data_6O9U
# 
_entry.id   6O9U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6O9U         
WWPDB D_1000240268 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6O9U 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gulbis, J.M.' 1 0000-0003-2091-2237 
'Clarke, O.B.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                3024 
_citation.page_last                 3024 
_citation.title                     'A constricted opening in Kir channels does not impede potassium conduction.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-16842-0 
_citation.pdbx_database_id_PubMed   32541684 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Black, K.A.'    1  ? 
primary 'He, S.'         2  ? 
primary 'Jin, R.'        3  ? 
primary 'Miller, D.M.'   4  ? 
primary 'Bolla, J.R.'    5  ? 
primary 'Clarke, O.B.'   6  ? 
primary 'Johnson, P.'    7  ? 
primary 'Windley, M.'    8  ? 
primary 'Burns, C.J.'    9  ? 
primary 'Hill, A.P.'     10 ? 
primary 'Laver, D.'      11 ? 
primary 'Robinson, C.V.' 12 ? 
primary 'Smith, B.J.'    13 ? 
primary 'Gulbis, J.M.'   14 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6O9U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.955 
_cell.length_a_esd                 ? 
_cell.length_b                     105.955 
_cell.length_b_esd                 ? 
_cell.length_c                     89.639 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6O9U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Inward rectifier potassium channel Kirbac3.1' 33782.766 1   ? ? ? ? 
2 non-polymer syn 'trimethylamine oxide'                         75.110    3   ? ? ? ? 
3 non-polymer syn 'POTASSIUM ION'                                39.098    9   ? ? ? ? 
4 non-polymer syn 'BARIUM ION'                                   137.327   1   ? ? ? ? 
5 non-polymer syn 'CHLORIDE ION'                                 35.453    1   ? ? ? ? 
6 non-polymer syn 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE       787.121   2   ? ? ? ? 
7 non-polymer syn 
;3,3',3''-phosphoryltripropanoic acid
;
266.185   1   ? ? ? ? 
8 water       nat water                                          18.015    167 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  ARG n 
1 14  ILE n 
1 15  LEU n 
1 16  ASN n 
1 17  SER n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  LEU n 
1 27  GLY n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  GLY n 
1 33  TRP n 
1 34  LEU n 
1 35  ASP n 
1 36  ASP n 
1 37  HIS n 
1 38  TYR n 
1 39  HIS n 
1 40  ASP n 
1 41  LEU n 
1 42  LEU n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  TRP n 
1 47  PRO n 
1 48  VAL n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  LEU n 
1 53  ILE n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  TYR n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLY n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  GLU n 
1 77  ASN n 
1 78  ALA n 
1 79  ARG n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  PHE n 
1 84  THR n 
1 85  ASP n 
1 86  ALA n 
1 87  PHE n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  MET n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  GLY n 
1 99  TYR n 
1 100 GLY n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 LEU n 
1 113 VAL n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 ALA n 
1 118 LEU n 
1 119 CYS n 
1 120 GLY n 
1 121 MET n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ILE n 
1 132 TYR n 
1 133 ALA n 
1 134 ARG n 
1 135 PHE n 
1 136 THR n 
1 137 ARG n 
1 138 PRO n 
1 139 THR n 
1 140 ALA n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 PHE n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 MET n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 ASP n 
1 153 PHE n 
1 154 GLU n 
1 155 GLY n 
1 156 LYS n 
1 157 PRO n 
1 158 THR n 
1 159 LEU n 
1 160 MET n 
1 161 MET n 
1 162 ARG n 
1 163 LEU n 
1 164 ALA n 
1 165 ASN n 
1 166 LEU n 
1 167 ARG n 
1 168 ILE n 
1 169 GLU n 
1 170 GLN n 
1 171 ILE n 
1 172 ILE n 
1 173 GLU n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ILE n 
1 186 SER n 
1 187 GLN n 
1 188 GLU n 
1 189 GLY n 
1 190 MET n 
1 191 VAL n 
1 192 PHE n 
1 193 ARG n 
1 194 ARG n 
1 195 PHE n 
1 196 HIS n 
1 197 ASP n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 THR n 
1 202 ARG n 
1 203 SER n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 TRP n 
1 213 THR n 
1 214 VAL n 
1 215 MET n 
1 216 HIS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 SER n 
1 223 PRO n 
1 224 ILE n 
1 225 TYR n 
1 226 GLY n 
1 227 GLU n 
1 228 THR n 
1 229 ASP n 
1 230 GLU n 
1 231 THR n 
1 232 LEU n 
1 233 ARG n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 SER n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 PHE n 
1 244 THR n 
1 245 GLY n 
1 246 HIS n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 PHE n 
1 251 ALA n 
1 252 GLN n 
1 253 ASN n 
1 254 VAL n 
1 255 HIS n 
1 256 ALA n 
1 257 ARG n 
1 258 HIS n 
1 259 ALA n 
1 260 TYR n 
1 261 SER n 
1 262 CYS n 
1 263 ASP n 
1 264 GLU n 
1 265 ILE n 
1 266 ILE n 
1 267 TRP n 
1 268 GLY n 
1 269 GLY n 
1 270 HIS n 
1 271 PHE n 
1 272 VAL n 
1 273 ASP n 
1 274 VAL n 
1 275 PHE n 
1 276 THR n 
1 277 THR n 
1 278 LEU n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLY n 
1 289 LYS n 
1 290 PHE n 
1 291 HIS n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLN n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   301 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Magnetospirillum magnetotacticum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     188 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IRK10_MAGMG 
_struct_ref.pdbx_db_accession          D9N164 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQ
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6O9U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 295 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             D9N164 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  295 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       295 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6O9U HIS A 296 ? UNP D9N164 ? ? 'expression tag' 296 1 
1 6O9U HIS A 297 ? UNP D9N164 ? ? 'expression tag' 297 2 
1 6O9U HIS A 298 ? UNP D9N164 ? ? 'expression tag' 298 3 
1 6O9U HIS A 299 ? UNP D9N164 ? ? 'expression tag' 299 4 
1 6O9U HIS A 300 ? UNP D9N164 ? ? 'expression tag' 300 5 
1 6O9U HIS A 301 ? UNP D9N164 ? ? 'expression tag' 301 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
BA  non-polymer         . 'BARIUM ION'                             ? 'Ba 2'             137.327 
CL  non-polymer         . 'CHLORIDE ION'                           ? 'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
K   non-polymer         . 'POTASSIUM ION'                          ? 'K 1'              39.098  
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
PCW non-polymer         . 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE 
'(Z,Z)-4-HYDROXY-N,N,N-TRIMETHYL-10-OXO-7-[(1-OXO-9-OCTADECENYL)OXY]-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-18-EN-1-AMINIUM-4-OXIDE' 
'C44 H85 N O8 P 1' 787.121 
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'       119.119 
TMO non-polymer         . 'trimethylamine oxide'                   ? 'C3 H9 N O'        75.110  
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'      117.146 
Z3P non-polymer         . 
;3,3',3''-phosphoryltripropanoic acid
;
?                                                                                                                            
'C9 H15 O7 P'      266.185 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6O9U 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.72 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.97 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.5% PEG 4k, 2.5% PEG 8k, 10-17% PEG 400, 90 mM HEPES pH 7.5, 1 mM TCEP, and 50 mM EDTA' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-08-20 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6O9U 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.00 
_reflns.d_resolution_low                 45.61 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       65702 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.3 
_reflns.pdbx_Rmerge_I_obs                0.111 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.97 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.24 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6508 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                108.460 
_refine.B_iso_mean                               43.0896 
_refine.B_iso_min                                22.100 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6O9U 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0000 
_refine.ls_d_res_low                             45.6080 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     65702 
_refine.ls_number_reflns_R_free                  3311 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7400 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2034 
_refine.ls_R_factor_R_free                       0.2271 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2021 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.890 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1XL4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.2100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.0000 
_refine_hist.d_res_low                        45.6080 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               2504 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       283 
_refine_hist.pdbx_B_iso_mean_ligand           57.44 
_refine_hist.pdbx_B_iso_mean_solvent          45.36 
_refine_hist.pdbx_number_atoms_protein        2215 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         121 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 2348 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.545  ? 3197 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 361  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 403  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.275 ? 1359 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0002 2.0288  2679 . 137 2542 99.0000  . . . 0.3197 0.0000 0.3317 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.0288 2.0591  2724 . 128 2596 100.0000 . . . 0.3150 0.0000 0.3104 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.0591 2.0913  2747 . 140 2607 100.0000 . . . 0.3238 0.0000 0.3050 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.0913 2.1256  2756 . 145 2611 100.0000 . . . 0.3046 0.0000 0.2867 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.1256 2.1622  2738 . 115 2623 100.0000 . . . 0.2902 0.0000 0.2866 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.1622 2.2015  2745 . 147 2598 100.0000 . . . 0.2680 0.0000 0.2670 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.2015 2.2439  2729 . 137 2592 100.0000 . . . 0.2680 0.0000 0.2650 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.2439 2.2897  2716 . 126 2590 100.0000 . . . 0.2588 0.0000 0.2468 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.2897 2.3395  2772 . 140 2632 100.0000 . . . 0.2612 0.0000 0.2437 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.3395 2.3939  2751 . 172 2579 100.0000 . . . 0.2609 0.0000 0.2279 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.3939 2.4537  2733 . 134 2599 100.0000 . . . 0.2323 0.0000 0.2209 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.4537 2.5201  2727 . 153 2574 100.0000 . . . 0.2193 0.0000 0.2116 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.5201 2.5942  2735 . 152 2583 100.0000 . . . 0.2485 0.0000 0.1988 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.5942 2.6780  2743 . 154 2589 100.0000 . . . 0.2532 0.0000 0.1913 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.6780 2.7737  2784 . 139 2645 100.0000 . . . 0.2297 0.0000 0.1920 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.7737 2.8847  2738 . 134 2604 100.0000 . . . 0.2409 0.0000 0.1890 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.8847 3.0160  2749 . 149 2600 100.0000 . . . 0.2088 0.0000 0.1712 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.0160 3.1749  2714 . 166 2548 100.0000 . . . 0.2152 0.0000 0.1708 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.1749 3.3738  2739 . 122 2617 100.0000 . . . 0.2210 0.0000 0.1672 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.3738 3.6342  2756 . 108 2648 100.0000 . . . 0.2064 0.0000 0.1666 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.6342 3.9997  2725 . 131 2594 100.0000 . . . 0.1838 0.0000 0.1745 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.9997 4.5780  2733 . 131 2602 99.0000  . . . 0.2294 0.0000 0.1690 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 4.5780 5.7660  2757 . 135 2622 100.0000 . . . 0.1949 0.0000 0.1888 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 5.7660 45.6196 2712 . 116 2596 99.0000  . . . 0.2099 0.0000 0.2297 . . . . . . 24 . . . 
# 
_struct.entry_id                     6O9U 
_struct.title                        'KirBac3.1 at a resolution of 2 Angstroms' 
_struct.pdbx_descriptor              'Inward rectifier potassium channel Kirbac3.1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6O9U 
_struct_keywords.text            'MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 7 ? 
S N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 36  ? VAL A 44  ? ASP A 36  VAL A 44  1 ? 9  
HELX_P HELX_P2 AA2 SER A 45  ? GLY A 72  ? SER A 45  GLY A 72  1 ? 28 
HELX_P HELX_P3 AA3 SER A 82  ? ALA A 95  ? SER A 82  ALA A 95  1 ? 14 
HELX_P HELX_P4 AA4 ILE A 105 ? THR A 136 ? ILE A 105 THR A 136 1 ? 32 
HELX_P HELX_P5 AA5 THR A 228 ? SER A 235 ? THR A 228 SER A 235 1 ? 8  
HELX_P HELX_P6 AA6 SER A 261 ? ASP A 263 ? SER A 261 ASP A 263 5 ? 3  
HELX_P HELX_P7 AA7 LEU A 287 ? PHE A 290 ? LEU A 287 PHE A 290 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ALA 95 O   ? ? ? 1_555 M K   . K  ? ? A ALA 95  A K   412 1_555 ? ? ? ? ? ? ? 3.368 ? ? 
metalc2  metalc ? ? A THR 96 O   ? ? ? 1_555 H K   . K  ? ? A THR 96  A K   407 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc3  metalc ? ? A THR 96 O   ? ? ? 1_555 H K   . K  ? ? A THR 96  A K   407 4_545 ? ? ? ? ? ? ? 2.757 ? ? 
metalc4  metalc ? ? A THR 96 OG1 ? ? ? 1_555 M K   . K  ? ? A THR 96  A K   412 1_555 ? ? ? ? ? ? ? 3.178 ? ? 
metalc5  metalc ? ? A THR 96 O   ? ? ? 1_555 N BA  . BA ? ? A THR 96  A BA  413 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc6  metalc ? ? A THR 96 OG1 ? ? ? 1_555 N BA  . BA ? ? A THR 96  A BA  413 1_555 ? ? ? ? ? ? ? 3.157 ? ? 
metalc7  metalc ? ? A THR 96 O   ? ? ? 1_555 N BA  . BA ? ? A THR 96  A BA  413 4_545 ? ? ? ? ? ? ? 2.879 ? ? 
metalc8  metalc ? ? A THR 96 OG1 ? ? ? 1_555 N BA  . BA ? ? A THR 96  A BA  413 4_545 ? ? ? ? ? ? ? 3.157 ? ? 
metalc9  metalc ? ? A ILE 97 O   ? ? ? 1_555 G K   . K  ? ? A ILE 97  A K   406 1_555 ? ? ? ? ? ? ? 2.749 ? ? 
metalc10 metalc ? ? A ILE 97 O   ? ? ? 1_555 G K   . K  ? ? A ILE 97  A K   406 4_545 ? ? ? ? ? ? ? 2.749 ? ? 
metalc11 metalc ? ? A ILE 97 O   ? ? ? 1_555 H K   . K  ? ? A ILE 97  A K   407 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc12 metalc ? ? A ILE 97 O   ? ? ? 1_555 H K   . K  ? ? A ILE 97  A K   407 4_545 ? ? ? ? ? ? ? 2.878 ? ? 
metalc13 metalc ? ? A GLY 98 O   ? ? ? 1_555 F K   . K  ? ? A GLY 98  A K   405 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc14 metalc ? ? A GLY 98 O   ? ? ? 1_555 F K   . K  ? ? A GLY 98  A K   405 4_545 ? ? ? ? ? ? ? 2.848 ? ? 
metalc15 metalc ? ? A GLY 98 O   ? ? ? 1_555 G K   . K  ? ? A GLY 98  A K   406 1_555 ? ? ? ? ? ? ? 2.769 ? ? 
metalc16 metalc ? ? A GLY 98 O   ? ? ? 1_555 G K   . K  ? ? A GLY 98  A K   406 4_545 ? ? ? ? ? ? ? 2.769 ? ? 
metalc17 metalc ? ? A TYR 99 O   ? ? ? 1_555 F K   . K  ? ? A TYR 99  A K   405 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc18 metalc ? ? A TYR 99 O   ? ? ? 1_555 F K   . K  ? ? A TYR 99  A K   405 4_545 ? ? ? ? ? ? ? 2.841 ? ? 
metalc19 metalc ? ? K K   .  K   ? ? ? 1_555 S HOH . O  ? ? A K   410 A HOH 656 1_555 ? ? ? ? ? ? ? 3.424 ? ? 
metalc20 metalc ? ? K K   .  K   ? ? ? 1_555 S HOH . O  ? ? A K   410 A HOH 656 2_545 ? ? ? ? ? ? ? 3.424 ? ? 
metalc21 metalc ? ? L K   .  K   ? ? ? 1_555 S HOH . O  ? ? A K   411 A HOH 634 1_555 ? ? ? ? ? ? ? 2.632 ? ? 
metalc22 metalc ? ? M K   .  K   ? ? ? 1_555 S HOH . O  ? ? A K   412 A HOH 634 1_555 ? ? ? ? ? ? ? 2.804 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 75  ? GLU A 76  ? ILE A 75  GLU A 76  
AA1 2 ILE A 103 ? PRO A 104 ? ILE A 103 PRO A 104 
AA2 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AA2 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AA2 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
AA3 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AA3 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AA3 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153 
AA3 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
AA4 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AA4 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AA4 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
AA5 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AA5 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AA5 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
AA5 4 GLN A 252 ? TYR A 260 ? GLN A 252 TYR A 260 
AA6 1 HIS A 270 ? PHE A 271 ? HIS A 270 PHE A 271 
AA6 2 ILE A 293 ? ALA A 294 ? ILE A 293 ALA A 294 
AA7 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 
AA7 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 76  ? N GLU A 76  O ILE A 103 ? O ILE A 103 
AA2 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AA2 2 3 N LEU A 159 ? N LEU A 159 O HIS A 216 ? O HIS A 216 
AA3 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AA3 2 3 O MET A 160 ? O MET A 160 N VAL A 149 ? N VAL A 149 
AA3 3 4 N MET A 148 ? N MET A 148 O ILE A 266 ? O ILE A 266 
AA4 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184 
AA4 2 3 N ILE A 171 ? N ILE A 171 O PHE A 208 ? O PHE A 208 
AA5 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184 
AA5 2 3 N ILE A 172 ? N ILE A 172 O HIS A 246 ? O HIS A 246 
AA5 3 4 N VAL A 241 ? N VAL A 241 O HIS A 258 ? O HIS A 258 
AA6 1 2 N HIS A 270 ? N HIS A 270 O ALA A 294 ? O ALA A 294 
AA7 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A TMO 401 ? 9  'binding site for residue TMO A 401' 
AC2 Software A TMO 402 ? 4  'binding site for residue TMO A 402' 
AC3 Software A TMO 403 ? 2  'binding site for residue TMO A 403' 
AC4 Software A K   405 ? 12 'binding site for residue K A 405'   
AC5 Software A K   406 ? 16 'binding site for residue K A 406'   
AC6 Software A K   407 ? 16 'binding site for residue K A 407'   
AC7 Software A K   409 ? 4  'binding site for residue K A 409'   
AC8 Software A K   410 ? 8  'binding site for residue K A 410'   
AC9 Software A K   411 ? 3  'binding site for residue K A 411'   
AD1 Software A K   412 ? 5  'binding site for residue K A 412'   
AD2 Software A BA  413 ? 8  'binding site for residue BA A 413'  
AD3 Software A CL  414 ? 4  'binding site for residue CL A 414'  
AD4 Software A PCW 415 ? 4  'binding site for residue PCW A 415' 
AD5 Software A PCW 416 ? 8  'binding site for residue PCW A 416' 
AD6 Software A Z3P 417 ? 14 'binding site for residue Z3P A 417' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  TYR A 132 ? TYR A 132 . ? 3_445 ? 
2   AC1 9  THR A 136 ? THR A 136 . ? 1_555 ? 
3   AC1 9  PHE A 250 ? PHE A 250 . ? 3_445 ? 
4   AC1 9  ALA A 251 ? ALA A 251 . ? 3_445 ? 
5   AC1 9  GLN A 252 ? GLN A 252 . ? 3_445 ? 
6   AC1 9  K   K .   ? K   A 410 . ? 4_545 ? 
7   AC1 9  K   K .   ? K   A 410 . ? 3_445 ? 
8   AC1 9  K   K .   ? K   A 410 . ? 2_545 ? 
9   AC1 9  K   K .   ? K   A 410 . ? 1_555 ? 
10  AC2 4  GLU A 173 ? GLU A 173 . ? 1_555 ? 
11  AC2 4  ASP A 175 ? ASP A 175 . ? 1_555 ? 
12  AC2 4  THR A 244 ? THR A 244 . ? 1_555 ? 
13  AC2 4  ASN A 253 ? ASN A 253 . ? 1_555 ? 
14  AC3 2  ASP A 197 ? ASP A 197 . ? 1_555 ? 
15  AC3 2  LEU A 198 ? LEU A 198 . ? 1_555 ? 
16  AC4 12 GLY A 98  ? GLY A 98  . ? 1_555 ? 
17  AC4 12 GLY A 98  ? GLY A 98  . ? 3_445 ? 
18  AC4 12 GLY A 98  ? GLY A 98  . ? 2_545 ? 
19  AC4 12 GLY A 98  ? GLY A 98  . ? 4_545 ? 
20  AC4 12 TYR A 99  ? TYR A 99  . ? 4_545 ? 
21  AC4 12 TYR A 99  ? TYR A 99  . ? 2_545 ? 
22  AC4 12 TYR A 99  ? TYR A 99  . ? 1_555 ? 
23  AC4 12 TYR A 99  ? TYR A 99  . ? 3_445 ? 
24  AC4 12 K   G .   ? K   A 406 . ? 4_545 ? 
25  AC4 12 K   G .   ? K   A 406 . ? 3_445 ? 
26  AC4 12 K   G .   ? K   A 406 . ? 2_545 ? 
27  AC4 12 K   G .   ? K   A 406 . ? 1_555 ? 
28  AC5 16 ILE A 97  ? ILE A 97  . ? 1_555 ? 
29  AC5 16 ILE A 97  ? ILE A 97  . ? 3_445 ? 
30  AC5 16 ILE A 97  ? ILE A 97  . ? 2_545 ? 
31  AC5 16 ILE A 97  ? ILE A 97  . ? 4_545 ? 
32  AC5 16 GLY A 98  ? GLY A 98  . ? 1_555 ? 
33  AC5 16 GLY A 98  ? GLY A 98  . ? 3_445 ? 
34  AC5 16 GLY A 98  ? GLY A 98  . ? 4_545 ? 
35  AC5 16 GLY A 98  ? GLY A 98  . ? 2_545 ? 
36  AC5 16 K   F .   ? K   A 405 . ? 1_555 ? 
37  AC5 16 K   F .   ? K   A 405 . ? 2_545 ? 
38  AC5 16 K   F .   ? K   A 405 . ? 3_445 ? 
39  AC5 16 K   F .   ? K   A 405 . ? 4_545 ? 
40  AC5 16 K   H .   ? K   A 407 . ? 4_545 ? 
41  AC5 16 K   H .   ? K   A 407 . ? 3_445 ? 
42  AC5 16 K   H .   ? K   A 407 . ? 2_545 ? 
43  AC5 16 K   H .   ? K   A 407 . ? 1_555 ? 
44  AC6 16 THR A 96  ? THR A 96  . ? 1_555 ? 
45  AC6 16 THR A 96  ? THR A 96  . ? 3_445 ? 
46  AC6 16 THR A 96  ? THR A 96  . ? 2_545 ? 
47  AC6 16 THR A 96  ? THR A 96  . ? 4_545 ? 
48  AC6 16 ILE A 97  ? ILE A 97  . ? 3_445 ? 
49  AC6 16 ILE A 97  ? ILE A 97  . ? 4_545 ? 
50  AC6 16 ILE A 97  ? ILE A 97  . ? 2_545 ? 
51  AC6 16 ILE A 97  ? ILE A 97  . ? 1_555 ? 
52  AC6 16 K   G .   ? K   A 406 . ? 1_555 ? 
53  AC6 16 K   G .   ? K   A 406 . ? 2_545 ? 
54  AC6 16 K   G .   ? K   A 406 . ? 3_445 ? 
55  AC6 16 K   G .   ? K   A 406 . ? 4_545 ? 
56  AC6 16 BA  N .   ? BA  A 413 . ? 4_545 ? 
57  AC6 16 BA  N .   ? BA  A 413 . ? 3_445 ? 
58  AC6 16 BA  N .   ? BA  A 413 . ? 2_545 ? 
59  AC6 16 BA  N .   ? BA  A 413 . ? 1_555 ? 
60  AC7 4  K   K .   ? K   A 410 . ? 1_555 ? 
61  AC7 4  K   K .   ? K   A 410 . ? 2_545 ? 
62  AC7 4  K   K .   ? K   A 410 . ? 3_445 ? 
63  AC7 4  K   K .   ? K   A 410 . ? 4_545 ? 
64  AC8 8  TMO B .   ? TMO A 401 . ? 3_445 ? 
65  AC8 8  TMO B .   ? TMO A 401 . ? 1_555 ? 
66  AC8 8  TMO B .   ? TMO A 401 . ? 2_545 ? 
67  AC8 8  TMO B .   ? TMO A 401 . ? 4_545 ? 
68  AC8 8  K   J .   ? K   A 409 . ? 2_545 ? 
69  AC8 8  K   J .   ? K   A 409 . ? 3_445 ? 
70  AC8 8  K   J .   ? K   A 409 . ? 4_545 ? 
71  AC8 8  K   J .   ? K   A 409 . ? 1_555 ? 
72  AC9 3  K   M .   ? K   A 412 . ? 1_555 ? 
73  AC9 3  K   M .   ? K   A 412 . ? 3_445 ? 
74  AC9 3  HOH S .   ? HOH A 634 . ? 1_555 ? 
75  AD1 5  ALA A 95  ? ALA A 95  . ? 1_555 ? 
76  AD1 5  THR A 96  ? THR A 96  . ? 1_555 ? 
77  AD1 5  K   L .   ? K   A 411 . ? 1_555 ? 
78  AD1 5  K   L .   ? K   A 411 . ? 4_545 ? 
79  AD1 5  HOH S .   ? HOH A 634 . ? 1_555 ? 
80  AD2 8  THR A 96  ? THR A 96  . ? 3_445 ? 
81  AD2 8  THR A 96  ? THR A 96  . ? 1_555 ? 
82  AD2 8  THR A 96  ? THR A 96  . ? 2_545 ? 
83  AD2 8  THR A 96  ? THR A 96  . ? 4_545 ? 
84  AD2 8  K   H .   ? K   A 407 . ? 2_545 ? 
85  AD2 8  K   H .   ? K   A 407 . ? 3_445 ? 
86  AD2 8  K   H .   ? K   A 407 . ? 4_545 ? 
87  AD2 8  K   H .   ? K   A 407 . ? 1_555 ? 
88  AD3 4  ARG A 194 ? ARG A 194 . ? 4_545 ? 
89  AD3 4  THR A 201 ? THR A 201 . ? 1_555 ? 
90  AD3 4  ARG A 202 ? ARG A 202 . ? 1_555 ? 
91  AD3 4  PCW Q .   ? PCW A 416 . ? 1_555 ? 
92  AD4 4  THR A 60  ? THR A 60  . ? 3_445 ? 
93  AD4 4  MET A 121 ? MET A 121 . ? 1_555 ? 
94  AD4 4  GLY A 123 ? GLY A 123 . ? 3_445 ? 
95  AD4 4  ALA A 127 ? ALA A 127 . ? 3_445 ? 
96  AD5 8  PHE A 192 ? PHE A 192 . ? 4_545 ? 
97  AD5 8  ARG A 193 ? ARG A 193 . ? 4_545 ? 
98  AD5 8  ARG A 194 ? ARG A 194 . ? 4_545 ? 
99  AD5 8  THR A 213 ? THR A 213 . ? 1_555 ? 
100 AD5 8  MET A 215 ? MET A 215 . ? 1_555 ? 
101 AD5 8  CL  O .   ? CL  A 414 . ? 1_555 ? 
102 AD5 8  Z3P R .   ? Z3P A 417 . ? 1_555 ? 
103 AD5 8  HOH S .   ? HOH A 620 . ? 1_555 ? 
104 AD6 14 ARG A 193 ? ARG A 193 . ? 4_545 ? 
105 AD6 14 PHE A 208 ? PHE A 208 . ? 1_555 ? 
106 AD6 14 SER A 209 ? SER A 209 . ? 1_555 ? 
107 AD6 14 LEU A 210 ? LEU A 210 . ? 1_555 ? 
108 AD6 14 SER A 211 ? SER A 211 . ? 1_555 ? 
109 AD6 14 TRP A 212 ? TRP A 212 . ? 1_555 ? 
110 AD6 14 THR A 213 ? THR A 213 . ? 1_555 ? 
111 AD6 14 PHE A 275 ? PHE A 275 . ? 1_555 ? 
112 AD6 14 ARG A 283 ? ARG A 283 . ? 1_555 ? 
113 AD6 14 PCW Q .   ? PCW A 416 . ? 1_555 ? 
114 AD6 14 HOH S .   ? HOH A 517 . ? 1_555 ? 
115 AD6 14 HOH S .   ? HOH A 524 . ? 1_555 ? 
116 AD6 14 HOH S .   ? HOH A 543 . ? 4_545 ? 
117 AD6 14 HOH S .   ? HOH A 547 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6O9U 
_atom_sites.fract_transf_matrix[1][1]   0.009438 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009438 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011156 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BA 
C  
CL 
H  
K  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . PRO A 1 12  ? -4.810  -16.311 5.246   1.00 67.44  ?  12  PRO A N    1 
ATOM   2    C  CA   . PRO A 1 12  ? -5.148  -17.149 6.397   1.00 68.11  ?  12  PRO A CA   1 
ATOM   3    C  C    . PRO A 1 12  ? -5.017  -18.635 6.083   1.00 67.03  ?  12  PRO A C    1 
ATOM   4    O  O    . PRO A 1 12  ? -5.782  -19.164 5.276   1.00 58.27  ?  12  PRO A O    1 
ATOM   5    C  CB   . PRO A 1 12  ? -6.610  -16.778 6.684   1.00 63.34  ?  12  PRO A CB   1 
ATOM   6    C  CG   . PRO A 1 12  ? -7.092  -15.987 5.463   1.00 64.99  ?  12  PRO A CG   1 
ATOM   7    C  CD   . PRO A 1 12  ? -6.001  -16.032 4.434   1.00 71.67  ?  12  PRO A CD   1 
ATOM   8    H  HA   . PRO A 1 12  ? -4.596  -16.924 7.162   1.00 81.82  ?  12  PRO A HA   1 
ATOM   9    H  HB2  . PRO A 1 12  ? -7.135  -17.587 6.794   1.00 76.09  ?  12  PRO A HB2  1 
ATOM   10   H  HB3  . PRO A 1 12  ? -6.655  -16.232 7.484   1.00 76.09  ?  12  PRO A HB3  1 
ATOM   11   H  HG2  . PRO A 1 12  ? -7.900  -16.396 5.115   1.00 78.07  ?  12  PRO A HG2  1 
ATOM   12   H  HG3  . PRO A 1 12  ? -7.267  -15.070 5.726   1.00 78.07  ?  12  PRO A HG3  1 
ATOM   13   H  HD2  . PRO A 1 12  ? -6.158  -16.751 3.802   1.00 86.09  ?  12  PRO A HD2  1 
ATOM   14   H  HD3  . PRO A 1 12  ? -5.917  -15.175 3.988   1.00 86.09  ?  12  PRO A HD3  1 
ATOM   15   N  N    . ARG A 1 13  ? -4.058  -19.300 6.716   1.00 57.61  ?  13  ARG A N    1 
ATOM   16   C  CA   . ARG A 1 13  ? -3.825  -20.710 6.449   1.00 52.82  ?  13  ARG A CA   1 
ATOM   17   C  C    . ARG A 1 13  ? -4.829  -21.571 7.203   1.00 44.93  ?  13  ARG A C    1 
ATOM   18   O  O    . ARG A 1 13  ? -5.228  -21.253 8.327   1.00 43.55  ?  13  ARG A O    1 
ATOM   19   C  CB   . ARG A 1 13  ? -2.397  -21.099 6.835   1.00 45.58  ?  13  ARG A CB   1 
ATOM   20   C  CG   . ARG A 1 13  ? -2.045  -20.894 8.298   1.00 50.00  ?  13  ARG A CG   1 
ATOM   21   C  CD   . ARG A 1 13  ? -0.537  -20.940 8.496   1.00 52.32  ?  13  ARG A CD   1 
ATOM   22   N  NE   . ARG A 1 13  ? 0.054   -22.142 7.914   1.00 49.88  ?  13  ARG A NE   1 
ATOM   23   C  CZ   . ARG A 1 13  ? 1.360   -22.334 7.748   1.00 44.86  ?  13  ARG A CZ   1 
ATOM   24   N  NH1  . ARG A 1 13  ? 2.230   -21.402 8.112   1.00 45.61  ?  13  ARG A NH1  1 
ATOM   25   N  NH2  . ARG A 1 13  ? 1.797   -23.463 7.211   1.00 43.85  ?  13  ARG A NH2  1 
ATOM   26   H  H    . ARG A 1 13  ? -3.530  -18.958 7.302   1.00 69.22  ?  13  ARG A H    1 
ATOM   27   H  HA   . ARG A 1 13  ? -3.937  -20.876 5.500   1.00 63.46  ?  13  ARG A HA   1 
ATOM   28   H  HB2  . ARG A 1 13  ? -2.269  -22.040 6.633   1.00 54.78  ?  13  ARG A HB2  1 
ATOM   29   H  HB3  . ARG A 1 13  ? -1.780  -20.567 6.308   1.00 54.78  ?  13  ARG A HB3  1 
ATOM   30   H  HG2  . ARG A 1 13  ? -2.367  -20.026 8.589   1.00 60.08  ?  13  ARG A HG2  1 
ATOM   31   H  HG3  . ARG A 1 13  ? -2.446  -21.599 8.829   1.00 60.08  ?  13  ARG A HG3  1 
ATOM   32   H  HD2  . ARG A 1 13  ? -0.136  -20.168 8.067   1.00 62.87  ?  13  ARG A HD2  1 
ATOM   33   H  HD3  . ARG A 1 13  ? -0.340  -20.935 9.445   1.00 62.87  ?  13  ARG A HD3  1 
ATOM   34   H  HE   . ARG A 1 13  ? -0.478  -22.769 7.662   1.00 59.93  ?  13  ARG A HE   1 
ATOM   35   H  HH11 . ARG A 1 13  ? 1.951   -20.667 8.462   1.00 54.81  ?  13  ARG A HH11 1 
ATOM   36   H  HH12 . ARG A 1 13  ? 3.072   -21.533 8.001   1.00 54.81  ?  13  ARG A HH12 1 
ATOM   37   H  HH21 . ARG A 1 13  ? 1.238   -24.070 6.971   1.00 52.70  ?  13  ARG A HH21 1 
ATOM   38   H  HH22 . ARG A 1 13  ? 2.641   -23.588 7.101   1.00 52.70  ?  13  ARG A HH22 1 
ATOM   39   N  N    . ILE A 1 14  ? -5.252  -22.658 6.564   1.00 40.02  ?  14  ILE A N    1 
ATOM   40   C  CA   . ILE A 1 14  ? -6.138  -23.614 7.217   1.00 42.40  ?  14  ILE A CA   1 
ATOM   41   C  C    . ILE A 1 14  ? -5.337  -24.545 8.116   1.00 44.35  ?  14  ILE A C    1 
ATOM   42   O  O    . ILE A 1 14  ? -5.602  -24.659 9.319   1.00 50.63  ?  14  ILE A O    1 
ATOM   43   C  CB   . ILE A 1 14  ? -6.946  -24.398 6.165   1.00 47.55  ?  14  ILE A CB   1 
ATOM   44   C  CG1  . ILE A 1 14  ? -7.779  -23.431 5.316   1.00 46.96  ?  14  ILE A CG1  1 
ATOM   45   C  CG2  . ILE A 1 14  ? -7.852  -25.428 6.839   1.00 45.74  ?  14  ILE A CG2  1 
ATOM   46   C  CD1  . ILE A 1 14  ? -8.440  -24.072 4.113   1.00 45.59  ?  14  ILE A CD1  1 
ATOM   47   H  H    . ILE A 1 14  ? -5.040  -22.864 5.756   1.00 48.10  ?  14  ILE A H    1 
ATOM   48   H  HA   . ILE A 1 14  ? -6.767  -23.129 7.774   1.00 50.96  ?  14  ILE A HA   1 
ATOM   49   H  HB   . ILE A 1 14  ? -6.326  -24.865 5.584   1.00 57.15  ?  14  ILE A HB   1 
ATOM   50   H  HG12 . ILE A 1 14  ? -8.479  -23.054 5.871   1.00 56.43  ?  14  ILE A HG12 1 
ATOM   51   H  HG13 . ILE A 1 14  ? -7.200  -22.724 4.992   1.00 56.43  ?  14  ILE A HG13 1 
ATOM   52   H  HG21 . ILE A 1 14  ? -8.348  -25.907 6.157   1.00 54.97  ?  14  ILE A HG21 1 
ATOM   53   H  HG22 . ILE A 1 14  ? -7.304  -26.048 7.345   1.00 54.97  ?  14  ILE A HG22 1 
ATOM   54   H  HG23 . ILE A 1 14  ? -8.466  -24.968 7.433   1.00 54.97  ?  14  ILE A HG23 1 
ATOM   55   H  HD11 . ILE A 1 14  ? -8.944  -23.396 3.633   1.00 54.79  ?  14  ILE A HD11 1 
ATOM   56   H  HD12 . ILE A 1 14  ? -7.754  -24.444 3.537   1.00 54.79  ?  14  ILE A HD12 1 
ATOM   57   H  HD13 . ILE A 1 14  ? -9.035  -24.775 4.417   1.00 54.79  ?  14  ILE A HD13 1 
ATOM   58   N  N    . LEU A 1 15  ? -4.340  -25.216 7.546   1.00 39.94  ?  15  LEU A N    1 
ATOM   59   C  CA   . LEU A 1 15  ? -3.426  -26.033 8.329   1.00 38.27  ?  15  LEU A CA   1 
ATOM   60   C  C    . LEU A 1 15  ? -2.313  -25.166 8.899   1.00 33.18  ?  15  LEU A C    1 
ATOM   61   O  O    . LEU A 1 15  ? -1.670  -24.404 8.169   1.00 39.40  ?  15  LEU A O    1 
ATOM   62   C  CB   . LEU A 1 15  ? -2.831  -27.146 7.467   1.00 36.48  ?  15  LEU A CB   1 
ATOM   63   C  CG   . LEU A 1 15  ? -3.809  -28.227 7.011   1.00 33.56  ?  15  LEU A CG   1 
ATOM   64   C  CD1  . LEU A 1 15  ? -3.171  -29.104 5.949   1.00 35.97  ?  15  LEU A CD1  1 
ATOM   65   C  CD2  . LEU A 1 15  ? -4.267  -29.070 8.193   1.00 35.15  ?  15  LEU A CD2  1 
ATOM   66   H  H    . LEU A 1 15  ? -4.173  -25.213 6.703   1.00 48.01  ?  15  LEU A H    1 
ATOM   67   H  HA   . LEU A 1 15  ? -3.907  -26.440 9.067   1.00 46.01  ?  15  LEU A HA   1 
ATOM   68   H  HB2  . LEU A 1 15  ? -2.451  -26.745 6.670   1.00 43.86  ?  15  LEU A HB2  1 
ATOM   69   H  HB3  . LEU A 1 15  ? -2.130  -27.584 7.974   1.00 43.86  ?  15  LEU A HB3  1 
ATOM   70   H  HG   . LEU A 1 15  ? -4.591  -27.805 6.622   1.00 40.36  ?  15  LEU A HG   1 
ATOM   71   H  HD11 . LEU A 1 15  ? -3.808  -29.782 5.675   1.00 43.25  ?  15  LEU A HD11 1 
ATOM   72   H  HD12 . LEU A 1 15  ? -2.927  -28.553 5.190   1.00 43.25  ?  15  LEU A HD12 1 
ATOM   73   H  HD13 . LEU A 1 15  ? -2.380  -29.524 6.321   1.00 43.25  ?  15  LEU A HD13 1 
ATOM   74   H  HD21 . LEU A 1 15  ? -4.885  -29.747 7.877   1.00 42.26  ?  15  LEU A HD21 1 
ATOM   75   H  HD22 . LEU A 1 15  ? -3.493  -29.491 8.599   1.00 42.26  ?  15  LEU A HD22 1 
ATOM   76   H  HD23 . LEU A 1 15  ? -4.707  -28.495 8.839   1.00 42.26  ?  15  LEU A HD23 1 
ATOM   77   N  N    . ASN A 1 16  ? -2.091  -25.279 10.204  1.00 35.55  ?  16  ASN A N    1 
ATOM   78   C  CA   . ASN A 1 16  ? -0.952  -24.633 10.832  1.00 38.48  ?  16  ASN A CA   1 
ATOM   79   C  C    . ASN A 1 16  ? 0.314   -25.451 10.586  1.00 34.12  ?  16  ASN A C    1 
ATOM   80   O  O    . ASN A 1 16  ? 0.270   -26.589 10.115  1.00 34.41  ?  16  ASN A O    1 
ATOM   81   C  CB   . ASN A 1 16  ? -1.194  -24.461 12.330  1.00 39.13  ?  16  ASN A CB   1 
ATOM   82   C  CG   . ASN A 1 16  ? -2.369  -23.552 12.626  1.00 43.96  ?  16  ASN A CG   1 
ATOM   83   O  OD1  . ASN A 1 16  ? -2.397  -22.396 12.203  1.00 44.51  ?  16  ASN A OD1  1 
ATOM   84   N  ND2  . ASN A 1 16  ? -3.356  -24.077 13.343  1.00 42.65  ?  16  ASN A ND2  1 
ATOM   85   H  H    . ASN A 1 16  ? -2.587  -25.725 10.746  1.00 42.74  ?  16  ASN A H    1 
ATOM   86   H  HA   . ASN A 1 16  ? -0.826  -23.754 10.442  1.00 46.26  ?  16  ASN A HA   1 
ATOM   87   H  HB2  . ASN A 1 16  ? -1.378  -25.329 12.723  1.00 47.04  ?  16  ASN A HB2  1 
ATOM   88   H  HB3  . ASN A 1 16  ? -0.404  -24.073 12.736  1.00 47.04  ?  16  ASN A HB3  1 
ATOM   89   H  HD21 . ASN A 1 16  ? -4.046  -23.602 13.537  1.00 51.26  ?  16  ASN A HD21 1 
ATOM   90   H  HD22 . ASN A 1 16  ? -3.302  -24.890 13.619  1.00 51.26  ?  16  ASN A HD22 1 
ATOM   91   N  N    . SER A 1 17  ? 1.459   -24.853 10.920  1.00 35.41  ?  17  SER A N    1 
ATOM   92   C  CA   . SER A 1 17  ? 2.737   -25.512 10.677  1.00 37.27  ?  17  SER A CA   1 
ATOM   93   C  C    . SER A 1 17  ? 2.817   -26.870 11.366  1.00 33.73  ?  17  SER A C    1 
ATOM   94   O  O    . SER A 1 17  ? 3.453   -27.792 10.844  1.00 31.11  ?  17  SER A O    1 
ATOM   95   C  CB   . SER A 1 17  ? 3.883   -24.616 11.145  1.00 33.21  ?  17  SER A CB   1 
ATOM   96   O  OG   . SER A 1 17  ? 3.961   -23.444 10.353  1.00 49.80  ?  17  SER A OG   1 
ATOM   97   H  H    . SER A 1 17  ? 1.520   -24.075 11.282  1.00 42.58  ?  17  SER A H    1 
ATOM   98   H  HA   . SER A 1 17  ? 2.841   -25.655 9.724   1.00 44.80  ?  17  SER A HA   1 
ATOM   99   H  HB2  . SER A 1 17  ? 3.729   -24.363 12.069  1.00 39.93  ?  17  SER A HB2  1 
ATOM   100  H  HB3  . SER A 1 17  ? 4.717   -25.104 11.069  1.00 39.93  ?  17  SER A HB3  1 
ATOM   101  H  HG   . SER A 1 17  ? 4.094   -23.649 9.549   1.00 59.85  ?  17  SER A HG   1 
ATOM   102  N  N    . ASP A 1 18  ? 2.187   -27.016 12.528  1.00 33.69  ?  18  ASP A N    1 
ATOM   103  C  CA   . ASP A 1 18  ? 2.255   -28.269 13.270  1.00 37.80  ?  18  ASP A CA   1 
ATOM   104  C  C    . ASP A 1 18  ? 1.263   -29.309 12.771  1.00 30.85  ?  18  ASP A C    1 
ATOM   105  O  O    . ASP A 1 18  ? 1.170   -30.388 13.366  1.00 35.09  ?  18  ASP A O    1 
ATOM   106  C  CB   . ASP A 1 18  ? 2.022   -28.010 14.761  1.00 37.89  ?  18  ASP A CB   1 
ATOM   107  C  CG   . ASP A 1 18  ? 0.658   -27.419 15.045  1.00 48.70  ?  18  ASP A CG   1 
ATOM   108  O  OD1  . ASP A 1 18  ? -0.059  -27.071 14.082  1.00 44.38  ?  18  ASP A OD1  1 
ATOM   109  O  OD2  . ASP A 1 18  ? 0.301   -27.305 16.236  1.00 50.19  ?  18  ASP A OD2  1 
ATOM   110  H  H    . ASP A 1 18  ? 1.714   -26.406 12.908  1.00 40.50  ?  18  ASP A H    1 
ATOM   111  H  HA   . ASP A 1 18  ? 3.146   -28.640 13.171  1.00 45.44  ?  18  ASP A HA   1 
ATOM   112  H  HB2  . ASP A 1 18  ? 2.092   -28.850 15.242  1.00 45.55  ?  18  ASP A HB2  1 
ATOM   113  H  HB3  . ASP A 1 18  ? 2.692   -27.387 15.082  1.00 45.55  ?  18  ASP A HB3  1 
ATOM   114  N  N    . GLY A 1 19  ? 0.528   -29.020 11.702  1.00 31.65  ?  19  GLY A N    1 
ATOM   115  C  CA   . GLY A 1 19  ? -0.399  -29.970 11.133  1.00 36.12  ?  19  GLY A CA   1 
ATOM   116  C  C    . GLY A 1 19  ? -1.813  -29.881 11.663  1.00 41.18  ?  19  GLY A C    1 
ATOM   117  O  O    . GLY A 1 19  ? -2.681  -30.620 11.183  1.00 39.36  ?  19  GLY A O    1 
ATOM   118  H  H    . GLY A 1 19  ? 0.553   -28.267 11.287  1.00 38.06  ?  19  GLY A H    1 
ATOM   119  H  HA2  . GLY A 1 19  ? -0.432  -29.840 10.172  1.00 43.43  ?  19  GLY A HA2  1 
ATOM   120  H  HA3  . GLY A 1 19  ? -0.073  -30.867 11.303  1.00 43.43  ?  19  GLY A HA3  1 
ATOM   121  N  N    . SER A 1 20  ? -2.072  -29.015 12.638  1.00 43.25  ?  20  SER A N    1 
ATOM   122  C  CA   . SER A 1 20  ? -3.428  -28.796 13.112  1.00 48.10  ?  20  SER A CA   1 
ATOM   123  C  C    . SER A 1 20  ? -4.143  -27.799 12.204  1.00 43.71  ?  20  SER A C    1 
ATOM   124  O  O    . SER A 1 20  ? -3.518  -27.014 11.486  1.00 43.94  ?  20  SER A O    1 
ATOM   125  C  CB   . SER A 1 20  ? -3.420  -28.286 14.552  1.00 35.18  ?  20  SER A CB   1 
ATOM   126  O  OG   . SER A 1 20  ? -2.908  -26.966 14.620  1.00 48.67  ?  20  SER A OG   1 
ATOM   127  H  H    . SER A 1 20  ? -1.477  -28.542 13.041  1.00 51.98  ?  20  SER A H    1 
ATOM   128  H  HA   . SER A 1 20  ? -3.915  -29.635 13.088  1.00 57.80  ?  20  SER A HA   1 
ATOM   129  H  HB2  . SER A 1 20  ? -4.328  -28.290 14.893  1.00 42.30  ?  20  SER A HB2  1 
ATOM   130  H  HB3  . SER A 1 20  ? -2.861  -28.868 15.090  1.00 42.30  ?  20  SER A HB3  1 
ATOM   131  H  HG   . SER A 1 20  ? -2.121  -26.947 14.327  1.00 58.49  ?  20  SER A HG   1 
ATOM   132  N  N    . SER A 1 21  ? -5.472  -27.838 12.243  1.00 49.92  ?  21  SER A N    1 
ATOM   133  C  CA   . SER A 1 21  ? -6.296  -27.013 11.372  1.00 46.76  ?  21  SER A CA   1 
ATOM   134  C  C    . SER A 1 21  ? -6.951  -25.889 12.163  1.00 39.18  ?  21  SER A C    1 
ATOM   135  O  O    . SER A 1 21  ? -7.264  -26.038 13.347  1.00 49.62  ?  21  SER A O    1 
ATOM   136  C  CB   . SER A 1 21  ? -7.372  -27.851 10.676  1.00 48.97  ?  21  SER A CB   1 
ATOM   137  O  OG   . SER A 1 21  ? -8.312  -28.352 11.606  1.00 54.25  ?  21  SER A OG   1 
ATOM   138  H  H    . SER A 1 21  ? -5.925  -28.341 12.774  1.00 59.99  ?  21  SER A H    1 
ATOM   139  H  HA   . SER A 1 21  ? -5.734  -26.614 10.689  1.00 56.19  ?  21  SER A HA   1 
ATOM   140  H  HB2  . SER A 1 21  ? -7.835  -27.294 10.030  1.00 58.85  ?  21  SER A HB2  1 
ATOM   141  H  HB3  . SER A 1 21  ? -6.947  -28.597 10.225  1.00 58.85  ?  21  SER A HB3  1 
ATOM   142  H  HG   . SER A 1 21  ? -8.894  -28.809 11.208  1.00 65.19  ?  21  SER A HG   1 
ATOM   143  N  N    . ASN A 1 22  ? -7.152  -24.759 11.489  1.00 43.41  ?  22  ASN A N    1 
ATOM   144  C  CA   . ASN A 1 22  ? -7.823  -23.602 12.065  1.00 48.65  ?  22  ASN A CA   1 
ATOM   145  C  C    . ASN A 1 22  ? -9.324  -23.604 11.803  1.00 41.94  ?  22  ASN A C    1 
ATOM   146  O  O    . ASN A 1 22  ? -9.975  -22.573 12.000  1.00 56.79  ?  22  ASN A O    1 
ATOM   147  C  CB   . ASN A 1 22  ? -7.212  -22.311 11.513  1.00 43.51  ?  22  ASN A CB   1 
ATOM   148  C  CG   . ASN A 1 22  ? -5.808  -22.071 12.016  1.00 40.49  ?  22  ASN A CG   1 
ATOM   149  O  OD1  . ASN A 1 22  ? -5.525  -22.248 13.200  1.00 44.74  ?  22  ASN A OD1  1 
ATOM   150  N  ND2  . ASN A 1 22  ? -4.916  -21.668 11.117  1.00 43.86  ?  22  ASN A ND2  1 
ATOM   151  H  H    . ASN A 1 22  ? -6.900  -24.638 10.676  1.00 52.17  ?  22  ASN A H    1 
ATOM   152  H  HA   . ASN A 1 22  ? -7.689  -23.608 13.026  1.00 58.46  ?  22  ASN A HA   1 
ATOM   153  H  HB2  . ASN A 1 22  ? -7.178  -22.366 10.545  1.00 52.30  ?  22  ASN A HB2  1 
ATOM   154  H  HB3  . ASN A 1 22  ? -7.761  -21.559 11.784  1.00 52.30  ?  22  ASN A HB3  1 
ATOM   155  H  HD21 . ASN A 1 22  ? -4.103  -21.519 11.355  1.00 52.72  ?  22  ASN A HD21 1 
ATOM   156  H  HD22 . ASN A 1 22  ? -5.152  -21.556 10.298  1.00 52.72  ?  22  ASN A HD22 1 
ATOM   157  N  N    . ILE A 1 23  ? -9.886  -24.729 11.365  1.00 44.36  ?  23  ILE A N    1 
ATOM   158  C  CA   . ILE A 1 23  ? -11.306 -24.780 11.044  1.00 46.04  ?  23  ILE A CA   1 
ATOM   159  C  C    . ILE A 1 23  ? -12.112 -24.700 12.332  1.00 44.45  ?  23  ILE A C    1 
ATOM   160  O  O    . ILE A 1 23  ? -11.855 -25.437 13.293  1.00 43.02  ?  23  ILE A O    1 
ATOM   161  C  CB   . ILE A 1 23  ? -11.630 -26.053 10.247  1.00 42.45  ?  23  ILE A CB   1 
ATOM   162  C  CG1  . ILE A 1 23  ? -10.867 -26.039 8.916   1.00 41.60  ?  23  ILE A CG1  1 
ATOM   163  C  CG2  . ILE A 1 23  ? -13.133 -26.165 9.990   1.00 39.28  ?  23  ILE A CG2  1 
ATOM   164  C  CD1  . ILE A 1 23  ? -10.950 -27.327 8.123   1.00 51.14  ?  23  ILE A CD1  1 
ATOM   165  H  H    . ILE A 1 23  ? -9.468  -25.471 11.246  1.00 53.31  ?  23  ILE A H    1 
ATOM   166  H  HA   . ILE A 1 23  ? -11.537 -24.014 10.495  1.00 55.33  ?  23  ILE A HA   1 
ATOM   167  H  HB   . ILE A 1 23  ? -11.344 -26.824 10.761  1.00 51.03  ?  23  ILE A HB   1 
ATOM   168  H  HG12 . ILE A 1 23  ? -11.227 -25.329 8.361   1.00 50.00  ?  23  ILE A HG12 1 
ATOM   169  H  HG13 . ILE A 1 23  ? -9.930  -25.867 9.099   1.00 50.00  ?  23  ILE A HG13 1 
ATOM   170  H  HG21 . ILE A 1 23  ? -13.308 -26.976 9.487   1.00 47.21  ?  23  ILE A HG21 1 
ATOM   171  H  HG22 . ILE A 1 23  ? -13.597 -26.198 10.842  1.00 47.21  ?  23  ILE A HG22 1 
ATOM   172  H  HG23 . ILE A 1 23  ? -13.425 -25.391 9.484   1.00 47.21  ?  23  ILE A HG23 1 
ATOM   173  H  HD11 . ILE A 1 23  ? -10.441 -27.225 7.303   1.00 61.45  ?  23  ILE A HD11 1 
ATOM   174  H  HD12 . ILE A 1 23  ? -10.580 -28.049 8.655   1.00 61.45  ?  23  ILE A HD12 1 
ATOM   175  H  HD13 . ILE A 1 23  ? -11.880 -27.510 7.915   1.00 61.45  ?  23  ILE A HD13 1 
ATOM   176  N  N    . THR A 1 24  ? -13.084 -23.791 12.363  1.00 39.22  ?  24  THR A N    1 
ATOM   177  C  CA   . THR A 1 24  ? -13.935 -23.617 13.535  1.00 48.62  ?  24  THR A CA   1 
ATOM   178  C  C    . THR A 1 24  ? -14.990 -24.716 13.557  1.00 43.40  ?  24  THR A C    1 
ATOM   179  O  O    . THR A 1 24  ? -15.756 -24.870 12.601  1.00 37.22  ?  24  THR A O    1 
ATOM   180  C  CB   . THR A 1 24  ? -14.595 -22.239 13.520  1.00 50.67  ?  24  THR A CB   1 
ATOM   181  O  OG1  . THR A 1 24  ? -13.585 -21.225 13.462  1.00 55.15  ?  24  THR A OG1  1 
ATOM   182  C  CG2  . THR A 1 24  ? -15.445 -22.031 14.769  1.00 47.73  ?  24  THR A CG2  1 
ATOM   183  H  H    . THR A 1 24  ? -13.272 -23.259 11.714  1.00 47.14  ?  24  THR A H    1 
ATOM   184  H  HA   . THR A 1 24  ? -13.397 -23.691 14.338  1.00 58.43  ?  24  THR A HA   1 
ATOM   185  H  HB   . THR A 1 24  ? -15.170 -22.166 12.742  1.00 60.88  ?  24  THR A HB   1 
ATOM   186  H  HG1  . THR A 1 24  ? -13.942 -20.464 13.453  1.00 66.26  ?  24  THR A HG1  1 
ATOM   187  H  HG21 . THR A 1 24  ? -15.857 -21.153 14.746  1.00 57.36  ?  24  THR A HG21 1 
ATOM   188  H  HG22 . THR A 1 24  ? -16.141 -22.705 14.813  1.00 57.36  ?  24  THR A HG22 1 
ATOM   189  H  HG23 . THR A 1 24  ? -14.890 -22.098 15.562  1.00 57.36  ?  24  THR A HG23 1 
ATOM   190  N  N    . ARG A 1 25  ? -15.030 -25.476 14.648  1.00 42.02  ?  25  ARG A N    1 
ATOM   191  C  CA   . ARG A 1 25  ? -15.980 -26.575 14.799  1.00 47.90  ?  25  ARG A CA   1 
ATOM   192  C  C    . ARG A 1 25  ? -17.214 -26.048 15.519  1.00 50.81  ?  25  ARG A C    1 
ATOM   193  O  O    . ARG A 1 25  ? -17.222 -25.905 16.744  1.00 52.63  ?  25  ARG A O    1 
ATOM   194  C  CB   . ARG A 1 25  ? -15.343 -27.734 15.555  1.00 44.27  ?  25  ARG A CB   1 
ATOM   195  C  CG   . ARG A 1 25  ? -14.160 -28.361 14.827  1.00 49.10  ?  25  ARG A CG   1 
ATOM   196  C  CD   . ARG A 1 25  ? -13.773 -29.718 15.403  1.00 52.71  ?  25  ARG A CD   1 
ATOM   197  N  NE   . ARG A 1 25  ? -14.894 -30.654 15.407  1.00 61.82  ?  25  ARG A NE   1 
ATOM   198  C  CZ   . ARG A 1 25  ? -14.777 -31.976 15.494  1.00 65.65  ?  25  ARG A CZ   1 
ATOM   199  N  NH1  . ARG A 1 25  ? -13.580 -32.544 15.575  1.00 48.95  ?  25  ARG A NH1  1 
ATOM   200  N  NH2  . ARG A 1 25  ? -15.866 -32.734 15.491  1.00 56.92  ?  25  ARG A NH2  1 
ATOM   201  H  H    . ARG A 1 25  ? -14.510 -25.373 15.325  1.00 50.51  ?  25  ARG A H    1 
ATOM   202  H  HA   . ARG A 1 25  ? -16.249 -26.892 13.922  1.00 57.56  ?  25  ARG A HA   1 
ATOM   203  H  HB2  . ARG A 1 25  ? -15.027 -27.412 16.413  1.00 53.21  ?  25  ARG A HB2  1 
ATOM   204  H  HB3  . ARG A 1 25  ? -16.010 -28.426 15.687  1.00 53.21  ?  25  ARG A HB3  1 
ATOM   205  H  HG2  . ARG A 1 25  ? -14.392 -28.486 13.894  1.00 59.01  ?  25  ARG A HG2  1 
ATOM   206  H  HG3  . ARG A 1 25  ? -13.393 -27.772 14.903  1.00 59.01  ?  25  ARG A HG3  1 
ATOM   207  H  HD2  . ARG A 1 25  ? -13.062 -30.100 14.866  1.00 63.33  ?  25  ARG A HD2  1 
ATOM   208  H  HD3  . ARG A 1 25  ? -13.474 -29.601 16.319  1.00 63.33  ?  25  ARG A HD3  1 
ATOM   209  H  HE   . ARG A 1 25  ? -15.688 -30.327 15.348  1.00 74.26  ?  25  ARG A HE   1 
ATOM   210  H  HH11 . ARG A 1 25  ? -12.871 -32.056 15.577  1.00 58.82  ?  25  ARG A HH11 1 
ATOM   211  H  HH12 . ARG A 1 25  ? -13.513 -33.400 15.629  1.00 58.82  ?  25  ARG A HH12 1 
ATOM   212  H  HH21 . ARG A 1 25  ? -16.643 -32.370 15.436  1.00 68.38  ?  25  ARG A HH21 1 
ATOM   213  H  HH22 . ARG A 1 25  ? -15.794 -33.589 15.544  1.00 68.38  ?  25  ARG A HH22 1 
ATOM   214  N  N    . LEU A 1 26  ? -18.267 -25.759 14.754  1.00 53.23  ?  26  LEU A N    1 
ATOM   215  C  CA   . LEU A 1 26  ? -19.499 -25.252 15.347  1.00 62.43  ?  26  LEU A CA   1 
ATOM   216  C  C    . LEU A 1 26  ? -20.136 -26.304 16.250  1.00 66.00  ?  26  LEU A C    1 
ATOM   217  O  O    . LEU A 1 26  ? -20.395 -26.054 17.432  1.00 69.60  ?  26  LEU A O    1 
ATOM   218  C  CB   . LEU A 1 26  ? -20.459 -24.810 14.240  1.00 44.40  ?  26  LEU A CB   1 
ATOM   219  C  CG   . LEU A 1 26  ? -19.854 -23.809 13.248  1.00 49.23  ?  26  LEU A CG   1 
ATOM   220  C  CD1  . LEU A 1 26  ? -20.849 -23.447 12.159  1.00 53.41  ?  26  LEU A CD1  1 
ATOM   221  C  CD2  . LEU A 1 26  ? -19.365 -22.551 13.955  1.00 52.55  ?  26  LEU A CD2  1 
ATOM   222  H  H    . LEU A 1 26  ? -18.292 -25.847 13.899  1.00 63.96  ?  26  LEU A H    1 
ATOM   223  H  HA   . LEU A 1 26  ? -19.292 -24.477 15.891  1.00 75.00  ?  26  LEU A HA   1 
ATOM   224  H  HB2  . LEU A 1 26  ? -20.737 -25.592 13.738  1.00 53.37  ?  26  LEU A HB2  1 
ATOM   225  H  HB3  . LEU A 1 26  ? -21.233 -24.390 14.648  1.00 53.37  ?  26  LEU A HB3  1 
ATOM   226  H  HG   . LEU A 1 26  ? -19.088 -24.222 12.820  1.00 59.16  ?  26  LEU A HG   1 
ATOM   227  H  HD11 . LEU A 1 26  ? -20.434 -22.814 11.551  1.00 64.17  ?  26  LEU A HD11 1 
ATOM   228  H  HD12 . LEU A 1 26  ? -21.098 -24.252 11.679  1.00 64.17  ?  26  LEU A HD12 1 
ATOM   229  H  HD13 . LEU A 1 26  ? -21.633 -23.049 12.567  1.00 64.17  ?  26  LEU A HD13 1 
ATOM   230  H  HD21 . LEU A 1 26  ? -18.991 -21.944 13.296  1.00 63.14  ?  26  LEU A HD21 1 
ATOM   231  H  HD22 . LEU A 1 26  ? -20.114 -22.130 14.404  1.00 63.14  ?  26  LEU A HD22 1 
ATOM   232  H  HD23 . LEU A 1 26  ? -18.686 -22.797 14.602  1.00 63.14  ?  26  LEU A HD23 1 
ATOM   233  N  N    . GLY A 1 27  ? -20.393 -27.496 15.706  1.00 70.21  ?  27  GLY A N    1 
ATOM   234  C  CA   . GLY A 1 27  ? -20.791 -28.637 16.505  1.00 81.07  ?  27  GLY A CA   1 
ATOM   235  C  C    . GLY A 1 27  ? -22.188 -29.124 16.141  1.00 82.25  ?  27  GLY A C    1 
ATOM   236  O  O    . GLY A 1 27  ? -22.602 -29.063 14.985  1.00 75.69  ?  27  GLY A O    1 
ATOM   237  H  H    . GLY A 1 27  ? -20.340 -27.663 14.864  1.00 84.34  ?  27  GLY A H    1 
ATOM   238  H  HA2  . GLY A 1 27  ? -20.165 -29.365 16.367  1.00 97.36  ?  27  GLY A HA2  1 
ATOM   239  H  HA3  . GLY A 1 27  ? -20.783 -28.396 17.444  1.00 97.36  ?  27  GLY A HA3  1 
ATOM   240  N  N    . LEU A 1 28  ? -22.889 -29.616 17.166  1.00 83.40  ?  28  LEU A N    1 
ATOM   241  C  CA   . LEU A 1 28  ? -24.225 -30.202 17.041  1.00 85.71  ?  28  LEU A CA   1 
ATOM   242  C  C    . LEU A 1 28  ? -24.115 -31.689 16.721  1.00 87.53  ?  28  LEU A C    1 
ATOM   243  O  O    . LEU A 1 28  ? -24.469 -32.536 17.541  1.00 92.47  ?  28  LEU A O    1 
ATOM   244  C  CB   . LEU A 1 28  ? -25.060 -29.501 15.966  1.00 82.78  ?  28  LEU A CB   1 
ATOM   245  C  CG   . LEU A 1 28  ? -26.567 -29.561 16.219  1.00 88.48  ?  28  LEU A CG   1 
ATOM   246  C  CD1  . LEU A 1 28  ? -26.984 -28.434 17.153  1.00 86.89  ?  28  LEU A CD1  1 
ATOM   247  C  CD2  . LEU A 1 28  ? -27.356 -29.513 14.920  1.00 80.65  ?  28  LEU A CD2  1 
ATOM   248  H  H    . LEU A 1 28  ? -22.598 -29.620 17.975  1.00 100.16 ?  28  LEU A H    1 
ATOM   249  H  HA   . LEU A 1 28  ? -24.690 -30.111 17.887  1.00 102.93 ?  28  LEU A HA   1 
ATOM   250  H  HB2  . LEU A 1 28  ? -24.802 -28.567 15.929  1.00 99.41  ?  28  LEU A HB2  1 
ATOM   251  H  HB3  . LEU A 1 28  ? -24.886 -29.924 15.110  1.00 99.41  ?  28  LEU A HB3  1 
ATOM   252  H  HG   . LEU A 1 28  ? -26.775 -30.400 16.659  1.00 106.26 ?  28  LEU A HG   1 
ATOM   253  H  HD11 . LEU A 1 28  ? -27.941 -28.486 17.303  1.00 104.35 ?  28  LEU A HD11 1 
ATOM   254  H  HD12 . LEU A 1 28  ? -26.511 -28.531 17.995  1.00 104.35 ?  28  LEU A HD12 1 
ATOM   255  H  HD13 . LEU A 1 28  ? -26.759 -27.584 16.743  1.00 104.35 ?  28  LEU A HD13 1 
ATOM   256  H  HD21 . LEU A 1 28  ? -28.303 -29.553 15.125  1.00 96.86  ?  28  LEU A HD21 1 
ATOM   257  H  HD22 . LEU A 1 28  ? -27.152 -28.686 14.457  1.00 96.86  ?  28  LEU A HD22 1 
ATOM   258  H  HD23 . LEU A 1 28  ? -27.104 -30.272 14.370  1.00 96.86  ?  28  LEU A HD23 1 
ATOM   259  N  N    . TRP A 1 33  ? -20.885 -35.067 30.442  1.00 68.39  ?  33  TRP A N    1 
ATOM   260  C  CA   . TRP A 1 33  ? -19.854 -35.217 31.462  1.00 72.02  ?  33  TRP A CA   1 
ATOM   261  C  C    . TRP A 1 33  ? -19.160 -36.570 31.336  1.00 74.13  ?  33  TRP A C    1 
ATOM   262  O  O    . TRP A 1 33  ? -17.941 -36.666 31.481  1.00 72.10  ?  33  TRP A O    1 
ATOM   263  C  CB   . TRP A 1 33  ? -20.458 -35.064 32.860  1.00 72.34  ?  33  TRP A CB   1 
ATOM   264  H  HA   . TRP A 1 33  ? -19.187 -34.523 31.344  1.00 86.51  ?  33  TRP A HA   1 
ATOM   265  N  N    . LEU A 1 34  ? -19.946 -37.613 31.066  1.00 74.63  ?  34  LEU A N    1 
ATOM   266  C  CA   . LEU A 1 34  ? -19.434 -38.970 30.911  1.00 68.42  ?  34  LEU A CA   1 
ATOM   267  C  C    . LEU A 1 34  ? -19.781 -39.542 29.539  1.00 67.90  ?  34  LEU A C    1 
ATOM   268  O  O    . LEU A 1 34  ? -19.905 -40.758 29.379  1.00 65.07  ?  34  LEU A O    1 
ATOM   269  C  CB   . LEU A 1 34  ? -19.970 -39.878 32.018  1.00 66.86  ?  34  LEU A CB   1 
ATOM   270  H  H    . LEU A 1 34  ? -20.799 -37.556 30.967  1.00 89.64  ?  34  LEU A H    1 
ATOM   271  H  HA   . LEU A 1 34  ? -18.467 -38.949 30.987  1.00 82.18  ?  34  LEU A HA   1 
ATOM   272  N  N    . ASP A 1 35  ? -19.939 -38.671 28.539  1.00 62.33  ?  35  ASP A N    1 
ATOM   273  C  CA   . ASP A 1 35  ? -20.254 -39.128 27.190  1.00 56.97  ?  35  ASP A CA   1 
ATOM   274  C  C    . ASP A 1 35  ? -19.066 -39.800 26.515  1.00 47.00  ?  35  ASP A C    1 
ATOM   275  O  O    . ASP A 1 35  ? -19.261 -40.581 25.578  1.00 51.59  ?  35  ASP A O    1 
ATOM   276  C  CB   . ASP A 1 35  ? -20.730 -37.952 26.335  1.00 52.93  ?  35  ASP A CB   1 
ATOM   277  H  H    . ASP A 1 35  ? -19.869 -37.817 28.617  1.00 74.88  ?  35  ASP A H    1 
ATOM   278  H  HA   . ASP A 1 35  ? -20.975 -39.774 27.237  1.00 68.45  ?  35  ASP A HA   1 
ATOM   279  N  N    . ASP A 1 36  ? -17.850 -39.515 26.967  1.00 40.50  ?  36  ASP A N    1 
ATOM   280  C  CA   . ASP A 1 36  ? -16.644 -40.052 26.347  1.00 35.81  ?  36  ASP A CA   1 
ATOM   281  C  C    . ASP A 1 36  ? -15.583 -40.228 27.433  1.00 34.62  ?  36  ASP A C    1 
ATOM   282  O  O    . ASP A 1 36  ? -14.451 -39.756 27.317  1.00 31.67  ?  36  ASP A O    1 
ATOM   283  C  CB   . ASP A 1 36  ? -16.168 -39.125 25.227  1.00 32.73  ?  36  ASP A CB   1 
ATOM   284  C  CG   . ASP A 1 36  ? -15.386 -39.850 24.147  1.00 32.32  ?  36  ASP A CG   1 
ATOM   285  O  OD1  . ASP A 1 36  ? -15.408 -41.098 24.114  1.00 33.74  ?  36  ASP A OD1  1 
ATOM   286  O  OD2  . ASP A 1 36  ? -14.749 -39.160 23.324  1.00 29.18  ?  36  ASP A OD2  1 
ATOM   287  H  H    . ASP A 1 36  ? -17.695 -39.006 27.643  1.00 48.68  ?  36  ASP A H    1 
ATOM   288  H  HA   . ASP A 1 36  ? -16.837 -40.921 25.964  1.00 43.06  ?  36  ASP A HA   1 
ATOM   289  H  HB2  . ASP A 1 36  ? -16.940 -38.712 24.811  1.00 39.36  ?  36  ASP A HB2  1 
ATOM   290  H  HB3  . ASP A 1 36  ? -15.591 -38.443 25.606  1.00 39.36  ?  36  ASP A HB3  1 
ATOM   291  N  N    . HIS A 1 37  ? -15.948 -40.931 28.510  1.00 34.62  ?  37  HIS A N    1 
ATOM   292  C  CA   . HIS A 1 37  ? -15.196 -40.818 29.757  1.00 38.18  ?  37  HIS A CA   1 
ATOM   293  C  C    . HIS A 1 37  ? -13.804 -41.426 29.642  1.00 28.77  ?  37  HIS A C    1 
ATOM   294  O  O    . HIS A 1 37  ? -12.831 -40.842 30.136  1.00 31.76  ?  37  HIS A O    1 
ATOM   295  C  CB   . HIS A 1 37  ? -15.976 -41.454 30.913  1.00 40.50  ?  37  HIS A CB   1 
ATOM   296  C  CG   . HIS A 1 37  ? -16.451 -42.849 30.646  1.00 47.77  ?  37  HIS A CG   1 
ATOM   297  N  ND1  . HIS A 1 37  ? -15.611 -43.941 30.667  1.00 55.16  ?  37  HIS A ND1  1 
ATOM   298  C  CD2  . HIS A 1 37  ? -17.687 -43.330 30.376  1.00 53.99  ?  37  HIS A CD2  1 
ATOM   299  C  CE1  . HIS A 1 37  ? -16.306 -45.034 30.407  1.00 52.96  ?  37  HIS A CE1  1 
ATOM   300  N  NE2  . HIS A 1 37  ? -17.569 -44.691 30.228  1.00 63.18  ?  37  HIS A NE2  1 
ATOM   301  H  H    . HIS A 1 37  ? -16.617 -41.471 28.543  1.00 41.63  ?  37  HIS A H    1 
ATOM   302  H  HA   . HIS A 1 37  ? -15.086 -39.877 29.964  1.00 45.90  ?  37  HIS A HA   1 
ATOM   303  H  HB2  . HIS A 1 37  ? -15.404 -41.483 31.696  1.00 48.68  ?  37  HIS A HB2  1 
ATOM   304  H  HB3  . HIS A 1 37  ? -16.756 -40.908 31.099  1.00 48.68  ?  37  HIS A HB3  1 
ATOM   305  H  HD2  . HIS A 1 37  ? -18.469 -42.833 30.298  1.00 64.87  ?  37  HIS A HD2  1 
ATOM   306  H  HE1  . HIS A 1 37  ? -15.965 -45.898 30.361  1.00 63.63  ?  37  HIS A HE1  1 
ATOM   307  H  HE2  . HIS A 1 37  ? -18.213 -45.232 30.047  1.00 75.90  ?  37  HIS A HE2  1 
ATOM   308  N  N    . TYR A 1 38  ? -13.675 -42.593 29.008  1.00 30.84  ?  38  TYR A N    1 
ATOM   309  C  CA   . TYR A 1 38  ? -12.354 -43.197 28.874  1.00 29.98  ?  38  TYR A CA   1 
ATOM   310  C  C    . TYR A 1 38  ? -11.425 -42.281 28.086  1.00 31.49  ?  38  TYR A C    1 
ATOM   311  O  O    . TYR A 1 38  ? -10.306 -41.985 28.522  1.00 29.38  ?  38  TYR A O    1 
ATOM   312  C  CB   . TYR A 1 38  ? -12.458 -44.571 28.209  1.00 32.96  ?  38  TYR A CB   1 
ATOM   313  C  CG   . TYR A 1 38  ? -11.122 -45.269 28.070  1.00 27.62  ?  38  TYR A CG   1 
ATOM   314  C  CD1  . TYR A 1 38  ? -10.412 -45.678 29.191  1.00 28.58  ?  38  TYR A CD1  1 
ATOM   315  C  CD2  . TYR A 1 38  ? -10.568 -45.512 26.819  1.00 29.32  ?  38  TYR A CD2  1 
ATOM   316  C  CE1  . TYR A 1 38  ? -9.191  -46.310 29.073  1.00 30.33  ?  38  TYR A CE1  1 
ATOM   317  C  CE2  . TYR A 1 38  ? -9.344  -46.146 26.690  1.00 29.01  ?  38  TYR A CE2  1 
ATOM   318  C  CZ   . TYR A 1 38  ? -8.662  -46.542 27.821  1.00 35.02  ?  38  TYR A CZ   1 
ATOM   319  O  OH   . TYR A 1 38  ? -7.445  -47.170 27.701  1.00 29.69  ?  38  TYR A OH   1 
ATOM   320  H  H    . TYR A 1 38  ? -14.319 -43.042 28.656  1.00 37.09  ?  38  TYR A H    1 
ATOM   321  H  HA   . TYR A 1 38  ? -11.973 -43.320 29.757  1.00 36.06  ?  38  TYR A HA   1 
ATOM   322  H  HB2  . TYR A 1 38  ? -13.035 -45.137 28.745  1.00 39.63  ?  38  TYR A HB2  1 
ATOM   323  H  HB3  . TYR A 1 38  ? -12.832 -44.464 27.321  1.00 39.63  ?  38  TYR A HB3  1 
ATOM   324  H  HD1  . TYR A 1 38  ? -10.766 -45.522 30.037  1.00 34.38  ?  38  TYR A HD1  1 
ATOM   325  H  HD2  . TYR A 1 38  ? -11.028 -45.244 26.056  1.00 35.27  ?  38  TYR A HD2  1 
ATOM   326  H  HE1  . TYR A 1 38  ? -8.728  -46.578 29.833  1.00 36.48  ?  38  TYR A HE1  1 
ATOM   327  H  HE2  . TYR A 1 38  ? -8.985  -46.303 25.847  1.00 34.90  ?  38  TYR A HE2  1 
ATOM   328  H  HH   . TYR A 1 38  ? -7.141  -47.355 28.462  1.00 35.71  ?  38  TYR A HH   1 
ATOM   329  N  N    . HIS A 1 39  ? -11.885 -41.810 26.924  1.00 32.48  ?  39  HIS A N    1 
ATOM   330  C  CA   . HIS A 1 39  ? -11.117 -40.848 26.139  1.00 28.32  ?  39  HIS A CA   1 
ATOM   331  C  C    . HIS A 1 39  ? -10.725 -39.636 26.974  1.00 31.81  ?  39  HIS A C    1 
ATOM   332  O  O    . HIS A 1 39  ? -9.575  -39.183 26.936  1.00 31.75  ?  39  HIS A O    1 
ATOM   333  C  CB   . HIS A 1 39  ? -11.933 -40.410 24.922  1.00 31.38  ?  39  HIS A CB   1 
ATOM   334  C  CG   . HIS A 1 39  ? -11.427 -39.159 24.274  1.00 33.21  ?  39  HIS A CG   1 
ATOM   335  N  ND1  . HIS A 1 39  ? -11.791 -37.900 24.700  1.00 35.87  ?  39  HIS A ND1  1 
ATOM   336  C  CD2  . HIS A 1 39  ? -10.587 -38.973 23.228  1.00 34.21  ?  39  HIS A CD2  1 
ATOM   337  C  CE1  . HIS A 1 39  ? -11.198 -36.993 23.945  1.00 31.92  ?  39  HIS A CE1  1 
ATOM   338  N  NE2  . HIS A 1 39  ? -10.462 -37.618 23.044  1.00 32.75  ?  39  HIS A NE2  1 
ATOM   339  H  H    . HIS A 1 39  ? -12.637 -42.033 26.571  1.00 39.05  ?  39  HIS A H    1 
ATOM   340  H  HA   . HIS A 1 39  ? -10.305 -41.272 25.822  1.00 34.06  ?  39  HIS A HA   1 
ATOM   341  H  HB2  . HIS A 1 39  ? -11.910 -41.118 24.259  1.00 37.74  ?  39  HIS A HB2  1 
ATOM   342  H  HB3  . HIS A 1 39  ? -12.849 -40.250 25.201  1.00 37.74  ?  39  HIS A HB3  1 
ATOM   343  H  HD1  . HIS A 1 39  ? -12.322 -37.731 25.355  1.00 43.13  ?  39  HIS A HD1  1 
ATOM   344  H  HD2  . HIS A 1 39  ? -10.174 -39.639 22.727  1.00 41.13  ?  39  HIS A HD2  1 
ATOM   345  H  HE1  . HIS A 1 39  ? -11.283 -36.071 24.034  1.00 38.39  ?  39  HIS A HE1  1 
ATOM   346  N  N    . ASP A 1 40  ? -11.676 -39.088 27.732  1.00 29.76  ?  40  ASP A N    1 
ATOM   347  C  CA   . ASP A 1 40  ? -11.411 -37.855 28.468  1.00 32.90  ?  40  ASP A CA   1 
ATOM   348  C  C    . ASP A 1 40  ? -10.420 -38.086 29.603  1.00 31.96  ?  40  ASP A C    1 
ATOM   349  O  O    . ASP A 1 40  ? -9.582  -37.222 29.884  1.00 29.33  ?  40  ASP A O    1 
ATOM   350  C  CB   . ASP A 1 40  ? -12.722 -37.275 28.999  1.00 38.30  ?  40  ASP A CB   1 
ATOM   351  C  CG   . ASP A 1 40  ? -13.636 -36.783 27.886  1.00 40.60  ?  40  ASP A CG   1 
ATOM   352  O  OD1  . ASP A 1 40  ? -13.184 -36.726 26.722  1.00 37.71  ?  40  ASP A OD1  1 
ATOM   353  O  OD2  . ASP A 1 40  ? -14.808 -36.457 28.174  1.00 39.36  ?  40  ASP A OD2  1 
ATOM   354  H  H    . ASP A 1 40  ? -12.468 -39.405 27.836  1.00 35.80  ?  40  ASP A H    1 
ATOM   355  H  HA   . ASP A 1 40  ? -11.022 -37.206 27.861  1.00 39.56  ?  40  ASP A HA   1 
ATOM   356  H  HB2  . ASP A 1 40  ? -13.195 -37.962 29.495  1.00 46.05  ?  40  ASP A HB2  1 
ATOM   357  H  HB3  . ASP A 1 40  ? -12.523 -36.524 29.580  1.00 46.05  ?  40  ASP A HB3  1 
