM   9959  C  C   . LEU C 2 291 ? 205.173 234.690 199.425 1.00 68.12  0  274 LEU C C   1 
ATOM   9960  O  O   . LEU C 2 291 ? 205.075 235.913 199.560 1.00 68.12  0  274 LEU C O   1 
ATOM   9961  C  CB  . LEU C 2 291 ? 203.163 233.772 200.602 1.00 68.12  0  274 LEU C CB  1 
ATOM   9962  C  CG  . LEU C 2 291 ? 202.421 233.285 199.361 1.00 68.12  0  274 LEU C CG  1 
ATOM   9963  C  CD1 . LEU C 2 291 ? 202.935 231.923 198.947 1.00 68.12  0  274 LEU C CD1 1 
ATOM   9964  C  CD2 . LEU C 2 291 ? 200.933 233.235 199.632 1.00 68.12  0  274 LEU C CD2 1 
ATOM   9965  N  N   . SER C 2 292 ? 205.686 234.117 198.341 1.00 69.38  0  275 SER C N   1 
ATOM   9966  C  CA  . SER C 2 292 ? 206.307 234.900 197.286 1.00 69.38  0  275 SER C CA  1 
ATOM   9967  C  C   . SER C 2 292 ? 205.905 234.351 195.926 1.00 69.38  0  275 SER C C   1 
ATOM   9968  O  O   . SER C 2 292 ? 205.710 233.139 195.776 1.00 69.38  0  275 SER C O   1 
ATOM   9969  C  CB  . SER C 2 292 ? 207.838 234.880 197.411 1.00 69.38  0  275 SER C CB  1 
ATOM   9970  O  OG  . SER C 2 292 ? 208.375 233.729 196.787 1.00 69.38  0  275 SER C OG  1 
ATOM   9971  N  N   . PRO C 2 293 ? 205.775 235.214 194.919 1.00 73.39  0  276 PRO C N   1 
ATOM   9972  C  CA  . PRO C 2 293 ? 205.482 234.752 193.554 1.00 73.39  0  276 PRO C CA  1 
ATOM   9973  C  C   . PRO C 2 293 ? 206.696 234.378 192.714 1.00 73.39  0  276 PRO C C   1 
ATOM   9974  O  O   . PRO C 2 293 ? 206.530 234.148 191.513 1.00 73.39  0  276 PRO C O   1 
ATOM   9975  C  CB  . PRO C 2 293 ? 204.780 235.972 192.944 1.00 73.39  0  276 PRO C CB  1 
ATOM   9976  C  CG  . PRO C 2 293 ? 205.416 237.117 193.613 1.00 73.39  0  276 PRO C CG  1 
ATOM   9977  C  CD  . PRO C 2 293 ? 205.704 236.683 195.023 1.00 73.39  0  276 PRO C CD  1 
ATOM   9978  N  N   . GLN C 2 294 ? 207.896 234.325 193.289 1.00 80.62  0  277 GLN C N   1 
ATOM   9979  C  CA  . GLN C 2 294 ? 209.087 234.019 192.505 1.00 80.62  0  277 GLN C CA  1 
ATOM   9980  C  C   . GLN C 2 294 ? 209.115 232.541 192.131 1.00 80.62  0  277 GLN C C   1 
ATOM   9981  O  O   . GLN C 2 294 ? 209.161 231.666 193.002 1.00 80.62  0  277 GLN C O   1 
ATOM   9982  C  CB  . GLN C 2 294 ? 210.357 234.410 193.261 1.00 80.62  0  277 GLN C CB  1 
ATOM   9983  C  CG  . GLN C 2 294 ? 210.687 235.902 193.212 1.00 80.62  0  277 GLN C CG  1 
ATOM   9984  C  CD  . GLN C 2 294 ? 209.826 236.746 194.127 1.00 80.62  0  277 GLN C CD  1 
ATOM   9985  O  OE1 . GLN C 2 294 ? 209.057 237.592 193.670 1.00 80.62  0  277 GLN C OE1 1 
ATOM   9986  N  NE2 . GLN C 2 294 ? 209.974 236.544 195.429 1.00 80.62  0  277 GLN C NE2 1 
ATOM   9987  N  N   . PHE C 2 295 ? 209.077 232.279 190.829 1.00 85.34  0  278 PHE C N   1 
ATOM   9988  C  CA  . PHE C 2 295 ? 209.080 230.926 190.305 1.00 85.34  0  278 PHE C CA  1 
ATOM   9989  C  C   . PHE C 2 295 ? 210.467 230.301 190.476 1.00 85.34  0  278 PHE C C   1 
ATOM   9990  O  O   . PHE C 2 295 ? 211.465 231.022 190.574 1.00 85.34  0  278 PHE C O   1 
ATOM   9991  C  CB  . PHE C 2 295 ? 208.667 230.955 188.833 1.00 85.34  0  278 PHE C CB  1 
ATOM   9992  C  CG  . PHE C 2 295 ? 207.266 231.447 188.620 1.00 85.34  0  278 PHE C CG  1 
ATOM   9993  C  CD1 . PHE C 2 295 ? 206.182 230.684 189.027 1.00 85.34  0  278 PHE C CD1 1 
ATOM   9994  C  CD2 . PHE C 2 295 ? 207.033 232.680 188.029 1.00 85.34  0  278 PHE C CD2 1 