ATOM   358  N  N    . LEU A 1 41  ? -10.496 -39.243 30.265  1.00 30.44  ?  41  LEU A N    1 
ATOM   359  C  CA   . LEU A 1 41  ? -9.527  -39.555 31.310  1.00 27.45  ?  41  LEU A CA   1 
ATOM   360  C  C    . LEU A 1 41  ? -8.107  -39.601 30.764  1.00 31.71  ?  41  LEU A C    1 
ATOM   361  O  O    . LEU A 1 41  ? -7.157  -39.277 31.485  1.00 31.57  ?  41  LEU A O    1 
ATOM   362  C  CB   . LEU A 1 41  ? -9.878  -40.887 31.972  1.00 33.46  ?  41  LEU A CB   1 
ATOM   363  C  CG   . LEU A 1 41  ? -11.140 -40.888 32.835  1.00 33.28  ?  41  LEU A CG   1 
ATOM   364  C  CD1  . LEU A 1 41  ? -11.556 -42.313 33.159  1.00 36.35  ?  41  LEU A CD1  1 
ATOM   365  C  CD2  . LEU A 1 41  ? -10.922 -40.092 34.114  1.00 36.36  ?  41  LEU A CD2  1 
ATOM   366  H  H    . LEU A 1 41  ? -11.088 -39.852 30.130  1.00 36.61  ?  41  LEU A H    1 
ATOM   367  H  HA   . LEU A 1 41  ? -9.564  -38.865 31.990  1.00 33.02  ?  41  LEU A HA   1 
ATOM   368  H  HB2  . LEU A 1 41  ? -10.002 -41.552 31.277  1.00 40.23  ?  41  LEU A HB2  1 
ATOM   369  H  HB3  . LEU A 1 41  ? -9.138  -41.150 32.541  1.00 40.23  ?  41  LEU A HB3  1 
ATOM   370  H  HG   . LEU A 1 41  ? -11.862 -40.469 32.341  1.00 40.02  ?  41  LEU A HG   1 
ATOM   371  H  HD11 . LEU A 1 41  ? -12.357 -42.291 33.706  1.00 43.71  ?  41  LEU A HD11 1 
ATOM   372  H  HD12 . LEU A 1 41  ? -11.734 -42.785 32.331  1.00 43.71  ?  41  LEU A HD12 1 
ATOM   373  H  HD13 . LEU A 1 41  ? -10.837 -42.749 33.642  1.00 43.71  ?  41  LEU A HD13 1 
ATOM   374  H  HD21 . LEU A 1 41  ? -11.738 -40.111 34.640  1.00 43.72  ?  41  LEU A HD21 1 
ATOM   375  H  HD22 . LEU A 1 41  ? -10.196 -40.495 34.616  1.00 43.72  ?  41  LEU A HD22 1 
ATOM   376  H  HD23 . LEU A 1 41  ? -10.698 -39.178 33.882  1.00 43.72  ?  41  LEU A HD23 1 
ATOM   377  N  N    . LEU A 1 42  ? -7.940  -39.994 29.500  1.00 30.57  ?  42  LEU A N    1 
ATOM   378  C  CA   . LEU A 1 42  ? -6.614  -40.079 28.901  1.00 30.72  ?  42  LEU A CA   1 
ATOM   379  C  C    . LEU A 1 42  ? -6.129  -38.763 28.311  1.00 32.87  ?  42  LEU A C    1 
ATOM   380  O  O    . LEU A 1 42  ? -4.924  -38.620 28.076  1.00 30.81  ?  42  LEU A O    1 
ATOM   381  C  CB   . LEU A 1 42  ? -6.592  -41.140 27.795  1.00 30.77  ?  42  LEU A CB   1 
ATOM   382  C  CG   . LEU A 1 42  ? -6.941  -42.583 28.171  1.00 37.96  ?  42  LEU A CG   1 
ATOM   383  C  CD1  . LEU A 1 42  ? -6.548  -43.509 27.037  1.00 26.03  ?  42  LEU A CD1  1 
ATOM   384  C  CD2  . LEU A 1 42  ? -6.274  -43.017 29.464  1.00 34.80  ?  42  LEU A CD2  1 
ATOM   385  H  H    . LEU A 1 42  ? -8.580  -40.217 28.970  1.00 36.76  ?  42  LEU A H    1 
ATOM   386  H  HA   . LEU A 1 42  ? -5.981  -40.349 29.584  1.00 36.94  ?  42  LEU A HA   1 
ATOM   387  H  HB2  . LEU A 1 42  ? -7.222  -40.868 27.109  1.00 37.01  ?  42  LEU A HB2  1 
ATOM   388  H  HB3  . LEU A 1 42  ? -5.700  -41.156 27.416  1.00 37.01  ?  42  LEU A HB3  1 
ATOM   389  H  HG   . LEU A 1 42  ? -7.901  -42.653 28.293  1.00 45.63  ?  42  LEU A HG   1 
ATOM   390  H  HD11 . LEU A 1 42  ? -6.772  -44.420 27.283  1.00 31.32  ?  42  LEU A HD11 1 
ATOM   391  H  HD12 . LEU A 1 42  ? -7.033  -43.252 26.238  1.00 31.32  ?  42  LEU A HD12 1 
ATOM   392  H  HD13 . LEU A 1 42  ? -5.593  -43.432 26.884  1.00 31.32  ?  42  LEU A HD13 1 
ATOM   393  H  HD21 . LEU A 1 42  ? -6.526  -43.934 29.656  1.00 41.84  ?  42  LEU A HD21 1 
ATOM   394  H  HD22 . LEU A 1 42  ? -5.312  -42.953 29.359  1.00 41.84  ?  42  LEU A HD22 1 
ATOM   395  H  HD23 . LEU A 1 42  ? -6.569  -42.435 30.181  1.00 41.84  ?  42  LEU A HD23 1 
ATOM   396  N  N    . THR A 1 43  ? -7.023  -37.803 28.065  1.00 28.33  ?  43  THR A N    1 
ATOM   397  C  CA   . THR A 1 43  ? -6.656  -36.593 27.343  1.00 28.02  ?  43  THR A CA   1 
ATOM   398  C  C    . THR A 1 43  ? -6.702  -35.327 28.187  1.00 36.59  ?  43  THR A C    1 
ATOM   399  O  O    . THR A 1 43  ? -6.150  -34.308 27.760  1.00 32.18  ?  43  THR A O    1 
ATOM   400  C  CB   . THR A 1 43  ? -7.556  -36.413 26.109  1.00 31.80  ?  43  THR A CB   1 
ATOM   401  O  OG1  . THR A 1 43  ? -8.935  -36.466 26.494  1.00 35.04  ?  43  THR A OG1  1 
ATOM   402  C  CG2  . THR A 1 43  ? -7.277  -37.505 25.092  1.00 30.80  ?  43  THR A CG2  1 
ATOM   403  H  H    . THR A 1 43  ? -7.848  -37.833 28.307  1.00 34.08  ?  43  THR A H    1 
ATOM   404  H  HA   . THR A 1 43  ? -5.745  -36.694 27.024  1.00 33.71  ?  43  THR A HA   1 
ATOM   405  H  HB   . THR A 1 43  ? -7.370  -35.556 25.696  1.00 38.24  ?  43  THR A HB   1 
ATOM   406  H  HG1  . THR A 1 43  ? -9.105  -37.208 26.850  1.00 42.13  ?  43  THR A HG1  1 
ATOM   407  H  HG21 . THR A 1 43  ? -7.847  -37.388 24.316  1.00 37.04  ?  43  THR A HG21 1 
ATOM   408  H  HG22 . THR A 1 43  ? -6.350  -37.466 24.811  1.00 37.04  ?  43  THR A HG22 1 
ATOM   409  H  HG23 . THR A 1 43  ? -7.452  -38.375 25.483  1.00 37.04  ?  43  THR A HG23 1 
ATOM   410  N  N    . VAL A 1 44  ? -7.332  -35.351 29.365  1.00 36.79  ?  44  VAL A N    1 
ATOM   411  C  CA   . VAL A 1 44  ? -7.214  -34.206 30.260  1.00 32.59  ?  44  VAL A CA   1 
ATOM   412  C  C    . VAL A 1 44  ? -5.752  -34.042 30.671  1.00 35.36  ?  44  VAL A C    1 
ATOM   413  O  O    . VAL A 1 44  ? -4.945  -34.978 30.606  1.00 32.04  ?  44  VAL A O    1 
ATOM   414  C  CB   . VAL A 1 44  ? -8.110  -34.337 31.502  1.00 34.70  ?  44  VAL A CB   1 
ATOM   415  C  CG1  . VAL A 1 44  ? -9.580  -34.247 31.121  1.00 33.83  ?  44  VAL A CG1  1 
ATOM   416  C  CG2  . VAL A 1 44  ? -7.812  -35.633 32.259  1.00 34.62  ?  44  VAL A CG2  1 
ATOM   417  H  H    . VAL A 1 44  ? -7.818  -35.997 29.659  1.00 44.23  ?  44  VAL A H    1 
ATOM   418  H  HA   . VAL A 1 44  ? -7.481  -33.405 29.782  1.00 39.19  ?  44  VAL A HA   1 
ATOM   419  H  HB   . VAL A 1 44  ? -7.917  -33.598 32.101  1.00 41.72  ?  44  VAL A HB   1 
ATOM   420  H  HG11 . VAL A 1 44  ? -10.119 -34.333 31.922  1.00 40.68  ?  44  VAL A HG11 1 
ATOM   421  H  HG12 . VAL A 1 44  ? -9.744  -33.388 30.701  1.00 40.68  ?  44  VAL A HG12 1 
ATOM   422  H  HG13 . VAL A 1 44  ? -9.789  -34.964 30.502  1.00 40.68  ?  44  VAL A HG13 1 
ATOM   423  H  HG21 . VAL A 1 44  ? -8.392  -35.685 33.035  1.00 41.63  ?  44  VAL A HG21 1 
ATOM   424  H  HG22 . VAL A 1 44  ? -7.977  -36.386 31.671  1.00 41.63  ?  44  VAL A HG22 1 
ATOM   425  H  HG23 . VAL A 1 44  ? -6.884  -35.628 32.539  1.00 41.63  ?  44  VAL A HG23 1 
ATOM   426  N  N    . SER A 1 45  ? -5.413  -32.831 31.102  1.00 32.45  ?  45  SER A N    1 
ATOM   427  C  CA   . SER A 1 45  ? -4.069  -32.566 31.586  1.00 36.42  ?  45  SER A CA   1 
ATOM   428  C  C    . SER A 1 45  ? -3.772  -33.420 32.814  1.00 33.29  ?  45  SER A C    1 
ATOM   429  O  O    . SER A 1 45  ? -4.673  -33.876 33.523  1.00 33.26  ?  45  SER A O    1 
ATOM   430  C  CB   . SER A 1 45  ? -3.908  -31.087 31.933  1.00 40.18  ?  45  SER A CB   1 
ATOM   431  O  OG   . SER A 1 45  ? -4.648  -30.763 33.098  1.00 39.52  ?  45  SER A OG   1 
ATOM   432  H  H    . SER A 1 45  ? -5.941  -32.153 31.123  1.00 39.02  ?  45  SER A H    1 
ATOM   433  H  HA   . SER A 1 45  ? -3.427  -32.790 30.894  1.00 43.78  ?  45  SER A HA   1 
ATOM   434  H  HB2  . SER A 1 45  ? -2.970  -30.900 32.092  1.00 48.30  ?  45  SER A HB2  1 
ATOM   435  H  HB3  . SER A 1 45  ? -4.233  -30.551 31.193  1.00 48.30  ?  45  SER A HB3  1 
ATOM   436  H  HG   . SER A 1 45  ? -4.554  -29.949 33.281  1.00 47.50  ?  45  SER A HG   1 
ATOM   437  N  N    . TRP A 1 46  ? -2.482  -33.634 33.066  1.00 33.79  ?  46  TRP A N    1 
ATOM   438  C  CA   . TRP A 1 46  ? -2.088  -34.399 34.245  1.00 36.67  ?  46  TRP A CA   1 
ATOM   439  C  C    . TRP A 1 46  ? -2.597  -33.778 35.539  1.00 36.98  ?  46  TRP A C    1 
ATOM   440  O  O    . TRP A 1 46  ? -3.066  -34.532 36.411  1.00 38.23  ?  46  TRP A O    1 
ATOM   441  C  CB   . TRP A 1 46  ? -0.562  -34.557 34.274  1.00 39.39  ?  46  TRP A CB   1 
ATOM   442  C  CG   . TRP A 1 46  ? -0.068  -35.678 33.408  1.00 38.33  ?  46  TRP A CG   1 
ATOM   443  C  CD1  . TRP A 1 46  ? 0.612   -35.569 32.229  1.00 39.27  ?  46  TRP A CD1  1 
ATOM   444  C  CD2  . TRP A 1 46  ? -0.225  -37.082 33.650  1.00 42.05  ?  46  TRP A CD2  1 
ATOM   445  N  NE1  . TRP A 1 46  ? 0.893   -36.817 31.725  1.00 41.66  ?  46  TRP A NE1  1 
ATOM   446  C  CE2  . TRP A 1 46  ? 0.389   -37.763 32.578  1.00 43.18  ?  46  TRP A CE2  1 
ATOM   447  C  CE3  . TRP A 1 46  ? -0.823  -37.829 34.670  1.00 40.45  ?  46  TRP A CE3  1 
ATOM   448  C  CZ2  . TRP A 1 46  ? 0.420   -39.154 32.497  1.00 33.61  ?  46  TRP A CZ2  1 
ATOM   449  C  CZ3  . TRP A 1 46  ? -0.791  -39.209 34.588  1.00 39.11  ?  46  TRP A CZ3  1 
ATOM   450  C  CH2  . TRP A 1 46  ? -0.173  -39.857 33.509  1.00 35.60  ?  46  TRP A CH2  1 
ATOM   451  H  H    . TRP A 1 46  ? -1.829  -33.354 32.581  1.00 40.63  ?  46  TRP A H    1 
ATOM   452  H  HA   . TRP A 1 46  ? -2.472  -35.287 34.177  1.00 44.08  ?  46  TRP A HA   1 
ATOM   453  H  HB2  . TRP A 1 46  ? -0.154  -33.735 33.960  1.00 47.35  ?  46  TRP A HB2  1 
ATOM   454  H  HB3  . TRP A 1 46  ? -0.282  -34.738 35.185  1.00 47.35  ?  46  TRP A HB3  1 
ATOM   455  H  HD1  . TRP A 1 46  ? 0.854   -34.766 31.827  1.00 47.20  ?  46  TRP A HD1  1 
ATOM   456  H  HE1  . TRP A 1 46  ? 1.314   -36.978 30.992  1.00 50.08  ?  46  TRP A HE1  1 
ATOM   457  H  HE3  . TRP A 1 46  ? -1.235  -37.407 35.389  1.00 48.63  ?  46  TRP A HE3  1 
ATOM   458  H  HZ2  . TRP A 1 46  ? 0.829   -39.587 31.783  1.00 40.41  ?  46  TRP A HZ2  1 
ATOM   459  H  HZ3  . TRP A 1 46  ? -1.185  -39.716 35.261  1.00 47.02  ?  46  TRP A HZ3  1 
ATOM   460  H  HH2  . TRP A 1 46  ? -0.166  -40.787 33.481  1.00 42.80  ?  46  TRP A HH2  1 
ATOM   461  N  N    . PRO A 1 47  ? -2.537  -32.458 35.742  1.00 40.40  ?  47  PRO A N    1 
ATOM   462  C  CA   . PRO A 1 47  ? -3.142  -31.890 36.959  1.00 38.70  ?  47  PRO A CA   1 
ATOM   463  C  C    . PRO A 1 47  ? -4.615  -32.226 37.108  1.00 37.36  ?  47  PRO A C    1 
ATOM   464  O  O    . PRO A 1 47  ? -5.059  -32.570 38.211  1.00 41.62  ?  47  PRO A O    1 
ATOM   465  C  CB   . PRO A 1 47  ? -2.909  -30.382 36.787  1.00 40.63  ?  47  PRO A CB   1 
ATOM   466  C  CG   . PRO A 1 47  ? -1.692  -30.288 35.942  1.00 41.04  ?  47  PRO A CG   1 
ATOM   467  C  CD   . PRO A 1 47  ? -1.761  -31.455 34.992  1.00 38.66  ?  47  PRO A CD   1 
ATOM   468  H  HA   . PRO A 1 47  ? -2.664  -32.198 37.745  1.00 46.52  ?  47  PRO A HA   1 
ATOM   469  H  HB2  . PRO A 1 47  ? -3.671  -29.980 36.340  1.00 48.84  ?  47  PRO A HB2  1 
ATOM   470  H  HB3  . PRO A 1 47  ? -2.761  -29.971 37.653  1.00 48.84  ?  47  PRO A HB3  1 
ATOM   471  H  HG2  . PRO A 1 47  ? -1.699  -29.450 35.454  1.00 49.33  ?  47  PRO A HG2  1 
ATOM   472  H  HG3  . PRO A 1 47  ? -0.902  -30.350 36.502  1.00 49.33  ?  47  PRO A HG3  1 
ATOM   473  H  HD2  . PRO A 1 47  ? -2.228  -31.203 34.180  1.00 46.47  ?  47  PRO A HD2  1 
ATOM   474  H  HD3  . PRO A 1 47  ? -0.870  -31.789 34.801  1.00 46.47  ?  47  PRO A HD3  1 
ATOM   475  N  N    . VAL A 1 48  ? -5.390  -32.131 36.025  1.00 36.61  ?  48  VAL A N    1 
ATOM   476  C  CA   . VAL A 1 48  ? -6.803  -32.496 36.086  1.00 32.65  ?  48  VAL A CA   1 
ATOM   477  C  C    . VAL A 1 48  ? -6.953  -33.982 36.382  1.00 40.19  ?  48  VAL A C    1 
ATOM   478  O  O    . VAL A 1 48  ? -7.798  -34.389 37.189  1.00 36.76  ?  48  VAL A O    1 
ATOM   479  C  CB   . VAL A 1 48  ? -7.511  -32.100 34.775  1.00 35.42  ?  48  VAL A CB   1 
ATOM   480  C  CG1  . VAL A 1 48  ? -8.945  -32.620 34.742  1.00 35.70  ?  48  VAL A CG1  1 
ATOM   481  C  CG2  . VAL A 1 48  ? -7.499  -30.586 34.605  1.00 38.50  ?  48  VAL A CG2  1 
ATOM   482  H  H    . VAL A 1 48  ? -5.124  -31.861 35.253  1.00 44.02  ?  48  VAL A H    1 
ATOM   483  H  HA   . VAL A 1 48  ? -7.223  -32.005 36.810  1.00 39.26  ?  48  VAL A HA   1 
ATOM   484  H  HB   . VAL A 1 48  ? -7.033  -32.491 34.027  1.00 42.59  ?  48  VAL A HB   1 
ATOM   485  H  HG11 . VAL A 1 48  ? -9.358  -32.354 33.906  1.00 42.93  ?  48  VAL A HG11 1 
ATOM   486  H  HG12 . VAL A 1 48  ? -8.931  -33.588 34.812  1.00 42.93  ?  48  VAL A HG12 1 
ATOM   487  H  HG13 . VAL A 1 48  ? -9.435  -32.242 35.489  1.00 42.93  ?  48  VAL A HG13 1 
ATOM   488  H  HG21 . VAL A 1 48  ? -7.948  -30.358 33.776  1.00 46.29  ?  48  VAL A HG21 1 
ATOM   489  H  HG22 . VAL A 1 48  ? -7.962  -30.181 35.355  1.00 46.29  ?  48  VAL A HG22 1 
ATOM   490  H  HG23 . VAL A 1 48  ? -6.579  -30.279 34.579  1.00 46.29  ?  48  VAL A HG23 1 
ATOM   491  N  N    . PHE A 1 49  ? -6.136  -34.815 35.735  1.00 37.88  ?  49  PHE A N    1 
ATOM   492  C  CA   . PHE A 1 49  ? -6.210  -36.256 35.957  1.00 37.60  ?  49  PHE A CA   1 
ATOM   493  C  C    . PHE A 1 49  ? -5.955  -36.599 37.421  1.00 32.91  ?  49  PHE A C    1 
ATOM   494  O  O    . PHE A 1 49  ? -6.719  -37.350 38.038  1.00 34.80  ?  49  PHE A O    1 
ATOM   495  C  CB   . PHE A 1 49  ? -5.208  -36.972 35.050  1.00 33.23  ?  49  PHE A CB   1 
ATOM   496  C  CG   . PHE A 1 49  ? -5.161  -38.460 35.252  1.00 31.75  ?  49  PHE A CG   1 
ATOM   497  C  CD1  . PHE A 1 49  ? -6.069  -39.288 34.615  1.00 28.00  ?  49  PHE A CD1  1 
ATOM   498  C  CD2  . PHE A 1 49  ? -4.208  -39.029 36.079  1.00 35.54  ?  49  PHE A CD2  1 
ATOM   499  C  CE1  . PHE A 1 49  ? -6.027  -40.656 34.799  1.00 35.62  ?  49  PHE A CE1  1 
ATOM   500  C  CE2  . PHE A 1 49  ? -4.161  -40.397 36.267  1.00 33.80  ?  49  PHE A CE2  1 
ATOM   501  C  CZ   . PHE A 1 49  ? -5.072  -41.212 35.627  1.00 34.70  ?  49  PHE A CZ   1 
ATOM   502  H  H    . PHE A 1 49  ? -5.536  -34.573 35.169  1.00 45.54  ?  49  PHE A H    1 
ATOM   503  H  HA   . PHE A 1 49  ? -7.100  -36.566 35.727  1.00 45.20  ?  49  PHE A HA   1 
ATOM   504  H  HB2  . PHE A 1 49  ? -5.450  -36.807 34.125  1.00 39.95  ?  49  PHE A HB2  1 
ATOM   505  H  HB3  . PHE A 1 49  ? -4.321  -36.621 35.225  1.00 39.95  ?  49  PHE A HB3  1 
ATOM   506  H  HD1  . PHE A 1 49  ? -6.714  -38.918 34.056  1.00 33.69  ?  49  PHE A HD1  1 
ATOM   507  H  HD2  . PHE A 1 49  ? -3.592  -38.485 36.513  1.00 42.72  ?  49  PHE A HD2  1 
ATOM   508  H  HE1  . PHE A 1 49  ? -6.643  -41.203 34.366  1.00 42.83  ?  49  PHE A HE1  1 
ATOM   509  H  HE2  . PHE A 1 49  ? -3.517  -40.769 36.826  1.00 40.65  ?  49  PHE A HE2  1 
ATOM   510  H  HZ   . PHE A 1 49  ? -5.042  -42.133 35.752  1.00 41.72  ?  49  PHE A HZ   1 
ATOM   511  N  N    . ILE A 1 50  ? -4.879  -36.057 37.995  1.00 33.12  ?  50  ILE A N    1 
ATOM   512  C  CA   . ILE A 1 50  ? -4.545  -36.359 39.383  1.00 33.61  ?  50  ILE A CA   1 
ATOM   513  C  C    . ILE A 1 50  ? -5.607  -35.802 40.323  1.00 38.81  ?  50  ILE A C    1 
ATOM   514  O  O    . ILE A 1 50  ? -5.917  -36.405 41.357  1.00 38.11  ?  50  ILE A O    1 
ATOM   515  C  CB   . ILE A 1 50  ? -3.142  -35.819 39.717  1.00 36.54  ?  50  ILE A CB   1 
ATOM   516  C  CG1  . ILE A 1 50  ? -2.086  -36.600 38.931  1.00 36.36  ?  50  ILE A CG1  1 
ATOM   517  C  CG2  . ILE A 1 50  ? -2.864  -35.917 41.216  1.00 40.14  ?  50  ILE A CG2  1 
ATOM   518  C  CD1  . ILE A 1 50  ? -0.693  -36.011 39.007  1.00 48.00  ?  50  ILE A CD1  1 
ATOM   519  H  H    . ILE A 1 50  ? -4.334  -35.519 37.605  1.00 39.83  ?  50  ILE A H    1 
ATOM   520  H  HA   . ILE A 1 50  ? -4.525  -37.322 39.497  1.00 40.41  ?  50  ILE A HA   1 
ATOM   521  H  HB   . ILE A 1 50  ? -3.099  -34.887 39.454  1.00 43.93  ?  50  ILE A HB   1 
ATOM   522  H  HG12 . ILE A 1 50  ? -2.043  -37.504 39.280  1.00 43.72  ?  50  ILE A HG12 1 
ATOM   523  H  HG13 . ILE A 1 50  ? -2.346  -36.622 37.997  1.00 43.72  ?  50  ILE A HG13 1 
ATOM   524  H  HG21 . ILE A 1 50  ? -1.976  -35.570 41.395  1.00 48.25  ?  50  ILE A HG21 1 
ATOM   525  H  HG22 . ILE A 1 50  ? -3.527  -35.394 41.694  1.00 48.25  ?  50  ILE A HG22 1 
ATOM   526  H  HG23 . ILE A 1 50  ? -2.918  -36.847 41.486  1.00 48.25  ?  50  ILE A HG23 1 
ATOM   527  H  HD11 . ILE A 1 50  ? -0.089  -36.563 38.485  1.00 57.69  ?  50  ILE A HD11 1 
ATOM   528  H  HD12 . ILE A 1 50  ? -0.711  -35.110 38.648  1.00 57.69  ?  50  ILE A HD12 1 
ATOM   529  H  HD13 . ILE A 1 50  ? -0.408  -35.993 39.934  1.00 57.69  ?  50  ILE A HD13 1 
ATOM   530  N  N    . THR A 1 51  ? -6.179  -34.645 39.986  1.00 38.08  ?  51  THR A N    1 
ATOM   531  C  CA   . THR A 1 51  ? -7.266  -34.101 40.792  1.00 37.15  ?  51  THR A CA   1 
ATOM   532  C  C    . THR A 1 51  ? -8.476  -35.026 40.771  1.00 40.36  ?  51  THR A C    1 
ATOM   533  O  O    . THR A 1 51  ? -9.131  -35.230 41.800  1.00 41.79  ?  51  THR A O    1 
ATOM   534  C  CB   . THR A 1 51  ? -7.644  -32.708 40.287  1.00 38.51  ?  51  THR A CB   1 
ATOM   535  O  OG1  . THR A 1 51  ? -6.493  -31.857 40.327  1.00 39.68  ?  51  THR A OG1  1 
ATOM   536  C  CG2  . THR A 1 51  ? -8.749  -32.096 41.145  1.00 46.16  ?  51  THR A CG2  1 
ATOM   537  H  H    . THR A 1 51  ? -5.959  -34.165 39.307  1.00 45.78  ?  51  THR A H    1 
ATOM   538  H  HA   . THR A 1 51  ? -6.968  -34.017 41.711  1.00 44.66  ?  51  THR A HA   1 
ATOM   539  H  HB   . THR A 1 51  ? -7.966  -32.772 39.374  1.00 46.29  ?  51  THR A HB   1 
ATOM   540  H  HG1  . THR A 1 51  ? -5.885  -32.172 39.840  1.00 47.70  ?  51  THR A HG1  1 
ATOM   541  H  HG21 . THR A 1 51  ? -8.977  -31.214 40.811  1.00 55.47  ?  51  THR A HG21 1 
ATOM   542  H  HG22 . THR A 1 51  ? -9.539  -32.657 41.118  1.00 55.47  ?  51  THR A HG22 1 
ATOM   543  H  HG23 . THR A 1 51  ? -8.449  -32.017 42.064  1.00 55.47  ?  51  THR A HG23 1 
ATOM   544  N  N    . LEU A 1 52  ? -8.784  -35.602 39.607  1.00 39.07  ?  52  LEU A N    1 
ATOM   545  C  CA   . LEU A 1 52  ? -9.927  -36.503 39.508  1.00 40.19  ?  52  LEU A CA   1 
ATOM   546  C  C    . LEU A 1 52  ? -9.689  -37.787 40.293  1.00 38.65  ?  52  LEU A C    1 
ATOM   547  O  O    . LEU A 1 52  ? -10.593 -38.270 40.986  1.00 39.96  ?  52  LEU A O    1 
ATOM   548  C  CB   . LEU A 1 52  ? -10.220 -36.814 38.040  1.00 40.25  ?  52  LEU A CB   1 
ATOM   549  C  CG   . LEU A 1 52  ? -10.774 -35.650 37.216  1.00 43.92  ?  52  LEU A CG   1 
ATOM   550  C  CD1  . LEU A 1 52  ? -10.754 -35.989 35.736  1.00 39.92  ?  52  LEU A CD1  1 
ATOM   551  C  CD2  . LEU A 1 52  ? -12.186 -35.299 37.658  1.00 47.78  ?  52  LEU A CD2  1 
ATOM   552  H  H    . LEU A 1 52  ? -8.354  -35.487 38.871  1.00 46.97  ?  52  LEU A H    1 
ATOM   553  H  HA   . LEU A 1 52  ? -10.707 -36.065 39.882  1.00 48.31  ?  52  LEU A HA   1 
ATOM   554  H  HB2  . LEU A 1 52  ? -9.396  -37.103 37.618  1.00 48.38  ?  52  LEU A HB2  1 
ATOM   555  H  HB3  . LEU A 1 52  ? -10.871 -37.532 38.003  1.00 48.38  ?  52  LEU A HB3  1 
ATOM   556  H  HG   . LEU A 1 52  ? -10.214 -34.870 37.353  1.00 52.79  ?  52  LEU A HG   1 
ATOM   557  H  HD11 . LEU A 1 52  ? -11.109 -35.238 35.236  1.00 47.99  ?  52  LEU A HD11 1 
ATOM   558  H  HD12 . LEU A 1 52  ? -9.840  -36.165 35.465  1.00 47.99  ?  52  LEU A HD12 1 
ATOM   559  H  HD13 . LEU A 1 52  ? -11.302 -36.776 35.585  1.00 47.99  ?  52  LEU A HD13 1 
ATOM   560  H  HD21 . LEU A 1 52  ? -12.510 -34.560 37.120  1.00 57.42  ?  52  LEU A HD21 1 
ATOM   561  H  HD22 . LEU A 1 52  ? -12.756 -36.074 37.536  1.00 57.42  ?  52  LEU A HD22 1 
ATOM   562  H  HD23 . LEU A 1 52  ? -12.169 -35.045 38.594  1.00 57.42  ?  52  LEU A HD23 1 
ATOM   563  N  N    . ILE A 1 53  ? -8.486  -38.358 40.197  1.00 35.72  ?  53  ILE A N    1 
ATOM   564  C  CA   . ILE A 1 53  ? -8.159  -39.536 40.997  1.00 35.02  ?  53  ILE A CA   1 
ATOM   565  C  C    . ILE A 1 53  ? -8.273  -39.204 42.479  1.00 37.33  ?  53  ILE A C    1 
ATOM   566  O  O    . ILE A 1 53  ? -8.900  -39.934 43.255  1.00 34.48  ?  53  ILE A O    1 
ATOM   567  C  CB   . ILE A 1 53  ? -6.750  -40.054 40.648  1.00 34.35  ?  53  ILE A CB   1 
ATOM   568  C  CG1  . ILE A 1 53  ? -6.656  -40.448 39.168  1.00 38.80  ?  53  ILE A CG1  1 
ATOM   569  C  CG2  . ILE A 1 53  ? -6.368  -41.236 41.539  1.00 35.10  ?  53  ILE A CG2  1 
ATOM   570  C  CD1  . ILE A 1 53  ? -7.536  -41.611 38.759  1.00 42.16  ?  53  ILE A CD1  1 
ATOM   571  H  H    . ILE A 1 53  ? -7.852  -38.086 39.684  1.00 42.94  ?  53  ILE A H    1 
ATOM   572  H  HA   . ILE A 1 53  ? -8.795  -40.240 40.798  1.00 42.10  ?  53  ILE A HA   1 
ATOM   573  H  HB   . ILE A 1 53  ? -6.117  -39.337 40.809  1.00 41.30  ?  53  ILE A HB   1 
ATOM   574  H  HG12 . ILE A 1 53  ? -6.911  -39.684 38.628  1.00 46.64  ?  53  ILE A HG12 1 
ATOM   575  H  HG13 . ILE A 1 53  ? -5.738  -40.693 38.972  1.00 46.64  ?  53  ILE A HG13 1 
ATOM   576  H  HG21 . ILE A 1 53  ? -5.479  -41.539 41.296  1.00 42.20  ?  53  ILE A HG21 1 
ATOM   577  H  HG22 . ILE A 1 53  ? -6.378  -40.948 42.465  1.00 42.20  ?  53  ILE A HG22 1 
ATOM   578  H  HG23 . ILE A 1 53  ? -7.009  -41.951 41.406  1.00 42.20  ?  53  ILE A HG23 1 
ATOM   579  H  HD11 . ILE A 1 53  ? -7.409  -41.785 37.813  1.00 50.68  ?  53  ILE A HD11 1 
ATOM   580  H  HD12 . ILE A 1 53  ? -7.287  -42.393 39.276  1.00 50.68  ?  53  ILE A HD12 1 
ATOM   581  H  HD13 . ILE A 1 53  ? -8.463  -41.381 38.931  1.00 50.68  ?  53  ILE A HD13 1 
ATOM   582  N  N    . THR A 1 54  ? -7.661  -38.093 42.892  1.00 34.05  ?  54  THR A N    1 
ATOM   583  C  CA   . THR A 1 54  ? -7.719  -37.685 44.290  1.00 39.82  ?  54  THR A CA   1 
ATOM   584  C  C    . THR A 1 54  ? -9.161  -37.476 44.736  1.00 43.55  ?  54  THR A C    1 
ATOM   585  O  O    . THR A 1 54  ? -9.564  -37.940 45.809  1.00 43.30  ?  54  THR A O    1 
ATOM   586  C  CB   . THR A 1 54  ? -6.899  -36.410 44.488  1.00 37.58  ?  54  THR A CB   1 
ATOM   587  O  OG1  . THR A 1 54  ? -5.561  -36.626 44.025  1.00 39.77  ?  54  THR A OG1  1 
ATOM   588  C  CG2  . THR A 1 54  ? -6.858  -36.013 45.958  1.00 40.68  ?  54  THR A CG2  1 
ATOM   589  H  H    . THR A 1 54  ? -7.210  -37.565 42.385  1.00 40.95  ?  54  THR A H    1 
ATOM   590  H  HA   . THR A 1 54  ? -7.330  -38.382 44.841  1.00 47.87  ?  54  THR A HA   1 
ATOM   591  H  HB   . THR A 1 54  ? -7.302  -35.684 43.986  1.00 45.17  ?  54  THR A HB   1 
ATOM   592  H  HG1  . THR A 1 54  ? -5.569  -36.826 43.209  1.00 47.81  ?  54  THR A HG1  1 
ATOM   593  H  HG21 . THR A 1 54  ? -6.335  -35.204 46.068  1.00 48.90  ?  54  THR A HG21 1 
ATOM   594  H  HG22 . THR A 1 54  ? -7.758  -35.855 46.283  1.00 48.90  ?  54  THR A HG22 1 
ATOM   595  H  HG23 . THR A 1 54  ? -6.454  -36.723 46.481  1.00 48.90  ?  54  THR A HG23 1 
ATOM   596  N  N    . GLY A 1 55  ? -9.955  -36.782 43.920  1.00 41.53  ?  55  GLY A N    1 
ATOM   597  C  CA   . GLY A 1 55  ? -11.348 -36.560 44.274  1.00 39.82  ?  55  GLY A CA   1 
ATOM   598  C  C    . GLY A 1 55  ? -12.101 -37.857 44.500  1.00 45.10  ?  55  GLY A C    1 
ATOM   599  O  O    . GLY A 1 55  ? -12.774 -38.031 45.519  1.00 44.40  ?  55  GLY A O    1 
ATOM   600  H  H    . GLY A 1 55  ? -9.714  -36.438 43.170  1.00 49.92  ?  55  GLY A H    1 
ATOM   601  H  HA2  . GLY A 1 55  ? -11.395 -36.032 45.086  1.00 47.86  ?  55  GLY A HA2  1 
ATOM   602  H  HA3  . GLY A 1 55  ? -11.789 -36.070 43.562  1.00 47.86  ?  55  GLY A HA3  1 
ATOM   603  N  N    . LEU A 1 56  ? -11.998 -38.787 43.548  1.00 40.65  ?  56  LEU A N    1 
ATOM   604  C  CA   . LEU A 1 56  ? -12.645 -40.083 43.709  1.00 44.57  ?  56  LEU A CA   1 
ATOM   605  C  C    . LEU A 1 56  ? -12.137 -40.796 44.954  1.00 44.21  ?  56  LEU A C    1 
ATOM   606  O  O    . LEU A 1 56  ? -12.910 -41.435 45.678  1.00 39.11  ?  56  LEU A O    1 
ATOM   607  C  CB   . LEU A 1 56  ? -12.403 -40.941 42.468  1.00 38.72  ?  56  LEU A CB   1 
ATOM   608  C  CG   . LEU A 1 56  ? -12.904 -42.385 42.539  1.00 44.75  ?  56  LEU A CG   1 
ATOM   609  C  CD1  . LEU A 1 56  ? -14.401 -42.424 42.783  1.00 47.88  ?  56  LEU A CD1  1 
ATOM   610  C  CD2  . LEU A 1 56  ? -12.549 -43.133 41.266  1.00 53.58  ?  56  LEU A CD2  1 
ATOM   611  H  H    . LEU A 1 56  ? -11.565 -38.691 42.811  1.00 48.87  ?  56  LEU A H    1 
ATOM   612  H  HA   . LEU A 1 56  ? -13.602 -39.952 43.804  1.00 53.56  ?  56  LEU A HA   1 
ATOM   613  H  HB2  . LEU A 1 56  ? -12.846 -40.519 41.715  1.00 46.54  ?  56  LEU A HB2  1 
ATOM   614  H  HB3  . LEU A 1 56  ? -11.448 -40.974 42.302  1.00 46.54  ?  56  LEU A HB3  1 
ATOM   615  H  HG   . LEU A 1 56  ? -12.468 -42.834 43.281  1.00 53.78  ?  56  LEU A HG   1 
ATOM   616  H  HD11 . LEU A 1 56  ? -14.690 -43.349 42.824  1.00 57.54  ?  56  LEU A HD11 1 
ATOM   617  H  HD12 . LEU A 1 56  ? -14.596 -41.979 43.623  1.00 57.54  ?  56  LEU A HD12 1 
ATOM   618  H  HD13 . LEU A 1 56  ? -14.851 -41.968 42.055  1.00 57.54  ?  56  LEU A HD13 1 
ATOM   619  H  HD21 . LEU A 1 56  ? -12.875 -44.044 41.334  1.00 64.38  ?  56  LEU A HD21 1 
ATOM   620  H  HD22 . LEU A 1 56  ? -12.965 -42.687 40.512  1.00 64.38  ?  56  LEU A HD22 1 
ATOM   621  H  HD23 . LEU A 1 56  ? -11.585 -43.133 41.159  1.00 64.38  ?  56  LEU A HD23 1 
ATOM   622  N  N    . TYR A 1 57  ? -10.834 -40.697 45.215  1.00 36.94  ?  57  TYR A N    1 
ATOM   623  C  CA   . TYR A 1 57  ? -10.235 -41.371 46.361  1.00 38.81  ?  57  TYR A CA   1 
ATOM   624  C  C    . TYR A 1 57  ? -10.776 -40.814 47.675  1.00 43.47  ?  57  TYR A C    1 
ATOM   625  O  O    . TYR A 1 57  ? -11.055 -41.572 48.611  1.00 39.01  ?  57  TYR A O    1 
ATOM   626  C  CB   . TYR A 1 57  ? -8.717  -41.228 46.263  1.00 38.81  ?  57  TYR A CB   1 
ATOM   627  C  CG   . TYR A 1 57  ? -7.916  -41.565 47.496  1.00 39.30  ?  57  TYR A CG   1 
ATOM   628  C  CD1  . TYR A 1 57  ? -7.776  -42.876 47.927  1.00 42.91  ?  57  TYR A CD1  1 
ATOM   629  C  CD2  . TYR A 1 57  ? -7.245  -40.570 48.196  1.00 40.43  ?  57  TYR A CD2  1 
ATOM   630  C  CE1  . TYR A 1 57  ? -7.017  -43.183 49.043  1.00 42.26  ?  57  TYR A CE1  1 
ATOM   631  C  CE2  . TYR A 1 57  ? -6.486  -40.867 49.311  1.00 43.69  ?  57  TYR A CE2  1 
ATOM   632  C  CZ   . TYR A 1 57  ? -6.374  -42.173 49.728  1.00 37.14  ?  57  TYR A CZ   1 
ATOM   633  O  OH   . TYR A 1 57  ? -5.615  -42.464 50.836  1.00 44.19  ?  57  TYR A OH   1 
ATOM   634  H  H    . TYR A 1 57  ? -10.277 -40.244 44.742  1.00 44.41  ?  57  TYR A H    1 
ATOM   635  H  HA   . TYR A 1 57  ? -10.452 -42.315 46.322  1.00 46.66  ?  57  TYR A HA   1 
ATOM   636  H  HB2  . TYR A 1 57  ? -8.405  -41.810 45.553  1.00 46.66  ?  57  TYR A HB2  1 
ATOM   637  H  HB3  . TYR A 1 57  ? -8.515  -40.308 46.034  1.00 46.66  ?  57  TYR A HB3  1 
ATOM   638  H  HD1  . TYR A 1 57  ? -8.209  -43.558 47.466  1.00 51.58  ?  57  TYR A HD1  1 
ATOM   639  H  HD2  . TYR A 1 57  ? -7.319  -39.686 47.916  1.00 48.59  ?  57  TYR A HD2  1 
ATOM   640  H  HE1  . TYR A 1 57  ? -6.939  -44.065 49.328  1.00 50.79  ?  57  TYR A HE1  1 
ATOM   641  H  HE2  . TYR A 1 57  ? -6.050  -40.188 49.774  1.00 52.51  ?  57  TYR A HE2  1 
ATOM   642  H  HH   . TYR A 1 57  ? -5.284  -41.759 51.151  1.00 53.11  ?  57  TYR A HH   1 
ATOM   643  N  N    . LEU A 1 58  ? -10.955 -39.494 47.755  1.00 40.59  ?  58  LEU A N    1 
ATOM   644  C  CA   . LEU A 1 58  ? -11.496 -38.894 48.971  1.00 39.25  ?  58  LEU A CA   1 
ATOM   645  C  C    . LEU A 1 58  ? -12.992 -39.156 49.102  1.00 44.91  ?  58  LEU A C    1 
ATOM   646  O  O    . LEU A 1 58  ? -13.497 -39.368 50.212  1.00 43.17  ?  58  LEU A O    1 
ATOM   647  C  CB   . LEU A 1 58  ? -11.208 -37.393 48.978  1.00 37.78  ?  58  LEU A CB   1 
ATOM   648  C  CG   . LEU A 1 58  ? -9.729  -37.006 48.890  1.00 41.37  ?  58  LEU A CG   1 
ATOM   649  C  CD1  . LEU A 1 58  ? -9.575  -35.498 48.815  1.00 42.59  ?  58  LEU A CD1  1 
ATOM   650  C  CD2  . LEU A 1 58  ? -8.937  -37.561 50.065  1.00 43.83  ?  58  LEU A CD2  1 
ATOM   651  H  H    . LEU A 1 58  ? -10.774 -38.934 47.129  1.00 48.79  ?  58  LEU A H    1 
ATOM   652  H  HA   . LEU A 1 58  ? -11.054 -39.287 49.740  1.00 47.18  ?  58  LEU A HA   1 
ATOM   653  H  HB2  . LEU A 1 58  ? -11.660 -36.991 48.219  1.00 45.42  ?  58  LEU A HB2  1 
ATOM   654  H  HB3  . LEU A 1 58  ? -11.559 -37.017 49.800  1.00 45.42  ?  58  LEU A HB3  1 
ATOM   655  H  HG   . LEU A 1 58  ? -9.355  -37.382 48.077  1.00 49.73  ?  58  LEU A HG   1 
ATOM   656  H  HD11 . LEU A 1 58  ? -8.632  -35.279 48.760  1.00 51.19  ?  58  LEU A HD11 1 
ATOM   657  H  HD12 . LEU A 1 58  ? -10.037 -35.172 48.027  1.00 51.19  ?  58  LEU A HD12 1 
ATOM   658  H  HD13 . LEU A 1 58  ? -9.961  -35.102 49.612  1.00 51.19  ?  58  LEU A HD13 1 
ATOM   659  H  HD21 . LEU A 1 58  ? -8.009  -37.296 49.974  1.00 52.68  ?  58  LEU A HD21 1 
ATOM   660  H  HD22 . LEU A 1 58  ? -9.304  -37.204 50.889  1.00 52.68  ?  58  LEU A HD22 1 
ATOM   661  H  HD23 . LEU A 1 58  ? -9.007  -38.529 50.064  1.00 52.68  ?  58  LEU A HD23 1 
ATOM   662  N  N    . VAL A 1 59  ? -13.717 -39.152 47.982  1.00 40.20  ?  59  VAL A N    1 
ATOM   663  C  CA   . VAL A 1 59  ? -15.161 -39.366 48.023  1.00 38.38  ?  59  VAL A CA   1 
ATOM   664  C  C    . VAL A 1 59  ? -15.486 -40.776 48.502  1.00 42.63  ?  59  VAL A C    1 
ATOM   665  O  O    . VAL A 1 59  ? -16.403 -40.975 49.307  1.00 41.01  ?  59  VAL A O    1 
ATOM   666  C  CB   . VAL A 1 59  ? -15.774 -39.079 46.639  1.00 39.81  ?  59  VAL A CB   1 
ATOM   667  C  CG1  . VAL A 1 59  ? -17.174 -39.676 46.513  1.00 45.14  ?  59  VAL A CG1  1 
ATOM   668  C  CG2  . VAL A 1 59  ? -15.825 -37.579 46.395  1.00 49.58  ?  59  VAL A CG2  1 
ATOM   669  H  H    . VAL A 1 59  ? -13.398 -39.029 47.193  1.00 48.32  ?  59  VAL A H    1 
ATOM   670  H  HA   . VAL A 1 59  ? -15.552 -38.742 48.654  1.00 46.14  ?  59  VAL A HA   1 
ATOM   671  H  HB   . VAL A 1 59  ? -15.213 -39.477 45.954  1.00 47.86  ?  59  VAL A HB   1 
ATOM   672  H  HG11 . VAL A 1 59  ? -17.525 -39.475 45.631  1.00 54.25  ?  59  VAL A HG11 1 
ATOM   673  H  HG12 . VAL A 1 59  ? -17.120 -40.636 46.636  1.00 54.25  ?  59  VAL A HG12 1 
ATOM   674  H  HG13 . VAL A 1 59  ? -17.746 -39.286 47.193  1.00 54.25  ?  59  VAL A HG13 1 
ATOM   675  H  HG21 . VAL A 1 59  ? -16.212 -37.415 45.521  1.00 59.58  ?  59  VAL A HG21 1 
ATOM   676  H  HG22 . VAL A 1 59  ? -16.372 -37.167 47.082  1.00 59.58  ?  59  VAL A HG22 1 
ATOM   677  H  HG23 . VAL A 1 59  ? -14.924 -37.223 46.430  1.00 59.58  ?  59  VAL A HG23 1 
ATOM   678  N  N    . THR A 1 60  ? -14.750 -41.776 48.016  1.00 40.02  ?  60  THR A N    1 
ATOM   679  C  CA   . THR A 1 60  ? -15.064 -43.154 48.375  1.00 42.31  ?  60  THR A CA   1 
ATOM   680  C  C    . THR A 1 60  ? -14.676 -43.460 49.815  1.00 43.01  ?  60  THR A C    1 
ATOM   681  O  O    . THR A 1 60  ? -15.309 -44.306 50.458  1.00 40.68  ?  60  THR A O    1 
ATOM   682  C  CB   . THR A 1 60  ? -14.368 -44.122 47.418  1.00 45.11  ?  60  THR A CB   1 
ATOM   683  O  OG1  . THR A 1 60  ? -12.951 -43.917 47.469  1.00 59.62  ?  60  THR A OG1  1 
ATOM   684  C  CG2  . THR A 1 60  ? -14.864 -43.905 45.994  1.00 41.37  ?  60  THR A CG2  1 
ATOM   685  H  H    . THR A 1 60  ? -14.078 -41.684 47.487  1.00 48.10  ?  60  THR A H    1 
ATOM   686  H  HA   . THR A 1 60  ? -16.021 -43.289 48.290  1.00 50.85  ?  60  THR A HA   1 
ATOM   687  H  HB   . THR A 1 60  ? -14.572 -45.034 47.677  1.00 54.22  ?  60  THR A HB   1 
ATOM   688  H  HG1  . THR A 1 60  ? -12.766 -43.129 47.245  1.00 71.62  ?  60  THR A HG1  1 
ATOM   689  H  HG21 . THR A 1 60  ? -14.420 -44.520 45.391  1.00 49.73  ?  60  THR A HG21 1 
ATOM   690  H  HG22 . THR A 1 60  ? -15.821 -44.055 45.950  1.00 49.73  ?  60  THR A HG22 1 
ATOM   691  H  HG23 . THR A 1 60  ? -14.675 -42.996 45.713  1.00 49.73  ?  60  THR A HG23 1 
ATOM   692  N  N    . ASN A 1 61  ? -13.645 -42.793 50.336  1.00 36.63  ?  61  ASN A N    1 
ATOM   693  C  CA   . ASN A 1 61  ? -13.303 -42.955 51.745  1.00 45.69  ?  61  ASN A CA   1 
ATOM   694  C  C    . ASN A 1 61  ? -14.374 -42.345 52.640  1.00 45.65  ?  61  ASN A C    1 
ATOM   695  O  O    . ASN A 1 61  ? -14.738 -42.928 53.668  1.00 44.47  ?  61  ASN A O    1 
ATOM   696  C  CB   . ASN A 1 61  ? -11.939 -42.327 52.029  1.00 40.55  ?  61  ASN A CB   1 
ATOM   697  C  CG   . ASN A 1 61  ? -10.789 -43.237 51.641  1.00 46.47  ?  61  ASN A CG   1 
ATOM   698  O  OD1  . ASN A 1 61  ? -10.075 -42.981 50.669  1.00 47.84  ?  61  ASN A OD1  1 
ATOM   699  N  ND2  . ASN A 1 61  ? -10.601 -44.307 52.405  1.00 36.65  ?  61  ASN A ND2  1 
ATOM   700  H  H    . ASN A 1 61  ? -13.137 -42.251 49.902  1.00 44.04  ?  61  ASN A H    1 
ATOM   701  H  HA   . ASN A 1 61  ? -13.245 -43.902 51.949  1.00 54.91  ?  61  ASN A HA   1 
ATOM   702  H  HB2  . ASN A 1 61  ? -11.857 -41.505 51.521  1.00 48.74  ?  61  ASN A HB2  1 
ATOM   703  H  HB3  . ASN A 1 61  ? -11.868 -42.141 52.978  1.00 48.74  ?  61  ASN A HB3  1 
ATOM   704  H  HD21 . ASN A 1 61  ? -9.962  -44.854 52.228  1.00 44.06  ?  61  ASN A HD21 1 
ATOM   705  H  HD22 . ASN A 1 61  ? -11.119 -44.452 53.076  1.00 44.06  ?  61  ASN A HD22 1 
ATOM   706  N  N    . ALA A 1 62  ? -14.895 -41.175 52.263  1.00 43.23  ?  62  ALA A N    1 
ATOM   707  C  CA   . ALA A 1 62  ? -15.990 -40.575 53.018  1.00 49.00  ?  62  ALA A CA   1 
ATOM   708  C  C    . ALA A 1 62  ? -17.207 -41.491 53.041  1.00 49.19  ?  62  ALA A C    1 
ATOM   709  O  O    . ALA A 1 62  ? -17.858 -41.644 54.082  1.00 50.29  ?  62  ALA A O    1 
ATOM   710  C  CB   . ALA A 1 62  ? -16.356 -39.216 52.422  1.00 48.71  ?  62  ALA A CB   1 
ATOM   711  H  H    . ALA A 1 62  ? -14.635 -40.717 51.583  1.00 51.95  ?  62  ALA A H    1 
ATOM   712  H  HA   . ALA A 1 62  ? -15.702 -40.435 53.934  1.00 58.89  ?  62  ALA A HA   1 
ATOM   713  H  HB1  . ALA A 1 62  ? -17.084 -38.833 52.935  1.00 58.54  ?  62  ALA A HB1  1 
ATOM   714  H  HB2  . ALA A 1 62  ? -15.580 -38.635 52.462  1.00 58.54  ?  62  ALA A HB2  1 
ATOM   715  H  HB3  . ALA A 1 62  ? -16.630 -39.340 51.500  1.00 58.54  ?  62  ALA A HB3  1 
ATOM   716  N  N    . LEU A 1 63  ? -17.532 -42.110 51.903  1.00 41.72  ?  63  LEU A N    1 
ATOM   717  C  CA   . LEU A 1 63  ? -18.681 -43.008 51.855  1.00 43.96  ?  63  LEU A CA   1 
ATOM   718  C  C    . LEU A 1 63  ? -18.468 -44.220 52.751  1.00 45.11  ?  63  LEU A C    1 
ATOM   719  O  O    . LEU A 1 63  ? -19.393 -44.658 53.445  1.00 46.90  ?  63  LEU A O    1 
ATOM   720  C  CB   . LEU A 1 63  ? -18.949 -43.445 50.414  1.00 47.32  ?  63  LEU A CB   1 
ATOM   721  C  CG   . LEU A 1 63  ? -19.384 -42.346 49.439  1.00 49.99  ?  63  LEU A CG   1 
ATOM   722  C  CD1  . LEU A 1 63  ? -19.572 -42.922 48.041  1.00 48.41  ?  63  LEU A CD1  1 
ATOM   723  C  CD2  . LEU A 1 63  ? -20.660 -41.659 49.906  1.00 53.55  ?  63  LEU A CD2  1 
ATOM   724  H  H    . LEU A 1 63  ? -17.109 -42.027 51.159  1.00 50.15  ?  63  LEU A H    1 
ATOM   725  H  HA   . LEU A 1 63  ? -19.464 -42.534 52.174  1.00 52.83  ?  63  LEU A HA   1 
ATOM   726  H  HB2  . LEU A 1 63  ? -18.136 -43.838 50.060  1.00 56.86  ?  63  LEU A HB2  1 
ATOM   727  H  HB3  . LEU A 1 63  ? -19.650 -44.114 50.426  1.00 56.86  ?  63  LEU A HB3  1 
ATOM   728  H  HG   . LEU A 1 63  ? -18.686 -41.674 49.392  1.00 60.07  ?  63  LEU A HG   1 
ATOM   729  H  HD11 . LEU A 1 63  ? -19.847 -42.210 47.442  1.00 58.17  ?  63  LEU A HD11 1 
ATOM   730  H  HD12 . LEU A 1 63  ? -18.732 -43.302 47.741  1.00 58.17  ?  63  LEU A HD12 1 
ATOM   731  H  HD13 . LEU A 1 63  ? -20.255 -43.610 48.073  1.00 58.17  ?  63  LEU A HD13 1 
ATOM   732  H  HD21 . LEU A 1 63  ? -20.901 -40.973 49.264  1.00 64.34  ?  63  LEU A HD21 1 
ATOM   733  H  HD22 . LEU A 1 63  ? -21.369 -42.318 49.968  1.00 64.34  ?  63  LEU A HD22 1 
ATOM   734  H  HD23 . LEU A 1 63  ? -20.503 -41.259 50.775  1.00 64.34  ?  63  LEU A HD23 1 
ATOM   735  N  N    . PHE A 1 64  ? -17.257 -44.780 52.752  1.00 38.06  ?  64  PHE A N    1 
ATOM   736  C  CA   . PHE A 1 64  ? -16.972 -45.888 53.656  1.00 42.92  ?  64  PHE A CA   1 
ATOM   737  C  C    . PHE A 1 64  ? -17.003 -45.427 55.108  1.00 46.59  ?  64  PHE A C    1 
ATOM   738  O  O    . PHE A 1 64  ? -17.472 -46.159 55.987  1.00 43.68  ?  64  PHE A O    1 
ATOM   739  C  CB   . PHE A 1 64  ? -15.621 -46.517 53.315  1.00 36.39  ?  64  PHE A CB   1 
ATOM   740  C  CG   . PHE A 1 64  ? -15.708 -47.622 52.299  1.00 43.62  ?  64  PHE A CG   1 
ATOM   741  C  CD1  . PHE A 1 64  ? -16.153 -48.882 52.666  1.00 39.96  ?  64  PHE A CD1  1 
ATOM   742  C  CD2  . PHE A 1 64  ? -15.342 -47.405 50.982  1.00 43.15  ?  64  PHE A CD2  1 
ATOM   743  C  CE1  . PHE A 1 64  ? -16.236 -49.902 51.737  1.00 44.02  ?  64  PHE A CE1  1 
ATOM   744  C  CE2  . PHE A 1 64  ? -15.421 -48.422 50.049  1.00 42.45  ?  64  PHE A CE2  1 
ATOM   745  C  CZ   . PHE A 1 64  ? -15.868 -49.672 50.428  1.00 43.52  ?  64  PHE A CZ   1 
ATOM   746  H  H    . PHE A 1 64  ? -16.599 -44.542 52.251  1.00 45.75  ?  64  PHE A H    1 
ATOM   747  H  HA   . PHE A 1 64  ? -17.654 -46.568 53.544  1.00 51.58  ?  64  PHE A HA   1 
ATOM   748  H  HB2  . PHE A 1 64  ? -15.038 -45.830 52.957  1.00 43.75  ?  64  PHE A HB2  1 
ATOM   749  H  HB3  . PHE A 1 64  ? -15.236 -46.887 54.124  1.00 43.75  ?  64  PHE A HB3  1 
ATOM   750  H  HD1  . PHE A 1 64  ? -16.402 -49.042 53.547  1.00 48.03  ?  64  PHE A HD1  1 
ATOM   751  H  HD2  . PHE A 1 64  ? -15.040 -46.564 50.721  1.00 51.86  ?  64  PHE A HD2  1 
ATOM   752  H  HE1  . PHE A 1 64  ? -16.537 -50.743 51.995  1.00 52.90  ?  64  PHE A HE1  1 
ATOM   753  H  HE2  . PHE A 1 64  ? -15.173 -48.265 49.167  1.00 51.02  ?  64  PHE A HE2  1 
ATOM   754  H  HZ   . PHE A 1 64  ? -15.922 -50.357 49.802  1.00 52.31  ?  64  PHE A HZ   1 
ATOM   755  N  N    . ALA A 1 65  ? -16.516 -44.215 55.378  1.00 42.47  ?  65  ALA A N    1 
ATOM   756  C  CA   . ALA A 1 65  ? -16.601 -43.665 56.727  1.00 51.98  ?  65  ALA A CA   1 
ATOM   757  C  C    . ALA A 1 65  ? -18.045 -43.633 57.212  1.00 50.34  ?  65  ALA A C    1 
ATOM   758  O  O    . ALA A 1 65  ? -18.349 -44.068 58.329  1.00 46.13  ?  65  ALA A O    1 
ATOM   759  C  CB   . ALA A 1 65  ? -15.994 -42.264 56.758  1.00 44.40  ?  65  ALA A CB   1 
ATOM   760  H  H    . ALA A 1 65  ? -16.136 -43.698 54.804  1.00 51.04  ?  65  ALA A H    1 
ATOM   761  H  HA   . ALA A 1 65  ? -16.092 -44.227 57.332  1.00 62.46  ?  65  ALA A HA   1 
ATOM   762  H  HB1  . ALA A 1 65  ? -16.058 -41.912 57.660  1.00 53.36  ?  65  ALA A HB1  1 
ATOM   763  H  HB2  . ALA A 1 65  ? -15.063 -42.317 56.489  1.00 53.36  ?  65  ALA A HB2  1 
ATOM   764  H  HB3  . ALA A 1 65  ? -16.484 -41.694 56.145  1.00 53.36  ?  65  ALA A HB3  1 
ATOM   765  N  N    . LEU A 1 66  ? -18.952 -43.114 56.382  1.00 43.38  ?  66  LEU A N    1 
ATOM   766  C  CA   . LEU A 1 66  ? -20.365 -43.108 56.745  1.00 44.04  ?  66  LEU A CA   1 
ATOM   767  C  C    . LEU A 1 66  ? -20.887 -44.526 56.932  1.00 48.31  ?  66  LEU A C    1 
ATOM   768  O  O    . LEU A 1 66  ? -21.733 -44.776 57.799  1.00 50.60  ?  66  LEU A O    1 
ATOM   769  C  CB   . LEU A 1 66  ? -21.175 -42.375 55.676  1.00 43.26  ?  66  LEU A CB   1 
ATOM   770  C  CG   . LEU A 1 66  ? -20.851 -40.890 55.495  1.00 44.68  ?  66  LEU A CG   1 
ATOM   771  C  CD1  . LEU A 1 66  ? -21.575 -40.324 54.285  1.00 49.07  ?  66  LEU A CD1  1 
ATOM   772  C  CD2  . LEU A 1 66  ? -21.210 -40.097 56.745  1.00 49.83  ?  66  LEU A CD2  1 
ATOM   773  H  H    . LEU A 1 66  ? -18.777 -42.766 55.616  1.00 52.14  ?  66  LEU A H    1 
ATOM   774  H  HA   . LEU A 1 66  ? -20.475 -42.634 57.584  1.00 52.93  ?  66  LEU A HA   1 
ATOM   775  H  HB2  . LEU A 1 66  ? -21.021 -42.811 54.823  1.00 51.99  ?  66  LEU A HB2  1 
ATOM   776  H  HB3  . LEU A 1 66  ? -22.115 -42.440 55.907  1.00 51.99  ?  66  LEU A HB3  1 
ATOM   777  H  HG   . LEU A 1 66  ? -19.898 -40.793 55.344  1.00 53.70  ?  66  LEU A HG   1 
ATOM   778  H  HD11 . LEU A 1 66  ? -21.352 -39.384 54.194  1.00 58.96  ?  66  LEU A HD11 1 
ATOM   779  H  HD12 . LEU A 1 66  ? -21.293 -40.809 53.493  1.00 58.96  ?  66  LEU A HD12 1 
ATOM   780  H  HD13 . LEU A 1 66  ? -22.531 -40.427 54.413  1.00 58.96  ?  66  LEU A HD13 1 
ATOM   781  H  HD21 . LEU A 1 66  ? -20.993 -39.163 56.599  1.00 59.88  ?  66  LEU A HD21 1 
ATOM   782  H  HD22 . LEU A 1 66  ? -22.159 -40.194 56.918  1.00 59.88  ?  66  LEU A HD22 1 
ATOM   783  H  HD23 . LEU A 1 66  ? -20.700 -40.442 57.494  1.00 59.88  ?  66  LEU A HD23 1 
ATOM   784  N  N    . ALA A 1 67  ? -20.391 -45.470 56.130  1.00 47.93  ?  67  ALA A N    1 
ATOM   785  C  CA   . ALA A 1 67  ? -20.824 -46.857 56.263  1.00 48.08  ?  67  ALA A CA   1 
ATOM   786  C  C    . ALA A 1 67  ? -20.499 -47.400 57.649  1.00 49.10  ?  67  ALA A C    1 
ATOM   787  O  O    . ALA A 1 67  ? -21.333 -48.055 58.284  1.00 44.25  ?  67  ALA A O    1 
ATOM   788  C  CB   . ALA A 1 67  ? -20.168 -47.716 55.181  1.00 51.03  ?  67  ALA A CB   1 
ATOM   789  H  H    . ALA A 1 67  ? -19.811 -45.334 55.510  1.00 57.60  ?  67  ALA A H    1 
ATOM   790  H  HA   . ALA A 1 67  ? -21.785 -46.902 56.141  1.00 57.78  ?  67  ALA A HA   1 
ATOM   791  H  HB1  . ALA A 1 67  ? -20.466 -48.633 55.283  1.00 61.32  ?  67  ALA A HB1  1 
ATOM   792  H  HB2  . ALA A 1 67  ? -20.429 -47.378 54.309  1.00 61.32  ?  67  ALA A HB2  1 
ATOM   793  H  HB3  . ALA A 1 67  ? -19.205 -47.667 55.280  1.00 61.32  ?  67  ALA A HB3  1 
ATOM   794  N  N    . TYR A 1 68  ? -19.286 -47.135 58.138  1.00 47.22  ?  68  TYR A N    1 
ATOM   795  C  CA   . TYR A 1 68  ? -18.898 -47.624 59.457  1.00 50.89  ?  68  TYR A CA   1 
ATOM   796  C  C    . TYR A 1 68  ? -19.736 -46.973 60.551  1.00 52.35  ?  68  TYR A C    1 
ATOM   797  O  O    . TYR A 1 68  ? -20.214 -47.652 61.467  1.00 54.41  ?  68  TYR A O    1 
ATOM   798  C  CB   . TYR A 1 68  ? -17.407 -47.375 59.693  1.00 48.63  ?  68  TYR A CB   1 
ATOM   799  C  CG   . TYR A 1 68  ? -16.508 -48.213 58.812  1.00 43.91  ?  68  TYR A CG   1 
ATOM   800  C  CD1  . TYR A 1 68  ? -16.427 -49.589 58.985  1.00 44.34  ?  68  TYR A CD1  1 
ATOM   801  C  CD2  . TYR A 1 68  ? -15.739 -47.631 57.813  1.00 40.58  ?  68  TYR A CD2  1 
ATOM   802  C  CE1  . TYR A 1 68  ? -15.610 -50.364 58.184  1.00 44.85  ?  68  TYR A CE1  1 
ATOM   803  C  CE2  . TYR A 1 68  ? -14.916 -48.399 57.006  1.00 43.80  ?  68  TYR A CE2  1 
ATOM   804  C  CZ   . TYR A 1 68  ? -14.856 -49.765 57.196  1.00 47.66  ?  68  TYR A CZ   1 
ATOM   805  O  OH   . TYR A 1 68  ? -14.043 -50.537 56.399  1.00 45.14  ?  68  TYR A OH   1 
ATOM   806  H  H    . TYR A 1 68  ? -18.679 -46.680 57.731  1.00 56.75  ?  68  TYR A H    1 
ATOM   807  H  HA   . TYR A 1 68  ? -19.050 -48.581 59.494  1.00 61.15  ?  68  TYR A HA   1 
ATOM   808  H  HB2  . TYR A 1 68  ? -17.213 -46.442 59.513  1.00 58.44  ?  68  TYR A HB2  1 
ATOM   809  H  HB3  . TYR A 1 68  ? -17.197 -47.583 60.617  1.00 58.44  ?  68  TYR A HB3  1 
ATOM   810  H  HD1  . TYR A 1 68  ? -16.935 -49.996 59.649  1.00 53.29  ?  68  TYR A HD1  1 
ATOM   811  H  HD2  . TYR A 1 68  ? -15.778 -46.712 57.682  1.00 48.78  ?  68  TYR A HD2  1 
ATOM   812  H  HE1  . TYR A 1 68  ? -15.568 -51.284 58.311  1.00 53.90  ?  68  TYR A HE1  1 
ATOM   813  H  HE2  . TYR A 1 68  ? -14.408 -47.997 56.339  1.00 52.65  ?  68  TYR A HE2  1 
ATOM   814  H  HH   . TYR A 1 68  ? -13.642 -50.053 55.842  1.00 54.25  ?  68  TYR A HH   1 
ATOM   815  N  N    . LEU A 1 69  ? -19.928 -45.654 60.471  1.00 50.59  ?  69  LEU A N    1 
ATOM   816  C  CA   . LEU A 1 69  ? -20.760 -44.973 61.458  1.00 54.71  ?  69  LEU A CA   1 
ATOM   817  C  C    . LEU A 1 69  ? -22.176 -45.534 61.461  1.00 58.22  ?  69  LEU A C    1 
ATOM   818  O  O    . LEU A 1 69  ? -22.787 -45.694 62.525  1.00 57.86  ?  69  LEU A O    1 
ATOM   819  C  CB   . LEU A 1 69  ? -20.783 -43.470 61.180  1.00 49.54  ?  69  LEU A CB   1 
ATOM   820  C  CG   . LEU A 1 69  ? -19.447 -42.733 61.273  1.00 47.20  ?  69  LEU A CG   1 
ATOM   821  C  CD1  . LEU A 1 69  ? -19.631 -41.287 60.848  1.00 45.63  ?  69  LEU A CD1  1 
ATOM   822  C  CD2  . LEU A 1 69  ? -18.867 -42.809 62.679  1.00 54.46  ?  69  LEU A CD2  1 
ATOM   823  H  H    . LEU A 1 69  ? -19.594 -45.142 59.867  1.00 60.79  ?  69  LEU A H    1 
ATOM   824  H  HA   . LEU A 1 69  ? -20.381 -45.110 62.340  1.00 65.73  ?  69  LEU A HA   1 
ATOM   825  H  HB2  . LEU A 1 69  ? -21.124 -43.334 60.282  1.00 59.54  ?  69  LEU A HB2  1 
ATOM   826  H  HB3  . LEU A 1 69  ? -21.385 -43.055 61.817  1.00 59.54  ?  69  LEU A HB3  1 
ATOM   827  H  HG   . LEU A 1 69  ? -18.815 -43.146 60.664  1.00 56.72  ?  69  LEU A HG   1 
ATOM   828  H  HD11 . LEU A 1 69  ? -18.778 -40.829 60.910  1.00 54.84  ?  69  LEU A HD11 1 
ATOM   829  H  HD12 . LEU A 1 69  ? -19.952 -41.266 59.933  1.00 54.84  ?  69  LEU A HD12 1 
ATOM   830  H  HD13 . LEU A 1 69  ? -20.277 -40.865 61.435  1.00 54.84  ?  69  LEU A HD13 1 
ATOM   831  H  HD21 . LEU A 1 69  ? -18.023 -42.331 62.698  1.00 65.43  ?  69  LEU A HD21 1 
ATOM   832  H  HD22 . LEU A 1 69  ? -19.491 -42.402 63.300  1.00 65.43  ?  69  LEU A HD22 1 
ATOM   833  H  HD23 . LEU A 1 69  ? -18.726 -43.740 62.912  1.00 65.43  ?  69  LEU A HD23 1 
ATOM   834  N  N    . ALA A 1 70  ? -22.714 -45.843 60.279  1.00 50.10  ?  70  ALA A N    1 
ATOM   835  C  CA   . ALA A 1 70  ? -24.054 -46.411 60.195  1.00 51.82  ?  70  ALA A CA   1 
ATOM   836  C  C    . ALA A 1 70  ? -24.153 -47.755 60.904  1.00 49.33  ?  70  ALA A C    1 
ATOM   837  O  O    . ALA A 1 70  ? -25.264 -48.204 61.204  1.00 58.05  ?  70  ALA A O    1 
ATOM   838  C  CB   . ALA A 1 70  ? -24.470 -46.563 58.732  1.00 52.02  ?  70  ALA A CB   1 
ATOM   839  H  H    . ALA A 1 70  ? -22.326 -45.733 59.519  1.00 60.21  ?  70  ALA A H    1 
ATOM   840  H  HA   . ALA A 1 70  ? -24.679 -45.804 60.621  1.00 62.26  ?  70  ALA A HA   1 
ATOM   841  H  HB1  . ALA A 1 70  ? -25.363 -46.942 58.696  1.00 62.51  ?  70  ALA A HB1  1 
ATOM   842  H  HB2  . ALA A 1 70  ? -24.464 -45.690 58.310  1.00 62.51  ?  70  ALA A HB2  1 
ATOM   843  H  HB3  . ALA A 1 70  ? -23.842 -47.152 58.285  1.00 62.51  ?  70  ALA A HB3  1 
ATOM   844  N  N    . CYS A 1 71  ? -23.022 -48.407 61.171  1.00 48.61  ?  71  CYS A N    1 
ATOM   845  C  CA   . CYS A 1 71  ? -23.015 -49.656 61.919  1.00 52.86  ?  71  CYS A CA   1 
ATOM   846  C  C    . CYS A 1 71  ? -22.948 -49.443 63.426  1.00 55.76  ?  71  CYS A C    1 
ATOM   847  O  O    . CYS A 1 71  ? -23.220 -50.384 64.181  1.00 61.16  ?  71  CYS A O    1 
ATOM   848  C  CB   . CYS A 1 71  ? -21.830 -50.526 61.486  1.00 61.82  ?  71  CYS A CB   1 
ATOM   849  S  SG   . CYS A 1 71  ? -21.898 -51.112 59.772  1.00 54.21  ?  71  CYS A SG   1 
ATOM   850  H  H    . CYS A 1 71  ? -22.241 -48.143 60.925  1.00 58.42  ?  71  CYS A H    1 
ATOM   851  H  HA   . CYS A 1 71  ? -23.831 -50.143 61.723  1.00 63.52  ?  71  CYS A HA   1 
ATOM   852  H  HB2  . CYS A 1 71  ? -21.015 -50.011 61.587  1.00 74.26  ?  71  CYS A HB2  1 
ATOM   853  H  HB3  . CYS A 1 71  ? -21.795 -51.307 62.061  1.00 74.26  ?  71  CYS A HB3  1 
ATOM   854  H  HG   . CYS A 1 71  ? -21.923 -50.164 59.037  1.00 65.13  ?  71  CYS A HG   1 
ATOM   855  N  N    . GLY A 1 72  ? -22.595 -48.237 63.877  1.00 52.96  ?  72  GLY A N    1 
ATOM   856  C  CA   . GLY A 1 72  ? -22.424 -47.949 65.287  1.00 51.37  ?  72  GLY A CA   1 
ATOM   857  C  C    . GLY A 1 72  ? -20.978 -47.596 65.606  1.00 57.17  ?  72  GLY A C    1 
ATOM   858  O  O    . GLY A 1 72  ? -20.235 -47.118 64.748  1.00 59.28  ?  72  GLY A O    1 
ATOM   859  H  H    . GLY A 1 72  ? -22.448 -47.560 63.367  1.00 63.64  ?  72  GLY A H    1 
ATOM   860  H  HA2  . GLY A 1 72  ? -22.990 -47.202 65.539  1.00 61.73  ?  72  GLY A HA2  1 
ATOM   861  H  HA3  . GLY A 1 72  ? -22.679 -48.723 65.812  1.00 61.73  ?  72  GLY A HA3  1 
ATOM   862  N  N    . ASP A 1 73  ? -20.599 -47.838 66.865  1.00 57.68  ?  73  ASP A N    1 
ATOM   863  C  CA   . ASP A 1 73  ? -19.225 -47.614 67.317  1.00 54.30  ?  73  ASP A CA   1 
ATOM   864  C  C    . ASP A 1 73  ? -18.444 -48.908 67.109  1.00 53.98  ?  73  ASP A C    1 
ATOM   865  O  O    . ASP A 1 73  ? -18.155 -49.660 68.042  1.00 51.72  ?  73  ASP A O    1 
ATOM   866  C  CB   . ASP A 1 73  ? -19.199 -47.174 68.777  1.00 60.29  ?  73  ASP A CB   1 
ATOM   867  C  CG   . ASP A 1 73  ? -20.097 -45.986 69.047  1.00 62.63  ?  73  ASP A CG   1 
ATOM   868  O  OD1  . ASP A 1 73  ? -20.209 -45.110 68.163  1.00 66.38  ?  73  ASP A OD1  1 
ATOM   869  O  OD2  . ASP A 1 73  ? -20.690 -45.927 70.146  1.00 65.88  ?  73  ASP A OD2  1 
ATOM   870  H  H    . ASP A 1 73  ? -21.123 -48.134 67.479  1.00 69.29  ?  73  ASP A H    1 
ATOM   871  H  HA   . ASP A 1 73  ? -18.816 -46.918 66.779  1.00 65.24  ?  73  ASP A HA   1 
ATOM   872  H  HB2  . ASP A 1 73  ? -19.500 -47.909 69.333  1.00 72.44  ?  73  ASP A HB2  1 
ATOM   873  H  HB3  . ASP A 1 73  ? -18.293 -46.925 69.016  1.00 72.44  ?  73  ASP A HB3  1 
ATOM   874  N  N    . VAL A 1 74  ? -18.093 -49.165 65.852  1.00 52.04  ?  74  VAL A N    1 
ATOM   875  C  CA   . VAL A 1 74  ? -17.462 -50.420 65.468  1.00 46.89  ?  74  VAL A CA   1 
ATOM   876  C  C    . VAL A 1 74  ? -15.984 -50.225 65.126  1.00 47.53  ?  74  VAL A C    1 
ATOM   877  O  O    . VAL A 1 74  ? -15.372 -51.100 64.516  1.00 43.22  ?  74  VAL A O    1 
ATOM   878  C  CB   . VAL A 1 74  ? -18.219 -51.090 64.309  1.00 50.77  ?  74  VAL A CB   1 
ATOM   879  C  CG1  . VAL A 1 74  ? -19.622 -51.483 64.746  1.00 58.00  ?  74  VAL A CG1  1 
ATOM   880  C  CG2  . VAL A 1 74  ? -18.274 -50.174 63.088  1.00 49.48  ?  74  VAL A CG2  1 
ATOM   881  H  H    . VAL A 1 74  ? -18.211 -48.620 65.197  1.00 62.53  ?  74  VAL A H    1 
ATOM   882  H  HA   . VAL A 1 74  ? -17.504 -51.024 66.226  1.00 56.35  ?  74  VAL A HA   1 
ATOM   883  H  HB   . VAL A 1 74  ? -17.749 -51.899 64.054  1.00 61.01  ?  74  VAL A HB   1 
ATOM   884  H  HG11 . VAL A 1 74  ? -20.079 -51.902 64.000  1.00 69.68  ?  74  VAL A HG11 1 
ATOM   885  H  HG12 . VAL A 1 74  ? -19.558 -52.105 65.488  1.00 69.68  ?  74  VAL A HG12 1 
ATOM   886  H  HG13 . VAL A 1 74  ? -20.101 -50.686 65.022  1.00 69.68  ?  74  VAL A HG13 1 
ATOM   887  H  HG21 . VAL A 1 74  ? -18.756 -50.625 62.377  1.00 59.46  ?  74  VAL A HG21 1 
ATOM   888  H  HG22 . VAL A 1 74  ? -18.731 -49.353 63.329  1.00 59.46  ?  74  VAL A HG22 1 
ATOM   889  H  HG23 . VAL A 1 74  ? -17.368 -49.977 62.800  1.00 59.46  ?  74  VAL A HG23 1 
ATOM   890  N  N    . ILE A 1 75  ? -15.396 -49.099 65.524  1.00 46.31  ?  75  ILE A N    1 
ATOM   891  C  CA   . ILE A 1 75  ? -13.982 -48.818 65.293  1.00 47.15  ?  75  ILE A CA   1 
ATOM   892  C  C    . ILE A 1 75  ? -13.334 -48.587 66.651  1.00 49.40  ?  75  ILE A C    1 
ATOM   893  O  O    . ILE A 1 75  ? -13.593 -47.569 67.306  1.00 49.68  ?  75  ILE A O    1 
ATOM   894  C  CB   . ILE A 1 75  ? -13.773 -47.608 64.372  1.00 51.02  ?  75  ILE A CB   1 
ATOM   895  C  CG1  . ILE A 1 75  ? -14.442 -47.845 63.014  1.00 43.13  ?  75  ILE A CG1  1 
ATOM   896  C  CG2  . ILE A 1 75  ? -12.281 -47.340 64.181  1.00 45.73  ?  75  ILE A CG2  1 
ATOM   897  C  CD1  . ILE A 1 75  ? -14.540 -46.603 62.154  1.00 41.11  ?  75  ILE A CD1  1 
ATOM   898  H  H    . ILE A 1 75  ? -15.806 -48.468 65.939  1.00 55.65  ?  75  ILE A H    1 
ATOM   899  H  HA   . ILE A 1 75  ? -13.564 -49.591 64.882  1.00 56.66  ?  75  ILE A HA   1 
ATOM   900  H  HB   . ILE A 1 75  ? -14.177 -46.829 64.786  1.00 61.31  ?  75  ILE A HB   1 
ATOM   901  H  HG12 . ILE A 1 75  ? -13.927 -48.505 62.523  1.00 51.84  ?  75  ILE A HG12 1 
ATOM   902  H  HG13 . ILE A 1 75  ? -15.342 -48.174 63.162  1.00 51.84  ?  75  ILE A HG13 1 
ATOM   903  H  HG21 . ILE A 1 75  ? -12.171 -46.573 63.597  1.00 54.95  ?  75  ILE A HG21 1 
ATOM   904  H  HG22 . ILE A 1 75  ? -11.879 -47.158 65.045  1.00 54.95  ?  75  ILE A HG22 1 
ATOM   905  H  HG23 . ILE A 1 75  ? -11.869 -48.122 63.781  1.00 54.95  ?  75  ILE A HG23 1 
ATOM   906  H  HD11 . ILE A 1 75  ? -14.972 -46.832 61.317  1.00 49.41  ?  75  ILE A HD11 1 
ATOM   907  H  HD12 . ILE A 1 75  ? -15.063 -45.934 62.624  1.00 49.41  ?  75  ILE A HD12 1 
ATOM   908  H  HD13 . ILE A 1 75  ? -13.646 -46.265 61.985  1.00 49.41  ?  75  ILE A HD13 1 
ATOM   909  N  N    . GLU A 1 76  ? -12.485 -49.522 67.068  1.00 47.89  ?  76  GLU A N    1 
ATOM   910  C  CA   . GLU A 1 76  ? -11.800 -49.391 68.346  1.00 54.93  ?  76  GLU A CA   1 
ATOM   911  C  C    . GLU A 1 76  ? -10.884 -48.174 68.331  1.00 52.30  ?  76  GLU A C    1 
ATOM   912  O  O    . GLU A 1 76  ? -10.259 -47.858 67.315  1.00 50.19  ?  76  GLU A O    1 
ATOM   913  C  CB   . GLU A 1 76  ? -10.996 -50.657 68.647  1.00 55.98  ?  76  GLU A CB   1 
ATOM   914  C  CG   . GLU A 1 76  ? -10.959 -51.031 70.120  1.00 60.08  ?  76  GLU A CG   1 
ATOM   915  C  CD   . GLU A 1 76  ? -10.554 -52.473 70.348  1.00 59.98  ?  76  GLU A CD   1 
ATOM   916  O  OE1  . GLU A 1 76  ? -11.078 -53.359 69.639  1.00 61.69  ?  76  GLU A OE1  1 
ATOM   917  O  OE2  . GLU A 1 76  ? -9.716  -52.723 71.239  1.00 72.23  ?  76  GLU A OE2  1 
ATOM   918  H  H    . GLU A 1 76  ? -12.289 -50.236 66.632  1.00 57.55  ?  76  GLU A H    1 
ATOM   919  H  HA   . GLU A 1 76  ? -12.456 -49.271 69.051  1.00 65.99  ?  76  GLU A HA   1 
ATOM   920  H  HB2  . GLU A 1 76  ? -11.391 -51.400 68.164  1.00 67.26  ?  76  GLU A HB2  1 
ATOM   921  H  HB3  . GLU A 1 76  ? -10.082 -50.523 68.353  1.00 67.26  ?  76  GLU A HB3  1 
ATOM   922  H  HG2  . GLU A 1 76  ? -10.316 -50.463 70.574  1.00 72.18  ?  76  GLU A HG2  1 
ATOM   923  H  HG3  . GLU A 1 76  ? -11.842 -50.903 70.501  1.00 72.18  ?  76  GLU A HG3  1 
ATOM   924  N  N    . ASN A 1 77  ? -10.814 -47.486 69.470  1.00 46.49  ?  77  ASN A N    1 
ATOM   925  C  CA   . ASN A 1 77  ? -10.000 -46.289 69.668  1.00 44.24  ?  77  ASN A CA   1 
ATOM   926  C  C    . ASN A 1 77  ? -10.487 -45.100 68.849  1.00 46.09  ?  77  ASN A C    1 
ATOM   927  O  O    . ASN A 1 77  ? -9.808  -44.066 68.809  1.00 44.86  ?  77  ASN A O    1 
ATOM   928  C  CB   . ASN A 1 77  ? -8.522  -46.552 69.357  1.00 41.26  ?  77  ASN A CB   1 
ATOM   929  C  CG   . ASN A 1 77  ? -7.893  -47.532 70.325  1.00 54.58  ?  77  ASN A CG   1 
ATOM   930  O  OD1  . ASN A 1 77  ? -8.072  -47.421 71.538  1.00 58.94  ?  77  ASN A OD1  1 
ATOM   931  N  ND2  . ASN A 1 77  ? -7.156  -48.501 69.796  1.00 48.63  ?  77  ASN A ND2  1 
ATOM   932  H  H    . ASN A 1 77  ? -11.252 -47.707 70.176  1.00 55.87  ?  77  ASN A H    1 
ATOM   933  H  HA   . ASN A 1 77  ? -10.057 -46.036 70.603  1.00 53.17  ?  77  ASN A HA   1 
ATOM   934  H  HB2  . ASN A 1 77  ? -8.447  -46.921 68.463  1.00 49.60  ?  77  ASN A HB2  1 
ATOM   935  H  HB3  . ASN A 1 77  ? -8.033  -45.716 69.414  1.00 49.60  ?  77  ASN A HB3  1 
ATOM   936  H  HD21 . ASN A 1 77  ? -6.778  -49.082 70.306  1.00 58.43  ?  77  ASN A HD21 1 
ATOM   937  H  HD22 . ASN A 1 77  ? -7.054  -48.547 68.943  1.00 58.43  ?  77  ASN A HD22 1 
ATOM   938  N  N    . ALA A 1 78  ? -11.643 -45.210 68.202  1.00 44.40  ?  78  ALA A N    1 
ATOM   939  C  CA   . ALA A 1 78  ? -12.253 -44.099 67.489  1.00 48.13  ?  78  ALA A CA   1 
ATOM   940  C  C    . ALA A 1 78  ? -13.266 -43.408 68.391  1.00 54.24  ?  78  ALA A C    1 
ATOM   941  O  O    . ALA A 1 78  ? -14.015 -44.066 69.119  1.00 50.87  ?  78  ALA A O    1 
ATOM   942  C  CB   . ALA A 1 78  ? -12.943 -44.578 66.209  1.00 47.27  ?  78  ALA A CB   1 
ATOM   943  H  H    . ALA A 1 78  ? -12.102 -45.937 68.163  1.00 53.37  ?  78  ALA A H    1 
ATOM   944  H  HA   . ALA A 1 78  ? -11.569 -43.456 67.246  1.00 57.84  ?  78  ALA A HA   1 
ATOM   945  H  HB1  . ALA A 1 78  ? -13.338 -43.815 65.759  1.00 56.80  ?  78  ALA A HB1  1 
ATOM   946  H  HB2  . ALA A 1 78  ? -12.284 -44.997 65.634  1.00 56.80  ?  78  ALA A HB2  1 
ATOM   947  H  HB3  . ALA A 1 78  ? -13.633 -45.218 66.443  1.00 56.80  ?  78  ALA A HB3  1 
ATOM   948  N  N    . ARG A 1 79  ? -13.282 -42.083 68.344  1.00 50.65  ?  79  ARG A N    1 
ATOM   949  C  CA   . ARG A 1 79  ? -14.265 -41.338 69.112  1.00 48.02  ?  79  ARG A CA   1 
ATOM   950  C  C    . ARG A 1 79  ? -15.666 -41.651 68.591  1.00 47.97  ?  79  ARG A C    1 
ATOM   951  O  O    . ARG A 1 79  ? -15.881 -41.681 67.374  1.00 50.56  ?  79  ARG A O    1 
ATOM   952  C  CB   . ARG A 1 79  ? -13.985 -39.839 69.021  1.00 46.92  ?  79  ARG A CB   1 
ATOM   953  C  CG   . ARG A 1 79  ? -12.647 -39.432 69.622  1.00 43.40  ?  79  ARG A CG   1 
ATOM   954  C  CD   . ARG A 1 79  ? -12.235 -38.035 69.194  1.00 50.71  ?  79  ARG A CD   1 
ATOM   955  N  NE   . ARG A 1 79  ? -11.846 -37.985 67.787  1.00 55.98  ?  79  ARG A NE   1 
ATOM   956  C  CZ   . ARG A 1 79  ? -11.409 -36.893 67.168  1.00 58.58  ?  79  ARG A CZ   1 
ATOM   957  N  NH1  . ARG A 1 79  ? -11.302 -35.745 67.825  1.00 53.82  ?  79  ARG A NH1  1 
ATOM   958  N  NH2  . ARG A 1 79  ? -11.076 -36.947 65.886  1.00 61.81  ?  79  ARG A NH2  1 
ATOM   959  H  H    . ARG A 1 79  ? -12.744 -41.598 67.881  1.00 60.86  ?  79  ARG A H    1 
ATOM   960  H  HA   . ARG A 1 79  ? -14.217 -41.604 70.044  1.00 57.70  ?  79  ARG A HA   1 
ATOM   961  H  HB2  . ARG A 1 79  ? -13.983 -39.578 68.087  1.00 56.38  ?  79  ARG A HB2  1 
ATOM   962  H  HB3  . ARG A 1 79  ? -14.682 -39.360 69.495  1.00 56.38  ?  79  ARG A HB3  1 
ATOM   963  H  HG2  . ARG A 1 79  ? -12.715 -39.444 70.590  1.00 52.17  ?  79  ARG A HG2  1 
ATOM   964  H  HG3  . ARG A 1 79  ? -11.962 -40.052 69.328  1.00 52.17  ?  79  ARG A HG3  1 
ATOM   965  H  HD2  . ARG A 1 79  ? -12.982 -37.429 69.322  1.00 60.93  ?  79  ARG A HD2  1 
ATOM   966  H  HD3  . ARG A 1 79  ? -11.478 -37.748 69.728  1.00 60.93  ?  79  ARG A HD3  1 
ATOM   967  H  HE   . ARG A 1 79  ? -11.903 -38.711 67.329  1.00 67.26  ?  79  ARG A HE   1 
ATOM   968  H  HH11 . ARG A 1 79  ? -11.516 -35.705 68.657  1.00 64.66  ?  79  ARG A HH11 1 
ATOM   969  H  HH12 . ARG A 1 79  ? -11.019 -35.042 67.419  1.00 64.66  ?  79  ARG A HH12 1 
ATOM   970  H  HH21 . ARG A 1 79  ? -11.144 -37.688 65.455  1.00 74.25  ?  79  ARG A HH21 1 
ATOM   971  H  HH22 . ARG A 1 79  ? -10.794 -36.241 65.484  1.00 74.25  ?  79  ARG A HH22 1 
ATOM   972  N  N    . PRO A 1 80  ? -16.639 -41.892 69.470  1.00 53.12  ?  80  PRO A N    1 
ATOM   973  C  CA   . PRO A 1 80  ? -17.977 -42.269 68.994  1.00 54.68  ?  80  PRO A CA   1 
ATOM   974  C  C    . PRO A 1 80  ? -18.606 -41.165 68.155  1.00 50.32  ?  80  PRO A C    1 
ATOM   975  O  O    . PRO A 1 80  ? -18.609 -39.993 68.536  1.00 48.50  ?  80  PRO A O    1 
ATOM   976  C  CB   . PRO A 1 80  ? -18.761 -42.522 70.289  1.00 53.98  ?  80  PRO A CB   1 
ATOM   977  C  CG   . PRO A 1 80  ? -18.004 -41.805 71.351  1.00 59.12  ?  80  PRO A CG   1 
ATOM   978  C  CD   . PRO A 1 80  ? -16.570 -41.854 70.941  1.00 56.68  ?  80  PRO A CD   1 
ATOM   979  H  HA   . PRO A 1 80  ? -17.936 -43.088 68.475  1.00 65.70  ?  80  PRO A HA   1 
ATOM   980  H  HB2  . PRO A 1 80  ? -19.657 -42.161 70.204  1.00 64.86  ?  80  PRO A HB2  1 
ATOM   981  H  HB3  . PRO A 1 80  ? -18.790 -43.474 70.472  1.00 64.86  ?  80  PRO A HB3  1 
ATOM   982  H  HG2  . PRO A 1 80  ? -18.311 -40.886 71.404  1.00 71.03  ?  80  PRO A HG2  1 
ATOM   983  H  HG3  . PRO A 1 80  ? -18.131 -42.255 72.200  1.00 71.03  ?  80  PRO A HG3  1 
ATOM   984  H  HD2  . PRO A 1 80  ? -16.105 -41.056 71.238  1.00 68.10  ?  80  PRO A HD2  1 
ATOM   985  H  HD3  . PRO A 1 80  ? -16.148 -42.659 71.281  1.00 68.10  ?  80  PRO A HD3  1 
ATOM   986  N  N    . GLY A 1 81  ? -19.139 -41.555 66.998  1.00 54.96  ?  81  GLY A N    1 
ATOM   987  C  CA   . GLY A 1 81  ? -19.788 -40.627 66.098  1.00 54.10  ?  81  GLY A CA   1 
ATOM   988  C  C    . GLY A 1 81  ? -18.859 -39.731 65.307  1.00 49.93  ?  81  GLY A C    1 
ATOM   989  O  O    . GLY A 1 81  ? -19.346 -38.860 64.575  1.00 45.68  ?  81  GLY A O    1 
ATOM   990  H  H    . GLY A 1 81  ? -19.134 -42.367 66.714  1.00 66.04  ?  81  GLY A H    1 
ATOM   991  H  HA2  . GLY A 1 81  ? -20.326 -41.128 65.466  1.00 65.00  ?  81  GLY A HA2  1 
ATOM   992  H  HA3  . GLY A 1 81  ? -20.383 -40.058 66.611  1.00 65.00  ?  81  GLY A HA3  1 
ATOM   993  N  N    . SER A 1 82  ? -17.546 -39.912 65.420  1.00 44.94  ?  82  SER A N    1 
ATOM   994  C  CA   . SER A 1 82  ? -16.594 -39.042 64.738  1.00 50.72  ?  82  SER A CA   1 
ATOM   995  C  C    . SER A 1 82  ? -16.450 -39.463 63.279  1.00 49.52  ?  82  SER A C    1 
ATOM   996  O  O    . SER A 1 82  ? -15.992 -40.574 62.989  1.00 43.79  ?  82  SER A O    1 
ATOM   997  C  CB   . SER A 1 82  ? -15.238 -39.086 65.438  1.00 45.62  ?  82  SER A CB   1 
ATOM   998  O  OG   . SER A 1 82  ? -14.286 -38.302 64.741  1.00 51.18  ?  82  SER A OG   1 
ATOM   999  H  H    . SER A 1 82  ? -17.180 -40.534 65.887  1.00 54.01  ?  82  SER A H    1 
ATOM   1000 H  HA   . SER A 1 82  ? -16.920 -38.129 64.762  1.00 60.95  ?  82  SER A HA   1 
ATOM   1001 H  HB2  . SER A 1 82  ? -15.336 -38.738 66.338  1.00 54.83  ?  82  SER A HB2  1 
ATOM   1002 H  HB3  . SER A 1 82  ? -14.929 -40.005 65.469  1.00 54.83  ?  82  SER A HB3  1 
ATOM   1003 H  HG   . SER A 1 82  ? -13.544 -38.333 65.134  1.00 61.49  ?  82  SER A HG   1 
ATOM   1004 N  N    . PHE A 1 83  ? -16.843 -38.576 62.361  1.00 48.76  ?  83  PHE A N    1 
ATOM   1005 C  CA   . PHE A 1 83  ? -16.576 -38.813 60.946  1.00 52.07  ?  83  PHE A CA   1 
ATOM   1006 C  C    . PHE A 1 83  ? -15.080 -38.795 60.665  1.00 45.65  ?  83  PHE A C    1 
ATOM   1007 O  O    . PHE A 1 83  ? -14.588 -39.565 59.833  1.00 48.24  ?  83  PHE A O    1 
ATOM   1008 C  CB   . PHE A 1 83  ? -17.290 -37.764 60.094  1.00 47.29  ?  83  PHE A CB   1 
ATOM   1009 C  CG   . PHE A 1 83  ? -16.910 -37.802 58.639  1.00 52.90  ?  83  PHE A CG   1 
ATOM   1010 C  CD1  . PHE A 1 83  ? -17.585 -38.626 57.754  1.00 51.67  ?  83  PHE A CD1  1 
ATOM   1011 C  CD2  . PHE A 1 83  ? -15.877 -37.013 58.158  1.00 47.27  ?  83  PHE A CD2  1 
ATOM   1012 C  CE1  . PHE A 1 83  ? -17.236 -38.663 56.416  1.00 46.50  ?  83  PHE A CE1  1 
ATOM   1013 C  CE2  . PHE A 1 83  ? -15.524 -37.047 56.823  1.00 49.15  ?  83  PHE A CE2  1 
ATOM   1014 C  CZ   . PHE A 1 83  ? -16.205 -37.873 55.950  1.00 48.15  ?  83  PHE A CZ   1 
ATOM   1015 H  H    . PHE A 1 83  ? -17.258 -37.843 62.530  1.00 58.60  ?  83  PHE A H    1 
ATOM   1016 H  HA   . PHE A 1 83  ? -16.919 -39.686 60.700  1.00 62.56  ?  83  PHE A HA   1 
ATOM   1017 H  HB2  . PHE A 1 83  ? -18.247 -37.911 60.154  1.00 56.83  ?  83  PHE A HB2  1 
ATOM   1018 H  HB3  . PHE A 1 83  ? -17.071 -36.882 60.435  1.00 56.83  ?  83  PHE A HB3  1 
ATOM   1019 H  HD1  . PHE A 1 83  ? -18.280 -39.161 58.062  1.00 62.09  ?  83  PHE A HD1  1 
ATOM   1020 H  HD2  . PHE A 1 83  ? -15.415 -36.455 58.741  1.00 56.81  ?  83  PHE A HD2  1 
ATOM   1021 H  HE1  . PHE A 1 83  ? -17.697 -39.220 55.831  1.00 55.89  ?  83  PHE A HE1  1 
ATOM   1022 H  HE2  . PHE A 1 83  ? -14.829 -36.513 56.511  1.00 59.07  ?  83  PHE A HE2  1 
ATOM   1023 H  HZ   . PHE A 1 83  ? -15.970 -37.896 55.051  1.00 57.86  ?  83  PHE A HZ   1 
ATOM   1024 N  N    . THR A 1 84  ? -14.343 -37.924 61.357  1.00 44.77  ?  84  THR A N    1 
ATOM   1025 C  CA   . THR A 1 84  ? -12.903 -37.821 61.144  1.00 44.73  ?  84  THR A CA   1 
ATOM   1026 C  C    . THR A 1 84  ? -12.210 -39.152 61.413  1.00 50.41  ?  84  THR A C    1 
ATOM   1027 O  O    . THR A 1 84  ? -11.439 -39.644 60.580  1.00 44.71  ?  84  THR A O    1 
ATOM   1028 C  CB   . THR A 1 84  ? -12.332 -36.718 62.038  1.00 42.69  ?  84  THR A CB   1 
ATOM   1029 O  OG1  . THR A 1 84  ? -12.927 -35.464 61.681  1.00 43.37  ?  84  THR A OG1  1 
ATOM   1030 C  CG2  . THR A 1 84  ? -10.819 -36.611 61.894  1.00 45.44  ?  84  THR A CG2  1 
ATOM   1031 H  H    . THR A 1 84  ? -14.653 -37.386 61.951  1.00 53.81  ?  84  THR A H    1 
ATOM   1032 H  HA   . THR A 1 84  ? -12.736 -37.576 60.220  1.00 53.75  ?  84  THR A HA   1 
ATOM   1033 H  HB   . THR A 1 84  ? -12.537 -36.917 62.965  1.00 51.31  ?  84  THR A HB   1 
ATOM   1034 H  HG1  . THR A 1 84  ? -12.619 -34.852 62.167  1.00 52.12  ?  84  THR A HG1  1 
ATOM   1035 H  HG21 . THR A 1 84  ? -10.480 -35.907 62.468  1.00 54.61  ?  84  THR A HG21 1 
ATOM   1036 H  HG22 . THR A 1 84  ? -10.403 -37.451 62.144  1.00 54.61  ?  84  THR A HG22 1 
ATOM   1037 H  HG23 . THR A 1 84  ? -10.588 -36.407 60.974  1.00 54.61  ?  84  THR A HG23 1 
ATOM   1038 N  N    . ASP A 1 85  ? -12.471 -39.751 62.577  1.00 42.51  ?  85  ASP A N    1 
ATOM   1039 C  CA   . ASP A 1 85  ? -11.817 -41.010 62.922  1.00 48.54  ?  85  ASP A CA   1 
ATOM   1040 C  C    . ASP A 1 85  ? -12.234 -42.124 61.971  1.00 46.60  ?  85  ASP A C    1 
ATOM   1041 O  O    . ASP A 1 85  ? -11.413 -42.970 61.595  1.00 41.73  ?  85  ASP A O    1 
ATOM   1042 C  CB   . ASP A 1 85  ? -12.141 -41.390 64.367  1.00 48.36  ?  85  ASP A CB   1 
ATOM   1043 C  CG   . ASP A 1 85  ? -11.568 -40.408 65.371  1.00 53.97  ?  85  ASP A CG   1 
ATOM   1044 O  OD1  . ASP A 1 85  ? -10.778 -39.531 64.965  1.00 51.43  ?  85  ASP A OD1  1 
ATOM   1045 O  OD2  . ASP A 1 85  ? -11.909 -40.512 66.569  1.00 55.82  ?  85  ASP A OD2  1 
ATOM   1046 H  H    . ASP A 1 85  ? -13.013 -39.453 63.174  1.00 51.09  ?  85  ASP A H    1 
ATOM   1047 H  HA   . ASP A 1 85  ? -10.856 -40.897 62.849  1.00 58.33  ?  85  ASP A HA   1 
ATOM   1048 H  HB2  . ASP A 1 85  ? -13.104 -41.409 64.481  1.00 58.11  ?  85  ASP A HB2  1 
ATOM   1049 H  HB3  . ASP A 1 85  ? -11.766 -42.265 64.555  1.00 58.11  ?  85  ASP A HB3  1 
ATOM   1050 N  N    . ALA A 1 86  ? -13.509 -42.149 61.579  1.00 37.51  ?  86  ALA A N    1 
ATOM   1051 C  CA   . ALA A 1 86  ? -13.968 -43.155 60.631  1.00 51.65  ?  86  ALA A CA   1 
ATOM   1052 C  C    . ALA A 1 86  ? -13.354 -42.939 59.254  1.00 48.17  ?  86  ALA A C    1 
ATOM   1053 O  O    . ALA A 1 86  ? -13.078 -43.909 58.540  1.00 41.18  ?  86  ALA A O    1 
ATOM   1054 C  CB   . ALA A 1 86  ? -15.493 -43.133 60.544  1.00 44.18  ?  86  ALA A CB   1 
ATOM   1055 H  H    . ALA A 1 86  ? -14.117 -41.602 61.845  1.00 45.09  ?  86  ALA A H    1 
ATOM   1056 H  HA   . ALA A 1 86  ? -13.697 -44.032 60.945  1.00 62.06  ?  86  ALA A HA   1 
ATOM   1057 H  HB1  . ALA A 1 86  ? -15.782 -43.807 59.910  1.00 53.10  ?  86  ALA A HB1  1 
ATOM   1058 H  HB2  . ALA A 1 86  ? -15.861 -43.323 61.421  1.00 53.10  ?  86  ALA A HB2  1 
ATOM   1059 H  HB3  . ALA A 1 86  ? -15.779 -42.255 60.248  1.00 53.10  ?  86  ALA A HB3  1 
ATOM   1060 N  N    . PHE A 1 87  ? -13.131 -41.680 58.871  1.00 37.89  ?  87  PHE A N    1 
ATOM   1061 C  CA   . PHE A 1 87  ? -12.540 -41.380 57.572  1.00 42.89  ?  87  PHE A CA   1 
ATOM   1062 C  C    . PHE A 1 87  ? -11.100 -41.869 57.500  1.00 44.73  ?  87  PHE A C    1 
ATOM   1063 O  O    . PHE A 1 87  ? -10.699 -42.511 56.522  1.00 43.81  ?  87  PHE A O    1 
ATOM   1064 C  CB   . PHE A 1 87  ? -12.611 -39.875 57.307  1.00 41.10  ?  87  PHE A CB   1 
ATOM   1065 C  CG   . PHE A 1 87  ? -11.978 -39.454 56.012  1.00 43.48  ?  87  PHE A CG   1 
ATOM   1066 C  CD1  . PHE A 1 87  ? -12.695 -39.498 54.828  1.00 41.09  ?  87  PHE A CD1  1 
ATOM   1067 C  CD2  . PHE A 1 87  ? -10.667 -39.011 55.979  1.00 39.18  ?  87  PHE A CD2  1 
ATOM   1068 C  CE1  . PHE A 1 87  ? -12.115 -39.110 53.636  1.00 40.76  ?  87  PHE A CE1  1 
ATOM   1069 C  CE2  . PHE A 1 87  ? -10.082 -38.623 54.789  1.00 45.09  ?  87  PHE A CE2  1 
ATOM   1070 C  CZ   . PHE A 1 87  ? -10.808 -38.672 53.617  1.00 41.08  ?  87  PHE A CZ   1 
ATOM   1071 H  H    . PHE A 1 87  ? -13.313 -40.986 59.346  1.00 45.55  ?  87  PHE A H    1 
ATOM   1072 H  HA   . PHE A 1 87  ? -13.047 -41.832 56.880  1.00 51.55  ?  87  PHE A HA   1 
ATOM   1073 H  HB2  . PHE A 1 87  ? -13.543 -39.606 57.283  1.00 49.40  ?  87  PHE A HB2  1 
ATOM   1074 H  HB3  . PHE A 1 87  ? -12.154 -39.410 58.025  1.00 49.40  ?  87  PHE A HB3  1 
ATOM   1075 H  HD1  . PHE A 1 87  ? -13.577 -39.793 54.836  1.00 49.39  ?  87  PHE A HD1  1 
ATOM   1076 H  HD2  . PHE A 1 87  ? -10.173 -38.977 56.767  1.00 47.10  ?  87  PHE A HD2  1 
ATOM   1077 H  HE1  . PHE A 1 87  ? -12.606 -39.144 52.847  1.00 48.99  ?  87  PHE A HE1  1 
ATOM   1078 H  HE2  . PHE A 1 87  ? -9.200  -38.328 54.779  1.00 54.19  ?  87  PHE A HE2  1 
ATOM   1079 H  HZ   . PHE A 1 87  ? -10.416 -38.411 52.815  1.00 49.38  ?  87  PHE A HZ   1 
ATOM   1080 N  N    . PHE A 1 88  ? -10.306 -41.579 58.530  1.00 40.98  ?  88  PHE A N    1 
ATOM   1081 C  CA   . PHE A 1 88  ? -8.907  -41.979 58.508  1.00 42.83  ?  88  PHE A CA   1 
ATOM   1082 C  C    . PHE A 1 88  ? -8.750  -43.481 58.697  1.00 47.46  ?  88  PHE A C    1 
ATOM   1083 O  O    . PHE A 1 88  ? -7.809  -44.075 58.158  1.00 43.11  ?  88  PHE A O    1 
ATOM   1084 C  CB   . PHE A 1 88  ? -8.132  -41.207 59.573  1.00 42.90  ?  88  PHE A CB   1 
ATOM   1085 C  CG   . PHE A 1 88  ? -8.001  -39.738 59.274  1.00 47.57  ?  88  PHE A CG   1 
ATOM   1086 C  CD1  . PHE A 1 88  ? -7.574  -39.308 58.026  1.00 45.39  ?  88  PHE A CD1  1 
ATOM   1087 C  CD2  . PHE A 1 88  ? -8.313  -38.788 60.232  1.00 42.61  ?  88  PHE A CD2  1 
ATOM   1088 C  CE1  . PHE A 1 88  ? -7.453  -37.961 57.745  1.00 43.41  ?  88  PHE A CE1  1 
ATOM   1089 C  CE2  . PHE A 1 88  ? -8.193  -37.438 59.954  1.00 41.96  ?  88  PHE A CE2  1 
ATOM   1090 C  CZ   . PHE A 1 88  ? -7.764  -37.025 58.710  1.00 46.98  ?  88  PHE A CZ   1 
ATOM   1091 H  H    . PHE A 1 88  ? -10.551 -41.159 59.240  1.00 49.26  ?  88  PHE A H    1 
ATOM   1092 H  HA   . PHE A 1 88  ? -8.530  -41.749 57.644  1.00 51.48  ?  88  PHE A HA   1 
ATOM   1093 H  HB2  . PHE A 1 88  ? -8.593  -41.297 60.422  1.00 51.56  ?  88  PHE A HB2  1 
ATOM   1094 H  HB3  . PHE A 1 88  ? -7.239  -41.578 59.641  1.00 51.56  ?  88  PHE A HB3  1 
ATOM   1095 H  HD1  . PHE A 1 88  ? -7.362  -39.934 57.373  1.00 54.54  ?  88  PHE A HD1  1 
ATOM   1096 H  HD2  . PHE A 1 88  ? -8.602  -39.060 61.073  1.00 51.22  ?  88  PHE A HD2  1 
ATOM   1097 H  HE1  . PHE A 1 88  ? -7.164  -37.685 56.905  1.00 52.18  ?  88  PHE A HE1  1 
ATOM   1098 H  HE2  . PHE A 1 88  ? -8.403  -36.809 60.606  1.00 50.44  ?  88  PHE A HE2  1 
ATOM   1099 H  HZ   . PHE A 1 88  ? -7.684  -36.118 58.522  1.00 56.46  ?  88  PHE A HZ   1 
ATOM   1100 N  N    . PHE A 1 89  ? -9.656  -44.117 59.444  1.00 44.30  ?  89  PHE A N    1 
ATOM   1101 C  CA   . PHE A 1 89  ? -9.658  -45.575 59.492  1.00 44.47  ?  89  PHE A CA   1 
ATOM   1102 C  C    . PHE A 1 89  ? -9.969  -46.159 58.120  1.00 34.84  ?  89  PHE A C    1 
ATOM   1103 O  O    . PHE A 1 89  ? -9.385  -47.172 57.719  1.00 37.63  ?  89  PHE A O    1 
ATOM   1104 C  CB   . PHE A 1 89  ? -10.668 -46.075 60.524  1.00 39.32  ?  89  PHE A CB   1 
ATOM   1105 C  CG   . PHE A 1 89  ? -10.915 -47.553 60.451  1.00 33.89  ?  89  PHE A CG   1 
ATOM   1106 C  CD1  . PHE A 1 89  ? -9.936  -48.450 60.839  1.00 37.17  ?  89  PHE A CD1  1 
ATOM   1107 C  CD2  . PHE A 1 89  ? -12.122 -48.045 59.984  1.00 37.88  ?  89  PHE A CD2  1 
ATOM   1108 C  CE1  . PHE A 1 89  ? -10.156 -49.809 60.767  1.00 36.56  ?  89  PHE A CE1  1 
ATOM   1109 C  CE2  . PHE A 1 89  ? -12.347 -49.405 59.910  1.00 36.07  ?  89  PHE A CE2  1 
ATOM   1110 C  CZ   . PHE A 1 89  ? -11.362 -50.288 60.301  1.00 35.22  ?  89  PHE A CZ   1 
ATOM   1111 H  H    . PHE A 1 89  ? -10.263 -43.737 59.919  1.00 53.24  ?  89  PHE A H    1 
ATOM   1112 H  HA   . PHE A 1 89  ? -8.778  -45.884 59.758  1.00 53.45  ?  89  PHE A HA   1 
ATOM   1113 H  HB2  . PHE A 1 89  ? -10.334 -45.872 61.412  1.00 47.27  ?  89  PHE A HB2  1 
ATOM   1114 H  HB3  . PHE A 1 89  ? -11.514 -45.623 60.378  1.00 47.27  ?  89  PHE A HB3  1 
ATOM   1115 H  HD1  . PHE A 1 89  ? -9.120  -48.132 61.152  1.00 44.69  ?  89  PHE A HD1  1 
ATOM   1116 H  HD2  . PHE A 1 89  ? -12.788 -47.453 59.718  1.00 45.53  ?  89  PHE A HD2  1 
ATOM   1117 H  HE1  . PHE A 1 89  ? -9.490  -50.403 61.032  1.00 43.96  ?  89  PHE A HE1  1 
ATOM   1118 H  HE2  . PHE A 1 89  ? -13.162 -49.725 59.596  1.00 43.37  ?  89  PHE A HE2  1 
ATOM   1119 H  HZ   . PHE A 1 89  ? -11.513 -51.204 60.254  1.00 42.34  ?  89  PHE A HZ   1 
ATOM   1120 N  N    . SER A 1 90  ? -10.896 -45.536 57.390  1.00 35.59  ?  90  SER A N    1 
ATOM   1121 C  CA   . SER A 1 90  ? -11.187 -45.962 56.025  1.00 44.16  ?  90  SER A CA   1 
ATOM   1122 C  C    . SER A 1 90  ? -9.949  -45.843 55.144  1.00 40.01  ?  90  SER A C    1 
ATOM   1123 O  O    . SER A 1 90  ? -9.625  -46.759 54.379  1.00 43.73  ?  90  SER A O    1 
ATOM   1124 C  CB   . SER A 1 90  ? -12.339 -45.131 55.459  1.00 41.42  ?  90  SER A CB   1 
ATOM   1125 O  OG   . SER A 1 90  ? -12.523 -45.379 54.077  1.00 47.68  ?  90  SER A OG   1 
ATOM   1126 H  H    . SER A 1 90  ? -11.366 -44.869 57.662  1.00 42.79  ?  90  SER A H    1 
ATOM   1127 H  HA   . SER A 1 90  ? -11.462 -46.892 56.035  1.00 53.07  ?  90  SER A HA   1 
ATOM   1128 H  HB2  . SER A 1 90  ? -13.154 -45.361 55.931  1.00 49.79  ?  90  SER A HB2  1 
ATOM   1129 H  HB3  . SER A 1 90  ? -12.139 -44.190 55.585  1.00 49.79  ?  90  SER A HB3  1 
ATOM   1130 H  HG   . SER A 1 90  ? -12.698 -46.191 53.952  1.00 57.30  ?  90  SER A HG   1 
ATOM   1131 N  N    . VAL A 1 91  ? -9.243  -44.715 55.243  1.00 39.89  ?  91  VAL A N    1 
ATOM   1132 C  CA   . VAL A 1 91  ? -7.999  -44.534 54.498  1.00 40.83  ?  91  VAL A CA   1 
ATOM   1133 C  C    . VAL A 1 91  ? -7.018  -45.652 54.828  1.00 40.37  ?  91  VAL A C    1 
ATOM   1134 O  O    . VAL A 1 91  ? -6.470  -46.309 53.935  1.00 36.86  ?  91  VAL A O    1 
ATOM   1135 C  CB   . VAL A 1 91  ? -7.395  -43.150 54.800  1.00 34.73  ?  91  VAL A CB   1 
ATOM   1136 C  CG1  . VAL A 1 91  ? -5.982  -43.027 54.237  1.00 38.61  ?  91  VAL A CG1  1 
ATOM   1137 C  CG2  . VAL A 1 91  ? -8.284  -42.049 54.239  1.00 40.34  ?  91  VAL A CG2  1 
ATOM   1138 H  H    . VAL A 1 91  ? -9.463  -44.043 55.732  1.00 47.95  ?  91  VAL A H    1 
ATOM   1139 H  HA   . VAL A 1 91  ? -8.191  -44.576 53.548  1.00 49.07  ?  91  VAL A HA   1 
ATOM   1140 H  HB   . VAL A 1 91  ? -7.344  -43.031 55.762  1.00 41.76  ?  91  VAL A HB   1 
ATOM   1141 H  HG11 . VAL A 1 91  ? -5.635  -42.145 54.445  1.00 46.42  ?  91  VAL A HG11 1 
ATOM   1142 H  HG12 . VAL A 1 91  ? -5.421  -43.707 54.640  1.00 46.42  ?  91  VAL A HG12 1 
ATOM   1143 H  HG13 . VAL A 1 91  ? -6.014  -43.151 53.275  1.00 46.42  ?  91  VAL A HG13 1 
ATOM   1144 H  HG21 . VAL A 1 91  ? -7.886  -41.187 54.440  1.00 48.48  ?  91  VAL A HG21 1 
ATOM   1145 H  HG22 . VAL A 1 91  ? -8.359  -42.162 53.278  1.00 48.48  ?  91  VAL A HG22 1 
ATOM   1146 H  HG23 . VAL A 1 91  ? -9.161  -42.112 54.649  1.00 48.48  ?  91  VAL A HG23 1 
ATOM   1147 N  N    . GLN A 1 92  ? -6.773  -45.875 56.120  1.00 40.72  ?  92  GLN A N    1 
ATOM   1148 C  CA   . GLN A 1 92  ? -5.821  -46.896 56.539  1.00 34.02  ?  92  GLN A CA   1 
ATOM   1149 C  C    . GLN A 1 92  ? -6.243  -48.288 56.099  1.00 28.49  ?  92  GLN A C    1 
ATOM   1150 O  O    . GLN A 1 92  ? -5.388  -49.171 55.973  1.00 36.25  ?  92  GLN A O    1 
ATOM   1151 C  CB   . GLN A 1 92  ? -5.657  -46.855 58.059  1.00 39.65  ?  92  GLN A CB   1 
ATOM   1152 C  CG   . GLN A 1 92  ? -5.076  -45.552 58.577  1.00 41.04  ?  92  GLN A CG   1 
ATOM   1153 C  CD   . GLN A 1 92  ? -5.159  -45.442 60.086  1.00 49.56  ?  92  GLN A CD   1 
ATOM   1154 O  OE1  . GLN A 1 92  ? -5.363  -46.437 60.782  1.00 40.29  ?  92  GLN A OE1  1 
ATOM   1155 N  NE2  . GLN A 1 92  ? -5.005  -44.227 60.600  1.00 38.79  ?  92  GLN A NE2  1 
ATOM   1156 H  H    . GLN A 1 92  ? -7.145  -45.449 56.769  1.00 48.95  ?  92  GLN A H    1 
ATOM   1157 H  HA   . GLN A 1 92  ? -4.959  -46.704 56.139  1.00 40.90  ?  92  GLN A HA   1 
ATOM   1158 H  HB2  . GLN A 1 92  ? -6.527  -46.977 58.471  1.00 47.66  ?  92  GLN A HB2  1 
ATOM   1159 H  HB3  . GLN A 1 92  ? -5.062  -47.572 58.329  1.00 47.66  ?  92  GLN A HB3  1 
ATOM   1160 H  HG2  . GLN A 1 92  ? -4.142  -45.497 58.321  1.00 49.33  ?  92  GLN A HG2  1 
ATOM   1161 H  HG3  . GLN A 1 92  ? -5.570  -44.810 58.193  1.00 49.33  ?  92  GLN A HG3  1 
ATOM   1162 H  HE21 . GLN A 1 92  ? -4.865  -43.555 60.081  1.00 46.63  ?  92  GLN A HE21 1 
ATOM   1163 H  HE22 . GLN A 1 92  ? -5.044  -44.112 61.451  1.00 46.63  ?  92  GLN A HE22 1 
ATOM   1164 N  N    . THR A 1 93  ? -7.535  -48.504 55.862  1.00 34.80  ?  93  THR A N    1 
ATOM   1165 C  CA   . THR A 1 93  ? -8.029  -49.793 55.395  1.00 35.20  ?  93  THR A CA   1 
ATOM   1166 C  C    . THR A 1 93  ? -7.952  -49.909 53.874  1.00 33.99  ?  93  THR A C    1 
ATOM   1167 O  O    . THR A 1 93  ? -7.445  -50.906 53.351  1.00 35.07  ?  93  THR A O    1 
ATOM   1168 C  CB   . THR A 1 93  ? -9.469  -50.001 55.879  1.00 34.92  ?  93  THR A CB   1 
ATOM   1169 O  OG1  . THR A 1 93  ? -9.504  -49.959 57.313  1.00 38.96  ?  93  THR A OG1  1 
ATOM   1170 C  CG2  . THR A 1 93  ? -10.015 -51.342 55.411  1.00 32.49  ?  93  THR A CG2  1 
ATOM   1171 H  H    . THR A 1 93  ? -8.151  -47.912 55.966  1.00 41.84  ?  93  THR A H    1 
ATOM   1172 H  HA   . THR A 1 93  ? -7.481  -50.496 55.777  1.00 42.32  ?  93  THR A HA   1 
ATOM   1173 H  HB   . THR A 1 93  ? -10.034 -49.298 55.522  1.00 41.99  ?  93  THR A HB   1 
ATOM   1174 H  HG1  . THR A 1 93  ? -9.226  -49.214 57.585  1.00 46.84  ?  93  THR A HG1  1 
ATOM   1175 H  HG21 . THR A 1 93  ? -10.926 -51.456 55.725  1.00 39.07  ?  93  THR A HG21 1 
ATOM   1176 H  HG22 . THR A 1 93  ? -10.009 -51.381 54.442  1.00 39.07  ?  93  THR A HG22 1 
ATOM   1177 H  HG23 . THR A 1 93  ? -9.468  -52.063 55.759  1.00 39.07  ?  93  THR A HG23 1 
ATOM   1178 N  N    . MET A 1 94  ? -8.442  -48.899 53.152  1.00 37.49  ?  94  MET A N    1 
ATOM   1179 C  CA   . MET A 1 94  ? -8.416  -48.948 51.692  1.00 40.27  ?  94  MET A CA   1 
ATOM   1180 C  C    . MET A 1 94  ? -6.986  -48.946 51.166  1.00 37.27  ?  94  MET A C    1 
ATOM   1181 O  O    . MET A 1 94  ? -6.659  -49.697 50.240  1.00 35.63  ?  94  MET A O    1 
ATOM   1182 C  CB   . MET A 1 94  ? -9.198  -47.770 51.112  1.00 37.69  ?  94  MET A CB   1 
ATOM   1183 C  CG   . MET A 1 94  ? -9.214  -47.718 49.583  1.00 42.43  ?  94  MET A CG   1 
ATOM   1184 S  SD   . MET A 1 94  ? -9.907  -46.180 48.954  1.00 41.91  ?  94  MET A SD   1 
ATOM   1185 C  CE   . MET A 1 94  ? -11.634 -46.403 49.373  1.00 43.97  ?  94  MET A CE   1 
ATOM   1186 H  H    . MET A 1 94  ? -8.791  -48.184 53.480  1.00 45.07  ?  94  MET A H    1 
ATOM   1187 H  HA   . MET A 1 94  ? -8.852  -49.764 51.401  1.00 48.41  ?  94  MET A HA   1 
ATOM   1188 H  HB2  . MET A 1 94  ? -10.117 -47.828 51.415  1.00 45.31  ?  94  MET A HB2  1 
ATOM   1189 H  HB3  . MET A 1 94  ? -8.799  -46.945 51.431  1.00 45.31  ?  94  MET A HB3  1 
ATOM   1190 H  HG2  . MET A 1 94  ? -8.305  -47.795 49.254  1.00 51.00  ?  94  MET A HG2  1 
ATOM   1191 H  HG3  . MET A 1 94  ? -9.754  -48.451 49.247  1.00 51.00  ?  94  MET A HG3  1 
ATOM   1192 H  HE1  . MET A 1 94  ? -12.132 -45.624 49.081  1.00 52.85  ?  94  MET A HE1  1 
ATOM   1193 H  HE2  . MET A 1 94  ? -11.967 -47.196 48.925  1.00 52.85  ?  94  MET A HE2  1 
ATOM   1194 H  HE3  . MET A 1 94  ? -11.715 -46.507 50.334  1.00 52.85  ?  94  MET A HE3  1 
ATOM   1195 N  N    . ALA A 1 95  ? -6.123  -48.099 51.733  1.00 36.81  ?  95  ALA A N    1 
ATOM   1196 C  CA   . ALA A 1 95  ? -4.712  -48.101 51.371  1.00 35.87  ?  95  ALA A CA   1 
ATOM   1197 C  C    . ALA A 1 95  ? -3.955  -49.277 51.969  1.00 33.50  ?  95  ALA A C    1 
ATOM   1198 O  O    . ALA A 1 95  ? -2.784  -49.475 51.628  1.00 38.30  ?  95  ALA A O    1 
ATOM   1199 C  CB   . ALA A 1 95  ? -4.055  -46.794 51.814  1.00 37.78  ?  95  ALA A CB   1 
ATOM   1200 H  H    . ALA A 1 95  ? -6.334  -47.516 52.329  1.00 44.26  ?  95  ALA A H    1 
ATOM   1201 H  HA   . ALA A 1 95  ? -4.636  -48.159 50.405  1.00 43.13  ?  95  ALA A HA   1 
ATOM   1202 H  HB1  . ALA A 1 95  ? -3.117  -46.812 51.566  1.00 45.42  ?  95  ALA A HB1  1 
ATOM   1203 H  HB2  . ALA A 1 95  ? -4.500  -46.052 51.375  1.00 45.42  ?  95  ALA A HB2  1 
ATOM   1204 H  HB3  . ALA A 1 95  ? -4.141  -46.709 52.777  1.00 45.42  ?  95  ALA A HB3  1 
ATOM   1205 N  N    . THR A 1 96  ? -4.592  -50.051 52.850  1.00 37.17  ?  96  THR A N    1 
ATOM   1206 C  CA   . THR A 1 96  ? -3.989  -51.236 53.461  1.00 40.76  ?  96  THR A CA   1 
ATOM   1207 C  C    . THR A 1 96  ? -2.787  -50.883 54.335  1.00 39.34  ?  96  THR A C    1 
ATOM   1208 O  O    . THR A 1 96  ? -1.867  -51.685 54.495  1.00 40.04  ?  96  THR A O    1 
ATOM   1209 C  CB   . THR A 1 96  ? -3.593  -52.273 52.400  1.00 45.42  ?  96  THR A CB   1 
ATOM   1210 O  OG1  . THR A 1 96  ? -2.624  -51.714 51.505  1.00 44.03  ?  96  THR A OG1  1 
ATOM   1211 C  CG2  . THR A 1 96  ? -4.813  -52.721 51.607  1.00 39.51  ?  96  THR A CG2  1 
ATOM   1212 H  H    . THR A 1 96  ? -5.397  -49.905 53.115  1.00 44.68  ?  96  THR A H    1 
ATOM   1213 H  HA   . THR A 1 96  ? -4.651  -51.651 54.036  1.00 48.99  ?  96  THR A HA   1 
ATOM   1214 H  HB   . THR A 1 96  ? -3.212  -53.050 52.839  1.00 54.59  ?  96  THR A HB   1 
ATOM   1215 H  HG1  . THR A 1 96  ? -1.938  -51.484 51.931  1.00 52.91  ?  96  THR A HG1  1 
ATOM   1216 H  HG21 . THR A 1 96  ? -4.552  -53.376 50.940  1.00 47.50  ?  96  THR A HG21 1 
ATOM   1217 H  HG22 . THR A 1 96  ? -5.466  -53.121 52.202  1.00 47.50  ?  96  THR A HG22 1 
ATOM   1218 H  HG23 . THR A 1 96  ? -5.217  -51.960 51.161  1.00 47.50  ?  96  THR A HG23 1 
ATOM   1219 N  N    . ILE A 1 97  ? -2.787  -49.687 54.928  1.00 46.13  ?  97  ILE A N    1 
ATOM   1220 C  CA   . ILE A 1 97  ? -1.730  -49.333 55.872  1.00 39.12  ?  97  ILE A CA   1 
ATOM   1221 C  C    . ILE A 1 97  ? -1.882  -50.137 57.158  1.00 39.60  ?  97  ILE A C    1 
ATOM   1222 O  O    . ILE A 1 97  ? -0.926  -50.757 57.638  1.00 38.02  ?  97  ILE A O    1 
ATOM   1223 C  CB   . ILE A 1 97  ? -1.743  -47.820 56.155  1.00 42.77  ?  97  ILE A CB   1 
ATOM   1224 C  CG1  . ILE A 1 97  ? -1.583  -47.027 54.857  1.00 38.07  ?  97  ILE A CG1  1 
ATOM   1225 C  CG2  . ILE A 1 97  ? -0.626  -47.452 57.129  1.00 37.96  ?  97  ILE A CG2  1 
ATOM   1226 C  CD1  . ILE A 1 97  ? -1.833  -45.546 55.013  1.00 38.32  ?  97  ILE A CD1  1 
ATOM   1227 H  H    . ILE A 1 97  ? -3.377  -49.075 54.802  1.00 55.44  ?  97  ILE A H    1 
ATOM   1228 H  HA   . ILE A 1 97  ? -0.871  -49.555 55.481  1.00 47.02  ?  97  ILE A HA   1 
ATOM   1229 H  HB   . ILE A 1 97  ? -2.595  -47.587 56.558  1.00 51.41  ?  97  ILE A HB   1 
ATOM   1230 H  HG12 . ILE A 1 97  ? -0.677  -47.142 54.530  1.00 45.77  ?  97  ILE A HG12 1 
ATOM   1231 H  HG13 . ILE A 1 97  ? -2.214  -47.367 54.203  1.00 45.77  ?  97  ILE A HG13 1 
ATOM   1232 H  HG21 . ILE A 1 97  ? -0.653  -46.496 57.293  1.00 45.64  ?  97  ILE A HG21 1 
ATOM   1233 H  HG22 . ILE A 1 97  ? -0.761  -47.935 57.960  1.00 45.64  ?  97  ILE A HG22 1 
ATOM   1234 H  HG23 . ILE A 1 97  ? 0.227   -47.698 56.738  1.00 45.64  ?  97  ILE A HG23 1 
ATOM   1235 H  HD11 . ILE A 1 97  ? -1.714  -45.114 54.153  1.00 46.07  ?  97  ILE A HD11 1 
ATOM   1236 H  HD12 . ILE A 1 97  ? -2.741  -45.411 55.328  1.00 46.07  ?  97  ILE A HD12 1 
ATOM   1237 H  HD13 . ILE A 1 97  ? -1.202  -45.186 55.655  1.00 46.07  ?  97  ILE A HD13 1 
ATOM   1238 N  N    . GLY A 1 98  ? -3.080  -50.128 57.739  1.00 38.32  ?  98  GLY A N    1 
ATOM   1239 C  CA   . GLY A 1 98  ? -3.371  -50.904 58.929  1.00 47.37  ?  98  GLY A CA   1 
ATOM   1240 C  C    . GLY A 1 98  ? -2.416  -50.660 60.079  1.00 36.89  ?  98  GLY A C    1 
ATOM   1241 O  O    . GLY A 1 98  ? -1.789  -51.602 60.573  1.00 39.86  ?  98  GLY A O    1 
ATOM   1242 H  H    . GLY A 1 98  ? -3.749  -49.669 57.453  1.00 46.06  ?  98  GLY A H    1 
ATOM   1243 H  HA2  . GLY A 1 98  ? -4.268  -50.694 59.233  1.00 56.93  ?  98  GLY A HA2  1 
ATOM   1244 H  HA3  . GLY A 1 98  ? -3.340  -51.848 58.707  1.00 56.93  ?  98  GLY A HA3  1 
ATOM   1245 N  N    . TYR A 1 99  ? -2.294  -49.403 60.516  1.00 40.57  ?  99  TYR A N    1 
ATOM   1246 C  CA   . TYR A 1 99  ? -1.420  -49.090 61.645  1.00 40.85  ?  99  TYR A CA   1 
ATOM   1247 C  C    . TYR A 1 99  ? -1.703  -50.001 62.833  1.00 41.90  ?  99  TYR A C    1 
ATOM   1248 O  O    . TYR A 1 99  ? -0.776  -50.505 63.476  1.00 45.50  ?  99  TYR A O    1 
ATOM   1249 C  CB   . TYR A 1 99  ? -1.586  -47.626 62.057  1.00 43.35  ?  99  TYR A CB   1 
ATOM   1250 C  CG   . TYR A 1 99  ? -0.968  -46.622 61.109  1.00 39.03  ?  99  TYR A CG   1 
ATOM   1251 C  CD1  . TYR A 1 99  ? 0.391   -46.651 60.820  1.00 43.62  ?  99  TYR A CD1  1 
ATOM   1252 C  CD2  . TYR A 1 99  ? -1.739  -45.627 60.525  1.00 38.22  ?  99  TYR A CD2  1 
ATOM   1253 C  CE1  . TYR A 1 99  ? 0.960   -45.726 59.961  1.00 32.38  ?  99  TYR A CE1  1 
ATOM   1254 C  CE2  . TYR A 1 99  ? -1.177  -44.697 59.665  1.00 33.98  ?  99  TYR A CE2  1 
ATOM   1255 C  CZ   . TYR A 1 99  ? 0.171   -44.751 59.389  1.00 33.97  ?  99  TYR A CZ   1 
ATOM   1256 O  OH   . TYR A 1 99  ? 0.730   -43.828 58.534  1.00 43.58  ?  99  TYR A OH   1 
ATOM   1257 H  H    . TYR A 1 99  ? -2.701  -48.724 60.181  1.00 48.77  ?  99  TYR A H    1 
ATOM   1258 H  HA   . TYR A 1 99  ? -0.498  -49.224 61.377  1.00 49.11  ?  99  TYR A HA   1 
ATOM   1259 H  HB2  . TYR A 1 99  ? -2.534  -47.427 62.117  1.00 52.10  ?  99  TYR A HB2  1 
ATOM   1260 H  HB3  . TYR A 1 99  ? -1.173  -47.501 62.926  1.00 52.10  ?  99  TYR A HB3  1 
ATOM   1261 H  HD1  . TYR A 1 99  ? 0.926   -47.307 61.205  1.00 52.42  ?  99  TYR A HD1  1 
ATOM   1262 H  HD2  . TYR A 1 99  ? -2.649  -45.587 60.709  1.00 45.95  ?  99  TYR A HD2  1 
ATOM   1263 H  HE1  . TYR A 1 99  ? 1.871   -45.760 59.773  1.00 38.93  ?  99  TYR A HE1  1 
ATOM   1264 H  HE2  . TYR A 1 99  ? -1.707  -44.039 59.277  1.00 40.86  ?  99  TYR A HE2  1 
ATOM   1265 H  HH   . TYR A 1 99  ? 0.140   -43.296 58.260  1.00 52.38  ?  99  TYR A HH   1 
ATOM   1266 N  N    . GLY A 1 100 ? -2.979  -50.225 63.142  1.00 42.23  ?  100 GLY A N    1 
ATOM   1267 C  CA   . GLY A 1 100 ? -3.364  -51.115 64.218  1.00 51.90  ?  100 GLY A CA   1 
ATOM   1268 C  C    . GLY A 1 100 ? -3.971  -50.438 65.426  1.00 53.04  ?  100 GLY A C    1 
ATOM   1269 O  O    . GLY A 1 100 ? -4.362  -51.137 66.368  1.00 47.09  ?  100 GLY A O    1 
ATOM   1270 H  H    . GLY A 1 100 ? -3.645  -49.864 62.734  1.00 50.76  ?  100 GLY A H    1 
ATOM   1271 H  HA2  . GLY A 1 100 ? -4.009  -51.756 63.880  1.00 62.36  ?  100 GLY A HA2  1 
ATOM   1272 H  HA3  . GLY A 1 100 ? -2.582  -51.607 64.514  1.00 62.36  ?  100 GLY A HA3  1 
ATOM   1273 N  N    . LYS A 1 101 ? -4.055  -49.106 65.444  1.00 48.27  ?  101 LYS A N    1 
ATOM   1274 C  CA   . LYS A 1 101 ? -4.755  -48.423 66.526  1.00 48.00  ?  101 LYS A CA   1 
ATOM   1275 C  C    . LYS A 1 101 ? -6.256  -48.404 66.268  1.00 51.60  ?  101 LYS A C    1 
ATOM   1276 O  O    . LYS A 1 101 ? -7.048  -48.813 67.124  1.00 42.27  ?  101 LYS A O    1 
ATOM   1277 C  CB   . LYS A 1 101 ? -4.216  -47.000 66.687  1.00 48.47  ?  101 LYS A CB   1 
ATOM   1278 C  CG   . LYS A 1 101 ? -4.818  -46.239 67.859  1.00 49.22  ?  101 LYS A CG   1 
ATOM   1279 H  H    . LYS A 1 101 ? -3.719  -48.584 64.849  1.00 58.00  ?  101 LYS A H    1 
ATOM   1280 H  HA   . LYS A 1 101 ? -4.599  -48.900 67.356  1.00 57.68  ?  101 LYS A HA   1 
ATOM   1281 H  HB2  . LYS A 1 101 ? -3.257  -47.043 66.824  1.00 58.25  ?  101 LYS A HB2  1 
ATOM   1282 H  HB3  . LYS A 1 101 ? -4.410  -46.500 65.879  1.00 58.25  ?  101 LYS A HB3  1 
ATOM   1283 N  N    . LEU A 1 102 ? -6.661  -47.939 65.089  1.00 49.53  ?  102 LEU A N    1 
ATOM   1284 C  CA   . LEU A 1 102 ? -8.050  -48.019 64.653  1.00 45.50  ?  102 LEU A CA   1 
ATOM   1285 C  C    . LEU A 1 102 ? -8.257  -49.375 63.989  1.00 48.63  ?  102 LEU A C    1 
ATOM   1286 O  O    . LEU A 1 102 ? -7.666  -49.656 62.940  1.00 50.79  ?  102 LEU A O    1 
ATOM   1287 C  CB   . LEU A 1 102 ? -8.381  -46.876 63.696  1.00 41.97  ?  102 LEU A CB   1 
ATOM   1288 C  CG   . LEU A 1 102 ? -8.114  -45.465 64.223  1.00 50.29  ?  102 LEU A CG   1 
ATOM   1289 C  CD1  . LEU A 1 102 ? -8.241  -44.442 63.101  1.00 50.35  ?  102 LEU A CD1  1 
ATOM   1290 C  CD2  . LEU A 1 102 ? -9.061  -45.127 65.363  1.00 49.20  ?  102 LEU A CD2  1 
ATOM   1291 H  H    . LEU A 1 102 ? -6.140  -47.567 64.514  1.00 59.52  ?  102 LEU A H    1 
ATOM   1292 H  HA   . LEU A 1 102 ? -8.637  -47.958 65.423  1.00 54.68  ?  102 LEU A HA   1 
ATOM   1293 H  HB2  . LEU A 1 102 ? -7.852  -46.990 62.891  1.00 50.45  ?  102 LEU A HB2  1 
ATOM   1294 H  HB3  . LEU A 1 102 ? -9.323  -46.928 63.473  1.00 50.45  ?  102 LEU A HB3  1 
ATOM   1295 H  HG   . LEU A 1 102 ? -7.207  -45.423 64.565  1.00 60.43  ?  102 LEU A HG   1 
ATOM   1296 H  HD11 . LEU A 1 102 ? -8.067  -43.558 63.459  1.00 60.50  ?  102 LEU A HD11 1 
ATOM   1297 H  HD12 . LEU A 1 102 ? -7.594  -44.652 62.409  1.00 60.50  ?  102 LEU A HD12 1 
ATOM   1298 H  HD13 . LEU A 1 102 ? -9.139  -44.482 62.737  1.00 60.50  ?  102 LEU A HD13 1 
ATOM   1299 H  HD21 . LEU A 1 102 ? -8.870  -44.230 65.677  1.00 59.12  ?  102 LEU A HD21 1 
ATOM   1300 H  HD22 . LEU A 1 102 ? -9.974  -45.178 65.040  1.00 59.12  ?  102 LEU A HD22 1 
ATOM   1301 H  HD23 . LEU A 1 102 ? -8.928  -45.765 66.082  1.00 59.12  ?  102 LEU A HD23 1 
ATOM   1302 N  N    . ILE A 1 103 ? -9.084  -50.217 64.601  1.00 44.72  ?  103 ILE A N    1 
ATOM   1303 C  CA   . ILE A 1 103 ? -9.341  -51.560 64.084  1.00 43.54  ?  103 ILE A CA   1 
ATOM   1304 C  C    . ILE A 1 103 ? -10.843 -51.808 64.109  1.00 45.64  ?  103 ILE A C    1 
ATOM   1305 O  O    . ILE A 1 103 ? -11.576 -51.197 64.902  1.00 47.46  ?  103 ILE A O    1 
ATOM   1306 C  CB   . ILE A 1 103 ? -8.584  -52.638 64.894  1.00 45.15  ?  103 ILE A CB   1 
ATOM   1307 C  CG1  . ILE A 1 103 ? -8.994  -52.592 66.369  1.00 54.09  ?  103 ILE A CG1  1 
ATOM   1308 C  CG2  . ILE A 1 103 ? -7.077  -52.437 64.749  1.00 47.68  ?  103 ILE A CG2  1 
ATOM   1309 C  CD1  . ILE A 1 103 ? -8.456  -53.741 67.193  1.00 61.59  ?  103 ILE A CD1  1 
ATOM   1310 H  H    . ILE A 1 103 ? -9.513  -50.034 65.323  1.00 53.74  ?  103 ILE A H    1 
ATOM   1311 H  HA   . ILE A 1 103 ? -9.042  -51.609 63.162  1.00 52.33  ?  103 ILE A HA   1 
ATOM   1312 H  HB   . ILE A 1 103 ? -8.814  -53.510 64.537  1.00 54.26  ?  103 ILE A HB   1 
ATOM   1313 H  HG12 . ILE A 1 103 ? -8.664  -51.767 66.759  1.00 64.99  ?  103 ILE A HG12 1 
ATOM   1314 H  HG13 . ILE A 1 103 ? -9.962  -52.616 66.425  1.00 64.99  ?  103 ILE A HG13 1 
ATOM   1315 H  HG21 . ILE A 1 103 ? -6.618  -53.120 65.262  1.00 57.29  ?  103 ILE A HG21 1 
ATOM   1316 H  HG22 . ILE A 1 103 ? -6.838  -52.510 63.812  1.00 57.29  ?  103 ILE A HG22 1 
ATOM   1317 H  HG23 . ILE A 1 103 ? -6.843  -51.557 65.083  1.00 57.29  ?  103 ILE A HG23 1 
ATOM   1318 H  HD11 . ILE A 1 103 ? -8.757  -53.640 68.109  1.00 73.99  ?  103 ILE A HD11 1 
ATOM   1319 H  HD12 . ILE A 1 103 ? -8.786  -54.575 66.825  1.00 73.99  ?  103 ILE A HD12 1 
ATOM   1320 H  HD13 . ILE A 1 103 ? -7.486  -53.725 67.160  1.00 73.99  ?  103 ILE A HD13 1 
ATOM   1321 N  N    . PRO A 1 104 ? -11.335 -52.703 63.254  1.00 49.57  ?  104 PRO A N    1 
ATOM   1322 C  CA   . PRO A 1 104 ? -12.778 -52.957 63.200  1.00 51.15  ?  104 PRO A CA   1 
ATOM   1323 C  C    . PRO A 1 104 ? -13.246 -53.872 64.322  1.00 49.91  ?  104 PRO A C    1 
ATOM   1324 O  O    . PRO A 1 104 ? -12.508 -54.733 64.808  1.00 46.67  ?  104 PRO A O    1 
ATOM   1325 C  CB   . PRO A 1 104 ? -12.959 -53.626 61.833  1.00 49.35  ?  104 PRO A CB   1 
ATOM   1326 C  CG   . PRO A 1 104 ? -11.670 -54.358 61.625  1.00 44.87  ?  104 PRO A CG   1 
ATOM   1327 C  CD   . PRO A 1 104 ? -10.600 -53.499 62.253  1.00 42.70  ?  104 PRO A CD   1 
ATOM   1328 H  HA   . PRO A 1 104 ? -13.275 -52.124 63.225  1.00 61.46  ?  104 PRO A HA   1 
ATOM   1329 H  HB2  . PRO A 1 104 ? -13.707 -54.243 61.862  1.00 59.30  ?  104 PRO A HB2  1 
ATOM   1330 H  HB3  . PRO A 1 104 ? -13.090 -52.951 61.148  1.00 59.30  ?  104 PRO A HB3  1 
ATOM   1331 H  HG2  . PRO A 1 104 ? -11.713 -55.222 62.063  1.00 53.93  ?  104 PRO A HG2  1 
ATOM   1332 H  HG3  . PRO A 1 104 ? -11.507 -54.465 60.675  1.00 53.93  ?  104 PRO A HG3  1 
ATOM   1333 H  HD2  . PRO A 1 104 ? -9.933  -54.054 62.687  1.00 51.32  ?  104 PRO A HD2  1 
ATOM   1334 H  HD3  . PRO A 1 104 ? -10.200 -52.918 61.587  1.00 51.32  ?  104 PRO A HD3  1 
ATOM   1335 N  N    . ILE A 1 105 ? -14.500 -53.676 64.726  1.00 49.84  ?  105 ILE A N    1 
ATOM   1336 C  CA   . ILE A 1 105 ? -15.125 -54.458 65.789  1.00 44.61  ?  105 ILE A CA   1 
ATOM   1337 C  C    . ILE A 1 105 ? -16.412 -55.057 65.242  1.00 40.44  ?  105 ILE A C    1 
ATOM   1338 O  O    . ILE A 1 105 ? -17.314 -54.324 64.819  1.00 46.68  ?  105 ILE A O    1 
ATOM   1339 C  CB   . ILE A 1 105 ? -15.415 -53.607 67.036  1.00 53.37  ?  105 ILE A CB   1 
ATOM   1340 C  CG1  . ILE A 1 105 ? -14.129 -52.968 67.568  1.00 48.38  ?  105 ILE A CG1  1 
ATOM   1341 C  CG2  . ILE A 1 105 ? -16.066 -54.463 68.127  1.00 50.19  ?  105 ILE A CG2  1 
ATOM   1342 C  CD1  . ILE A 1 105 ? -14.372 -51.909 68.625  1.00 57.68  ?  105 ILE A CD1  1 
ATOM   1343 H  H    . ILE A 1 105 ? -15.021 -53.080 64.390  1.00 59.89  ?  105 ILE A H    1 
ATOM   1344 H  HA   . ILE A 1 105 ? -14.533 -55.183 66.044  1.00 53.61  ?  105 ILE A HA   1 
ATOM   1345 H  HB   . ILE A 1 105 ? -16.031 -52.900 66.791  1.00 64.12  ?  105 ILE A HB   1 
ATOM   1346 H  HG12 . ILE A 1 105 ? -13.575 -53.660 67.962  1.00 58.14  ?  105 ILE A HG12 1 
ATOM   1347 H  HG13 . ILE A 1 105 ? -13.659 -52.550 66.830  1.00 58.14  ?  105 ILE A HG13 1 
ATOM   1348 H  HG21 . ILE A 1 105 ? -16.239 -53.907 68.903  1.00 60.31  ?  105 ILE A HG21 1 
ATOM   1349 H  HG22 . ILE A 1 105 ? -16.898 -54.827 67.788  1.00 60.31  ?  105 ILE A HG22 1 
ATOM   1350 H  HG23 . ILE A 1 105 ? -15.462 -55.184 68.365  1.00 60.31  ?  105 ILE A HG23 1 
ATOM   1351 H  HD11 . ILE A 1 105 ? -13.518 -51.550 68.914  1.00 69.29  ?  105 ILE A HD11 1 
ATOM   1352 H  HD12 . ILE A 1 105 ? -14.916 -51.202 68.244  1.00 69.29  ?  105 ILE A HD12 1 
ATOM   1353 H  HD13 . ILE A 1 105 ? -14.833 -52.314 69.377  1.00 69.29  ?  105 ILE A HD13 1 
ATOM   1354 N  N    . GLY A 1 106 ? -16.498 -56.385 65.255  1.00 43.15  ?  106 GLY A N    1 
ATOM   1355 C  CA   . GLY A 1 106 ? -17.728 -57.072 64.945  1.00 50.01  ?  106 GLY A CA   1 
ATOM   1356 C  C    . GLY A 1 106 ? -17.834 -57.507 63.496  1.00 54.32  ?  106 GLY A C    1 
ATOM   1357 O  O    . GLY A 1 106 ? -17.021 -57.132 62.645  1.00 47.00  ?  106 GLY A O    1 
ATOM   1358 H  H    . GLY A 1 106 ? -15.843 -56.910 65.444  1.00 51.86  ?  106 GLY A H    1 
ATOM   1359 H  HA2  . GLY A 1 106 ? -17.802 -57.861 65.505  1.00 60.09  ?  106 GLY A HA2  1 
ATOM   1360 H  HA3  . GLY A 1 106 ? -18.478 -56.489 65.142  1.00 60.09  ?  106 GLY A HA3  1 
ATOM   1361 N  N    . PRO A 1 107 ? -18.856 -58.314 63.191  1.00 55.14  ?  107 PRO A N    1 
ATOM   1362 C  CA   . PRO A 1 107 ? -18.999 -58.819 61.812  1.00 57.60  ?  107 PRO A CA   1 
ATOM   1363 C  C    . PRO A 1 107 ? -19.200 -57.728 60.772  1.00 56.75  ?  107 PRO A C    1 
ATOM   1364 O  O    . PRO A 1 107 ? -18.571 -57.773 59.706  1.00 55.97  ?  107 PRO A O    1 
ATOM   1365 C  CB   . PRO A 1 107 ? -20.223 -59.743 61.911  1.00 55.85  ?  107 PRO A CB   1 
ATOM   1366 C  CG   . PRO A 1 107 ? -20.321 -60.111 63.345  1.00 58.53  ?  107 PRO A CG   1 
ATOM   1367 C  CD   . PRO A 1 107 ? -19.837 -58.920 64.106  1.00 58.94  ?  107 PRO A CD   1 
ATOM   1368 H  HA   . PRO A 1 107 ? -18.223 -59.347 61.570  1.00 69.20  ?  107 PRO A HA   1 
ATOM   1369 H  HB2  . PRO A 1 107 ? -21.017 -59.265 61.625  1.00 67.10  ?  107 PRO A HB2  1 
ATOM   1370 H  HB3  . PRO A 1 107 ? -20.082 -60.531 61.364  1.00 67.10  ?  107 PRO A HB3  1 
ATOM   1371 H  HG2  . PRO A 1 107 ? -21.244 -60.306 63.568  1.00 70.32  ?  107 PRO A HG2  1 
ATOM   1372 H  HG3  . PRO A 1 107 ? -19.757 -60.880 63.522  1.00 70.32  ?  107 PRO A HG3  1 
ATOM   1373 H  HD2  . PRO A 1 107 ? -20.569 -58.306 64.275  1.00 70.81  ?  107 PRO A HD2  1 
ATOM   1374 H  HD3  . PRO A 1 107 ? -19.406 -59.197 64.930  1.00 70.81  ?  107 PRO A HD3  1 
ATOM   1375 N  N    . LEU A 1 108 ? -20.072 -56.753 61.041  1.00 57.33  ?  108 LEU A N    1 
ATOM   1376 C  CA   . LEU A 1 108 ? -20.384 -55.742 60.034  1.00 56.40  ?  108 LEU A CA   1 
ATOM   1377 C  C    . LEU A 1 108 ? -19.144 -54.941 59.655  1.00 55.53  ?  108 LEU A C    1 
ATOM   1378 O  O    . LEU A 1 108 ? -18.814 -54.810 58.471  1.00 48.01  ?  108 LEU A O    1 
ATOM   1379 C  CB   . LEU A 1 108 ? -21.489 -54.814 60.543  1.00 59.02  ?  108 LEU A CB   1 
ATOM   1380 C  CG   . LEU A 1 108 ? -22.920 -55.356 60.480  1.00 64.82  ?  108 LEU A CG   1 
ATOM   1381 C  CD1  . LEU A 1 108 ? -23.877 -54.397 61.172  1.00 70.48  ?  108 LEU A CD1  1 
ATOM   1382 C  CD2  . LEU A 1 108 ? -23.357 -55.586 59.040  1.00 66.84  ?  108 LEU A CD2  1 
ATOM   1383 H  H    . LEU A 1 108 ? -20.489 -56.658 61.786  1.00 68.88  ?  108 LEU A H    1 
ATOM   1384 H  HA   . LEU A 1 108 ? -20.709 -56.184 59.234  1.00 67.76  ?  108 LEU A HA   1 
ATOM   1385 H  HB2  . LEU A 1 108 ? -21.303 -54.601 61.470  1.00 70.91  ?  108 LEU A HB2  1 
ATOM   1386 H  HB3  . LEU A 1 108 ? -21.467 -54.000 60.016  1.00 70.91  ?  108 LEU A HB3  1 
ATOM   1387 H  HG   . LEU A 1 108 ? -22.957 -56.206 60.946  1.00 77.86  ?  108 LEU A HG   1 
ATOM   1388 H  HD11 . LEU A 1 108 ? -24.776 -54.758 61.121  1.00 84.66  ?  108 LEU A HD11 1 
ATOM   1389 H  HD12 . LEU A 1 108 ? -23.610 -54.301 62.099  1.00 84.66  ?  108 LEU A HD12 1 
ATOM   1390 H  HD13 . LEU A 1 108 ? -23.839 -53.537 60.725  1.00 84.66  ?  108 LEU A HD13 1 
ATOM   1391 H  HD21 . LEU A 1 108 ? -24.265 -55.928 59.037  1.00 80.29  ?  108 LEU A HD21 1 
ATOM   1392 H  HD22 . LEU A 1 108 ? -23.319 -54.743 58.560  1.00 80.29  ?  108 LEU A HD22 1 
ATOM   1393 H  HD23 . LEU A 1 108 ? -22.759 -56.229 58.628  1.00 80.29  ?  108 LEU A HD23 1 
ATOM   1394 N  N    . ALA A 1 109 ? -18.448 -54.390 60.651  1.00 49.60  ?  109 ALA A N    1 
ATOM   1395 C  CA   . ALA A 1 109 ? -17.235 -53.631 60.370  1.00 48.43  ?  109 ALA A CA   1 
ATOM   1396 C  C    . ALA A 1 109 ? -16.221 -54.476 59.611  1.00 49.02  ?  109 ALA A C    1 
ATOM   1397 O  O    . ALA A 1 109 ? -15.592 -53.999 58.659  1.00 45.05  ?  109 ALA A O    1 
ATOM   1398 C  CB   . ALA A 1 109 ? -16.629 -53.113 61.672  1.00 46.20  ?  109 ALA A CB   1 
ATOM   1399 H  H    . ALA A 1 109 ? -18.654 -54.441 61.485  1.00 59.60  ?  109 ALA A H    1 
ATOM   1400 H  HA   . ALA A 1 109 ? -17.461 -52.865 59.819  1.00 58.20  ?  109 ALA A HA   1 
ATOM   1401 H  HB1  . ALA A 1 109 ? -15.825 -52.611 61.468  1.00 55.52  ?  109 ALA A HB1  1 
ATOM   1402 H  HB2  . ALA A 1 109 ? -17.275 -52.539 62.114  1.00 55.52  ?  109 ALA A HB2  1 
ATOM   1403 H  HB3  . ALA A 1 109 ? -16.413 -53.868 62.241  1.00 55.52  ?  109 ALA A HB3  1 
ATOM   1404 N  N    . ASN A 1 110 ? -16.051 -55.735 60.016  1.00 43.43  ?  110 ASN A N    1 
ATOM   1405 C  CA   . ASN A 1 110 ? -15.077 -56.595 59.358  1.00 45.38  ?  110 ASN A CA   1 
ATOM   1406 C  C    . ASN A 1 110 ? -15.514 -56.963 57.945  1.00 46.92  ?  110 ASN A C    1 
ATOM   1407 O  O    . ASN A 1 110 ? -14.664 -57.210 57.082  1.00 40.64  ?  110 ASN A O    1 
ATOM   1408 C  CB   . ASN A 1 110 ? -14.841 -57.854 60.191  1.00 44.25  ?  110 ASN A CB   1 
ATOM   1409 C  CG   . ASN A 1 110 ? -13.893 -57.618 61.349  1.00 50.46  ?  110 ASN A CG   1 
ATOM   1410 O  OD1  . ASN A 1 110 ? -12.679 -57.538 61.161  1.00 47.10  ?  110 ASN A OD1  1 
ATOM   1411 N  ND2  . ASN A 1 110 ? -14.440 -57.512 62.555  1.00 52.19  ?  110 ASN A ND2  1 
ATOM   1412 H  H    . ASN A 1 110 ? -16.483 -56.109 60.660  1.00 52.20  ?  110 ASN A H    1 
ATOM   1413 H  HA   . ASN A 1 110 ? -14.234 -56.120 59.293  1.00 54.54  ?  110 ASN A HA   1 
ATOM   1414 H  HB2  . ASN A 1 110 ? -15.689 -58.156 60.553  1.00 53.18  ?  110 ASN A HB2  1 
ATOM   1415 H  HB3  . ASN A 1 110 ? -14.458 -58.542 59.624  1.00 53.18  ?  110 ASN A HB3  1 
ATOM   1416 H  HD21 . ASN A 1 110 ? -13.942 -57.378 63.243  1.00 62.71  ?  110 ASN A HD21 1 
ATOM   1417 H  HD22 . ASN A 1 110 ? -15.293 -57.574 62.648  1.00 62.71  ?  110 ASN A HD22 1 
ATOM   1418 N  N    . THR A 1 111 ? -16.823 -57.010 57.688  1.00 44.13  ?  111 THR A N    1 
ATOM   1419 C  CA   . THR A 1 111 ? -17.299 -57.220 56.324  1.00 47.34  ?  111 THR A CA   1 
ATOM   1420 C  C    . THR A 1 111 ? -17.007 -56.004 55.454  1.00 47.09  ?  111 THR A C    1 
ATOM   1421 O  O    . THR A 1 111 ? -16.541 -56.145 54.317  1.00 44.91  ?  111 THR A O    1 
ATOM   1422 C  CB   . THR A 1 111 ? -18.797 -57.534 56.331  1.00 53.14  ?  111 THR A CB   1 
ATOM   1423 O  OG1  . THR A 1 111 ? -19.023 -58.765 57.028  1.00 52.98  ?  111 THR A OG1  1 
ATOM   1424 C  CG2  . THR A 1 111 ? -19.344 -57.663 54.907  1.00 49.33  ?  111 THR A CG2  1 
ATOM   1425 H  H    . THR A 1 111 ? -17.445 -56.924 58.276  1.00 53.04  ?  111 THR A H    1 
ATOM   1426 H  HA   . THR A 1 111 ? -16.835 -57.981 55.941  1.00 56.89  ?  111 THR A HA   1 
ATOM   1427 H  HB   . THR A 1 111 ? -19.274 -56.818 56.778  1.00 63.85  ?  111 THR A HB   1 
ATOM   1428 H  HG1  . THR A 1 111 ? -18.750 -58.701 57.820  1.00 63.66  ?  111 THR A HG1  1 
ATOM   1429 H  HG21 . THR A 1 111 ? -20.293 -57.862 54.933  1.00 59.27  ?  111 THR A HG21 1 
ATOM   1430 H  HG22 . THR A 1 111 ? -19.209 -56.833 54.423  1.00 59.27  ?  111 THR A HG22 1 
ATOM   1431 H  HG23 . THR A 1 111 ? -18.885 -58.379 54.439  1.00 59.27  ?  111 THR A HG23 1 
ATOM   1432 N  N    . LEU A 1 112 ? -17.271 -54.802 55.974  1.00 39.77  ?  112 LEU A N    1 
ATOM   1433 C  CA   . LEU A 1 112 ? -16.940 -53.587 55.236  1.00 44.72  ?  112 LEU A CA   1 
ATOM   1434 C  C    . LEU A 1 112 ? -15.449 -53.520 54.931  1.00 43.28  ?  112 LEU A C    1 
ATOM   1435 O  O    . LEU A 1 112 ? -15.051 -53.131 53.827  1.00 43.29  ?  112 LEU A O    1 
ATOM   1436 C  CB   . LEU A 1 112 ? -17.381 -52.355 56.028  1.00 44.93  ?  112 LEU A CB   1 
ATOM   1437 C  CG   . LEU A 1 112 ? -18.878 -52.030 56.011  1.00 50.58  ?  112 LEU A CG   1 
ATOM   1438 C  CD1  . LEU A 1 112 ? -19.198 -50.962 57.044  1.00 49.80  ?  112 LEU A CD1  1 
ATOM   1439 C  CD2  . LEU A 1 112 ? -19.320 -51.572 54.627  1.00 48.82  ?  112 LEU A CD2  1 
ATOM   1440 H  H    . LEU A 1 112 ? -17.635 -54.667 56.741  1.00 47.81  ?  112 LEU A H    1 
ATOM   1441 H  HA   . LEU A 1 112 ? -17.419 -53.589 54.393  1.00 53.75  ?  112 LEU A HA   1 
ATOM   1442 H  HB2  . LEU A 1 112 ? -17.126 -52.484 56.955  1.00 54.00  ?  112 LEU A HB2  1 
ATOM   1443 H  HB3  . LEU A 1 112 ? -16.915 -51.583 55.671  1.00 54.00  ?  112 LEU A HB3  1 
ATOM   1444 H  HG   . LEU A 1 112 ? -19.379 -52.829 56.238  1.00 60.78  ?  112 LEU A HG   1 
ATOM   1445 H  HD11 . LEU A 1 112 ? -20.149 -50.772 57.016  1.00 59.84  ?  112 LEU A HD11 1 
ATOM   1446 H  HD12 . LEU A 1 112 ? -18.951 -51.290 57.923  1.00 59.84  ?  112 LEU A HD12 1 
ATOM   1447 H  HD13 . LEU A 1 112 ? -18.693 -50.160 56.836  1.00 59.84  ?  112 LEU A HD13 1 
ATOM   1448 H  HD21 . LEU A 1 112 ? -20.270 -51.374 54.649  1.00 58.66  ?  112 LEU A HD21 1 
ATOM   1449 H  HD22 . LEU A 1 112 ? -18.822 -50.777 54.383  1.00 58.66  ?  112 LEU A HD22 1 
ATOM   1450 H  HD23 . LEU A 1 112 ? -19.145 -52.282 53.989  1.00 58.66  ?  112 LEU A HD23 1 
ATOM   1451 N  N    . VAL A 1 113 ? -14.609 -53.893 55.899  1.00 41.43  ?  113 VAL A N    1 
ATOM   1452 C  CA   . VAL A 1 113 ? -13.168 -53.926 55.663  1.00 42.53  ?  113 VAL A CA   1 
ATOM   1453 C  C    . VAL A 1 113 ? -12.843 -54.854 54.500  1.00 37.34  ?  113 VAL A C    1 
ATOM   1454 O  O    . VAL A 1 113 ? -12.030 -54.522 53.630  1.00 36.75  ?  113 VAL A O    1 
ATOM   1455 C  CB   . VAL A 1 113 ? -12.429 -54.344 56.949  1.00 40.06  ?  113 VAL A CB   1 
ATOM   1456 C  CG1  . VAL A 1 113 ? -10.972 -54.700 56.660  1.00 38.21  ?  113 VAL A CG1  1 
ATOM   1457 C  CG2  . VAL A 1 113 ? -12.497 -53.226 57.976  1.00 34.85  ?  113 VAL A CG2  1 
ATOM   1458 H  H    . VAL A 1 113 ? -14.846 -54.129 56.691  1.00 49.80  ?  113 VAL A H    1 
ATOM   1459 H  HA   . VAL A 1 113 ? -12.869 -53.034 55.425  1.00 51.12  ?  113 VAL A HA   1 
ATOM   1460 H  HB   . VAL A 1 113 ? -12.862 -55.126 57.325  1.00 48.15  ?  113 VAL A HB   1 
ATOM   1461 H  HG11 . VAL A 1 113 ? -10.540 -54.957 57.490  1.00 45.94  ?  113 VAL A HG11 1 
ATOM   1462 H  HG12 . VAL A 1 113 ? -10.946 -55.437 56.031  1.00 45.94  ?  113 VAL A HG12 1 
ATOM   1463 H  HG13 . VAL A 1 113 ? -10.527 -53.925 56.281  1.00 45.94  ?  113 VAL A HG13 1 
ATOM   1464 H  HG21 . VAL A 1 113 ? -12.028 -53.505 58.778  1.00 41.90  ?  113 VAL A HG21 1 
ATOM   1465 H  HG22 . VAL A 1 113 ? -12.079 -52.432 57.607  1.00 41.90  ?  113 VAL A HG22 1 
ATOM   1466 H  HG23 . VAL A 1 113 ? -13.427 -53.044 58.183  1.00 41.90  ?  113 VAL A HG23 1 
ATOM   1467 N  N    . THR A 1 114 ? -13.467 -56.033 54.472  1.00 38.66  ?  114 THR A N    1 
ATOM   1468 C  CA   . THR A 1 114 ? -13.234 -56.972 53.379  1.00 43.04  ?  114 THR A CA   1 
ATOM   1469 C  C    . THR A 1 114 ? -13.628 -56.358 52.042  1.00 39.43  ?  114 THR A C    1 
ATOM   1470 O  O    . THR A 1 114 ? -12.905 -56.495 51.048  1.00 44.83  ?  114 THR A O    1 
ATOM   1471 C  CB   . THR A 1 114 ? -14.016 -58.263 53.629  1.00 41.32  ?  114 THR A CB   1 
ATOM   1472 O  OG1  . THR A 1 114 ? -13.614 -58.831 54.882  1.00 40.24  ?  114 THR A OG1  1 
ATOM   1473 C  CG2  . THR A 1 114 ? -13.769 -59.277 52.519  1.00 36.03  ?  114 THR A CG2  1 
ATOM   1474 H  H    . THR A 1 114 ? -14.023 -56.309 55.067  1.00 46.47  ?  114 THR A H    1 
ATOM   1475 H  HA   . THR A 1 114 ? -12.290 -57.192 53.344  1.00 51.73  ?  114 THR A HA   1 
ATOM   1476 H  HB   . THR A 1 114 ? -14.965 -58.064 53.656  1.00 49.67  ?  114 THR A HB   1 
ATOM   1477 H  HG1  . THR A 1 114 ? -13.768 -58.290 55.505  1.00 48.37  ?  114 THR A HG1  1 
ATOM   1478 H  HG21 . THR A 1 114 ? -14.272 -60.088 52.694  1.00 43.32  ?  114 THR A HG21 1 
ATOM   1479 H  HG22 . THR A 1 114 ? -14.050 -58.910 51.666  1.00 43.32  ?  114 THR A HG22 1 
ATOM   1480 H  HG23 . THR A 1 114 ? -12.825 -59.495 52.473  1.00 43.32  ?  114 THR A HG23 1 
ATOM   1481 N  N    . LEU A 1 115 ? -14.773 -55.675 52.001  1.00 41.15  ?  115 LEU A N    1 
ATOM   1482 C  CA   . LEU A 1 115 ? -15.202 -55.002 50.781  1.00 43.73  ?  115 LEU A CA   1 
ATOM   1483 C  C    . LEU A 1 115 ? -14.283 -53.836 50.442  1.00 46.16  ?  115 LEU A C    1 
ATOM   1484 O  O    . LEU A 1 115 ? -13.925 -53.641 49.274  1.00 43.25  ?  115 LEU A O    1 
ATOM   1485 C  CB   . LEU A 1 115 ? -16.646 -54.524 50.939  1.00 43.44  ?  115 LEU A CB   1 
ATOM   1486 C  CG   . LEU A 1 115 ? -17.186 -53.502 49.934  1.00 57.94  ?  115 LEU A CG   1 
ATOM   1487 C  CD1  . LEU A 1 115 ? -17.206 -54.073 48.524  1.00 58.16  ?  115 LEU A CD1  1 
ATOM   1488 C  CD2  . LEU A 1 115 ? -18.576 -53.042 50.348  1.00 56.59  ?  115 LEU A CD2  1 
ATOM   1489 H  H    . LEU A 1 115 ? -15.314 -55.589 52.664  1.00 49.46  ?  115 LEU A H    1 
ATOM   1490 H  HA   . LEU A 1 115 ? -15.173 -55.633 50.044  1.00 52.56  ?  115 LEU A HA   1 
ATOM   1491 H  HB2  . LEU A 1 115 ? -17.224 -55.302 50.888  1.00 52.21  ?  115 LEU A HB2  1 
ATOM   1492 H  HB3  . LEU A 1 115 ? -16.732 -54.125 51.819  1.00 52.21  ?  115 LEU A HB3  1 
ATOM   1493 H  HG   . LEU A 1 115 ? -16.604 -52.726 49.932  1.00 69.61  ?  115 LEU A HG   1 
ATOM   1494 H  HD11 . LEU A 1 115 ? -17.552 -53.401 47.916  1.00 69.88  ?  115 LEU A HD11 1 
ATOM   1495 H  HD12 . LEU A 1 115 ? -16.302 -54.316 48.269  1.00 69.88  ?  115 LEU A HD12 1 
ATOM   1496 H  HD13 . LEU A 1 115 ? -17.776 -54.858 48.510  1.00 69.88  ?  115 LEU A HD13 1 
ATOM   1497 H  HD21 . LEU A 1 115 ? -18.901 -52.396 49.701  1.00 67.99  ?  115 LEU A HD21 1 
ATOM   1498 H  HD22 . LEU A 1 115 ? -19.168 -53.810 50.375  1.00 67.99  ?  115 LEU A HD22 1 
ATOM   1499 H  HD23 . LEU A 1 115 ? -18.524 -52.633 51.226  1.00 67.99  ?  115 LEU A HD23 1 
ATOM   1500 N  N    . GLU A 1 116 ? -13.889 -53.050 51.447  1.00 39.57  ?  116 GLU A N    1 
ATOM   1501 C  CA   . GLU A 1 116 ? -13.081 -51.865 51.179  1.00 37.56  ?  116 GLU A CA   1 
ATOM   1502 C  C    . GLU A 1 116 ? -11.695 -52.242 50.671  1.00 37.03  ?  116 GLU A C    1 
ATOM   1503 O  O    . GLU A 1 116 ? -11.163 -51.591 49.765  1.00 36.98  ?  116 GLU A O    1 
ATOM   1504 C  CB   . GLU A 1 116 ? -12.969 -51.003 52.435  1.00 38.57  ?  116 GLU A CB   1 
ATOM   1505 C  CG   . GLU A 1 116 ? -12.193 -49.718 52.206  1.00 40.62  ?  116 GLU A CG   1 
ATOM   1506 C  CD   . GLU A 1 116 ? -12.439 -48.677 53.278  1.00 46.44  ?  116 GLU A CD   1 
ATOM   1507 O  OE1  . GLU A 1 116 ? -12.835 -49.053 54.401  1.00 44.99  ?  116 GLU A OE1  1 
ATOM   1508 O  OE2  . GLU A 1 116 ? -12.238 -47.478 52.990  1.00 44.46  ?  116 GLU A OE2  1 
ATOM   1509 H  H    . GLU A 1 116 ? -14.074 -53.180 52.277  1.00 47.56  ?  116 GLU A H    1 
ATOM   1510 H  HA   . GLU A 1 116 ? -13.516 -51.337 50.492  1.00 45.15  ?  116 GLU A HA   1 
ATOM   1511 H  HB2  . GLU A 1 116 ? -13.860 -50.765 52.734  1.00 46.36  ?  116 GLU A HB2  1 
ATOM   1512 H  HB3  . GLU A 1 116 ? -12.512 -51.509 53.125  1.00 46.36  ?  116 GLU A HB3  1 
ATOM   1513 H  HG2  . GLU A 1 116 ? -11.244 -49.920 52.198  1.00 48.82  ?  116 GLU A HG2  1 
ATOM   1514 H  HG3  . GLU A 1 116 ? -12.457 -49.338 51.354  1.00 48.82  ?  116 GLU A HG3  1 
ATOM   1515 N  N    . ALA A 1 117 ? -11.089 -53.281 51.248  1.00 34.07  ?  117 ALA A N    1 
ATOM   1516 C  CA   . ALA A 1 117 ? -9.791  -53.735 50.765  1.00 40.00  ?  117 ALA A CA   1 
ATOM   1517 C  C    . ALA A 1 117 ? -9.869  -54.130 49.297  1.00 40.76  ?  117 ALA A C    1 
ATOM   1518 O  O    . ALA A 1 117 ? -8.965  -53.823 48.511  1.00 35.95  ?  117 ALA A O    1 
ATOM   1519 C  CB   . ALA A 1 117 ? -9.299  -54.907 51.610  1.00 37.46  ?  117 ALA A CB   1 
ATOM   1520 H  H    . ALA A 1 117 ? -11.405 -53.732 51.909  1.00 40.97  ?  117 ALA A H    1 
ATOM   1521 H  HA   . ALA A 1 117 ? -9.150  -53.012 50.849  1.00 48.08  ?  117 ALA A HA   1 
ATOM   1522 H  HB1  . ALA A 1 117 ? -8.435  -55.197 51.276  1.00 45.04  ?  117 ALA A HB1  1 
ATOM   1523 H  HB2  . ALA A 1 117 ? -9.217  -54.618 52.533  1.00 45.04  ?  117 ALA A HB2  1 
ATOM   1524 H  HB3  . ALA A 1 117 ? -9.939  -55.633 51.546  1.00 45.04  ?  117 ALA A HB3  1 
ATOM   1525 N  N    . LEU A 1 118 ? -10.948 -54.810 48.910  1.00 36.94  ?  118 LEU A N    1 
ATOM   1526 C  CA   . LEU A 1 118 ? -11.156 -55.134 47.505  1.00 40.57  ?  118 LEU A CA   1 
ATOM   1527 C  C    . LEU A 1 118 ? -11.296 -53.867 46.670  1.00 41.14  ?  118 LEU A C    1 
ATOM   1528 O  O    . LEU A 1 118 ? -10.737 -53.773 45.571  1.00 34.82  ?  118 LEU A O    1 
ATOM   1529 C  CB   . LEU A 1 118 ? -12.393 -56.021 47.360  1.00 40.57  ?  118 LEU A CB   1 
ATOM   1530 C  CG   . LEU A 1 118 ? -12.688 -56.584 45.969  1.00 41.13  ?  118 LEU A CG   1 
ATOM   1531 C  CD1  . LEU A 1 118 ? -11.563 -57.494 45.500  1.00 43.05  ?  118 LEU A CD1  1 
ATOM   1532 C  CD2  . LEU A 1 118 ? -14.016 -57.328 45.984  1.00 49.93  ?  118 LEU A CD2  1 
ATOM   1533 H  H    . LEU A 1 118 ? -11.566 -55.092 49.437  1.00 44.41  ?  118 LEU A H    1 
ATOM   1534 H  HA   . LEU A 1 118 ? -10.389 -55.629 47.176  1.00 48.77  ?  118 LEU A HA   1 
ATOM   1535 H  HB2  . LEU A 1 118 ? -12.292 -56.778 47.958  1.00 48.76  ?  118 LEU A HB2  1 
ATOM   1536 H  HB3  . LEU A 1 118 ? -13.168 -55.503 47.628  1.00 48.76  ?  118 LEU A HB3  1 
ATOM   1537 H  HG   . LEU A 1 118 ? -12.763 -55.849 45.340  1.00 49.44  ?  118 LEU A HG   1 
ATOM   1538 H  HD11 . LEU A 1 118 ? -11.780 -57.834 44.617  1.00 51.75  ?  118 LEU A HD11 1 
ATOM   1539 H  HD12 . LEU A 1 118 ? -10.739 -56.984 45.465  1.00 51.75  ?  118 LEU A HD12 1 
ATOM   1540 H  HD13 . LEU A 1 118 ? -11.472 -58.230 46.125  1.00 51.75  ?  118 LEU A HD13 1 
ATOM   1541 H  HD21 . LEU A 1 118 ? -14.191 -57.679 45.097  1.00 59.99  ?  118 LEU A HD21 1 
ATOM   1542 H  HD22 . LEU A 1 118 ? -13.963 -58.055 46.624  1.00 59.99  ?  118 LEU A HD22 1 
ATOM   1543 H  HD23 . LEU A 1 118 ? -14.720 -56.712 46.241  1.00 59.99  ?  118 LEU A HD23 1 
ATOM   1544 N  N    . CYS A 1 119 ? -12.030 -52.876 47.182  1.00 37.84  ?  119 CYS A N    1 
ATOM   1545 C  CA   . CYS A 1 119 ? -12.174 -51.613 46.465  1.00 35.97  ?  119 CYS A CA   1 
ATOM   1546 C  C    . CYS A 1 119 ? -10.835 -50.898 46.333  1.00 37.74  ?  119 CYS A C    1 
ATOM   1547 O  O    . CYS A 1 119 ? -10.534 -50.314 45.284  1.00 39.49  ?  119 CYS A O    1 
ATOM   1548 C  CB   . CYS A 1 119 ? -13.190 -50.719 47.175  1.00 36.34  ?  119 CYS A CB   1 
ATOM   1549 S  SG   . CYS A 1 119 ? -14.904 -51.269 47.020  1.00 47.84  ?  119 CYS A SG   1 
ATOM   1550 H  H    . CYS A 1 119 ? -12.447 -52.910 47.934  1.00 45.49  ?  119 CYS A H    1 
ATOM   1551 H  HA   . CYS A 1 119 ? -12.506 -51.794 45.571  1.00 43.24  ?  119 CYS A HA   1 
ATOM   1552 H  HB2  . CYS A 1 119 ? -12.973 -50.692 48.120  1.00 43.69  ?  119 CYS A HB2  1 
ATOM   1553 H  HB3  . CYS A 1 119 ? -13.132 -49.825 46.800  1.00 43.69  ?  119 CYS A HB3  1 
ATOM   1554 H  HG   . CYS A 1 119 ? -15.615 -50.502 47.609  1.00 57.49  ?  119 CYS A HG   1 
ATOM   1555 N  N    . GLY A 1 120 ? -10.020 -50.927 47.387  1.00 39.24  ?  120 GLY A N    1 
ATOM   1556 C  CA   . GLY A 1 120 ? -8.705  -50.315 47.304  1.00 36.36  ?  120 GLY A CA   1 
ATOM   1557 C  C    . GLY A 1 120 ? -7.831  -50.977 46.258  1.00 41.08  ?  120 GLY A C    1 
ATOM   1558 O  O    . GLY A 1 120 ? -7.107  -50.303 45.520  1.00 42.08  ?  120 GLY A O    1 
ATOM   1559 H  H    . GLY A 1 120 ? -10.204 -51.287 48.146  1.00 47.17  ?  120 GLY A H    1 
ATOM   1560 H  HA2  . GLY A 1 120 ? -8.798  -49.376 47.079  1.00 43.72  ?  120 GLY A HA2  1 
ATOM   1561 H  HA3  . GLY A 1 120 ? -8.261  -50.383 48.164  1.00 43.72  ?  120 GLY A HA3  1 
ATOM   1562 N  N    . MET A 1 121 ? -7.892  -52.306 46.173  1.00 41.16  ?  121 MET A N    1 
ATOM   1563 C  CA   . MET A 1 121 ? -7.099  -53.019 45.179  1.00 44.22  ?  121 MET A CA   1 
ATOM   1564 C  C    . MET A 1 121 ? -7.632  -52.769 43.772  1.00 39.59  ?  121 MET A C    1 
ATOM   1565 O  O    . MET A 1 121 ? -6.851  -52.570 42.834  1.00 38.15  ?  121 MET A O    1 
ATOM   1566 C  CB   . MET A 1 121 ? -7.082  -54.515 45.499  1.00 48.39  ?  121 MET A CB   1 
ATOM   1567 C  CG   . MET A 1 121 ? -6.509  -54.852 46.877  1.00 60.00  ?  121 MET A CG   1 
ATOM   1568 S  SD   . MET A 1 121 ? -6.854  -56.542 47.416  1.00 76.97  ?  121 MET A SD   1 
ATOM   1569 C  CE   . MET A 1 121 ? -5.231  -57.289 47.275  1.00 53.30  ?  121 MET A CE   1 
ATOM   1570 H  H    . MET A 1 121 ? -8.378  -52.809 46.673  1.00 49.47  ?  121 MET A H    1 
ATOM   1571 H  HA   . MET A 1 121 ? -6.185  -52.698 45.224  1.00 53.14  ?  121 MET A HA   1 
ATOM   1572 H  HB2  . MET A 1 121 ? -7.992  -54.851 45.467  1.00 58.16  ?  121 MET A HB2  1 
ATOM   1573 H  HB3  . MET A 1 121 ? -6.541  -54.970 44.835  1.00 58.16  ?  121 MET A HB3  1 
ATOM   1574 H  HG2  . MET A 1 121 ? -5.546  -54.739 46.851  1.00 72.08  ?  121 MET A HG2  1 
ATOM   1575 H  HG3  . MET A 1 121 ? -6.894  -54.248 47.532  1.00 72.08  ?  121 MET A HG3  1 
ATOM   1576 H  HE1  . MET A 1 121 ? -5.288  -58.220 47.543  1.00 64.04  ?  121 MET A HE1  1 
ATOM   1577 H  HE2  . MET A 1 121 ? -4.935  -57.228 46.354  1.00 64.04  ?  121 MET A HE2  1 
ATOM   1578 H  HE3  . MET A 1 121 ? -4.615  -56.815 47.854  1.00 64.04  ?  121 MET A HE3  1 
ATOM   1579 N  N    . LEU A 1 122 ? -8.958  -52.756 43.608  1.00 36.24  ?  122 LEU A N    1 
ATOM   1580 C  CA   . LEU A 1 122 ? -9.544  -52.490 42.297  1.00 36.91  ?  122 LEU A CA   1 
ATOM   1581 C  C    . LEU A 1 122 ? -9.271  -51.060 41.847  1.00 36.56  ?  122 LEU A C    1 
ATOM   1582 O  O    . LEU A 1 122 ? -8.988  -50.819 40.668  1.00 37.15  ?  122 LEU A O    1 
ATOM   1583 C  CB   . LEU A 1 122 ? -11.048 -52.762 42.331  1.00 37.97  ?  122 LEU A CB   1 
ATOM   1584 C  CG   . LEU A 1 122 ? -11.492 -54.220 42.476  1.00 40.42  ?  122 LEU A CG   1 
ATOM   1585 C  CD1  . LEU A 1 122 ? -13.012 -54.298 42.535  1.00 40.25  ?  122 LEU A CD1  1 
ATOM   1586 C  CD2  . LEU A 1 122 ? -10.962 -55.085 41.339  1.00 44.97  ?  122 LEU A CD2  1 
ATOM   1587 H  H    . LEU A 1 122 ? -9.532  -52.896 44.233  1.00 43.57  ?  122 LEU A H    1 
ATOM   1588 H  HA   . LEU A 1 122 ? -9.146  -53.090 41.647  1.00 44.38  ?  122 LEU A HA   1 
ATOM   1589 H  HB2  . LEU A 1 122 ? -11.426 -52.273 43.078  1.00 45.64  ?  122 LEU A HB2  1 
ATOM   1590 H  HB3  . LEU A 1 122 ? -11.433 -52.428 41.505  1.00 45.64  ?  122 LEU A HB3  1 
ATOM   1591 H  HG   . LEU A 1 122 ? -11.142 -54.574 43.309  1.00 48.58  ?  122 LEU A HG   1 
ATOM   1592 H  HD11 . LEU A 1 122 ? -13.277 -55.227 42.627  1.00 48.38  ?  122 LEU A HD11 1 
ATOM   1593 H  HD12 . LEU A 1 122 ? -13.325 -53.787 43.298  1.00 48.38  ?  122 LEU A HD12 1 
ATOM   1594 H  HD13 . LEU A 1 122 ? -13.379 -53.929 41.717  1.00 48.38  ?  122 LEU A HD13 1 
ATOM   1595 H  HD21 . LEU A 1 122 ? -11.265 -55.997 41.469  1.00 54.05  ?  122 LEU A HD21 1 
ATOM   1596 H  HD22 . LEU A 1 122 ? -11.300 -54.741 40.497  1.00 54.05  ?  122 LEU A HD22 1 
ATOM   1597 H  HD23 . LEU A 1 122 ? -9.993  -55.054 41.345  1.00 54.05  ?  122 LEU A HD23 1 
ATOM   1598 N  N    . GLY A 1 123 ? -9.360  -50.098 42.765  1.00 36.59  ?  123 GLY A N    1 
ATOM   1599 C  CA   . GLY A 1 123 ? -9.042  -48.724 42.412  1.00 35.72  ?  123 GLY A CA   1 
ATOM   1600 C  C    . GLY A 1 123 ? -7.598  -48.562 41.982  1.00 39.11  ?  123 GLY A C    1 
ATOM   1601 O  O    . GLY A 1 123 ? -7.292  -47.790 41.070  1.00 38.95  ?  123 GLY A O    1 
ATOM   1602 H  H    . GLY A 1 123 ? -9.598  -50.214 43.583  1.00 43.99  ?  123 GLY A H    1 
ATOM   1603 H  HA2  . GLY A 1 123 ? -9.614  -48.436 41.683  1.00 42.94  ?  123 GLY A HA2  1 
ATOM   1604 H  HA3  . GLY A 1 123 ? -9.203  -48.148 43.175  1.00 42.94  ?  123 GLY A HA3  1 
ATOM   1605 N  N    . LEU A 1 124 ? -6.688  -49.287 42.634  1.00 37.31  ?  124 LEU A N    1 
ATOM   1606 C  CA   . LEU A 1 124 ? -5.293  -49.274 42.213  1.00 33.38  ?  124 LEU A CA   1 
ATOM   1607 C  C    . LEU A 1 124 ? -5.143  -49.830 40.803  1.00 38.23  ?  124 LEU A C    1 
ATOM   1608 O  O    . LEU A 1 124 ? -4.417  -49.265 39.977  1.00 35.45  ?  124 LEU A O    1 
ATOM   1609 C  CB   . LEU A 1 124 ? -4.445  -50.079 43.197  1.00 35.76  ?  124 LEU A CB   1 
ATOM   1610 C  CG   . LEU A 1 124 ? -2.988  -50.339 42.807  1.00 40.82  ?  124 LEU A CG   1 