ATOM   9995  C  CE1 . PHE C 2 295 ? 204.888 231.138 188.842 1.00 85.34  0  278 PHE C CE1 1 
ATOM   9996  C  CE2 . PHE C 2 295 ? 205.742 233.140 187.838 1.00 85.34  0  278 PHE C CE2 1 
ATOM   9997  C  CZ  . PHE C 2 295 ? 204.668 232.369 188.247 1.00 85.34  0  278 PHE C CZ  1 
ATOM   9998  N  N   . PRO C 2 296 ? 210.556 228.945 190.560 1.00 86.07  0  279 PRO C N   1 
ATOM   9999  C  CA  . PRO C 2 296 ? 211.861 228.303 190.798 1.00 86.07  0  279 PRO C CA  1 
ATOM   10000 C  C   . PRO C 2 296 ? 212.864 228.491 189.669 1.00 86.07  0  279 PRO C C   1 
ATOM   10001 O  O   . PRO C 2 296 ? 213.995 228.923 189.913 1.00 86.07  0  279 PRO C O   1 
ATOM   10002 C  CB  . PRO C 2 296 ? 211.499 226.821 190.965 1.00 86.07  0  279 PRO C CB  1 
ATOM   10003 C  CG  . PRO C 2 296 ? 210.070 226.813 191.340 1.00 86.07  0  279 PRO C CG  1 
ATOM   10004 C  CD  . PRO C 2 296 ? 209.453 227.967 190.634 1.00 86.07  0  279 PRO C CD  1 
ATOM   10005 N  N   . ASN C 2 297 ? 212.472 228.175 188.436 1.00 90.71  0  280 ASN C N   1 
ATOM   10006 C  CA  . ASN C 2 297 ? 213.368 228.332 187.290 1.00 90.71  0  280 ASN C CA  1 
ATOM   10007 C  C   . ASN C 2 297 ? 213.315 229.790 186.841 1.00 90.71  0  280 ASN C C   1 
ATOM   10008 O  O   . ASN C 2 297 ? 212.615 230.167 185.898 1.00 90.71  0  280 ASN C O   1 
ATOM   10009 C  CB  . ASN C 2 297 ? 212.983 227.377 186.169 1.00 90.71  0  280 ASN C CB  1 
ATOM   10010 N  N   . GLU C 2 298 ? 214.080 230.627 187.544 1.00 94.63  0  281 GLU C N   1 
ATOM   10011 C  CA  . GLU C 2 298 ? 214.113 232.063 187.264 1.00 94.63  0  281 GLU C CA  1 
ATOM   10012 C  C   . GLU C 2 298 ? 215.525 232.561 187.560 1.00 94.63  0  281 GLU C C   1 
ATOM   10013 O  O   . GLU C 2 298 ? 215.862 232.815 188.721 1.00 94.63  0  281 GLU C O   1 
ATOM   10014 C  CB  . GLU C 2 298 ? 213.072 232.807 188.089 1.00 94.63  0  281 GLU C CB  1 
ATOM   10015 N  N   . GLU C 2 299 ? 216.347 232.655 186.509 1.00 98.50  0  282 GLU C N   1 
ATOM   10016 C  CA  . GLU C 2 299 ? 217.696 233.226 186.495 1.00 98.50  0  282 GLU C CA  1 
ATOM   10017 C  C   . GLU C 2 299 ? 218.696 232.475 187.376 1.00 98.50  0  282 GLU C C   1 
ATOM   10018 O  O   . GLU C 2 299 ? 219.785 233.002 187.642 1.00 98.50  0  282 GLU C O   1 
ATOM   10019 C  CB  . GLU C 2 299 ? 217.687 234.715 186.876 1.00 98.50  0  282 GLU C CB  1 
ATOM   10020 N  N   . ASP C 2 300 ? 218.343 231.273 187.850 1.00 94.67  0  283 ASP C N   1 
ATOM   10021 C  CA  . ASP C 2 300 ? 219.206 230.338 188.585 1.00 94.67  0  283 ASP C CA  1 
ATOM   10022 C  C   . ASP C 2 300 ? 219.762 230.904 189.895 1.00 94.67  0  283 ASP C C   1 
ATOM   10023 O  O   . ASP C 2 300 ? 220.713 230.347 190.454 1.00 94.67  0  283 ASP C O   1 
ATOM   10024 C  CB  . ASP C 2 300 ? 220.357 229.831 187.705 1.00 94.67  0  283 ASP C CB  1 
ATOM   10025 N  N   . SER C 2 301 ? 219.204 231.995 190.408 1.00 85.28  0  284 SER C N   1 
ATOM   10026 C  CA  . SER C 2 301 ? 219.637 232.560 191.688 1.00 85.28  0  284 SER C CA  1 
ATOM   10027 C  C   . SER C 2 301 ? 218.762 232.057 192.828 1.00 85.28  0  284 SER C C   1 
ATOM   10028 O  O   . SER C 2 301 ? 218.207 232.834 193.604 1.00 85.28  0  284 SER C O   1 
ATOM   10029 C  CB  . SER C 2 301 ? 219.628 234.082 191.621 1.00 85.28  0  284 SER C CB  1 
ATOM   10030 O  OG  . SER C 2 301 ? 219.572 234.648 192.91