ATOM   1611 C  CD1  . LEU A 1 124 ? -2.232  -49.029 42.642  1.00 47.84  ?  124 LEU A CD1  1 
ATOM   1612 C  CD2  . LEU A 1 124 ? -2.309  -51.225 43.840  1.00 46.87  ?  124 LEU A CD2  1 
ATOM   1613 H  H    . LEU A 1 124 ? -6.853  -49.788 43.314  1.00 44.86  ?  124 LEU A H    1 
ATOM   1614 H  HA   . LEU A 1 124 ? -4.969  -48.360 42.213  1.00 40.13  ?  124 LEU A HA   1 
ATOM   1615 H  HB2  . LEU A 1 124 ? -4.433  -49.604 44.043  1.00 42.99  ?  124 LEU A HB2  1 
ATOM   1616 H  HB3  . LEU A 1 124 ? -4.866  -50.943 43.322  1.00 42.99  ?  124 LEU A HB3  1 
ATOM   1617 H  HG   . LEU A 1 124 ? -2.968  -50.804 41.956  1.00 49.07  ?  124 LEU A HG   1 
ATOM   1618 H  HD11 . LEU A 1 124 ? -1.314  -49.224 42.395  1.00 57.49  ?  124 LEU A HD11 1 
ATOM   1619 H  HD12 . LEU A 1 124 ? -2.658  -48.505 41.945  1.00 57.49  ?  124 LEU A HD12 1 
ATOM   1620 H  HD13 . LEU A 1 124 ? -2.254  -48.544 43.481  1.00 57.49  ?  124 LEU A HD13 1 
ATOM   1621 H  HD21 . LEU A 1 124 ? -1.389  -51.375 43.571  1.00 56.33  ?  124 LEU A HD21 1 
ATOM   1622 H  HD22 . LEU A 1 124 ? -2.334  -50.780 44.702  1.00 56.33  ?  124 LEU A HD22 1 
ATOM   1623 H  HD23 . LEU A 1 124 ? -2.782  -52.070 43.890  1.00 56.33  ?  124 LEU A HD23 1 
ATOM   1624 N  N    . ALA A 1 125 ? -5.821  -50.942 40.512  1.00 33.23  ?  125 ALA A N    1 
ATOM   1625 C  CA   . ALA A 1 125 ? -5.767  -51.518 39.174  1.00 33.67  ?  125 ALA A CA   1 
ATOM   1626 C  C    . ALA A 1 125 ? -6.287  -50.535 38.134  1.00 34.88  ?  125 ALA A C    1 
ATOM   1627 O  O    . ALA A 1 125 ? -5.702  -50.392 37.055  1.00 34.51  ?  125 ALA A O    1 
ATOM   1628 C  CB   . ALA A 1 125 ? -6.572  -52.816 39.136  1.00 37.94  ?  125 ALA A CB   1 
ATOM   1629 H  H    . ALA A 1 125 ? -6.313  -51.376 41.068  1.00 39.95  ?  125 ALA A H    1 
ATOM   1630 H  HA   . ALA A 1 125 ? -4.846  -51.728 38.955  1.00 40.49  ?  125 ALA A HA   1 
ATOM   1631 H  HB1  . ALA A 1 125 ? -6.528  -53.188 38.241  1.00 45.61  ?  125 ALA A HB1  1 
ATOM   1632 H  HB2  . ALA A 1 125 ? -6.193  -53.441 39.774  1.00 45.61  ?  125 ALA A HB2  1 
ATOM   1633 H  HB3  . ALA A 1 125 ? -7.494  -52.623 39.369  1.00 45.61  ?  125 ALA A HB3  1 
ATOM   1634 N  N    . VAL A 1 126 ? -7.383  -49.844 38.447  1.00 33.27  ?  126 VAL A N    1 
ATOM   1635 C  CA   . VAL A 1 126 ? -7.970  -48.891 37.510  1.00 32.60  ?  126 VAL A CA   1 
ATOM   1636 C  C    . VAL A 1 126 ? -7.029  -47.714 37.284  1.00 36.69  ?  126 VAL A C    1 
ATOM   1637 O  O    . VAL A 1 126 ? -6.756  -47.326 36.143  1.00 35.50  ?  126 VAL A O    1 
ATOM   1638 C  CB   . VAL A 1 126 ? -9.346  -48.432 38.024  1.00 33.36  ?  126 VAL A CB   1 
ATOM   1639 C  CG1  . VAL A 1 126 ? -9.876  -47.249 37.226  1.00 33.62  ?  126 VAL A CG1  1 
ATOM   1640 C  CG2  . VAL A 1 126 ? -10.330 -49.590 37.961  1.00 31.90  ?  126 VAL A CG2  1 
ATOM   1641 H  H    . VAL A 1 126 ? -7.803  -49.909 39.195  1.00 40.00  ?  126 VAL A H    1 
ATOM   1642 H  HA   . VAL A 1 126 ? -8.104  -49.332 36.657  1.00 39.21  ?  126 VAL A HA   1 
ATOM   1643 H  HB   . VAL A 1 126 ? -9.264  -48.157 38.951  1.00 40.11  ?  126 VAL A HB   1 
ATOM   1644 H  HG11 . VAL A 1 126 ? -10.742 -46.992 37.580  1.00 40.43  ?  126 VAL A HG11 1 
ATOM   1645 H  HG12 . VAL A 1 126 ? -9.253  -46.511 37.306  1.00 40.43  ?  126 VAL A HG12 1 
ATOM   1646 H  HG13 . VAL A 1 126 ? -9.963  -47.510 36.296  1.00 40.43  ?  126 VAL A HG13 1 
ATOM   1647 H  HG21 . VAL A 1 126 ? -11.193 -49.290 38.287  1.00 38.36  ?  126 VAL A HG21 1 
ATOM   1648 H  HG22 . VAL A 1 126 ? -10.409 -49.887 37.041  1.00 38.36  ?  126 VAL A HG22 1 
ATOM   1649 H  HG23 . VAL A 1 126 ? -10.001 -50.315 38.516  1.00 38.36  ?  126 VAL A HG23 1 
ATOM   1650 N  N    . ALA A 1 127 ? -6.519  -47.127 38.368  1.00 30.68  ?  127 ALA A N    1 
ATOM   1651 C  CA   . ALA A 1 127 ? -5.620  -45.988 38.231  1.00 34.32  ?  127 ALA A CA   1 
ATOM   1652 C  C    . ALA A 1 127 ? -4.369  -46.363 37.449  1.00 31.58  ?  127 ALA A C    1 
ATOM   1653 O  O    . ALA A 1 127 ? -3.914  -45.602 36.587  1.00 32.42  ?  127 ALA A O    1 
ATOM   1654 C  CB   . ALA A 1 127 ? -5.242  -45.455 39.612  1.00 40.08  ?  127 ALA A CB   1 
ATOM   1655 H  H    . ALA A 1 127 ? -6.676  -47.366 39.179  1.00 36.90  ?  127 ALA A H    1 
ATOM   1656 H  HA   . ALA A 1 127 ? -6.075  -45.280 37.749  1.00 41.27  ?  127 ALA A HA   1 
ATOM   1657 H  HB1  . ALA A 1 127 ? -4.645  -44.699 39.505  1.00 48.17  ?  127 ALA A HB1  1 
ATOM   1658 H  HB2  . ALA A 1 127 ? -6.049  -45.178 40.074  1.00 48.17  ?  127 ALA A HB2  1 
ATOM   1659 H  HB3  . ALA A 1 127 ? -4.800  -46.159 40.111  1.00 48.17  ?  127 ALA A HB3  1 
ATOM   1660 N  N    . ALA A 1 128 ? -3.790  -47.529 37.746  1.00 26.67  ?  128 ALA A N    1 
ATOM   1661 C  CA   . ALA A 1 128 ? -2.592  -47.963 37.035  1.00 33.57  ?  128 ALA A CA   1 
ATOM   1662 C  C    . ALA A 1 128 ? -2.883  -48.198 35.558  1.00 32.53  ?  128 ALA A C    1 
ATOM   1663 O  O    . ALA A 1 128 ? -2.061  -47.867 34.695  1.00 28.66  ?  128 ALA A O    1 
ATOM   1664 C  CB   . ALA A 1 128 ? -2.032  -49.232 37.679  1.00 34.79  ?  128 ALA A CB   1 
ATOM   1665 H  H    . ALA A 1 128 ? -4.068  -48.077 38.347  1.00 32.08  ?  128 ALA A H    1 
ATOM   1666 H  HA   . ALA A 1 128 ? -1.917  -47.270 37.101  1.00 40.37  ?  128 ALA A HA   1 
ATOM   1667 H  HB1  . ALA A 1 128 ? -1.238  -49.507 37.196  1.00 41.83  ?  128 ALA A HB1  1 
ATOM   1668 H  HB2  . ALA A 1 128 ? -1.809  -49.044 38.604  1.00 41.83  ?  128 ALA A HB2  1 
ATOM   1669 H  HB3  . ALA A 1 128 ? -2.705  -49.930 37.637  1.00 41.83  ?  128 ALA A HB3  1 
ATOM   1670 N  N    . SER A 1 129 ? -4.046  -48.774 35.247  1.00 30.93  ?  129 SER A N    1 
ATOM   1671 C  CA   . SER A 1 129 ? -4.419  -48.994 33.853  1.00 32.70  ?  129 SER A CA   1 
ATOM   1672 C  C    . SER A 1 129 ? -4.494  -47.674 33.096  1.00 28.67  ?  129 SER A C    1 
ATOM   1673 O  O    . SER A 1 129 ? -3.980  -47.554 31.977  1.00 30.75  ?  129 SER A O    1 
ATOM   1674 C  CB   A SER A 1 129 ? -5.753  -49.738 33.781  0.48 32.66  ?  129 SER A CB   1 
ATOM   1675 C  CB   B SER A 1 129 ? -5.757  -49.734 33.787  0.52 32.57  ?  129 SER A CB   1 
ATOM   1676 O  OG   A SER A 1 129 ? -5.645  -51.029 34.356  0.48 31.96  ?  129 SER A OG   1 
ATOM   1677 O  OG   B SER A 1 129 ? -6.215  -49.870 32.452  0.52 30.39  ?  129 SER A OG   1 
ATOM   1678 H  H    . SER A 1 129 ? -4.629  -49.043 35.819  1.00 37.20  ?  129 SER A H    1 
ATOM   1679 H  HA   . SER A 1 129 ? -3.741  -49.543 33.429  0.98 39.32  ?  129 SER A HA   1 
ATOM   1680 H  HB2  A SER A 1 129 ? -6.423  -49.232 34.265  0.48 39.27  ?  129 SER A HB2  1 
ATOM   1681 H  HB2  B SER A 1 129 ? -5.645  -50.618 34.170  0.52 39.17  ?  129 SER A HB2  1 
ATOM   1682 H  HB3  A SER A 1 129 ? -6.014  -49.828 32.851  0.48 39.27  ?  129 SER A HB3  1 
ATOM   1683 H  HB3  B SER A 1 129 ? -6.416  -49.236 34.295  0.52 39.17  ?  129 SER A HB3  1 
ATOM   1684 H  HG   A SER A 1 129 ? -5.419  -50.966 35.163  0.48 38.44  ?  129 SER A HG   1 
ATOM   1685 H  HG   B SER A 1 129 ? -6.319  -49.111 32.106  0.52 36.55  ?  129 SER A HG   1 
ATOM   1686 N  N    . LEU A 1 130 ? -5.125  -46.665 33.701  1.00 29.43  ?  130 LEU A N    1 
ATOM   1687 C  CA   . LEU A 1 130 ? -5.238  -45.359 33.060  1.00 31.36  ?  130 LEU A CA   1 
ATOM   1688 C  C    . LEU A 1 130 ? -3.879  -44.681 32.934  1.00 30.89  ?  130 LEU A C    1 
ATOM   1689 O  O    . LEU A 1 130 ? -3.571  -44.088 31.893  1.00 26.57  ?  130 LEU A O    1 
ATOM   1690 C  CB   . LEU A 1 130 ? -6.204  -44.476 33.850  1.00 31.09  ?  130 LEU A CB   1 
ATOM   1691 C  CG   . LEU A 1 130 ? -7.644  -44.988 33.929  1.00 32.45  ?  130 LEU A CG   1 
ATOM   1692 C  CD1  . LEU A 1 130 ? -8.449  -44.160 34.911  1.00 31.89  ?  130 LEU A CD1  1 
ATOM   1693 C  CD2  . LEU A 1 130 ? -8.294  -44.966 32.556  1.00 29.87  ?  130 LEU A CD2  1 
ATOM   1694 H  H    . LEU A 1 130 ? -5.494  -46.713 34.477  1.00 35.40  ?  130 LEU A H    1 
ATOM   1695 H  HA   . LEU A 1 130 ? -5.599  -45.475 32.168  1.00 37.72  ?  130 LEU A HA   1 
ATOM   1696 H  HB2  . LEU A 1 130 ? -5.874  -44.396 34.759  1.00 37.39  ?  130 LEU A HB2  1 
ATOM   1697 H  HB3  . LEU A 1 130 ? -6.229  -43.600 33.435  1.00 37.39  ?  130 LEU A HB3  1 
ATOM   1698 H  HG   . LEU A 1 130 ? -7.637  -45.906 34.244  1.00 39.02  ?  130 LEU A HG   1 
ATOM   1699 H  HD11 . LEU A 1 130 ? -9.356  -44.503 34.944  1.00 38.36  ?  130 LEU A HD11 1 
ATOM   1700 H  HD12 . LEU A 1 130 ? -8.040  -44.224 35.788  1.00 38.36  ?  130 LEU A HD12 1 
ATOM   1701 H  HD13 . LEU A 1 130 ? -8.455  -43.236 34.615  1.00 38.36  ?  130 LEU A HD13 1 
ATOM   1702 H  HD21 . LEU A 1 130 ? -9.203  -45.295 32.632  1.00 35.93  ?  130 LEU A HD21 1 
ATOM   1703 H  HD22 . LEU A 1 130 ? -8.297  -44.055 32.223  1.00 35.93  ?  130 LEU A HD22 1 
ATOM   1704 H  HD23 . LEU A 1 130 ? -7.785  -45.536 31.958  1.00 35.93  ?  130 LEU A HD23 1 
ATOM   1705 N  N    . ILE A 1 131 ? -3.055  -44.746 33.982  1.00 25.62  ?  131 ILE A N    1 
ATOM   1706 C  CA   . ILE A 1 131 ? -1.732  -44.129 33.924  1.00 30.16  ?  131 ILE A CA   1 
ATOM   1707 C  C    . ILE A 1 131 ? -0.900  -44.766 32.820  1.00 31.17  ?  131 ILE A C    1 
ATOM   1708 O  O    . ILE A 1 131 ? -0.197  -44.077 32.071  1.00 26.67  ?  131 ILE A O    1 
ATOM   1709 C  CB   . ILE A 1 131 ? -1.034  -44.235 35.292  1.00 31.52  ?  131 ILE A CB   1 
ATOM   1710 C  CG1  . ILE A 1 131 ? -1.642  -43.221 36.267  1.00 32.02  ?  131 ILE A CG1  1 
ATOM   1711 C  CG2  . ILE A 1 131 ? 0.476   -44.013 35.162  1.00 29.35  ?  131 ILE A CG2  1 
ATOM   1712 C  CD1  . ILE A 1 131 ? -1.211  -43.405 37.702  1.00 34.41  ?  131 ILE A CD1  1 
ATOM   1713 H  H    . ILE A 1 131 ? -3.236  -45.136 34.728  1.00 30.83  ?  131 ILE A H    1 
ATOM   1714 H  HA   . ILE A 1 131 ? -1.834  -43.187 33.714  1.00 36.27  ?  131 ILE A HA   1 
ATOM   1715 H  HB   . ILE A 1 131 ? -1.183  -45.126 35.645  1.00 37.91  ?  131 ILE A HB   1 
ATOM   1716 H  HG12 . ILE A 1 131 ? -1.379  -42.329 35.991  1.00 38.50  ?  131 ILE A HG12 1 
ATOM   1717 H  HG13 . ILE A 1 131 ? -2.608  -43.301 36.236  1.00 38.50  ?  131 ILE A HG13 1 
ATOM   1718 H  HG21 . ILE A 1 131 ? 0.882   -44.087 36.040  1.00 35.30  ?  131 ILE A HG21 1 
ATOM   1719 H  HG22 . ILE A 1 131 ? 0.844   -44.687 34.570  1.00 35.30  ?  131 ILE A HG22 1 
ATOM   1720 H  HG23 . ILE A 1 131 ? 0.634   -43.129 34.797  1.00 35.30  ?  131 ILE A HG23 1 
ATOM   1721 H  HD11 . ILE A 1 131 ? -1.638  -42.727 38.249  1.00 41.38  ?  131 ILE A HD11 1 
ATOM   1722 H  HD12 . ILE A 1 131 ? -1.477  -44.288 38.001  1.00 41.38  ?  131 ILE A HD12 1 
ATOM   1723 H  HD13 . ILE A 1 131 ? -0.247  -43.314 37.756  1.00 41.38  ?  131 ILE A HD13 1 
ATOM   1724 N  N    . TYR A 1 132 ? -0.960  -46.090 32.705  1.00 27.16  ?  132 TYR A N    1 
ATOM   1725 C  CA   . TYR A 1 132 ? -0.155  -46.763 31.697  1.00 32.50  ?  132 TYR A CA   1 
ATOM   1726 C  C    . TYR A 1 132 ? -0.664  -46.463 30.289  1.00 31.09  ?  132 TYR A C    1 
ATOM   1727 O  O    . TYR A 1 132 ? 0.132   -46.328 29.352  1.00 27.79  ?  132 TYR A O    1 
ATOM   1728 C  CB   . TYR A 1 132 ? -0.136  -48.263 31.961  1.00 31.76  ?  132 TYR A CB   1 
ATOM   1729 C  CG   . TYR A 1 132 ? 0.636   -49.002 30.908  1.00 45.40  ?  132 TYR A CG   1 
ATOM   1730 C  CD1  . TYR A 1 132 ? 2.021   -49.038 30.916  1.00 48.81  ?  132 TYR A CD1  1 
ATOM   1731 C  CD2  . TYR A 1 132 ? -0.024  -49.636 29.887  1.00 53.69  ?  132 TYR A CD2  1 
ATOM   1732 C  CE1  . TYR A 1 132 ? 2.713   -49.702 29.934  1.00 43.01  ?  132 TYR A CE1  1 
ATOM   1733 C  CE2  . TYR A 1 132 ? 0.651   -50.308 28.904  1.00 59.86  ?  132 TYR A CE2  1 
ATOM   1734 C  CZ   . TYR A 1 132 ? 2.014   -50.336 28.929  1.00 58.30  ?  132 TYR A CZ   1 
ATOM   1735 O  OH   . TYR A 1 132 ? 2.679   -51.009 27.940  1.00 68.09  ?  132 TYR A OH   1 
ATOM   1736 H  H    . TYR A 1 132 ? -1.447  -46.609 33.187  1.00 32.68  ?  132 TYR A H    1 
ATOM   1737 H  HA   . TYR A 1 132 ? 0.758   -46.439 31.757  1.00 39.08  ?  132 TYR A HA   1 
ATOM   1738 H  HB2  . TYR A 1 132 ? 0.283   -48.431 32.819  1.00 38.19  ?  132 TYR A HB2  1 
ATOM   1739 H  HB3  . TYR A 1 132 ? -1.047  -48.599 31.960  1.00 38.19  ?  132 TYR A HB3  1 
ATOM   1740 H  HD1  . TYR A 1 132 ? 2.488   -48.607 31.595  1.00 58.66  ?  132 TYR A HD1  1 
ATOM   1741 H  HD2  . TYR A 1 132 ? -0.954  -49.617 29.867  1.00 64.51  ?  132 TYR A HD2  1 
ATOM   1742 H  HE1  . TYR A 1 132 ? 3.642   -49.727 29.949  1.00 51.70  ?  132 TYR A HE1  1 
ATOM   1743 H  HE2  . TYR A 1 132 ? 0.185   -50.735 28.222  1.00 71.92  ?  132 TYR A HE2  1 
ATOM   1744 H  HH   . TYR A 1 132 ? 2.129   -51.343 27.400  1.00 81.79  ?  132 TYR A HH   1 
ATOM   1745 N  N    . ALA A 1 133 ? -1.984  -46.350 30.122  1.00 29.30  ?  133 ALA A N    1 
ATOM   1746 C  CA   . ALA A 1 133 ? -2.534  -45.970 28.826  1.00 29.19  ?  133 ALA A CA   1 
ATOM   1747 C  C    . ALA A 1 133 ? -2.158  -44.542 28.457  1.00 28.33  ?  133 ALA A C    1 
ATOM   1748 O  O    . ALA A 1 133 ? -1.956  -44.244 27.275  1.00 27.87  ?  133 ALA A O    1 
ATOM   1749 C  CB   . ALA A 1 133 ? -4.056  -46.129 28.825  1.00 28.88  ?  133 ALA A CB   1 
ATOM   1750 H  H    . ALA A 1 133 ? -2.572  -46.486 30.734  1.00 35.24  ?  133 ALA A H    1 
ATOM   1751 H  HA   . ALA A 1 133 ? -2.172  -46.559 28.145  1.00 35.11  ?  133 ALA A HA   1 
ATOM   1752 H  HB1  . ALA A 1 133 ? -4.399  -45.871 27.955  1.00 34.74  ?  133 ALA A HB1  1 
ATOM   1753 H  HB2  . ALA A 1 133 ? -4.276  -47.056 29.007  1.00 34.74  ?  133 ALA A HB2  1 
ATOM   1754 H  HB3  . ALA A 1 133 ? -4.433  -45.558 29.513  1.00 34.74  ?  133 ALA A HB3  1 
ATOM   1755 N  N    . ARG A 1 134 ? -2.065  -43.649 29.446  1.00 29.52  ?  134 ARG A N    1 
ATOM   1756 C  CA   . ARG A 1 134 ? -1.610  -42.288 29.175  1.00 30.70  ?  134 ARG A CA   1 
ATOM   1757 C  C    . ARG A 1 134 ? -0.126  -42.264 28.830  1.00 28.42  ?  134 ARG A C    1 
ATOM   1758 O  O    . ARG A 1 134 ? 0.304   -41.497 27.962  1.00 31.74  ?  134 ARG A O    1 
ATOM   1759 C  CB   . ARG A 1 134 ? -1.891  -41.387 30.381  1.00 26.81  ?  134 ARG A CB   1 
ATOM   1760 C  CG   . ARG A 1 134 ? -3.371  -41.111 30.638  1.00 27.26  ?  134 ARG A CG   1 
ATOM   1761 C  CD   . ARG A 1 134 ? -3.579  -40.262 31.888  1.00 28.77  ?  134 ARG A CD   1 
ATOM   1762 N  NE   . ARG A 1 134 ? -2.939  -38.953 31.775  1.00 34.65  ?  134 ARG A NE   1 
ATOM   1763 C  CZ   . ARG A 1 134 ? -3.558  -37.817 31.461  1.00 34.05  ?  134 ARG A CZ   1 
ATOM   1764 N  NH1  . ARG A 1 134 ? -4.863  -37.785 31.231  1.00 30.16  ?  134 ARG A NH1  1 
ATOM   1765 N  NH2  . ARG A 1 134 ? -2.858  -36.695 31.382  1.00 37.13  ?  134 ARG A NH2  1 
ATOM   1766 H  H    . ARG A 1 134 ? -2.257  -43.805 30.269  1.00 35.51  ?  134 ARG A H    1 
ATOM   1767 H  HA   . ARG A 1 134 ? -2.100  -41.936 28.416  1.00 36.92  ?  134 ARG A HA   1 
ATOM   1768 H  HB2  . ARG A 1 134 ? -1.529  -41.812 31.175  1.00 32.26  ?  134 ARG A HB2  1 
ATOM   1769 H  HB3  . ARG A 1 134 ? -1.452  -40.534 30.239  1.00 32.26  ?  134 ARG A HB3  1 
ATOM   1770 H  HG2  . ARG A 1 134 ? -3.742  -40.631 29.881  1.00 32.79  ?  134 ARG A HG2  1 
ATOM   1771 H  HG3  . ARG A 1 134 ? -3.837  -41.953 30.762  1.00 32.79  ?  134 ARG A HG3  1 
ATOM   1772 H  HD2  . ARG A 1 134 ? -4.529  -40.123 32.024  1.00 34.61  ?  134 ARG A HD2  1 
ATOM   1773 H  HD3  . ARG A 1 134 ? -3.196  -40.721 32.652  1.00 34.61  ?  134 ARG A HD3  1 
ATOM   1774 H  HE   . ARG A 1 134 ? -2.093  -38.914 31.924  1.00 41.66  ?  134 ARG A HE   1 
ATOM   1775 H  HH11 . ARG A 1 134 ? -5.325  -38.509 31.277  1.00 36.27  ?  134 ARG A HH11 1 
ATOM   1776 H  HH12 . ARG A 1 134 ? -5.246  -37.042 31.031  1.00 36.27  ?  134 ARG A HH12 1 
ATOM   1777 H  HH21 . ARG A 1 134 ? -2.012  -36.704 31.533  1.00 44.63  ?  134 ARG A HH21 1 
ATOM   1778 H  HH22 . ARG A 1 134 ? -3.252  -35.956 31.185  1.00 44.63  ?  134 ARG A HH22 1 
ATOM   1779 N  N    . PHE A 1 135 ? 0.669   -43.109 29.491  1.00 33.21  ?  135 PHE A N    1 
ATOM   1780 C  CA   . PHE A 1 135 ? 2.116   -43.091 29.296  1.00 33.50  ?  135 PHE A CA   1 
ATOM   1781 C  C    . PHE A 1 135 ? 2.505   -43.577 27.905  1.00 29.23  ?  135 PHE A C    1 
ATOM   1782 O  O    . PHE A 1 135 ? 3.341   -42.960 27.234  1.00 29.93  ?  135 PHE A O    1 
ATOM   1783 C  CB   . PHE A 1 135 ? 2.797   -43.960 30.359  1.00 35.46  ?  135 PHE A CB   1 
ATOM   1784 C  CG   . PHE A 1 135 ? 3.119   -43.236 31.641  1.00 35.34  ?  135 PHE A CG   1 
ATOM   1785 C  CD1  . PHE A 1 135 ? 2.470   -42.064 31.992  1.00 36.25  ?  135 PHE A CD1  1 
ATOM   1786 C  CD2  . PHE A 1 135 ? 4.088   -43.737 32.495  1.00 38.39  ?  135 PHE A CD2  1 
ATOM   1787 C  CE1  . PHE A 1 135 ? 2.781   -41.411 33.172  1.00 39.54  ?  135 PHE A CE1  1 
ATOM   1788 C  CE2  . PHE A 1 135 ? 4.401   -43.087 33.673  1.00 40.43  ?  135 PHE A CE2  1 
ATOM   1789 C  CZ   . PHE A 1 135 ? 3.746   -41.924 34.010  1.00 31.77  ?  135 PHE A CZ   1 
ATOM   1790 H  H    . PHE A 1 135 ? 0.394   -43.698 30.054  1.00 39.93  ?  135 PHE A H    1 
ATOM   1791 H  HA   . PHE A 1 135 ? 2.438   -42.182 29.399  1.00 40.28  ?  135 PHE A HA   1 
ATOM   1792 H  HB2  . PHE A 1 135 ? 2.209   -44.700 30.579  1.00 42.64  ?  135 PHE A HB2  1 
ATOM   1793 H  HB3  . PHE A 1 135 ? 3.629   -44.300 29.996  1.00 42.64  ?  135 PHE A HB3  1 
ATOM   1794 H  HD1  . PHE A 1 135 ? 1.817   -41.713 31.429  1.00 43.59  ?  135 PHE A HD1  1 
ATOM   1795 H  HD2  . PHE A 1 135 ? 4.534   -44.522 32.273  1.00 46.15  ?  135 PHE A HD2  1 
ATOM   1796 H  HE1  . PHE A 1 135 ? 2.338   -40.625 33.399  1.00 47.53  ?  135 PHE A HE1  1 
ATOM   1797 H  HE2  . PHE A 1 135 ? 5.052   -43.435 34.238  1.00 48.60  ?  135 PHE A HE2  1 
ATOM   1798 H  HZ   . PHE A 1 135 ? 3.955   -41.485 34.803  1.00 38.21  ?  135 PHE A HZ   1 
ATOM   1799 N  N    . THR A 1 136 ? 1.925   -44.691 27.458  1.00 27.65  ?  136 THR A N    1 
ATOM   1800 C  CA   . THR A 1 136 ? 2.417   -45.394 26.271  1.00 30.20  ?  136 THR A CA   1 
ATOM   1801 C  C    . THR A 1 136 ? 1.846   -44.788 24.988  1.00 26.25  ?  136 THR A C    1 
ATOM   1802 O  O    . THR A 1 136 ? 1.233   -45.455 24.154  1.00 29.86  ?  136 THR A O    1 
ATOM   1803 C  CB   . THR A 1 136 ? 2.092   -46.878 26.364  1.00 33.00  ?  136 THR A CB   1 
ATOM   1804 O  OG1  . THR A 1 136 ? 0.711   -47.058 26.715  1.00 33.09  ?  136 THR A OG1  1 
ATOM   1805 C  CG2  . THR A 1 136 ? 2.981   -47.549 27.391  1.00 34.15  ?  136 THR A CG2  1 
ATOM   1806 H  H    . THR A 1 136 ? 1.241   -45.062 27.825  1.00 33.26  ?  136 THR A H    1 
ATOM   1807 H  HA   . THR A 1 136 ? 3.382   -45.305 26.235  1.00 36.32  ?  136 THR A HA   1 
ATOM   1808 H  HB   . THR A 1 136 ? 2.258   -47.294 25.503  1.00 39.69  ?  136 THR A HB   1 
ATOM   1809 H  HG1  . THR A 1 136 ? 0.554   -46.698 27.457  1.00 39.79  ?  136 THR A HG1  1 
ATOM   1810 H  HG21 . THR A 1 136 ? 2.769   -48.494 27.446  1.00 41.07  ?  136 THR A HG21 1 
ATOM   1811 H  HG22 . THR A 1 136 ? 3.912   -47.448 27.139  1.00 41.07  ?  136 THR A HG22 1 
ATOM   1812 H  HG23 . THR A 1 136 ? 2.844   -47.144 28.262  1.00 41.07  ?  136 THR A HG23 1 
ATOM   1813 N  N    . ARG A 1 137 ? 2.082   -43.491 24.840  1.00 26.20  ?  137 ARG A N    1 
ATOM   1814 C  CA   . ARG A 1 137 ? 1.700   -42.738 23.648  1.00 30.33  ?  137 ARG A CA   1 
ATOM   1815 C  C    . ARG A 1 137 ? 2.906   -41.902 23.244  1.00 30.08  ?  137 ARG A C    1 
ATOM   1816 O  O    . ARG A 1 137 ? 2.877   -40.667 23.301  1.00 33.51  ?  137 ARG A O    1 
ATOM   1817 C  CB   . ARG A 1 137 ? 0.465   -41.878 23.918  1.00 26.75  ?  137 ARG A CB   1 
ATOM   1818 C  CG   . ARG A 1 137 ? -0.731  -42.687 24.417  1.00 30.33  ?  137 ARG A CG   1 
ATOM   1819 C  CD   . ARG A 1 137 ? -1.928  -41.805 24.714  1.00 29.94  ?  137 ARG A CD   1 
ATOM   1820 N  NE   . ARG A 1 137 ? -1.697  -40.949 25.872  1.00 29.08  ?  137 ARG A NE   1 
ATOM   1821 C  CZ   . ARG A 1 137 ? -2.520  -39.985 26.271  1.00 35.08  ?  137 ARG A CZ   1 
ATOM   1822 N  NH1  . ARG A 1 137 ? -3.639  -39.740 25.601  1.00 32.31  ?  137 ARG A NH1  1 
ATOM   1823 N  NH2  . ARG A 1 137 ? -2.223  -39.259 27.341  1.00 33.66  ?  137 ARG A NH2  1 
ATOM   1824 H  H    . ARG A 1 137 ? 2.474   -43.008 25.434  1.00 31.52  ?  137 ARG A H    1 
ATOM   1825 H  HA   . ARG A 1 137 ? 1.496   -43.354 22.927  1.00 36.48  ?  137 ARG A HA   1 
ATOM   1826 H  HB2  . ARG A 1 137 ? 0.683   -41.218 24.594  1.00 32.18  ?  137 ARG A HB2  1 
ATOM   1827 H  HB3  . ARG A 1 137 ? 0.204   -41.435 23.095  1.00 32.18  ?  137 ARG A HB3  1 
ATOM   1828 H  HG2  . ARG A 1 137 ? -0.988  -43.328 23.736  1.00 36.48  ?  137 ARG A HG2  1 
ATOM   1829 H  HG3  . ARG A 1 137 ? -0.484  -43.148 25.234  1.00 36.48  ?  137 ARG A HG3  1 
ATOM   1830 H  HD2  . ARG A 1 137 ? -2.104  -41.237 23.948  1.00 36.02  ?  137 ARG A HD2  1 
ATOM   1831 H  HD3  . ARG A 1 137 ? -2.698  -42.365 24.900  1.00 36.02  ?  137 ARG A HD3  1 
ATOM   1832 H  HE   . ARG A 1 137 ? -0.979  -41.077 26.328  1.00 34.98  ?  137 ARG A HE   1 
ATOM   1833 H  HH11 . ARG A 1 137 ? -3.836  -40.209 24.907  1.00 38.85  ?  137 ARG A HH11 1 
ATOM   1834 H  HH12 . ARG A 1 137 ? -4.169  -39.115 25.863  1.00 38.85  ?  137 ARG A HH12 1 
ATOM   1835 H  HH21 . ARG A 1 137 ? -1.498  -39.414 27.777  1.00 40.47  ?  137 ARG A HH21 1 
ATOM   1836 H  HH22 . ARG A 1 137 ? -2.754  -38.634 27.598  1.00 40.47  ?  137 ARG A HH22 1 
ATOM   1837 N  N    . PRO A 1 138 ? 3.992   -42.554 22.836  1.00 27.89  ?  138 PRO A N    1 
ATOM   1838 C  CA   . PRO A 1 138 ? 5.252   -41.837 22.612  1.00 27.91  ?  138 PRO A CA   1 
ATOM   1839 C  C    . PRO A 1 138 ? 5.200   -40.932 21.392  1.00 29.69  ?  138 PRO A C    1 
ATOM   1840 O  O    . PRO A 1 138 ? 4.431   -41.143 20.452  1.00 32.54  ?  138 PRO A O    1 
ATOM   1841 C  CB   . PRO A 1 138 ? 6.267   -42.967 22.410  1.00 29.36  ?  138 PRO A CB   1 
ATOM   1842 C  CG   . PRO A 1 138 ? 5.455   -44.107 21.887  1.00 28.46  ?  138 PRO A CG   1 
ATOM   1843 C  CD   . PRO A 1 138 ? 4.124   -43.999 22.581  1.00 27.88  ?  138 PRO A CD   1 
ATOM   1844 H  HA   . PRO A 1 138 ? 5.494   -41.318 23.395  1.00 33.58  ?  138 PRO A HA   1 
ATOM   1845 H  HB2  . PRO A 1 138 ? 6.937   -42.695 21.764  1.00 35.32  ?  138 PRO A HB2  1 
ATOM   1846 H  HB3  . PRO A 1 138 ? 6.678   -43.196 23.259  1.00 35.32  ?  138 PRO A HB3  1 
ATOM   1847 H  HG2  . PRO A 1 138 ? 5.349   -44.018 20.927  1.00 34.24  ?  138 PRO A HG2  1 
ATOM   1848 H  HG3  . PRO A 1 138 ? 5.889   -44.946 22.108  1.00 34.24  ?  138 PRO A HG3  1 
ATOM   1849 H  HD2  . PRO A 1 138 ? 3.412   -44.306 21.998  1.00 33.53  ?  138 PRO A HD2  1 
ATOM   1850 H  HD3  . PRO A 1 138 ? 4.137   -44.490 23.417  1.00 33.53  ?  138 PRO A HD3  1 
ATOM   1851 N  N    . THR A 1 139 ? 6.056   -39.915 21.421  1.00 31.79  ?  139 THR A N    1 
ATOM   1852 C  CA   . THR A 1 139 ? 6.252   -39.021 20.290  1.00 32.51  ?  139 THR A CA   1 
ATOM   1853 C  C    . THR A 1 139 ? 7.319   -39.587 19.357  1.00 28.12  ?  139 THR A C    1 
ATOM   1854 O  O    . THR A 1 139 ? 8.149   -40.410 19.750  1.00 25.91  ?  139 THR A O    1 
ATOM   1855 C  CB   . THR A 1 139 ? 6.662   -37.627 20.766  1.00 32.44  ?  139 THR A CB   1 
ATOM   1856 O  OG1  . THR A 1 139 ? 7.914   -37.704 21.463  1.00 31.92  ?  139 THR A OG1  1 
ATOM   1857 C  CG2  . THR A 1 139 ? 5.605   -37.047 21.693  1.00 30.91  ?  139 THR A CG2  1 
ATOM   1858 H  H    . THR A 1 139 ? 6.544   -39.719 22.101  1.00 38.23  ?  139 THR A H    1 
ATOM   1859 H  HA   . THR A 1 139 ? 5.423   -38.943 19.794  1.00 39.10  ?  139 THR A HA   1 
ATOM   1860 H  HB   . THR A 1 139 ? 6.754   -37.038 20.001  1.00 39.01  ?  139 THR A HB   1 
ATOM   1861 H  HG1  . THR A 1 139 ? 8.143   -36.940 21.727  1.00 38.39  ?  139 THR A HG1  1 
ATOM   1862 H  HG21 . THR A 1 139 ? 5.873   -36.163 21.989  1.00 37.17  ?  139 THR A HG21 1 
ATOM   1863 H  HG22 . THR A 1 139 ? 4.757   -36.980 21.227  1.00 37.17  ?  139 THR A HG22 1 
ATOM   1864 H  HG23 . THR A 1 139 ? 5.494   -37.620 22.468  1.00 37.17  ?  139 THR A HG23 1 
ATOM   1865 N  N    . ALA A 1 140 ? 7.291   -39.126 18.104  1.00 24.02  ?  140 ALA A N    1 
ATOM   1866 C  CA   . ALA A 1 140 ? 8.166   -39.693 17.082  1.00 24.76  ?  140 ALA A CA   1 
ATOM   1867 C  C    . ALA A 1 140 ? 9.598   -39.184 17.184  1.00 27.29  ?  140 ALA A C    1 
ATOM   1868 O  O    . ALA A 1 140 ? 10.521  -39.868 16.728  1.00 26.98  ?  140 ALA A O    1 
ATOM   1869 C  CB   . ALA A 1 140 ? 7.617   -39.387 15.689  1.00 27.62  ?  140 ALA A CB   1 
ATOM   1870 H  H    . ALA A 1 140 ? 6.780   -38.494 17.825  1.00 28.90  ?  140 ALA A H    1 
ATOM   1871 H  HA   . ALA A 1 140 ? 8.186   -40.657 17.189  1.00 29.79  ?  140 ALA A HA   1 
ATOM   1872 H  HB1  . ALA A 1 140 ? 8.210   -39.771 15.025  1.00 33.23  ?  140 ALA A HB1  1 
ATOM   1873 H  HB2  . ALA A 1 140 ? 6.732   -39.776 15.606  1.00 33.23  ?  140 ALA A HB2  1 
ATOM   1874 H  HB3  . ALA A 1 140 ? 7.568   -38.425 15.573  1.00 33.23  ?  140 ALA A HB3  1 
ATOM   1875 N  N    . GLY A 1 141 ? 9.805   -38.003 17.757  1.00 24.92  ?  141 GLY A N    1 
ATOM   1876 C  CA   . GLY A 1 141 ? 11.139  -37.425 17.827  1.00 26.93  ?  141 GLY A CA   1 
ATOM   1877 C  C    . GLY A 1 141 ? 11.707  -37.050 16.474  1.00 28.39  ?  141 GLY A C    1 
ATOM   1878 O  O    . GLY A 1 141 ? 12.918  -37.185 16.254  1.00 31.45  ?  141 GLY A O    1 
ATOM   1879 H  H    . GLY A 1 141 ? 9.191   -37.518 18.113  1.00 29.99  ?  141 GLY A H    1 
ATOM   1880 H  HA2  . GLY A 1 141 ? 11.112  -36.626 18.377  1.00 32.40  ?  141 GLY A HA2  1 
ATOM   1881 H  HA3  . GLY A 1 141 ? 11.741  -38.060 18.244  1.00 32.40  ?  141 GLY A HA3  1 
ATOM   1882 N  N    . VAL A 1 142 ? 10.863  -36.572 15.565  1.00 25.29  ?  142 VAL A N    1 
ATOM   1883 C  CA   . VAL A 1 142 ? 11.258  -36.244 14.200  1.00 28.78  ?  142 VAL A CA   1 
ATOM   1884 C  C    . VAL A 1 142 ? 11.169  -34.738 14.004  1.00 29.20  ?  142 VAL A C    1 
ATOM   1885 O  O    . VAL A 1 142 ? 10.251  -34.084 14.513  1.00 33.38  ?  142 VAL A O    1 
ATOM   1886 C  CB   . VAL A 1 142 ? 10.377  -36.985 13.174  1.00 29.85  ?  142 VAL A CB   1 
ATOM   1887 C  CG1  . VAL A 1 142 ? 10.613  -36.463 11.760  1.00 39.73  ?  142 VAL A CG1  1 
ATOM   1888 C  CG2  . VAL A 1 142 ? 10.663  -38.473 13.225  1.00 32.57  ?  142 VAL A CG2  1 
ATOM   1889 H  H    . VAL A 1 142 ? 10.030  -36.424 15.721  1.00 30.43  ?  142 VAL A H    1 
ATOM   1890 H  HA   . VAL A 1 142 ? 12.179  -36.515 14.060  1.00 34.62  ?  142 VAL A HA   1 
ATOM   1891 H  HB   . VAL A 1 142 ? 9.443   -36.848 13.397  1.00 35.91  ?  142 VAL A HB   1 
ATOM   1892 H  HG11 . VAL A 1 142 ? 10.044  -36.951 11.145  1.00 47.76  ?  142 VAL A HG11 1 
ATOM   1893 H  HG12 . VAL A 1 142 ? 10.396  -35.518 11.733  1.00 47.76  ?  142 VAL A HG12 1 
ATOM   1894 H  HG13 . VAL A 1 142 ? 11.545  -36.596 11.526  1.00 47.76  ?  142 VAL A HG13 1 
ATOM   1895 H  HG21 . VAL A 1 142 ? 10.102  -38.924 12.575  1.00 39.16  ?  142 VAL A HG21 1 
ATOM   1896 H  HG22 . VAL A 1 142 ? 11.598  -38.622 13.016  1.00 39.16  ?  142 VAL A HG22 1 
ATOM   1897 H  HG23 . VAL A 1 142 ? 10.467  -38.801 14.117  1.00 39.16  ?  142 VAL A HG23 1 
ATOM   1898 N  N    . LEU A 1 143 ? 12.122  -34.196 13.255  1.00 26.10  ?  143 LEU A N    1 
ATOM   1899 C  CA   . LEU A 1 143 ? 12.176  -32.779 12.924  1.00 27.50  ?  143 LEU A CA   1 
ATOM   1900 C  C    . LEU A 1 143 ? 11.873  -32.600 11.443  1.00 27.05  ?  143 LEU A C    1 
ATOM   1901 O  O    . LEU A 1 143 ? 12.411  -33.331 10.606  1.00 26.81  ?  143 LEU A O    1 
ATOM   1902 C  CB   . LEU A 1 143 ? 13.556  -32.209 13.261  1.00 33.04  ?  143 LEU A CB   1 
ATOM   1903 C  CG   . LEU A 1 143 ? 13.839  -30.740 12.951  1.00 29.15  ?  143 LEU A CG   1 
ATOM   1904 C  CD1  . LEU A 1 143 ? 13.053  -29.843 13.885  1.00 34.36  ?  143 LEU A CD1  1 
ATOM   1905 C  CD2  . LEU A 1 143 ? 15.333  -30.468 13.064  1.00 34.85  ?  143 LEU A CD2  1 
ATOM   1906 H  H    . LEU A 1 143 ? 12.771  -34.647 12.916  1.00 31.40  ?  143 LEU A H    1 
ATOM   1907 H  HA   . LEU A 1 143 ? 11.509  -32.298 13.438  1.00 33.08  ?  143 LEU A HA   1 
ATOM   1908 H  HB2  . LEU A 1 143 ? 13.701  -32.327 14.212  1.00 39.73  ?  143 LEU A HB2  1 
ATOM   1909 H  HB3  . LEU A 1 143 ? 14.217  -32.729 12.776  1.00 39.73  ?  143 LEU A HB3  1 
ATOM   1910 H  HG   . LEU A 1 143 ? 13.563  -30.546 12.041  1.00 35.06  ?  143 LEU A HG   1 
ATOM   1911 H  HD11 . LEU A 1 143 ? 13.248  -28.917 13.671  1.00 41.31  ?  143 LEU A HD11 1 
ATOM   1912 H  HD12 . LEU A 1 143 ? 12.106  -30.018 13.769  1.00 41.31  ?  143 LEU A HD12 1 
ATOM   1913 H  HD13 . LEU A 1 143 ? 13.315  -30.033 14.800  1.00 41.31  ?  143 LEU A HD13 1 
ATOM   1914 H  HD21 . LEU A 1 143 ? 15.499  -29.533 12.865  1.00 41.90  ?  143 LEU A HD21 1 
ATOM   1915 H  HD22 . LEU A 1 143 ? 15.623  -30.671 13.967  1.00 41.90  ?  143 LEU A HD22 1 
ATOM   1916 H  HD23 . LEU A 1 143 ? 15.805  -31.030 12.430  1.00 41.90  ?  143 LEU A HD23 1 
ATOM   1917 N  N    . PHE A 1 144 ? 11.010  -31.635 11.123  1.00 26.95  ?  144 PHE A N    1 
ATOM   1918 C  CA   . PHE A 1 144 ? 10.661  -31.312 9.745   1.00 25.24  ?  144 PHE A CA   1 
ATOM   1919 C  C    . PHE A 1 144 ? 11.418  -30.069 9.299   1.00 26.61  ?  144 PHE A C    1 
ATOM   1920 O  O    . PHE A 1 144 ? 11.621  -29.140 10.085  1.00 24.75  ?  144 PHE A O    1 
ATOM   1921 C  CB   . PHE A 1 144 ? 9.159   -31.057 9.589   1.00 28.93  ?  144 PHE A CB   1 
ATOM   1922 C  CG   . PHE A 1 144 ? 8.296   -32.239 9.911   1.00 29.15  ?  144 PHE A CG   1 
ATOM   1923 C  CD1  . PHE A 1 144 ? 7.949   -32.521 11.222  1.00 34.70  ?  144 PHE A CD1  1 
ATOM   1924 C  CD2  . PHE A 1 144 ? 7.809   -33.052 8.904   1.00 29.20  ?  144 PHE A CD2  1 
ATOM   1925 C  CE1  . PHE A 1 144 ? 7.144   -33.603 11.522  1.00 33.14  ?  144 PHE A CE1  1 
ATOM   1926 C  CE2  . PHE A 1 144 ? 7.003   -34.139 9.199   1.00 28.40  ?  144 PHE A CE2  1 
ATOM   1927 C  CZ   . PHE A 1 144 ? 6.670   -34.412 10.509  1.00 27.77  ?  144 PHE A CZ   1 
ATOM   1928 H  H    . PHE A 1 144 ? 10.607  -31.144 11.703  1.00 32.42  ?  144 PHE A H    1 
ATOM   1929 H  HA   . PHE A 1 144 ? 10.911  -32.049 9.166   1.00 30.37  ?  144 PHE A HA   1 
ATOM   1930 H  HB2  . PHE A 1 144 ? 8.903   -30.334 10.184  1.00 34.80  ?  144 PHE A HB2  1 
ATOM   1931 H  HB3  . PHE A 1 144 ? 8.981   -30.803 8.670   1.00 34.80  ?  144 PHE A HB3  1 
ATOM   1932 H  HD1  . PHE A 1 144 ? 8.266   -31.980 11.908  1.00 41.72  ?  144 PHE A HD1  1 
ATOM   1933 H  HD2  . PHE A 1 144 ? 8.031   -32.872 8.019   1.00 35.13  ?  144 PHE A HD2  1 
ATOM   1934 H  HE1  . PHE A 1 144 ? 6.922   -33.786 12.406  1.00 39.85  ?  144 PHE A HE1  1 
ATOM   1935 H  HE2  . PHE A 1 144 ? 6.685   -34.682 8.515   1.00 34.16  ?  144 PHE A HE2  1 
ATOM   1936 H  HZ   . PHE A 1 144 ? 6.129   -35.142 10.710  1.00 33.40  ?  144 PHE A HZ   1 
ATOM   1937 N  N    . SER A 1 145 ? 11.827  -30.051 8.034   1.00 26.15  ?  145 SER A N    1 
ATOM   1938 C  CA   . SER A 1 145 ? 12.428  -28.848 7.477   1.00 22.86  ?  145 SER A CA   1 
ATOM   1939 C  C    . SER A 1 145 ? 11.417  -27.708 7.505   1.00 25.75  ?  145 SER A C    1 
ATOM   1940 O  O    . SER A 1 145 ? 10.219  -27.911 7.291   1.00 25.44  ?  145 SER A O    1 
ATOM   1941 C  CB   . SER A 1 145 ? 12.913  -29.104 6.048   1.00 24.33  ?  145 SER A CB   1 
ATOM   1942 O  OG   . SER A 1 145 ? 11.843  -29.462 5.191   1.00 29.01  ?  145 SER A OG   1 
ATOM   1943 H  H    . SER A 1 145 ? 11.768  -30.712 7.486   1.00 31.46  ?  145 SER A H    1 
ATOM   1944 H  HA   . SER A 1 145 ? 13.192  -28.592 8.017   1.00 27.52  ?  145 SER A HA   1 
ATOM   1945 H  HB2  . SER A 1 145 ? 13.329  -28.295 5.709   1.00 29.28  ?  145 SER A HB2  1 
ATOM   1946 H  HB3  . SER A 1 145 ? 13.560  -29.827 6.060   1.00 29.28  ?  145 SER A HB3  1 
ATOM   1947 H  HG   . SER A 1 145 ? 11.275  -28.844 5.167   1.00 34.89  ?  145 SER A HG   1 
ATOM   1948 N  N    . SER A 1 146 ? 11.902  -26.499 7.788   1.00 26.70  ?  146 SER A N    1 
ATOM   1949 C  CA   . SER A 1 146 ? 11.008  -25.357 7.931   1.00 28.13  ?  146 SER A CA   1 
ATOM   1950 C  C    . SER A 1 146 ? 10.391  -24.941 6.603   1.00 27.47  ?  146 SER A C    1 
ATOM   1951 O  O    . SER A 1 146 ? 9.386   -24.221 6.600   1.00 29.37  ?  146 SER A O    1 
ATOM   1952 C  CB   . SER A 1 146 ? 11.761  -24.175 8.546   1.00 29.02  ?  146 SER A CB   1 
ATOM   1953 O  OG   . SER A 1 146 ? 12.770  -23.708 7.668   1.00 26.43  ?  146 SER A OG   1 
ATOM   1954 H  H    . SER A 1 146 ? 12.736  -26.318 7.900   1.00 32.12  ?  146 SER A H    1 
ATOM   1955 H  HA   . SER A 1 146 ? 10.286  -25.597 8.533   1.00 33.84  ?  146 SER A HA   1 
ATOM   1956 H  HB2  . SER A 1 146 ? 11.134  -23.456 8.718   1.00 34.90  ?  146 SER A HB2  1 
ATOM   1957 H  HB3  . SER A 1 146 ? 12.173  -24.461 9.377   1.00 34.90  ?  146 SER A HB3  1 
ATOM   1958 H  HG   . SER A 1 146 ? 13.321  -24.323 7.511   1.00 31.79  ?  146 SER A HG   1 
ATOM   1959 N  N    . ARG A 1 147 ? 10.965  -25.377 5.483   1.00 25.76  ?  147 ARG A N    1 
ATOM   1960 C  CA   . ARG A 1 147 ? 10.463  -25.035 4.163   1.00 26.46  ?  147 ARG A CA   1 
ATOM   1961 C  C    . ARG A 1 147 ? 10.456  -26.278 3.285   1.00 26.59  ?  147 ARG A C    1 
ATOM   1962 O  O    . ARG A 1 147 ? 11.047  -27.309 3.617   1.00 29.20  ?  147 ARG A O    1 
ATOM   1963 C  CB   . ARG A 1 147 ? 11.319  -23.948 3.499   1.00 28.99  ?  147 ARG A CB   1 
ATOM   1964 C  CG   . ARG A 1 147 ? 11.423  -22.648 4.279   1.00 28.16  ?  147 ARG A CG   1 
ATOM   1965 C  CD   . ARG A 1 147 ? 10.127  -21.858 4.245   1.00 34.26  ?  147 ARG A CD   1 
ATOM   1966 N  NE   . ARG A 1 147 ? 10.273  -20.571 4.921   1.00 39.14  ?  147 ARG A NE   1 
ATOM   1967 C  CZ   . ARG A 1 147 ? 10.156  -20.389 6.233   1.00 39.52  ?  147 ARG A CZ   1 
ATOM   1968 N  NH1  . ARG A 1 147 ? 9.880   -21.410 7.033   1.00 31.36  ?  147 ARG A NH1  1 
ATOM   1969 N  NH2  . ARG A 1 147 ? 10.315  -19.178 6.752   1.00 38.36  ?  147 ARG A NH2  1 
ATOM   1970 H  H    . ARG A 1 147 ? 11.660  -25.883 5.467   1.00 30.99  ?  147 ARG A H    1 
ATOM   1971 H  HA   . ARG A 1 147 ? 9.553   -24.707 4.238   1.00 31.83  ?  147 ARG A HA   1 
ATOM   1972 H  HB2  . ARG A 1 147 ? 12.218  -24.292 3.382   1.00 34.88  ?  147 ARG A HB2  1 
ATOM   1973 H  HB3  . ARG A 1 147 ? 10.935  -23.739 2.633   1.00 34.88  ?  147 ARG A HB3  1 
ATOM   1974 H  HG2  . ARG A 1 147 ? 11.631  -22.848 5.205   1.00 33.87  ?  147 ARG A HG2  1 
ATOM   1975 H  HG3  . ARG A 1 147 ? 12.122  -22.098 3.891   1.00 33.87  ?  147 ARG A HG3  1 
ATOM   1976 H  HD2  . ARG A 1 147 ? 9.877   -21.691 3.323   1.00 41.20  ?  147 ARG A HD2  1 
ATOM   1977 H  HD3  . ARG A 1 147 ? 9.432   -22.362 4.696   1.00 41.20  ?  147 ARG A HD3  1 
ATOM   1978 H  HE   . ARG A 1 147 ? 10.446  -19.882 4.436   1.00 47.05  ?  147 ARG A HE   1 
ATOM   1979 H  HH11 . ARG A 1 147 ? 9.778   -22.198 6.704   1.00 37.72  ?  147 ARG A HH11 1 
ATOM   1980 H  HH12 . ARG A 1 147 ? 9.805   -21.284 7.880   1.00 37.72  ?  147 ARG A HH12 1 
ATOM   1981 H  HH21 . ARG A 1 147 ? 10.492  -18.510 6.239   1.00 46.11  ?  147 ARG A HH21 1 
ATOM   1982 H  HH22 . ARG A 1 147 ? 10.236  -19.059 7.600   1.00 46.11  ?  147 ARG A HH22 1 
ATOM   1983 N  N    . MET A 1 148 ? 9.765   -26.167 2.156   1.00 25.15  ?  148 MET A N    1 
ATOM   1984 C  CA   . MET A 1 148 ? 9.918   -27.071 1.028   1.00 24.58  ?  148 MET A CA   1 
ATOM   1985 C  C    . MET A 1 148 ? 10.687  -26.351 -0.071  1.00 27.61  ?  148 MET A C    1 
ATOM   1986 O  O    . MET A 1 148 ? 10.898  -25.137 -0.016  1.00 27.44  ?  148 MET A O    1 
ATOM   1987 C  CB   . MET A 1 148 ? 8.555   -27.539 0.497   1.00 29.13  ?  148 MET A CB   1 
ATOM   1988 C  CG   . MET A 1 148 ? 7.489   -27.770 1.562   1.00 29.61  ?  148 MET A CG   1 
ATOM   1989 S  SD   . MET A 1 148 ? 5.935   -28.366 0.851   1.00 29.96  ?  148 MET A SD   1 
ATOM   1990 C  CE   . MET A 1 148 ? 6.319   -30.099 0.596   1.00 27.18  ?  148 MET A CE   1 
ATOM   1991 H  H    . MET A 1 148 ? 9.181   -25.551 2.018   1.00 30.26  ?  148 MET A H    1 
ATOM   1992 H  HA   . MET A 1 148 ? 10.419  -27.853 1.310   1.00 29.58  ?  148 MET A HA   1 
ATOM   1993 H  HB2  . MET A 1 148 ? 8.216   -26.866 -0.115  1.00 35.04  ?  148 MET A HB2  1 
ATOM   1994 H  HB3  . MET A 1 148 ? 8.680   -28.375 0.022   1.00 35.04  ?  148 MET A HB3  1 
ATOM   1995 H  HG2  . MET A 1 148 ? 7.807   -28.435 2.192   1.00 35.61  ?  148 MET A HG2  1 
ATOM   1996 H  HG3  . MET A 1 148 ? 7.310   -26.934 2.020   1.00 35.61  ?  148 MET A HG3  1 
ATOM   1997 H  HE1  . MET A 1 148 ? 5.546   -30.540 0.209   1.00 32.69  ?  148 MET A HE1  1 
ATOM   1998 H  HE2  . MET A 1 148 ? 7.076   -30.169 -0.007  1.00 32.69  ?  148 MET A HE2  1 
ATOM   1999 H  HE3  . MET A 1 148 ? 6.538   -30.503 1.450   1.00 32.69  ?  148 MET A HE3  1 
ATOM   2000 N  N    . VAL A 1 149 ? 11.105  -27.113 -1.082  1.00 24.58  ?  149 VAL A N    1 
ATOM   2001 C  CA   . VAL A 1 149 ? 11.718  -26.551 -2.278  1.00 25.89  ?  149 VAL A CA   1 
ATOM   2002 C  C    . VAL A 1 149 ? 11.108  -27.228 -3.495  1.00 29.77  ?  149 VAL A C    1 
ATOM   2003 O  O    . VAL A 1 149 ? 10.576  -28.337 -3.418  1.00 29.36  ?  149 VAL A O    1 
ATOM   2004 C  CB   . VAL A 1 149 ? 13.261  -26.711 -2.305  1.00 26.74  ?  149 VAL A CB   1 
ATOM   2005 C  CG1  . VAL A 1 149 ? 13.893  -26.155 -1.039  1.00 28.69  ?  149 VAL A CG1  1 
ATOM   2006 C  CG2  . VAL A 1 149 ? 13.665  -28.163 -2.496  1.00 28.83  ?  149 VAL A CG2  1 
ATOM   2007 H  H    . VAL A 1 149 ? 11.043  -27.971 -1.096  1.00 29.58  ?  149 VAL A H    1 
ATOM   2008 H  HA   . VAL A 1 149 ? 11.513  -25.604 -2.325  1.00 31.15  ?  149 VAL A HA   1 
ATOM   2009 H  HB   . VAL A 1 149 ? 13.613  -26.207 -3.055  1.00 32.17  ?  149 VAL A HB   1 
ATOM   2010 H  HG11 . VAL A 1 149 ? 14.855  -26.271 -1.090  1.00 34.51  ?  149 VAL A HG11 1 
ATOM   2011 H  HG12 . VAL A 1 149 ? 13.677  -25.212 -0.967  1.00 34.51  ?  149 VAL A HG12 1 
ATOM   2012 H  HG13 . VAL A 1 149 ? 13.542  -26.635 -0.274  1.00 34.51  ?  149 VAL A HG13 1 
ATOM   2013 H  HG21 . VAL A 1 149 ? 14.633  -28.223 -2.507  1.00 34.68  ?  149 VAL A HG21 1 
ATOM   2014 H  HG22 . VAL A 1 149 ? 13.309  -28.688 -1.761  1.00 34.68  ?  149 VAL A HG22 1 
ATOM   2015 H  HG23 . VAL A 1 149 ? 13.303  -28.483 -3.337  1.00 34.68  ?  149 VAL A HG23 1 
ATOM   2016 N  N    . ILE A 1 150 ? 11.186  -26.534 -4.630  1.00 30.70  ?  150 ILE A N    1 
ATOM   2017 C  CA   . ILE A 1 150 ? 10.926  -27.118 -5.941  1.00 29.29  ?  150 ILE A CA   1 
ATOM   2018 C  C    . ILE A 1 150 ? 12.134  -26.816 -6.814  1.00 32.39  ?  150 ILE A C    1 
ATOM   2019 O  O    . ILE A 1 150 ? 12.422  -25.645 -7.092  1.00 31.22  ?  150 ILE A O    1 
ATOM   2020 C  CB   . ILE A 1 150 ? 9.640   -26.574 -6.590  1.00 27.78  ?  150 ILE A CB   1 
ATOM   2021 C  CG1  . ILE A 1 150 ? 8.410   -27.016 -5.795  1.00 31.05  ?  150 ILE A CG1  1 
ATOM   2022 C  CG2  . ILE A 1 150 ? 9.520   -27.063 -8.037  1.00 28.52  ?  150 ILE A CG2  1 
ATOM   2023 C  CD1  . ILE A 1 150 ? 7.104   -26.375 -6.248  1.00 30.75  ?  150 ILE A CD1  1 
ATOM   2024 H  H    . ILE A 1 150 ? 11.395  -25.701 -4.664  1.00 36.93  ?  150 ILE A H    1 
ATOM   2025 H  HA   . ILE A 1 150 ? 10.842  -28.081 -5.855  1.00 35.23  ?  150 ILE A HA   1 
ATOM   2026 H  HB   . ILE A 1 150 ? 9.678   -25.605 -6.591  1.00 33.42  ?  150 ILE A HB   1 
ATOM   2027 H  HG12 . ILE A 1 150 ? 8.313   -27.977 -5.882  1.00 37.34  ?  150 ILE A HG12 1 
ATOM   2028 H  HG13 . ILE A 1 150 ? 8.544   -26.785 -4.862  1.00 37.34  ?  150 ILE A HG13 1 
ATOM   2029 H  HG21 . ILE A 1 150 ? 8.705   -26.708 -8.424  1.00 34.31  ?  150 ILE A HG21 1 
ATOM   2030 H  HG22 . ILE A 1 150 ? 10.289  -26.751 -8.540  1.00 34.31  ?  150 ILE A HG22 1 
ATOM   2031 H  HG23 . ILE A 1 150 ? 9.494   -28.033 -8.041  1.00 34.31  ?  150 ILE A HG23 1 
ATOM   2032 H  HD11 . ILE A 1 150 ? 6.381   -26.709 -5.695  1.00 36.98  ?  150 ILE A HD11 1 
ATOM   2033 H  HD12 . ILE A 1 150 ? 7.176   -25.413 -6.155  1.00 36.98  ?  150 ILE A HD12 1 
ATOM   2034 H  HD13 . ILE A 1 150 ? 6.945   -26.607 -7.177  1.00 36.98  ?  150 ILE A HD13 1 
ATOM   2035 N  N    . SER A 1 151 ? 12.840  -27.861 -7.237  1.00 31.87  ?  151 SER A N    1 
ATOM   2036 C  CA   . SER A 1 151 ? 14.021  -27.703 -8.076  1.00 28.62  ?  151 SER A CA   1 
ATOM   2037 C  C    . SER A 1 151 ? 14.223  -28.983 -8.875  1.00 34.38  ?  151 SER A C    1 
ATOM   2038 O  O    . SER A 1 151 ? 13.646  -30.029 -8.571  1.00 29.89  ?  151 SER A O    1 
ATOM   2039 C  CB   . SER A 1 151 ? 15.262  -27.372 -7.241  1.00 32.13  ?  151 SER A CB   1 
ATOM   2040 O  OG   . SER A 1 151 ? 15.505  -28.360 -6.255  1.00 31.05  ?  151 SER A OG   1 
ATOM   2041 H  H    . SER A 1 151 ? 12.652  -28.679 -7.050  1.00 38.32  ?  151 SER A H    1 
ATOM   2042 H  HA   . SER A 1 151 ? 13.873  -26.976 -8.701  1.00 34.43  ?  151 SER A HA   1 
ATOM   2043 H  HB2  . SER A 1 151 ? 16.031  -27.321 -7.830  1.00 38.64  ?  151 SER A HB2  1 
ATOM   2044 H  HB3  . SER A 1 151 ? 15.126  -26.518 -6.802  1.00 38.64  ?  151 SER A HB3  1 
ATOM   2045 H  HG   . SER A 1 151 ? 16.188  -28.160 -5.810  1.00 37.34  ?  151 SER A HG   1 
ATOM   2046 N  N    . ASP A 1 152 ? 15.061  -28.885 -9.905  1.00 32.32  ?  152 ASP A N    1 
ATOM   2047 C  CA   . ASP A 1 152 ? 15.264  -30.002 -10.817 1.00 31.95  ?  152 ASP A CA   1 
ATOM   2048 C  C    . ASP A 1 152 ? 16.097  -31.095 -10.159 1.00 35.03  ?  152 ASP A C    1 
ATOM   2049 O  O    . ASP A 1 152 ? 17.143  -30.823 -9.562  1.00 33.65  ?  152 ASP A O    1 
ATOM   2050 C  CB   . ASP A 1 152 ? 15.947  -29.522 -12.098 1.00 36.98  ?  152 ASP A CB   1 
ATOM   2051 C  CG   . ASP A 1 152 ? 15.035  -28.680 -12.965 1.00 41.90  ?  152 ASP A CG   1 
ATOM   2052 O  OD1  . ASP A 1 152 ? 13.829  -28.587 -12.651 1.00 39.05  ?  152 ASP A OD1  1 
ATOM   2053 O  OD2  . ASP A 1 152 ? 15.525  -28.107 -13.961 1.00 53.11  ?  152 ASP A OD2  1 
ATOM   2054 H  H    . ASP A 1 152 ? 15.522  -28.184 -10.095 1.00 38.87  ?  152 ASP A H    1 
ATOM   2055 H  HA   . ASP A 1 152 ? 14.403  -30.380 -11.056 1.00 38.42  ?  152 ASP A HA   1 
ATOM   2056 H  HB2  . ASP A 1 152 ? 16.719  -28.984 -11.862 1.00 44.46  ?  152 ASP A HB2  1 
ATOM   2057 H  HB3  . ASP A 1 152 ? 16.226  -30.294 -12.616 1.00 44.46  ?  152 ASP A HB3  1 
ATOM   2058 N  N    . PHE A 1 153 ? 15.627  -32.335 -10.271 1.00 33.33  ?  153 PHE A N    1 
ATOM   2059 C  CA   . PHE A 1 153 ? 16.378  -33.491 -9.800  1.00 33.91  ?  153 PHE A CA   1 
ATOM   2060 C  C    . PHE A 1 153 ? 16.094  -34.661 -10.726 1.00 36.12  ?  153 PHE A C    1 
ATOM   2061 O  O    . PHE A 1 153 ? 14.929  -34.983 -10.985 1.00 32.02  ?  153 PHE A O    1 
ATOM   2062 C  CB   . PHE A 1 153 ? 16.015  -33.853 -8.356  1.00 32.11  ?  153 PHE A CB   1 
ATOM   2063 C  CG   . PHE A 1 153 ? 16.818  -34.998 -7.804  1.00 34.04  ?  153 PHE A CG   1 
ATOM   2064 C  CD1  . PHE A 1 153 ? 18.153  -34.829 -7.488  1.00 39.70  ?  153 PHE A CD1  1 
ATOM   2065 C  CD2  . PHE A 1 153 ? 16.242  -36.239 -7.603  1.00 33.57  ?  153 PHE A CD2  1 
ATOM   2066 C  CE1  . PHE A 1 153 ? 18.900  -35.876 -6.984  1.00 42.71  ?  153 PHE A CE1  1 
ATOM   2067 C  CE2  . PHE A 1 153 ? 16.986  -37.288 -7.099  1.00 38.12  ?  153 PHE A CE2  1 
ATOM   2068 C  CZ   . PHE A 1 153 ? 18.315  -37.104 -6.788  1.00 34.88  ?  153 PHE A CZ   1 
ATOM   2069 H  H    . PHE A 1 153 ? 14.866  -32.534 -10.620 1.00 40.08  ?  153 PHE A H    1 
ATOM   2070 H  HA   . PHE A 1 153 ? 17.327  -33.294 -9.837  1.00 40.78  ?  153 PHE A HA   1 
ATOM   2071 H  HB2  . PHE A 1 153 ? 16.171  -33.081 -7.790  1.00 38.61  ?  153 PHE A HB2  1 
ATOM   2072 H  HB3  . PHE A 1 153 ? 15.078  -34.103 -8.322  1.00 38.61  ?  153 PHE A HB3  1 
ATOM   2073 H  HD1  . PHE A 1 153 ? 18.554  -34.001 -7.619  1.00 47.72  ?  153 PHE A HD1  1 
ATOM   2074 H  HD2  . PHE A 1 153 ? 15.345  -36.370 -7.812  1.00 40.36  ?  153 PHE A HD2  1 
ATOM   2075 H  HE1  . PHE A 1 153 ? 19.797  -35.748 -6.775  1.00 51.34  ?  153 PHE A HE1  1 
ATOM   2076 H  HE2  . PHE A 1 153 ? 16.589  -38.119 -6.967  1.00 45.83  ?  153 PHE A HE2  1 
ATOM   2077 H  HZ   . PHE A 1 153 ? 18.816  -37.810 -6.448  1.00 41.94  ?  153 PHE A HZ   1 
ATOM   2078 N  N    . GLU A 1 154 ? 17.160  -35.289 -11.220 1.00 33.97  ?  154 GLU A N    1 
ATOM   2079 C  CA   . GLU A 1 154 ? 17.045  -36.407 -12.154 1.00 39.79  ?  154 GLU A CA   1 
ATOM   2080 C  C    . GLU A 1 154 ? 16.116  -36.058 -13.313 1.00 36.41  ?  154 GLU A C    1 
ATOM   2081 O  O    . GLU A 1 154 ? 15.293  -36.866 -13.749 1.00 41.45  ?  154 GLU A O    1 
ATOM   2082 C  CB   . GLU A 1 154 ? 16.586  -37.674 -11.427 1.00 39.77  ?  154 GLU A CB   1 
ATOM   2083 C  CG   . GLU A 1 154 ? 17.662  -38.246 -10.509 1.00 47.61  ?  154 GLU A CG   1 
ATOM   2084 C  CD   . GLU A 1 154 ? 17.179  -39.415 -9.671  1.00 57.51  ?  154 GLU A CD   1 
ATOM   2085 O  OE1  . GLU A 1 154 ? 15.988  -39.436 -9.296  1.00 58.47  ?  154 GLU A OE1  1 
ATOM   2086 O  OE2  . GLU A 1 154 ? 17.999  -40.315 -9.385  1.00 51.55  ?  154 GLU A OE2  1 
ATOM   2087 H  H    . GLU A 1 154 ? 17.972  -35.082 -11.027 1.00 40.84  ?  154 GLU A H    1 
ATOM   2088 H  HA   . GLU A 1 154 ? 17.922  -36.587 -12.527 1.00 47.83  ?  154 GLU A HA   1 
ATOM   2089 H  HB2  . GLU A 1 154 ? 15.810  -37.464 -10.885 1.00 47.80  ?  154 GLU A HB2  1 
ATOM   2090 H  HB3  . GLU A 1 154 ? 16.360  -38.351 -12.084 1.00 47.80  ?  154 GLU A HB3  1 
ATOM   2091 H  HG2  . GLU A 1 154 ? 18.405  -38.555 -11.051 1.00 57.21  ?  154 GLU A HG2  1 
ATOM   2092 H  HG3  . GLU A 1 154 ? 17.962  -37.550 -9.905  1.00 57.21  ?  154 GLU A HG3  1 
ATOM   2093 N  N    . GLY A 1 155 ? 16.249  -34.832 -13.813 1.00 38.59  ?  155 GLY A N    1 
ATOM   2094 C  CA   . GLY A 1 155 ? 15.584  -34.415 -15.028 1.00 42.22  ?  155 GLY A CA   1 
ATOM   2095 C  C    . GLY A 1 155 ? 14.167  -33.911 -14.875 1.00 43.98  ?  155 GLY A C    1 
ATOM   2096 O  O    . GLY A 1 155 ? 13.497  -33.694 -15.892 1.00 41.32  ?  155 GLY A O    1 
ATOM   2097 H  H    . GLY A 1 155 ? 16.731  -34.217 -13.454 1.00 46.39  ?  155 GLY A H    1 
ATOM   2098 H  HA2  . GLY A 1 155 ? 16.105  -33.707 -15.439 1.00 50.75  ?  155 GLY A HA2  1 
ATOM   2099 H  HA3  . GLY A 1 155 ? 15.565  -35.164 -15.644 1.00 50.75  ?  155 GLY A HA3  1 
ATOM   2100 N  N    . LYS A 1 156 ? 13.684  -33.709 -13.650 1.00 37.62  ?  156 LYS A N    1 
ATOM   2101 C  CA   . LYS A 1 156 ? 12.317  -33.261 -13.436 1.00 34.63  ?  156 LYS A CA   1 
ATOM   2102 C  C    . LYS A 1 156 ? 12.279  -32.226 -12.320 1.00 31.82  ?  156 LYS A C    1 
ATOM   2103 O  O    . LYS A 1 156 ? 12.981  -32.382 -11.310 1.00 31.11  ?  156 LYS A O    1 
ATOM   2104 C  CB   . LYS A 1 156 ? 11.390  -34.424 -13.058 1.00 41.15  ?  156 LYS A CB   1 
ATOM   2105 C  CG   . LYS A 1 156 ? 11.156  -35.447 -14.153 1.00 52.31  ?  156 LYS A CG   1 
ATOM   2106 C  CD   . LYS A 1 156 ? 10.238  -36.556 -13.655 1.00 51.04  ?  156 LYS A CD   1 
ATOM   2107 C  CE   . LYS A 1 156 ? 9.714   -37.416 -14.791 1.00 61.69  ?  156 LYS A CE   1 
ATOM   2108 N  NZ   . LYS A 1 156 ? 10.784  -38.236 -15.423 1.00 72.87  ?  156 LYS A NZ   1 
ATOM   2109 H  H    . LYS A 1 156 ? 14.133  -33.827 -12.925 1.00 45.23  ?  156 LYS A H    1 
ATOM   2110 H  HA   . LYS A 1 156 ? 11.981  -32.851 -14.248 1.00 41.64  ?  156 LYS A HA   1 
ATOM   2111 H  HB2  . LYS A 1 156 ? 11.776  -34.891 -12.300 1.00 49.46  ?  156 LYS A HB2  1 
ATOM   2112 H  HB3  . LYS A 1 156 ? 10.526  -34.060 -12.809 1.00 49.46  ?  156 LYS A HB3  1 
ATOM   2113 H  HG2  . LYS A 1 156 ? 10.734  -35.017 -14.913 1.00 62.86  ?  156 LYS A HG2  1 
ATOM   2114 H  HG3  . LYS A 1 156 ? 12.003  -35.842 -14.413 1.00 62.86  ?  156 LYS A HG3  1 
ATOM   2115 H  HD2  . LYS A 1 156 ? 10.732  -37.128 -13.046 1.00 61.33  ?  156 LYS A HD2  1 
ATOM   2116 H  HD3  . LYS A 1 156 ? 9.478   -36.161 -13.200 1.00 61.33  ?  156 LYS A HD3  1 
ATOM   2117 H  HE2  . LYS A 1 156 ? 9.037   -38.019 -14.446 1.00 74.11  ?  156 LYS A HE2  1 
ATOM   2118 H  HE3  . LYS A 1 156 ? 9.333   -36.842 -15.474 1.00 74.11  ?  156 LYS A HE3  1 
ATOM   2119 H  HZ1  . LYS A 1 156 ? 10.442  -38.726 -16.082 1.00 87.53  ?  156 LYS A HZ1  1 
ATOM   2120 H  HZ2  . LYS A 1 156 ? 11.417  -37.706 -15.755 1.00 87.53  ?  156 LYS A HZ2  1 
ATOM   2121 H  HZ3  . LYS A 1 156 ? 11.148  -38.779 -14.818 1.00 87.53  ?  156 LYS A HZ3  1 
ATOM   2122 N  N    . PRO A 1 157 ? 11.470  -31.175 -12.454 1.00 40.24  ?  157 PRO A N    1 
ATOM   2123 C  CA   . PRO A 1 157 ? 11.192  -30.336 -11.282 1.00 32.23  ?  157 PRO A CA   1 
ATOM   2124 C  C    . PRO A 1 157 ? 10.547  -31.182 -10.194 1.00 30.82  ?  157 PRO A C    1 
ATOM   2125 O  O    . PRO A 1 157 ? 9.607   -31.938 -10.447 1.00 29.14  ?  157 PRO A O    1 
ATOM   2126 C  CB   . PRO A 1 157 ? 10.244  -29.258 -11.822 1.00 33.12  ?  157 PRO A CB   1 
ATOM   2127 C  CG   . PRO A 1 157 ? 9.702   -29.809 -13.097 1.00 42.81  ?  157 PRO A CG   1 
ATOM   2128 C  CD   . PRO A 1 157 ? 10.754  -30.705 -13.653 1.00 36.67  ?  157 PRO A CD   1 
ATOM   2129 H  HA   . PRO A 1 157 ? 12.005  -29.926 -10.948 1.00 38.76  ?  157 PRO A HA   1 
ATOM   2130 H  HB2  . PRO A 1 157 ? 9.529   -29.104 -11.185 1.00 39.83  ?  157 PRO A HB2  1 
ATOM   2131 H  HB3  . PRO A 1 157 ? 10.740  -28.441 -11.986 1.00 39.83  ?  157 PRO A HB3  1 
ATOM   2132 H  HG2  . PRO A 1 157 ? 8.892   -30.310 -12.914 1.00 51.46  ?  157 PRO A HG2  1 
ATOM   2133 H  HG3  . PRO A 1 157 ? 9.519   -29.081 -13.711 1.00 51.46  ?  157 PRO A HG3  1 
ATOM   2134 H  HD2  . PRO A 1 157 ? 10.348  -31.453 -14.119 1.00 44.08  ?  157 PRO A HD2  1 
ATOM   2135 H  HD3  . PRO A 1 157 ? 11.352  -30.207 -14.231 1.00 44.08  ?  157 PRO A HD3  1 
ATOM   2136 N  N    . THR A 1 158 ? 11.076  -31.069 -8.979  1.00 31.35  ?  158 THR A N    1 
ATOM   2137 C  CA   . THR A 1 158 ? 10.732  -31.986 -7.901  1.00 23.59  ?  158 THR A CA   1 
ATOM   2138 C  C    . THR A 1 158 ? 10.447  -31.199 -6.633  1.00 27.63  ?  158 THR A C    1 
ATOM   2139 O  O    . THR A 1 158 ? 11.262  -30.372 -6.213  1.00 26.94  ?  158 THR A O    1 
ATOM   2140 C  CB   . THR A 1 158 ? 11.867  -32.991 -7.662  1.00 27.89  ?  158 THR A CB   1 
ATOM   2141 O  OG1  . THR A 1 158 ? 12.076  -33.768 -8.848  1.00 26.98  ?  158 THR A OG1  1 
ATOM   2142 C  CG2  . THR A 1 158 ? 11.541  -33.930 -6.511  1.00 26.63  ?  158 THR A CG2  1 
ATOM   2143 H  H    . THR A 1 158 ? 11.642  -30.463 -8.753  1.00 37.70  ?  158 THR A H    1 
ATOM   2144 H  HA   . THR A 1 158 ? 9.933   -32.479 -8.141  1.00 28.40  ?  158 THR A HA   1 
ATOM   2145 H  HB   . THR A 1 158 ? 12.681  -32.511 -7.444  1.00 33.55  ?  158 THR A HB   1 
ATOM   2146 H  HG1  . THR A 1 158 ? 12.283  -33.265 -9.488  1.00 32.46  ?  158 THR A HG1  1 
ATOM   2147 H  HG21 . THR A 1 158 ? 12.270  -34.556 -6.377  1.00 32.03  ?  158 THR A HG21 1 
ATOM   2148 H  HG22 . THR A 1 158 ? 11.408  -33.422 -5.696  1.00 32.03  ?  158 THR A HG22 1 
ATOM   2149 H  HG23 . THR A 1 158 ? 10.731  -34.427 -6.708  1.00 32.03  ?  158 THR A HG23 1 
ATOM   2150 N  N    . LEU A 1 159 ? 9.288   -31.458 -6.034  1.00 26.13  ?  159 LEU A N    1 
ATOM   2151 C  CA   . LEU A 1 159 ? 8.940   -30.881 -4.744  1.00 27.76  ?  159 LEU A CA   1 
ATOM   2152 C  C    . LEU A 1 159 ? 9.595   -31.698 -3.640  1.00 28.82  ?  159 LEU A C    1 
ATOM   2153 O  O    . LEU A 1 159 ? 9.501   -32.931 -3.634  1.00 27.30  ?  159 LEU A O    1 
ATOM   2154 C  CB   . LEU A 1 159 ? 7.421   -30.862 -4.569  1.00 28.61  ?  159 LEU A CB   1 
ATOM   2155 C  CG   . LEU A 1 159 ? 6.850   -30.446 -3.209  1.00 25.25  ?  159 LEU A CG   1 
ATOM   2156 C  CD1  . LEU A 1 159 ? 7.056   -28.964 -2.964  1.00 29.25  ?  159 LEU A CD1  1 
ATOM   2157 C  CD2  . LEU A 1 159 ? 5.372   -30.814 -3.129  1.00 28.05  ?  159 LEU A CD2  1 
ATOM   2158 H  H    . LEU A 1 159 ? 8.681   -31.971 -6.361  1.00 31.44  ?  159 LEU A H    1 
ATOM   2159 H  HA   . LEU A 1 159 ? 9.270   -29.971 -4.694  1.00 33.40  ?  159 LEU A HA   1 
ATOM   2160 H  HB2  . LEU A 1 159 ? 7.054   -30.250 -5.226  1.00 34.42  ?  159 LEU A HB2  1 
ATOM   2161 H  HB3  . LEU A 1 159 ? 7.090   -31.755 -4.752  1.00 34.42  ?  159 LEU A HB3  1 
ATOM   2162 H  HG   . LEU A 1 159 ? 7.317   -30.932 -2.511  1.00 30.38  ?  159 LEU A HG   1 
ATOM   2163 H  HD11 . LEU A 1 159 ? 6.685   -28.733 -2.098  1.00 35.18  ?  159 LEU A HD11 1 
ATOM   2164 H  HD12 . LEU A 1 159 ? 8.006   -28.771 -2.980  1.00 35.18  ?  159 LEU A HD12 1 
ATOM   2165 H  HD13 . LEU A 1 159 ? 6.605   -28.463 -3.662  1.00 35.18  ?  159 LEU A HD13 1 
ATOM   2166 H  HD21 . LEU A 1 159 ? 5.027   -30.545 -2.263  1.00 33.75  ?  159 LEU A HD21 1 
ATOM   2167 H  HD22 . LEU A 1 159 ? 4.894   -30.352 -3.835  1.00 33.75  ?  159 LEU A HD22 1 
ATOM   2168 H  HD23 . LEU A 1 159 ? 5.280   -31.773 -3.239  1.00 33.75  ?  159 LEU A HD23 1 
ATOM   2169 N  N    . MET A 1 160 ? 10.257  -31.016 -2.704  1.00 23.84  ?  160 MET A N    1 
ATOM   2170 C  CA   . MET A 1 160 ? 11.004  -31.702 -1.662  1.00 25.68  ?  160 MET A CA   1 
ATOM   2171 C  C    . MET A 1 160 ? 10.834  -31.015 -0.318  1.00 25.72  ?  160 MET A C    1 
ATOM   2172 O  O    . MET A 1 160 ? 10.686  -29.793 -0.231  1.00 26.17  ?  160 MET A O    1 
ATOM   2173 C  CB   . MET A 1 160 ? 12.505  -31.762 -1.963  1.00 24.94  ?  160 MET A CB   1 
ATOM   2174 C  CG   . MET A 1 160 ? 12.866  -32.185 -3.358  1.00 28.73  ?  160 MET A CG   1 
ATOM   2175 S  SD   . MET A 1 160 ? 14.658  -32.269 -3.521  1.00 28.86  ?  160 MET A SD   1 
ATOM   2176 C  CE   . MET A 1 160 ? 14.823  -32.333 -5.302  1.00 35.60  ?  160 MET A CE   1 
ATOM   2177 H  H    . MET A 1 160 ? 10.286  -30.158 -2.654  1.00 28.70  ?  160 MET A H    1 
ATOM   2178 H  HA   . MET A 1 160 ? 10.678  -32.613 -1.592  1.00 30.90  ?  160 MET A HA   1 
ATOM   2179 H  HB2  . MET A 1 160 ? 12.882  -30.880 -1.819  1.00 30.01  ?  160 MET A HB2  1 
ATOM   2180 H  HB3  . MET A 1 160 ? 12.915  -32.394 -1.352  1.00 30.01  ?  160 MET A HB3  1 
ATOM   2181 H  HG2  . MET A 1 160 ? 12.497  -33.064 -3.538  1.00 34.56  ?  160 MET A HG2  1 
ATOM   2182 H  HG3  . MET A 1 160 ? 12.527  -31.535 -3.993  1.00 34.56  ?  160 MET A HG3  1 
ATOM   2183 H  HE1  . MET A 1 160 ? 15.764  -32.382 -5.531  1.00 42.81  ?  160 MET A HE1  1 
ATOM   2184 H  HE2  . MET A 1 160 ? 14.360  -33.119 -5.634  1.00 42.81  ?  160 MET A HE2  1 
ATOM   2185 H  HE3  . MET A 1 160 ? 14.430  -31.532 -5.684  1.00 42.81  ?  160 MET A HE3  1 
ATOM   2186 N  N    . MET A 1 161 ? 10.858  -31.837 0.727   1.00 25.57  ?  161 MET A N    1 
ATOM   2187 C  CA   . MET A 1 161 ? 11.139  -31.418 2.091   1.00 22.39  ?  161 MET A CA   1 
ATOM   2188 C  C    . MET A 1 161 ? 11.984  -32.524 2.708   1.00 24.93  ?  161 MET A C    1 
ATOM   2189 O  O    . MET A 1 161 ? 12.273  -33.531 2.055   1.00 26.45  ?  161 MET A O    1 
ATOM   2190 C  CB   . MET A 1 161 ? 9.844   -31.146 2.870   1.00 25.67  ?  161 MET A CB   1 
ATOM   2191 C  CG   . MET A 1 161 ? 8.834   -32.290 2.862   1.00 26.36  ?  161 MET A CG   1 
ATOM   2192 S  SD   . MET A 1 161 ? 9.264   -33.653 3.955   1.00 27.26  ?  161 MET A SD   1 
ATOM   2193 C  CE   . MET A 1 161 ? 9.168   -32.865 5.561   1.00 28.69  ?  161 MET A CE   1 
ATOM   2194 H  H    . MET A 1 161 ? 10.707  -32.681 0.664   1.00 30.76  ?  161 MET A H    1 
ATOM   2195 H  HA   . MET A 1 161 ? 11.655  -30.597 2.071   1.00 26.95  ?  161 MET A HA   1 
ATOM   2196 H  HB2  . MET A 1 161 ? 10.072  -30.963 3.795   1.00 30.89  ?  161 MET A HB2  1 
ATOM   2197 H  HB3  . MET A 1 161 ? 9.409   -30.369 2.484   1.00 30.89  ?  161 MET A HB3  1 
ATOM   2198 H  HG2  . MET A 1 161 ? 7.971   -31.946 3.143   1.00 31.71  ?  161 MET A HG2  1 
ATOM   2199 H  HG3  . MET A 1 161 ? 8.769   -32.642 1.961   1.00 31.71  ?  161 MET A HG3  1 
ATOM   2200 H  HE1  . MET A 1 161 ? 9.385   -33.518 6.246   1.00 34.52  ?  161 MET A HE1  1 
ATOM   2201 H  HE2  . MET A 1 161 ? 9.801   -32.131 5.591   1.00 34.52  ?  161 MET A HE2  1 
ATOM   2202 H  HE3  . MET A 1 161 ? 8.267   -32.532 5.696   1.00 34.52  ?  161 MET A HE3  1 
ATOM   2203 N  N    . ARG A 1 162 ? 12.404  -32.360 3.962   1.00 26.41  ?  162 ARG A N    1 
ATOM   2204 C  CA   . ARG A 1 162 ? 13.203  -33.418 4.564   1.00 27.33  ?  162 ARG A CA   1 
ATOM   2205 C  C    . ARG A 1 162 ? 12.933  -33.540 6.056   1.00 26.38  ?  162 ARG A C    1 
ATOM   2206 O  O    . ARG A 1 162 ? 12.373  -32.644 6.694   1.00 24.25  ?  162 ARG A O    1 
ATOM   2207 C  CB   . ARG A 1 162 ? 14.703  -33.223 4.309   1.00 29.51  ?  162 ARG A CB   1 
ATOM   2208 C  CG   . ARG A 1 162 ? 15.307  -31.893 4.710   1.00 23.92  ?  162 ARG A CG   1 
ATOM   2209 C  CD   . ARG A 1 162 ? 16.813  -31.961 4.454   1.00 26.38  ?  162 ARG A CD   1 
ATOM   2210 N  NE   . ARG A 1 162 ? 17.519  -30.717 4.740   1.00 30.58  ?  162 ARG A NE   1 
ATOM   2211 C  CZ   . ARG A 1 162 ? 18.772  -30.470 4.367   1.00 33.61  ?  162 ARG A CZ   1 
ATOM   2212 N  NH1  . ARG A 1 162 ? 19.463  -31.379 3.689   1.00 29.69  ?  162 ARG A NH1  1 
ATOM   2213 N  NH2  . ARG A 1 162 ? 19.338  -29.308 4.666   1.00 30.66  ?  162 ARG A NH2  1 
ATOM   2214 H  H    . ARG A 1 162 ? 12.247  -31.678 4.463   1.00 31.77  ?  162 ARG A H    1 
ATOM   2215 H  HA   . ARG A 1 162 ? 12.949  -34.260 4.156   1.00 32.88  ?  162 ARG A HA   1 
ATOM   2216 H  HB2  . ARG A 1 162 ? 15.183  -33.912 4.794   1.00 35.50  ?  162 ARG A HB2  1 
ATOM   2217 H  HB3  . ARG A 1 162 ? 14.863  -33.333 3.358   1.00 35.50  ?  162 ARG A HB3  1 
ATOM   2218 H  HG2  . ARG A 1 162 ? 14.928  -31.181 4.172   1.00 28.79  ?  162 ARG A HG2  1 
ATOM   2219 H  HG3  . ARG A 1 162 ? 15.156  -31.732 5.655   1.00 28.79  ?  162 ARG A HG3  1 
ATOM   2220 H  HD2  . ARG A 1 162 ? 17.194  -32.654 5.016   1.00 31.73  ?  162 ARG A HD2  1 
ATOM   2221 H  HD3  . ARG A 1 162 ? 16.961  -32.178 3.520   1.00 31.73  ?  162 ARG A HD3  1 
ATOM   2222 H  HE   . ARG A 1 162 ? 17.123  -30.133 5.230   1.00 36.77  ?  162 ARG A HE   1 
ATOM   2223 H  HH11 . ARG A 1 162 ? 19.101  -32.134 3.491   1.00 35.72  ?  162 ARG A HH11 1 
ATOM   2224 H  HH12 . ARG A 1 162 ? 20.272  -31.214 3.450   1.00 35.72  ?  162 ARG A HH12 1 
ATOM   2225 H  HH21 . ARG A 1 162 ? 18.896  -28.715 5.105   1.00 36.87  ?  162 ARG A HH21 1 
ATOM   2226 H  HH22 . ARG A 1 162 ? 20.148  -29.149 4.424   1.00 36.87  ?  162 ARG A HH22 1 
ATOM   2227 N  N    . LEU A 1 163 ? 13.337  -34.691 6.587   1.00 23.53  ?  163 LEU A N    1 
ATOM   2228 C  CA   . LEU A 1 163 ? 13.121  -35.078 7.970   1.00 27.16  ?  163 LEU A CA   1 
ATOM   2229 C  C    . LEU A 1 163 ? 14.456  -35.407 8.618   1.00 23.39  ?  163 LEU A C    1 
ATOM   2230 O  O    . LEU A 1 163 ? 15.393  -35.846 7.948   1.00 27.46  ?  163 LEU A O    1 
ATOM   2231 C  CB   . LEU A 1 163 ? 12.210  -36.309 8.064   1.00 32.30  ?  163 LEU A CB   1 
ATOM   2232 C  CG   . LEU A 1 163 ? 10.845  -36.255 7.382   1.00 32.80  ?  163 LEU A CG   1 
ATOM   2233 C  CD1  . LEU A 1 163 ? 10.394  -37.658 7.016   1.00 34.51  ?  163 LEU A CD1  1 
ATOM   2234 C  CD2  . LEU A 1 163 ? 9.835   -35.597 8.292   1.00 34.89  ?  163 LEU A CD2  1 
ATOM   2235 H  H    . LEU A 1 163 ? 13.760  -35.290 6.138   1.00 28.32  ?  163 LEU A H    1 
ATOM   2236 H  HA   . LEU A 1 163 ? 12.709  -34.346 8.455   1.00 32.67  ?  163 LEU A HA   1 
ATOM   2237 H  HB2  . LEU A 1 163 ? 12.686  -37.061 7.679   1.00 38.84  ?  163 LEU A HB2  1 
ATOM   2238 H  HB3  . LEU A 1 163 ? 12.047  -36.487 9.004   1.00 38.84  ?  163 LEU A HB3  1 
ATOM   2239 H  HG   . LEU A 1 163 ? 10.912  -35.732 6.568   1.00 39.45  ?  163 LEU A HG   1 
ATOM   2240 H  HD11 . LEU A 1 163 ? 9.527   -37.608 6.584   1.00 41.49  ?  163 LEU A HD11 1 
ATOM   2241 H  HD12 . LEU A 1 163 ? 11.043  -38.051 6.411   1.00 41.49  ?  163 LEU A HD12 1 
ATOM   2242 H  HD13 . LEU A 1 163 ? 10.331  -38.190 7.825   1.00 41.49  ?  163 LEU A HD13 1 
ATOM   2243 H  HD21 . LEU A 1 163 ? 8.976   -35.572 7.842   1.00 41.96  ?  163 LEU A HD21 1 
ATOM   2244 H  HD22 . LEU A 1 163 ? 9.765   -36.112 9.111   1.00 41.96  ?  163 LEU A HD22 1 
ATOM   2245 H  HD23 . LEU A 1 163 ? 10.131  -34.695 8.491   1.00 41.96  ?  163 LEU A HD23 1 
ATOM   2246 N  N    . ALA A 1 164 ? 14.531  -35.211 9.931   1.00 23.06  ?  164 ALA A N    1 
ATOM   2247 C  CA   . ALA A 1 164 ? 15.699  -35.596 10.709  1.00 25.29  ?  164 ALA A CA   1 
ATOM   2248 C  C    . ALA A 1 164 ? 15.256  -36.330 11.964  1.00 26.57  ?  164 ALA A C    1 
ATOM   2249 O  O    . ALA A 1 164 ? 14.242  -35.983 12.576  1.00 27.41  ?  164 ALA A O    1 
ATOM   2250 C  CB   . ALA A 1 164 ? 16.552  -34.385 11.096  1.00 29.63  ?  164 ALA A CB   1 
ATOM   2251 H  H    . ALA A 1 164 ? 13.907  -34.850 10.400  1.00 27.75  ?  164 ALA A H    1 
ATOM   2252 H  HA   . ALA A 1 164 ? 16.249  -36.198 10.183  1.00 30.44  ?  164 ALA A HA   1 
ATOM   2253 H  HB1  . ALA A 1 164 ? 17.316  -34.689 11.611  1.00 35.63  ?  164 ALA A HB1  1 
ATOM   2254 H  HB2  . ALA A 1 164 ? 16.852  -33.940 10.288  1.00 35.63  ?  164 ALA A HB2  1 
ATOM   2255 H  HB3  . ALA A 1 164 ? 16.014  -33.778 11.628  1.00 35.63  ?  164 ALA A HB3  1 
ATOM   2256 N  N    . ASN A 1 165 ? 16.021  -37.353 12.334  1.00 28.69  ?  165 ASN A N    1 
ATOM   2257 C  CA   . ASN A 1 165 ? 15.802  -38.095 13.567  1.00 25.60  ?  165 ASN A CA   1 
ATOM   2258 C  C    . ASN A 1 165 ? 16.550  -37.398 14.697  1.00 29.39  ?  165 ASN A C    1 
ATOM   2259 O  O    . ASN A 1 165 ? 17.768  -37.212 14.616  1.00 30.94  ?  165 ASN A O    1 
ATOM   2260 C  CB   . ASN A 1 165 ? 16.286  -39.536 13.414  1.00 28.52  ?  165 ASN A CB   1 
ATOM   2261 C  CG   . ASN A 1 165 ? 15.867  -40.421 14.567  1.00 26.86  ?  165 ASN A CG   1 
ATOM   2262 O  OD1  . ASN A 1 165 ? 15.352  -39.943 15.578  1.00 28.46  ?  165 ASN A OD1  1 
ATOM   2263 N  ND2  . ASN A 1 165 ? 16.094  -41.724 14.424  1.00 29.67  ?  165 ASN A ND2  1 
ATOM   2264 H  H    . ASN A 1 165 ? 16.688  -37.642 11.874  1.00 34.51  ?  165 ASN A H    1 
ATOM   2265 H  HA   . ASN A 1 165 ? 14.855  -38.105 13.780  1.00 30.80  ?  165 ASN A HA   1 
ATOM   2266 H  HB2  . ASN A 1 165 ? 15.915  -39.910 12.600  1.00 34.30  ?  165 ASN A HB2  1 
ATOM   2267 H  HB3  . ASN A 1 165 ? 17.255  -39.541 13.370  1.00 34.30  ?  165 ASN A HB3  1 
ATOM   2268 H  HD21 . ASN A 1 165 ? 15.874  -42.270 15.051  1.00 35.69  ?  165 ASN A HD21 1 
ATOM   2269 H  HD22 . ASN A 1 165 ? 16.457  -42.021 13.703  1.00 35.69  ?  165 ASN A HD22 1 
ATOM   2270 N  N    . LEU A 1 166 ? 15.830  -37.014 15.746  1.00 32.68  ?  166 LEU A N    1 
ATOM   2271 C  CA   . LEU A 1 166 ? 16.451  -36.346 16.882  1.00 30.61  ?  166 LEU A CA   1 
ATOM   2272 C  C    . LEU A 1 166 ? 16.896  -37.315 17.970  1.00 35.72  ?  166 LEU A C    1 
ATOM   2273 O  O    . LEU A 1 166 ? 17.459  -36.876 18.978  1.00 31.89  ?  166 LEU A O    1 
ATOM   2274 C  CB   . LEU A 1 166 ? 15.489  -35.314 17.475  1.00 29.11  ?  166 LEU A CB   1 
ATOM   2275 C  CG   . LEU A 1 166 ? 15.044  -34.203 16.521  1.00 31.79  ?  166 LEU A CG   1 
ATOM   2276 C  CD1  . LEU A 1 166 ? 14.050  -33.283 17.209  1.00 39.64  ?  166 LEU A CD1  1 
ATOM   2277 C  CD2  . LEU A 1 166 ? 16.232  -33.407 16.005  1.00 38.63  ?  166 LEU A CD2  1 
ATOM   2278 H  H    . LEU A 1 166 ? 14.981  -37.129 15.824  1.00 39.30  ?  166 LEU A H    1 
ATOM   2279 H  HA   . LEU A 1 166 ? 17.238  -35.872 16.571  1.00 36.81  ?  166 LEU A HA   1 
ATOM   2280 H  HB2  . LEU A 1 166 ? 14.691  -35.775 17.776  1.00 35.02  ?  166 LEU A HB2  1 
ATOM   2281 H  HB3  . LEU A 1 166 ? 15.923  -34.890 18.232  1.00 35.02  ?  166 LEU A HB3  1 
ATOM   2282 H  HG   . LEU A 1 166 ? 14.601  -34.604 15.758  1.00 38.23  ?  166 LEU A HG   1 
ATOM   2283 H  HD11 . LEU A 1 166 ? 13.782  -32.588 16.588  1.00 47.65  ?  166 LEU A HD11 1 
ATOM   2284 H  HD12 . LEU A 1 166 ? 13.276  -33.801 17.480  1.00 47.65  ?  166 LEU A HD12 1 
ATOM   2285 H  HD13 . LEU A 1 166 ? 14.472  -32.887 17.987  1.00 47.65  ?  166 LEU A HD13 1 
ATOM   2286 H  HD21 . LEU A 1 166 ? 15.911  -32.715 15.406  1.00 46.44  ?  166 LEU A HD21 1 
ATOM   2287 H  HD22 . LEU A 1 166 ? 16.693  -33.005 16.758  1.00 46.44  ?  166 LEU A HD22 1 
ATOM   2288 H  HD23 . LEU A 1 166 ? 16.831  -34.004 15.531  1.00 46.44  ?  166 LEU A HD23 1 
ATOM   2289 N  N    . ARG A 1 167 ? 16.668  -38.610 17.792  1.00 28.45  ?  167 ARG A N    1 
ATOM   2290 C  CA   . ARG A 1 167 ? 17.072  -39.617 18.758  1.00 28.26  ?  167 ARG A CA   1 
ATOM   2291 C  C    . ARG A 1 167 ? 18.091  -40.550 18.120  1.00 29.00  ?  167 ARG A C    1 
ATOM   2292 O  O    . ARG A 1 167 ? 18.287  -40.558 16.902  1.00 32.91  ?  167 ARG A O    1 
ATOM   2293 C  CB   . ARG A 1 167 ? 15.862  -40.406 19.265  1.00 28.22  ?  167 ARG A CB   1 
ATOM   2294 C  CG   . ARG A 1 167 ? 14.799  -39.549 19.931  1.00 26.93  ?  167 ARG A CG   1 
ATOM   2295 C  CD   . ARG A 1 167 ? 13.642  -40.406 20.381  1.00 34.18  ?  167 ARG A CD   1 
ATOM   2296 N  NE   . ARG A 1 167 ? 12.688  -39.682 21.219  1.00 30.52  ?  167 ARG A NE   1 
ATOM   2297 C  CZ   . ARG A 1 167 ? 11.369  -39.665 21.041  1.00 32.97  ?  167 ARG A CZ   1 
ATOM   2298 N  NH1  . ARG A 1 167 ? 10.800  -40.342 20.051  1.00 28.73  ?  167 ARG A NH1  1 
ATOM   2299 N  NH2  . ARG A 1 167 ? 10.606  -38.972 21.874  1.00 28.10  ?  167 ARG A NH2  1 
ATOM   2300 H  H    . ARG A 1 167 ? 16.272  -38.936 17.102  1.00 34.22  ?  167 ARG A H    1 
ATOM   2301 H  HA   . ARG A 1 167 ? 17.491  -39.182 19.518  1.00 33.99  ?  167 ARG A HA   1 
ATOM   2302 H  HB2  . ARG A 1 167 ? 15.448  -40.859 18.513  1.00 33.94  ?  167 ARG A HB2  1 
ATOM   2303 H  HB3  . ARG A 1 167 ? 16.165  -41.060 19.914  1.00 33.94  ?  167 ARG A HB3  1 
ATOM   2304 H  HG2  . ARG A 1 167 ? 15.178  -39.109 20.708  1.00 32.40  ?  167 ARG A HG2  1 
ATOM   2305 H  HG3  . ARG A 1 167 ? 14.468  -38.893 19.298  1.00 32.40  ?  167 ARG A HG3  1 
ATOM   2306 H  HD2  . ARG A 1 167 ? 13.168  -40.732 19.600  1.00 41.09  ?  167 ARG A HD2  1 
ATOM   2307 H  HD3  . ARG A 1 167 ? 13.985  -41.154 20.896  1.00 41.09  ?  167 ARG A HD3  1 
ATOM   2308 H  HE   . ARG A 1 167 ? 13.005  -39.230 21.879  1.00 36.70  ?  167 ARG A HE   1 
ATOM   2309 H  HH11 . ARG A 1 167 ? 11.285  -40.798 19.507  1.00 34.56  ?  167 ARG A HH11 1 
ATOM   2310 H  HH12 . ARG A 1 167 ? 9.946   -40.322 19.952  1.00 34.56  ?  167 ARG A HH12 1 
ATOM   2311 H  HH21 . ARG A 1 167 ? 10.965  -38.530 22.519  1.00 33.80  ?  167 ARG A HH21 1 
ATOM   2312 H  HH22 . ARG A 1 167 ? 9.753   -38.958 21.764  1.00 33.80  ?  167 ARG A HH22 1 
ATOM   2313 N  N    . ILE A 1 168 ? 18.748  -41.346 18.964  1.00 29.19  ?  168 ILE A N    1 
ATOM   2314 C  CA   . ILE A 1 168 ? 19.782  -42.256 18.482  1.00 35.21  ?  168 ILE A CA   1 
ATOM   2315 C  C    . ILE A 1 168 ? 19.219  -43.597 18.025  1.00 32.98  ?  168 ILE A C    1 
ATOM   2316 O  O    . ILE A 1 168 ? 19.871  -44.290 17.231  1.00 40.59  ?  168 ILE A O    1 
ATOM   2317 C  CB   . ILE A 1 168 ? 20.862  -42.484 19.557  1.00 37.16  ?  168 ILE A CB   1 
ATOM   2318 C  CG1  . ILE A 1 168 ? 20.258  -43.118 20.813  1.00 38.03  ?  168 ILE A CG1  1 
ATOM   2319 C  CG2  . ILE A 1 168 ? 21.547  -41.161 19.889  1.00 42.59  ?  168 ILE A CG2  1 
ATOM   2320 C  CD1  . ILE A 1 168 ? 21.276  -43.490 21.870  1.00 52.52  ?  168 ILE A CD1  1 
ATOM   2321 H  H    . ILE A 1 168 ? 18.615  -41.376 19.813  1.00 35.12  ?  168 ILE A H    1 
ATOM   2322 H  HA   . ILE A 1 168 ? 20.216  -41.848 17.717  1.00 42.34  ?  168 ILE A HA   1 
ATOM   2323 H  HB   . ILE A 1 168 ? 21.527  -43.092 19.198  1.00 44.67  ?  168 ILE A HB   1 
ATOM   2324 H  HG12 . ILE A 1 168 ? 19.635  -42.489 21.211  1.00 45.71  ?  168 ILE A HG12 1 
ATOM   2325 H  HG13 . ILE A 1 168 ? 19.788  -43.927 20.558  1.00 45.71  ?  168 ILE A HG13 1 
ATOM   2326 H  HG21 . ILE A 1 168 ? 22.224  -41.318 20.566  1.00 51.19  ?  168 ILE A HG21 1 
ATOM   2327 H  HG22 . ILE A 1 168 ? 21.959  -40.809 19.085  1.00 51.19  ?  168 ILE A HG22 1 
ATOM   2328 H  HG23 . ILE A 1 168 ? 20.884  -40.537 20.223  1.00 51.19  ?  168 ILE A HG23 1 
ATOM   2329 H  HD11 . ILE A 1 168 ? 20.815  -43.882 22.628  1.00 63.11  ?  168 ILE A HD11 1 
ATOM   2330 H  HD12 . ILE A 1 168 ? 21.901  -44.129 21.495  1.00 63.11  ?  168 ILE A HD12 1 
ATOM   2331 H  HD13 . ILE A 1 168 ? 21.748  -42.689 22.148  1.00 63.11  ?  168 ILE A HD13 1 
ATOM   2332 N  N    . GLU A 1 169 ? 18.035  -43.984 18.496  1.00 30.32  ?  169 GLU A N    1 
ATOM   2333 C  CA   . GLU A 1 169 ? 17.404  -45.203 18.017  1.00 28.39  ?  169 GLU A CA   1 
ATOM   2334 C  C    . GLU A 1 169 ? 16.720  -44.947 16.674  1.00 29.77  ?  169 GLU A C    1 
ATOM   2335 O  O    . GLU A 1 169 ? 16.349  -43.818 16.339  1.00 32.89  ?  169 GLU A O    1 
ATOM   2336 C  CB   . GLU A 1 169 ? 16.391  -45.737 19.034  1.00 28.78  ?  169 GLU A CB   1 
ATOM   2337 C  CG   . GLU A 1 169 ? 16.964  -45.988 20.428  1.00 28.78  ?  169 GLU A CG   1 
ATOM   2338 C  CD   . GLU A 1 169 ? 16.965  -44.750 21.306  1.00 33.01  ?  169 GLU A CD   1 
ATOM   2339 O  OE1  . GLU A 1 169 ? 16.285  -43.765 20.954  1.00 31.26  ?  169 GLU A OE1  1 
ATOM   2340 O  OE2  . GLU A 1 169 ? 17.647  -44.763 22.354  1.00 37.26  ?  169 GLU A OE2  1 
ATOM   2341 H  H    . GLU A 1 169 ? 17.582  -43.559 19.090  1.00 36.47  ?  169 GLU A H    1 
ATOM   2342 H  HA   . GLU A 1 169 ? 18.084  -45.882 17.884  1.00 34.15  ?  169 GLU A HA   1 
ATOM   2343 H  HB2  . GLU A 1 169 ? 15.672  -45.092 19.124  1.00 34.62  ?  169 GLU A HB2  1 
ATOM   2344 H  HB3  . GLU A 1 169 ? 16.035  -46.578 18.707  1.00 34.62  ?  169 GLU A HB3  1 
ATOM   2345 H  HG2  . GLU A 1 169 ? 16.430  -46.667 20.870  1.00 34.61  ?  169 GLU A HG2  1 
ATOM   2346 H  HG3  . GLU A 1 169 ? 17.880  -46.293 20.340  1.00 34.61  ?  169 GLU A HG3  1 
ATOM   2347 N  N    A GLN A 1 170 ? 16.551  -46.019 15.908  0.53 28.67  ?  170 GLN A N    1 
ATOM   2348 N  N    B GLN A 1 170 ? 16.553  -46.016 15.906  0.47 28.55  ?  170 GLN A N    1 
ATOM   2349 C  CA   A GLN A 1 170 ? 16.039  -45.943 14.548  0.53 30.96  ?  170 GLN A CA   1 
ATOM   2350 C  CA   B GLN A 1 170 ? 16.032  -45.926 14.551  0.47 29.91  ?  170 GLN A CA   1 
ATOM   2351 C  C    A GLN A 1 170 ? 14.547  -46.262 14.509  0.53 31.84  ?  170 GLN A C    1 
ATOM   2352 C  C    B GLN A 1 170 ? 14.534  -46.210 14.530  0.47 31.72  ?  170 GLN A C    1 
ATOM   2353 O  O    A GLN A 1 170 ? 13.975  -46.800 15.460  0.53 27.59  ?  170 GLN A O    1 
ATOM   2354 O  O    B GLN A 1 170 ? 13.944  -46.682 15.505  0.47 27.62  ?  170 GLN A O    1 
ATOM   2355 C  CB   A GLN A 1 170 ? 16.814  -46.902 13.638  0.53 32.67  ?  170 GLN A CB   1 
ATOM   2356 C  CB   B GLN A 1 170 ? 16.774  -46.895 13.625  0.47 30.40  ?  170 GLN A CB   1 
ATOM   2357 C  CG   A GLN A 1 170 ? 18.297  -46.562 13.514  0.53 31.75  ?  170 GLN A CG   1 
ATOM   2358 C  CG   B GLN A 1 170 ? 18.241  -46.544 13.406  0.47 32.06  ?  170 GLN A CG   1 
ATOM   2359 C  CD   A GLN A 1 170 ? 19.103  -47.660 12.845  0.53 37.90  ?  170 GLN A CD   1 
ATOM   2360 C  CD   B GLN A 1 170 ? 19.079  -46.711 14.657  0.47 35.10  ?  170 GLN A CD   1 
ATOM   2361 O  OE1  A GLN A 1 170 ? 18.865  -48.844 13.071  0.53 35.96  ?  170 GLN A OE1  1 
ATOM   2362 O  OE1  B GLN A 1 170 ? 19.110  -47.785 15.259  0.47 38.73  ?  170 GLN A OE1  1 
ATOM   2363 N  NE2  A GLN A 1 170 ? 20.064  -47.271 12.017  0.53 41.76  ?  170 GLN A NE2  1 
ATOM   2364 N  NE2  B GLN A 1 170 ? 19.757  -45.642 15.063  0.47 31.61  ?  170 GLN A NE2  1 
ATOM   2365 H  H    A GLN A 1 170 ? 16.731  -46.821 16.162  0.53 34.49  ?  170 GLN A H    1 
ATOM   2366 H  H    B GLN A 1 170 ? 16.738  -46.819 16.153  0.47 34.34  ?  170 GLN A H    1 
ATOM   2367 H  HA   A GLN A 1 170 ? 16.164  -45.042 14.212  0.53 37.24  ?  170 GLN A HA   1 
ATOM   2368 H  HA   B GLN A 1 170 ? 16.171  -45.026 14.218  0.47 35.97  ?  170 GLN A HA   1 
ATOM   2369 H  HB2  A GLN A 1 170 ? 16.744  -47.801 13.997  0.53 39.28  ?  170 GLN A HB2  1 
ATOM   2370 H  HB2  B GLN A 1 170 ? 16.737  -47.784 14.010  0.47 36.57  ?  170 GLN A HB2  1 
ATOM   2371 H  HB3  A GLN A 1 170 ? 16.426  -46.872 12.749  0.53 39.28  ?  170 GLN A HB3  1 
ATOM   2372 H  HB3  B GLN A 1 170 ? 16.337  -46.894 12.759  0.47 36.57  ?  170 GLN A HB3  1 
ATOM   2373 H  HG2  A GLN A 1 170 ? 18.392  -45.756 12.982  0.53 38.18  ?  170 GLN A HG2  1 
ATOM   2374 H  HG2  B GLN A 1 170 ? 18.605  -47.126 12.721  0.47 38.55  ?  170 GLN A HG2  1 
ATOM   2375 H  HG3  A GLN A 1 170 ? 18.663  -46.419 14.400  0.53 38.18  ?  170 GLN A HG3  1 
ATOM   2376 H  HG3  B GLN A 1 170 ? 18.305  -45.618 13.124  0.47 38.55  ?  170 GLN A HG3  1 
ATOM   2377 H  HE21 A GLN A 1 170 ? 20.202  -46.432 11.883  0.53 50.19  ?  170 GLN A HE21 1 
ATOM   2378 H  HE21 B GLN A 1 170 ? 19.709  -44.908 14.617  0.47 38.02  ?  170 GLN A HE21 1 
ATOM   2379 H  HE22 A GLN A 1 170 ? 20.548  -47.856 11.614  0.53 50.19  ?  170 GLN A HE22 1 
ATOM   2380 H  HE22 B GLN A 1 170 ? 20.247  -45.686 15.768  0.47 38.02  ?  170 GLN A HE22 1 
ATOM   2381 N  N    . ILE A 1 171 ? 13.919  -45.911 13.388  1.00 26.45  ?  171 ILE A N    1 
ATOM   2382 C  CA   . ILE A 1 171 ? 12.490  -46.109 13.184  1.00 27.82  ?  171 ILE A CA   1 
ATOM   2383 C  C    . ILE A 1 171 ? 12.301  -47.071 12.018  1.00 28.57  ?  171 ILE A C    1 
ATOM   2384 O  O    . ILE A 1 171 ? 12.829  -46.842 10.922  1.00 29.65  ?  171 ILE A O    1 
ATOM   2385 C  CB   . ILE A 1 171 ? 11.763  -44.774 12.943  1.00 23.67  ?  171 ILE A CB   1 
ATOM   2386 C  CG1  . ILE A 1 171 ? 12.088  -43.806 14.090  1.00 27.84  ?  171 ILE A CG1  1 
ATOM   2387 C  CG2  . ILE A 1 171 ? 10.263  -45.006 12.854  1.00 24.22  ?  171 ILE A CG2  1 
ATOM   2388 C  CD1  . ILE A 1 171 ? 11.418  -42.444 14.002  1.00 27.27  ?  171 ILE A CD1  1 
ATOM   2389 H  H    A ILE A 1 171 ? 14.312  -45.547 12.716  0.53 31.82  ?  171 ILE A H    1 
ATOM   2390 H  H    B ILE A 1 171 ? 14.320  -45.583 12.702  0.47 31.82  ?  171 ILE A H    1 
ATOM   2391 H  HA   . ILE A 1 171 ? 12.110  -46.519 13.976  1.00 33.46  ?  171 ILE A HA   1 
ATOM   2392 H  HB   . ILE A 1 171 ? 12.074  -44.390 12.108  1.00 28.49  ?  171 ILE A HB   1 
ATOM   2393 H  HG12 . ILE A 1 171 ? 11.810  -44.214 14.924  1.00 33.49  ?  171 ILE A HG12 1 
ATOM   2394 H  HG13 . ILE A 1 171 ? 13.047  -43.658 14.105  1.00 33.49  ?  171 ILE A HG13 1 
ATOM   2395 H  HG21 . ILE A 1 171 ? 9.821   -44.156 12.702  1.00 29.15  ?  171 ILE A HG21 1 
ATOM   2396 H  HG22 . ILE A 1 171 ? 10.081  -45.611 12.117  1.00 29.15  ?  171 ILE A HG22 1 
ATOM   2397 H  HG23 . ILE A 1 171 ? 9.955   -45.397 13.686  1.00 29.15  ?  171 ILE A HG23 1 
ATOM   2398 H  HD11 . ILE A 1 171 ? 11.686  -41.911 14.767  1.00 32.81  ?  171 ILE A HD11 1 
ATOM   2399 H  HD12 . ILE A 1 171 ? 11.696  -42.008 13.181  1.00 32.81  ?  171 ILE A HD12 1 
ATOM   2400 H  HD13 . ILE A 1 171 ? 10.456  -42.566 14.004  1.00 32.81  ?  171 ILE A HD13 1 
ATOM   2401 N  N    . ILE A 1 172 ? 11.533  -48.137 12.258  1.00 29.22  ?  172 ILE A N    1 
ATOM   2402 C  CA   . ILE A 1 172 ? 11.450  -49.294 11.371  1.00 24.61  ?  172 ILE A CA   1 
ATOM   2403 C  C    . ILE A 1 172 ? 10.209  -49.185 10.497  1.00 22.10  ?  172 ILE A C    1 
ATOM   2404 O  O    . ILE A 1 172 ? 9.141   -48.762 10.961  1.00 28.78  ?  172 ILE A O    1 
ATOM   2405 C  CB   . ILE A 1 172 ? 11.433  -50.598 12.194  1.00 31.95  ?  172 ILE A CB   1 
ATOM   2406 C  CG1  . ILE A 1 172 ? 12.583  -50.608 13.207  1.00 32.31  ?  172 ILE A CG1  1 
ATOM   2407 C  CG2  . ILE A 1 172 ? 11.512  -51.813 11.290  1.00 36.01  ?  172 ILE A CG2  1 
ATOM   2408 C  CD1  . ILE A 1 172 ? 13.960  -50.414 12.597  1.00 35.91  ?  172 ILE A CD1  1 
ATOM   2409 H  H    . ILE A 1 172 ? 11.035  -48.212 12.955  1.00 35.15  ?  172 ILE A H    1 
ATOM   2410 H  HA   . ILE A 1 172 ? 12.229  -49.310 10.792  1.00 29.61  ?  172 ILE A HA   1 
ATOM   2411 H  HB   . ILE A 1 172 ? 10.596  -50.637 12.683  1.00 38.42  ?  172 ILE A HB   1 
ATOM   2412 H  HG12 . ILE A 1 172 ? 12.440  -49.892 13.846  1.00 38.86  ?  172 ILE A HG12 1 
ATOM   2413 H  HG13 . ILE A 1 172 ? 12.583  -51.462 13.668  1.00 38.86  ?  172 ILE A HG13 1 
ATOM   2414 H  HG21 . ILE A 1 172 ? 11.499  -52.614 11.837  1.00 43.29  ?  172 ILE A HG21 1 
ATOM   2415 H  HG22 . ILE A 1 172 ? 10.751  -51.809 10.689  1.00 43.29  ?  172 ILE A HG22 1 
ATOM   2416 H  HG23 . ILE A 1 172 ? 12.337  -51.773 10.780  1.00 43.29  ?  172 ILE A HG23 1 
ATOM   2417 H  HD11 . ILE A 1 172 ? 14.624  -50.434 13.305  1.00 43.18  ?  172 ILE A HD11 1 
ATOM   2418 H  HD12 . ILE A 1 172 ? 14.129  -51.129 11.965  1.00 43.18  ?  172 ILE A HD12 1 
ATOM   2419 H  HD13 . ILE A 1 172 ? 13.986  -49.557 12.143  1.00 43.18  ?  172 ILE A HD13 1 
ATOM   2420 N  N    . GLU A 1 173 ? 10.348  -49.584 9.232   1.00 26.34  ?  173 GLU A N    1 
ATOM   2421 C  CA   . GLU A 1 173 ? 9.266   -49.538 8.248   1.00 26.11  ?  173 GLU A CA   1 
ATOM   2422 C  C    . GLU A 1 173 ? 8.583   -48.172 8.269   1.00 30.07  ?  173 GLU A C    1 
ATOM   2423 O  O    . GLU A 1 173 ? 7.371   -48.044 8.455   1.00 26.76  ?  173 GLU A O    1 
ATOM   2424 C  CB   . GLU A 1 173 ? 8.258   -50.666 8.486   1.00 31.05  ?  173 GLU A CB   1 
ATOM   2425 C  CG   . GLU A 1 173 ? 8.838   -52.070 8.366   1.00 33.49  ?  173 GLU A CG   1 
ATOM   2426 C  CD   . GLU A 1 173 ? 9.011   -52.522 6.929   1.00 46.96  ?  173 GLU A CD   1 
ATOM   2427 O  OE1  . GLU A 1 173 ? 8.706   -53.698 6.634   1.00 48.16  ?  173 GLU A OE1  1 
ATOM   2428 O  OE2  . GLU A 1 173 ? 9.447   -51.703 6.093   1.00 41.50  ?  173 GLU A OE2  1 
ATOM   2429 H  H    . GLU A 1 173 ? 11.083  -49.894 8.912   1.00 31.70  ?  173 GLU A H    1 
ATOM   2430 H  HA   . GLU A 1 173 ? 9.646   -49.664 7.364   1.00 31.41  ?  173 GLU A HA   1 
ATOM   2431 H  HB2  . GLU A 1 173 ? 7.895   -50.574 9.381   1.00 37.34  ?  173 GLU A HB2  1 
ATOM   2432 H  HB3  . GLU A 1 173 ? 7.544   -50.587 7.834   1.00 37.34  ?  173 GLU A HB3  1 
ATOM   2433 H  HG2  . GLU A 1 173 ? 9.710   -52.088 8.791   1.00 40.26  ?  173 GLU A HG2  1 
ATOM   2434 H  HG3  . GLU A 1 173 ? 8.242   -52.696 8.806   1.00 40.26  ?  173 GLU A HG3  1 
ATOM   2435 N  N    . ALA A 1 174 ? 9.398   -47.140 8.066   1.00 29.21  ?  174 ALA A N    1 
ATOM   2436 C  CA   . ALA A 1 174 ? 8.918   -45.768 8.115   1.00 28.01  ?  174 ALA A CA   1 
ATOM   2437 C  C    . ALA A 1 174 ? 8.220   -45.402 6.812   1.00 30.84  ?  174 ALA A C    1 
ATOM   2438 O  O    . ALA A 1 174 ? 8.742   -45.654 5.723   1.00 31.30  ?  174 ALA A O    1 
ATOM   2439 C  CB   . ALA A 1 174 ? 10.080  -44.813 8.382   1.00 29.28  ?  174 ALA A CB   1 
ATOM   2440 H  H    . ALA A 1 174 ? 10.238  -47.212 7.896   1.00 35.14  ?  174 ALA A H    1 
ATOM   2441 H  HA   . ALA A 1 174 ? 8.279   -45.679 8.839   1.00 33.69  ?  174 ALA A HA   1 
ATOM   2442 H  HB1  . ALA A 1 174 ? 9.741   -43.904 8.411   1.00 35.22  ?  174 ALA A HB1  1 
ATOM   2443 H  HB2  . ALA A 1 174 ? 10.488  -45.042 9.232   1.00 35.22  ?  174 ALA A HB2  1 
ATOM   2444 H  HB3  . ALA A 1 174 ? 10.731  -44.900 7.668   1.00 35.22  ?  174 ALA A HB3  1 
ATOM   2445 N  N    . ASP A 1 175 ? 7.038   -44.804 6.930   1.00 28.05  ?  175 ASP A N    1 
ATOM   2446 C  CA   . ASP A 1 175 ? 6.263   -44.339 5.791   1.00 31.80  ?  175 ASP A CA   1 
ATOM   2447 C  C    . ASP A 1 175 ? 6.143   -42.825 5.851   1.00 24.70  ?  175 ASP A C    1 
ATOM   2448 O  O    . ASP A 1 175 ? 6.077   -42.237 6.933   1.00 26.20  ?  175 ASP A O    1 
ATOM   2449 C  CB   . ASP A 1 175 ? 4.858   -44.956 5.770   1.00 31.63  ?  175 ASP A CB   1 
ATOM   2450 C  CG   . ASP A 1 175 ? 4.871   -46.431 5.437   1.00 41.43  ?  175 ASP A CG   1 
ATOM   2451 O  OD1  . ASP A 1 175 ? 5.635   -46.831 4.534   1.00 42.00  ?  175 ASP A OD1  1 
ATOM   2452 O  OD2  . ASP A 1 175 ? 4.114   -47.190 6.078   1.00 44.17  ?  175 ASP A OD2  1 
ATOM   2453 H  H    . ASP A 1 175 ? 6.654   -44.653 7.685   1.00 33.74  ?  175 ASP A H    1 
ATOM   2454 H  HA   . ASP A 1 175 ? 6.719   -44.580 4.969   1.00 38.25  ?  175 ASP A HA   1 
ATOM   2455 H  HB2  . ASP A 1 175 ? 4.454   -44.850 6.645   1.00 38.04  ?  175 ASP A HB2  1 
ATOM   2456 H  HB3  . ASP A 1 175 ? 4.323   -44.502 5.100   1.00 38.04  ?  175 ASP A HB3  1 
ATOM   2457 N  N    . VAL A 1 176 ? 6.105   -42.193 4.681   1.00 24.91  ?  176 VAL A N    1 
ATOM   2458 C  CA   . VAL A 1 176 ? 5.897   -40.754 4.604   1.00 26.19  ?  176 VAL A CA   1 
ATOM   2459 C  C    . VAL A 1 176 ? 4.883   -40.455 3.510   1.00 25.19  ?  176 VAL A C    1 
ATOM   2460 O  O    . VAL A 1 176 ? 4.800   -41.158 2.498   1.00 29.77  ?  176 VAL A O    1 
ATOM   2461 C  CB   . VAL A 1 176 ? 7.216   -39.984 4.357   1.00 25.19  ?  176 VAL A CB   1 
ATOM   2462 C  CG1  . VAL A 1 176 ? 7.806   -40.323 2.996   1.00 26.36  ?  176 VAL A CG1  1 
ATOM   2463 C  CG2  . VAL A 1 176 ? 6.981   -38.490 4.498   1.00 39.83  ?  176 VAL A CG2  1 
ATOM   2464 H  H    . VAL A 1 176 ? 6.199   -42.577 3.917   1.00 29.98  ?  176 VAL A H    1 
ATOM   2465 H  HA   . VAL A 1 176 ? 5.527   -40.446 5.446   1.00 31.51  ?  176 VAL A HA   1 
ATOM   2466 H  HB   . VAL A 1 176 ? 7.861   -40.247 5.032   1.00 30.30  ?  176 VAL A HB   1 
ATOM   2467 H  HG11 . VAL A 1 176 ? 8.630   -39.823 2.876   1.00 31.71  ?  176 VAL A HG11 1 
ATOM   2468 H  HG12 . VAL A 1 176 ? 7.988   -41.275 2.959   1.00 31.71  ?  176 VAL A HG12 1 
ATOM   2469 H  HG13 . VAL A 1 176 ? 7.169   -40.080 2.306   1.00 31.71  ?  176 VAL A HG13 1 
ATOM   2470 H  HG21 . VAL A 1 176 ? 7.817   -38.023 4.341   1.00 47.88  ?  176 VAL A HG21 1 
ATOM   2471 H  HG22 . VAL A 1 176 ? 6.318   -38.213 3.847   1.00 47.88  ?  176 VAL A HG22 1 
ATOM   2472 H  HG23 . VAL A 1 176 ? 6.662   -38.305 5.395   1.00 47.88  ?  176 VAL A HG23 1 
ATOM   2473 N  N    . HIS A 1 177 ? 4.104   -39.400 3.733   1.00 29.47  ?  177 HIS A N    1 
ATOM   2474 C  CA   . HIS A 1 177 ? 3.126   -38.914 2.771   1.00 29.66  ?  177 HIS A CA   1 
ATOM   2475 C  C    . HIS A 1 177 ? 3.334   -37.420 2.580   1.00 27.20  ?  177 HIS A C    1 
ATOM   2476 O  O    . HIS A 1 177 ? 3.486   -36.683 3.560   1.00 29.81  ?  177 HIS A O    1 
ATOM   2477 C  CB   . HIS A 1 177 ? 1.689   -39.169 3.244   1.00 33.79  ?  177 HIS A CB   1 
ATOM   2478 C  CG   . HIS A 1 177 ? 1.407   -40.593 3.610   1.00 28.90  ?  177 HIS A CG   1 
ATOM   2479 N  ND1  . HIS A 1 177 ? 0.737   -41.458 2.772   1.00 30.61  ?  177 HIS A ND1  1 
ATOM   2480 C  CD2  . HIS A 1 177 ? 1.684   -41.296 4.733   1.00 31.03  ?  177 HIS A CD2  1 
ATOM   2481 C  CE1  . HIS A 1 177 ? 0.621   -42.635 3.361   1.00 27.79  ?  177 HIS A CE1  1 
ATOM   2482 N  NE2  . HIS A 1 177 ? 1.186   -42.563 4.552   1.00 32.94  ?  177 HIS A NE2  1 
ATOM   2483 H  H    . HIS A 1 177 ? 4.126   -38.938 4.457   1.00 35.45  ?  177 HIS A H    1 
ATOM   2484 H  HA   . HIS A 1 177 ? 3.257   -39.358 1.919   1.00 35.68  ?  177 HIS A HA   1 
ATOM   2485 H  HB2  . HIS A 1 177 ? 1.518   -38.624 4.027   1.00 40.62  ?  177 HIS A HB2  1 
ATOM   2486 H  HB3  . HIS A 1 177 ? 1.079   -38.921 2.532   1.00 40.62  ?  177 HIS A HB3  1 
ATOM   2487 H  HD1  . HIS A 1 177 ? 0.443   -41.263 1.988   1.00 36.81  ?  177 HIS A HD1  1 
ATOM   2488 H  HD2  . HIS A 1 177 ? 2.129   -40.981 5.486   1.00 37.31  ?  177 HIS A HD2  1 
ATOM   2489 H  HE1  . HIS A 1 177 ? 0.212   -43.387 2.997   1.00 33.44  ?  177 HIS A HE1  1 
ATOM   2490 N  N    . LEU A 1 178 ? 3.364   -36.982 1.325   1.00 26.16  ?  178 LEU A N    1 
ATOM   2491 C  CA   . LEU A 1 178 ? 3.217   -35.576 0.971   1.00 25.77  ?  178 LEU A CA   1 
ATOM   2492 C  C    . LEU A 1 178 ? 1.821   -35.400 0.392   1.00 28.64  ?  178 LEU A C    1 
ATOM   2493 O  O    . LEU A 1 178 ? 1.508   -35.967 -0.661  1.00 31.42  ?  178 LEU A O    1 
ATOM   2494 C  CB   . LEU A 1 178 ? 4.278   -35.130 -0.036  1.00 32.18  ?  178 LEU A CB   1 
ATOM   2495 C  CG   . LEU A 1 178 ? 5.750   -35.254 0.369   1.00 37.38  ?  178 LEU A CG   1 
ATOM   2496 C  CD1  . LEU A 1 178 ? 6.628   -34.580 -0.677  1.00 34.10  ?  178 LEU A CD1  1 
ATOM   2497 C  CD2  . LEU A 1 178 ? 6.006   -34.656 1.744   1.00 35.79  ?  178 LEU A CD2  1 
ATOM   2498 H  H    . LEU A 1 178 ? 3.470   -37.496 0.644   1.00 31.47  ?  178 LEU A H    1 
ATOM   2499 H  HA   . LEU A 1 178 ? 3.295   -35.028 1.768   1.00 31.01  ?  178 LEU A HA   1 
ATOM   2500 H  HB2  . LEU A 1 178 ? 4.162   -35.656 -0.843  1.00 38.70  ?  178 LEU A HB2  1 
ATOM   2501 H  HB3  . LEU A 1 178 ? 4.119   -34.196 -0.242  1.00 38.70  ?  178 LEU A HB3  1 
ATOM   2502 H  HG   . LEU A 1 178 ? 5.990   -36.193 0.401   1.00 44.94  ?  178 LEU A HG   1 
ATOM   2503 H  HD11 . LEU A 1 178 ? 7.557   -34.665 -0.410  1.00 41.00  ?  178 LEU A HD11 1 
ATOM   2504 H  HD12 . LEU A 1 178 ? 6.489   -35.014 -1.533  1.00 41.00  ?  178 LEU A HD12 1 
ATOM   2505 H  HD13 . LEU A 1 178 ? 6.385   -33.643 -0.736  1.00 41.00  ?  178 LEU A HD13 1 
ATOM   2506 H  HD21 . LEU A 1 178 ? 6.947   -34.755 1.960   1.00 43.03  ?  178 LEU A HD21 1 
ATOM   2507 H  HD22 . LEU A 1 178 ? 5.767   -33.716 1.729   1.00 43.03  ?  178 LEU A HD22 1 
ATOM   2508 H  HD23 . LEU A 1 178 ? 5.465   -35.125 2.398   1.00 43.03  ?  178 LEU A HD23 1 
ATOM   2509 N  N    . VAL A 1 179 ? 0.987   -34.626 1.079   1.00 28.15  ?  179 VAL A N    1 
ATOM   2510 C  CA   . VAL A 1 179 ? -0.432  -34.518 0.764   1.00 30.60  ?  179 VAL A CA   1 
ATOM   2511 C  C    . VAL A 1 179 ? -0.727  -33.092 0.323   1.00 25.09  ?  179 VAL A C    1 
ATOM   2512 O  O    . VAL A 1 179 ? -0.555  -32.146 1.103   1.00 29.54  ?  179 VAL A O    1 
ATOM   2513 C  CB   . VAL A 1 179 ? -1.304  -34.912 1.967   1.00 34.35  ?  179 VAL A CB   1 
ATOM   2514 C  CG1  . VAL A 1 179 ? -2.780  -34.859 1.604   1.00 32.25  ?  179 VAL A CG1  1 
ATOM   2515 C  CG2  . VAL A 1 179 ? -0.926  -36.304 2.457   1.00 29.15  ?  179 VAL A CG2  1 
ATOM   2516 H  H    . VAL A 1 179 ? 1.227   -34.142 1.749   1.00 33.86  ?  179 VAL A H    1 
ATOM   2517 H  HA   . VAL A 1 179 ? -0.643  -35.114 0.028   1.00 36.80  ?  179 VAL A HA   1 
ATOM   2518 H  HB   . VAL A 1 179 ? -1.149  -34.285 2.691   1.00 41.30  ?  179 VAL A HB   1 
ATOM   2519 H  HG11 . VAL A 1 179 ? -3.304  -35.111 2.380   1.00 38.79  ?  179 VAL A HG11 1 
ATOM   2520 H  HG12 . VAL A 1 179 ? -3.005  -33.956 1.332   1.00 38.79  ?  179 VAL A HG12 1 
ATOM   2521 H  HG13 . VAL A 1 179 ? -2.948  -35.476 0.875   1.00 38.79  ?  179 VAL A HG13 1 
ATOM   2522 H  HG21 . VAL A 1 179 ? -1.486  -36.534 3.215   1.00 35.07  ?  179 VAL A HG21 1 
ATOM   2523 H  HG22 . VAL A 1 179 ? -1.064  -36.940 1.738   1.00 35.07  ?  179 VAL A HG22 1 
ATOM   2524 H  HG23 . VAL A 1 179 ? 0.007   -36.301 2.724   1.00 35.07  ?  179 VAL A HG23 1 
ATOM   2525 N  N    . LEU A 1 180 ? -1.166  -32.939 -0.924  1.00 27.32  ?  180 LEU A N    1 
ATOM   2526 C  CA   . LEU A 1 180 ? -1.684  -31.666 -1.404  1.00 28.43  ?  180 LEU A CA   1 
ATOM   2527 C  C    . LEU A 1 180 ? -3.145  -31.528 -1.005  1.00 33.72  ?  180 LEU A C    1 
ATOM   2528 O  O    . LEU A 1 180 ? -3.941  -32.447 -1.217  1.00 30.39  ?  180 LEU A O    1 
ATOM   2529 C  CB   . LEU A 1 180 ? -1.553  -31.571 -2.925  1.00 28.24  ?  180 LEU A CB   1 
ATOM   2530 C  CG   . LEU A 1 180 ? -2.318  -30.435 -3.620  1.00 30.27  ?  180 LEU A CG   1 
ATOM   2531 C  CD1  . LEU A 1 180 ? -1.722  -29.075 -3.285  1.00 27.70  ?  180 LEU A CD1  1 
ATOM   2532 C  CD2  . LEU A 1 180 ? -2.350  -30.654 -5.120  1.00 29.64  ?  180 LEU A CD2  1 
ATOM   2533 H  H    . LEU A 1 180 ? -1.173  -33.565 -1.514  1.00 32.86  ?  180 LEU A H    1 
ATOM   2534 H  HA   . LEU A 1 180 ? -1.183  -30.938 -1.004  1.00 34.20  ?  180 LEU A HA   1 
ATOM   2535 H  HB2  . LEU A 1 180 ? -0.614  -31.457 -3.140  1.00 33.97  ?  180 LEU A HB2  1 
ATOM   2536 H  HB3  . LEU A 1 180 ? -1.869  -32.405 -3.307  1.00 33.97  ?  180 LEU A HB3  1 
ATOM   2537 H  HG   . LEU A 1 180 ? -3.235  -30.439 -3.304  1.00 36.40  ?  180 LEU A HG   1 
ATOM   2538 H  HD11 . LEU A 1 180 ? -2.231  -28.387 -3.741  1.00 33.33  ?  180 LEU A HD11 1 
ATOM   2539 H  HD12 . LEU A 1 180 ? -1.767  -28.939 -2.326  1.00 33.33  ?  180 LEU A HD12 1 
ATOM   2540 H  HD13 . LEU A 1 180 ? -0.798  -29.054 -3.579  1.00 33.33  ?  180 LEU A HD13 1 
ATOM   2541 H  HD21 . LEU A 1 180 ? -2.837  -29.925 -5.535  1.00 35.65  ?  180 LEU A HD21 1 
ATOM   2542 H  HD22 . LEU A 1 180 ? -1.439  -30.677 -5.455  1.00 35.65  ?  180 LEU A HD22 1 
ATOM   2543 H  HD23 . LEU A 1 180 ? -2.792  -31.496 -5.307  1.00 35.65  ?  180 LEU A HD23 1 
ATOM   2544 N  N    . VAL A 1 181 ? -3.496  -30.379 -0.439  1.00 32.07  ?  181 VAL A N    1 
ATOM   2545 C  CA   . VAL A 1 181 ? -4.881  -30.025 -0.144  1.00 26.15  ?  181 VAL A CA   1 
ATOM   2546 C  C    . VAL A 1 181 ? -5.174  -28.726 -0.878  1.00 30.30  ?  181 VAL A C    1 
ATOM   2547 O  O    . VAL A 1 181 ? -4.455  -27.735 -0.699  1.00 27.07  ?  181 VAL A O    1 
ATOM   2548 C  CB   . VAL A 1 181 ? -5.130  -29.870 1.365   1.00 30.56  ?  181 VAL A CB   1 
ATOM   2549 C  CG1  . VAL A 1 181 ? -6.612  -29.628 1.640   1.00 31.23  ?  181 VAL A CG1  1 
ATOM   2550 C  CG2  . VAL A 1 181 ? -4.639  -31.098 2.127   1.00 34.13  ?  181 VAL A CG2  1 
ATOM   2551 H  H    . VAL A 1 181 ? -2.934  -29.770 -0.209  1.00 38.56  ?  181 VAL A H    1 
ATOM   2552 H  HA   . VAL A 1 181 ? -5.472  -30.714 -0.486  1.00 31.47  ?  181 VAL A HA   1 
ATOM   2553 H  HB   . VAL A 1 181 ? -4.636  -29.100 1.688   1.00 36.75  ?  181 VAL A HB   1 
ATOM   2554 H  HG11 . VAL A 1 181 ? -6.744  -29.533 2.596   1.00 37.56  ?  181 VAL A HG11 1 
ATOM   2555 H  HG12 . VAL A 1 181 ? -6.889  -28.817 1.185   1.00 37.56  ?  181 VAL A HG12 1 
ATOM   2556 H  HG13 . VAL A 1 181 ? -7.122  -30.383 1.308   1.00 37.56  ?  181 VAL A HG13 1 
ATOM   2557 H  HG21 . VAL A 1 181 ? -4.809  -30.970 3.074   1.00 41.03  ?  181 VAL A HG21 1 
ATOM   2558 H  HG22 . VAL A 1 181 ? -5.116  -31.879 1.807   1.00 41.03  ?  181 VAL A HG22 1 
ATOM   2559 H  HG23 . VAL A 1 181 ? -3.687  -31.205 1.974   1.00 41.03  ?  181 VAL A HG23 1 
ATOM   2560 N  N    . ARG A 1 182 ? -6.213  -28.727 -1.708  1.00 31.96  ?  182 ARG A N    1 
ATOM   2561 C  CA   . ARG A 1 182 ? -6.555  -27.531 -2.465  1.00 35.93  ?  182 ARG A CA   1 
ATOM   2562 C  C    . ARG A 1 182 ? -8.029  -27.566 -2.837  1.00 29.85  ?  182 ARG A C    1 
ATOM   2563 O  O    . ARG A 1 182 ? -8.696  -28.601 -2.752  1.00 31.58  ?  182 ARG A O    1 
ATOM   2564 C  CB   . ARG A 1 182 ? -5.693  -27.397 -3.724  1.00 34.84  ?  182 ARG A CB   1 
ATOM   2565 C  CG   . ARG A 1 182 ? -6.003  -28.424 -4.788  1.00 37.46  ?  182 ARG A CG   1 
ATOM   2566 C  CD   . ARG A 1 182 ? -5.217  -28.172 -6.049  1.00 36.54  ?  182 ARG A CD   1 
ATOM   2567 N  NE   . ARG A 1 182 ? -5.372  -29.279 -6.986  1.00 38.07  ?  182 ARG A NE   1 
ATOM   2568 C  CZ   . ARG A 1 182 ? -4.569  -29.510 -8.018  1.00 32.60  ?  182 ARG A CZ   1 
ATOM   2569 N  NH1  . ARG A 1 182 ? -3.536  -28.715 -8.260  1.00 43.15  ?  182 ARG A NH1  1 
ATOM   2570 N  NH2  . ARG A 1 182 ? -4.799  -30.548 -8.806  1.00 38.84  ?  182 ARG A NH2  1 
ATOM   2571 H  H    . ARG A 1 182 ? -6.730  -29.400 -1.849  1.00 38.43  ?  182 ARG A H    1 
ATOM   2572 H  HA   . ARG A 1 182 ? -6.402  -26.750 -1.911  1.00 43.20  ?  182 ARG A HA   1 
ATOM   2573 H  HB2  . ARG A 1 182 ? -5.837  -26.518 -4.109  1.00 41.89  ?  182 ARG A HB2  1 
ATOM   2574 H  HB3  . ARG A 1 182 ? -4.760  -27.498 -3.476  1.00 41.89  ?  182 ARG A HB3  1 
ATOM   2575 H  HG2  . ARG A 1 182 ? -5.773  -29.306 -4.457  1.00 45.03  ?  182 ARG A HG2  1 
ATOM   2576 H  HG3  . ARG A 1 182 ? -6.947  -28.383 -5.006  1.00 45.03  ?  182 ARG A HG3  1 
ATOM   2577 H  HD2  . ARG A 1 182 ? -5.540  -27.363 -6.475  1.00 43.93  ?  182 ARG A HD2  1 
ATOM   2578 H  HD3  . ARG A 1 182 ? -4.275  -28.086 -5.830  1.00 43.93  ?  182 ARG A HD3  1 
ATOM   2579 H  HE   . ARG A 1 182 ? -6.030  -29.819 -6.862  1.00 45.76  ?  182 ARG A HE   1 
ATOM   2580 H  HH11 . ARG A 1 182 ? -3.384  -28.041 -7.749  1.00 51.86  ?  182 ARG A HH11 1 
ATOM   2581 H  HH12 . ARG A 1 182 ? -3.021  -28.872 -8.930  1.00 51.86  ?  182 ARG A HH12 1 
ATOM   2582 H  HH21 . ARG A 1 182 ? -5.468  -31.066 -8.651  1.00 46.69  ?  182 ARG A HH21 1 
ATOM   2583 H  HH22 . ARG A 1 182 ? -4.282  -30.702 -9.476  1.00 46.69  ?  182 ARG A HH22 1 
ATOM   2584 N  N    . SER A 1 183 ? -8.522  -26.409 -3.265  1.00 32.01  ?  183 SER A N    1 
ATOM   2585 C  CA   . SER A 1 183 ? -9.885  -26.266 -3.749  1.00 36.41  ?  183 SER A CA   1 
ATOM   2586 C  C    . SER A 1 183 ? -9.929  -26.545 -5.244  1.00 34.35  ?  183 SER A C    1 
ATOM   2587 O  O    . SER A 1 183 ? -9.045  -26.118 -5.992  1.00 35.62  ?  183 SER A O    1 
ATOM   2588 C  CB   . SER A 1 183 ? -10.402 -24.858 -3.459  1.00 34.96  ?  183 SER A CB   1 
ATOM   2589 O  OG   . SER A 1 183 ? -10.281 -24.557 -2.079  1.00 39.51  ?  183 SER A OG   1 
ATOM   2590 H  H    . SER A 1 183 ? -8.072  -25.676 -3.284  1.00 38.49  ?  183 SER A H    1 
ATOM   2591 H  HA   . SER A 1 183 ? -10.459 -26.905 -3.298  1.00 43.77  ?  183 SER A HA   1 
ATOM   2592 H  HB2  . SER A 1 183 ? -9.881  -24.218 -3.969  1.00 42.04  ?  183 SER A HB2  1 
ATOM   2593 H  HB3  . SER A 1 183 ? -11.336 -24.805 -3.714  1.00 42.04  ?  183 SER A HB3  1 
ATOM   2594 H  HG   . SER A 1 183 ? -10.567 -23.782 -1.928  1.00 47.49  ?  183 SER A HG   1 
ATOM   2595 N  N    . GLU A 1 184 ? -10.961 -27.266 -5.674  1.00 34.77  ?  184 GLU A N    1 
ATOM   2596 C  CA   . GLU A 1 184 ? -11.081 -27.695 -7.059  1.00 34.44  ?  184 GLU A CA   1 
ATOM   2597 C  C    . GLU A 1 184 ? -12.524 -27.539 -7.514  1.00 35.99  ?  184 GLU A C    1 
ATOM   2598 O  O    . GLU A 1 184 ? -13.423 -27.250 -6.721  1.00 30.66  ?  184 GLU A O    1 
ATOM   2599 C  CB   . GLU A 1 184 ? -10.617 -29.147 -7.232  1.00 36.44  ?  184 GLU A CB   1 
ATOM   2600 C  CG   . GLU A 1 184 ? -9.209  -29.398 -6.722  1.00 39.67  ?  184 GLU A CG   1 
ATOM   2601 C  CD   . GLU A 1 184 ? -8.732  -30.805 -7.003  1.00 38.32  ?  184 GLU A CD   1 
ATOM   2602 O  OE1  . GLU A 1 184 ? -9.505  -31.588 -7.594  1.00 43.12  ?  184 GLU A OE1  1 
ATOM   2603 O  OE2  . GLU A 1 184 ? -7.584  -31.127 -6.632  1.00 40.06  ?  184 GLU A OE2  1 
ATOM   2604 H  H    . GLU A 1 184 ? -11.613 -27.522 -5.174  1.00 41.80  ?  184 GLU A H    1 
ATOM   2605 H  HA   . GLU A 1 184 ? -10.524 -27.130 -7.617  1.00 41.41  ?  184 GLU A HA   1 
ATOM   2606 H  HB2  . GLU A 1 184 ? -11.219 -29.729 -6.742  1.00 43.81  ?  184 GLU A HB2  1 
ATOM   2607 H  HB3  . GLU A 1 184 ? -10.636 -29.372 -8.175  1.00 43.81  ?  184 GLU A HB3  1 
ATOM   2608 H  HG2  . GLU A 1 184 ? -8.600  -28.782 -7.158  1.00 47.69  ?  184 GLU A HG2  1 
ATOM   2609 H  HG3  . GLU A 1 184 ? -9.191  -29.261 -5.762  1.00 47.69  ?  184 GLU A HG3  1 
ATOM   2610 N  N    . ILE A 1 185 ? -12.737 -27.740 -8.814  1.00 43.10  ?  185 ILE A N    1 
ATOM   2611 C  CA   . ILE A 1 185 ? -14.049 -27.623 -9.437  1.00 39.19  ?  185 ILE A CA   1 
ATOM   2612 C  C    . ILE A 1 185 ? -14.260 -28.842 -10.320 1.00 38.05  ?  185 ILE A C    1 
ATOM   2613 O  O    . ILE A 1 185 ? -13.432 -29.130 -11.191 1.00 42.28  ?  185 ILE A O    1 
ATOM   2614 C  CB   . ILE A 1 185 ? -14.179 -26.334 -10.273 1.00 46.68  ?  185 ILE A CB   1 
ATOM   2615 C  CG1  . ILE A 1 185 ? -13.709 -25.108 -9.483  1.00 46.80  ?  185 ILE A CG1  1 
ATOM   2616 C  CG2  . ILE A 1 185 ? -15.625 -26.137 -10.714 1.00 46.38  ?  185 ILE A CG2  1 
ATOM   2617 C  CD1  . ILE A 1 185 ? -13.356 -23.935 -10.360 1.00 57.93  ?  185 ILE A CD1  1 
ATOM   2618 H  H    . ILE A 1 185 ? -12.115 -27.951 -9.369  1.00 51.81  ?  185 ILE A H    1 
ATOM   2619 H  HA   . ILE A 1 185 ? -14.735 -27.616 -8.750  1.00 47.11  ?  185 ILE A HA   1 
ATOM   2620 H  HB   . ILE A 1 185 ? -13.624 -26.422 -11.064 1.00 56.10  ?  185 ILE A HB   1 
ATOM   2621 H  HG12 . ILE A 1 185 ? -14.419 -24.829 -8.883  1.00 56.24  ?  185 ILE A HG12 1 
ATOM   2622 H  HG13 . ILE A 1 185 ? -12.920 -25.347 -8.971  1.00 56.24  ?  185 ILE A HG13 1 
ATOM   2623 H  HG21 . ILE A 1 185 ? -15.687 -25.323 -11.238 1.00 55.73  ?  185 ILE A HG21 1 
ATOM   2624 H  HG22 . ILE A 1 185 ? -15.897 -26.898 -11.251 1.00 55.73  ?  185 ILE A HG22 1 
ATOM   2625 H  HG23 . ILE A 1 185 ? -16.188 -26.068 -9.927  1.00 55.73  ?  185 ILE A HG23 1 
ATOM   2626 H  HD11 . ILE A 1 185 ? -13.068 -23.197 -9.799  1.00 69.59  ?  185 ILE A HD11 1 
ATOM   2627 H  HD12 . ILE A 1 185 ? -12.639 -24.194 -10.959 1.00 69.59  ?  185 ILE A HD12 1 
ATOM   2628 H  HD13 . ILE A 1 185 ? -14.138 -23.677 -10.871 1.00 69.59  ?  185 ILE A HD13 1 
ATOM   2629 N  N    . SER A 1 186 ? -15.362 -29.555 -10.102 1.00 36.16  ?  186 SER A N    1 
ATOM   2630 C  CA   . SER A 1 186 ? -15.671 -30.701 -10.940 1.00 42.07  ?  186 SER A CA   1 
ATOM   2631 C  C    . SER A 1 186 ? -16.335 -30.240 -12.234 1.00 38.99  ?  186 SER A C    1 
ATOM   2632 O  O    . SER A 1 186 ? -16.804 -29.106 -12.353 1.00 37.71  ?  186 SER A O    1 
ATOM   2633 C  CB   . SER A 1 186 ? -16.583 -31.683 -10.202 1.00 39.50  ?  186 SER A CB   1 
ATOM   2634 O  OG   . SER A 1 186 ? -17.874 -31.135 -10.006 1.00 42.52  ?  186 SER A OG   1 
ATOM   2635 H  H    . SER A 1 186 ? -15.937 -29.396 -9.483  1.00 43.47  ?  186 SER A H    1 
ATOM   2636 H  HA   . SER A 1 186 ? -14.849 -31.162 -11.168 1.00 50.56  ?  186 SER A HA   1 
ATOM   2637 H  HB2  . SER A 1 186 ? -16.662 -32.495 -10.728 1.00 47.48  ?  186 SER A HB2  1 
ATOM   2638 H  HB3  . SER A 1 186 ? -16.193 -31.886 -9.338  1.00 47.48  ?  186 SER A HB3  1 
ATOM   2639 H  HG   . SER A 1 186 ? -18.362 -31.686 -9.600  1.00 51.11  ?  186 SER A HG   1 
ATOM   2640 N  N    . GLN A 1 187 ? -16.368 -31.140 -13.220 1.00 42.93  ?  187 GLN A N    1 
ATOM   2641 C  CA   . GLN A 1 187 ? -17.010 -30.806 -14.485 1.00 48.19  ?  187 GLN A CA   1 
ATOM   2642 C  C    . GLN A 1 187 ? -18.491 -30.507 -14.306 1.00 41.83  ?  187 GLN A C    1 
ATOM   2643 O  O    . GLN A 1 187 ? -19.089 -29.853 -15.167 1.00 51.66  ?  187 GLN A O    1 
ATOM   2644 C  CB   . GLN A 1 187 ? -16.812 -31.936 -15.498 1.00 49.81  ?  187 GLN A CB   1 
ATOM   2645 C  CG   . GLN A 1 187 ? -17.560 -33.215 -15.182 1.00 44.49  ?  187 GLN A CG   1 
ATOM   2646 C  CD   . GLN A 1 187 ? -17.222 -34.332 -16.151 1.00 48.91  ?  187 GLN A CD   1 
ATOM   2647 O  OE1  . GLN A 1 187 ? -18.044 -34.720 -16.981 1.00 55.40  ?  187 GLN A OE1  1 
ATOM   2648 N  NE2  . GLN A 1 187 ? -16.005 -34.855 -16.049 1.00 59.09  ?  187 GLN A NE2  1 
ATOM   2649 H  H    . GLN A 1 187 ? -16.035 -31.932 -13.180 1.00 51.60  ?  187 GLN A H    1 
ATOM   2650 H  HA   . GLN A 1 187 ? -16.590 -30.009 -14.846 1.00 57.91  ?  187 GLN A HA   1 
ATOM   2651 H  HB2  . GLN A 1 187 ? -17.113 -31.628 -16.367 1.00 59.85  ?  187 GLN A HB2  1 
ATOM   2652 H  HB3  . GLN A 1 187 ? -15.867 -32.152 -15.539 1.00 59.85  ?  187 GLN A HB3  1 
ATOM   2653 H  HG2  . GLN A 1 187 ? -17.323 -33.509 -14.288 1.00 53.47  ?  187 GLN A HG2  1 
ATOM   2654 H  HG3  . GLN A 1 187 ? -18.514 -33.047 -15.236 1.00 53.47  ?  187 GLN A HG3  1 
ATOM   2655 H  HE21 . GLN A 1 187 ? -15.458 -34.558 -15.457 1.00 70.99  ?  187 GLN A HE21 1 
ATOM   2656 H  HE22 . GLN A 1 187 ? -15.766 -35.491 -16.576 1.00 70.99  ?  187 GLN A HE22 1 
ATOM   2657 N  N    . GLU A 1 188 ? -19.097 -30.970 -13.211 1.00 42.96  ?  188 GLU A N    1 
ATOM   2658 C  CA   . GLU A 1 188 ? -20.453 -30.570 -12.861 1.00 37.57  ?  188 GLU A CA   1 
ATOM   2659 C  C    . GLU A 1 188 ? -20.522 -29.162 -12.285 1.00 43.57  ?  188 GLU A C    1 
ATOM   2660 O  O    . GLU A 1 188 ? -21.625 -28.674 -12.020 1.00 41.20  ?  188 GLU A O    1 
ATOM   2661 C  CB   . GLU A 1 188 ? -21.053 -31.544 -11.843 1.00 37.28  ?  188 GLU A CB   1 
ATOM   2662 C  CG   . GLU A 1 188 ? -21.276 -32.962 -12.356 1.00 36.13  ?  188 GLU A CG   1 
ATOM   2663 C  CD   . GLU A 1 188 ? -20.039 -33.832 -12.260 1.00 35.09  ?  188 GLU A CD   1 
ATOM   2664 O  OE1  . GLU A 1 188 ? -19.136 -33.503 -11.462 1.00 36.42  ?  188 GLU A OE1  1 
ATOM   2665 O  OE2  . GLU A 1 188 ? -19.972 -34.848 -12.984 1.00 35.60  ?  188 GLU A OE2  1 
ATOM   2666 H  H    . GLU A 1 188 ? -18.739 -31.519 -12.654 1.00 51.64  ?  188 GLU A H    1 
ATOM   2667 H  HA   . GLU A 1 188 ? -21.004 -30.594 -13.659 1.00 45.16  ?  188 GLU A HA   1 
ATOM   2668 H  HB2  . GLU A 1 188 ? -20.455 -31.600 -11.082 1.00 44.81  ?  188 GLU A HB2  1 
ATOM   2669 H  HB3  . GLU A 1 188 ? -21.913 -31.199 -11.557 1.00 44.81  ?  188 GLU A HB3  1 
ATOM   2670 H  HG2  . GLU A 1 188 ? -21.976 -33.380 -11.831 1.00 43.43  ?  188 GLU A HG2  1 
ATOM   2671 H  HG3  . GLU A 1 188 ? -21.541 -32.922 -13.288 1.00 43.43  ?  188 GLU A HG3  1 
ATOM   2672 N  N    . GLY A 1 189 ? -19.382 -28.508 -12.068 1.00 43.60  ?  189 GLY A N    1 
ATOM   2673 C  CA   . GLY A 1 189 ? -19.363 -27.182 -11.489 1.00 39.46  ?  189 GLY A CA   1 
ATOM   2674 C  C    . GLY A 1 189 ? -19.350 -27.140 -9.977  1.00 39.12  ?  189 GLY A C    1 
ATOM   2675 O  O    . GLY A 1 189 ? -19.393 -26.043 -9.407  1.00 41.67  ?  189 GLY A O    1 
ATOM   2676 H  H    . GLY A 1 189 ? -18.602 -28.820 -12.251 1.00 52.40  ?  189 GLY A H    1 
ATOM   2677 H  HA2  . GLY A 1 189 ? -18.575 -26.713 -11.807 1.00 47.44  ?  189 GLY A HA2  1 
ATOM   2678 H  HA3  . GLY A 1 189 ? -20.144 -26.695 -11.794 1.00 47.44  ?  189 GLY A HA3  1 
ATOM   2679 N  N    . MET A 1 190 ? -19.285 -28.289 -9.308  1.00 43.27  ?  190 MET A N    1 
ATOM   2680 C  CA   . MET A 1 190 ? -19.260 -28.322 -7.853  1.00 39.94  ?  190 MET A CA   1 
ATOM   2681 C  C    . MET A 1 190 ? -17.877 -27.938 -7.344  1.00 33.03  ?  190 MET A C    1 
ATOM   2682 O  O    . MET A 1 190 ? -16.861 -28.423 -7.850  1.00 40.83  ?  190 MET A O    1 
ATOM   2683 C  CB   . MET A 1 190 ? -19.644 -29.713 -7.347  1.00 43.77  ?  190 MET A CB   1 
ATOM   2684 C  CG   . MET A 1 190 ? -21.090 -30.091 -7.628  1.00 56.75  ?  190 MET A CG   1 
ATOM   2685 S  SD   . MET A 1 190 ? -21.503 -31.769 -7.105  1.00 63.91  ?  190 MET A SD   1 
ATOM   2686 C  CE   . MET A 1 190 ? -20.639 -32.729 -8.337  1.00 53.09  ?  190 MET A CE   1 
ATOM   2687 H  H    . MET A 1 190 ? -19.255 -29.065 -9.678  1.00 52.01  ?  190 MET A H    1 
ATOM   2688 H  HA   . MET A 1 190 ? -19.910 -27.689 -7.511  1.00 48.01  ?  190 MET A HA   1 
ATOM   2689 H  HB2  . MET A 1 190 ? -19.077 -30.370 -7.780  1.00 52.61  ?  190 MET A HB2  1 
ATOM   2690 H  HB3  . MET A 1 190 ? -19.511 -29.744 -6.387  1.00 52.61  ?  190 MET A HB3  1 
ATOM   2691 H  HG2  . MET A 1 190 ? -21.673 -29.479 -7.153  1.00 68.18  ?  190 MET A HG2  1 
ATOM   2692 H  HG3  . MET A 1 190 ? -21.252 -30.028 -8.582  1.00 68.18  ?  190 MET A HG3  1 
ATOM   2693 H  HE1  . MET A 1 190 ? -20.786 -33.672 -8.162  1.00 63.79  ?  190 MET A HE1  1 
ATOM   2694 H  HE2  . MET A 1 190 ? -20.983 -32.498 -9.215  1.00 63.79  ?  190 MET A HE2  1 
ATOM   2695 H  HE3  . MET A 1 190 ? -19.692 -32.526 -8.288  1.00 63.79  ?  190 MET A HE3  1 
ATOM   2696 N  N    . VAL A 1 191 ? -17.842 -27.062 -6.344  1.00 40.96  ?  191 VAL A N    1 
ATOM   2697 C  CA   . VAL A 1 191 ? -16.602 -26.595 -5.734  1.00 39.64  ?  191 VAL A CA   1 
ATOM   2698 C  C    . VAL A 1 191 ? -16.386 -27.359 -4.438  1.00 44.28  ?  191 VAL A C    1 
ATOM   2699 O  O    . VAL A 1 191 ? -17.334 -27.606 -3.682  1.00 44.18  ?  191 VAL A O    1 
ATOM   2700 C  CB   . VAL A 1 191 ? -16.645 -25.076 -5.480  1.00 47.65  ?  191 VAL A CB   1 
ATOM   2701 C  CG1  . VAL A 1 191 ? -15.335 -24.594 -4.866  1.00 45.43  ?  191 VAL A CG1  1 
ATOM   2702 C  CG2  . VAL A 1 191 ? -16.932 -24.333 -6.774  1.00 45.16  ?  191 VAL A CG2  1 
ATOM   2703 H  H    . VAL A 1 191 ? -18.546 -26.714 -5.992  1.00 49.24  ?  191 VAL A H    1 
ATOM   2704 H  HA   . VAL A 1 191 ? -15.860 -26.785 -6.329  1.00 47.65  ?  191 VAL A HA   1 
ATOM   2705 H  HB   . VAL A 1 191 ? -17.361 -24.879 -4.855  1.00 57.26  ?  191 VAL A HB   1 
ATOM   2706 H  HG11 . VAL A 1 191 ? -15.390 -23.637 -4.718  1.00 54.60  ?  191 VAL A HG11 1 
ATOM   2707 H  HG12 . VAL A 1 191 ? -15.195 -25.053 -4.023  1.00 54.60  ?  191 VAL A HG12 1 
ATOM   2708 H  HG13 . VAL A 1 191 ? -14.609 -24.793 -5.477  1.00 54.60  ?  191 VAL A HG13 1 
ATOM   2709 H  HG21 . VAL A 1 191 ? -16.955 -23.380 -6.593  1.00 54.28  ?  191 VAL A HG21 1 
ATOM   2710 H  HG22 . VAL A 1 191 ? -16.230 -24.531 -7.414  1.00 54.28  ?  191 VAL A HG22 1 
ATOM   2711 H  HG23 . VAL A 1 191 ? -17.789 -24.624 -7.122  1.00 54.28  ?  191 VAL A HG23 1 
ATOM   2712 N  N    . PHE A 1 192 ? -15.136 -27.727 -4.171  1.00 41.20  ?  192 PHE A N    1 
ATOM   2713 C  CA   . PHE A 1 192 ? -14.824 -28.552 -3.014  1.00 38.13  ?  192 PHE A CA   1 
ATOM   2714 C  C    . PHE A 1 192 ? -13.322 -28.529 -2.785  1.00 37.51  ?  192 PHE A C    1 
ATOM   2715 O  O    . PHE A 1 192 ? -12.544 -28.219 -3.692  1.00 34.72  ?  192 PHE A O    1 
ATOM   2716 C  CB   . PHE A 1 192 ? -15.305 -29.992 -3.215  1.00 38.22  ?  192 PHE A CB   1 
ATOM   2717 C  CG   . PHE A 1 192 ? -14.729 -30.653 -4.437  1.00 42.28  ?  192 PHE A CG   1 
ATOM   2718 C  CD1  . PHE A 1 192 ? -15.323 -30.486 -5.677  1.00 41.15  ?  192 PHE A CD1  1 
ATOM   2719 C  CD2  . PHE A 1 192 ? -13.589 -31.436 -4.348  1.00 41.00  ?  192 PHE A CD2  1 
ATOM   2720 C  CE1  . PHE A 1 192 ? -14.794 -31.088 -6.802  1.00 36.39  ?  192 PHE A CE1  1 
ATOM   2721 C  CE2  . PHE A 1 192 ? -13.058 -32.041 -5.468  1.00 36.24  ?  192 PHE A CE2  1 
ATOM   2722 C  CZ   . PHE A 1 192 ? -13.661 -31.867 -6.698  1.00 42.76  ?  192 PHE A CZ   1 
ATOM   2723 H  H    . PHE A 1 192 ? -14.453 -27.512 -4.647  1.00 49.52  ?  192 PHE A H    1 
ATOM   2724 H  HA   . PHE A 1 192 ? -15.262 -28.188 -2.228  1.00 45.84  ?  192 PHE A HA   1 
ATOM   2725 H  HB2  . PHE A 1 192 ? -15.048 -30.519 -2.443  1.00 45.95  ?  192 PHE A HB2  1 
ATOM   2726 H  HB3  . PHE A 1 192 ? -16.271 -29.990 -3.306  1.00 45.95  ?  192 PHE A HB3  1 
ATOM   2727 H  HD1  . PHE A 1 192 ? -16.088 -29.962 -5.752  1.00 49.47  ?  192 PHE A HD1  1 
ATOM   2728 H  HD2  . PHE A 1 192 ? -13.179 -31.557 -3.522  1.00 49.29  ?  192 PHE A HD2  1 
ATOM   2729 H  HE1  . PHE A 1 192 ? -15.203 -30.970 -7.629  1.00 43.75  ?  192 PHE A HE1  1 
ATOM   2730 H  HE2  . PHE A 1 192 ? -12.293 -32.565 -5.395  1.00 43.58  ?  192 PHE A HE2  1 
ATOM   2731 H  HZ   . PHE A 1 192 ? -13.304 -32.274 -7.454  1.00 51.40  ?  192 PHE A HZ   1 
ATOM   2732 N  N    . ARG A 1 193 ? -12.926 -28.856 -1.559  1.00 35.15  ?  193 ARG A N    1 
ATOM   2733 C  CA   . ARG A 1 193 ? -11.535 -29.123 -1.233  1.00 34.88  ?  193 ARG A CA   1 
ATOM   2734 C  C    . ARG A 1 193 ? -11.333 -30.625 -1.099  1.00 38.57  ?  193 ARG A C    1 
ATOM   2735 O  O    . ARG A 1 193 ? -12.160 -31.325 -0.507  1.00 32.01  ?  193 ARG A O    1 
ATOM   2736 C  CB   . ARG A 1 193 ? -11.116 -28.417 0.061   1.00 34.65  ?  193 ARG A CB   1 
ATOM   2737 C  CG   . ARG A 1 193 ? -10.760 -26.950 -0.128  1.00 42.71  ?  193 ARG A CG   1 
ATOM   2738 C  CD   . ARG A 1 193 ? -10.414 -26.258 1.186   1.00 38.31  ?  193 ARG A CD   1 
ATOM   2739 N  NE   . ARG A 1 193 ? -9.032  -26.482 1.607   1.00 36.43  ?  193 ARG A NE   1 
ATOM   2740 C  CZ   . ARG A 1 193 ? -7.966  -25.967 0.999   1.00 38.55  ?  193 ARG A CZ   1 
ATOM   2741 N  NH1  . ARG A 1 193 ? -8.108  -25.208 -0.080  1.00 34.58  ?  193 ARG A NH1  1 
ATOM   2742 N  NH2  . ARG A 1 193 ? -6.750  -26.220 1.462   1.00 35.59  ?  193 ARG A NH2  1 
ATOM   2743 H  H    . ARG A 1 193 ? -13.458 -28.931 -0.887  1.00 42.26  ?  193 ARG A H    1 
ATOM   2744 H  HA   . ARG A 1 193 ? -10.969 -28.802 -1.952  1.00 41.94  ?  193 ARG A HA   1 
ATOM   2745 H  HB2  . ARG A 1 193 ? -11.849 -28.465 0.694   1.00 41.66  ?  193 ARG A HB2  1 
ATOM   2746 H  HB3  . ARG A 1 193 ? -10.338 -28.867 0.425   1.00 41.66  ?  193 ARG A HB3  1 
ATOM   2747 H  HG2  . ARG A 1 193 ? -9.990  -26.884 -0.714  1.00 51.34  ?  193 ARG A HG2  1 
ATOM   2748 H  HG3  . ARG A 1 193 ? -11.518 -26.488 -0.520  1.00 51.34  ?  193 ARG A HG3  1 
ATOM   2749 H  HD2  . ARG A 1 193 ? -10.543 -25.302 1.082   1.00 46.05  ?  193 ARG A HD2  1 
ATOM   2750 H  HD3  . ARG A 1 193 ? -10.997 -26.597 1.884   1.00 46.05  ?  193 ARG A HD3  1 
ATOM   2751 H  HE   . ARG A 1 193 ? -8.898  -26.981 2.295   1.00 43.79  ?  193 ARG A HE   1 
ATOM   2752 H  HH11 . ARG A 1 193 ? -8.893  -25.037 -0.386  1.00 41.58  ?  193 ARG A HH11 1 
ATOM   2753 H  HH12 . ARG A 1 193 ? -7.414  -24.881 -0.470  1.00 41.58  ?  193 ARG A HH12 1 
ATOM   2754 H  HH21 . ARG A 1 193 ? -6.650  -26.715 2.158   1.00 42.79  ?  193 ARG A HH21 1 
ATOM   2755 H  HH22 . ARG A 1 193 ? -6.061  -25.893 1.065   1.00 42.79  ?  193 ARG A HH22 1 
ATOM   2756 N  N    . ARG A 1 194 ? -10.236 -31.117 -1.668  1.00 31.72  ?  194 ARG A N    1 
ATOM   2757 C  CA   . ARG A 1 194 ? -9.880  -32.525 -1.577  1.00 43.52  ?  194 ARG A CA   1 
ATOM   2758 C  C    . ARG A 1 194 ? -8.378  -32.634 -1.374  1.00 34.85  ?  194 ARG A C    1 
ATOM   2759 O  O    . ARG A 1 194 ? -7.643  -31.648 -1.480  1.00 30.53  ?  194 ARG A O    1 
ATOM   2760 C  CB   . ARG A 1 194 ? -10.312 -33.301 -2.827  1.00 37.75  ?  194 ARG A CB   1 
ATOM   2761 C  CG   . ARG A 1 194 ? -9.710  -32.785 -4.125  1.00 38.74  ?  194 ARG A CG   1 
ATOM   2762 C  CD   . ARG A 1 194 ? -9.180  -33.930 -4.976  1.00 40.08  ?  194 ARG A CD   1 
ATOM   2763 N  NE   . ARG A 1 194 ? -10.168 -34.991 -5.165  1.00 40.18  ?  194 ARG A NE   1 
ATOM   2764 C  CZ   . ARG A 1 194 ? -10.966 -35.118 -6.223  1.00 47.21  ?  194 ARG A CZ   1 
ATOM   2765 N  NH1  . ARG A 1 194 ? -10.918 -34.249 -7.225  1.00 44.37  ?  194 ARG A NH1  1 
ATOM   2766 N  NH2  . ARG A 1 194 ? -11.822 -36.130 -6.279  1.00 42.57  ?  194 ARG A NH2  1 
ATOM   2767 H  H    . ARG A 1 194 ? -9.675  -30.647 -2.119  1.00 38.14  ?  194 ARG A H    1 
ATOM   2768 H  HA   . ARG A 1 194 ? -10.321 -32.918 -0.807  1.00 52.31  ?  194 ARG A HA   1 
ATOM   2769 H  HB2  . ARG A 1 194 ? -10.044 -34.227 -2.726  1.00 45.39  ?  194 ARG A HB2  1 
ATOM   2770 H  HB3  . ARG A 1 194 ? -11.277 -33.247 -2.909  1.00 45.39  ?  194 ARG A HB3  1 
ATOM   2771 H  HG2  . ARG A 1 194 ? -10.392 -32.317 -4.632  1.00 46.57  ?  194 ARG A HG2  1 
ATOM   2772 H  HG3  . ARG A 1 194 ? -8.973  -32.188 -3.922  1.00 46.57  ?  194 ARG A HG3  1 
ATOM   2773 H  HD2  . ARG A 1 194 ? -8.935  -33.588 -5.850  1.00 48.17  ?  194 ARG A HD2  1 
ATOM   2774 H  HD3  . ARG A 1 194 ? -8.404  -34.316 -4.540  1.00 48.17  ?  194 ARG A HD3  1 
ATOM   2775 H  HE   . ARG A 1 194 ? -10.241 -35.579 -4.542  1.00 48.30  ?  194 ARG A HE   1 
ATOM   2776 H  HH11 . ARG A 1 194 ? -10.365 -33.591 -7.197  1.00 53.33  ?  194 ARG A HH11 1 
ATOM   2777 H  HH12 . ARG A 1 194 ? -11.440 -34.344 -7.902  1.00 53.33  ?  194 ARG A HH12 1 
ATOM   2778 H  HH21 . ARG A 1 194 ? -11.859 -36.697 -5.633  1.00 51.17  ?  194 ARG A HH21 1 
ATOM   2779 H  HH22 . ARG A 1 194 ? -12.341 -36.218 -6.959  1.00 51.17  ?  194 ARG A HH22 1 
ATOM   2780 N  N    . PHE A 1 195 ? -7.918  -33.848 -1.084  1.00 31.67  ?  195 PHE A N    1 
ATOM   2781 C  CA   . PHE A 1 195 ? -6.501  -34.092 -0.876  1.00 30.38  ?  195 PHE A CA   1 
ATOM   2782 C  C    . PHE A 1 195 ? -5.965  -35.042 -1.939  1.00 29.07  ?  195 PHE A C    1 
ATOM   2783 O  O    . PHE A 1 195 ? -6.693  -35.884 -2.475  1.00 31.19  ?  195 PHE A O    1 
ATOM   2784 C  CB   . PHE A 1 195 ? -6.220  -34.646 0.536   1.00 35.45  ?  195 PHE A CB   1 
ATOM   2785 C  CG   . PHE A 1 195 ? -6.832  -35.992 0.810   1.00 40.80  ?  195 PHE A CG   1 
ATOM   2786 C  CD1  . PHE A 1 195 ? -6.149  -37.158 0.494   1.00 36.85  ?  195 PHE A CD1  1 
ATOM   2787 C  CD2  . PHE A 1 195 ? -8.076  -36.094 1.414   1.00 33.29  ?  195 PHE A CD2  1 
ATOM   2788 C  CE1  . PHE A 1 195 ? -6.706  -38.400 0.756   1.00 39.82  ?  195 PHE A CE1  1 
ATOM   2789 C  CE2  . PHE A 1 195 ? -8.639  -37.332 1.678   1.00 36.80  ?  195 PHE A CE2  1 
ATOM   2790 C  CZ   . PHE A 1 195 ? -7.953  -38.486 1.350   1.00 34.97  ?  195 PHE A CZ   1 
ATOM   2791 H  H    . PHE A 1 195 ? -8.411  -34.548 -1.001  1.00 38.08  ?  195 PHE A H    1 
ATOM   2792 H  HA   . PHE A 1 195 ? -6.024  -33.251 -0.964  1.00 36.54  ?  195 PHE A HA   1 
ATOM   2793 H  HB2  . PHE A 1 195 ? -5.260  -34.729 0.651   1.00 42.63  ?  195 PHE A HB2  1 
ATOM   2794 H  HB3  . PHE A 1 195 ? -6.574  -34.023 1.190   1.00 42.63  ?  195 PHE A HB3  1 
ATOM   2795 H  HD1  . PHE A 1 195 ? -5.311  -37.105 0.093   1.00 44.31  ?  195 PHE A HD1  1 
ATOM   2796 H  HD2  . PHE A 1 195 ? -8.543  -35.321 1.636   1.00 40.02  ?  195 PHE A HD2  1 
ATOM   2797 H  HE1  . PHE A 1 195 ? -6.241  -39.174 0.533   1.00 47.87  ?  195 PHE A HE1  1 
ATOM   2798 H  HE2  . PHE A 1 195 ? -9.477  -37.386 2.077   1.00 44.24  ?  195 PHE A HE2  1 
ATOM   2799 H  HZ   . PHE A 1 195 ? -8.329  -39.318 1.527   1.00 42.05  ?  195 PHE A HZ   1 
ATOM   2800 N  N    . HIS A 1 196 ? -4.684  -34.868 -2.258  1.00 29.82  ?  196 HIS A N    1 
ATOM   2801 C  CA   . HIS A 1 196 ? -3.947  -35.744 -3.159  1.00 27.25  ?  196 HIS A CA   1 
ATOM   2802 C  C    . HIS A 1 196 ? -2.726  -36.259 -2.414  1.00 30.90  ?  196 HIS A C    1 
ATOM   2803 O  O    . HIS A 1 196 ? -1.873  -35.466 -1.999  1.00 30.41  ?  196 HIS A O    1 
ATOM   2804 C  CB   . HIS A 1 196 ? -3.506  -35.009 -4.428  1.00 31.41  ?  196 HIS A CB   1 
ATOM   2805 C  CG   . HIS A 1 196 ? -4.632  -34.458 -5.245  1.00 31.49  ?  196 HIS A CG   1 
ATOM   2806 N  ND1  . HIS A 1 196 ? -5.193  -35.148 -6.298  1.00 34.94  ?  196 HIS A ND1  1 
ATOM   2807 C  CD2  . HIS A 1 196 ? -5.283  -33.272 -5.181  1.00 32.45  ?  196 HIS A CD2  1 
ATOM   2808 C  CE1  . HIS A 1 196 ? -6.153  -34.417 -6.837  1.00 38.07  ?  196 HIS A CE1  1 
ATOM   2809 N  NE2  . HIS A 1 196 ? -6.227  -33.274 -6.179  1.00 30.84  ?  196 HIS A NE2  1 
ATOM   2810 H  H    . HIS A 1 196 ? -4.206  -34.223 -1.951  1.00 35.87  ?  196 HIS A H    1 
ATOM   2811 H  HA   . HIS A 1 196 ? -4.502  -36.499 -3.411  1.00 32.78  ?  196 HIS A HA   1 
ATOM   2812 H  HB2  . HIS A 1 196 ? -2.935  -34.267 -4.174  1.00 37.77  ?  196 HIS A HB2  1 
ATOM   2813 H  HB3  . HIS A 1 196 ? -3.010  -35.627 -4.988  1.00 37.77  ?  196 HIS A HB3  1 
ATOM   2814 H  HD2  . HIS A 1 196 ? -5.126  -32.588 -4.571  1.00 39.02  ?  196 HIS A HD2  1 
ATOM   2815 H  HE1  . HIS A 1 196 ? -6.684  -34.664 -7.559  1.00 45.77  ?  196 HIS A HE1  1 
ATOM   2816 H  HE2  . HIS A 1 196 ? -6.777  -32.635 -6.347  1.00 37.08  ?  196 HIS A HE2  1 
ATOM   2817 N  N    . ASP A 1 197 ? -2.644  -37.574 -2.234  1.00 34.02  ?  197 ASP A N    1 
ATOM   2818 C  CA   . ASP A 1 197 ? -1.452  -38.191 -1.661  1.00 34.29  ?  197 ASP A CA   1 
ATOM   2819 C  C    . ASP A 1 197 ? -0.432  -38.346 -2.783  1.00 32.95  ?  197 ASP A C    1 
ATOM   2820 O  O    . ASP A 1 197 ? -0.575  -39.218 -3.643  1.00 37.19  ?  197 ASP A O    1 
ATOM   2821 C  CB   . ASP A 1 197 ? -1.795  -39.531 -1.016  1.00 38.09  ?  197 ASP A CB   1 
ATOM   2822 C  CG   . ASP A 1 197 ? -0.765  -39.964 0.019   1.00 41.37  ?  197 ASP A CG   1 
ATOM   2823 O  OD1  . ASP A 1 197 ? 0.227   -39.234 0.224   1.00 31.32  ?  197 ASP A OD1  1 
ATOM   2824 O  OD2  . ASP A 1 197 ? -0.952  -41.034 0.637   1.00 41.70  ?  197 ASP A OD2  1 
ATOM   2825 H  H    . ASP A 1 197 ? -3.266  -38.133 -2.436  1.00 40.90  ?  197 ASP A H    1 
ATOM   2826 H  HA   . ASP A 1 197 ? -1.079  -37.607 -0.982  1.00 41.23  ?  197 ASP A HA   1 
ATOM   2827 H  HB2  . ASP A 1 197 ? -2.654  -39.458 -0.573  1.00 45.79  ?  197 ASP A HB2  1 
ATOM   2828 H  HB3  . ASP A 1 197 ? -1.833  -40.213 -1.705  1.00 45.79  ?  197 ASP A HB3  1 
ATOM   2829 N  N    . LEU A 1 198 ? 0.593   -37.495 -2.779  1.00 30.14  ?  198 LEU A N    1 
ATOM   2830 C  CA   . LEU A 1 198 ? 1.454   -37.349 -3.945  1.00 28.79  ?  198 LEU A CA   1 
ATOM   2831 C  C    . LEU A 1 198 ? 2.403   -38.533 -4.097  1.00 27.66  ?  198 LEU A C    1 
ATOM   2832 O  O    . LEU A 1 198 ? 2.896   -39.092 -3.113  1.00 27.80  ?  198 LEU A O    1 
ATOM   2833 C  CB   . LEU A 1 198 ? 2.256   -36.051 -3.847  1.00 28.19  ?  198 LEU A CB   1 
ATOM   2834 C  CG   . LEU A 1 198 ? 1.443   -34.759 -3.724  1.00 30.30  ?  198 LEU A CG   1 
ATOM   2835 C  CD1  . LEU A 1 198 ? 2.364   -33.570 -3.471  1.00 28.81  ?  198 LEU A CD1  1 
ATOM   2836 C  CD2  . LEU A 1 198 ? 0.602   -34.525 -4.969  1.00 31.94  ?  198 LEU A CD2  1 
ATOM   2837 H  H    . LEU A 1 198 ? 0.808   -36.993 -2.115  1.00 36.25  ?  198 LEU A H    1 
ATOM   2838 H  HA   . LEU A 1 198 ? 0.902   -37.302 -4.742  1.00 34.64  ?  198 LEU A HA   1 
ATOM   2839 H  HB2  . LEU A 1 198 ? 2.829   -36.106 -3.066  1.00 33.92  ?  198 LEU A HB2  1 
ATOM   2840 H  HB3  . LEU A 1 198 ? 2.805   -35.971 -4.643  1.00 33.92  ?  198 LEU A HB3  1 
ATOM   2841 H  HG   . LEU A 1 198 ? 0.841   -34.837 -2.968  1.00 36.45  ?  198 LEU A HG   1 
ATOM   2842 H  HD11 . LEU A 1 198 ? 1.827   -32.766 -3.397  1.00 34.66  ?  198 LEU A HD11 1 
ATOM   2843 H  HD12 . LEU A 1 198 ? 2.852   -33.720 -2.646  1.00 34.66  ?  198 LEU A HD12 1 
ATOM   2844 H  HD13 . LEU A 1 198 ? 2.984   -33.488 -4.212  1.00 34.66  ?  198 LEU A HD13 1 
ATOM   2845 H  HD21 . LEU A 1 198 ? 0.101   -33.702 -4.861  1.00 38.41  ?  198 LEU A HD21 1 
ATOM   2846 H  HD22 . LEU A 1 198 ? 1.190   -34.456 -5.738  1.00 38.41  ?  198 LEU A HD22 1 
ATOM   2847 H  HD23 . LEU A 1 198 ? -0.007  -35.271 -5.083  1.00 38.41  ?  198 LEU A HD23 1 
ATOM   2848 N  N    . THR A 1 199 ? 2.664   -38.902 -5.350  1.00 30.94  ?  199 THR A N    1 
ATOM   2849 C  CA   . THR A 1 199 ? 3.605   -39.974 -5.652  1.00 33.81  ?  199 THR A CA   1 
ATOM   2850 C  C    . THR A 1 199 ? 5.020   -39.537 -5.299  1.00 30.19  ?  199 THR A C    1 
ATOM   2851 O  O    . THR A 1 199 ? 5.466   -38.458 -5.700  1.00 29.80  ?  199 THR A O    1 
ATOM   2852 C  CB   . THR A 1 199 ? 3.522   -40.346 -7.134  1.00 32.88  ?  199 THR A CB   1 
ATOM   2853 O  OG1  . THR A 1 199 ? 2.192   -40.771 -7.444  1.00 35.97  ?  199 THR A OG1  1 
ATOM   2854 C  CG2  . THR A 1 199 ? 4.491   -41.466 -7.476  1.00 36.68  ?  199 THR A CG2  1 
ATOM   2855 H  H    . THR A 1 199 ? 2.306   -38.545 -6.046  1.00 37.22  ?  199 THR A H    1 
ATOM   2856 H  HA   . THR A 1 199 ? 3.384   -40.757 -5.125  1.00 40.66  ?  199 THR A HA   1 
ATOM   2857 H  HB   . THR A 1 199 ? 3.747   -39.571 -7.674  1.00 39.54  ?  199 THR A HB   1 
ATOM   2858 H  HG1  . THR A 1 199 ? 1.648   -40.152 -7.284  1.00 43.25  ?  199 THR A HG1  1 
ATOM   2859 H  HG21 . THR A 1 199 ? 4.423   -41.687 -8.419  1.00 44.10  ?  199 THR A HG21 1 
ATOM   2860 H  HG22 . THR A 1 199 ? 5.400   -41.189 -7.282  1.00 44.10  ?  199 THR A HG22 1 
ATOM   2861 H  HG23 . THR A 1 199 ? 4.283   -42.255 -6.952  1.00 44.10  ?  199 THR A HG23 1 
ATOM   2862 N  N    . LEU A 1 200 ? 5.726   -40.382 -4.556  1.00 28.53  ?  200 LEU A N    1 
ATOM   2863 C  CA   . LEU A 1 200 ? 7.059   -40.075 -4.068  1.00 30.51  ?  200 LEU A CA   1 
ATOM   2864 C  C    . LEU A 1 200 ? 8.075   -41.022 -4.690  1.00 29.61  ?  200 LEU A C    1 
ATOM   2865 O  O    . LEU A 1 200 ? 7.749   -42.148 -5.073  1.00 26.25  ?  200 LEU A O    1 
ATOM   2866 C  CB   . LEU A 1 200 ? 7.119   -40.184 -2.539  1.00 24.90  ?  200 LEU A CB   1 
ATOM   2867 C  CG   . LEU A 1 200 ? 6.117   -39.331 -1.760  1.00 26.69  ?  200 LEU A CG   1 
ATOM   2868 C  CD1  . LEU A 1 200 ? 6.272   -39.555 -0.261  1.00 28.30  ?  200 LEU A CD1  1 
ATOM   2869 C  CD2  . LEU A 1 200 ? 6.277   -37.853 -2.100  1.00 27.33  ?  200 LEU A CD2  1 
ATOM   2870 H  H    . LEU A 1 200 ? 5.445   -41.159 -4.317  1.00 34.32  ?  200 LEU A H    1 
ATOM   2871 H  HA   . LEU A 1 200 ? 7.293   -39.167 -4.319  1.00 36.70  ?  200 LEU A HA   1 
ATOM   2872 H  HB2  . LEU A 1 200 ? 6.962   -41.109 -2.293  1.00 29.96  ?  200 LEU A HB2  1 
ATOM   2873 H  HB3  . LEU A 1 200 ? 8.007   -39.921 -2.250  1.00 29.96  ?  200 LEU A HB3  1 
ATOM   2874 H  HG   . LEU A 1 200 ? 5.218   -39.597 -2.009  1.00 32.11  ?  200 LEU A HG   1 
ATOM   2875 H  HD11 . LEU A 1 200 ? 5.627   -39.004 0.209   1.00 34.05  ?  200 LEU A HD11 1 
ATOM   2876 H  HD12 . LEU A 1 200 ? 6.114   -40.491 -0.064  1.00 34.05  ?  200 LEU A HD12 1 
ATOM   2877 H  HD13 . LEU A 1 200 ? 7.173   -39.309 0.002   1.00 34.05  ?  200 LEU A HD13 1 
ATOM   2878 H  HD21 . LEU A 1 200 ? 5.629   -37.341 -1.592  1.00 32.88  ?  200 LEU A HD21 1 
ATOM   2879 H  HD22 . LEU A 1 200 ? 7.177   -37.573 -1.870  1.00 32.88  ?  200 LEU A HD22 1 
ATOM   2880 H  HD23 . LEU A 1 200 ? 6.125   -37.730 -3.050  1.00 32.88  ?  200 LEU A HD23 1 
ATOM   2881 N  N    . THR A 1 201 ? 9.319   -40.553 -4.793  1.00 29.36  ?  201 THR A N    1 
ATOM   2882 C  CA   . THR A 1 201 ? 10.393  -41.435 -5.236  1.00 31.45  ?  201 THR A CA   1 
ATOM   2883 C  C    . THR A 1 201 ? 10.624  -42.543 -4.222  1.00 27.98  ?  201 THR A C    1 
ATOM   2884 O  O    . THR A 1 201 ? 10.862  -43.697 -4.596  1.00 28.27  ?  201 THR A O    1 
ATOM   2885 C  CB   . THR A 1 201 ? 11.677  -40.641 -5.452  1.00 28.06  ?  201 THR A CB   1 
ATOM   2886 O  OG1  . THR A 1 201 ? 12.145  -40.147 -4.192  1.00 48.53  ?  201 THR A OG1  1 
ATOM   2887 C  CG2  . THR A 1 201 ? 11.429  -39.477 -6.390  1.00 27.82  ?  201 THR A CG2  1 
ATOM   2888 H  H    . THR A 1 201 ? 9.562   -39.747 -4.615  1.00 35.31  ?  201 THR A H    1 
ATOM   2889 H  HA   . THR A 1 201 ? 10.143  -41.843 -6.079  1.00 37.83  ?  201 THR A HA   1 
ATOM   2890 H  HB   . THR A 1 201 ? 12.352  -41.216 -5.846  1.00 33.76  ?  201 THR A HB   1 
ATOM   2891 H  HG1  . THR A 1 201 ? 12.853  -39.708 -4.301  1.00 58.31  ?  201 THR A HG1  1 
ATOM   2892 H  HG21 . THR A 1 201 ? 12.249  -38.977 -6.522  1.00 33.47  ?  201 THR A HG21 1 
ATOM   2893 H  HG22 . THR A 1 201 ? 11.116  -39.803 -7.248  1.00 33.47  ?  201 THR A HG22 1 
ATOM   2894 H  HG23 . THR A 1 201 ? 10.757  -38.886 -6.013  1.00 33.47  ?  201 THR A HG23 1 
ATOM   2895 N  N    . ARG A 1 202 ? 10.562  -42.205 -2.935  1.00 23.35  ?  202 ARG A N    1 
ATOM   2896 C  CA   . ARG A 1 202 ? 10.578  -43.174 -1.846  1.00 28.46  ?  202 ARG A CA   1 
ATOM   2897 C  C    . ARG A 1 202 ? 9.469   -42.807 -0.871  1.00 27.46  ?  202 ARG A C    1 
ATOM   2898 O  O    . ARG A 1 202 ? 9.505   -41.731 -0.265  1.00 27.09  ?  202 ARG A O    1 
ATOM   2899 C  CB   . ARG A 1 202 ? 11.930  -43.193 -1.122  1.00 28.33  ?  202 ARG A CB   1 
ATOM   2900 C  CG   . ARG A 1 202 ? 13.128  -43.509 -2.007  1.00 40.85  ?  202 ARG A CG   1 
ATOM   2901 C  CD   . ARG A 1 202 ? 13.114  -44.948 -2.501  1.00 35.86  ?  202 ARG A CD   1 
ATOM   2902 N  NE   . ARG A 1 202 ? 14.347  -45.284 -3.210  1.00 38.02  ?  202 ARG A NE   1 
ATOM   2903 C  CZ   . ARG A 1 202 ? 14.567  -45.059 -4.504  1.00 39.01  ?  202 ARG A CZ   1 
ATOM   2904 N  NH1  . ARG A 1 202 ? 13.638  -44.493 -5.261  1.00 33.84  ?  202 ARG A NH1  1 
ATOM   2905 N  NH2  . ARG A 1 202 ? 15.728  -45.401 -5.046  1.00 34.15  ?  202 ARG A NH2  1 
ATOM   2906 H  H    . ARG A 1 202 ? 10.507  -41.392 -2.661  1.00 28.10  ?  202 ARG A H    1 
ATOM   2907 H  HA   . ARG A 1 202 ? 10.401  -44.062 -2.196  1.00 34.24  ?  202 ARG A HA   1 
ATOM   2908 H  HB2  . ARG A 1 202 ? 12.081  -42.320 -0.727  1.00 34.08  ?  202 ARG A HB2  1 
ATOM   2909 H  HB3  . ARG A 1 202 ? 11.897  -43.865 -0.423  1.00 34.08  ?  202 ARG A HB3  1 
ATOM   2910 H  HG2  . ARG A 1 202 ? 13.114  -42.924 -2.781  1.00 49.10  ?  202 ARG A HG2  1 
ATOM   2911 H  HG3  . ARG A 1 202 ? 13.943  -43.372 -1.500  1.00 49.10  ?  202 ARG A HG3  1 
ATOM   2912 H  HD2  . ARG A 1 202 ? 13.027  -45.546 -1.742  1.00 43.12  ?  202 ARG A HD2  1 
ATOM   2913 H  HD3  . ARG A 1 202 ? 12.370  -45.070 -3.111  1.00 43.12  ?  202 ARG A HD3  1 
ATOM   2914 H  HE   . ARG A 1 202 ? 14.978  -45.655 -2.758  1.00 45.70  ?  202 ARG A HE   1 
ATOM   2915 H  HH11 . ARG A 1 202 ? 12.883  -44.267 -4.917  1.00 40.69  ?  202 ARG A HH11 1 
ATOM   2916 H  HH12 . ARG A 1 202 ? 13.790  -44.352 -6.095  1.00 40.69  ?  202 ARG A HH12 1 
ATOM   2917 H  HH21 . ARG A 1 202 ? 16.336  -45.769 -4.562  1.00 41.06  ?  202 ARG A HH21 1 
ATOM   2918 H  HH22 . ARG A 1 202 ? 15.871  -45.257 -5.882  1.00 41.06  ?  202 ARG A HH22 1 
ATOM   2919 N  N    . SER A 1 203 ? 8.483   -43.690 -0.728  1.00 29.02  ?  203 SER A N    1 
ATOM   2920 C  CA   . SER A 1 203 ? 7.459   -43.532 0.295   1.00 31.99  ?  203 SER A CA   1 
ATOM   2921 C  C    . SER A 1 203 ? 7.730   -44.377 1.530   1.00 28.36  ?  203 SER A C    1 
ATOM   2922 O  O    . SER A 1 203 ? 7.157   -44.104 2.591   1.00 29.50  ?  203 SER A O    1 
ATOM   2923 C  CB   . SER A 1 203 ? 6.082   -43.904 -0.268  1.00 30.61  ?  203 SER A CB   1 
ATOM   2924 O  OG   . SER A 1 203 ? 6.053   -45.270 -0.647  1.00 41.78  ?  203 SER A OG   1 
ATOM   2925 H  H    . SER A 1 203 ? 8.387   -44.392 -1.215  1.00 34.91  ?  203 SER A H    1 
ATOM   2926 H  HA   . SER A 1 203 ? 7.429   -42.602 0.569   1.00 38.48  ?  203 SER A HA   1 
ATOM   2927 H  HB2  . SER A 1 203 ? 5.409   -43.749 0.412   1.00 36.82  ?  203 SER A HB2  1 
ATOM   2928 H  HB3  . SER A 1 203 ? 5.900   -43.355 -1.047  1.00 36.82  ?  203 SER A HB3  1 
ATOM   2929 H  HG   . SER A 1 203 ? 5.297   -45.466 -0.955  1.00 50.22  ?  203 SER A HG   1 
ATOM   2930 N  N    . ARG A 1 204 ? 8.594   -45.382 1.418   1.00 29.00  ?  204 ARG A N    1 
ATOM   2931 C  CA   . ARG A 1 204 ? 8.893   -46.301 2.505   1.00 31.59  ?  204 ARG A CA   1 
ATOM   2932 C  C    . ARG A 1 204 ? 10.397  -46.346 2.709   1.00 28.38  ?  204 ARG A C    1 
ATOM   2933 O  O    . ARG A 1 204 ? 11.152  -46.544 1.751   1.00 30.45  ?  204 ARG A O    1 
ATOM   2934 C  CB   . ARG A 1 204 ? 8.341   -47.703 2.196   1.00 35.52  ?  204 ARG A CB   1 
ATOM   2935 C  CG   . ARG A 1 204 ? 8.933   -48.859 3.010   1.00 41.80  ?  204 ARG A CG   1 
ATOM   2936 C  CD   . ARG A 1 204 ? 8.579   -48.775 4.485   1.00 42.21  ?  204 ARG A CD   1 
ATOM   2937 N  NE   . ARG A 1 204 ? 7.134   -48.805 4.706   1.00 46.01  ?  204 ARG A NE   1 
ATOM   2938 C  CZ   . ARG A 1 204 ? 6.405   -49.911 4.834   1.00 47.68  ?  204 ARG A CZ   1 
ATOM   2939 N  NH1  . ARG A 1 204 ? 6.972   -51.109 4.768   1.00 55.79  ?  204 ARG A NH1  1 
ATOM   2940 N  NH2  . ARG A 1 204 ? 5.098   -49.819 5.031   1.00 44.57  ?  204 ARG A NH2  1 
ATOM   2941 H  H    . ARG A 1 204 ? 9.032   -45.554 0.698   1.00 34.88  ?  204 ARG A H    1 
ATOM   2942 H  HA   . ARG A 1 204 ? 8.480   -45.981 3.323   1.00 37.99  ?  204 ARG A HA   1 
ATOM   2943 H  HB2  . ARG A 1 204 ? 7.385   -47.696 2.358   1.00 42.71  ?  204 ARG A HB2  1 
ATOM   2944 H  HB3  . ARG A 1 204 ? 8.507   -47.895 1.260   1.00 42.71  ?  204 ARG A HB3  1 
ATOM   2945 H  HG2  . ARG A 1 204 ? 8.588   -49.697 2.665   1.00 50.24  ?  204 ARG A HG2  1 
ATOM   2946 H  HG3  . ARG A 1 204 ? 9.899   -48.839 2.931   1.00 50.24  ?  204 ARG A HG3  1 
ATOM   2947 H  HD2  . ARG A 1 204 ? 8.972   -49.531 4.950   1.00 50.74  ?  204 ARG A HD2  1 
ATOM   2948 H  HD3  . ARG A 1 204 ? 8.923   -47.944 4.848   1.00 50.74  ?  204 ARG A HD3  1 
ATOM   2949 H  HE   . ARG A 1 204 ? 6.724   -48.051 4.756   1.00 55.30  ?  204 ARG A HE   1 
ATOM   2950 H  HH11 . ARG A 1 204 ? 7.819   -51.177 4.640   1.00 67.03  ?  204 ARG A HH11 1 
ATOM   2951 H  HH12 . ARG A 1 204 ? 6.491   -51.817 4.852   1.00 67.03  ?  204 ARG A HH12 1 
ATOM   2952 H  HH21 . ARG A 1 204 ? 4.723   -49.046 5.075   1.00 53.57  ?  204 ARG A HH21 1 
ATOM   2953 H  HH22 . ARG A 1 204 ? 4.624   -50.532 5.115   1.00 53.57  ?  204 ARG A HH22 1 
ATOM   2954 N  N    . SER A 1 205 ? 10.827  -46.142 3.948   1.00 26.50  ?  205 SER A N    1 
ATOM   2955 C  CA   . SER A 1 205 ? 12.212  -46.368 4.336   1.00 26.03  ?  205 SER A CA   1 
ATOM   2956 C  C    . SER A 1 205 ? 12.243  -47.532 5.316   1.00 29.23  ?  205 SER A C    1 
ATOM   2957 O  O    . SER A 1 205 ? 11.724  -47.398 6.437   1.00 25.77  ?  205 SER A O    1 
ATOM   2958 C  CB   . SER A 1 205 ? 12.817  -45.116 4.972   1.00 28.60  ?  205 SER A CB   1 
ATOM   2959 O  OG   . SER A 1 205 ? 14.177  -45.329 5.303   1.00 34.71  ?  205 SER A OG   1 
ATOM   2960 H  H    . SER A 1 205 ? 10.327  -45.868 4.591   1.00 31.89  ?  205 SER A H    1 
ATOM   2961 H  HA   . SER A 1 205 ? 12.737  -46.604 3.556   1.00 31.32  ?  205 SER A HA   1 
ATOM   2962 H  HB2  . SER A 1 205 ? 12.756  -44.381 4.343   1.00 34.40  ?  205 SER A HB2  1 
ATOM   2963 H  HB3  . SER A 1 205 ? 12.324  -44.903 5.780   1.00 34.40  ?  205 SER A HB3  1 
ATOM   2964 H  HG   . SER A 1 205 ? 14.500  -44.637 5.652   1.00 41.74  ?  205 SER A HG   1 
ATOM   2965 N  N    . PRO A 1 206 ? 12.803  -48.690 4.949   1.00 28.73  ?  206 PRO A N    1 
ATOM   2966 C  CA   . PRO A 1 206 ? 12.822  -49.818 5.897   1.00 29.70  ?  206 PRO A CA   1 
ATOM   2967 C  C    . PRO A 1 206 ? 13.434  -49.472 7.242   1.00 28.17  ?  206 PRO A C    1 
ATOM   2968 O  O    . PRO A 1 206 ? 12.954  -49.955 8.276   1.00 28.17  ?  206 PRO A O    1 
ATOM   2969 C  CB   . PRO A 1 206 ? 13.638  -50.879 5.148   1.00 31.06  ?  206 PRO A CB   1 
ATOM   2970 C  CG   . PRO A 1 206 ? 13.398  -50.581 3.712   1.00 35.18  ?  206 PRO A CG   1 
ATOM   2971 C  CD   . PRO A 1 206 ? 13.294  -49.083 3.616   1.00 28.71  ?  206 PRO A CD   1 
ATOM   2972 H  HA   . PRO A 1 206 ? 11.922  -50.151 6.035   1.00 35.73  ?  206 PRO A HA   1 
ATOM   2973 H  HB2  . PRO A 1 206 ? 14.579  -50.786 5.367   1.00 37.35  ?  206 PRO A HB2  1 
ATOM   2974 H  HB3  . PRO A 1 206 ? 13.315  -51.765 5.376   1.00 37.35  ?  206 PRO A HB3  1 
ATOM   2975 H  HG2  . PRO A 1 206 ? 14.143  -50.905 3.183   1.00 42.29  ?  206 PRO A HG2  1 
ATOM   2976 H  HG3  . PRO A 1 206 ? 12.570  -50.998 3.428   1.00 42.29  ?  206 PRO A HG3  1 
ATOM   2977 H  HD2  . PRO A 1 206 ? 14.167  -48.693 3.449   1.00 34.53  ?  206 PRO A HD2  1 
ATOM   2978 H  HD3  . PRO A 1 206 ? 12.654  -48.831 2.932   1.00 34.53  ?  206 PRO A HD3  1 
ATOM   2979 N  N    . ILE A 1 207 ? 14.479  -48.648 7.264   1.00 28.27  ?  207 ILE A N    1 
ATOM   2980 C  CA   . ILE A 1 207 ? 15.069  -48.173 8.510   1.00 29.15  ?  207 ILE A CA   1 
ATOM   2981 C  C    . ILE A 1 207 ? 15.378  -46.692 8.336   1.00 34.41  ?  207 ILE A C    1 
ATOM   2982 O  O    . ILE A 1 207 ? 16.335  -46.332 7.641   1.00 37.21  ?  207 ILE A O    1 
ATOM   2983 C  CB   . ILE A 1 207 ? 16.338  -48.945 8.907   1.00 30.27  ?  207 ILE A CB   1 
ATOM   2984 C  CG1  . ILE A 1 207 ? 16.027  -50.440 9.040   1.00 32.96  ?  207 ILE A CG1  1 
ATOM   2985 C  CG2  . ILE A 1 207 ? 16.899  -48.384 10.217  1.00 33.94  ?  207 ILE A CG2  1 
ATOM   2986 C  CD1  . ILE A 1 207 ? 17.183  -51.292 9.545   1.00 38.14  ?  207 ILE A CD1  1 
ATOM   2987 H  H    . ILE A 1 207 ? 14.869  -48.346 6.559   1.00 34.01  ?  207 ILE A H    1 
ATOM   2988 H  HA   . ILE A 1 207 ? 14.421  -48.266 9.226   1.00 35.07  ?  207 ILE A HA   1 
ATOM   2989 H  HB   . ILE A 1 207 ? 17.002  -48.827 8.210   1.00 36.40  ?  207 ILE A HB   1 
ATOM   2990 H  HG12 . ILE A 1 207 ? 15.291  -50.548 9.661   1.00 39.64  ?  207 ILE A HG12 1 
ATOM   2991 H  HG13 . ILE A 1 207 ? 15.771  -50.780 8.169   1.00 39.64  ?  207 ILE A HG13 1 
ATOM   2992 H  HG21 . ILE A 1 207 ? 17.698  -48.880 10.456  1.00 40.81  ?  207 ILE A HG21 1 
ATOM   2993 H  HG22 . ILE A 1 207 ? 17.115  -47.447 10.092  1.00 40.81  ?  207 ILE A HG22 1 
ATOM   2994 H  HG23 . ILE A 1 207 ? 16.230  -48.480 10.913  1.00 40.81  ?  207 ILE A HG23 1 
ATOM   2995 H  HD11 . ILE A 1 207 ? 16.895  -52.216 9.596   1.00 45.85  ?  207 ILE A HD11 1 
ATOM   2996 H  HD12 . ILE A 1 207 ? 17.928  -51.211 8.928   1.00 45.85  ?  207 ILE A HD12 1 
ATOM   2997 H  HD13 . ILE A 1 207 ? 17.446  -50.977 10.424  1.00 45.85  ?  207 ILE A HD13 1 
ATOM   2998 N  N    . PHE A 1 208 ? 14.570  -45.837 8.957   1.00 32.01  ?  208 PHE A N    1 
ATOM   2999 C  CA   . PHE A 1 208 ? 14.871  -44.415 9.045   1.00 30.32  ?  208 PHE A CA   1 
ATOM   3000 C  C    . PHE A 1 208 ? 15.843  -44.203 10.200  1.00 32.93  ?  208 PHE A C    1 
ATOM   3001 O  O    . PHE A 1 208 ? 15.538  -44.553 11.346  1.00 27.98  ?  208 PHE A O    1 
ATOM   3002 C  CB   . PHE A 1 208 ? 13.583  -43.619 9.242   1.00 31.02  ?  208 PHE A CB   1 
ATOM   3003 C  CG   . PHE A 1 208 ? 13.800  -42.161 9.517   1.00 27.58  ?  208 PHE A CG   1 
ATOM   3004 C  CD1  . PHE A 1 208 ? 14.282  -41.318 8.531   1.00 30.81  ?  208 PHE A CD1  1 
ATOM   3005 C  CD2  . PHE A 1 208 ? 13.503  -41.629 10.760  1.00 28.41  ?  208 PHE A CD2  1 
ATOM   3006 C  CE1  . PHE A 1 208 ? 14.476  -39.974 8.785   1.00 34.11  ?  208 PHE A CE1  1 
ATOM   3007 C  CE2  . PHE A 1 208 ? 13.693  -40.285 11.017  1.00 29.63  ?  208 PHE A CE2  1 
ATOM   3008 C  CZ   . PHE A 1 208 ? 14.178  -39.458 10.028  1.00 26.64  ?  208 PHE A CZ   1 
ATOM   3009 H  H    . PHE A 1 208 ? 13.833  -46.061 9.339   1.00 38.49  ?  208 PHE A H    1 
ATOM   3010 H  HA   . PHE A 1 208 ? 15.296  -44.120 8.225   1.00 36.46  ?  208 PHE A HA   1 
ATOM   3011 H  HB2  . PHE A 1 208 ? 13.047  -43.691 8.436   1.00 37.30  ?  208 PHE A HB2  1 
ATOM   3012 H  HB3  . PHE A 1 208 ? 13.097  -43.993 9.993   1.00 37.30  ?  208 PHE A HB3  1 
ATOM   3013 H  HD1  . PHE A 1 208 ? 14.484  -41.661 7.691   1.00 37.05  ?  208 PHE A HD1  1 
ATOM   3014 H  HD2  . PHE A 1 208 ? 13.175  -42.184 11.430  1.00 34.18  ?  208 PHE A HD2  1 
ATOM   3015 H  HE1  . PHE A 1 208 ? 14.803  -39.417 8.117   1.00 41.01  ?  208 PHE A HE1  1 
ATOM   3016 H  HE2  . PHE A 1 208 ? 13.493  -39.939 11.856  1.00 35.63  ?  208 PHE A HE2  1 
ATOM   3017 H  HZ   . PHE A 1 208 ? 14.308  -38.553 10.200  1.00 32.05  ?  208 PHE A HZ   1 
ATOM   3018 N  N    A SER A 1 209 ? 17.011  -43.636 9.898   0.49 28.35  ?  209 SER A N    1 
ATOM   3019 N  N    B SER A 1 209 ? 17.010  -43.632 9.899   0.51 26.93  ?  209 SER A N    1 
ATOM   3020 C  CA   A SER A 1 209 ? 18.100  -43.526 10.861  0.49 31.05  ?  209 SER A CA   1 
ATOM   3021 C  CA   B SER A 1 209 ? 18.095  -43.527 10.869  0.51 28.28  ?  209 SER A CA   1 
ATOM   3022 C  C    A SER A 1 209 ? 18.417  -42.081 11.226  0.49 29.34  ?  209 SER A C    1 
ATOM   3023 C  C    B SER A 1 209 ? 18.424  -42.084 11.226  0.51 28.67  ?  209 SER A C    1 
ATOM   3024 O  O    A SER A 1 209 ? 18.319  -41.707 12.398  0.49 29.97  ?  209 SER A O    1 
ATOM   3025 O  O    B SER A 1 209 ? 18.343  -41.716 12.402  0.51 30.15  ?  209 SER A O    1 
ATOM   3026 C  CB   A SER A 1 209 ? 19.353  -44.218 10.302  0.49 31.50  ?  209 SER A CB   1 
ATOM   3027 C  CB   B SER A 1 209 ? 19.340  -44.241 10.325  0.51 29.19  ?  209 SER A CB   1 
ATOM   3028 O  OG   A SER A 1 209 ? 20.426  -44.151 11.225  0.49 36.22  ?  209 SER A OG   1 
ATOM   3029 O  OG   B SER A 1 209 ? 19.081  -45.615 10.103  0.51 30.07  ?  209 SER A OG   1 
ATOM   3030 H  H    A SER A 1 209 ? 17.198  -43.302 9.128   0.49 34.10  ?  209 SER A H    1 
ATOM   3031 H  H    B SER A 1 209 ? 17.198  -43.294 9.131   0.51 32.40  ?  209 SER A H    1 
ATOM   3032 H  HA   A SER A 1 209 ? 17.844  -43.988 11.674  0.49 37.34  ?  209 SER A HA   1 
ATOM   3033 H  HA   B SER A 1 209 ? 17.828  -43.979 11.685  0.51 34.02  ?  209 SER A HA   1 
ATOM   3034 H  HB2  A SER A 1 209 ? 19.146  -45.150 10.126  0.49 37.89  ?  209 SER A HB2  1 
ATOM   3035 H  HB2  B SER A 1 209 ? 19.597  -43.829 9.485   0.51 35.12  ?  209 SER A HB2  1 
ATOM   3036 H  HB3  A SER A 1 209 ? 19.617  -43.777 9.480   0.49 37.89  ?  209 SER A HB3  1 
ATOM   3037 H  HB3  B SER A 1 209 ? 20.059  -44.156 10.970  0.51 35.12  ?  209 SER A HB3  1 
ATOM   3038 H  HG   A SER A 1 209 ? 21.103  -44.533 10.906  0.49 43.54  ?  209 SER A HG   1 
ATOM   3039 H  HG   B SER A 1 209 ? 19.770  -45.993 9.805   0.51 36.17  ?  209 SER A HG   1 
ATOM   3040 N  N    . LEU A 1 210 ? 18.798  -41.254 10.252  1.00 27.31  ?  210 LEU A N    1 
ATOM   3041 C  CA   . LEU A 1 210 ? 19.310  -39.915 10.530  1.00 30.17  ?  210 LEU A CA   1 
ATOM   3042 C  C    . LEU A 1 210 ? 18.535  -38.821 9.813   1.00 26.77  ?  210 LEU A C    1 
ATOM   3043 O  O    . LEU A 1 210 ? 18.002  -37.920 10.470  1.00 26.73  ?  210 LEU A O    1 
ATOM   3044 C  CB   . LEU A 1 210 ? 20.790  -39.861 10.142  1.00 29.01  ?  210 LEU A CB   1 
ATOM   3045 C  CG   . LEU A 1 210 ? 21.692  -40.832 10.906  1.00 34.94  ?  210 LEU A CG   1 
ATOM   3046 C  CD1  . LEU A 1 210 ? 23.072  -40.896 10.272  1.00 36.63  ?  210 LEU A CD1  1 
ATOM   3047 C  CD2  . LEU A 1 210 ? 21.790  -40.429 12.366  1.00 36.19  ?  210 LEU A CD2  1 
ATOM   3048 H  H    A LEU A 1 210 ? 18.770  -41.448 9.415   0.49 32.85  ?  210 LEU A H    1 
ATOM   3049 H  H    B LEU A 1 210 ? 18.765  -41.446 9.414   0.51 32.85  ?  210 LEU A H    1 
ATOM   3050 H  HA   . LEU A 1 210 ? 19.247  -39.748 11.484  1.00 36.28  ?  210 LEU A HA   1 
ATOM   3051 H  HB2  . LEU A 1 210 ? 20.870  -40.069 9.198   1.00 34.89  ?  210 LEU A HB2  1 
ATOM   3052 H  HB3  . LEU A 1 210 ? 21.120  -38.964 10.306  1.00 34.89  ?  210 LEU A HB3  1 
ATOM   3053 H  HG   . LEU A 1 210 ? 21.304  -41.720 10.867  1.00 42.02  ?  210 LEU A HG   1 
ATOM   3054 H  HD11 . LEU A 1 210 ? 23.621  -41.518 10.775  1.00 44.03  ?  210 LEU A HD11 1 
ATOM   3055 H  HD12 . LEU A 1 210 ? 22.983  -41.200 9.355   1.00 44.03  ?  210 LEU A HD12 1 
ATOM   3056 H  HD13 . LEU A 1 210 ? 23.469  -40.012 10.291  1.00 44.03  ?  210 LEU A HD13 1 
ATOM   3057 H  HD21 . LEU A 1 210 ? 22.365  -41.058 12.828  1.00 43.50  ?  210 LEU A HD21 1 
ATOM   3058 H  HD22 . LEU A 1 210 ? 22.162  -39.536 12.422  1.00 43.50  ?  210 LEU A HD22 1 
ATOM   3059 H  HD23 . LEU A 1 210 ? 20.902  -40.444 12.756  1.00 43.50  ?  210 LEU A HD23 1 
ATOM   3060 N  N    . SER A 1 211 ? 18.476  -38.853 8.486   1.00 29.62  ?  211 SER A N    1 
ATOM   3061 C  CA   . SER A 1 211 ? 17.807  -37.804 7.735   1.00 32.94  ?  211 SER A CA   1 
ATOM   3062 C  C    . SER A 1 211 ? 17.286  -38.388 6.432   1.00 29.04  ?  211 SER A C    1 
ATOM   3063 O  O    . SER A 1 211 ? 17.894  -39.291 5.849   1.00 34.27  ?  211 SER A O    1 
ATOM   3064 C  CB   . SER A 1 211 ? 18.748  -36.622 7.465   1.00 33.73  ?  211 SER A CB   1 
ATOM   3065 O  OG   . SER A 1 211 ? 18.067  -35.570 6.806   1.00 30.46  ?  211 SER A OG   1 
ATOM   3066 H  H    . SER A 1 211 ? 18.818  -39.473 7.998   1.00 35.62  ?  211 SER A H    1 
ATOM   3067 H  HA   . SER A 1 211 ? 17.050  -37.479 8.246   1.00 39.61  ?  211 SER A HA   1 
ATOM   3068 H  HB2  . SER A 1 211 ? 19.092  -36.294 8.311   1.00 40.56  ?  211 SER A HB2  1 
ATOM   3069 H  HB3  . SER A 1 211 ? 19.480  -36.924 6.905   1.00 40.56  ?  211 SER A HB3  1 
ATOM   3070 H  HG   . SER A 1 211 ? 17.430  -35.298 7.281   1.00 36.63  ?  211 SER A HG   1 
ATOM   3071 N  N    . TRP A 1 212 ? 16.151  -37.859 5.981   1.00 25.41  ?  212 TRP A N    1 
ATOM   3072 C  CA   . TRP A 1 212 ? 15.441  -38.399 4.827   1.00 27.87  ?  212 TRP A CA   1 
ATOM   3073 C  C    . TRP A 1 212 ? 14.841  -37.242 4.044   1.00 23.25  ?  212 TRP A C    1 
ATOM   3074 O  O    . TRP A 1 212 ? 14.037  -36.476 4.584   1.00 25.97  ?  212 TRP A O    1 
ATOM   3075 C  CB   . TRP A 1 212 ? 14.355  -39.379 5.287   1.00 34.39  ?  212 TRP A CB   1 
ATOM   3076 C  CG   . TRP A 1 212 ? 13.611  -40.092 4.196   1.00 25.85  ?  212 TRP A CG   1 
ATOM   3077 C  CD1  . TRP A 1 212 ? 13.878  -40.073 2.856   1.00 31.05  ?  212 TRP A CD1  1 
ATOM   3078 C  CD2  . TRP A 1 212 ? 12.467  -40.939 4.365   1.00 27.00  ?  212 TRP A CD2  1 
ATOM   3079 N  NE1  . TRP A 1 212 ? 12.966  -40.855 2.182   1.00 29.01  ?  212 TRP A NE1  1 
ATOM   3080 C  CE2  . TRP A 1 212 ? 12.090  -41.396 3.087   1.00 28.63  ?  212 TRP A CE2  1 
ATOM   3081 C  CE3  . TRP A 1 212 ? 11.726  -41.353 5.475   1.00 24.34  ?  212 TRP A CE3  1 
ATOM   3082 C  CZ2  . TRP A 1 212 ? 11.004  -42.246 2.890   1.00 26.32  ?  212 TRP A CZ2  1 
ATOM   3083 C  CZ3  . TRP A 1 212 ? 10.647  -42.195 5.277   1.00 26.78  ?  212 TRP A CZ3  1 
ATOM   3084 C  CH2  . TRP A 1 212 ? 10.298  -42.633 3.995   1.00 23.29  ?  212 TRP A CH2  1 
ATOM   3085 H  H    . TRP A 1 212 ? 15.767  -37.175 6.333   1.00 30.57  ?  212 TRP A H    1 
ATOM   3086 H  HA   . TRP A 1 212 ? 16.064  -38.873 4.253   1.00 33.52  ?  212 TRP A HA   1 
ATOM   3087 H  HB2  . TRP A 1 212 ? 14.770  -40.056 5.844   1.00 41.35  ?  212 TRP A HB2  1 
ATOM   3088 H  HB3  . TRP A 1 212 ? 13.702  -38.888 5.810   1.00 41.35  ?  212 TRP A HB3  1 
ATOM   3089 H  HD1  . TRP A 1 212 ? 14.572  -39.599 2.457   1.00 37.34  ?  212 TRP A HD1  1 
ATOM   3090 H  HE1  . TRP A 1 212 ? 12.949  -40.983 1.331   1.00 34.89  ?  212 TRP A HE1  1 
ATOM   3091 H  HE3  . TRP A 1 212 ? 11.951  -41.064 6.330   1.00 29.30  ?  212 TRP A HE3  1 
ATOM   3092 H  HZ2  . TRP A 1 212 ? 10.769  -42.540 2.040   1.00 31.67  ?  212 TRP A HZ2  1 
ATOM   3093 H  HZ3  . TRP A 1 212 ? 10.146  -42.477 6.008   1.00 32.22  ?  212 TRP A HZ3  1 
ATOM   3094 H  HH2  . TRP A 1 212 ? 9.568   -43.200 3.892   1.00 28.03  ?  212 TRP A HH2  1 
ATOM   3095 N  N    . THR A 1 213 ? 15.238  -37.111 2.782   1.00 25.60  ?  213 THR A N    1 
ATOM   3096 C  CA   . THR A 1 213 ? 14.683  -36.101 1.892   1.00 27.05  ?  213 THR A CA   1 
ATOM   3097 C  C    . THR A 1 213 ? 13.538  -36.725 1.106   1.00 26.83  ?  213 THR A C    1 
ATOM   3098 O  O    . THR A 1 213 ? 13.738  -37.702 0.376   1.00 29.39  ?  213 THR A O    1 
ATOM   3099 C  CB   . THR A 1 213 ? 15.750  -35.554 0.944   1.00 28.46  ?  213 THR A CB   1 
ATOM   3100 O  OG1  . THR A 1 213 ? 16.822  -34.984 1.704   1.00 28.87  ?  213 THR A OG1  1 
ATOM   3101 C  CG2  . THR A 1 213 ? 15.167  -34.478 0.035   1.00 32.11  ?  213 THR A CG2  1 
ATOM   3102 H  H    . THR A 1 213 ? 15.838  -37.605 2.413   1.00 30.80  ?  213 THR A H    1 
ATOM   3103 H  HA   . THR A 1 213 ? 14.331  -35.365 2.416   1.00 32.54  ?  213 THR A HA   1 
ATOM   3104 H  HB   . THR A 1 213 ? 16.092  -36.273 0.390   1.00 34.24  ?  213 THR A HB   1 
ATOM   3105 H  HG1  . THR A 1 213 ? 17.167  -35.569 2.198   1.00 34.73  ?  213 THR A HG1  1 
ATOM   3106 H  HG21 . THR A 1 213 ? 15.854  -34.140 -0.561  1.00 38.61  ?  213 THR A HG21 1 
ATOM   3107 H  HG22 . THR A 1 213 ? 14.444  -34.849 -0.496  1.00 38.61  ?  213 THR A HG22 1 
ATOM   3108 H  HG23 . THR A 1 213 ? 14.823  -33.745 0.568   1.00 38.61  ?  213 THR A HG23 1 
ATOM   3109 N  N    . VAL A 1 214 ? 12.347  -36.158 1.259   1.00 25.40  ?  214 VAL A N    1 
ATOM   3110 C  CA   . VAL A 1 214 ? 11.126  -36.679 0.658   1.00 29.43  ?  214 VAL A CA   1 
ATOM   3111 C  C    . VAL A 1 214 ? 10.867  -35.902 -0.623  1.00 27.32  ?  214 VAL A C    1 
ATOM   3112 O  O    . VAL A 1 214 ? 10.900  -34.666 -0.621  1.00 29.06  ?  214 VAL A O    1 
ATOM   3113 C  CB   . VAL A 1 214 ? 9.945   -36.560 1.636   1.00 30.62  ?  214 VAL A CB   1 
ATOM   3114 C  CG1  . VAL A 1 214 ? 8.685   -37.175 1.049   1.00 33.97  ?  214 VAL A CG1  1 
ATOM   3115 C  CG2  . VAL A 1 214 ? 10.302  -37.223 2.961   1.00 32.64  ?  214 VAL A CG2  1 
ATOM   3116 H  H    . VAL A 1 214 ? 12.218  -35.445 1.723   1.00 30.56  ?  214 VAL A H    1 
ATOM   3117 H  HA   . VAL A 1 214 ? 11.248  -37.614 0.433   1.00 35.40  ?  214 VAL A HA   1 
ATOM   3118 H  HB   . VAL A 1 214 ? 9.769   -35.622 1.808   1.00 36.82  ?  214 VAL A HB   1 
ATOM   3119 H  HG11 . VAL A 1 214 ? 7.962   -37.084 1.689   1.00 40.85  ?  214 VAL A HG11 1 
ATOM   3120 H  HG12 . VAL A 1 214 ? 8.461   -36.711 0.228   1.00 40.85  ?  214 VAL A HG12 1 
ATOM   3121 H  HG13 . VAL A 1 214 ? 8.849   -38.113 0.866   1.00 40.85  ?  214 VAL A HG13 1 
ATOM   3122 H  HG21 . VAL A 1 214 ? 9.550   -37.141 3.567   1.00 39.25  ?  214 VAL A HG21 1 
ATOM   3123 H  HG22 . VAL A 1 214 ? 10.499  -38.160 2.802   1.00 39.25  ?  214 VAL A HG22 1 
ATOM   3124 H  HG23 . VAL A 1 214 ? 11.079  -36.780 3.335   1.00 39.25  ?  214 VAL A HG23 1 
ATOM   3125 N  N    . MET A 1 215 ? 10.611  -36.617 -1.718  1.00 25.74  ?  215 MET A N    1 
ATOM   3126 C  CA   . MET A 1 215 ? 10.605  -36.010 -3.042  1.00 26.24  ?  215 MET A CA   1 
ATOM   3127 C  C    . MET A 1 215 ? 9.389   -36.449 -3.842  1.00 28.46  ?  215 MET A C    1 
ATOM   3128 O  O    . MET A 1 215 ? 9.123   -37.648 -3.973  1.00 27.41  ?  215 MET A O    1 
ATOM   3129 C  CB   . MET A 1 215 ? 11.874  -36.380 -3.809  1.00 25.84  ?  215 MET A CB   1 
ATOM   3130 C  CG   . MET A 1 215 ? 13.157  -36.025 -3.083  1.00 30.40  ?  215 MET A CG   1 
ATOM   3131 S  SD   . MET A 1 215 ? 14.585  -36.144 -4.171  1.00 31.10  ?  215 MET A SD   1 
ATOM   3132 C  CE   . MET A 1 215 ? 14.394  -37.808 -4.794  1.00 41.37  ?  215 MET A CE   1 
ATOM   3133 H  H    . MET A 1 215 ? 10.438  -37.459 -1.718  1.00 30.97  ?  215 MET A H    1 
ATOM   3134 H  HA   . MET A 1 215 ? 10.585  -35.045 -2.946  1.00 31.57  ?  215 MET A HA   1 
ATOM   3135 H  HB2  . MET A 1 215 ? 11.877  -37.337 -3.964  1.00 31.09  ?  215 MET A HB2  1 
ATOM   3136 H  HB3  . MET A 1 215 ? 11.875  -35.910 -4.657  1.00 31.09  ?  215 MET A HB3  1 
ATOM   3137 H  HG2  . MET A 1 215 ? 13.099  -35.113 -2.757  1.00 36.56  ?  215 MET A HG2  1 
ATOM   3138 H  HG3  . MET A 1 215 ? 13.287  -36.639 -2.343  1.00 36.56  ?  215 MET A HG3  1 
ATOM   3139 H  HE1  . MET A 1 215 ? 15.120  -38.000 -5.407  1.00 49.73  ?  215 MET A HE1  1 
ATOM   3140 H  HE2  . MET A 1 215 ? 14.417  -38.428 -4.048  1.00 49.73  ?  215 MET A HE2  1 
ATOM   3141 H  HE3  . MET A 1 215 ? 13.543  -37.876 -5.255  1.00 49.73  ?  215 MET A HE3  1 
ATOM   3142 N  N    . HIS A 1 216 ? 8.673   -35.471 -4.393  1.00 26.13  ?  216 HIS A N    1 
ATOM   3143 C  CA   . HIS A 1 216 ? 7.605   -35.712 -5.356  1.00 23.54  ?  216 HIS A CA   1 
ATOM   3144 C  C    . HIS A 1 216 ? 8.048   -35.194 -6.716  1.00 29.32  ?  216 HIS A C    1 
ATOM   3145 O  O    . HIS A 1 216 ? 8.043   -33.975 -6.945  1.00 30.09  ?  216 HIS A O    1 
ATOM   3146 C  CB   . HIS A 1 216 ? 6.311   -35.020 -4.920  1.00 25.18  ?  216 HIS A CB   1 
ATOM   3147 C  CG   . HIS A 1 216 ? 5.283   -34.931 -6.002  1.00 29.32  ?  216 HIS A CG   1 
ATOM   3148 N  ND1  . HIS A 1 216 ? 4.702   -36.043 -6.571  1.00 27.64  ?  216 HIS A ND1  1 
ATOM   3149 C  CD2  . HIS A 1 216 ? 4.738   -33.861 -6.627  1.00 29.62  ?  216 HIS A CD2  1 
ATOM   3150 C  CE1  . HIS A 1 216 ? 3.839   -35.662 -7.497  1.00 31.67  ?  216 HIS A CE1  1 
ATOM   3151 N  NE2  . HIS A 1 216 ? 3.842   -34.342 -7.550  1.00 25.07  ?  216 HIS A NE2  1 
ATOM   3152 H  H    . HIS A 1 216 ? 8.793   -34.637 -4.219  1.00 31.44  ?  216 HIS A H    1 
ATOM   3153 H  HA   . HIS A 1 216 ? 7.438   -36.665 -5.426  1.00 28.33  ?  216 HIS A HA   1 
ATOM   3154 H  HB2  . HIS A 1 216 ? 5.923   -35.518 -4.183  1.00 30.30  ?  216 HIS A HB2  1 
ATOM   3155 H  HB3  . HIS A 1 216 ? 6.520   -34.118 -4.633  1.00 30.30  ?  216 HIS A HB3  1 
ATOM   3156 H  HD1  . HIS A 1 216 ? 4.873   -36.858 -6.356  1.00 33.25  ?  216 HIS A HD1  1 
ATOM   3157 H  HD2  . HIS A 1 216 ? 4.931   -32.967 -6.460  1.00 35.62  ?  216 HIS A HD2  1 
ATOM   3158 H  HE1  . HIS A 1 216 ? 3.319   -36.227 -8.021  1.00 38.08  ?  216 HIS A HE1  1 
ATOM   3159 N  N    . PRO A 1 217 ? 8.460   -36.057 -7.643  1.00 29.23  ?  217 PRO A N    1 
ATOM   3160 C  CA   . PRO A 1 217 ? 8.749   -35.582 -9.001  1.00 27.11  ?  217 PRO A CA   1 
ATOM   3161 C  C    . PRO A 1 217 ? 7.484   -35.055 -9.660  1.00 30.41  ?  217 PRO A C    1 
ATOM   3162 O  O    . PRO A 1 217 ? 6.437   -35.706 -9.645  1.00 32.11  ?  217 PRO A O    1 
ATOM   3163 C  CB   . PRO A 1 217 ? 9.289   -36.830 -9.710  1.00 31.81  ?  217 PRO A CB   1 
ATOM   3164 C  CG   . PRO A 1 217 ? 9.732   -37.743 -8.609  1.00 31.99  ?  217 PRO A CG   1 
ATOM   3165 C  CD   . PRO A 1 217 ? 8.784   -37.483 -7.480  1.00 29.56  ?  217 PRO A CD   1 
ATOM   3166 H  HA   . PRO A 1 217 ? 9.429   -34.890 -8.988  1.00 32.61  ?  217 PRO A HA   1 
ATOM   3167 H  HB2  . PRO A 1 217 ? 8.583   -37.241 -10.233 1.00 38.25  ?  217 PRO A HB2  1 
ATOM   3168 H  HB3  . PRO A 1 217 ? 10.038  -36.586 -10.276 1.00 38.25  ?  217 PRO A HB3  1 
ATOM   3169 H  HG2  . PRO A 1 217 ? 9.670   -38.665 -8.904  1.00 38.47  ?  217 PRO A HG2  1 
ATOM   3170 H  HG3  . PRO A 1 217 ? 10.642  -37.525 -8.351  1.00 38.47  ?  217 PRO A HG3  1 
ATOM   3171 H  HD2  . PRO A 1 217 ? 7.986   -38.026 -7.575  1.00 35.56  ?  217 PRO A HD2  1 
ATOM   3172 H  HD3  . PRO A 1 217 ? 9.221   -37.636 -6.627  1.00 35.56  ?  217 PRO A HD3  1 
ATOM   3173 N  N    . ILE A 1 218 ? 7.585   -33.860 -10.233 1.00 28.33  ?  218 ILE A N    1 
ATOM   3174 C  CA   . ILE A 1 218 ? 6.419   -33.196 -10.838 1.00 28.56  ?  218 ILE A CA   1 
ATOM   3175 C  C    . ILE A 1 218 ? 6.453   -33.558 -12.327 1.00 34.27  ?  218 ILE A C    1 
ATOM   3176 O  O    . ILE A 1 218 ? 6.960   -32.822 -13.170 1.00 35.08  ?  218 ILE A O    1 
ATOM   3177 C  CB   . ILE A 1 218 ? 6.423   -31.684 -10.599 1.00 28.04  ?  218 ILE A CB   1 
ATOM   3178 C  CG1  . ILE A 1 218 ? 6.526   -31.378 -9.101  1.00 34.13  ?  218 ILE A CG1  1 
ATOM   3179 C  CG2  . ILE A 1 218 ? 5.163   -31.051 -11.189 1.00 28.27  ?  218 ILE A CG2  1 
ATOM   3180 C  CD1  . ILE A 1 218 ? 6.798   -29.920 -8.788  1.00 33.47  ?  218 ILE A CD1  1 
ATOM   3181 H  H    . ILE A 1 218 ? 8.314   -33.408 -10.288 1.00 34.08  ?  218 ILE A H    1 
ATOM   3182 H  HA   . ILE A 1 218 ? 5.607   -33.561 -10.454 1.00 34.36  ?  218 ILE A HA   1 
ATOM   3183 H  HB   . ILE A 1 218 ? 7.197   -31.304 -11.045 1.00 33.73  ?  218 ILE A HB   1 
ATOM   3184 H  HG12 . ILE A 1 218 ? 5.690   -31.621 -8.675  1.00 41.04  ?  218 ILE A HG12 1 
ATOM   3185 H  HG13 . ILE A 1 218 ? 7.251   -31.902 -8.725  1.00 41.04  ?  218 ILE A HG13 1 
ATOM   3186 H  HG21 . ILE A 1 218 ? 5.186   -30.094 -11.028 1.00 34.00  ?  218 ILE A HG21 1 
ATOM   3187 H  HG22 . ILE A 1 218 ? 5.140   -31.225 -12.143 1.00 34.00  ?  218 ILE A HG22 1 
ATOM   3188 H  HG23 . ILE A 1 218 ? 4.385   -31.441 -10.762 1.00 34.00  ?  218 ILE A HG23 1 
ATOM   3189 H  HD11 . ILE A 1 218 ? 6.849   -29.808 -7.826  1.00 40.25  ?  218 ILE A HD11 1 
ATOM   3190 H  HD12 . ILE A 1 218 ? 7.639   -29.661 -9.196  1.00 40.25  ?  218 ILE A HD12 1 
ATOM   3191 H  HD13 . ILE A 1 218 ? 6.076   -29.380 -9.147  1.00 40.25  ?  218 ILE A HD13 1 
ATOM   3192 N  N    . ASP A 1 219 ? 5.894   -34.723 -12.638 1.00 35.35  ?  219 ASP A N    1 
ATOM   3193 C  CA   . ASP A 1 219 ? 5.747   -35.163 -14.018 1.00 35.58  ?  219 ASP A CA   1 
ATOM   3194 C  C    . ASP A 1 219 ? 4.323   -34.871 -14.489 1.00 39.23  ?  219 ASP A C    1 
ATOM   3195 O  O    . ASP A 1 219 ? 3.491   -34.350 -13.744 1.00 36.18  ?  219 ASP A O    1 
ATOM   3196 C  CB   . ASP A 1 219 ? 6.105   -36.648 -14.151 1.00 37.59  ?  219 ASP A CB   1 
ATOM   3197 C  CG   . ASP A 1 219 ? 5.195   -37.556 -13.344 1.00 38.62  ?  219 ASP A CG   1 
ATOM   3198 O  OD1  . ASP A 1 219 ? 4.109   -37.114 -12.918 1.00 40.65  ?  219 ASP A OD1  1 
ATOM   3199 O  OD2  . ASP A 1 219 ? 5.574   -38.727 -13.134 1.00 56.72  ?  219 ASP A OD2  1 
ATOM   3200 H  H    . ASP A 1 219 ? 5.589   -35.282 -12.059 1.00 42.51  ?  219 ASP A H    1 
ATOM   3201 H  HA   . ASP A 1 219 ? 6.357   -34.657 -14.577 1.00 42.77  ?  219 ASP A HA   1 
ATOM   3202 H  HB2  . ASP A 1 219 ? 6.034   -36.906 -15.084 1.00 45.19  ?  219 ASP A HB2  1 
ATOM   3203 H  HB3  . ASP A 1 219 ? 7.014   -36.782 -13.839 1.00 45.19  ?  219 ASP A HB3  1 
ATOM   3204 N  N    . HIS A 1 220 ? 4.035   -35.221 -15.746 1.00 41.90  ?  220 HIS A N    1 
ATOM   3205 C  CA   . HIS A 1 220 ? 2.768   -34.824 -16.358 1.00 42.97  ?  220 HIS A CA   1 
ATOM   3206 C  C    . HIS A 1 220 ? 1.550   -35.455 -15.695 1.00 39.84  ?  220 HIS A C    1 
ATOM   3207 O  O    . HIS A 1 220 ? 0.425   -35.107 -16.068 1.00 44.99  ?  220 HIS A O    1 
ATOM   3208 C  CB   . HIS A 1 220 ? 2.764   -35.137 -17.862 1.00 46.81  ?  220 HIS A CB   1 
ATOM   3209 C  CG   . HIS A 1 220 ? 3.288   -36.494 -18.212 1.00 47.86  ?  220 HIS A CG   1 
ATOM   3210 N  ND1  . HIS A 1 220 ? 3.892   -36.764 -19.421 1.00 46.26  ?  220 HIS A ND1  1 
ATOM   3211 C  CD2  . HIS A 1 220 ? 3.299   -37.657 -17.518 1.00 51.59  ?  220 HIS A CD2  1 
ATOM   3212 C  CE1  . HIS A 1 220 ? 4.255   -38.033 -19.456 1.00 50.15  ?  220 HIS A CE1  1 
ATOM   3213 N  NE2  . HIS A 1 220 ? 3.907   -38.598 -18.314 1.00 52.18  ?  220 HIS A NE2  1 
ATOM   3214 H  H    . HIS A 1 220 ? 4.549   -35.683 -16.258 1.00 50.37  ?  220 HIS A H    1 
ATOM   3215 H  HA   . HIS A 1 220 ? 2.678   -33.862 -16.265 1.00 51.64  ?  220 HIS A HA   1 
ATOM   3216 H  HB2  . HIS A 1 220 ? 1.853   -35.080 -18.189 1.00 56.26  ?  220 HIS A HB2  1 
ATOM   3217 H  HB3  . HIS A 1 220 ? 3.316   -34.482 -18.317 1.00 56.26  ?  220 HIS A HB3  1 
ATOM   3218 H  HD2  . HIS A 1 220 ? 2.960   -37.793 -16.663 1.00 61.99  ?  220 HIS A HD2  1 
ATOM   3219 H  HE1  . HIS A 1 220 ? 4.682   -38.458 -20.165 1.00 60.26  ?  220 HIS A HE1  1 
ATOM   3220 H  HE2  . HIS A 1 220 ? 4.038   -39.421 -18.103 1.00 62.70  ?  220 HIS A HE2  1 
ATOM   3221 N  N    A HIS A 1 221 ? 1.727   -36.357 -14.730 0.43 45.89  ?  221 HIS A N    1 
ATOM   3222 N  N    B HIS A 1 221 ? 1.742   -36.363 -14.739 0.57 45.92  ?  221 HIS A N    1 
ATOM   3223 C  CA   A HIS A 1 221 ? 0.612   -36.904 -13.967 0.43 46.93  ?  221 HIS A CA   1 
ATOM   3224 C  CA   B HIS A 1 221 ? 0.647   -36.932 -13.966 0.57 46.97  ?  221 HIS A CA   1 
ATOM   3225 C  C    A HIS A 1 221 ? 0.643   -36.459 -12.509 0.43 44.32  ?  221 HIS A C    1 
ATOM   3226 C  C    B HIS A 1 221 ? 0.493   -36.294 -12.592 0.57 44.31  ?  221 HIS A C    1 
ATOM   3227 O  O    A HIS A 1 221 ? -0.026  -37.061 -11.664 0.43 43.36  ?  221 HIS A O    1 
ATOM   3228 O  O    B HIS A 1 221 ? -0.471  -36.608 -11.885 0.57 42.20  ?  221 HIS A O    1 
ATOM   3229 C  CB   A HIS A 1 221 ? 0.600   -38.427 -14.068 0.43 49.45  ?  221 HIS A CB   1 
ATOM   3230 C  CB   B HIS A 1 221 ? 0.852   -38.442 -13.795 0.57 48.64  ?  221 HIS A CB   1 
ATOM   3231 C  CG   A HIS A 1 221 ? 0.239   -38.927 -15.431 0.43 54.58  ?  221 HIS A CG   1 
ATOM   3232 C  CG   B HIS A 1 221 ? 0.675   -39.223 -15.059 0.57 55.24  ?  221 HIS A CG   1 
ATOM   3233 N  ND1  A HIS A 1 221 ? -0.957  -38.617 -16.041 0.43 51.15  ?  221 HIS A ND1  1 
ATOM   3234 N  ND1  B HIS A 1 221 ? 1.458   -40.311 -15.377 0.57 45.66  ?  221 HIS A ND1  1 
ATOM   3235 C  CD2  A HIS A 1 221 ? 0.920   -39.701 -16.309 0.43 52.39  ?  221 HIS A CD2  1 
ATOM   3236 C  CD2  B HIS A 1 221 ? -0.200  -39.076 -16.082 0.57 54.88  ?  221 HIS A CD2  1 
ATOM   3237 C  CE1  A HIS A 1 221 ? -1.001  -39.183 -17.234 0.43 51.54  ?  221 HIS A CE1  1 
ATOM   3238 C  CE1  B HIS A 1 221 ? 1.076   -40.800 -16.543 0.57 53.21  ?  221 HIS A CE1  1 
ATOM   3239 N  NE2  A HIS A 1 221 ? 0.126   -39.847 -17.420 0.43 54.75  ?  221 HIS A NE2  1 
ATOM   3240 N  NE2  B HIS A 1 221 ? 0.072   -40.069 -16.993 0.57 54.95  ?  221 HIS A NE2  1 
ATOM   3241 H  H    A HIS A 1 221 ? 2.494   -36.669 -14.497 0.43 55.15  ?  221 HIS A H    1 
ATOM   3242 H  H    B HIS A 1 221 ? 2.515   -36.670 -14.518 0.57 55.19  ?  221 HIS A H    1 
ATOM   3243 H  HA   A HIS A 1 221 ? -0.215  -36.578 -14.354 0.43 56.40  ?  221 HIS A HA   1 
ATOM   3244 H  HA   B HIS A 1 221 ? -0.182  -36.797 -14.451 0.57 56.45  ?  221 HIS A HA   1 
ATOM   3245 H  HB2  A HIS A 1 221 ? 1.484   -38.764 -13.852 0.43 59.42  ?  221 HIS A HB2  1 
ATOM   3246 H  HB2  B HIS A 1 221 ? 1.753   -38.601 -13.472 0.57 58.45  ?  221 HIS A HB2  1 
ATOM   3247 H  HB3  A HIS A 1 221 ? -0.050  -38.779 -13.440 0.43 59.42  ?  221 HIS A HB3  1 
ATOM   3248 H  HB3  B HIS A 1 221 ? 0.209   -38.774 -13.149 0.57 58.45  ?  221 HIS A HB3  1 
ATOM   3249 H  HD2  A HIS A 1 221 ? 1.765   -40.068 -16.182 0.43 62.94  ?  221 HIS A HD2  1 
ATOM   3250 H  HD2  B HIS A 1 221 ? -0.859  -38.425 -16.156 0.57 65.94  ?  221 HIS A HD2  1 
ATOM   3251 H  HE1  A HIS A 1 221 ? -1.705  -39.125 -17.838 0.43 61.93  ?  221 HIS A HE1  1 
ATOM   3252 H  HE1  B HIS A 1 221 ? 1.450   -41.534 -16.974 0.57 63.93  ?  221 HIS A HE1  1 
ATOM   3253 H  HE2  A HIS A 1 221 ? 0.329   -40.298 -18.124 0.43 65.79  ?  221 HIS A HE2  1 
ATOM   3254 H  HE2  B HIS A 1 221 ? -0.345  -40.194 -17.735 0.57 66.02  ?  221 HIS A HE2  1 
ATOM   3255 N  N    . SER A 1 222 ? 1.408   -35.415 -12.201 1.00 38.71  ?  222 SER A N    1 
ATOM   3256 C  CA   . SER A 1 222 ? 1.345   -34.809 -10.882 1.00 36.92  ?  222 SER A CA   1 
ATOM   3257 C  C    . SER A 1 222 ? 0.171   -33.833 -10.817 1.00 37.46  ?  222 SER A C    1 
ATOM   3258 O  O    . SER A 1 222 ? -0.076  -33.096 -11.774 1.00 37.98  ?  222 SER A O    1 
ATOM   3259 C  CB   . SER A 1 222 ? 2.646   -34.072 -10.570 1.00 32.55  ?  222 SER A CB   1 
ATOM   3260 O  OG   . SER A 1 222 ? 2.464   -33.138 -9.518  1.00 34.34  ?  222 SER A OG   1 
ATOM   3261 H  H    A SER A 1 222 ? 1.969   -35.043 -12.736 0.43 46.53  ?  222 SER A H    1 
ATOM   3262 H  H    B SER A 1 222 ? 2.074   -35.155 -12.680 0.57 46.53  ?  222 SER A H    1 
ATOM   3263 H  HA   . SER A 1 222 ? 1.212   -35.498 -10.213 1.00 44.39  ?  222 SER A HA   1 
ATOM   3264 H  HB2  . SER A 1 222 ? 3.318   -34.719 -10.305 1.00 39.14  ?  222 SER A HB2  1 
ATOM   3265 H  HB3  . SER A 1 222 ? 2.938   -33.599 -11.365 1.00 39.14  ?  222 SER A HB3  1 
ATOM   3266 H  HG   . SER A 1 222 ? 2.211   -33.535 -8.822  1.00 41.29  ?  222 SER A HG   1 
ATOM   3267 N  N    . PRO A 1 223 ? -0.569  -33.799 -9.706  1.00 32.52  ?  223 PRO A N    1 
ATOM   3268 C  CA   . PRO A 1 223 ? -1.638  -32.795 -9.577  1.00 34.97  ?  223 PRO A CA   1 
ATOM   3269 C  C    . PRO A 1 223 ? -1.135  -31.361 -9.563  1.00 35.09  ?  223 PRO A C    1 
ATOM   3270 O  O    . PRO A 1 223 ? -1.957  -30.445 -9.697  1.00 34.76  ?  223 PRO A O    1 
ATOM   3271 C  CB   . PRO A 1 223 ? -2.320  -33.162 -8.250  1.00 35.61  ?  223 PRO A CB   1 
ATOM   3272 C  CG   . PRO A 1 223 ? -1.339  -33.988 -7.519  1.00 40.82  ?  223 PRO A CG   1 
ATOM   3273 C  CD   . PRO A 1 223 ? -0.541  -34.717 -8.556  1.00 35.11  ?  223 PRO A CD   1 
ATOM   3274 H  HA   . PRO A 1 223 ? -2.277  -32.898 -10.299 1.00 42.04  ?  223 PRO A HA   1 
ATOM   3275 H  HB2  . PRO A 1 223 ? -2.525  -32.354 -7.754  1.00 42.81  ?  223 PRO A HB2  1 
ATOM   3276 H  HB3  . PRO A 1 223 ? -3.128  -33.669 -8.429  1.00 42.81  ?  223 PRO A HB3  1 
ATOM   3277 H  HG2  . PRO A 1 223 ? -0.763  -33.413 -6.991  1.00 49.07  ?  223 PRO A HG2  1 
ATOM   3278 H  HG3  . PRO A 1 223 ? -1.807  -34.616 -6.947  1.00 49.07  ?  223 PRO A HG3  1 
ATOM   3279 H  HD2  . PRO A 1 223 ? 0.370   -34.851 -8.251  1.00 42.21  ?  223 PRO A HD2  1 
ATOM   3280 H  HD3  . PRO A 1 223 ? -0.969  -35.558 -8.783  1.00 42.21  ?  223 PRO A HD3  1 
ATOM   3281 N  N    . ILE A 1 224 ? 0.169   -31.130 -9.414  1.00 29.18  ?  224 ILE A N    1 
ATOM   3282 C  CA   . ILE A 1 224 ? 0.722   -29.782 -9.479  1.00 33.15  ?  224 ILE A CA   1 
ATOM   3283 C  C    . ILE A 1 224 ? 1.558   -29.583 -10.743 1.00 32.66  ?  224 ILE A C    1 
ATOM   3284 O  O    . ILE A 1 224 ? 2.326   -28.628 -10.833 1.00 34.94  ?  224 ILE A O    1 
ATOM   3285 C  CB   . ILE A 1 224 ? 1.530   -29.434 -8.215  1.00 37.37  ?  224 ILE A CB   1 
ATOM   3286 C  CG1  . ILE A 1 224 ? 2.738   -30.363 -8.047  1.00 36.88  ?  224 ILE A CG1  1 
ATOM   3287 C  CG2  . ILE A 1 224 ? 0.628   -29.492 -6.990  1.00 30.95  ?  224 ILE A CG2  1 
ATOM   3288 C  CD1  . ILE A 1 224 ? 3.671   -29.952 -6.913  1.00 36.79  ?  224 ILE A CD1  1 
ATOM   3289 H  H    . ILE A 1 224 ? 0.756   -31.742 -9.272  1.00 35.10  ?  224 ILE A H    1 
ATOM   3290 H  HA   . ILE A 1 224 ? -0.017  -29.156 -9.525  1.00 39.86  ?  224 ILE A HA   1 
ATOM   3291 H  HB   . ILE A 1 224 ? 1.858   -28.526 -8.307  1.00 44.93  ?  224 ILE A HB   1 
ATOM   3292 H  HG12 . ILE A 1 224 ? 2.420   -31.260 -7.859  1.00 44.34  ?  224 ILE A HG12 1 
ATOM   3293 H  HG13 . ILE A 1 224 ? 3.252   -30.361 -8.870  1.00 44.34  ?  224 ILE A HG13 1 
ATOM   3294 H  HG21 . ILE A 1 224 ? 1.150   -29.271 -6.203  1.00 37.22  ?  224 ILE A HG21 1 
ATOM   3295 H  HG22 . ILE A 1 224 ? -0.093  -28.853 -7.100  1.00 37.22  ?  224 ILE A HG22 1 
ATOM   3296 H  HG23 . ILE A 1 224 ? 0.266   -30.388 -6.907  1.00 37.22  ?  224 ILE A HG23 1 
ATOM   3297 H  HD11 . ILE A 1 224 ? 4.407   -30.581 -6.867  1.00 44.23  ?  224 ILE A HD11 1 
ATOM   3298 H  HD12 . ILE A 1 224 ? 4.008   -29.060 -7.091  1.00 44.23  ?  224 ILE A HD12 1 
ATOM   3299 H  HD13 . ILE A 1 224 ? 3.176   -29.959 -6.079  1.00 44.23  ?  224 ILE A HD13 1 
ATOM   3300 N  N    . TYR A 1 225 ? 1.411   -30.462 -11.730 1.00 34.79  ?  225 TYR A N    1 
ATOM   3301 C  CA   . TYR A 1 225 ? 2.093   -30.270 -13.003 1.00 33.42  ?  225 TYR A CA   1 
ATOM   3302 C  C    . TYR A 1 225 ? 1.641   -28.963 -13.645 1.00 37.09  ?  225 TYR A C    1 
ATOM   3303 O  O    . TYR A 1 225 ? 0.442   -28.692 -13.752 1.00 33.72  ?  225 TYR A O    1 
ATOM   3304 C  CB   . TYR A 1 225 ? 1.808   -31.447 -13.936 1.00 36.43  ?  225 TYR A CB   1 
ATOM   3305 C  CG   . TYR A 1 225 ? 2.522   -31.366 -15.267 1.00 36.97  ?  225 TYR A CG   1 
ATOM   3306 C  CD1  . TYR A 1 225 ? 3.868   -31.691 -15.374 1.00 44.91  ?  225 TYR A CD1  1 
ATOM   3307 C  CD2  . TYR A 1 225 ? 1.850   -30.974 -16.416 1.00 39.08  ?  225 TYR A CD2  1 
ATOM   3308 C  CE1  . TYR A 1 225 ? 4.524   -31.627 -16.588 1.00 46.86  ?  225 TYR A CE1  1 
ATOM   3309 C  CE2  . TYR A 1 225 ? 2.500   -30.905 -17.637 1.00 42.37  ?  225 TYR A CE2  1 
ATOM   3310 C  CZ   . TYR A 1 225 ? 3.836   -31.233 -17.715 1.00 45.96  ?  225 TYR A CZ   1 
ATOM   3311 O  OH   . TYR A 1 225 ? 4.491   -31.167 -18.923 1.00 49.51  ?  225 TYR A OH   1 
ATOM   3312 H  H    . TYR A 1 225 ? 0.927   -31.171 -11.688 1.00 41.83  ?  225 TYR A H    1 
ATOM   3313 H  HA   . TYR A 1 225 ? 3.050   -30.222 -12.853 1.00 40.18  ?  225 TYR A HA   1 
ATOM   3314 H  HB2  . TYR A 1 225 ? 2.090   -32.266 -13.498 1.00 43.80  ?  225 TYR A HB2  1 
ATOM   3315 H  HB3  . TYR A 1 225 ? 0.855   -31.480 -14.113 1.00 43.80  ?  225 TYR A HB3  1 
ATOM   3316 H  HD1  . TYR A 1 225 ? 4.335   -31.959 -14.616 1.00 53.98  ?  225 TYR A HD1  1 
ATOM   3317 H  HD2  . TYR A 1 225 ? 0.948   -30.753 -16.365 1.00 46.97  ?  225 TYR A HD2  1 
ATOM   3318 H  HE1  . TYR A 1 225 ? 5.426   -31.847 -16.644 1.00 56.32  ?  225 TYR A HE1  1 
ATOM   3319 H  HE2  . TYR A 1 225 ? 2.037   -30.639 -18.399 1.00 50.92  ?  225 TYR A HE2  1 
ATOM   3320 H  HH   . TYR A 1 225 ? 3.961   -30.915 -19.524 1.00 59.50  ?  225 TYR A HH   1 
ATOM   3321 N  N    . GLY A 1 226 ? 2.608   -28.150 -14.066 1.00 35.16  ?  226 GLY A N    1 
ATOM   3322 C  CA   . GLY A 1 226 ? 2.320   -26.866 -14.668 1.00 34.60  ?  226 GLY A CA   1 
ATOM   3323 C  C    . GLY A 1 226 ? 1.910   -25.776 -13.701 1.00 42.49  ?  226 GLY A C    1 
ATOM   3324 O  O    . GLY A 1 226 ? 1.695   -24.638 -14.136 1.00 41.12  ?  226 GLY A O    1 
ATOM   3325 H  H    . GLY A 1 226 ? 3.448   -28.328 -14.010 1.00 42.27  ?  226 GLY A H    1 
ATOM   3326 H  HA2  . GLY A 1 226 ? 3.108   -26.560 -15.144 1.00 41.60  ?  226 GLY A HA2  1 
ATOM   3327 H  HA3  . GLY A 1 226 ? 1.604   -26.976 -15.313 1.00 41.60  ?  226 GLY A HA3  1 
ATOM   3328 N  N    . GLU A 1 227 ? 1.794   -26.077 -12.411 1.00 36.40  ?  227 GLU A N    1 
ATOM   3329 C  CA   . GLU A 1 227 ? 1.370   -25.073 -11.447 1.00 35.60  ?  227 GLU A CA   1 
ATOM   3330 C  C    . GLU A 1 227 ? 2.489   -24.078 -11.169 1.00 37.73  ?  227 GLU A C    1 
ATOM   3331 O  O    . GLU A 1 227 ? 3.677   -24.387 -11.292 1.00 39.08  ?  227 GLU A O    1 
ATOM   3332 C  CB   . GLU A 1 227 ? 0.937   -25.733 -10.138 1.00 34.60  ?  227 GLU A CB   1 
ATOM   3333 C  CG   . GLU A 1 227 ? -0.316  -26.583 -10.246 1.00 37.55  ?  227 GLU A CG   1 
ATOM   3334 C  CD   . GLU A 1 227 ? -1.574  -25.758 -10.408 1.00 44.53  ?  227 GLU A CD   1 
ATOM   3335 O  OE1  . GLU A 1 227 ? -1.742  -24.782 -9.648  1.00 46.70  ?  227 GLU A OE1  1 
ATOM   3336 O  OE2  . GLU A 1 227 ? -2.394  -26.085 -11.291 1.00 55.52  ?  227 GLU A OE2  1 
ATOM   3337 H  H    . GLU A 1 227 ? 1.955   -26.851 -12.072 1.00 43.76  ?  227 GLU A H    1 
ATOM   3338 H  HA   . GLU A 1 227 ? 0.612   -24.586 -11.806 1.00 42.81  ?  227 GLU A HA   1 
ATOM   3339 H  HB2  . GLU A 1 227 ? 1.655   -26.306 -9.826  1.00 41.61  ?  227 GLU A HB2  1 
ATOM   3340 H  HB3  . GLU A 1 227 ? 0.766   -25.039 -9.482  1.00 41.61  ?  227 GLU A HB3  1 
ATOM   3341 H  HG2  . GLU A 1 227 ? -0.237  -27.164 -11.019 1.00 45.14  ?  227 GLU A HG2  1 
ATOM   3342 H  HG3  . GLU A 1 227 ? -0.408  -27.114 -9.440  1.00 45.14  ?  227 GLU A HG3  1 
ATOM   3343 N  N    . THR A 1 228 ? 2.091   -22.871 -10.785 1.00 39.88  ?  228 THR A N    1 
ATOM   3344 C  CA   . THR A 1 228 ? 3.006   -21.820 -10.371 1.00 36.83  ?  228 THR A CA   1 
ATOM   3345 C  C    . THR A 1 228 ? 2.646   -21.387 -8.958  1.00 38.09  ?  228 THR A C    1 
ATOM   3346 O  O    . THR A 1 228 ? 1.640   -21.818 -8.389  1.00 34.26  ?  228 THR A O    1 
ATOM   3347 C  CB   . THR A 1 228 ? 2.940   -20.615 -11.321 1.00 42.57  ?  228 THR A CB   1 
ATOM   3348 O  OG1  . THR A 1 228 ? 1.651   -19.995 -11.221 1.00 41.96  ?  228 THR A OG1  1 
ATOM   3349 C  CG2  . THR A 1 228 ? 3.179   -21.043 -12.760 1.00 38.58  ?  228 THR A CG2  1 
ATOM   3350 H  H    . THR A 1 228 ? 1.266   -22.632 -10.756 1.00 47.94  ?  228 THR A H    1 
ATOM   3351 H  HA   . THR A 1 228 ? 3.913   -22.162 -10.369 1.00 44.28  ?  228 THR A HA   1 
ATOM   3352 H  HB   . THR A 1 228 ? 3.625   -19.974 -11.075 1.00 51.16  ?  228 THR A HB   1 
ATOM   3353 H  HG1  . THR A 1 228 ? 1.609   -19.335 -11.738 1.00 50.43  ?  228 THR A HG1  1 
ATOM   3354 H  HG21 . THR A 1 228 ? 3.134   -20.273 -13.347 1.00 46.37  ?  228 THR A HG21 1 
ATOM   3355 H  HG22 . THR A 1 228 ? 4.054   -21.453 -12.842 1.00 46.37  ?  228 THR A HG22 1 
ATOM   3356 H  HG23 . THR A 1 228 ? 2.504   -21.685 -13.031 1.00 46.37  ?  228 THR A HG23 1 
ATOM   3357 N  N    . ASP A 1 229 ? 3.482   -20.519 -8.389  1.00 34.79  ?  229 ASP A N    1 
ATOM   3358 C  CA   . ASP A 1 229 ? 3.139   -19.919 -7.106  1.00 39.58  ?  229 ASP A CA   1 
ATOM   3359 C  C    . ASP A 1 229 ? 1.766   -19.263 -7.168  1.00 43.70  ?  229 ASP A C    1 
ATOM   3360 O  O    . ASP A 1 229 ? 0.971   -19.370 -6.228  1.00 43.29  ?  229 ASP A O    1 
ATOM   3361 C  CB   . ASP A 1 229 ? 4.202   -18.898 -6.701  1.00 36.97  ?  229 ASP A CB   1 
ATOM   3362 C  CG   . ASP A 1 229 ? 3.828   -18.139 -5.446  1.00 46.72  ?  229 ASP A CG   1 
ATOM   3363 O  OD1  . ASP A 1 229 ? 3.973   -18.702 -4.340  1.00 47.49  ?  229 ASP A OD1  1 
ATOM   3364 O  OD2  . ASP A 1 229 ? 3.376   -16.980 -5.563  1.00 45.33  ?  229 ASP A OD2  1 
ATOM   3365 H  H    . ASP A 1 229 ? 4.235   -20.266 -8.718  1.00 41.84  ?  229 ASP A H    1 
ATOM   3366 H  HA   . ASP A 1 229 ? 3.112   -20.612 -6.428  1.00 47.58  ?  229 ASP A HA   1 
ATOM   3367 H  HB2  . ASP A 1 229 ? 5.038   -19.361 -6.536  1.00 44.45  ?  229 ASP A HB2  1 
ATOM   3368 H  HB3  . ASP A 1 229 ? 4.313   -18.256 -7.419  1.00 44.45  ?  229 ASP A HB3  1 
ATOM   3369 N  N    . GLU A 1 230 ? 1.463   -18.598 -8.284  1.00 43.19  ?  230 GLU A N    1 
ATOM   3370 C  CA   . GLU A 1 230 ? 0.183   -17.912 -8.421  1.00 45.29  ?  230 GLU A CA   1 
ATOM   3371 C  C    . GLU A 1 230 ? -0.975  -18.901 -8.437  1.00 35.78  ?  230 GLU A C    1 
ATOM   3372 O  O    . GLU A 1 230 ? -1.964  -18.724 -7.717  1.00 40.06  ?  230 GLU A O    1 
ATOM   3373 C  CB   . GLU A 1 230 ? 0.179   -17.064 -9.694  1.00 49.70  ?  230 GLU A CB   1 
ATOM   3374 C  CG   . GLU A 1 230 ? -1.107  -16.279 -9.908  1.00 52.92  ?  230 GLU A CG   1 
ATOM   3375 C  CD   . GLU A 1 230 ? -1.076  -15.438 -11.171 1.00 70.71  ?  230 GLU A CD   1 
ATOM   3376 O  OE1  . GLU A 1 230 ? -0.443  -15.867 -12.158 1.00 67.25  ?  230 GLU A OE1  1 
ATOM   3377 O  OE2  . GLU A 1 230 ? -1.683  -14.347 -11.175 1.00 71.54  ?  230 GLU A OE2  1 
ATOM   3378 H  H    . GLU A 1 230 ? 1.979   -18.529 -8.970  1.00 51.91  ?  230 GLU A H    1 
ATOM   3379 H  HA   . GLU A 1 230 ? 0.060   -17.318 -7.664  1.00 54.43  ?  230 GLU A HA   1 
ATOM   3380 H  HB2  . GLU A 1 230 ? 0.910   -16.429 -9.648  1.00 59.73  ?  230 GLU A HB2  1 
ATOM   3381 H  HB3  . GLU A 1 230 ? 0.300   -17.649 -10.459 1.00 59.73  ?  230 GLU A HB3  1 
ATOM   3382 H  HG2  . GLU A 1 230 ? -1.849  -16.899 -9.978  1.00 63.59  ?  230 GLU A HG2  1 
ATOM   3383 H  HG3  . GLU A 1 230 ? -1.243  -15.683 -9.154  1.00 63.59  ?  230 GLU A HG3  1 
ATOM   3384 N  N    . THR A 1 231 ? -0.878  -19.948 -9.260  1.00 38.75  ?  231 THR A N    1 
ATOM   3385 C  CA   . THR A 1 231 ? -2.005  -20.863 -9.408  1.00 43.05  ?  231 THR A CA   1 
ATOM   3386 C  C    . THR A 1 231 ? -2.187  -21.737 -8.173  1.00 41.31  ?  231 THR A C    1 
ATOM   3387 O  O    . THR A 1 231 ? -3.306  -22.184 -7.895  1.00 41.94  ?  231 THR A O    1 
ATOM   3388 C  CB   . THR A 1 231 ? -1.829  -21.725 -10.660 1.00 42.86  ?  231 THR A CB   1 
ATOM   3389 O  OG1  . THR A 1 231 ? -0.649  -22.529 -10.542 1.00 45.24  ?  231 THR A OG1  1 
ATOM   3390 C  CG2  . THR A 1 231 ? -1.721  -20.845 -11.902 1.00 46.16  ?  231 THR A CG2  1 
ATOM   3391 H  H    . THR A 1 231 ? -0.187  -20.145 -9.733  1.00 46.58  ?  231 THR A H    1 
ATOM   3392 H  HA   . THR A 1 231 ? -2.815  -20.341 -9.521  1.00 51.75  ?  231 THR A HA   1 
ATOM   3393 H  HB   . THR A 1 231 ? -2.601  -22.303 -10.763 1.00 51.51  ?  231 THR A HB   1 
ATOM   3394 H  HG1  . THR A 1 231 ? -0.710  -23.032 -9.872  1.00 54.37  ?  231 THR A HG1  1 
ATOM   3395 H  HG21 . THR A 1 231 ? -1.610  -21.398 -12.691 1.00 55.47  ?  231 THR A HG21 1 
ATOM   3396 H  HG22 . THR A 1 231 ? -2.526  -20.312 -12.001 1.00 55.47  ?  231 THR A HG22 1 
ATOM   3397 H  HG23 . THR A 1 231 ? -0.958  -20.252 -11.822 1.00 55.47  ?  231 THR A HG23 1 
ATOM   3398 N  N    . LEU A 1 232 ? -1.114  -21.992 -7.418  1.00 38.54  ?  232 LEU A N    1 
ATOM   3399 C  CA   . LEU A 1 232 ? -1.266  -22.698 -6.150  1.00 37.75  ?  232 LEU A CA   1 
ATOM   3400 C  C    . LEU A 1 232 ? -2.007  -21.840 -5.132  1.00 37.54  ?  232 LEU A C    1 
ATOM   3401 O  O    . LEU A 1 232 ? -2.843  -22.346 -4.374  1.00 39.72  ?  232 LEU A O    1 
ATOM   3402 C  CB   . LEU A 1 232 ? 0.100   -23.111 -5.599  1.00 39.38  ?  232 LEU A CB   1 
ATOM   3403 C  CG   . LEU A 1 232 ? 0.899   -24.162 -6.375  1.00 35.15  ?  232 LEU A CG   1 
ATOM   3404 C  CD1  . LEU A 1 232 ? 2.251   -24.371 -5.711  1.00 36.05  ?  232 LEU A CD1  1 
ATOM   3405 C  CD2  . LEU A 1 232 ? 0.145   -25.480 -6.472  1.00 36.34  ?  232 LEU A CD2  1 
ATOM   3406 H  H    . LEU A 1 232 ? -0.306  -21.770 -7.615  1.00 46.33  ?  232 LEU A H    1 
ATOM   3407 H  HA   . LEU A 1 232 ? -1.786  -23.504 -6.297  1.00 45.38  ?  232 LEU A HA   1 
ATOM   3408 H  HB2  . LEU A 1 232 ? 0.654   -22.316 -5.548  1.00 47.34  ?  232 LEU A HB2  1 
ATOM   3409 H  HB3  . LEU A 1 232 ? -0.033  -23.462 -4.704  1.00 47.34  ?  232 LEU A HB3  1 
ATOM   3410 H  HG   . LEU A 1 232 ? 1.054   -23.838 -7.276  1.00 42.26  ?  232 LEU A HG   1 
ATOM   3411 H  HD11 . LEU A 1 232 ? 2.747   -25.038 -6.211  1.00 43.35  ?  232 LEU A HD11 1 
ATOM   3412 H  HD12 . LEU A 1 232 ? 2.735   -23.531 -5.709  1.00 43.35  ?  232 LEU A HD12 1 
ATOM   3413 H  HD13 . LEU A 1 232 ? 2.111   -24.676 -4.801  1.00 43.35  ?  232 LEU A HD13 1 
ATOM   3414 H  HD21 . LEU A 1 232 ? 0.683   -26.115 -6.970  1.00 43.69  ?  232 LEU A HD21 1 
ATOM   3415 H  HD22 . LEU A 1 232 ? -0.021  -25.815 -5.577  1.00 43.69  ?  232 LEU A HD22 1 
ATOM   3416 H  HD23 . LEU A 1 232 ? -0.697  -25.329 -6.930  1.00 43.69  ?  232 LEU A HD23 1 
ATOM   3417 N  N    . ARG A 1 233 ? -1.710  -20.539 -5.094  1.00 35.64  ?  233 ARG A N    1 
ATOM   3418 C  CA   . ARG A 1 233 ? -2.435  -19.648 -4.193  1.00 38.96  ?  233 ARG A CA   1 
ATOM   3419 C  C    . ARG A 1 233 ? -3.890  -19.508 -4.615  1.00 37.39  ?  233 ARG A C    1 
ATOM   3420 O  O    . ARG A 1 233 ? -4.782  -19.426 -3.763  1.00 43.72  ?  233 ARG A O    1 
ATOM   3421 C  CB   . ARG A 1 233 ? -1.761  -18.277 -4.150  1.00 37.91  ?  233 ARG A CB   1 
ATOM   3422 C  CG   . ARG A 1 233 ? -0.386  -18.292 -3.522  1.00 44.07  ?  233 ARG A CG   1 
ATOM   3423 C  CD   . ARG A 1 233 ? 0.307   -16.942 -3.636  1.00 45.47  ?  233 ARG A CD   1 
ATOM   3424 N  NE   . ARG A 1 233 ? 1.702   -17.029 -3.212  1.00 43.36  ?  233 ARG A NE   1 
ATOM   3425 C  CZ   . ARG A 1 233 ? 2.116   -16.960 -1.950  1.00 42.73  ?  233 ARG A CZ   1 
ATOM   3426 N  NH1  . ARG A 1 233 ? 1.246   -16.793 -0.963  1.00 47.22  ?  233 ARG A NH1  1 
ATOM   3427 N  NH2  . ARG A 1 233 ? 3.408   -17.057 -1.673  1.00 46.92  ?  233 ARG A NH2  1 
ATOM   3428 H  H    . ARG A 1 233 ? -1.106  -20.155 -5.571  1.00 42.85  ?  233 ARG A H    1 
ATOM   3429 H  HA   . ARG A 1 233 ? -2.416  -20.020 -3.298  1.00 46.83  ?  233 ARG A HA   1 
ATOM   3430 H  HB2  . ARG A 1 233 ? -1.669  -17.945 -5.056  1.00 45.58  ?  233 ARG A HB2  1 
ATOM   3431 H  HB3  . ARG A 1 233 ? -2.316  -17.672 -3.633  1.00 45.58  ?  233 ARG A HB3  1 
ATOM   3432 H  HG2  . ARG A 1 233 ? -0.468  -18.512 -2.581  1.00 52.97  ?  233 ARG A HG2  1 
ATOM   3433 H  HG3  . ARG A 1 233 ? 0.162   -18.953 -3.973  1.00 52.97  ?  233 ARG A HG3  1 
ATOM   3434 H  HD2  . ARG A 1 233 ? 0.287   -16.648 -4.560  1.00 54.65  ?  233 ARG A HD2  1 
ATOM   3435 H  HD3  . ARG A 1 233 ? -0.145  -16.299 -3.068  1.00 54.65  ?  233 ARG A HD3  1 
ATOM   3436 H  HE   . ARG A 1 233 ? 2.299   -17.133 -3.822  1.00 52.12  ?  233 ARG A HE   1 
ATOM   3437 H  HH11 . ARG A 1 233 ? 0.406   -16.731 -1.135  1.00 56.74  ?  233 ARG A HH11 1 
ATOM   3438 H  HH12 . ARG A 1 233 ? 1.522   -16.748 -0.149  1.00 56.74  ?  233 ARG A HH12 1 
ATOM   3439 H  HH21 . ARG A 1 233 ? 3.977   -17.164 -2.310  1.00 56.39  ?  233 ARG A HH21 1 
ATOM   3440 H  HH22 . ARG A 1 233 ? 3.678   -17.009 -0.858  1.00 56.39  ?  233 ARG A HH22 1 
ATOM   3441 N  N    . ASN A 1 234 ? -4.151  -19.484 -5.924  1.00 37.95  ?  234 ASN A N    1 
ATOM   3442 C  CA   . ASN A 1 234 ? -5.521  -19.327 -6.402  1.00 44.93  ?  234 ASN A CA   1 
ATOM   3443 C  C    . ASN A 1 234 ? -6.400  -20.480 -5.939  1.00 43.15  ?  234 ASN A C    1 
ATOM   3444 O  O    . ASN A 1 234 ? -7.584  -20.288 -5.644  1.00 44.23  ?  234 ASN A O    1 
ATOM   3445 C  CB   . ASN A 1 234 ? -5.540  -19.219 -7.927  1.00 48.37  ?  234 ASN A CB   1 
ATOM   3446 C  CG   . ASN A 1 234 ? -5.051  -17.871 -8.422  1.00 49.43  ?  234 ASN A CG   1 
ATOM   3447 O  OD1  . ASN A 1 234 ? -4.985  -16.904 -7.662  1.00 48.88  ?  234 ASN A OD1  1 
ATOM   3448 N  ND2  . ASN A 1 234 ? -4.713  -17.798 -9.704  1.00 50.98  ?  234 ASN A ND2  1 
ATOM   3449 H  H    . ASN A 1 234 ? -3.560  -19.555 -6.546  1.00 45.62  ?  234 ASN A H    1 
ATOM   3450 H  HA   . ASN A 1 234 ? -5.889  -18.506 -6.039  1.00 54.00  ?  234 ASN A HA   1 
ATOM   3451 H  HB2  . ASN A 1 234 ? -4.963  -19.903 -8.300  1.00 58.13  ?  234 ASN A HB2  1 
ATOM   3452 H  HB3  . ASN A 1 234 ? -6.449  -19.343 -8.242  1.00 58.13  ?  234 ASN A HB3  1 
ATOM   3453 H  HD21 . ASN A 1 234 ? -4.431  -17.055 -10.033 1.00 61.26  ?  234 ASN A HD21 1 
ATOM   3454 H  HD22 . ASN A 1 234 ? -4.774  -18.494 -10.205 1.00 61.26  ?  234 ASN A HD22 1 
ATOM   3455 N  N    . SER A 1 235 ? -5.841  -21.686 -5.876  1.00 42.28  ?  235 SER A N    1 
ATOM   3456 C  CA   . SER A 1 235 ? -6.547  -22.845 -5.352  1.00 38.46  ?  235 SER A CA   1 
ATOM   3457 C  C    . SER A 1 235 ? -6.330  -23.025 -3.856  1.00 33.57  ?  235 SER A C    1 
ATOM   3458 O  O    . SER A 1 235 ? -6.714  -24.063 -3.307  1.00 35.33  ?  235 SER A O    1 
ATOM   3459 C  CB   . SER A 1 235 ? -6.110  -24.106 -6.103  1.00 41.62  ?  235 SER A CB   1 
ATOM   3460 O  OG   . SER A 1 235 ? -4.700  -24.246 -6.092  1.00 38.36  ?  235 SER A OG   1 
ATOM   3461 H  H    . SER A 1 235 ? -5.039  -21.858 -6.136  1.00 50.82  ?  235 SER A H    1 
ATOM   3462 H  HA   . SER A 1 235 ? -7.498  -22.725 -5.502  1.00 46.24  ?  235 SER A HA   1 
ATOM   3463 H  HB2  . SER A 1 235 ? -6.506  -24.880 -5.674  1.00 50.03  ?  235 SER A HB2  1 
ATOM   3464 H  HB3  . SER A 1 235 ? -6.413  -24.045 -7.022  1.00 50.03  ?  235 SER A HB3  1 
ATOM   3465 H  HG   . SER A 1 235 ? -4.423  -24.300 -5.301  1.00 46.12  ?  235 SER A HG   1 
ATOM   3466 N  N    . HIS A 1 236 ? -5.739  -22.036 -3.194  1.00 34.75  ?  236 HIS A N    1 
ATOM   3467 C  CA   . HIS A 1 236 ? -5.411  -22.093 -1.771  1.00 35.05  ?  236 HIS A CA   1 
ATOM   3468 C  C    . HIS A 1 236 ? -4.788  -23.442 -1.415  1.00 38.81  ?  236 HIS A C    1 
ATOM   3469 O  O    . HIS A 1 236 ? -5.248  -24.169 -0.535  1.00 34.85  ?  236 HIS A O    1 
ATOM   3470 C  CB   . HIS A 1 236 ? -6.639  -21.813 -0.909  1.00 41.93  ?  236 HIS A CB   1 
ATOM   3471 C  CG   . HIS A 1 236 ? -6.304  -21.358 0.477   1.00 50.01  ?  236 HIS A CG   1 
ATOM   3472 N  ND1  . HIS A 1 236 ? -5.603  -20.199 0.727   1.00 60.66  ?  236 HIS A ND1  1 
ATOM   3473 C  CD2  . HIS A 1 236 ? -6.564  -21.909 1.687   1.00 62.88  ?  236 HIS A CD2  1 
ATOM   3474 C  CE1  . HIS A 1 236 ? -5.449  -20.052 2.031   1.00 65.57  ?  236 HIS A CE1  1 
ATOM   3475 N  NE2  . HIS A 1 236 ? -6.023  -21.076 2.636   1.00 56.14  ?  236 HIS A NE2  1 
ATOM   3476 H  H    . HIS A 1 236 ? -5.509  -21.293 -3.561  1.00 41.78  ?  236 HIS A H    1 
ATOM   3477 H  HA   . HIS A 1 236 ? -4.754  -21.406 -1.577  1.00 42.15  ?  236 HIS A HA   1 
ATOM   3478 H  HB2  . HIS A 1 236 ? -7.166  -21.116 -1.332  1.00 50.40  ?  236 HIS A HB2  1 
ATOM   3479 H  HB3  . HIS A 1 236 ? -7.164  -22.625 -0.837  1.00 50.40  ?  236 HIS A HB3  1 
ATOM   3480 H  HD2  . HIS A 1 236 ? -7.024  -22.701 1.845   1.00 75.54  ?  236 HIS A HD2  1 
ATOM   3481 H  HE1  . HIS A 1 236 ? -5.011  -19.347 2.451   1.00 78.77  ?  236 HIS A HE1  1 
ATOM   3482 H  HE2  . HIS A 1 236 ? -6.053  -21.201 3.486   1.00 67.46  ?  236 HIS A HE2  1 
ATOM   3483 N  N    . SER A 1 237 ? -3.714  -23.764 -2.125  1.00 38.08  ?  237 SER A N    1 
ATOM   3484 C  CA   . SER A 1 237 ? -3.041  -25.037 -1.935  1.00 30.76  ?  237 SER A CA   1 
ATOM   3485 C  C    . SER A 1 237 ? -2.219  -25.032 -0.653  1.00 36.80  ?  237 SER A C    1 
ATOM   3486 O  O    . SER A 1 237 ? -1.518  -24.063 -0.344  1.00 32.42  ?  237 SER A O    1 
ATOM   3487 C  CB   . SER A 1 237 ? -2.142  -25.343 -3.132  1.00 35.84  ?  237 SER A CB   1 
ATOM   3488 O  OG   . SER A 1 237 ? -2.915  -25.546 -4.300  1.00 38.05  ?  237 SER A OG   1 
ATOM   3489 H  H    . SER A 1 237 ? -3.356  -23.260 -2.724  1.00 45.77  ?  237 SER A H    1 
ATOM   3490 H  HA   . SER A 1 237 ? -3.704  -25.741 -1.867  1.00 37.00  ?  237 SER A HA   1 
ATOM   3491 H  HB2  . SER A 1 237 ? -1.542  -24.594 -3.276  1.00 43.09  ?  237 SER A HB2  1 
ATOM   3492 H  HB3  . SER A 1 237 ? -1.632  -26.146 -2.947  1.00 43.09  ?  237 SER A HB3  1 
ATOM   3493 H  HG   . SER A 1 237 ? -2.412  -25.714 -4.952  1.00 45.74  ?  237 SER A HG   1 
ATOM   3494 N  N    . GLU A 1 238 ? -2.320  -26.123 0.099   1.00 28.91  ?  238 GLU A N    1 
ATOM   3495 C  CA   . GLU A 1 238 ? -1.472  -26.364 1.253   1.00 28.94  ?  238 GLU A CA   1 
ATOM   3496 C  C    . GLU A 1 238 ? -0.931  -27.783 1.158   1.00 28.44  ?  238 GLU A C    1 
ATOM   3497 O  O    . GLU A 1 238 ? -1.470  -28.629 0.440   1.00 29.69  ?  238 GLU A O    1 
ATOM   3498 C  CB   . GLU A 1 238 ? -2.234  -26.152 2.572   1.00 32.81  ?  238 GLU A CB   1 
ATOM   3499 C  CG   . GLU A 1 238 ? -2.657  -24.708 2.798   1.00 36.54  ?  238 GLU A CG   1 
ATOM   3500 C  CD   . GLU A 1 238 ? -3.381  -24.495 4.116   1.00 39.83  ?  238 GLU A CD   1 
ATOM   3501 O  OE1  . GLU A 1 238 ? -3.739  -25.491 4.779   1.00 33.77  ?  238 GLU A OE1  1 
ATOM   3502 O  OE2  . GLU A 1 238 ? -3.592  -23.323 4.489   1.00 42.48  ?  238 GLU A OE2  1 
ATOM   3503 H  H    . GLU A 1 238 ? -2.887  -26.753 -0.047  1.00 34.77  ?  238 GLU A H    1 
ATOM   3504 H  HA   . GLU A 1 238 ? -0.722  -25.750 1.233   1.00 34.81  ?  238 GLU A HA   1 
ATOM   3505 H  HB2  . GLU A 1 238 ? -3.034  -26.700 2.565   1.00 39.46  ?  238 GLU A HB2  1 
ATOM   3506 H  HB3  . GLU A 1 238 ? -1.662  -26.414 3.311   1.00 39.46  ?  238 GLU A HB3  1 
ATOM   3507 H  HG2  . GLU A 1 238 ? -1.868  -24.145 2.796   1.00 43.93  ?  238 GLU A HG2  1 
ATOM   3508 H  HG3  . GLU A 1 238 ? -3.256  -24.441 2.082   1.00 43.93  ?  238 GLU A HG3  1 
ATOM   3509 N  N    . PHE A 1 239 ? 0.156   -28.034 1.882   1.00 27.13  ?  239 PHE A N    1 
ATOM   3510 C  CA   . PHE A 1 239 ? 0.849   -29.315 1.818   1.00 27.03  ?  239 PHE A CA   1 
ATOM   3511 C  C    . PHE A 1 239 ? 0.996   -29.874 3.223   1.00 27.73  ?  239 PHE A C    1 
ATOM   3512 O  O    . PHE A 1 239 ? 1.576   -29.225 4.099   1.00 29.07  ?  239 PHE A O    1 
ATOM   3513 C  CB   . PHE A 1 239 ? 2.209   -29.166 1.138   1.00 27.13  ?  239 PHE A CB   1 
ATOM   3514 C  CG   . PHE A 1 239 ? 2.108   -28.777 -0.308  1.00 27.40  ?  239 PHE A CG   1 
ATOM   3515 C  CD1  . PHE A 1 239 ? 2.048   -27.443 -0.676  1.00 32.13  ?  239 PHE A CD1  1 
ATOM   3516 C  CD2  . PHE A 1 239 ? 2.042   -29.744 -1.296  1.00 31.12  ?  239 PHE A CD2  1 
ATOM   3517 C  CE1  . PHE A 1 239 ? 1.940   -27.082 -2.002  1.00 30.20  ?  239 PHE A CE1  1 
ATOM   3518 C  CE2  . PHE A 1 239 ? 1.936   -29.388 -2.626  1.00 28.80  ?  239 PHE A CE2  1 
ATOM   3519 C  CZ   . PHE A 1 239 ? 1.885   -28.055 -2.978  1.00 28.48  ?  239 PHE A CZ   1 
ATOM   3520 H  H    . PHE A 1 239 ? 0.516   -27.471 2.424   1.00 32.64  ?  239 PHE A H    1 
ATOM   3521 H  HA   . PHE A 1 239 ? 0.318   -29.938 1.299   1.00 32.52  ?  239 PHE A HA   1 
ATOM   3522 H  HB2  . PHE A 1 239 ? 2.717   -28.479 1.597   1.00 32.63  ?  239 PHE A HB2  1 
ATOM   3523 H  HB3  . PHE A 1 239 ? 2.680   -30.013 1.187   1.00 32.63  ?  239 PHE A HB3  1 
ATOM   3524 H  HD1  . PHE A 1 239 ? 2.085   -26.784 -0.021  1.00 38.63  ?  239 PHE A HD1  1 
ATOM   3525 H  HD2  . PHE A 1 239 ? 2.077   -30.643 -1.063  1.00 37.43  ?  239 PHE A HD2  1 
ATOM   3526 H  HE1  . PHE A 1 239 ? 1.907   -26.184 -2.238  1.00 36.32  ?  239 PHE A HE1  1 
ATOM   3527 H  HE2  . PHE A 1 239 ? 1.898   -30.045 -3.283  1.00 34.65  ?  239 PHE A HE2  1 
ATOM   3528 H  HZ   . PHE A 1 239 ? 1.814   -27.812 -3.873  1.00 34.26  ?  239 PHE A HZ   1 
ATOM   3529 N  N    . LEU A 1 240 ? 0.464   -31.073 3.426   1.00 29.43  ?  240 LEU A N    1 
ATOM   3530 C  CA   . LEU A 1 240 ? 0.487   -31.758 4.707   1.00 31.69  ?  240 LEU A CA   1 
ATOM   3531 C  C    . LEU A 1 240 ? 1.428   -32.949 4.600   1.00 25.98  ?  240 LEU A C    1 
ATOM   3532 O  O    . LEU A 1 240 ? 1.367   -33.704 3.624   1.00 28.62  ?  240 LEU A O    1 
ATOM   3533 C  CB   . LEU A 1 240 ? -0.924  -32.214 5.090   1.00 34.34  ?  240 LEU A CB   1 
ATOM   3534 C  CG   . LEU A 1 240 ? -1.106  -33.037 6.364   1.00 34.38  ?  240 LEU A CG   1 
ATOM   3535 C  CD1  . LEU A 1 240 ? -0.718  -32.236 7.593   1.00 35.22  ?  240 LEU A CD1  1 
ATOM   3536 C  CD2  . LEU A 1 240 ? -2.554  -33.498 6.446   1.00 39.59  ?  240 LEU A CD2  1 
ATOM   3537 H  H    . LEU A 1 240 ? 0.070   -31.525 2.810   1.00 35.40  ?  240 LEU A H    1 
ATOM   3538 H  HA   . LEU A 1 240 ? 0.819   -31.159 5.394   1.00 38.11  ?  240 LEU A HA   1 
ATOM   3539 H  HB2  . LEU A 1 240 ? -1.474  -31.421 5.187   1.00 41.29  ?  240 LEU A HB2  1 
ATOM   3540 H  HB3  . LEU A 1 240 ? -1.270  -32.749 4.359   1.00 41.29  ?  240 LEU A HB3  1 
ATOM   3541 H  HG   . LEU A 1 240 ? -0.539  -33.823 6.321   1.00 41.33  ?  240 LEU A HG   1 
ATOM   3542 H  HD11 . LEU A 1 240 ? -0.845  -32.787 8.381   1.00 42.34  ?  240 LEU A HD11 1 
ATOM   3543 H  HD12 . LEU A 1 240 ? 0.214   -31.976 7.518   1.00 42.34  ?  240 LEU A HD12 1 
ATOM   3544 H  HD13 . LEU A 1 240 ? -1.279  -31.447 7.646   1.00 42.34  ?  240 LEU A HD13 1 
ATOM   3545 H  HD21 . LEU A 1 240 ? -2.673  -34.021 7.254   1.00 47.59  ?  240 LEU A HD21 1 
ATOM   3546 H  HD22 . LEU A 1 240 ? -3.132  -32.719 6.467   1.00 47.59  ?  240 LEU A HD22 1 
ATOM   3547 H  HD23 . LEU A 1 240 ? -2.757  -34.040 5.668   1.00 47.59  ?  240 LEU A HD23 1 
ATOM   3548 N  N    . VAL A 1 241 ? 2.306   -33.103 5.588   1.00 23.96  ?  241 VAL A N    1 
ATOM   3549 C  CA   . VAL A 1 241 ? 3.275   -34.192 5.623   1.00 23.58  ?  241 VAL A CA   1 
ATOM   3550 C  C    . VAL A 1 241 ? 2.954   -35.078 6.818   1.00 25.40  ?  241 VAL A C    1 
ATOM   3551 O  O    . VAL A 1 241 ? 2.825   -34.585 7.943   1.00 28.21  ?  241 VAL A O    1 
ATOM   3552 C  CB   . VAL A 1 241 ? 4.723   -33.674 5.717   1.00 26.91  ?  241 VAL A CB   1 
ATOM   3553 C  CG1  . VAL A 1 241 ? 5.711   -34.844 5.680   1.00 30.44  ?  241 VAL A CG1  1 
ATOM   3554 C  CG2  . VAL A 1 241 ? 5.024   -32.687 4.598   1.00 27.97  ?  241 VAL A CG2  1 
ATOM   3555 H  H    . VAL A 1 241 ? 2.359   -32.575 6.265   1.00 28.84  ?  241 VAL A H    1 
ATOM   3556 H  HA   . VAL A 1 241 ? 3.191   -34.723 4.816   1.00 28.37  ?  241 VAL A HA   1 
ATOM   3557 H  HB   . VAL A 1 241 ? 4.838   -33.212 6.562   1.00 32.37  ?  241 VAL A HB   1 
ATOM   3558 H  HG11 . VAL A 1 241 ? 6.614   -34.495 5.740   1.00 36.61  ?  241 VAL A HG11 1 
ATOM   3559 H  HG12 . VAL A 1 241 ? 5.532   -35.431 6.431   1.00 36.61  ?  241 VAL A HG12 1 
ATOM   3560 H  HG13 . VAL A 1 241 ? 5.597   -35.327 4.846   1.00 36.61  ?  241 VAL A HG13 1 
ATOM   3561 H  HG21 . VAL A 1 241 ? 5.941   -32.381 4.686   1.00 33.65  ?  241 VAL A HG21 1 
ATOM   3562 H  HG22 . VAL A 1 241 ? 4.904   -33.132 3.744   1.00 33.65  ?  241 VAL A HG22 1 
ATOM   3563 H  HG23 . VAL A 1 241 ? 4.416   -31.935 4.668   1.00 33.65  ?  241 VAL A HG23 1 
ATOM   3564 N  N    . LEU A 1 242 ? 2.845   -36.382 6.576   1.00 26.98  ?  242 LEU A N    1 
ATOM   3565 C  CA   . LEU A 1 242 ? 2.678   -37.365 7.638   1.00 24.23  ?  242 LEU A CA   1 
ATOM   3566 C  C    . LEU A 1 242 ? 3.846   -38.335 7.607   1.00 26.58  ?  242 LEU A C    1 
ATOM   3567 O  O    . LEU A 1 242 ? 4.164   -38.896 6.554   1.00 29.16  ?  242 LEU A O    1 
ATOM   3568 C  CB   . LEU A 1 242 ? 1.367   -38.140 7.498   1.00 31.15  ?  242 LEU A CB   1 
ATOM   3569 C  CG   . LEU A 1 242 ? 1.180   -39.254 8.543   1.00 35.11  ?  242 LEU A CG   1 
ATOM   3570 C  CD1  . LEU A 1 242 ? 0.906   -38.668 9.928   1.00 29.51  ?  242 LEU A CD1  1 
ATOM   3571 C  CD2  . LEU A 1 242 ? 0.083   -40.206 8.122   1.00 35.85  ?  242 LEU A CD2  1 
ATOM   3572 H  H    . LEU A 1 242 ? 2.865   -36.727 5.788   1.00 32.46  ?  242 LEU A H    1 
ATOM   3573 H  HA   . LEU A 1 242 ? 2.677   -36.914 8.496   1.00 29.16  ?  242 LEU A HA   1 
ATOM   3574 H  HB2  . LEU A 1 242 ? 0.627   -37.520 7.592   1.00 37.47  ?  242 LEU A HB2  1 
ATOM   3575 H  HB3  . LEU A 1 242 ? 1.341   -38.552 6.620   1.00 37.47  ?  242 LEU A HB3  1 
ATOM   3576 H  HG   . LEU A 1 242 ? 2.003   -39.765 8.600   1.00 42.22  ?  242 LEU A HG   1 
ATOM   3577 H  HD11 . LEU A 1 242 ? 0.793   -39.394 10.561  1.00 35.49  ?  242 LEU A HD11 1 
ATOM   3578 H  HD12 . LEU A 1 242 ? 1.657   -38.113 10.190  1.00 35.49  ?  242 LEU A HD12 1 
ATOM   3579 H  HD13 . LEU A 1 242 ? 0.097   -38.133 9.889   1.00 35.49  ?  242 LEU A HD13 1 
ATOM   3580 H  HD21 . LEU A 1 242 ? -0.012  -40.896 8.797   1.00 43.10  ?  242 LEU A HD21 1 
ATOM   3581 H  HD22 . LEU A 1 242 ? -0.747  -39.712 8.034   1.00 43.10  ?  242 LEU A HD22 1 
ATOM   3582 H  HD23 . LEU A 1 242 ? 0.322   -40.606 7.271   1.00 43.10  ?  242 LEU A HD23 1 
ATOM   3583 N  N    . PHE A 1 243 ? 4.467   -38.537 8.766   1.00 24.99  ?  243 PHE A N    1 
ATOM   3584 C  CA   . PHE A 1 243 ? 5.504   -39.537 8.957   1.00 24.21  ?  243 PHE A CA   1 
ATOM   3585 C  C    . PHE A 1 243 ? 5.017   -40.558 9.973   1.00 27.09  ?  243 PHE A C    1 
ATOM   3586 O  O    . PHE A 1 243 ? 4.429   -40.194 10.995  1.00 26.34  ?  243 PHE A O    1 
ATOM   3587 C  CB   . PHE A 1 243 ? 6.810   -38.897 9.444   1.00 24.48  ?  243 PHE A CB   1 
ATOM   3588 C  CG   . PHE A 1 243 ? 7.854   -39.892 9.876   1.00 22.94  ?  243 PHE A CG   1 
ATOM   3589 C  CD1  . PHE A 1 243 ? 8.809   -40.350 8.983   1.00 22.92  ?  243 PHE A CD1  1 
ATOM   3590 C  CD2  . PHE A 1 243 ? 7.882   -40.365 11.177  1.00 26.86  ?  243 PHE A CD2  1 
ATOM   3591 C  CE1  . PHE A 1 243 ? 9.770   -41.266 9.383   1.00 24.02  ?  243 PHE A CE1  1 
ATOM   3592 C  CE2  . PHE A 1 243 ? 8.837   -41.283 11.580  1.00 29.26  ?  243 PHE A CE2  1 
ATOM   3593 C  CZ   . PHE A 1 243 ? 9.780   -41.733 10.682  1.00 26.01  ?  243 PHE A CZ   1 
ATOM   3594 H  H    . PHE A 1 243 ? 4.295   -38.088 9.479   1.00 30.07  ?  243 PHE A H    1 
ATOM   3595 H  HA   . PHE A 1 243 ? 5.676   -39.993 8.118   1.00 29.14  ?  243 PHE A HA   1 
ATOM   3596 H  HB2  . PHE A 1 243 ? 7.186   -38.367 8.723   1.00 29.46  ?  243 PHE A HB2  1 
ATOM   3597 H  HB3  . PHE A 1 243 ? 6.614   -38.326 10.203  1.00 29.46  ?  243 PHE A HB3  1 
ATOM   3598 H  HD1  . PHE A 1 243 ? 8.805   -40.041 8.106   1.00 27.59  ?  243 PHE A HD1  1 
ATOM   3599 H  HD2  . PHE A 1 243 ? 7.246   -40.067 11.787  1.00 32.32  ?  243 PHE A HD2  1 
ATOM   3600 H  HE1  . PHE A 1 243 ? 10.405  -41.569 8.775   1.00 28.91  ?  243 PHE A HE1  1 
ATOM   3601 H  HE2  . PHE A 1 243 ? 8.844   -41.594 12.457  1.00 35.20  ?  243 PHE A HE2  1 
ATOM   3602 H  HZ   . PHE A 1 243 ? 10.425  -42.347 10.951  1.00 31.29  ?  243 PHE A HZ   1 
ATOM   3603 N  N    . THR A 1 244 ? 5.257   -41.837 9.690   1.00 28.03  ?  244 THR A N    1 
ATOM   3604 C  CA   . THR A 1 244 ? 4.905   -42.906 10.613  1.00 29.01  ?  244 THR A CA   1 
ATOM   3605 C  C    . THR A 1 244 ? 5.988   -43.972 10.574  1.00 27.13  ?  244 THR A C    1 
ATOM   3606 O  O    . THR A 1 244 ? 6.711   -44.114 9.585   1.00 28.46  ?  244 THR A O    1 
ATOM   3607 C  CB   . THR A 1 244 ? 3.547   -43.544 10.274  1.00 30.95  ?  244 THR A CB   1 
ATOM   3608 O  OG1  . THR A 1 244 ? 3.645   -44.254 9.033   1.00 35.23  ?  244 THR A OG1  1 
ATOM   3609 C  CG2  . THR A 1 244 ? 2.460   -42.488 10.166  1.00 40.74  ?  244 THR A CG2  1 
ATOM   3610 H  H    . THR A 1 244 ? 5.625   -42.111 8.963   1.00 33.72  ?  244 THR A H    1 
ATOM   3611 H  HA   . THR A 1 244 ? 4.858   -42.550 11.515  1.00 34.90  ?  244 THR A HA   1 
ATOM   3612 H  HB   . THR A 1 244 ? 3.300   -44.164 10.978  1.00 37.22  ?  244 THR A HB   1 
ATOM   3613 H  HG1  . THR A 1 244 ? 2.905   -44.604 8.843   1.00 42.36  ?  244 THR A HG1  1 
ATOM   3614 H  HG21 . THR A 1 244 ? 1.611   -42.906 9.952   1.00 48.97  ?  244 THR A HG21 1 
ATOM   3615 H  HG22 . THR A 1 244 ? 2.374   -42.014 11.008  1.00 48.97  ?  244 THR A HG22 1 
ATOM   3616 H  HG23 . THR A 1 244 ? 2.683   -41.853 9.468   1.00 48.97  ?  244 THR A HG23 1 
ATOM   3617 N  N    . GLY A 1 245 ? 6.092   -44.724 11.662  1.00 24.66  ?  245 GLY A N    1 
ATOM   3618 C  CA   . GLY A 1 245 ? 7.026   -45.835 11.712  1.00 27.91  ?  245 GLY A CA   1 
ATOM   3619 C  C    . GLY A 1 245 ? 7.018   -46.480 13.080  1.00 24.89  ?  245 GLY A C    1 
ATOM   3620 O  O    . GLY A 1 245 ? 6.407   -45.980 14.030  1.00 27.21  ?  245 GLY A O    1 
ATOM   3621 H  H    . GLY A 1 245 ? 5.635   -44.611 12.381  1.00 29.67  ?  245 GLY A H    1 
ATOM   3622 H  HA2  . GLY A 1 245 ? 6.780   -46.501 11.050  1.00 33.57  ?  245 GLY A HA2  1 
ATOM   3623 H  HA3  . GLY A 1 245 ? 7.923   -45.520 11.520  1.00 33.57  ?  245 GLY A HA3  1 
ATOM   3624 N  N    . HIS A 1 246 ? 7.716   -47.611 13.162  1.00 24.89  ?  246 HIS A N    1 
ATOM   3625 C  CA   . HIS A 1 246 ? 7.823   -48.403 14.384  1.00 24.31  ?  246 HIS A CA   1 
ATOM   3626 C  C    . HIS A 1 246 ? 9.113   -48.010 15.095  1.00 27.11  ?  246 HIS A C    1 
ATOM   3627 O  O    . HIS A 1 246 ? 10.210  -48.333 14.627  1.00 25.48  ?  246 HIS A O    1 
ATOM   3628 C  CB   . HIS A 1 246 ? 7.805   -49.893 14.051  1.00 26.57  ?  246 HIS A CB   1 
ATOM   3629 C  CG   . HIS A 1 246 ? 7.844   -50.784 15.250  1.00 25.47  ?  246 HIS A CG   1 
ATOM   3630 N  ND1  . HIS A 1 246 ? 9.022   -51.169 15.855  1.00 32.49  ?  246 HIS A ND1  1 
ATOM   3631 C  CD2  . HIS A 1 246 ? 6.850   -51.378 15.949  1.00 23.73  ?  246 HIS A CD2  1 
ATOM   3632 C  CE1  . HIS A 1 246 ? 8.749   -51.956 16.880  1.00 29.95  ?  246 HIS A CE1  1 
ATOM   3633 N  NE2  . HIS A 1 246 ? 7.438   -52.099 16.959  1.00 29.87  ?  246 HIS A NE2  1 
ATOM   3634 H  H    . HIS A 1 246 ? 8.149   -47.950 12.500  1.00 29.95  ?  246 HIS A H    1 
ATOM   3635 H  HA   . HIS A 1 246 ? 7.074   -48.206 14.967  1.00 29.26  ?  246 HIS A HA   1 
ATOM   3636 H  HB2  . HIS A 1 246 ? 6.993   -50.093 13.560  1.00 31.97  ?  246 HIS A HB2  1 
ATOM   3637 H  HB3  . HIS A 1 246 ? 8.579   -50.099 13.503  1.00 31.97  ?  246 HIS A HB3  1 
ATOM   3638 H  HD2  . HIS A 1 246 ? 5.938   -51.308 15.779  1.00 28.56  ?  246 HIS A HD2  1 
ATOM   3639 H  HE1  . HIS A 1 246 ? 9.374   -52.344 17.449  1.00 36.03  ?  246 HIS A HE1  1 
ATOM   3640 H  HE2  . HIS A 1 246 ? 7.021   -52.567 17.547  1.00 35.93  ?  246 HIS A HE2  1 
ATOM   3641 N  N    . HIS A 1 247 ? 8.986   -47.316 16.224  1.00 26.92  ?  247 HIS A N    1 
ATOM   3642 C  CA   . HIS A 1 247 ? 10.151  -46.753 16.892  1.00 25.32  ?  247 HIS A CA   1 
ATOM   3643 C  C    . HIS A 1 247 ? 10.807  -47.803 17.785  1.00 28.55  ?  247 HIS A C    1 
ATOM   3644 O  O    . HIS A 1 247 ? 10.153  -48.391 18.655  1.00 31.64  ?  247 HIS A O    1 
ATOM   3645 C  CB   . HIS A 1 247 ? 9.757   -45.520 17.701  1.00 27.39  ?  247 HIS A CB   1 
ATOM   3646 C  CG   . HIS A 1 247 ? 10.902  -44.597 17.972  1.00 23.90  ?  247 HIS A CG   1 
ATOM   3647 N  ND1  . HIS A 1 247 ? 11.992  -44.971 18.725  1.00 27.44  ?  247 HIS A ND1  1 
ATOM   3648 C  CD2  . HIS A 1 247 ? 11.137  -43.324 17.574  1.00 26.62  ?  247 HIS A CD2  1 
ATOM   3649 C  CE1  . HIS A 1 247 ? 12.847  -43.966 18.787  1.00 30.29  ?  247 HIS A CE1  1 
ATOM   3650 N  NE2  . HIS A 1 247 ? 12.352  -42.955 18.097  1.00 26.74  ?  247 HIS A NE2  1 
ATOM   3651 H  H    . HIS A 1 247 ? 8.239   -47.160 16.620  1.00 32.39  ?  247 HIS A H    1 
ATOM   3652 H  HA   . HIS A 1 247 ? 10.799  -46.480 16.224  1.00 30.46  ?  247 HIS A HA   1 
ATOM   3653 H  HB2  . HIS A 1 247 ? 9.084   -45.024 17.209  1.00 32.95  ?  247 HIS A HB2  1 
ATOM   3654 H  HB3  . HIS A 1 247 ? 9.397   -45.806 18.555  1.00 32.95  ?  247 HIS A HB3  1 
ATOM   3655 H  HD2  . HIS A 1 247 ? 10.579  -42.798 17.048  1.00 32.03  ?  247 HIS A HD2  1 
ATOM   3656 H  HE1  . HIS A 1 247 ? 13.659  -43.970 19.241  1.00 36.43  ?  247 HIS A HE1  1 
ATOM   3657 H  HE2  . HIS A 1 247 ? 12.728  -42.188 17.993  1.00 32.16  ?  247 HIS A HE2  1 
ATOM   3658 N  N    . GLU A 1 248 ? 12.107  -48.026 17.573  1.00 29.40  ?  248 GLU A N    1 
ATOM   3659 C  CA   . GLU A 1 248 ? 12.841  -49.034 18.335  1.00 30.56  ?  248 GLU A CA   1 
ATOM   3660 C  C    . GLU A 1 248 ? 12.807  -48.759 19.831  1.00 26.91  ?  248 GLU A C    1 
ATOM   3661 O  O    . GLU A 1 248 ? 12.732  -49.693 20.638  1.00 33.19  ?  248 GLU A O    1 
ATOM   3662 C  CB   . GLU A 1 248 ? 14.293  -49.085 17.870  1.00 30.11  ?  248 GLU A CB   1 
ATOM   3663 C  CG   . GLU A 1 248 ? 14.508  -49.825 16.592  1.00 40.68  ?  248 GLU A CG   1 
ATOM   3664 C  CD   . GLU A 1 248 ? 15.955  -50.216 16.408  1.00 43.40  ?  248 GLU A CD   1 
ATOM   3665 O  OE1  . GLU A 1 248 ? 16.831  -49.523 16.971  1.00 42.24  ?  248 GLU A OE1  1 
ATOM   3666 O  OE2  . GLU A 1 248 ? 16.221  -51.211 15.701  1.00 41.21  ?  248 GLU A OE2  1 
ATOM   3667 H  H    . GLU A 1 248 ? 12.584  -47.606 16.993  1.00 35.37  ?  248 GLU A H    1 
ATOM   3668 H  HA   . GLU A 1 248 ? 12.443  -49.904 18.178  1.00 36.75  ?  248 GLU A HA   1 
ATOM   3669 H  HB2  . GLU A 1 248 ? 14.610  -48.177 17.740  1.00 36.22  ?  248 GLU A HB2  1 
ATOM   3670 H  HB3  . GLU A 1 248 ? 14.824  -49.520 18.555  1.00 36.22  ?  248 GLU A HB3  1 
ATOM   3671 H  HG2  . GLU A 1 248 ? 13.974  -50.635 16.599  1.00 48.90  ?  248 GLU A HG2  1 
ATOM   3672 H  HG3  . GLU A 1 248 ? 14.250  -49.260 15.848  1.00 48.90  ?  248 GLU A HG3  1 
ATOM   3673 N  N    . ALA A 1 249 ? 12.902  -47.488 20.223  1.00 31.96  ?  249 ALA A N    1 
ATOM   3674 C  CA   . ALA A 1 249 ? 12.996  -47.155 21.640  1.00 30.16  ?  249 ALA A CA   1 
ATOM   3675 C  C    . ALA A 1 249 ? 11.764  -47.604 22.412  1.00 30.16  ?  249 ALA A C    1 
ATOM   3676 O  O    . ALA A 1 249 ? 11.855  -47.888 23.612  1.00 29.45  ?  249 ALA A O    1 
ATOM   3677 C  CB   . ALA A 1 249 ? 13.209  -45.651 21.812  1.00 31.51  ?  249 ALA A CB   1 
ATOM   3678 H  H    . ALA A 1 249 ? 12.914  -46.809 19.695  1.00 38.43  ?  249 ALA A H    1 
ATOM   3679 H  HA   . ALA A 1 249 ? 13.765  -47.610 22.018  1.00 36.28  ?  249 ALA A HA   1 
ATOM   3680 H  HB1  . ALA A 1 249 ? 13.269  -45.446 22.758  1.00 37.90  ?  249 ALA A HB1  1 
ATOM   3681 H  HB2  . ALA A 1 249 ? 14.031  -45.395 21.365  1.00 37.90  ?  249 ALA A HB2  1 
ATOM   3682 H  HB3  . ALA A 1 249 ? 12.458  -45.179 21.418  1.00 37.90  ?  249 ALA A HB3  1 
ATOM   3683 N  N    . PHE A 1 250 ? 10.608  -47.678 21.748  1.00 27.63  ?  250 PHE A N    1 
ATOM   3684 C  CA   . PHE A 1 250 ? 9.349   -47.973 22.415  1.00 27.52  ?  250 PHE A CA   1 
ATOM   3685 C  C    . PHE A 1 250 ? 8.707   -49.285 21.986  1.00 31.97  ?  250 PHE A C    1 
ATOM   3686 O  O    . PHE A 1 250 ? 7.784   -49.749 22.667  1.00 30.67  ?  250 PHE A O    1 
ATOM   3687 C  CB   . PHE A 1 250 ? 8.341   -46.838 22.167  1.00 31.09  ?  250 PHE A CB   1 
ATOM   3688 C  CG   . PHE A 1 250 ? 8.881   -45.472 22.473  1.00 31.05  ?  250 PHE A CG   1 
ATOM   3689 C  CD1  . PHE A 1 250 ? 8.914   -45.004 23.775  1.00 31.65  ?  250 PHE A CD1  1 
ATOM   3690 C  CD2  . PHE A 1 250 ? 9.350   -44.655 21.459  1.00 27.38  ?  250 PHE A CD2  1 
ATOM   3691 C  CE1  . PHE A 1 250 ? 9.411   -43.745 24.062  1.00 33.05  ?  250 PHE A CE1  1 
ATOM   3692 C  CE2  . PHE A 1 250 ? 9.847   -43.395 21.738  1.00 30.66  ?  250 PHE A CE2  1 
ATOM   3693 C  CZ   . PHE A 1 250 ? 9.877   -42.939 23.045  1.00 29.56  ?  250 PHE A CZ   1 
ATOM   3694 H  H    . PHE A 1 250 ? 10.532  -47.559 20.900  1.00 33.23  ?  250 PHE A H    1 
ATOM   3695 H  HA   . PHE A 1 250 ? 9.509   -48.022 23.371  1.00 33.10  ?  250 PHE A HA   1 
ATOM   3696 H  HB2  . PHE A 1 250 ? 8.080   -46.851 21.233  1.00 37.39  ?  250 PHE A HB2  1 
ATOM   3697 H  HB3  . PHE A 1 250 ? 7.564   -46.982 22.728  1.00 37.39  ?  250 PHE A HB3  1 
ATOM   3698 H  HD1  . PHE A 1 250 ? 8.602   -45.543 24.465  1.00 38.06  ?  250 PHE A HD1  1 
ATOM   3699 H  HD2  . PHE A 1 250 ? 9.332   -44.957 20.579  1.00 32.94  ?  250 PHE A HD2  1 
ATOM   3700 H  HE1  . PHE A 1 250 ? 9.429   -43.442 24.941  1.00 39.74  ?  250 PHE A HE1  1 
ATOM   3701 H  HE2  . PHE A 1 250 ? 10.161  -42.854 21.049  1.00 36.87  ?  250 PHE A HE2  1 
ATOM   3702 H  HZ   . PHE A 1 250 ? 10.210  -42.093 23.236  1.00 35.56  ?  250 PHE A HZ   1 
ATOM   3703 N  N    . ALA A 1 251 ? 9.157   -49.897 20.893  1.00 30.81  ?  251 ALA A N    1 
ATOM   3704 C  CA   . ALA A 1 251 ? 8.449   -51.027 20.294  1.00 29.75  ?  251 ALA A CA   1 
ATOM   3705 C  C    . ALA A 1 251 ? 6.997   -50.651 20.014  1.00 30.12  ?  251 ALA A C    1 
ATOM   3706 O  O    . ALA A 1 251 ? 6.077   -51.455 20.181  1.00 33.53  ?  251 ALA A O    1 
ATOM   3707 C  CB   . ALA A 1 251 ? 8.531   -52.271 21.179  1.00 32.75  ?  251 ALA A CB   1 
ATOM   3708 H  H    . ALA A 1 251 ? 9.876   -49.675 20.475  1.00 37.06  ?  251 ALA A H    1 
ATOM   3709 H  HA   . ALA A 1 251 ? 8.867   -51.241 19.445  1.00 35.78  ?  251 ALA A HA   1 
ATOM   3710 H  HB1  . ALA A 1 251 ? 8.051   -52.996 20.750  1.00 39.38  ?  251 ALA A HB1  1 
ATOM   3711 H  HB2  . ALA A 1 251 ? 9.463   -52.514 21.296  1.00 39.38  ?  251 ALA A HB2  1 
ATOM   3712 H  HB3  . ALA A 1 251 ? 8.130   -52.072 22.040  1.00 39.38  ?  251 ALA A HB3  1 
ATOM   3713 N  N    . GLN A 1 252 ? 6.798   -49.405 19.588  1.00 30.21  ?  252 GLN A N    1 
ATOM   3714 C  CA   . GLN A 1 252 ? 5.481   -48.866 19.287  1.00 28.95  ?  252 GLN A CA   1 
ATOM   3715 C  C    . GLN A 1 252 ? 5.544   -48.045 18.013  1.00 24.38  ?  252 GLN A C    1 
ATOM   3716 O  O    . GLN A 1 252 ? 6.568   -47.432 17.701  1.00 27.79  ?  252 GLN A O    1 
ATOM   3717 C  CB   . GLN A 1 252 ? 4.955   -47.951 20.394  1.00 32.37  ?  252 GLN A CB   1 
ATOM   3718 C  CG   . GLN A 1 252 ? 4.468   -48.641 21.625  1.00 34.37  ?  252 GLN A CG   1 
ATOM   3719 C  CD   . GLN A 1 252 ? 3.859   -47.656 22.598  1.00 33.12  ?  252 GLN A CD   1 
ATOM   3720 O  OE1  . GLN A 1 252 ? 4.485   -47.268 23.581  1.00 33.53  ?  252 GLN A OE1  1 
ATOM   3721 N  NE2  . GLN A 1 252 ? 2.635   -47.230 22.314  1.00 33.91  ?  252 GLN A NE2  1 
ATOM   3722 H  H    . GLN A 1 252 ? 7.433   -48.839 19.462  1.00 36.34  ?  252 GLN A H    1 
ATOM   3723 H  HA   . GLN A 1 252 ? 4.852   -49.593 19.159  1.00 34.82  ?  252 GLN A HA   1 
ATOM   3724 H  HB2  . GLN A 1 252 ? 5.669   -47.351 20.661  1.00 38.92  ?  252 GLN A HB2  1 
ATOM   3725 H  HB3  . GLN A 1 252 ? 4.215   -47.434 20.039  1.00 38.92  ?  252 GLN A HB3  1 
ATOM   3726 H  HG2  . GLN A 1 252 ? 3.789   -49.289 21.382  1.00 41.33  ?  252 GLN A HG2  1 
ATOM   3727 H  HG3  . GLN A 1 252 ? 5.213   -49.081 22.062  1.00 41.33  ?  252 GLN A HG3  1 
ATOM   3728 H  HE21 . GLN A 1 252 ? 2.230   -47.521 21.614  1.00 40.78  ?  252 GLN A HE21 1 
ATOM   3729 H  HE22 . GLN A 1 252 ? 2.244   -46.668 22.834  1.00 40.78  ?  252 GLN A HE22 1 
ATOM   3730 N  N    . ASN A 1 253 ? 4.425   -48.009 17.301  1.00 28.54  ?  253 ASN A N    1 
ATOM   3731 C  CA   . ASN A 1 253 ? 4.296   -47.096 16.179  1.00 29.12  ?  253 ASN A CA   1 
ATOM   3732 C  C    . ASN A 1 253 ? 4.224   -45.660 16.681  1.00 37.12  ?  253 ASN A C    1 
ATOM   3733 O  O    . ASN A 1 253 ? 3.601   -45.368 17.706  1.00 32.39  ?  253 ASN A O    1 
ATOM   3734 C  CB   . ASN A 1 253 ? 3.058   -47.436 15.354  1.00 32.33  ?  253 ASN A CB   1 
ATOM   3735 C  CG   . ASN A 1 253 ? 3.211   -48.741 14.594  1.00 47.19  ?  253 ASN A CG   1 
ATOM   3736 O  OD1  . ASN A 1 253 ? 4.317   -49.117 14.205  1.00 44.24  ?  253 ASN A OD1  1 
ATOM   3737 N  ND2  . ASN A 1 253 ? 2.101   -49.440 14.381  1.00 48.11  ?  253 ASN A ND2  1 
ATOM   3738 H  H    . ASN A 1 253 ? 3.733   -48.499 17.446  1.00 34.33  ?  253 ASN A H    1 
ATOM   3739 H  HA   . ASN A 1 253 ? 5.075   -47.180 15.607  1.00 35.03  ?  253 ASN A HA   1 
ATOM   3740 H  HB2  . ASN A 1 253 ? 2.295   -47.521 15.947  1.00 38.88  ?  253 ASN A HB2  1 
ATOM   3741 H  HB3  . ASN A 1 253 ? 2.902   -46.729 14.709  1.00 38.88  ?  253 ASN A HB3  1 
ATOM   3742 H  HD21 . ASN A 1 253 ? 2.138   -50.186 13.955  1.00 57.82  ?  253 ASN A HD21 1 
ATOM   3743 H  HD22 . ASN A 1 253 ? 1.346   -49.145 14.668  1.00 57.82  ?  253 ASN A HD22 1 
ATOM   3744 N  N    . VAL A 1 254 ? 4.892   -44.764 15.960  1.00 27.98  ?  254 VAL A N    1 
ATOM   3745 C  CA   . VAL A 1 254 ? 4.859   -43.339 16.242  1.00 25.31  ?  254 VAL A CA   1 
ATOM   3746 C  C    . VAL A 1 254 ? 4.477   -42.627 14.954  1.00 27.07  ?  254 VAL A C    1 
ATOM   3747 O  O    . VAL A 1 254 ? 4.498   -43.206 13.868  1.00 27.01  ?  254 VAL A O    1 
ATOM   3748 C  CB   . VAL A 1 254 ? 6.203   -42.805 16.783  1.00 23.13  ?  254 VAL A CB   1 
ATOM   3749 C  CG1  . VAL A 1 254 ? 6.549   -43.476 18.100  1.00 28.97  ?  254 VAL A CG1  1 
ATOM   3750 C  CG2  . VAL A 1 254 ? 7.324   -43.017 15.768  1.00 26.22  ?  254 VAL A CG2  1 
ATOM   3751 H  H    . VAL A 1 254 ? 5.384   -44.966 15.284  1.00 33.66  ?  254 VAL A H    1 
ATOM   3752 H  HA   . VAL A 1 254 ? 4.173   -43.159 16.904  1.00 30.46  ?  254 VAL A HA   1 
ATOM   3753 H  HB   . VAL A 1 254 ? 6.122   -41.852 16.945  1.00 27.83  ?  254 VAL A HB   1 
ATOM   3754 H  HG11 . VAL A 1 254 ? 7.395   -43.126 18.420  1.00 34.85  ?  254 VAL A HG11 1 
ATOM   3755 H  HG12 . VAL A 1 254 ? 5.848   -43.287 18.743  1.00 34.85  ?  254 VAL A HG12 1 
ATOM   3756 H  HG13 . VAL A 1 254 ? 6.619   -44.433 17.958  1.00 34.85  ?  254 VAL A HG13 1 
ATOM   3757 H  HG21 . VAL A 1 254 ? 8.152   -42.672 16.137  1.00 31.55  ?  254 VAL A HG21 1 
ATOM   3758 H  HG22 . VAL A 1 254 ? 7.411   -43.966 15.588  1.00 31.55  ?  254 VAL A HG22 1 
ATOM   3759 H  HG23 . VAL A 1 254 ? 7.102   -42.543 14.951  1.00 31.55  ?  254 VAL A HG23 1 
ATOM   3760 N  N    . HIS A 1 255 ? 4.113   -41.357 15.091  1.00 26.12  ?  255 HIS A N    1 
ATOM   3761 C  CA   . HIS A 1 255 ? 3.751   -40.557 13.936  1.00 28.19  ?  255 HIS A CA   1 
ATOM   3762 C  C    . HIS A 1 255 ? 4.027   -39.095 14.241  1.00 25.79  ?  255 HIS A C    1 
ATOM   3763 O  O    . HIS A 1 255 ? 3.992   -38.665 15.397  1.00 24.08  ?  255 HIS A O    1 
ATOM   3764 C  CB   . HIS A 1 255 ? 2.278   -40.743 13.560  1.00 28.43  ?  255 HIS A CB   1 
ATOM   3765 C  CG   . HIS A 1 255 ? 1.332   -40.144 14.549  1.00 30.12  ?  255 HIS A CG   1 
ATOM   3766 N  ND1  . HIS A 1 255 ? 0.955   -40.792 15.704  1.00 29.25  ?  255 HIS A ND1  1 
ATOM   3767 C  CD2  . HIS A 1 255 ? 0.699   -38.947 14.565  1.00 24.28  ?  255 HIS A CD2  1 
ATOM   3768 C  CE1  . HIS A 1 255 ? 0.127   -40.023 16.387  1.00 31.01  ?  255 HIS A CE1  1 
ATOM   3769 N  NE2  . HIS A 1 255 ? -0.045  -38.899 15.716  1.00 30.91  ?  255 HIS A NE2  1 
ATOM   3770 H  H    . HIS A 1 255 ? 4.069   -40.939 15.841  1.00 31.42  ?  255 HIS A H    1 
ATOM   3771 H  HA   . HIS A 1 255 ? 4.296   -40.821 13.179  1.00 33.91  ?  255 HIS A HA   1 
ATOM   3772 H  HB2  . HIS A 1 255 ? 2.119   -40.320 12.701  1.00 34.20  ?  255 HIS A HB2  1 
ATOM   3773 H  HB3  . HIS A 1 255 ? 2.087   -41.692 13.501  1.00 34.20  ?  255 HIS A HB3  1 
ATOM   3774 H  HD2  . HIS A 1 255 ? 0.757   -38.284 13.916  1.00 29.22  ?  255 HIS A HD2  1 
ATOM   3775 H  HE1  . HIS A 1 255 ? -0.270  -40.239 17.200  1.00 37.29  ?  255 HIS A HE1  1 
ATOM   3776 H  HE2  . HIS A 1 255 ? -0.544  -38.243 15.961  1.00 37.17  ?  255 HIS A HE2  1 
ATOM   3777 N  N    . ALA A 1 256 ? 4.296   -38.335 13.184  1.00 24.92  ?  256 ALA A N    1 
ATOM   3778 C  CA   . ALA A 1 256 ? 4.507   -36.902 13.289  1.00 27.84  ?  256 ALA A CA   1 
ATOM   3779 C  C    . ALA A 1 256 ? 3.920   -36.246 12.053  1.00 22.87  ?  256 ALA A C    1 
ATOM   3780 O  O    . ALA A 1 256 ? 3.820   -36.871 10.993  1.00 25.07  ?  256 ALA A O    1 
ATOM   3781 C  CB   . ALA A 1 256 ? 5.996   -36.555 13.424  1.00 26.56  ?  256 ALA A CB   1 
ATOM   3782 H  H    . ALA A 1 256 ? 4.363   -38.636 12.381  1.00 29.99  ?  256 ALA A H    1 
ATOM   3783 H  HA   . ALA A 1 256 ? 4.040   -36.563 14.069  1.00 33.49  ?  256 ALA A HA   1 
ATOM   3784 H  HB1  . ALA A 1 256 ? 6.091   -35.592 13.491  1.00 31.95  ?  256 ALA A HB1  1 
ATOM   3785 H  HB2  . ALA A 1 256 ? 6.348   -36.978 14.223  1.00 31.95  ?  256 ALA A HB2  1 
ATOM   3786 H  HB3  . ALA A 1 256 ? 6.468   -36.880 12.642  1.00 31.95  ?  256 ALA A HB3  1 
ATOM   3787 N  N    . ARG A 1 257 ? 3.532   -34.981 12.194  1.00 27.34  ?  257 ARG A N    1 
ATOM   3788 C  CA   . ARG A 1 257 ? 2.919   -34.252 11.096  1.00 22.97  ?  257 ARG A CA   1 
ATOM   3789 C  C    . ARG A 1 257 ? 3.441   -32.824 11.058  1.00 30.34  ?  257 ARG A C    1 
ATOM   3790 O  O    . ARG A 1 257 ? 3.951   -32.291 12.048  1.00 24.75  ?  257 ARG A O    1 
ATOM   3791 C  CB   . ARG A 1 257 ? 1.392   -34.238 11.213  1.00 32.65  ?  257 ARG A CB   1 
ATOM   3792 C  CG   . ARG A 1 257 ? 0.904   -33.601 12.487  1.00 36.97  ?  257 ARG A CG   1 
ATOM   3793 C  CD   . ARG A 1 257 ? -0.595  -33.511 12.523  1.00 43.17  ?  257 ARG A CD   1 
ATOM   3794 N  NE   . ARG A 1 257 ? -1.054  -33.249 13.882  1.00 58.46  ?  257 ARG A NE   1 
ATOM   3795 C  CZ   . ARG A 1 257 ? -1.855  -34.039 14.586  1.00 59.89  ?  257 ARG A CZ   1 
ATOM   3796 N  NH1  . ARG A 1 257 ? -2.337  -35.154 14.060  1.00 52.43  ?  257 ARG A NH1  1 
ATOM   3797 N  NH2  . ARG A 1 257 ? -2.197  -33.697 15.821  1.00 64.92  ?  257 ARG A NH2  1 
ATOM   3798 H  H    . ARG A 1 257 ? 3.614   -34.524 12.917  1.00 32.89  ?  257 ARG A H    1 
ATOM   3799 H  HA   . ARG A 1 257 ? 3.154   -34.682 10.258  1.00 27.64  ?  257 ARG A HA   1 
ATOM   3800 H  HB2  . ARG A 1 257 ? 1.024   -33.738 10.468  1.00 39.27  ?  257 ARG A HB2  1 
ATOM   3801 H  HB3  . ARG A 1 257 ? 1.067   -35.152 11.192  1.00 39.27  ?  257 ARG A HB3  1 
ATOM   3802 H  HG2  . ARG A 1 257 ? 1.194   -34.135 13.243  1.00 44.44  ?  257 ARG A HG2  1 
ATOM   3803 H  HG3  . ARG A 1 257 ? 1.263   -32.702 12.553  1.00 44.44  ?  257 ARG A HG3  1 
ATOM   3804 H  HD2  . ARG A 1 257 ? -0.890  -32.784 11.953  1.00 51.89  ?  257 ARG A HD2  1 
ATOM   3805 H  HD3  . ARG A 1 257 ? -0.977  -34.352 12.226  1.00 51.89  ?  257 ARG A HD3  1 
ATOM   3806 H  HE   . ARG A 1 257 ? -0.783  -32.524 14.258  1.00 70.24  ?  257 ARG A HE   1 
ATOM   3807 H  HH11 . ARG A 1 257 ? -2.118  -35.381 13.259  1.00 63.00  ?  257 ARG A HH11 1 
ATOM   3808 H  HH12 . ARG A 1 257 ? -2.859  -35.657 14.522  1.00 63.00  ?  257 ARG A HH12 1 
ATOM   3809 H  HH21 . ARG A 1 257 ? -1.892  -32.970 16.165  1.00 77.99  ?  257 ARG A HH21 1 
ATOM   3810 H  HH22 . ARG A 1 257 ? -2.723  -34.201 16.277  1.00 77.99  ?  257 ARG A HH22 1 
ATOM   3811 N  N    . HIS A 1 258 ? 3.275   -32.209 9.892   1.00 27.76  ?  258 HIS A N    1 
ATOM   3812 C  CA   . HIS A 1 258 ? 3.718   -30.850 9.625   1.00 28.75  ?  258 HIS A CA   1 
ATOM   3813 C  C    . HIS A 1 258 ? 2.966   -30.376 8.392   1.00 26.72  ?  258 HIS A C    1 
ATOM   3814 O  O    . HIS A 1 258 ? 2.521   -31.192 7.582   1.00 31.28  ?  258 HIS A O    1 
ATOM   3815 C  CB   . HIS A 1 258 ? 5.234   -30.804 9.402   1.00 27.64  ?  258 HIS A CB   1 
ATOM   3816 C  CG   . HIS A 1 258 ? 5.828   -29.434 9.502   1.00 26.21  ?  258 HIS A CG   1 
ATOM   3817 N  ND1  . HIS A 1 258 ? 6.275   -28.903 10.693  1.00 31.25  ?  258 HIS A ND1  1 
ATOM   3818 C  CD2  . HIS A 1 258 ? 6.065   -28.494 8.558   1.00 27.64  ?  258 HIS A CD2  1 
ATOM   3819 C  CE1  . HIS A 1 258 ? 6.754   -27.691 10.478  1.00 30.66  ?  258 HIS A CE1  1 
ATOM   3820 N  NE2  . HIS A 1 258 ? 6.639   -27.419 9.191   1.00 32.53  ?  258 HIS A NE2  1 
ATOM   3821 H  H    . HIS A 1 258 ? 2.892   -32.576 9.215   1.00 33.39  ?  258 HIS A H    1 
ATOM   3822 H  HA   . HIS A 1 258 ? 3.492   -30.275 10.372  1.00 34.59  ?  258 HIS A HA   1 
ATOM   3823 H  HB2  . HIS A 1 258 ? 5.663   -31.362 10.070  1.00 33.25  ?  258 HIS A HB2  1 
ATOM   3824 H  HB3  . HIS A 1 258 ? 5.429   -31.146 8.516   1.00 33.25  ?  258 HIS A HB3  1 
ATOM   3825 H  HD2  . HIS A 1 258 ? 5.872   -28.562 7.650   1.00 33.25  ?  258 HIS A HD2  1 
ATOM   3826 H  HE1  . HIS A 1 258 ? 7.112   -27.125 11.124  1.00 36.87  ?  258 HIS A HE1  1 
ATOM   3827 H  HE2  . HIS A 1 258 ? 6.882   -26.687 8.811   1.00 39.12  ?  258 HIS A HE2  1 
ATOM   3828 N  N    . ALA A 1 259 ? 2.807   -29.061 8.259   1.00 27.11  ?  259 ALA A N    1 
ATOM   3829 C  CA   . ALA A 1 259 ? 2.137   -28.515 7.088   1.00 27.12  ?  259 ALA A CA   1 
ATOM   3830 C  C    . ALA A 1 259 ? 2.865   -27.273 6.598   1.00 25.89  ?  259 ALA A C    1 
ATOM   3831 O  O    . ALA A 1 259 ? 3.451   -26.522 7.382   1.00 28.94  ?  259 ALA A O    1 
ATOM   3832 C  CB   . ALA A 1 259 ? 0.670   -28.176 7.372   1.00 28.42  ?  259 ALA A CB   1 
ATOM   3833 H  H    . ALA A 1 259 ? 3.075   -28.473 8.826   1.00 32.61  ?  259 ALA A H    1 
ATOM   3834 H  HA   . ALA A 1 259 ? 2.159   -29.175 6.377   1.00 32.63  ?  259 ALA A HA   1 
ATOM   3835 H  HB1  . ALA A 1 259 ? 0.268   -27.817 6.565   1.00 34.19  ?  259 ALA A HB1  1 
ATOM   3836 H  HB2  . ALA A 1 259 ? 0.206   -28.983 7.642   1.00 34.19  ?  259 ALA A HB2  1 
ATOM   3837 H  HB3  . ALA A 1 259 ? 0.630   -27.517 8.083   1.00 34.19  ?  259 ALA A HB3  1 
ATOM   3838 N  N    . TYR A 1 260 ? 2.809   -27.067 5.285   1.00 27.89  ?  260 TYR A N    1 
ATOM   3839 C  CA   . TYR A 1 260 ? 3.418   -25.920 4.632   1.00 32.98  ?  260 TYR A CA   1 
ATOM   3840 C  C    . TYR A 1 260 ? 2.375   -25.168 3.818   1.00 31.57  ?  260 TYR A C    1 
ATOM   3841 O  O    . TYR A 1 260 ? 1.448   -25.765 3.260   1.00 29.79  ?  260 TYR A O    1 
ATOM   3842 C  CB   . TYR A 1 260 ? 4.559   -26.340 3.698   1.00 28.24  ?  260 TYR A CB   1 
ATOM   3843 C  CG   . TYR A 1 260 ? 5.627   -27.191 4.343   1.00 25.12  ?  260 TYR A CG   1 
ATOM   3844 C  CD1  . TYR A 1 260 ? 5.501   -28.572 4.398   1.00 22.45  ?  260 TYR A CD1  1 
ATOM   3845 C  CD2  . TYR A 1 260 ? 6.773   -26.616 4.877   1.00 24.81  ?  260 TYR A CD2  1 
ATOM   3846 C  CE1  . TYR A 1 260 ? 6.481   -29.356 4.975   1.00 23.41  ?  260 TYR A CE1  1 
ATOM   3847 C  CE2  . TYR A 1 260 ? 7.761   -27.393 5.455   1.00 25.67  ?  260 TYR A CE2  1 
ATOM   3848 C  CZ   . TYR A 1 260 ? 7.609   -28.764 5.503   1.00 28.35  ?  260 TYR A CZ   1 
ATOM   3849 O  OH   . TYR A 1 260 ? 8.587   -29.546 6.078   1.00 28.34  ?  260 TYR A OH   1 
ATOM   3850 H  H    . TYR A 1 260 ? 2.411   -27.596 4.737   1.00 33.54  ?  260 TYR A H    1 
ATOM   3851 H  HA   . TYR A 1 260 ? 3.776   -25.318 5.304   1.00 39.66  ?  260 TYR A HA   1 
ATOM   3852 H  HB2  . TYR A 1 260 ? 4.185   -26.849 2.962   1.00 33.97  ?  260 TYR A HB2  1 
ATOM   3853 H  HB3  . TYR A 1 260 ? 4.989   -25.541 3.356   1.00 33.97  ?  260 TYR A HB3  1 
ATOM   3854 H  HD1  . TYR A 1 260 ? 4.743   -28.976 4.043   1.00 27.02  ?  260 TYR A HD1  1 
ATOM   3855 H  HD2  . TYR A 1 260 ? 6.878   -25.692 4.845   1.00 29.85  ?  260 TYR A HD2  1 
ATOM   3856 H  HE1  . TYR A 1 260 ? 6.381   -30.280 5.008   1.00 28.18  ?  260 TYR A HE1  1 
ATOM   3857 H  HE2  . TYR A 1 260 ? 8.522   -26.994 5.812   1.00 30.89  ?  260 TYR A HE2  1 
ATOM   3858 H  HH   . TYR A 1 260 ? 9.214   -29.062 6.358   1.00 34.09  ?  260 TYR A HH   1 
ATOM   3859 N  N    . SER A 1 261 ? 2.547   -23.852 3.743   1.00 29.45  ?  261 SER A N    1 
ATOM   3860 C  CA   . SER A 1 261 ? 1.763   -23.001 2.865   1.00 30.84  ?  261 SER A CA   1 
ATOM   3861 C  C    . SER A 1 261 ? 2.580   -22.655 1.622   1.00 34.48  ?  261 SER A C    1 
ATOM   3862 O  O    . SER A 1 261 ? 3.760   -22.995 1.505   1.00 31.94  ?  261 SER A O    1 
ATOM   3863 C  CB   . SER A 1 261 ? 1.327   -21.730 3.596   1.00 37.37  ?  261 SER A CB   1 
ATOM   3864 O  OG   . SER A 1 261 ? 2.448   -20.914 3.900   1.00 39.37  ?  261 SER A OG   1 
ATOM   3865 H  H    . SER A 1 261 ? 3.129   -23.420 4.206   1.00 35.42  ?  261 SER A H    1 
ATOM   3866 H  HA   . SER A 1 261 ? 0.967   -23.478 2.583   1.00 37.09  ?  261 SER A HA   1 
ATOM   3867 H  HB2  . SER A 1 261 ? 0.719   -21.232 3.028   1.00 44.93  ?  261 SER A HB2  1 
ATOM   3868 H  HB3  . SER A 1 261 ? 0.883   -21.977 4.422   1.00 44.93  ?  261 SER A HB3  1 
ATOM   3869 H  HG   . SER A 1 261 ? 2.198   -20.220 4.301   1.00 47.32  ?  261 SER A HG   1 
ATOM   3870 N  N    . CYS A 1 262 ? 1.938   -21.957 0.681   1.00 33.95  ?  262 CYS A N    1 
ATOM   3871 C  CA   . CYS A 1 262 ? 2.633   -21.523 -0.527  1.00 34.15  ?  262 CYS A CA   1 
ATOM   3872 C  C    . CYS A 1 262 ? 3.783   -20.577 -0.205  1.00 33.39  ?  262 CYS A C    1 
ATOM   3873 O  O    . CYS A 1 262 ? 4.766   -20.521 -0.953  1.00 41.61  ?  262 CYS A O    1 
ATOM   3874 C  CB   . CYS A 1 262 ? 1.651   -20.848 -1.486  1.00 37.96  ?  262 CYS A CB   1 
ATOM   3875 S  SG   . CYS A 1 262 ? 0.531   -21.990 -2.302  1.00 40.00  ?  262 CYS A SG   1 
ATOM   3876 H  H    . CYS A 1 262 ? 1.110   -21.727 0.719   1.00 40.83  ?  262 CYS A H    1 
ATOM   3877 H  HA   . CYS A 1 262 ? 3.002   -22.300 -0.975  1.00 41.07  ?  262 CYS A HA   1 
ATOM   3878 H  HB2  . CYS A 1 262 ? 1.115   -20.213 -0.987  1.00 45.64  ?  262 CYS A HB2  1 
ATOM   3879 H  HB3  . CYS A 1 262 ? 2.155   -20.385 -2.173  1.00 45.64  ?  262 CYS A HB3  1 
ATOM   3880 H  HG   . CYS A 1 262 ? -0.115  -22.565 -1.470  1.00 48.08  ?  262 CYS A HG   1 
ATOM   3881 N  N    . ASP A 1 263 ? 3.677   -19.822 0.891   1.00 37.11  ?  263 ASP A N    1 
ATOM   3882 C  CA   . ASP A 1 263 ? 4.753   -18.929 1.303   1.00 42.24  ?  263 ASP A CA   1 
ATOM   3883 C  C    . ASP A 1 263 ? 6.012   -19.673 1.720   1.00 39.66  ?  263 ASP A C    1 
ATOM   3884 O  O    . ASP A 1 263 ? 7.073   -19.049 1.831   1.00 36.68  ?  263 ASP A O    1 
ATOM   3885 C  CB   . ASP A 1 263 ? 4.292   -18.047 2.466   1.00 41.24  ?  263 ASP A CB   1 
ATOM   3886 C  CG   . ASP A 1 263 ? 3.282   -17.003 2.044   1.00 48.24  ?  263 ASP A CG   1 
ATOM   3887 O  OD1  . ASP A 1 263 ? 3.279   -16.626 0.854   1.00 50.11  ?  263 ASP A OD1  1 
ATOM   3888 O  OD2  . ASP A 1 263 ? 2.497   -16.556 2.906   1.00 54.16  ?  263 ASP A OD2  1 
ATOM   3889 H  H    . ASP A 1 263 ? 2.992   -19.811 1.410   1.00 44.62  ?  263 ASP A H    1 
ATOM   3890 H  HA   . ASP A 1 263 ? 4.982   -18.348 0.560   1.00 50.76  ?  263 ASP A HA   1 
ATOM   3891 H  HB2  . ASP A 1 263 ? 3.880   -18.607 3.143   1.00 49.57  ?  263 ASP A HB2  1 
ATOM   3892 H  HB3  . ASP A 1 263 ? 5.061   -17.588 2.839   1.00 49.57  ?  263 ASP A HB3  1 
ATOM   3893 N  N    . GLU A 1 264 ? 5.922   -20.981 1.952   1.00 35.60  ?  264 GLU A N    1 
ATOM   3894 C  CA   . GLU A 1 264 ? 7.016   -21.754 2.520   1.00 34.27  ?  264 GLU A CA   1 
ATOM   3895 C  C    . GLU A 1 264 ? 7.616   -22.725 1.508   1.00 28.74  ?  264 GLU A C    1 
ATOM   3896 O  O    . GLU A 1 264 ? 8.318   -23.667 1.889   1.00 29.48  ?  264 GLU A O    1 
ATOM   3897 C  CB   . GLU A 1 264 ? 6.517   -22.469 3.776   1.00 32.06  ?  264 GLU A CB   1 
ATOM   3898 C  CG   . GLU A 1 264 ? 6.056   -21.469 4.838   1.00 37.56  ?  264 GLU A CG   1 
ATOM   3899 C  CD   . GLU A 1 264 ? 5.155   -22.061 5.898   1.00 38.80  ?  264 GLU A CD   1 
ATOM   3900 O  OE1  . GLU A 1 264 ? 4.567   -23.139 5.671   1.00 41.10  ?  264 GLU A OE1  1 
ATOM   3901 O  OE2  . GLU A 1 264 ? 5.027   -21.431 6.965   1.00 47.86  ?  264 GLU A OE2  1 
ATOM   3902 H  H    . GLU A 1 264 ? 5.221   -21.451 1.783   1.00 42.80  ?  264 GLU A H    1 
ATOM   3903 H  HA   . GLU A 1 264 ? 7.719   -21.142 2.790   1.00 41.20  ?  264 GLU A HA   1 
ATOM   3904 H  HB2  . GLU A 1 264 ? 5.765   -23.036 3.544   1.00 38.55  ?  264 GLU A HB2  1 
ATOM   3905 H  HB3  . GLU A 1 264 ? 7.237   -23.001 4.150   1.00 38.55  ?  264 GLU A HB3  1 
ATOM   3906 H  HG2  . GLU A 1 264 ? 6.837   -21.107 5.284   1.00 45.15  ?  264 GLU A HG2  1 
ATOM   3907 H  HG3  . GLU A 1 264 ? 5.567   -20.754 4.401   1.00 45.15  ?  264 GLU A HG3  1 
ATOM   3908 N  N    . ILE A 1 265 ? 7.359   -22.499 0.222   1.00 28.08  ?  265 ILE A N    1 
ATOM   3909 C  CA   . ILE A 1 265 ? 7.986   -23.234 -0.869  1.00 29.05  ?  265 ILE A CA   1 
ATOM   3910 C  C    . ILE A 1 265 ? 9.008   -22.315 -1.522  1.00 32.61  ?  265 ILE A C    1 
ATOM   3911 O  O    . ILE A 1 265 ? 8.669   -21.201 -1.939  1.00 31.68  ?  265 ILE A O    1 
ATOM   3912 C  CB   . ILE A 1 265 ? 6.947   -23.715 -1.896  1.00 30.17  ?  265 ILE A CB   1 
ATOM   3913 C  CG1  . ILE A 1 265 ? 5.894   -24.587 -1.212  1.00 31.13  ?  265 ILE A CG1  1 
ATOM   3914 C  CG2  . ILE A 1 265 ? 7.630   -24.483 -3.031  1.00 30.75  ?  265 ILE A CG2  1 
ATOM   3915 C  CD1  . ILE A 1 265 ? 4.707   -24.915 -2.081  1.00 32.40  ?  265 ILE A CD1  1 
ATOM   3916 H  H    . ILE A 1 265 ? 6.803   -21.902 -0.051  1.00 33.78  ?  265 ILE A H    1 
ATOM   3917 H  HA   . ILE A 1 265 ? 8.450   -24.008 -0.514  1.00 34.95  ?  265 ILE A HA   1 
ATOM   3918 H  HB   . ILE A 1 265 ? 6.505   -22.939 -2.273  1.00 36.29  ?  265 ILE A HB   1 
ATOM   3919 H  HG12 . ILE A 1 265 ? 6.306   -25.425 -0.947  1.00 37.43  ?  265 ILE A HG12 1 
ATOM   3920 H  HG13 . ILE A 1 265 ? 5.565   -24.121 -0.427  1.00 37.43  ?  265 ILE A HG13 1 
ATOM   3921 H  HG21 . ILE A 1 265 ? 6.956   -24.775 -3.664  1.00 36.99  ?  265 ILE A HG21 1 
ATOM   3922 H  HG22 . ILE A 1 265 ? 8.265   -23.897 -3.471  1.00 36.99  ?  265 ILE A HG22 1 
ATOM   3923 H  HG23 . ILE A 1 265 ? 8.091   -25.252 -2.660  1.00 36.99  ?  265 ILE A HG23 1 
ATOM   3924 H  HD11 . ILE A 1 265 ? 4.090   -25.467 -1.576  1.00 38.96  ?  265 ILE A HD11 1 
ATOM   3925 H  HD12 . ILE A 1 265 ? 4.273   -24.089 -2.345  1.00 38.96  ?  265 ILE A HD12 1 
ATOM   3926 H  HD13 . ILE A 1 265 ? 5.015   -25.394 -2.866  1.00 38.96  ?  265 ILE A HD13 1 
ATOM   3927 N  N    . ILE A 1 266 ? 10.251  -22.778 -1.610  1.00 32.40  ?  266 ILE A N    1 
ATOM   3928 C  CA   . ILE A 1 266 ? 11.331  -22.020 -2.233  1.00 34.44  ?  266 ILE A CA   1 
ATOM   3929 C  C    . ILE A 1 266 ? 11.509  -22.574 -3.641  1.00 33.70  ?  266 ILE A C    1 
ATOM   3930 O  O    . ILE A 1 266 ? 12.107  -23.637 -3.837  1.00 28.43  ?  266 ILE A O    1 
ATOM   3931 C  CB   . ILE A 1 266 ? 12.627  -22.103 -1.424  1.00 32.61  ?  266 ILE A CB   1 
ATOM   3932 C  CG1  . ILE A 1 266 ? 12.381  -21.732 0.044   1.00 33.84  ?  266 ILE A CG1  1 
ATOM   3933 C  CG2  . ILE A 1 266 ? 13.696  -21.199 -2.037  1.00 32.81  ?  266 ILE A CG2  1 
ATOM   3934 C  CD1  . ILE A 1 266 ? 11.772  -20.359 0.256   1.00 34.74  ?  266 ILE A CD1  1 
ATOM   3935 H  H    . ILE A 1 266 ? 10.498  -23.545 -1.311  1.00 38.96  ?  266 ILE A H    1 
ATOM   3936 H  HA   . ILE A 1 266 ? 11.072  -21.087 -2.301  1.00 41.41  ?  266 ILE A HA   1 
ATOM   3937 H  HB   . ILE A 1 266 ? 12.948  -23.018 -1.457  1.00 39.22  ?  266 ILE A HB   1 
ATOM   3938 H  HG12 . ILE A 1 266 ? 11.776  -22.385 0.430   1.00 40.70  ?  266 ILE A HG12 1 
ATOM   3939 H  HG13 . ILE A 1 266 ? 13.228  -21.754 0.515   1.00 40.70  ?  266 ILE A HG13 1 
ATOM   3940 H  HG21 . ILE A 1 266 ? 14.507  -21.268 -1.509  1.00 39.46  ?  266 ILE A HG21 1 
ATOM   3941 H  HG22 . ILE A 1 266 ? 13.867  -21.487 -2.947  1.00 39.46  ?  266 ILE A HG22 1 
ATOM   3942 H  HG23 . ILE A 1 266 ? 13.374  -20.284 -2.033  1.00 39.46  ?  266 ILE A HG23 1 
ATOM   3943 H  HD11 . ILE A 1 266 ? 11.652  -20.211 1.207   1.00 41.77  ?  266 ILE A HD11 1 
ATOM   3944 H  HD12 . ILE A 1 266 ? 12.369  -19.689 -0.110  1.00 41.77  ?  266 ILE A HD12 1 
ATOM   3945 H  HD13 . ILE A 1 266 ? 10.914  -20.321 -0.196  1.00 41.77  ?  266 ILE A HD13 1 
ATOM   3946 N  N    . TRP A 1 267 ? 10.981  -21.855 -4.628  1.00 30.81  ?  267 TRP A N    1 
ATOM   3947 C  CA   . TRP A 1 267 ? 11.107  -22.271 -6.018  1.00 31.13  ?  267 TRP A CA   1 
ATOM   3948 C  C    . TRP A 1 267 ? 12.544  -22.070 -6.478  1.00 35.56  ?  267 TRP A C    1 
ATOM   3949 O  O    . TRP A 1 267 ? 13.084  -20.963 -6.385  1.00 30.78  ?  267 TRP A O    1 
ATOM   3950 C  CB   . TRP A 1 267 ? 10.141  -21.478 -6.893  1.00 30.56  ?  267 TRP A CB   1 
ATOM   3951 C  CG   . TRP A 1 267 ? 8.700   -21.761 -6.595  1.00 27.37  ?  267 TRP A CG   1 
ATOM   3952 C  CD1  . TRP A 1 267 ? 7.989   -21.334 -5.512  1.00 33.58  ?  267 TRP A CD1  1 
ATOM   3953 C  CD2  . TRP A 1 267 ? 7.793   -22.531 -7.392  1.00 30.47  ?  267 TRP A CD2  1 
ATOM   3954 N  NE1  . TRP A 1 267 ? 6.697   -21.793 -5.584  1.00 27.78  ?  267 TRP A NE1  1 
ATOM   3955 C  CE2  . TRP A 1 267 ? 6.550   -22.529 -6.729  1.00 31.20  ?  267 TRP A CE2  1 
ATOM   3956 C  CE3  . TRP A 1 267 ? 7.911   -23.221 -8.601  1.00 32.49  ?  267 TRP A CE3  1 
ATOM   3957 C  CZ2  . TRP A 1 267 ? 5.433   -23.191 -7.233  1.00 32.91  ?  267 TRP A CZ2  1 
ATOM   3958 C  CZ3  . TRP A 1 267 ? 6.800   -23.879 -9.102  1.00 32.24  ?  267 TRP A CZ3  1 
ATOM   3959 C  CH2  . TRP A 1 267 ? 5.577   -23.857 -8.419  1.00 33.76  ?  267 TRP A CH2  1 
ATOM   3960 H  H    . TRP A 1 267 ? 10.546  -21.122 -4.517  1.00 37.05  ?  267 TRP A H    1 
ATOM   3961 H  HA   . TRP A 1 267 ? 10.888  -23.213 -6.095  1.00 37.44  ?  267 TRP A HA   1 
ATOM   3962 H  HB2  . TRP A 1 267 ? 10.294  -20.531 -6.752  1.00 36.75  ?  267 TRP A HB2  1 
ATOM   3963 H  HB3  . TRP A 1 267 ? 10.302  -21.704 -7.823  1.00 36.75  ?  267 TRP A HB3  1 
ATOM   3964 H  HD1  . TRP A 1 267 ? 8.331   -20.811 -4.824  1.00 40.38  ?  267 TRP A HD1  1 
ATOM   3965 H  HE1  . TRP A 1 267 ? 6.080   -21.641 -5.005  1.00 33.41  ?  267 TRP A HE1  1 
ATOM   3966 H  HE3  . TRP A 1 267 ? 8.720   -23.239 -9.060  1.00 39.07  ?  267 TRP A HE3  1 
ATOM   3967 H  HZ2  . TRP A 1 267 ? 4.620   -23.179 -6.782  1.00 39.58  ?  267 TRP A HZ2  1 
ATOM   3968 H  HZ3  . TRP A 1 267 ? 6.866   -24.341 -9.906  1.00 38.77  ?  267 TRP A HZ3  1 
ATOM   3969 H  HH2  . TRP A 1 267 ? 4.847   -24.308 -8.778  1.00 40.60  ?  267 TRP A HH2  1 
ATOM   3970 N  N    . GLY A 1 268 ? 13.161  -23.141 -6.974  1.00 31.38  ?  268 GLY A N    1 
ATOM   3971 C  CA   . GLY A 1 268 ? 14.570  -23.134 -7.304  1.00 34.97  ?  268 GLY A CA   1 
ATOM   3972 C  C    . GLY A 1 268 ? 15.487  -23.457 -6.145  1.00 35.26  ?  268 GLY A C    1 
ATOM   3973 O  O    . GLY A 1 268 ? 16.709  -23.493 -6.335  1.00 34.48  ?  268 GLY A O    1 
ATOM   3974 H  H    . GLY A 1 268 ? 12.773  -23.892 -7.129  1.00 37.74  ?  268 GLY A H    1 
ATOM   3975 H  HA2  . GLY A 1 268 ? 14.733  -23.782 -8.006  1.00 42.04  ?  268 GLY A HA2  1 
ATOM   3976 H  HA3  . GLY A 1 268 ? 14.810  -22.257 -7.642  1.00 42.04  ?  268 GLY A HA3  1 
ATOM   3977 N  N    . GLY A 1 269 ? 14.944  -23.699 -4.956  1.00 30.50  ?  269 GLY A N    1 
ATOM   3978 C  CA   . GLY A 1 269 ? 15.784  -23.949 -3.806  1.00 29.96  ?  269 GLY A CA   1 
ATOM   3979 C  C    . GLY A 1 269 ? 16.404  -25.333 -3.838  1.00 30.91  ?  269 GLY A C    1 
ATOM   3980 O  O    . GLY A 1 269 ? 15.848  -26.284 -4.389  1.00 29.20  ?  269 GLY A O    1 
ATOM   3981 H  H    . GLY A 1 269 ? 14.100  -23.723 -4.796  1.00 36.68  ?  269 GLY A H    1 
ATOM   3982 H  HA2  . GLY A 1 269 ? 16.498  -23.293 -3.778  1.00 36.04  ?  269 GLY A HA2  1 
ATOM   3983 H  HA3  . GLY A 1 269 ? 15.257  -23.866 -2.996  1.00 36.04  ?  269 GLY A HA3  1 
ATOM   3984 N  N    . HIS A 1 270 ? 17.591  -25.431 -3.243  1.00 32.95  ?  270 HIS A N    1 
ATOM   3985 C  CA   . HIS A 1 270 ? 18.302  -26.693 -3.076  1.00 33.35  ?  270 HIS A CA   1 
ATOM   3986 C  C    . HIS A 1 270 ? 18.699  -26.811 -1.615  1.00 30.01  ?  270 HIS A C    1 
ATOM   3987 O  O    . HIS A 1 270 ? 19.387  -25.931 -1.088  1.00 33.99  ?  270 HIS A O    1 
ATOM   3988 C  CB   . HIS A 1 270 ? 19.548  -26.763 -3.967  1.00 32.53  ?  270 HIS A CB   1 
ATOM   3989 C  CG   . HIS A 1 270 ? 19.269  -26.546 -5.420  1.00 28.70  ?  270 HIS A CG   1 
ATOM   3990 N  ND1  . HIS A 1 270 ? 19.145  -27.584 -6.318  1.00 37.78  ?  270 HIS A ND1  1 
ATOM   3991 C  CD2  . HIS A 1 270 ? 19.095  -25.409 -6.134  1.00 33.60  ?  270 HIS A CD2  1 
ATOM   3992 C  CE1  . HIS A 1 270 ? 18.904  -27.097 -7.522  1.00 35.16  ?  270 HIS A CE1  1 
ATOM   3993 N  NE2  . HIS A 1 270 ? 18.868  -25.779 -7.437  1.00 40.29  ?  270 HIS A NE2  1 
ATOM   3994 H  H    . HIS A 1 270 ? 18.017  -24.758 -2.919  1.00 39.62  ?  270 HIS A H    1 
ATOM   3995 H  HA   . HIS A 1 270 ? 17.715  -27.433 -3.301  1.00 40.10  ?  270 HIS A HA   1 
ATOM   3996 H  HB2  . HIS A 1 270 ? 20.174  -26.080 -3.680  1.00 39.12  ?  270 HIS A HB2  1 
ATOM   3997 H  HB3  . HIS A 1 270 ? 19.951  -27.640 -3.870  1.00 39.12  ?  270 HIS A HB3  1 
ATOM   3998 H  HD2  . HIS A 1 270 ? 19.122  -24.540 -5.803  1.00 40.41  ?  270 HIS A HD2  1 
ATOM   3999 H  HE1  . HIS A 1 270 ? 18.780  -27.596 -8.296  1.00 42.28  ?  270 HIS A HE1  1 
ATOM   4000 H  HE2  . HIS A 1 270 ? 18.727  -25.240 -8.092  1.00 48.43  ?  270 HIS A HE2  1 
ATOM   4001 N  N    . PHE A 1 271 ? 18.274  -27.888 -0.962  1.00 31.64  ?  271 PHE A N    1 
ATOM   4002 C  CA   . PHE A 1 271 ? 18.693  -28.113 0.414   1.00 26.03  ?  271 PHE A CA   1 
ATOM   4003 C  C    . PHE A 1 271 ? 20.206  -28.290 0.476   1.00 31.16  ?  271 PHE A C    1 
ATOM   4004 O  O    . PHE A 1 271 ? 20.814  -28.922 -0.392  1.00 32.35  ?  271 PHE A O    1 
ATOM   4005 C  CB   . PHE A 1 271 ? 18.000  -29.346 0.997   1.00 27.77  ?  271 PHE A CB   1 
ATOM   4006 C  CG   . PHE A 1 271 ? 16.573  -29.113 1.404   1.00 26.90  ?  271 PHE A CG   1 
ATOM   4007 C  CD1  . PHE A 1 271 ? 16.271  -28.302 2.485   1.00 27.22  ?  271 PHE A CD1  1 
ATOM   4008 C  CD2  . PHE A 1 271 ? 15.534  -29.723 0.718   1.00 28.67  ?  271 PHE A CD2  1 
ATOM   4009 C  CE1  . PHE A 1 271 ? 14.957  -28.091 2.864   1.00 27.76  ?  271 PHE A CE1  1 
ATOM   4010 C  CE2  . PHE A 1 271 ? 14.220  -29.516 1.094   1.00 28.67  ?  271 PHE A CE2  1 
ATOM   4011 C  CZ   . PHE A 1 271 ? 13.932  -28.699 2.167   1.00 23.12  ?  271 PHE A CZ   1 
ATOM   4012 H  H    . PHE A 1 271 ? 17.753  -28.491 -1.285  1.00 38.05  ?  271 PHE A H    1 
ATOM   4013 H  HA   . PHE A 1 271 ? 18.452  -27.344 0.953   1.00 31.31  ?  271 PHE A HA   1 
ATOM   4014 H  HB2  . PHE A 1 271 ? 18.006  -30.051 0.331   1.00 33.40  ?  271 PHE A HB2  1 
ATOM   4015 H  HB3  . PHE A 1 271 ? 18.489  -29.634 1.784   1.00 33.40  ?  271 PHE A HB3  1 
ATOM   4016 H  HD1  . PHE A 1 271 ? 16.958  -27.888 2.955   1.00 32.75  ?  271 PHE A HD1  1 
ATOM   4017 H  HD2  . PHE A 1 271 ? 15.723  -30.273 -0.007  1.00 34.48  ?  271 PHE A HD2  1 
ATOM   4018 H  HE1  . PHE A 1 271 ? 14.764  -27.540 3.588   1.00 33.39  ?  271 PHE A HE1  1 
ATOM   4019 H  HE2  . PHE A 1 271 ? 13.531  -29.926 0.624   1.00 34.49  ?  271 PHE A HE2  1 
ATOM   4020 H  HZ   . PHE A 1 271 ? 13.048  -28.559 2.421   1.00 27.83  ?  271 PHE A HZ   1 
ATOM   4021 N  N    . VAL A 1 272 ? 20.810  -27.726 1.509   1.00 30.86  ?  272 VAL A N    1 
ATOM   4022 C  CA   . VAL A 1 272 ? 22.232  -27.913 1.763   1.00 33.17  ?  272 VAL A CA   1 
ATOM   4023 C  C    . VAL A 1 272 ? 22.449  -29.294 2.365   1.00 29.27  ?  272 VAL A C    1 
ATOM   4024 O  O    . VAL A 1 272 ? 21.699  -29.728 3.247   1.00 29.92  ?  272 VAL A O    1 
ATOM   4025 C  CB   . VAL A 1 272 ? 22.752  -26.801 2.692   1.00 34.25  ?  272 VAL A CB   1 
ATOM   4026 C  CG1  . VAL A 1 272 ? 24.178  -27.081 3.149   1.00 34.63  ?  272 VAL A CG1  1 
ATOM   4027 C  CG2  . VAL A 1 272 ? 22.671  -25.449 1.987   1.00 31.78  ?  272 VAL A CG2  1 
ATOM   4028 H  H    . VAL A 1 272 ? 20.416  -27.224 2.085   1.00 37.12  ?  272 VAL A H    1 
ATOM   4029 H  HA   . VAL A 1 272 ? 22.719  -27.864 0.926   1.00 39.89  ?  272 VAL A HA   1 
ATOM   4030 H  HB   . VAL A 1 272 ? 22.188  -26.760 3.480   1.00 41.19  ?  272 VAL A HB   1 
ATOM   4031 H  HG11 . VAL A 1 272 ? 24.470  -26.361 3.730   1.00 41.64  ?  272 VAL A HG11 1 
ATOM   4032 H  HG12 . VAL A 1 272 ? 24.196  -27.923 3.630   1.00 41.64  ?  272 VAL A HG12 1 
ATOM   4033 H  HG13 . VAL A 1 272 ? 24.754  -27.132 2.370   1.00 41.64  ?  272 VAL A HG13 1 
ATOM   4034 H  HG21 . VAL A 1 272 ? 23.002  -24.761 2.586   1.00 38.22  ?  272 VAL A HG21 1 
ATOM   4035 H  HG22 . VAL A 1 272 ? 23.215  -25.480 1.185   1.00 38.22  ?  272 VAL A HG22 1 
ATOM   4036 H  HG23 . VAL A 1 272 ? 21.747  -25.270 1.754   1.00 38.22  ?  272 VAL A HG23 1 
ATOM   4037 N  N    . ASP A 1 273 ? 23.478  -29.993 1.889   1.00 31.41  ?  273 ASP A N    1 
ATOM   4038 C  CA   . ASP A 1 273 ? 23.783  -31.321 2.408   1.00 31.25  ?  273 ASP A CA   1 
ATOM   4039 C  C    . ASP A 1 273 ? 24.016  -31.271 3.912   1.00 35.81  ?  273 ASP A C    1 
ATOM   4040 O  O    . ASP A 1 273 ? 24.756  -30.418 4.409   1.00 36.51  ?  273 ASP A O    1 
ATOM   4041 C  CB   . ASP A 1 273 ? 25.021  -31.892 1.715   1.00 38.94  ?  273 ASP A CB   1 
ATOM   4042 C  CG   . ASP A 1 273 ? 24.785  -32.196 0.250   1.00 51.17  ?  273 ASP A CG   1 
ATOM   4043 O  OD1  . ASP A 1 273 ? 23.609  -32.318 -0.155  1.00 59.66  ?  273 ASP A OD1  1 
ATOM   4044 O  OD2  . ASP A 1 273 ? 25.778  -32.321 -0.497  1.00 59.47  ?  273 ASP A OD2  1 
ATOM   4045 H  H    . ASP A 1 273 ? 24.010  -29.722 1.270   1.00 37.77  ?  273 ASP A H    1 
ATOM   4046 H  HA   . ASP A 1 273 ? 23.035  -31.914 2.235   1.00 37.58  ?  273 ASP A HA   1 
ATOM   4047 H  HB2  . ASP A 1 273 ? 25.742  -31.246 1.774   1.00 46.82  ?  273 ASP A HB2  1 
ATOM   4048 H  HB3  . ASP A 1 273 ? 25.277  -32.717 2.155   1.00 46.82  ?  273 ASP A HB3  1 
ATOM   4049 N  N    . VAL A 1 274 ? 23.380  -32.192 4.637   1.00 30.71  ?  274 VAL A N    1 
ATOM   4050 C  CA   . VAL A 1 274 ? 23.673  -32.379 6.054   1.00 31.23  ?  274 VAL A CA   1 
ATOM   4051 C  C    . VAL A 1 274 ? 24.665  -33.516 6.288   1.00 30.80  ?  274 VAL A C    1 
ATOM   4052 O  O    . VAL A 1 274 ? 25.255  -33.591 7.376   1.00 35.54  ?  274 VAL A O    1 
ATOM   4053 C  CB   . VAL A 1 274 ? 22.385  -32.627 6.870   1.00 32.96  ?  274 VAL A CB   1 
ATOM   4054 C  CG1  . VAL A 1 274 ? 21.494  -31.393 6.848   1.00 27.63  ?  274 VAL A CG1  1 
ATOM   4055 C  CG2  . VAL A 1 274 ? 21.634  -33.848 6.355   1.00 36.06  ?  274 VAL A CG2  1 
ATOM   4056 H  H    . VAL A 1 274 ? 22.774  -32.719 4.330   1.00 36.93  ?  274 VAL A H    1 
ATOM   4057 H  HA   . VAL A 1 274 ? 24.079  -31.566 6.392   1.00 37.56  ?  274 VAL A HA   1 
ATOM   4058 H  HB   . VAL A 1 274 ? 22.630  -32.798 7.793   1.00 39.63  ?  274 VAL A HB   1 
ATOM   4059 H  HG11 . VAL A 1 274 ? 20.694  -31.572 7.366   1.00 33.24  ?  274 VAL A HG11 1 
ATOM   4060 H  HG12 . VAL A 1 274 ? 21.978  -30.646 7.235   1.00 33.24  ?  274 VAL A HG12 1 
ATOM   4061 H  HG13 . VAL A 1 274 ? 21.255  -31.192 5.929   1.00 33.24  ?  274 VAL A HG13 1 
ATOM   4062 H  HG21 . VAL A 1 274 ? 20.833  -33.974 6.889   1.00 43.36  ?  274 VAL A HG21 1 
ATOM   4063 H  HG22 . VAL A 1 274 ? 21.393  -33.702 5.427   1.00 43.36  ?  274 VAL A HG22 1 
ATOM   4064 H  HG23 . VAL A 1 274 ? 22.207  -34.626 6.430   1.00 43.36  ?  274 VAL A HG23 1 
ATOM   4065 N  N    . PHE A 1 275 ? 24.857  -34.401 5.314   1.00 32.76  ?  275 PHE A N    1 
ATOM   4066 C  CA   . PHE A 1 275 ? 25.875  -35.437 5.405   1.00 39.37  ?  275 PHE A CA   1 
ATOM   4067 C  C    . PHE A 1 275 ? 27.174  -34.931 4.796   1.00 44.34  ?  275 PHE A C    1 
ATOM   4068 O  O    . PHE A 1 275 ? 27.171  -34.294 3.739   1.00 41.97  ?  275 PHE A O    1 
ATOM   4069 C  CB   . PHE A 1 275 ? 25.429  -36.712 4.684   1.00 35.55  ?  275 PHE A CB   1 
ATOM   4070 C  CG   . PHE A 1 275 ? 24.280  -37.414 5.347   1.00 39.83  ?  275 PHE A CG   1 
ATOM   4071 C  CD1  . PHE A 1 275 ? 24.504  -38.330 6.361   1.00 39.38  ?  275 PHE A CD1  1 
ATOM   4072 C  CD2  . PHE A 1 275 ? 22.977  -37.165 4.953   1.00 35.88  ?  275 PHE A CD2  1 
ATOM   4073 C  CE1  . PHE A 1 275 ? 23.449  -38.980 6.971   1.00 36.71  ?  275 PHE A CE1  1 
ATOM   4074 C  CE2  . PHE A 1 275 ? 21.920  -37.812 5.559   1.00 34.02  ?  275 PHE A CE2  1 
ATOM   4075 C  CZ   . PHE A 1 275 ? 22.156  -38.720 6.568   1.00 37.15  ?  275 PHE A CZ   1 
ATOM   4076 H  H    . PHE A 1 275 ? 24.405  -34.421 4.584   1.00 39.39  ?  275 PHE A H    1 
ATOM   4077 H  HA   . PHE A 1 275 ? 26.036  -35.652 6.337   1.00 47.32  ?  275 PHE A HA   1 
ATOM   4078 H  HB2  . PHE A 1 275 ? 25.155  -36.481 3.783   1.00 42.74  ?  275 PHE A HB2  1 
ATOM   4079 H  HB3  . PHE A 1 275 ? 26.176  -37.330 4.652   1.00 42.74  ?  275 PHE A HB3  1 
ATOM   4080 H  HD1  . PHE A 1 275 ? 25.374  -38.508 6.636   1.00 47.34  ?  275 PHE A HD1  1 
ATOM   4081 H  HD2  . PHE A 1 275 ? 22.812  -36.553 4.272   1.00 43.13  ?  275 PHE A HD2  1 
ATOM   4082 H  HE1  . PHE A 1 275 ? 23.610  -39.592 7.652   1.00 44.13  ?  275 PHE A HE1  1 
ATOM   4083 H  HE2  . PHE A 1 275 ? 21.049  -37.636 5.287   1.00 40.91  ?  275 PHE A HE2  1 
ATOM   4084 H  HZ   . PHE A 1 275 ? 21.444  -39.156 6.977   1.00 44.67  ?  275 PHE A HZ   1 
ATOM   4085 N  N    . THR A 1 276 ? 28.283  -35.222 5.469   1.00 46.82  ?  276 THR A N    1 
ATOM   4086 C  CA   . THR A 1 276 ? 29.592  -34.784 5.012   1.00 45.06  ?  276 THR A CA   1 
ATOM   4087 C  C    . THR A 1 276 ? 30.648  -35.751 5.525   1.00 54.05  ?  276 THR A C    1 
ATOM   4088 O  O    . THR A 1 276 ? 30.388  -36.594 6.388   1.00 48.58  ?  276 THR A O    1 
ATOM   4089 C  CB   . THR A 1 276 ? 29.901  -33.359 5.481   1.00 47.97  ?  276 THR A CB   1 
ATOM   4090 O  OG1  . THR A 1 276 ? 31.223  -32.994 5.070   1.00 64.48  ?  276 THR A OG1  1 
ATOM   4091 C  CG2  . THR A 1 276 ? 29.793  -33.255 6.998   1.00 52.22  ?  276 THR A CG2  1 
ATOM   4092 H  H    . THR A 1 276 ? 28.302  -35.676 6.199   1.00 56.26  ?  276 THR A H    1 
ATOM   4093 H  HA   . THR A 1 276 ? 29.613  -34.797 4.042   1.00 54.15  ?  276 THR A HA   1 
ATOM   4094 H  HB   . THR A 1 276 ? 29.261  -32.745 5.087   1.00 57.65  ?  276 THR A HB   1 
ATOM   4095 H  HG1  . THR A 1 276 ? 31.398  -32.212 5.324   1.00 77.46  ?  276 THR A HG1  1 
ATOM   4096 H  HG21 . THR A 1 276 ? 29.990  -32.349 7.283   1.00 62.74  ?  276 THR A HG21 1 
ATOM   4097 H  HG22 . THR A 1 276 ? 28.895  -33.487 7.283   1.00 62.74  ?  276 THR A HG22 1 
ATOM   4098 H  HG23 . THR A 1 276 ? 30.423  -33.861 7.417   1.00 62.74  ?  276 THR A HG23 1 
ATOM   4099 N  N    . THR A 1 277 ? 31.852  -35.619 4.977   1.00 64.35  ?  277 THR A N    1 
ATOM   4100 C  CA   . THR A 1 277 ? 33.012  -36.384 5.414   1.00 65.43  ?  277 THR A CA   1 
ATOM   4101 C  C    . THR A 1 277 ? 33.986  -35.430 6.092   1.00 61.01  ?  277 THR A C    1 
ATOM   4102 O  O    . THR A 1 277 ? 34.503  -34.509 5.453   1.00 61.52  ?  277 THR A O    1 
ATOM   4103 C  CB   . THR A 1 277 ? 33.681  -37.094 4.237   1.00 66.46  ?  277 THR A CB   1 
ATOM   4104 O  OG1  . THR A 1 277 ? 34.083  -36.127 3.259   1.00 76.91  ?  277 THR A OG1  1 
ATOM   4105 C  CG2  . THR A 1 277 ? 32.723  -38.094 3.599   1.00 56.91  ?  277 THR A CG2  1 
ATOM   4106 H  H    . THR A 1 277 ? 32.025  -35.076 4.333   1.00 77.31  ?  277 THR A H    1 
ATOM   4107 H  HA   . THR A 1 277 ? 32.735  -37.053 6.060   1.00 78.60  ?  277 THR A HA   1 
ATOM   4108 H  HB   . THR A 1 277 ? 34.461  -37.577 4.553   1.00 79.83  ?  277 THR A HB   1 
ATOM   4109 H  HG1  . THR A 1 277 ? 34.626  -35.584 3.598   1.00 92.37  ?  277 THR A HG1  1 
ATOM   4110 H  HG21 . THR A 1 277 ? 33.156  -38.539 2.854   1.00 68.37  ?  277 THR A HG21 1 
ATOM   4111 H  HG22 . THR A 1 277 ? 32.456  -38.760 4.252   1.00 68.37  ?  277 THR A HG22 1 
ATOM   4112 H  HG23 . THR A 1 277 ? 31.932  -37.635 3.276   1.00 68.37  ?  277 THR A HG23 1 
ATOM   4113 N  N    . LEU A 1 278 ? 34.225  -35.648 7.385   1.00 62.74  ?  278 LEU A N    1 
ATOM   4114 C  CA   . LEU A 1 278 ? 35.112  -34.785 8.144   1.00 57.94  ?  278 LEU A CA   1 
ATOM   4115 C  C    . LEU A 1 278 ? 36.535  -34.876 7.593   1.00 64.76  ?  278 LEU A C    1 
ATOM   4116 O  O    . LEU A 1 278 ? 36.871  -35.818 6.869   1.00 65.98  ?  278 LEU A O    1 
ATOM   4117 C  CB   . LEU A 1 278 ? 35.081  -35.178 9.620   1.00 58.07  ?  278 LEU A CB   1 
ATOM   4118 C  CG   . LEU A 1 278 ? 33.719  -35.056 10.307  1.00 57.23  ?  278 LEU A CG   1 
ATOM   4119 C  CD1  . LEU A 1 278 ? 33.817  -35.508 11.754  1.00 52.12  ?  278 LEU A CD1  1 
ATOM   4120 C  CD2  . LEU A 1 278 ? 33.171  -33.636 10.228  1.00 55.84  ?  278 LEU A CD2  1 
ATOM   4121 H  H    . LEU A 1 278 ? 33.882  -36.291 7.843   1.00 75.36  ?  278 LEU A H    1 
ATOM   4122 H  HA   . LEU A 1 278 ? 34.812  -33.866 8.065   1.00 69.61  ?  278 LEU A HA   1 
ATOM   4123 H  HB2  . LEU A 1 278 ? 35.364  -36.102 9.698   1.00 69.76  ?  278 LEU A HB2  1 
ATOM   4124 H  HB3  . LEU A 1 278 ? 35.701  -34.608 10.102  1.00 69.76  ?  278 LEU A HB3  1 
ATOM   4125 H  HG   . LEU A 1 278 ? 33.090  -35.641 9.856   1.00 68.76  ?  278 LEU A HG   1 
ATOM   4126 H  HD11 . LEU A 1 278 ? 32.946  -35.424 12.171  1.00 62.63  ?  278 LEU A HD11 1 
ATOM   4127 H  HD12 . LEU A 1 278 ? 34.107  -36.434 11.776  1.00 62.63  ?  278 LEU A HD12 1 
ATOM   4128 H  HD13 . LEU A 1 278 ? 34.461  -34.949 12.216  1.00 62.63  ?  278 LEU A HD13 1 
ATOM   4129 H  HD21 . LEU A 1 278 ? 32.310  -33.605 10.673  1.00 67.09  ?  278 LEU A HD21 1 
ATOM   4130 H  HD22 . LEU A 1 278 ? 33.793  -33.034 10.665  1.00 67.09  ?  278 LEU A HD22 1 
ATOM   4131 H  HD23 . LEU A 1 278 ? 33.071  -33.388 9.295   1.00 67.09  ?  278 LEU A HD23 1 
ATOM   4132 N  N    . PRO A 1 279 ? 37.390  -33.898 7.915   1.00 67.12  ?  279 PRO A N    1 
ATOM   4133 C  CA   . PRO A 1 279 ? 38.763  -33.932 7.379   1.00 67.86  ?  279 PRO A CA   1 
ATOM   4134 C  C    . PRO A 1 279 ? 39.500  -35.231 7.661   1.00 67.13  ?  279 PRO A C    1 
ATOM   4135 O  O    . PRO A 1 279 ? 40.249  -35.706 6.799   1.00 74.85  ?  279 PRO A O    1 
ATOM   4136 C  CB   . PRO A 1 279 ? 39.436  -32.731 8.064   1.00 65.59  ?  279 PRO A CB   1 
ATOM   4137 C  CG   . PRO A 1 279 ? 38.509  -32.318 9.168   1.00 70.16  ?  279 PRO A CG   1 
ATOM   4138 C  CD   . PRO A 1 279 ? 37.148  -32.682 8.705   1.00 65.36  ?  279 PRO A CD   1 
ATOM   4139 H  HA   . PRO A 1 279 ? 38.748  -33.781 6.421   1.00 81.52  ?  279 PRO A HA   1 
ATOM   4140 H  HB2  . PRO A 1 279 ? 40.295  -33.002 8.423   1.00 78.80  ?  279 PRO A HB2  1 
ATOM   4141 H  HB3  . PRO A 1 279 ? 39.545  -32.012 7.423   1.00 78.80  ?  279 PRO A HB3  1 
ATOM   4142 H  HG2  . PRO A 1 279 ? 38.734  -32.799 9.980   1.00 84.27  ?  279 PRO A HG2  1 
ATOM   4143 H  HG3  . PRO A 1 279 ? 38.577  -31.360 9.309   1.00 84.27  ?  279 PRO A HG3  1 
ATOM   4144 H  HD2  . PRO A 1 279 ? 36.572  -32.876 9.461   1.00 78.51  ?  279 PRO A HD2  1 
ATOM   4145 H  HD3  . PRO A 1 279 ? 36.780  -31.980 8.146   1.00 78.51  ?  279 PRO A HD3  1 
ATOM   4146 N  N    . ASP A 1 280 ? 39.311  -35.824 8.838   1.00 63.61  ?  280 ASP A N    1 
ATOM   4147 C  CA   . ASP A 1 280 ? 39.983  -37.074 9.168   1.00 62.38  ?  280 ASP A CA   1 
ATOM   4148 C  C    . ASP A 1 280 ? 39.305  -38.295 8.548   1.00 67.95  ?  280 ASP A C    1 
ATOM   4149 O  O    . ASP A 1 280 ? 39.680  -39.424 8.880   1.00 73.08  ?  280 ASP A O    1 
ATOM   4150 C  CB   . ASP A 1 280 ? 40.075  -37.239 10.687  1.00 63.60  ?  280 ASP A CB   1 
ATOM   4151 C  CG   . ASP A 1 280 ? 38.747  -37.593 11.320  1.00 60.55  ?  280 ASP A CG   1 
ATOM   4152 O  OD1  . ASP A 1 280 ? 37.696  -37.371 10.683  1.00 59.89  ?  280 ASP A OD1  1 
ATOM   4153 O  OD2  . ASP A 1 280 ? 38.750  -38.087 12.468  1.00 66.37  ?  280 ASP A OD2  1 
ATOM   4154 H  H    . ASP A 1 280 ? 38.799  -35.522 9.460   1.00 76.41  ?  280 ASP A H    1 
ATOM   4155 H  HA   . ASP A 1 280 ? 40.888  -37.037 8.822   1.00 74.93  ?  280 ASP A HA   1 
ATOM   4156 H  HB2  . ASP A 1 280 ? 40.702  -37.950 10.890  1.00 76.41  ?  280 ASP A HB2  1 
ATOM   4157 H  HB3  . ASP A 1 280 ? 40.380  -36.405 11.078  1.00 76.41  ?  280 ASP A HB3  1 
ATOM   4158 N  N    . GLY A 1 281 ? 38.314  -38.099 7.676   1.00 66.59  ?  281 GLY A N    1 
ATOM   4159 C  CA   . GLY A 1 281 ? 37.795  -39.154 6.835   1.00 62.98  ?  281 GLY A CA   1 
ATOM   4160 C  C    . GLY A 1 281 ? 36.443  -39.710 7.237   1.00 61.96  ?  281 GLY A C    1 
ATOM   4161 O  O    . GLY A 1 281 ? 35.761  -40.297 6.390   1.00 57.21  ?  281 GLY A O    1 
ATOM   4162 H  H    . GLY A 1 281 ? 37.923  -37.342 7.557   1.00 79.99  ?  281 GLY A H    1 
ATOM   4163 H  HA2  . GLY A 1 281 ? 37.720  -38.820 5.927   1.00 75.66  ?  281 GLY A HA2  1 
ATOM   4164 H  HA3  . GLY A 1 281 ? 38.428  -39.889 6.830   1.00 75.66  ?  281 GLY A HA3  1 
ATOM   4165 N  N    . ARG A 1 282 ? 36.032  -39.554 8.493   1.00 53.26  ?  282 ARG A N    1 
ATOM   4166 C  CA   . ARG A 1 282 ? 34.811  -40.201 8.953   1.00 62.79  ?  282 ARG A CA   1 
ATOM   4167 C  C    . ARG A 1 282 ? 33.579  -39.405 8.538   1.00 57.45  ?  282 ARG A C    1 
ATOM   4168 O  O    . ARG A 1 282 ? 33.581  -38.171 8.544   1.00 55.32  ?  282 ARG A O    1 
ATOM   4169 C  CB   . ARG A 1 282 ? 34.839  -40.399 10.471  1.00 58.34  ?  282 ARG A CB   1 
ATOM   4170 C  CG   . ARG A 1 282 ? 34.934  -39.139 11.318  1.00 64.12  ?  282 ARG A CG   1 
ATOM   4171 C  CD   . ARG A 1 282 ? 35.588  -39.471 12.662  1.00 59.55  ?  282 ARG A CD   1 
ATOM   4172 N  NE   . ARG A 1 282 ? 35.095  -38.651 13.768  1.00 65.01  ?  282 ARG A NE   1 
ATOM   4173 C  CZ   . ARG A 1 282 ? 35.537  -37.432 14.065  1.00 68.62  ?  282 ARG A CZ   1 
ATOM   4174 N  NH1  . ARG A 1 282 ? 36.482  -36.864 13.333  1.00 69.74  ?  282 ARG A NH1  1 
ATOM   4175 N  NH2  . ARG A 1 282 ? 35.024  -36.775 15.095  1.00 75.36  ?  282 ARG A NH2  1 
ATOM   4176 H  H    . ARG A 1 282 ? 36.436  -39.085 9.090   1.00 64.00  ?  282 ARG A H    1 
ATOM   4177 H  HA   . ARG A 1 282 ? 34.749  -41.078 8.541   1.00 75.43  ?  282 ARG A HA   1 
ATOM   4178 H  HB2  . ARG A 1 282 ? 34.026  -40.860 10.731  1.00 70.10  ?  282 ARG A HB2  1 
ATOM   4179 H  HB3  . ARG A 1 282 ? 35.605  -40.952 10.691  1.00 70.10  ?  282 ARG A HB3  1 
ATOM   4180 H  HG2  . ARG A 1 282 ? 35.480  -38.480 10.862  1.00 77.03  ?  282 ARG A HG2  1 
ATOM   4181 H  HG3  . ARG A 1 282 ? 34.044  -38.790 11.485  1.00 77.03  ?  282 ARG A HG3  1 
ATOM   4182 H  HD2  . ARG A 1 282 ? 35.409  -40.400 12.877  1.00 71.54  ?  282 ARG A HD2  1 
ATOM   4183 H  HD3  . ARG A 1 282 ? 36.545  -39.328 12.589  1.00 71.54  ?  282 ARG A HD3  1 
ATOM   4184 H  HE   . ARG A 1 282 ? 34.475  -38.982 14.263  1.00 78.10  ?  282 ARG A HE   1 
ATOM   4185 H  HH11 . ARG A 1 282 ? 36.819  -37.286 12.664  1.00 83.77  ?  282 ARG A HH11 1 
ATOM   4186 H  HH12 . ARG A 1 282 ? 36.762  -36.075 13.529  1.00 83.77  ?  282 ARG A HH12 1 
ATOM   4187 H  HH21 . ARG A 1 282 ? 34.408  -37.137 15.574  1.00 90.51  ?  282 ARG A HH21 1 
ATOM   4188 H  HH22 . ARG A 1 282 ? 35.306  -35.985 15.285  1.00 90.51  ?  282 ARG A HH22 1 
ATOM   4189 N  N    . ARG A 1 283 ? 32.527  -40.129 8.163   1.00 49.38  ?  283 ARG A N    1 
ATOM   4190 C  CA   . ARG A 1 283 ? 31.294  -39.501 7.713   1.00 45.02  ?  283 ARG A CA   1 
ATOM   4191 C  C    . ARG A 1 283 ? 30.532  -38.925 8.900   1.00 37.84  ?  283 ARG A C    1 
ATOM   4192 O  O    . ARG A 1 283 ? 30.525  -39.499 9.994   1.00 42.32  ?  283 ARG A O    1 
ATOM   4193 C  CB   . ARG A 1 283 ? 30.434  -40.520 6.967   1.00 43.45  ?  283 ARG A CB   1 
ATOM   4194 C  CG   . ARG A 1 283 ? 29.345  -39.917 6.097   1.00 48.96  ?  283 ARG A CG   1 
ATOM   4195 C  CD   . ARG A 1 283 ? 29.140  -40.753 4.844   1.00 47.33  ?  283 ARG A CD   1 
ATOM   4196 N  NE   . ARG A 1 283 ? 28.088  -40.225 3.980   1.00 44.35  ?  283 ARG A NE   1 
ATOM   4197 C  CZ   . ARG A 1 283 ? 28.254  -39.240 3.102   1.00 50.11  ?  283 ARG A CZ   1 
ATOM   4198 N  NH1  . ARG A 1 283 ? 29.433  -38.648 2.962   1.00 52.75  ?  283 ARG A NH1  1 
ATOM   4199 N  NH2  . ARG A 1 283 ? 27.230  -38.838 2.361   1.00 42.63  ?  283 ARG A NH2  1 
ATOM   4200 H  H    . ARG A 1 283 ? 32.505  -40.989 8.161   1.00 59.34  ?  283 ARG A H    1 
ATOM   4201 H  HA   . ARG A 1 283 ? 31.506  -38.776 7.105   1.00 54.11  ?  283 ARG A HA   1 
ATOM   4202 H  HB2  . ARG A 1 283 ? 31.009  -41.049 6.392   1.00 52.23  ?  283 ARG A HB2  1 
ATOM   4203 H  HB3  . ARG A 1 283 ? 30.004  -41.097 7.618   1.00 52.23  ?  283 ARG A HB3  1 
ATOM   4204 H  HG2  . ARG A 1 283 ? 28.511  -39.896 6.592   1.00 58.83  ?  283 ARG A HG2  1 
ATOM   4205 H  HG3  . ARG A 1 283 ? 29.604  -39.022 5.830   1.00 58.83  ?  283 ARG A HG3  1 
ATOM   4206 H  HD2  . ARG A 1 283 ? 29.965  -40.768 4.336   1.00 56.88  ?  283 ARG A HD2  1 
ATOM   4207 H  HD3  . ARG A 1 283 ? 28.891  -41.654 5.103   1.00 56.88  ?  283 ARG A HD3  1 
ATOM   4208 H  HE   . ARG A 1 283 ? 27.305  -40.575 4.044   1.00 53.30  ?  283 ARG A HE   1 
ATOM   4209 H  HH11 . ARG A 1 283 ? 30.102  -38.904 3.438   1.00 63.38  ?  283 ARG A HH11 1 
ATOM   4210 H  HH12 . ARG A 1 283 ? 29.530  -38.011 2.392   1.00 63.38  ?  283 ARG A HH12 1 
ATOM   4211 H  HH21 . ARG A 1 283 ? 26.462  -39.215 2.448   1.00 51.24  ?  283 ARG A HH21 1 
ATOM   4212 H  HH22 . ARG A 1 283 ? 27.334  -38.199 1.794   1.00 51.24  ?  283 ARG A HH22 1 
ATOM   4213 N  N    . ALA A 1 284 ? 29.890  -37.780 8.682   1.00 36.95  ?  284 ALA A N    1 
ATOM   4214 C  CA   . ALA A 1 284 ? 29.246  -37.047 9.760   1.00 34.29  ?  284 ALA A CA   1 
ATOM   4215 C  C    . ALA A 1 284 ? 27.906  -36.496 9.295   1.00 37.57  ?  284 ALA A C    1 
ATOM   4216 O  O    . ALA A 1 284 ? 27.667  -36.293 8.102   1.00 38.08  ?  284 ALA A O    1 
ATOM   4217 C  CB   . ALA A 1 284 ? 30.132  -35.900 10.267  1.00 44.32  ?  284 ALA A CB   1 
ATOM   4218 H  H    . ALA A 1 284 ? 29.814  -37.406 7.911   1.00 44.42  ?  284 ALA A H    1 
ATOM   4219 H  HA   . ALA A 1 284 ? 29.082  -37.652 10.501  1.00 41.23  ?  284 ALA A HA   1 
ATOM   4220 H  HB1  . ALA A 1 284 ? 29.670  -35.437 10.983  1.00 53.27  ?  284 ALA A HB1  1 
ATOM   4221 H  HB2  . ALA A 1 284 ? 30.967  -36.268 10.596  1.00 53.27  ?  284 ALA A HB2  1 
ATOM   4222 H  HB3  . ALA A 1 284 ? 30.305  -35.288 9.535   1.00 53.27  ?  284 ALA A HB3  1 
ATOM   4223 N  N    . LEU A 1 285 ? 27.035  -36.256 10.269  1.00 38.77  ?  285 LEU A N    1 
ATOM   4224 C  CA   . LEU A 1 285 ? 25.757  -35.593 10.057  1.00 41.16  ?  285 LEU A CA   1 
ATOM   4225 C  C    . LEU A 1 285 ? 25.791  -34.247 10.764  1.00 36.72  ?  285 LEU A C    1 
ATOM   4226 O  O    . LEU A 1 285 ? 26.076  -34.181 11.965  1.00 38.15  ?  285 LEU A O    1 
ATOM   4227 C  CB   . LEU A 1 285 ? 24.603  -36.443 10.591  1.00 36.73  ?  285 LEU A CB   1 
ATOM   4228 C  CG   . LEU A 1 285 ? 23.209  -35.813 10.511  1.00 35.64  ?  285 LEU A CG   1 
ATOM   4229 C  CD1  . LEU A 1 285 ? 22.677  -35.871 9.091   1.00 36.84  ?  285 LEU A CD1  1 
ATOM   4230 C  CD2  . LEU A 1 285 ? 22.267  -36.500 11.478  1.00 40.60  ?  285 LEU A CD2  1 
ATOM   4231 H  H    . LEU A 1 285 ? 27.169  -36.476 11.090  1.00 46.61  ?  285 LEU A H    1 
ATOM   4232 H  HA   . LEU A 1 285 ? 25.620  -35.443 9.109   1.00 49.48  ?  285 LEU A HA   1 
ATOM   4233 H  HB2  . LEU A 1 285 ? 24.575  -37.271 10.087  1.00 44.16  ?  285 LEU A HB2  1 
ATOM   4234 H  HB3  . LEU A 1 285 ? 24.777  -36.640 11.525  1.00 44.16  ?  285 LEU A HB3  1 
ATOM   4235 H  HG   . LEU A 1 285 ? 23.271  -34.880 10.768  1.00 42.85  ?  285 LEU A HG   1 
ATOM   4236 H  HD11 . LEU A 1 285 ? 21.795  -35.467 9.068   1.00 44.29  ?  285 LEU A HD11 1 
ATOM   4237 H  HD12 . LEU A 1 285 ? 23.280  -35.383 8.508   1.00 44.29  ?  285 LEU A HD12 1 
ATOM   4238 H  HD13 . LEU A 1 285 ? 22.623  -36.798 8.811   1.00 44.29  ?  285 LEU A HD13 1 
ATOM   4239 H  HD21 . LEU A 1 285 ? 21.391  -36.088 11.411  1.00 48.80  ?  285 LEU A HD21 1 
ATOM   4240 H  HD22 . LEU A 1 285 ? 22.208  -37.440 11.247  1.00 48.80  ?  285 LEU A HD22 1 
ATOM   4241 H  HD23 . LEU A 1 285 ? 22.612  -36.401 12.379  1.00 48.80  ?  285 LEU A HD23 1 
ATOM   4242 N  N    . ASP A 1 286 ? 25.498  -33.182 10.025  1.00 35.70  ?  286 ASP A N    1 
ATOM   4243 C  CA   . ASP A 1 286 ? 25.519  -31.821 10.561  1.00 35.61  ?  286 ASP A CA   1 
ATOM   4244 C  C    . ASP A 1 286 ? 24.112  -31.243 10.441  1.00 29.20  ?  286 ASP A C    1 
ATOM   4245 O  O    . ASP A 1 286 ? 23.756  -30.648 9.420   1.00 30.42  ?  286 ASP A O    1 
ATOM   4246 C  CB   . ASP A 1 286 ? 26.538  -30.957 9.826   1.00 35.13  ?  286 ASP A CB   1 
ATOM   4247 C  CG   . ASP A 1 286 ? 26.647  -29.563 10.413  1.00 40.27  ?  286 ASP A CG   1 
ATOM   4248 O  OD1  . ASP A 1 286 ? 25.996  -29.299 11.447  1.00 36.73  ?  286 ASP A OD1  1 
ATOM   4249 O  OD2  . ASP A 1 286 ? 27.380  -28.733 9.839   1.00 45.33  ?  286 ASP A OD2  1 
ATOM   4250 H  H    . ASP A 1 286 ? 25.279  -33.220 9.194   1.00 42.93  ?  286 ASP A H    1 
ATOM   4251 H  HA   . ASP A 1 286 ? 25.760  -31.848 11.500  1.00 42.82  ?  286 ASP A HA   1 
ATOM   4252 H  HB2  . ASP A 1 286 ? 27.410  -31.377 9.885   1.00 42.24  ?  286 ASP A HB2  1 
ATOM   4253 H  HB3  . ASP A 1 286 ? 26.271  -30.873 8.897   1.00 42.24  ?  286 ASP A HB3  1 
ATOM   4254 N  N    . LEU A 1 287 ? 23.315  -31.409 11.495  1.00 31.32  ?  287 LEU A N    1 
ATOM   4255 C  CA   . LEU A 1 287 ? 21.967  -30.860 11.498  1.00 37.69  ?  287 LEU A CA   1 
ATOM   4256 C  C    . LEU A 1 287 ? 21.943  -29.351 11.674  1.00 35.44  ?  287 LEU A C    1 
ATOM   4257 O  O    . LEU A 1 287 ? 20.856  -28.765 11.643  1.00 32.90  ?  287 LEU A O    1 
ATOM   4258 C  CB   . LEU A 1 287 ? 21.132  -31.526 12.591  1.00 34.57  ?  287 LEU A CB   1 
ATOM   4259 C  CG   . LEU A 1 287 ? 20.818  -33.009 12.378  1.00 36.06  ?  287 LEU A CG   1 
ATOM   4260 C  CD1  . LEU A 1 287 ? 19.923  -33.511 13.492  1.00 39.29  ?  287 LEU A CD1  1 
ATOM   4261 C  CD2  . LEU A 1 287 ? 20.169  -33.262 11.020  1.00 29.86  ?  287 LEU A CD2  1 
ATOM   4262 H  H    . LEU A 1 287 ? 23.531  -31.832 12.213  1.00 37.67  ?  287 LEU A H    1 
ATOM   4263 H  HA   . LEU A 1 287 ? 21.549  -31.062 10.646  1.00 45.30  ?  287 LEU A HA   1 
ATOM   4264 H  HB2  . LEU A 1 287 ? 21.611  -31.449 13.431  1.00 41.57  ?  287 LEU A HB2  1 
ATOM   4265 H  HB3  . LEU A 1 287 ? 20.285  -31.057 12.658  1.00 41.57  ?  287 LEU A HB3  1 
ATOM   4266 H  HG   . LEU A 1 287 ? 21.646  -33.513 12.411  1.00 43.35  ?  287 LEU A HG   1 
ATOM   4267 H  HD11 . LEU A 1 287 ? 19.732  -34.450 13.344  1.00 47.23  ?  287 LEU A HD11 1 
ATOM   4268 H  HD12 . LEU A 1 287 ? 20.380  -33.395 14.339  1.00 47.23  ?  287 LEU A HD12 1 
ATOM   4269 H  HD13 . LEU A 1 287 ? 19.098  -33.000 13.488  1.00 47.23  ?  287 LEU A HD13 1 
ATOM   4270 H  HD21 . LEU A 1 287 ? 19.989  -34.210 10.929  1.00 35.92  ?  287 LEU A HD21 1 
ATOM   4271 H  HD22 . LEU A 1 287 ? 19.341  -32.760 10.968  1.00 35.92  ?  287 LEU A HD22 1 
ATOM   4272 H  HD23 . LEU A 1 287 ? 20.777  -32.971 10.321  1.00 35.92  ?  287 LEU A HD23 1 
ATOM   4273 N  N    . GLY A 1 288 ? 23.095  -28.705 11.856  1.00 37.59  ?  288 GLY A N    1 
ATOM   4274 C  CA   . GLY A 1 288 ? 23.133  -27.258 11.784  1.00 34.29  ?  288 GLY A CA   1 
ATOM   4275 C  C    . GLY A 1 288 ? 22.712  -26.722 10.434  1.00 34.37  ?  288 GLY A C    1 
ATOM   4276 O  O    . GLY A 1 288 ? 22.264  -25.574 10.341  1.00 40.42  ?  288 GLY A O    1 
ATOM   4277 H  H    . GLY A 1 288 ? 23.852  -29.079 12.019  1.00 45.19  ?  288 GLY A H    1 
ATOM   4278 H  HA2  . GLY A 1 288 ? 22.542  -26.887 12.458  1.00 41.23  ?  288 GLY A HA2  1 
ATOM   4279 H  HA3  . GLY A 1 288 ? 24.035  -26.951 11.967  1.00 41.23  ?  288 GLY A HA3  1 
ATOM   4280 N  N    . LYS A 1 289 ? 22.836  -27.533 9.386   1.00 36.29  ?  289 LYS A N    1 
ATOM   4281 C  CA   . LYS A 1 289 ? 22.471  -27.149 8.030   1.00 32.82  ?  289 LYS A CA   1 
ATOM   4282 C  C    . LYS A 1 289 ? 21.074  -27.615 7.645   1.00 32.49  ?  289 LYS A C    1 
ATOM   4283 O  O    . LYS A 1 289 ? 20.667  -27.433 6.493   1.00 27.50  ?  289 LYS A O    1 
ATOM   4284 C  CB   . LYS A 1 289 ? 23.491  -27.720 7.043   1.00 37.89  ?  289 LYS A CB   1 
ATOM   4285 C  CG   . LYS A 1 289 ? 24.901  -27.181 7.225   1.00 44.00  ?  289 LYS A CG   1 
ATOM   4286 C  CD   . LYS A 1 289 ? 25.932  -28.070 6.548   1.00 49.91  ?  289 LYS A CD   1 
ATOM   4287 C  CE   . LYS A 1 289 ? 26.825  -27.283 5.601   1.00 59.55  ?  289 LYS A CE   1 
ATOM   4288 N  NZ   . LYS A 1 289 ? 27.473  -26.115 6.257   1.00 71.25  ?  289 LYS A NZ   1 
ATOM   4289 H  H    . LYS A 1 289 ? 23.140  -28.336 9.440   1.00 43.63  ?  289 LYS A H    1 
ATOM   4290 H  HA   . LYS A 1 289 ? 22.494  -26.182 7.960   1.00 39.47  ?  289 LYS A HA   1 
ATOM   4291 H  HB2  . LYS A 1 289 ? 23.527  -28.683 7.153   1.00 45.56  ?  289 LYS A HB2  1 
ATOM   4292 H  HB3  . LYS A 1 289 ? 23.207  -27.503 6.142   1.00 45.56  ?  289 LYS A HB3  1 
ATOM   4293 H  HG2  . LYS A 1 289 ? 24.958  -26.296 6.832   1.00 52.88  ?  289 LYS A HG2  1 
ATOM   4294 H  HG3  . LYS A 1 289 ? 25.108  -27.142 8.172   1.00 52.88  ?  289 LYS A HG3  1 
ATOM   4295 H  HD2  . LYS A 1 289 ? 26.494  -28.479 7.225   1.00 59.98  ?  289 LYS A HD2  1 
ATOM   4296 H  HD3  . LYS A 1 289 ? 25.475  -28.755 6.035   1.00 59.98  ?  289 LYS A HD3  1 
ATOM   4297 H  HE2  . LYS A 1 289 ? 27.525  -27.866 5.268   1.00 71.54  ?  289 LYS A HE2  1 
ATOM   4298 H  HE3  . LYS A 1 289 ? 26.289  -26.953 4.862   1.00 71.54  ?  289 LYS A HE3  1 
ATOM   4299 H  HZ1  . LYS A 1 289 ? 27.985  -25.682 5.671   1.00 85.58  ?  289 LYS A HZ1  1 
ATOM   4300 H  HZ2  . LYS A 1 289 ? 26.852  -25.557 6.566   1.00 85.58  ?  289 LYS A HZ2  1 
ATOM   4301 H  HZ3  . LYS A 1 289 ? 27.979  -26.389 6.936   1.00 85.58  ?  289 LYS A HZ3  1 
ATOM   4302 N  N    . PHE A 1 290 ? 20.326  -28.198 8.585   1.00 28.55  ?  290 PHE A N    1 
ATOM   4303 C  CA   . PHE A 1 290 ? 19.099  -28.904 8.229   1.00 32.07  ?  290 PHE A CA   1 
ATOM   4304 C  C    . PHE A 1 290 ? 18.090  -27.982 7.553   1.00 29.86  ?  290 PHE A C    1 
ATOM   4305 O  O    . PHE A 1 290 ? 17.441  -28.374 6.575   1.00 26.00  ?  290 PHE A O    1 
ATOM   4306 C  CB   . PHE A 1 290 ? 18.493  -29.545 9.476   1.00 32.98  ?  290 PHE A CB   1 
ATOM   4307 C  CG   . PHE A 1 290 ? 17.277  -30.375 9.195   1.00 24.62  ?  290 PHE A CG   1 
ATOM   4308 C  CD1  . PHE A 1 290 ? 17.385  -31.569 8.505   1.00 26.73  ?  290 PHE A CD1  1 
ATOM   4309 C  CD2  . PHE A 1 290 ? 16.027  -29.966 9.626   1.00 29.96  ?  290 PHE A CD2  1 
ATOM   4310 C  CE1  . PHE A 1 290 ? 16.265  -32.336 8.241   1.00 27.78  ?  290 PHE A CE1  1 
ATOM   4311 C  CE2  . PHE A 1 290 ? 14.907  -30.729 9.368   1.00 29.42  ?  290 PHE A CE2  1 
ATOM   4312 C  CZ   . PHE A 1 290 ? 15.026  -31.915 8.676   1.00 25.15  ?  290 PHE A CZ   1 
ATOM   4313 H  H    . PHE A 1 290 ? 20.506  -28.198 9.426   1.00 34.34  ?  290 PHE A H    1 
ATOM   4314 H  HA   . PHE A 1 290 ? 19.316  -29.615 7.606   1.00 38.56  ?  290 PHE A HA   1 
ATOM   4315 H  HB2  . PHE A 1 290 ? 19.157  -30.121 9.886   1.00 39.65  ?  290 PHE A HB2  1 
ATOM   4316 H  HB3  . PHE A 1 290 ? 18.237  -28.844 10.095  1.00 39.65  ?  290 PHE A HB3  1 
ATOM   4317 H  HD1  . PHE A 1 290 ? 18.219  -31.855 8.209   1.00 32.15  ?  290 PHE A HD1  1 
ATOM   4318 H  HD2  . PHE A 1 290 ? 15.940  -29.166 10.092  1.00 36.03  ?  290 PHE A HD2  1 
ATOM   4319 H  HE1  . PHE A 1 290 ? 16.348  -33.137 7.775   1.00 33.41  ?  290 PHE A HE1  1 
ATOM   4320 H  HE2  . PHE A 1 290 ? 14.072  -30.443 9.661   1.00 35.39  ?  290 PHE A HE2  1 
ATOM   4321 H  HZ   . PHE A 1 290 ? 14.271  -32.430 8.502   1.00 30.26  ?  290 PHE A HZ   1 
ATOM   4322 N  N    . HIS A 1 291 ? 17.940  -26.759 8.056   1.00 26.78  ?  291 HIS A N    1 
ATOM   4323 C  CA   . HIS A 1 291 ? 16.996  -25.802 7.493   1.00 29.30  ?  291 HIS A CA   1 
ATOM   4324 C  C    . HIS A 1 291 ? 17.625  -24.887 6.447   1.00 32.33  ?  291 HIS A C    1 
ATOM   4325 O  O    . HIS A 1 291 ? 16.963  -23.952 5.981   1.00 34.55  ?  291 HIS A O    1 
ATOM   4326 C  CB   . HIS A 1 291 ? 16.381  -24.949 8.606   1.00 31.76  ?  291 HIS A CB   1 
ATOM   4327 C  CG   . HIS A 1 291 ? 15.647  -25.741 9.643   1.00 27.37  ?  291 HIS A CG   1 
ATOM   4328 N  ND1  . HIS A 1 291 ? 14.475  -26.414 9.374   1.00 28.88  ?  291 HIS A ND1  1 
ATOM   4329 C  CD2  . HIS A 1 291 ? 15.914  -25.958 10.952  1.00 28.77  ?  291 HIS A CD2  1 
ATOM   4330 C  CE1  . HIS A 1 291 ? 14.053  -27.014 10.472  1.00 32.05  ?  291 HIS A CE1  1 
ATOM   4331 N  NE2  . HIS A 1 291 ? 14.909  -26.756 11.444  1.00 28.52  ?  291 HIS A NE2  1 
ATOM   4332 H  H    . HIS A 1 291 ? 18.379  -26.458 8.731   1.00 32.22  ?  291 HIS A H    1 
ATOM   4333 H  HA   . HIS A 1 291 ? 16.276  -26.291 7.063   1.00 35.24  ?  291 HIS A HA   1 
ATOM   4334 H  HB2  . HIS A 1 291 ? 17.090  -24.461 9.053   1.00 38.19  ?  291 HIS A HB2  1 
ATOM   4335 H  HB3  . HIS A 1 291 ? 15.752  -24.326 8.210   1.00 38.19  ?  291 HIS A HB3  1 
ATOM   4336 H  HD2  . HIS A 1 291 ? 16.643  -25.632 11.429  1.00 34.60  ?  291 HIS A HD2  1 
ATOM   4337 H  HE1  . HIS A 1 291 ? 13.285  -27.534 10.547  1.00 38.54  ?  291 HIS A HE1  1 
ATOM   4338 H  HE2  . HIS A 1 291 ? 14.846  -27.039 12.253  1.00 34.31  ?  291 HIS A HE2  1 
ATOM   4339 N  N    . GLU A 1 292 ? 18.874  -25.130 6.065   1.00 28.58  ?  292 GLU A N    1 
ATOM   4340 C  CA   . GLU A 1 292 ? 19.559  -24.261 5.118   1.00 30.95  ?  292 GLU A CA   1 
ATOM   4341 C  C    . GLU A 1 292 ? 19.194  -24.636 3.689   1.00 29.72  ?  292 GLU A C    1 
ATOM   4342 O  O    . GLU A 1 292 ? 19.214  -25.814 3.319   1.00 28.61  ?  292 GLU A O    1 
ATOM   4343 C  CB   . GLU A 1 292 ? 21.072  -24.341 5.313   1.00 31.79  ?  292 GLU A CB   1 
ATOM   4344 C  CG   . GLU A 1 292 ? 21.597  -23.401 6.382   1.00 43.55  ?  292 GLU A CG   1 
ATOM   4345 C  CD   . GLU A 1 292 ? 23.111  -23.384 6.454   1.00 59.67  ?  292 GLU A CD   1 
ATOM   4346 O  OE1  . GLU A 1 292 ? 23.764  -23.856 5.499   1.00 52.61  ?  292 GLU A OE1  1 
ATOM   4347 O  OE2  . GLU A 1 292 ? 23.649  -22.896 7.471   1.00 67.22  ?  292 GLU A OE2  1 
ATOM   4348 H  H    . GLU A 1 292 ? 19.347  -25.793 6.341   1.00 34.38  ?  292 GLU A H    1 
ATOM   4349 H  HA   . GLU A 1 292 ? 19.282  -23.344 5.270   1.00 37.22  ?  292 GLU A HA   1 
ATOM   4350 H  HB2  . GLU A 1 292 ? 21.307  -25.246 5.571   1.00 38.24  ?  292 GLU A HB2  1 
ATOM   4351 H  HB3  . GLU A 1 292 ? 21.508  -24.114 4.477   1.00 38.24  ?  292 GLU A HB3  1 
ATOM   4352 H  HG2  . GLU A 1 292 ? 21.296  -22.500 6.186   1.00 52.35  ?  292 GLU A HG2  1 
ATOM   4353 H  HG3  . GLU A 1 292 ? 21.259  -23.684 7.246   1.00 52.35  ?  292 GLU A HG3  1 
ATOM   4354 N  N    . ILE A 1 293 ? 18.866  -23.626 2.887   1.00 24.49  ?  293 ILE A N    1 
ATOM   4355 C  CA   . ILE A 1 293 ? 18.482  -23.805 1.495   1.00 26.11  ?  293 ILE A CA   1 
ATOM   4356 C  C    . ILE A 1 293 ? 19.280  -22.821 0.653   1.00 33.26  ?  293 ILE A C    1 
ATOM   4357 O  O    . ILE A 1 293 ? 19.397  -21.643 1.012   1.00 29.10  ?  293 ILE A O    1 
ATOM   4358 C  CB   . ILE A 1 293 ? 16.969  -23.594 1.293   1.00 28.95  ?  293 ILE A CB   1 
ATOM   4359 C  CG1  . ILE A 1 293 ? 16.177  -24.627 2.105   1.00 30.21  ?  293 ILE A CG1  1 
ATOM   4360 C  CG2  . ILE A 1 293 ? 16.610  -23.692 -0.180  1.00 27.63  ?  293 ILE A CG2  1 
ATOM   4361 C  CD1  . ILE A 1 293 ? 14.700  -24.322 2.228   1.00 28.05  ?  293 ILE A CD1  1 
ATOM   4362 H  H    . ILE A 1 293 ? 18.859  -22.803 3.138   1.00 29.48  ?  293 ILE A H    1 
ATOM   4363 H  HA   . ILE A 1 293 ? 18.706  -24.705 1.211   1.00 31.42  ?  293 ILE A HA   1 
ATOM   4364 H  HB   . ILE A 1 293 ? 16.735  -22.707 1.610   1.00 34.82  ?  293 ILE A HB   1 
ATOM   4365 H  HG12 . ILE A 1 293 ? 16.265  -25.493 1.677   1.00 36.34  ?  293 ILE A HG12 1 
ATOM   4366 H  HG13 . ILE A 1 293 ? 16.546  -24.666 3.002   1.00 36.34  ?  293 ILE A HG13 1 
ATOM   4367 H  HG21 . ILE A 1 293 ? 15.655  -23.555 -0.281  1.00 33.24  ?  293 ILE A HG21 1 
ATOM   4368 H  HG22 . ILE A 1 293 ? 17.096  -23.009 -0.669  1.00 33.24  ?  293 ILE A HG22 1 
ATOM   4369 H  HG23 . ILE A 1 293 ? 16.855  -24.571 -0.506  1.00 33.24  ?  293 ILE A HG23 1 
ATOM   4370 H  HD11 . ILE A 1 293 ? 14.277  -25.019 2.753   1.00 33.74  ?  293 ILE A HD11 1 
ATOM   4371 H  HD12 . ILE A 1 293 ? 14.591  -23.464 2.667   1.00 33.74  ?  293 ILE A HD12 1 
ATOM   4372 H  HD13 . ILE A 1 293 ? 14.310  -24.292 1.340   1.00 33.74  ?  293 ILE A HD13 1 
ATOM   4373 N  N    . ALA A 1 294 ? 19.821  -23.300 -0.462  1.00 27.61  ?  294 ALA A N    1 
ATOM   4374 C  CA   . ALA A 1 294 ? 20.586  -22.472 -1.382  1.00 30.46  ?  294 ALA A CA   1 
ATOM   4375 C  C    . ALA A 1 294 ? 19.707  -22.016 -2.537  1.00 32.77  ?  294 ALA A C    1 
ATOM   4376 O  O    . ALA A 1 294 ? 18.876  -22.779 -3.040  1.00 29.15  ?  294 ALA A O    1 
ATOM   4377 C  CB   . ALA A 1 294 ? 21.795  -23.236 -1.925  1.00 32.05  ?  294 ALA A CB   1 
ATOM   4378 H  H    . ALA A 1 294 ? 19.756  -24.120 -0.711  1.00 33.21  ?  294 ALA A H    1 
ATOM   4379 H  HA   . ALA A 1 294 ? 20.907  -21.686 -0.915  1.00 36.64  ?  294 ALA A HA   1 
ATOM   4380 H  HB1  . ALA A 1 294 ? 22.284  -22.660 -2.534  1.00 38.54  ?  294 ALA A HB1  1 
ATOM   4381 H  HB2  . ALA A 1 294 ? 22.365  -23.493 -1.184  1.00 38.54  ?  294 ALA A HB2  1 
ATOM   4382 H  HB3  . ALA A 1 294 ? 21.484  -24.026 -2.394  1.00 38.54  ?  294 ALA A HB3  1 
ATOM   4383 N  N    . GLN A 1 295 ? 19.899  -20.766 -2.955  1.00 28.11  ?  295 GLN A N    1 
ATOM   4384 C  CA   . GLN A 1 295 ? 19.199  -20.210 -4.101  1.00 27.32  ?  295 GLN A CA   1 
ATOM   4385 C  C    . GLN A 1 295 ? 20.175  -19.436 -4.970  1.00 31.59  ?  295 GLN A C    1 
ATOM   4386 O  O    . GLN A 1 295 ? 21.103  -18.793 -4.472  1.00 29.23  ?  295 GLN A O    1 
ATOM   4387 C  CB   . GLN A 1 295 ? 18.068  -19.261 -3.698  1.00 37.42  ?  295 GLN A CB   1 
ATOM   4388 C  CG   . GLN A 1 295 ? 16.977  -19.877 -2.865  1.00 40.87  ?  295 GLN A CG   1 
ATOM   4389 C  CD   . GLN A 1 295 ? 15.927  -18.858 -2.500  1.00 34.98  ?  295 GLN A CD   1 
ATOM   4390 O  OE1  . GLN A 1 295 ? 15.834  -18.428 -1.351  1.00 41.53  ?  295 GLN A OE1  1 
ATOM   4391 N  NE2  . GLN A 1 295 ? 15.140  -18.448 -3.485  1.00 33.98  ?  295 GLN A NE2  1 
ATOM   4392 H  H    . GLN A 1 295 ? 20.440  -20.213 -2.580  1.00 33.81  ?  295 GLN A H    1 
ATOM   4393 H  HA   . GLN A 1 295 ? 18.822  -20.931 -4.630  1.00 32.87  ?  295 GLN A HA   1 
ATOM   4394 H  HB2  . GLN A 1 295 ? 18.448  -18.531 -3.186  1.00 44.99  ?  295 GLN A HB2  1 
ATOM   4395 H  HB3  . GLN A 1 295 ? 17.657  -18.913 -4.505  1.00 44.99  ?  295 GLN A HB3  1 
ATOM   4396 H  HG2  . GLN A 1 295 ? 16.549  -20.587 -3.370  1.00 49.13  ?  295 GLN A HG2  1 
ATOM   4397 H  HG3  . GLN A 1 295 ? 17.358  -20.229 -2.046  1.00 49.13  ?  295 GLN A HG3  1 
ATOM   4398 H  HE21 . GLN A 1 295 ? 15.238  -18.770 -4.276  1.00 40.85  ?  295 GLN A HE21 1 
ATOM   4399 H  HE22 . GLN A 1 295 ? 14.526  -17.866 -3.330  1.00 40.85  ?  295 GLN A HE22 1 
ATOM   4400 N  N    . HIS A 1 296 ? 19.939  -19.498 -6.277  1.00 30.29  ?  296 HIS A N    1 
ATOM   4401 C  CA   . HIS A 1 296 ? 20.634  -18.655 -7.240  1.00 37.45  ?  296 HIS A CA   1 
ATOM   4402 C  C    . HIS A 1 296 ? 19.982  -17.279 -7.251  1.00 40.27  ?  296 HIS A C    1 
ATOM   4403 O  O    . HIS A 1 296 ? 18.769  -17.163 -7.455  1.00 40.65  ?  296 HIS A O    1 
ATOM   4404 C  CB   . HIS A 1 296 ? 20.574  -19.296 -8.626  1.00 36.47  ?  296 HIS A CB   1 
ATOM   4405 C  CG   . HIS A 1 296 ? 21.265  -18.509 -9.696  1.00 52.17  ?  296 HIS A CG   1 
ATOM   4406 N  ND1  . HIS A 1 296 ? 20.699  -17.403 -10.293 1.00 58.34  ?  296 HIS A ND1  1 
ATOM   4407 C  CD2  . HIS A 1 296 ? 22.467  -18.685 -10.294 1.00 50.90  ?  296 HIS A CD2  1 
ATOM   4408 C  CE1  . HIS A 1 296 ? 21.529  -16.925 -11.203 1.00 50.70  ?  296 HIS A CE1  1 
ATOM   4409 N  NE2  . HIS A 1 296 ? 22.609  -17.685 -11.224 1.00 47.55  ?  296 HIS A NE2  1 
ATOM   4410 H  H    . HIS A 1 296 ? 19.369  -20.032 -6.636  1.00 36.44  ?  296 HIS A H    1 
ATOM   4411 H  HA   . HIS A 1 296 ? 21.563  -18.558 -6.981  1.00 45.02  ?  296 HIS A HA   1 
ATOM   4412 H  HB2  . HIS A 1 296 ? 20.994  -20.169 -8.583  1.00 43.85  ?  296 HIS A HB2  1 
ATOM   4413 H  HB3  . HIS A 1 296 ? 19.644  -19.392 -8.884  1.00 43.85  ?  296 HIS A HB3  1 
ATOM   4414 H  HD2  . HIS A 1 296 ? 23.085  -19.355 -10.105 1.00 61.16  ?  296 HIS A HD2  1 
ATOM   4415 H  HE1  . HIS A 1 296 ? 21.377  -16.180 -11.739 1.00 60.92  ?  296 HIS A HE1  1 
ATOM   4416 H  HE2  . HIS A 1 296 ? 23.290  -17.571 -11.736 1.00 57.14  ?  296 HIS A HE2  1 
ATOM   4417 N  N    . HIS A 1 297 ? 20.776  -16.239 -7.021  1.00 37.07  ?  297 HIS A N    1 
ATOM   4418 C  CA   . HIS A 1 297 ? 20.286  -14.867 -7.023  1.00 39.73  ?  297 HIS A CA   1 
ATOM   4419 C  C    . HIS A 1 297 ? 20.655  -14.212 -8.347  1.00 46.36  ?  297 HIS A C    1 
ATOM   4420 O  O    . HIS A 1 297 ? 21.839  -14.123 -8.693  1.00 41.54  ?  297 HIS A O    1 
ATOM   4421 C  CB   . HIS A 1 297 ? 20.860  -14.084 -5.844  1.00 39.70  ?  297 HIS A CB   1 
ATOM   4422 C  CG   . HIS A 1 297 ? 20.348  -14.543 -4.514  1.00 36.78  ?  297 HIS A CG   1 
ATOM   4423 N  ND1  . HIS A 1 297 ? 19.337  -13.892 -3.840  1.00 39.08  ?  297 HIS A ND1  1 
ATOM   4424 C  CD2  . HIS A 1 297 ? 20.697  -15.598 -3.740  1.00 34.54  ?  297 HIS A CD2  1 
ATOM   4425 C  CE1  . HIS A 1 297 ? 19.090  -14.521 -2.705  1.00 43.23  ?  297 HIS A CE1  1 
ATOM   4426 N  NE2  . HIS A 1 297 ? 19.901  -15.561 -2.620  1.00 37.19  ?  297 HIS A NE2  1 
ATOM   4427 H  H    . HIS A 1 297 ? 21.618  -16.304 -6.859  1.00 44.57  ?  297 HIS A H    1 
ATOM   4428 H  HA   . HIS A 1 297 ? 19.319  -14.871 -6.944  1.00 47.76  ?  297 HIS A HA   1 
ATOM   4429 H  HB2  . HIS A 1 297 ? 21.825  -14.183 -5.841  1.00 47.72  ?  297 HIS A HB2  1 
ATOM   4430 H  HB3  . HIS A 1 297 ? 20.626  -13.148 -5.945  1.00 47.72  ?  297 HIS A HB3  1 
ATOM   4431 H  HD1  . HIS A 1 297 ? 18.933  -13.185 -4.114  1.00 46.98  ?  297 HIS A HD1  1 
ATOM   4432 H  HD2  . HIS A 1 297 ? 21.353  -16.228 -3.930  1.00 41.53  ?  297 HIS A HD2  1 
ATOM   4433 H  HE1  . HIS A 1 297 ? 18.454  -14.275 -2.073  1.00 51.96  ?  297 HIS A HE1  1 
ATOM   4434 N  N    . HIS A 1 298 ? 19.643  -13.768 -9.086  1.00 50.69  ?  298 HIS A N    1 
ATOM   4435 C  CA   . HIS A 1 298 ? 19.848  -13.147 -10.391 1.00 59.05  ?  298 HIS A CA   1 
ATOM   4436 C  C    . HIS A 1 298 ? 19.763  -11.629 -10.286 1.00 59.81  ?  298 HIS A C    1 
ATOM   4437 O  O    . HIS A 1 298 ? 18.828  -11.091 -9.693  1.00 62.33  ?  298 HIS A O    1 
ATOM   4438 C  CB   . HIS A 1 298 ? 18.815  -13.663 -11.395 1.00 55.31  ?  298 HIS A CB   1 
ATOM   4439 H  H    . HIS A 1 298 ? 18.817  -13.816 -8.851  1.00 60.91  ?  298 HIS A H    1 
ATOM   4440 H  HA   . HIS A 1 298 ? 20.731  -13.379 -10.718 1.00 70.95  ?  298 HIS A HA   1 
HETATM 4441 C  CAA  . TMO B 2 .   ? -2.125  -48.816 25.379  1.00 49.05  ?  401 TMO A CAA  1 
HETATM 4442 N  NAC  . TMO B 2 .   ? -1.322  -49.011 24.189  1.00 47.03  1  401 TMO A NAC  1 
HETATM 4443 C  CAD  . TMO B 2 .   ? 0.028   -49.416 24.539  1.00 41.93  ?  401 TMO A CAD  1 
HETATM 4444 C  CAB  . TMO B 2 .   ? -1.918  -50.083 23.417  1.00 43.21  ?  401 TMO A CAB  1 
HETATM 4445 O  OAE  . TMO B 2 .   ? -1.288  -47.819 23.442  1.00 45.60  -1 401 TMO A OAE  1 
HETATM 4446 H  HAA  . TMO B 2 .   ? -1.724  -48.126 25.930  1.00 58.95  ?  401 TMO A HAA  1 
HETATM 4447 H  HAAA . TMO B 2 .   ? -2.167  -49.645 25.880  1.00 58.95  ?  401 TMO A HAAA 1 
HETATM 4448 H  HAAB . TMO B 2 .   ? -3.021  -48.546 25.124  1.00 58.95  ?  401 TMO A HAAB 1 
HETATM 4449 H  HAD  . TMO B 2 .   ? 0.440   -48.729 25.085  1.00 50.40  ?  401 TMO A HAD  1 
HETATM 4450 H  HADA . TMO B 2 .   ? -0.003  -50.249 25.035  1.00 50.40  ?  401 TMO A HADA 1 
HETATM 4451 H  HADB . TMO B 2 .   ? 0.548   -49.541 23.729  1.00 50.40  ?  401 TMO A HADB 1 
HETATM 4452 H  HAB  . TMO B 2 .   ? -1.931  -50.895 23.948  1.00 51.93  ?  401 TMO A HAB  1 
HETATM 4453 H  HABA . TMO B 2 .   ? -1.396  -50.232 22.613  1.00 51.93  ?  401 TMO A HABA 1 
HETATM 4454 H  HABB . TMO B 2 .   ? -2.825  -49.841 23.173  1.00 51.93  ?  401 TMO A HABB 1 
HETATM 4455 C  CAA  . TMO C 2 .   ? 2.957   -49.287 10.709  1.00 56.67  ?  402 TMO A CAA  1 
HETATM 4456 N  NAC  . TMO C 2 .   ? 4.143   -48.953 9.941   1.00 55.56  1  402 TMO A NAC  1 
HETATM 4457 C  CAD  . TMO C 2 .   ? 5.322   -49.181 10.758  1.00 41.53  ?  402 TMO A CAD  1 
HETATM 4458 C  CAB  . TMO C 2 .   ? 4.208   -49.793 8.758   1.00 60.76  ?  402 TMO A CAB  1 
HETATM 4459 O  OAE  . TMO C 2 .   ? 4.089   -47.604 9.555   1.00 51.38  -1 402 TMO A OAE  1 
HETATM 4460 H  HAA  . TMO C 2 .   ? 2.995   -50.220 10.973  1.00 68.09  ?  402 TMO A HAA  1 
HETATM 4461 H  HAAA . TMO C 2 .   ? 2.917   -48.729 11.501  1.00 68.09  ?  402 TMO A HAAA 1 
HETATM 4462 H  HAAB . TMO C 2 .   ? 2.168   -49.136 10.167  1.00 68.09  ?  402 TMO A HAAB 1 
HETATM 4463 H  HAD  . TMO C 2 .   ? 6.117   -48.958 10.249  1.00 49.92  ?  402 TMO A HAD  1 
HETATM 4464 H  HADA . TMO C 2 .   ? 5.279   -48.622 11.551  1.00 49.92  ?  402 TMO A HADA 1 
HETATM 4465 H  HADB . TMO C 2 .   ? 5.357   -50.113 11.022  1.00 49.92  ?  402 TMO A HADB 1 
HETATM 4466 H  HAB  . TMO C 2 .   ? 4.248   -50.724 9.025   1.00 73.00  ?  402 TMO A HAB  1 
HETATM 4467 H  HABA . TMO C 2 .   ? 5.000   -49.569 8.246   1.00 73.00  ?  402 TMO A HABA 1 
HETATM 4468 H  HABB . TMO C 2 .   ? 3.419   -49.646 8.214   1.00 73.00  ?  402 TMO A HABB 1 
HETATM 4469 C  CAA  . TMO D 2 .   ? -0.543  -43.341 -3.110  1.00 68.24  ?  403 TMO A CAA  1 
HETATM 4470 N  NAC  . TMO D 2 .   ? 0.888   -43.261 -2.877  1.00 73.17  1  403 TMO A NAC  1 
HETATM 4471 C  CAD  . TMO D 2 .   ? 1.203   -43.776 -1.556  1.00 74.35  ?  403 TMO A CAD  1 
HETATM 4472 C  CAB  . TMO D 2 .   ? 1.587   -44.045 -3.880  1.00 68.44  ?  403 TMO A CAB  1 
HETATM 4473 O  OAE  . TMO D 2 .   ? 1.296   -41.924 -2.959  1.00 62.39  -1 403 TMO A OAE  1 
HETATM 4474 H  HAA  . TMO D 2 .   ? -0.830  -44.266 -3.050  1.00 81.98  ?  403 TMO A HAA  1 
HETATM 4475 H  HAAA . TMO D 2 .   ? -0.747  -42.996 -3.993  1.00 81.98  ?  403 TMO A HAAA 1 
HETATM 4476 H  HAAB . TMO D 2 .   ? -1.009  -42.814 -2.442  1.00 81.98  ?  403 TMO A HAAB 1 
HETATM 4477 H  HAD  . TMO D 2 .   ? 2.160   -43.721 -1.406  1.00 89.30  ?  403 TMO A HAD  1 
HETATM 4478 H  HADA . TMO D 2 .   ? 0.740   -43.251 -0.885  1.00 89.30  ?  403 TMO A HADA 1 
HETATM 4479 H  HADB . TMO D 2 .   ? 0.919   -44.702 -1.494  1.00 89.30  ?  403 TMO A HADB 1 
HETATM 4480 H  HAB  . TMO D 2 .   ? 1.301   -44.971 -3.825  1.00 82.21  ?  403 TMO A HAB  1 
HETATM 4481 H  HABA . TMO D 2 .   ? 2.543   -43.992 -3.725  1.00 82.21  ?  403 TMO A HABA 1 
HETATM 4482 H  HABB . TMO D 2 .   ? 1.383   -43.697 -4.762  1.00 82.21  ?  403 TMO A HABB 1 
HETATM 4483 K  K    . K   E 3 .   ? 0.000   -52.978 67.071  0.47 105.63 1  404 K   A K    1 
HETATM 4484 K  K    . K   F 3 .   ? -0.000  -52.978 62.311  0.28 50.78  1  405 K   A K    1 
HETATM 4485 K  K    . K   G 3 .   ? 0.000   -52.978 58.968  0.37 58.94  1  406 K   A K    1 
HETATM 4486 K  K    . K   H 3 .   ? -0.000  -52.978 56.059  0.32 63.64  1  407 K   A K    1 
HETATM 4487 K  K    . K   I 3 .   ? 0.000   -52.978 39.726  0.24 105.58 1  408 K   A K    1 
HETATM 4488 K  K    . K   J 3 .   ? -0.000  -52.978 25.799  0.37 53.23  1  409 K   A K    1 
HETATM 4489 K  K    . K   K 3 .   ? -0.000  -52.978 22.881  0.26 90.57  1  410 K   A K    1 
HETATM 4490 K  K    . K   L 3 .   ? -3.295  -52.743 47.396  0.78 79.05  1  411 K   A K    1 
HETATM 4491 K  K    . K   M 3 .   ? -2.022  -50.659 48.568  0.72 76.96  1  412 K   A K    1 
HETATM 4492 BA BA   . BA  N 4 .   ? 0.000   -52.978 52.724  0.38 108.46 2  413 BA  A BA   1 
HETATM 4493 CL CL   . CL  O 5 .   ? 15.552  -41.122 -3.239  1.00 44.78  -1 414 CL  A CL   1 
HETATM 4494 C  C20  . PCW P 6 .   ? -5.712  -65.285 43.974  1.00 55.17  ?  415 PCW A C20  1 
HETATM 4495 C  C21  . PCW P 6 .   ? -6.808  -64.803 44.920  1.00 52.29  ?  415 PCW A C21  1 
HETATM 4496 C  C22  . PCW P 6 .   ? -7.717  -63.761 44.275  1.00 55.79  ?  415 PCW A C22  1 
HETATM 4497 C  C23  . PCW P 6 .   ? -7.576  -62.395 44.940  1.00 57.62  ?  415 PCW A C23  1 
HETATM 4498 C  C24  . PCW P 6 .   ? -8.173  -61.279 44.090  1.00 55.08  ?  415 PCW A C24  1 
HETATM 4499 C  C25  . PCW P 6 .   ? -7.827  -59.898 44.641  1.00 58.54  ?  415 PCW A C25  1 
HETATM 4500 C  C26  . PCW P 6 .   ? -7.419  -58.898 43.560  1.00 60.33  ?  415 PCW A C26  1 
HETATM 4501 C  C27  . PCW P 6 .   ? -8.308  -57.658 43.542  1.00 56.26  ?  415 PCW A C27  1 
HETATM 4502 C  C28  . PCW P 6 .   ? -7.679  -56.514 42.752  1.00 47.52  ?  415 PCW A C28  1 
HETATM 4503 H  H20  . PCW P 6 .   ? -5.114  -64.546 43.782  1.00 66.29  ?  415 PCW A H20  1 
HETATM 4504 H  H211 . PCW P 6 .   ? -6.394  -64.414 45.707  1.00 62.83  ?  415 PCW A H211 1 
HETATM 4505 H  H212 . PCW P 6 .   ? -7.345  -65.563 45.192  1.00 62.83  ?  415 PCW A H212 1 
HETATM 4506 H  H221 . PCW P 6 .   ? -8.638  -64.055 44.351  1.00 67.03  ?  415 PCW A H221 1 
HETATM 4507 H  H222 . PCW P 6 .   ? -7.488  -63.680 43.336  1.00 67.03  ?  415 PCW A H222 1 
HETATM 4508 H  H231 . PCW P 6 .   ? -8.028  -62.415 45.797  1.00 69.23  ?  415 PCW A H231 1 
HETATM 4509 H  H232 . PCW P 6 .   ? -6.634  -62.212 45.084  1.00 69.23  ?  415 PCW A H232 1 
HETATM 4510 H  H241 . PCW P 6 .   ? -9.138  -61.379 44.071  1.00 66.18  ?  415 PCW A H241 1 
HETATM 4511 H  H242 . PCW P 6 .   ? -7.830  -61.353 43.185  1.00 66.18  ?  415 PCW A H242 1 
HETATM 4512 H  H251 . PCW P 6 .   ? -7.096  -59.989 45.271  1.00 70.33  ?  415 PCW A H251 1 
HETATM 4513 H  H252 . PCW P 6 .   ? -8.601  -59.548 45.111  1.00 70.33  ?  415 PCW A H252 1 
HETATM 4514 H  H261 . PCW P 6 .   ? -7.471  -59.333 42.694  1.00 72.48  ?  415 PCW A H261 1 
HETATM 4515 H  H262 . PCW P 6 .   ? -6.502  -58.623 43.717  1.00 72.48  ?  415 PCW A H262 1 
HETATM 4516 H  H271 . PCW P 6 .   ? -8.459  -57.366 44.454  1.00 67.59  ?  415 PCW A H271 1 
HETATM 4517 H  H272 . PCW P 6 .   ? -9.160  -57.888 43.139  1.00 67.59  ?  415 PCW A H272 1 
HETATM 4518 H  H281 . PCW P 6 .   ? -8.350  -55.837 42.575  1.00 57.11  ?  415 PCW A H281 1 
HETATM 4519 H  H282 . PCW P 6 .   ? -7.332  -56.853 41.913  1.00 57.11  ?  415 PCW A H282 1 
HETATM 4520 H  H283 . PCW P 6 .   ? -6.955  -56.125 43.268  1.00 57.11  ?  415 PCW A H283 1 
HETATM 4521 C  C4   . PCW Q 6 .   ? 19.823  -37.016 -2.063  1.00 76.54  ?  416 PCW A C4   1 
HETATM 4522 C  C5   . PCW Q 6 .   ? 18.342  -37.146 -1.723  1.00 67.68  ?  416 PCW A C5   1 
HETATM 4523 C  C6   . PCW Q 6 .   ? 18.808  -39.454 -1.462  1.00 60.61  ?  416 PCW A C6   1 
HETATM 4524 C  C7   . PCW Q 6 .   ? 17.789  -38.660 -3.452  1.00 56.21  ?  416 PCW A C7   1 
HETATM 4525 C  C8   . PCW Q 6 .   ? 16.565  -38.680 -1.415  1.00 59.16  ?  416 PCW A C8   1 
HETATM 4526 N  N    . PCW Q 6 .   ? 17.875  -38.488 -2.012  1.00 62.84  1  416 PCW A N    1 
HETATM 4527 O  O1P  . PCW Q 6 .   ? 17.738  -34.607 -3.137  1.00 82.49  ?  416 PCW A O1P  1 
HETATM 4528 O  O2P  . PCW Q 6 .   ? 19.977  -33.762 -4.097  1.00 94.71  -1 416 PCW A O2P  1 
HETATM 4529 O  O3P  . PCW Q 6 .   ? 19.788  -34.084 -1.657  1.00 88.76  ?  416 PCW A O3P  1 
HETATM 4530 O  O4P  . PCW Q 6 .   ? 19.926  -36.167 -3.169  1.00 77.24  ?  416 PCW A O4P  1 
HETATM 4531 P  P    . PCW Q 6 .   ? 19.381  -34.621 -3.008  1.00 90.86  ?  416 PCW A P    1 
HETATM 4532 O  O01  . Z3P R 7 .   ? 17.482  -42.752 7.194   1.00 30.26  -1 417 Z3P A O01  1 
HETATM 4533 C  C02  . Z3P R 7 .   ? 18.590  -42.329 6.772   1.00 28.87  ?  417 Z3P A C02  1 
HETATM 4534 O  O03  . Z3P R 7 .   ? 19.422  -41.824 7.570   1.00 29.14  ?  417 Z3P A O03  1 
HETATM 4535 C  C04  . Z3P R 7 .   ? 18.930  -42.417 5.287   1.00 28.69  ?  417 Z3P A C04  1 
HETATM 4536 C  C05  . Z3P R 7 .   ? 20.201  -41.641 4.964   1.00 30.59  ?  417 Z3P A C05  1 
HETATM 4537 P  P06  . Z3P R 7 .   ? 20.633  -41.742 3.158   1.00 35.69  ?  417 Z3P A P06  1 
HETATM 4538 O  O07  . Z3P R 7 .   ? 20.679  -43.129 2.641   1.00 23.83  ?  417 Z3P A O07  1 
HETATM 4539 C  C08  . Z3P R 7 .   ? 22.252  -40.840 2.997   1.00 35.18  ?  417 Z3P A C08  1 
HETATM 4540 C  C09  . Z3P R 7 .   ? 23.317  -41.421 3.923   1.00 39.28  ?  417 Z3P A C09  1 
HETATM 4541 C  C10  . Z3P R 7 .   ? 24.668  -40.723 3.777   1.00 37.31  ?  417 Z3P A C10  1 
HETATM 4542 O  O11  . Z3P R 7 .   ? 24.812  -39.767 2.967   1.00 33.31  ?  417 Z3P A O11  1 
HETATM 4543 O  O12  . Z3P R 7 .   ? 25.644  -41.107 4.471   1.00 41.70  -1 417 Z3P A O12  1 
HETATM 4544 C  C13  . Z3P R 7 .   ? 19.374  -40.696 2.265   1.00 29.35  ?  417 Z3P A C13  1 
HETATM 4545 C  C14  . Z3P R 7 .   ? 19.322  -39.274 2.824   1.00 30.73  ?  417 Z3P A C14  1 
HETATM 4546 C  C15  . Z3P R 7 .   ? 18.218  -38.413 2.212   1.00 34.75  ?  417 Z3P A C15  1 
HETATM 4547 O  O16  . Z3P R 7 .   ? 17.216  -38.947 1.670   1.00 32.20  -1 417 Z3P A O16  1 
HETATM 4548 O  O17  . Z3P R 7 .   ? 18.307  -37.157 2.261   1.00 36.53  ?  417 Z3P A O17  1 
HETATM 4549 H  H041 . Z3P R 7 .   ? 18.195  -42.051 4.771   1.00 34.51  ?  417 Z3P A H041 1 
HETATM 4550 H  H042 . Z3P R 7 .   ? 19.055  -43.348 5.045   1.00 34.51  ?  417 Z3P A H042 1 
HETATM 4551 H  H051 . Z3P R 7 .   ? 20.934  -42.006 5.484   1.00 36.79  ?  417 Z3P A H051 1 
HETATM 4552 H  H052 . Z3P R 7 .   ? 20.074  -40.711 5.207   1.00 36.79  ?  417 Z3P A H052 1 
HETATM 4553 H  H081 . Z3P R 7 .   ? 22.117  -39.906 3.219   1.00 42.30  ?  417 Z3P A H081 1 
HETATM 4554 H  H082 . Z3P R 7 .   ? 22.561  -40.906 2.080   1.00 42.30  ?  417 Z3P A H082 1 
HETATM 4555 H  H091 . Z3P R 7 .   ? 23.427  -42.363 3.720   1.00 47.22  ?  417 Z3P A H091 1 
HETATM 4556 H  H092 . Z3P R 7 .   ? 23.016  -41.332 4.841   1.00 47.22  ?  417 Z3P A H092 1 
HETATM 4557 H  H131 . Z3P R 7 .   ? 18.499  -41.105 2.358   1.00 35.31  ?  417 Z3P A H131 1 
HETATM 4558 H  H132 . Z3P R 7 .   ? 19.606  -40.657 1.323   1.00 35.31  ?  417 Z3P A H132 1 
HETATM 4559 H  H141 . Z3P R 7 .   ? 19.180  -39.323 3.782   1.00 36.96  ?  417 Z3P A H141 1 
HETATM 4560 H  H142 . Z3P R 7 .   ? 20.176  -38.845 2.659   1.00 36.96  ?  417 Z3P A H142 1 
HETATM 4561 O  O    . HOH S 8 .   ? 22.363  -21.824 8.728   1.00 56.39  ?  501 HOH A O    1 
HETATM 4562 O  O    . HOH S 8 .   ? -19.534 -44.488 66.259  1.00 56.41  ?  502 HOH A O    1 
HETATM 4563 O  O    . HOH S 8 .   ? -11.572 -21.032 11.937  1.00 55.55  ?  503 HOH A O    1 
HETATM 4564 O  O    . HOH S 8 .   ? 3.427   -40.424 -14.357 1.00 57.97  ?  504 HOH A O    1 
HETATM 4565 O  O    . HOH S 8 .   ? 18.913  -46.574 23.026  1.00 46.31  ?  505 HOH A O    1 
HETATM 4566 O  O    A HOH S 8 .   ? -3.771  -52.210 35.122  0.41 35.26  ?  506 HOH A O    1 
HETATM 4567 O  O    B HOH S 8 .   ? -1.839  -52.038 34.810  0.59 39.01  ?  506 HOH A O    1 
HETATM 4568 O  O    . HOH S 8 .   ? -1.019  -31.359 15.295  1.00 53.67  ?  507 HOH A O    1 
HETATM 4569 O  O    . HOH S 8 .   ? 15.124  -19.873 -5.881  1.00 41.47  ?  508 HOH A O    1 
HETATM 4570 O  O    . HOH S 8 .   ? 3.590   -37.698 -10.648 1.00 43.87  ?  509 HOH A O    1 
HETATM 4571 O  O    . HOH S 8 .   ? -19.824 -28.817 13.731  1.00 47.99  ?  510 HOH A O    1 
HETATM 4572 O  O    . HOH S 8 .   ? 6.116   -46.906 25.371  1.00 31.45  ?  511 HOH A O    1 
HETATM 4573 O  O    . HOH S 8 .   ? 18.558  -28.855 -10.039 1.00 42.03  ?  512 HOH A O    1 
HETATM 4574 O  O    . HOH S 8 .   ? 26.953  -26.363 10.443  1.00 55.17  ?  513 HOH A O    1 
HETATM 4575 O  O    . HOH S 8 .   ? -21.566 -35.200 -14.862 1.00 46.78  ?  514 HOH A O    1 
HETATM 4576 O  O    . HOH S 8 .   ? -3.965  -25.222 -8.263  1.00 46.78  ?  515 HOH A O    1 
HETATM 4577 O  O    . HOH S 8 .   ? -8.211  -26.072 -8.386  1.00 40.58  ?  516 HOH A O    1 
HETATM 4578 O  O    . HOH S 8 .   ? 23.933  -38.216 1.164   1.00 41.04  ?  517 HOH A O    1 
HETATM 4579 O  O    . HOH S 8 .   ? 6.853   -55.090 7.680   1.00 48.23  ?  518 HOH A O    1 
HETATM 4580 O  O    . HOH S 8 .   ? 5.686   -38.104 -9.182  1.00 36.92  ?  519 HOH A O    1 
HETATM 4581 O  O    . HOH S 8 .   ? 18.771  -33.330 1.469   1.00 38.27  ?  520 HOH A O    1 
HETATM 4582 O  O    . HOH S 8 .   ? 11.320  -47.725 -0.531  1.00 38.67  ?  521 HOH A O    1 
HETATM 4583 O  O    . HOH S 8 .   ? 2.693   -39.179 -0.523  1.00 29.83  ?  522 HOH A O    1 
HETATM 4584 O  O    . HOH S 8 .   ? 4.880   -24.275 7.976   1.00 32.60  ?  523 HOH A O    1 
HETATM 4585 O  O    . HOH S 8 .   ? 15.500  -43.107 5.535   1.00 32.19  ?  524 HOH A O    1 
HETATM 4586 O  O    . HOH S 8 .   ? 3.702   -30.347 -21.280 1.00 56.43  ?  525 HOH A O    1 
HETATM 4587 O  O    . HOH S 8 .   ? 4.537   -21.201 -3.786  1.00 33.39  ?  526 HOH A O    1 
HETATM 4588 O  O    . HOH S 8 .   ? 19.510  -43.058 14.682  1.00 43.26  ?  527 HOH A O    1 
HETATM 4589 O  O    . HOH S 8 .   ? 4.841   -46.568 2.041   1.00 49.27  ?  528 HOH A O    1 
HETATM 4590 O  O    . HOH S 8 .   ? -16.103 -45.465 69.897  1.00 47.71  ?  529 HOH A O    1 
HETATM 4591 O  O    . HOH S 8 .   ? -1.109  -21.866 1.052   1.00 38.87  ?  530 HOH A O    1 
HETATM 4592 O  O    . HOH S 8 .   ? -5.677  -27.055 3.912   1.00 36.64  ?  531 HOH A O    1 
HETATM 4593 O  O    . HOH S 8 .   ? -16.042 -46.591 67.184  1.00 43.63  ?  532 HOH A O    1 
HETATM 4594 O  O    . HOH S 8 .   ? 13.072  -40.455 17.085  1.00 27.22  ?  533 HOH A O    1 
HETATM 4595 O  O    . HOH S 8 .   ? 2.729   -31.548 15.165  1.00 34.00  ?  534 HOH A O    1 
HETATM 4596 O  O    . HOH S 8 .   ? -5.308  -19.928 -11.175 1.00 48.94  ?  535 HOH A O    1 
HETATM 4597 O  O    . HOH S 8 .   ? 12.816  -36.164 -9.732  1.00 29.86  ?  536 HOH A O    1 
HETATM 4598 O  O    . HOH S 8 .   ? 17.263  -36.136 21.527  1.00 55.58  ?  537 HOH A O    1 
HETATM 4599 O  O    . HOH S 8 .   ? 17.346  -30.213 -6.772  1.00 36.65  ?  538 HOH A O    1 
HETATM 4600 O  O    . HOH S 8 .   ? 1.278   -18.012 -12.962 1.00 51.17  ?  539 HOH A O    1 
HETATM 4601 O  O    . HOH S 8 .   ? -0.167  -24.659 5.842   1.00 43.44  ?  540 HOH A O    1 
HETATM 4602 O  O    . HOH S 8 .   ? -19.559 -54.673 63.399  1.00 51.05  ?  541 HOH A O    1 
HETATM 4603 O  O    . HOH S 8 .   ? 17.556  -19.712 0.761   1.00 36.38  ?  542 HOH A O    1 
HETATM 4604 O  O    . HOH S 8 .   ? -9.036  -27.701 3.994   1.00 42.30  ?  543 HOH A O    1 
HETATM 4605 O  O    . HOH S 8 .   ? -5.500  -49.217 61.415  1.00 43.82  ?  544 HOH A O    1 
HETATM 4606 O  O    . HOH S 8 .   ? -16.807 -38.059 28.993  1.00 43.75  ?  545 HOH A O    1 
HETATM 4607 O  O    . HOH S 8 .   ? 13.551  -40.110 -0.818  1.00 28.29  ?  546 HOH A O    1 
HETATM 4608 O  O    . HOH S 8 .   ? 18.978  -35.464 4.249   1.00 41.73  ?  547 HOH A O    1 
HETATM 4609 O  O    . HOH S 8 .   ? 7.444   -24.810 8.386   1.00 31.52  ?  548 HOH A O    1 
HETATM 4610 O  O    . HOH S 8 .   ? -15.458 -42.712 64.901  1.00 45.91  ?  549 HOH A O    1 
HETATM 4611 O  O    . HOH S 8 .   ? 3.730   -40.527 17.901  1.00 27.40  ?  550 HOH A O    1 
HETATM 4612 O  O    . HOH S 8 .   ? -2.143  -21.431 3.170   1.00 45.92  ?  551 HOH A O    1 
HETATM 4613 O  O    . HOH S 8 .   ? 26.140  -23.475 4.221   1.00 55.43  ?  552 HOH A O    1 
HETATM 4614 O  O    . HOH S 8 .   ? 5.496   -30.289 13.063  1.00 37.57  ?  553 HOH A O    1 
HETATM 4615 O  O    . HOH S 8 .   ? -5.535  -22.286 -9.461  1.00 49.02  ?  554 HOH A O    1 
HETATM 4616 O  O    . HOH S 8 .   ? 7.663   -49.246 25.348  1.00 30.49  ?  555 HOH A O    1 
HETATM 4617 O  O    . HOH S 8 .   ? -3.013  -36.961 -15.339 1.00 51.88  ?  556 HOH A O    1 
HETATM 4618 O  O    . HOH S 8 .   ? 5.209   -37.214 17.366  1.00 28.78  ?  557 HOH A O    1 
HETATM 4619 O  O    . HOH S 8 .   ? -6.423  -48.059 30.413  1.00 32.92  ?  558 HOH A O    1 
HETATM 4620 O  O    . HOH S 8 .   ? -2.895  -42.894 0.090   1.00 48.75  ?  559 HOH A O    1 
HETATM 4621 O  O    . HOH S 8 .   ? 19.583  -25.267 9.799   1.00 39.51  ?  560 HOH A O    1 
HETATM 4622 O  O    . HOH S 8 .   ? 18.949  -42.706 23.668  1.00 53.86  ?  561 HOH A O    1 
HETATM 4623 O  O    . HOH S 8 .   ? 9.657   -18.758 2.781   1.00 52.91  ?  562 HOH A O    1 
HETATM 4624 O  O    . HOH S 8 .   ? -14.606 -36.402 23.049  1.00 37.57  ?  563 HOH A O    1 
HETATM 4625 O  O    . HOH S 8 .   ? -19.075 -27.888 19.044  1.00 61.94  ?  564 HOH A O    1 
HETATM 4626 O  O    . HOH S 8 .   ? 17.713  -20.908 -7.162  1.00 38.81  ?  565 HOH A O    1 
HETATM 4627 O  O    . HOH S 8 .   ? -14.691 -33.341 -13.522 1.00 45.47  ?  566 HOH A O    1 
HETATM 4628 O  O    . HOH S 8 .   ? -4.167  -37.698 -6.748  1.00 41.39  ?  567 HOH A O    1 
HETATM 4629 O  O    . HOH S 8 .   ? -14.234 -43.029 25.743  1.00 32.72  ?  568 HOH A O    1 
HETATM 4630 O  O    . HOH S 8 .   ? 4.596   -42.748 -3.592  1.00 41.45  ?  569 HOH A O    1 
HETATM 4631 O  O    . HOH S 8 .   ? 10.814  -39.592 -1.503  1.00 27.22  ?  570 HOH A O    1 
HETATM 4632 O  O    . HOH S 8 .   ? -10.469 -57.843 62.848  1.00 56.76  ?  571 HOH A O    1 
HETATM 4633 O  O    . HOH S 8 .   ? -4.527  -46.726 63.440  1.00 39.60  ?  572 HOH A O    1 
HETATM 4634 O  O    . HOH S 8 .   ? -10.365 -27.383 -10.263 1.00 42.61  ?  573 HOH A O    1 
HETATM 4635 O  O    . HOH S 8 .   ? -17.611 -47.222 63.763  1.00 55.46  ?  574 HOH A O    1 
HETATM 4636 O  O    . HOH S 8 .   ? 38.115  -34.684 11.422  1.00 59.94  ?  575 HOH A O    1 
HETATM 4637 O  O    . HOH S 8 .   ? 10.391  -26.930 11.332  1.00 39.70  ?  576 HOH A O    1 
HETATM 4638 O  O    . HOH S 8 .   ? 10.360  -19.133 -4.175  1.00 35.39  ?  577 HOH A O    1 
HETATM 4639 O  O    . HOH S 8 .   ? 18.301  -28.488 -14.387 1.00 49.68  ?  578 HOH A O    1 
HETATM 4640 O  O    . HOH S 8 .   ? 14.040  -25.213 5.620   1.00 32.57  ?  579 HOH A O    1 
HETATM 4641 O  O    . HOH S 8 .   ? -8.178  -39.524 63.817  1.00 48.57  ?  580 HOH A O    1 
HETATM 4642 O  O    . HOH S 8 .   ? 15.629  -44.740 -7.811  1.00 43.90  ?  581 HOH A O    1 
HETATM 4643 O  O    . HOH S 8 .   ? -11.082 -57.431 58.795  1.00 43.19  ?  582 HOH A O    1 
HETATM 4644 O  O    . HOH S 8 .   ? -4.640  -39.602 -2.589  1.00 40.18  ?  583 HOH A O    1 
HETATM 4645 O  O    . HOH S 8 .   ? 6.285   -54.242 19.501  1.00 47.69  ?  584 HOH A O    1 
HETATM 4646 O  O    . HOH S 8 .   ? -0.124  -38.355 29.103  1.00 45.64  ?  585 HOH A O    1 
HETATM 4647 O  O    . HOH S 8 .   ? 1.753   -38.513 -9.913  1.00 51.43  ?  586 HOH A O    1 
HETATM 4648 O  O    . HOH S 8 .   ? -13.180 -25.122 16.842  1.00 48.32  ?  587 HOH A O    1 
HETATM 4649 O  O    . HOH S 8 .   ? 3.330   -41.665 0.051   1.00 38.39  ?  588 HOH A O    1 
HETATM 4650 O  O    . HOH S 8 .   ? 8.856   -35.568 19.019  1.00 39.91  ?  589 HOH A O    1 
HETATM 4651 O  O    . HOH S 8 .   ? -5.059  -27.891 33.209  1.00 54.66  ?  590 HOH A O    1 
HETATM 4652 O  O    . HOH S 8 .   ? 9.195   -46.369 -1.613  1.00 31.63  ?  591 HOH A O    1 
HETATM 4653 O  O    . HOH S 8 .   ? -23.432 -27.786 -9.903  1.00 51.69  ?  592 HOH A O    1 
HETATM 4654 O  O    . HOH S 8 .   ? 9.285   -31.435 15.296  1.00 57.47  ?  593 HOH A O    1 
HETATM 4655 O  O    . HOH S 8 .   ? 16.951  -29.894 -2.637  1.00 26.88  ?  594 HOH A O    1 
HETATM 4656 O  O    . HOH S 8 .   ? 17.053  -24.448 -9.330  1.00 57.42  ?  595 HOH A O    1 
HETATM 4657 O  O    . HOH S 8 .   ? 25.448  -28.883 0.005   1.00 40.85  ?  596 HOH A O    1 
HETATM 4658 O  O    . HOH S 8 .   ? -10.965 -31.178 15.598  1.00 49.27  ?  597 HOH A O    1 
HETATM 4659 O  O    . HOH S 8 .   ? 8.362   -33.334 -15.727 1.00 47.52  ?  598 HOH A O    1 
HETATM 4660 O  O    . HOH S 8 .   ? 8.152   -35.647 16.314  1.00 38.53  ?  599 HOH A O    1 
HETATM 4661 O  O    . HOH S 8 .   ? -1.463  -37.767 -6.072  1.00 38.21  ?  600 HOH A O    1 
HETATM 4662 O  O    . HOH S 8 .   ? 5.983   -44.473 -4.531  1.00 61.05  ?  601 HOH A O    1 
HETATM 4663 O  O    . HOH S 8 .   ? 7.364   -33.597 15.030  1.00 51.02  ?  602 HOH A O    1 
HETATM 4664 O  O    . HOH S 8 .   ? 15.251  -26.831 14.397  1.00 33.42  ?  603 HOH A O    1 
HETATM 4665 O  O    . HOH S 8 .   ? -13.234 -24.474 -1.700  1.00 46.64  ?  604 HOH A O    1 
HETATM 4666 O  O    . HOH S 8 .   ? 1.051   -37.799 -7.606  1.00 26.87  ?  605 HOH A O    1 
HETATM 4667 O  O    . HOH S 8 .   ? 3.783   -33.982 15.002  1.00 31.06  ?  606 HOH A O    1 
HETATM 4668 O  O    . HOH S 8 .   ? -21.540 -44.227 64.830  1.00 47.81  ?  607 HOH A O    1 
HETATM 4669 O  O    . HOH S 8 .   ? 23.620  -34.561 2.579   1.00 43.10  ?  608 HOH A O    1 
HETATM 4670 O  O    . HOH S 8 .   ? -9.625  -34.622 64.649  1.00 54.81  ?  609 HOH A O    1 
HETATM 4671 O  O    . HOH S 8 .   ? 9.555   -29.964 13.163  1.00 29.97  ?  610 HOH A O    1 
HETATM 4672 O  O    . HOH S 8 .   ? 6.237   -20.125 -9.556  1.00 47.48  ?  611 HOH A O    1 
HETATM 4673 O  O    . HOH S 8 .   ? -3.509  -36.750 25.211  1.00 47.60  ?  612 HOH A O    1 
HETATM 4674 O  O    . HOH S 8 .   ? -7.538  -30.687 30.936  1.00 42.61  ?  613 HOH A O    1 
HETATM 4675 O  O    . HOH S 8 .   ? 1.585   -21.972 11.831  1.00 48.82  ?  614 HOH A O    1 
HETATM 4676 O  O    . HOH S 8 .   ? -10.386 -19.748 -6.675  1.00 49.61  ?  615 HOH A O    1 
HETATM 4677 O  O    . HOH S 8 .   ? -15.827 -44.262 27.574  1.00 45.03  ?  616 HOH A O    1 
HETATM 4678 O  O    . HOH S 8 .   ? 2.006   -49.807 17.937  1.00 42.62  ?  617 HOH A O    1 
HETATM 4679 O  O    . HOH S 8 .   ? -10.066 -36.052 -0.905  1.00 41.03  ?  618 HOH A O    1 
HETATM 4680 O  O    . HOH S 8 .   ? 7.784   -46.029 -3.090  1.00 52.35  ?  619 HOH A O    1 
HETATM 4681 O  O    . HOH S 8 .   ? 18.587  -31.040 -4.547  1.00 40.59  ?  620 HOH A O    1 
HETATM 4682 O  O    . HOH S 8 .   ? 16.183  -26.046 -10.385 1.00 35.97  ?  621 HOH A O    1 
HETATM 4683 O  O    . HOH S 8 .   ? 3.809   -17.343 -9.858  1.00 47.09  ?  622 HOH A O    1 
HETATM 4684 O  O    . HOH S 8 .   ? -0.404  -32.189 31.291  1.00 44.91  ?  623 HOH A O    1 
HETATM 4685 O  O    . HOH S 8 .   ? 2.297   -43.258 19.713  1.00 49.94  ?  624 HOH A O    1 
HETATM 4686 O  O    . HOH S 8 .   ? 1.713   -38.383 21.553  1.00 47.49  ?  625 HOH A O    1 
HETATM 4687 O  O    . HOH S 8 .   ? 12.155  -52.473 19.352  1.00 46.96  ?  626 HOH A O    1 
HETATM 4688 O  O    . HOH S 8 .   ? 21.556  -34.103 2.977   1.00 40.38  ?  627 HOH A O    1 
HETATM 4689 O  O    . HOH S 8 .   ? 7.681   -39.551 24.083  1.00 23.32  ?  628 HOH A O    1 
HETATM 4690 O  O    . HOH S 8 .   ? 18.234  -40.237 21.876  1.00 32.09  ?  629 HOH A O    1 
HETATM 4691 O  O    . HOH S 8 .   ? 6.808   -35.457 -17.291 1.00 42.68  ?  630 HOH A O    1 
HETATM 4692 O  O    . HOH S 8 .   ? 1.744   -24.452 14.412  1.00 47.39  ?  631 HOH A O    1 
HETATM 4693 O  O    . HOH S 8 .   ? -18.039 -30.021 15.316  1.00 42.98  ?  632 HOH A O    1 
HETATM 4694 O  O    . HOH S 8 .   ? 16.330  -47.631 4.650   1.00 37.64  ?  633 HOH A O    1 
HETATM 4695 O  O    . HOH S 8 .   ? -4.719  -50.567 47.805  0.78 64.97  ?  634 HOH A O    1 
HETATM 4696 O  O    . HOH S 8 .   ? -21.634 -44.295 72.786  1.00 57.26  ?  635 HOH A O    1 
HETATM 4697 O  O    . HOH S 8 .   ? 5.809   -28.496 -13.612 1.00 38.20  ?  636 HOH A O    1 
HETATM 4698 O  O    . HOH S 8 .   ? -15.395 -37.313 -18.119 1.00 60.43  ?  637 HOH A O    1 
HETATM 4699 O  O    . HOH S 8 .   ? 19.190  -22.640 -8.522  1.00 56.04  ?  638 HOH A O    1 
HETATM 4700 O  O    . HOH S 8 .   ? -11.660 -31.927 -10.650 1.00 53.65  ?  639 HOH A O    1 
HETATM 4701 O  O    . HOH S 8 .   ? -4.204  -44.119 63.892  1.00 43.36  ?  640 HOH A O    1 
HETATM 4702 O  O    . HOH S 8 .   ? 2.693   -38.261 29.230  1.00 59.21  ?  641 HOH A O    1 
HETATM 4703 O  O    . HOH S 8 .   ? 3.328   -39.456 27.287  1.00 55.68  ?  642 HOH A O    1 
HETATM 4704 O  O    . HOH S 8 .   ? 9.757   -47.015 -4.127  1.00 54.16  ?  643 HOH A O    1 
HETATM 4705 O  O    . HOH S 8 .   ? -16.093 -60.532 63.826  1.00 51.07  ?  644 HOH A O    1 
HETATM 4706 O  O    . HOH S 8 .   ? 13.066  -48.062 -5.119  1.00 49.42  ?  645 HOH A O    1 
HETATM 4707 O  O    . HOH S 8 .   ? 1.168   -44.578 13.540  1.00 35.46  ?  646 HOH A O    1 
HETATM 4708 O  O    . HOH S 8 .   ? -1.984  -37.532 23.215  1.00 48.90  ?  647 HOH A O    1 
HETATM 4709 O  O    . HOH S 8 .   ? 6.076   -27.088 -11.899 1.00 52.59  ?  648 HOH A O    1 
HETATM 4710 O  O    . HOH S 8 .   ? -11.095 -21.014 -4.793  1.00 61.71  ?  649 HOH A O    1 
HETATM 4711 O  O    . HOH S 8 .   ? 6.947   -40.168 -10.028 1.00 49.69  ?  650 HOH A O    1 
HETATM 4712 O  O    . HOH S 8 .   ? -17.019 -45.222 65.230  1.00 48.21  ?  651 HOH A O    1 
HETATM 4713 O  O    . HOH S 8 .   ? 8.267   -41.716 -8.938  1.00 56.14  ?  652 HOH A O    1 
HETATM 4714 O  O    . HOH S 8 .   ? -22.903 -42.202 67.921  1.00 66.18  ?  653 HOH A O    1 
HETATM 4715 O  O    . HOH S 8 .   ? -9.402  -20.744 -9.110  1.00 55.58  ?  654 HOH A O    1 
HETATM 4716 O  O    . HOH S 8 .   ? 2.217   -38.040 18.894  1.00 51.59  ?  655 HOH A O    1 
HETATM 4717 O  O    . HOH S 8 .   ? 2.111   -52.078 20.340  1.00 75.04  ?  656 HOH A O    1 
HETATM 4718 O  O    . HOH S 8 .   ? -2.175  -35.373 26.069  1.00 62.49  ?  657 HOH A O    1 
HETATM 4719 O  O    . HOH S 8 .   ? 1.795   -35.824 17.779  1.00 52.82  ?  658 HOH A O    1 
HETATM 4720 O  O    . HOH S 8 .   ? 10.984  -27.094 13.627  1.00 57.78  ?  659 HOH A O    1 
HETATM 4721 O  O    . HOH S 8 .   ? 10.845  -47.103 -7.023  1.00 51.42  ?  660 HOH A O    1 
HETATM 4722 O  O    . HOH S 8 .   ? -10.461 -22.555 -7.759  1.00 53.63  ?  661 HOH A O    1 
HETATM 4723 O  O    . HOH S 8 .   ? -22.080 -54.477 65.002  1.00 61.09  ?  662 HOH A O    1 
HETATM 4724 O  O    . HOH S 8 .   ? 6.966   -30.969 14.870  1.00 48.64  ?  663 HOH A O    1 
HETATM 4725 O  O    . HOH S 8 .   ? -2.031  -45.311 0.324   1.00 49.51  ?  664 HOH A O    1 
HETATM 4726 O  O    . HOH S 8 .   ? 5.502   -34.550 16.844  1.00 50.41  ?  665 HOH A O    1 
HETATM 4727 O  O    . HOH S 8 .   ? -0.090  -46.206 11.911  1.00 48.61  ?  666 HOH A O    1 
HETATM 4728 O  O    . HOH S 8 .   ? 19.916  -28.008 -12.206 1.00 44.57  ?  667 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   MET 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  ARG 10  10  ?   ?   ?   A . n 
A 1 11  LYS 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  LYS 30  30  ?   ?   ?   A . n 
A 1 31  ARG 31  31  ?   ?   ?   A . n 
A 1 32  GLY 32  32  ?   ?   ?   A . n 
A 1 33  TRP 33  33  33  TRP TRP A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 MET 161 161 161 MET MET A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 HIS 196 196 196 HIS HIS A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 HIS 236 236 236 HIS HIS A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 PHE 271 271 271 PHE PHE A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 HIS 291 291 291 HIS HIS A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 HIS 299 299 ?   ?   ?   A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 TMO 1   401 909 TMO TMO A . 
C 2 TMO 1   402 910 TMO TMO A . 
D 2 TMO 1   403 911 TMO TMO A . 
E 3 K   1   404 20  K   K   A . 
F 3 K   1   405 1   K   K   A . 
G 3 K   1   406 2   K   K   A . 
H 3 K   1   407 3   K   K   A . 
I 3 K   1   408 5   K   K   A . 
J 3 K   1   409 6   K   K   A . 
K 3 K   1   410 7   K   K   A . 
L 3 K   1   411 8   K   K   A . 
M 3 K   1   412 9   K   K   A . 
N 4 BA  1   413 4   BA  BA  A . 
O 5 CL  1   414 1   CL  CL  A . 
P 6 PCW 1   415 1   PCW PCW A . 
Q 6 PCW 1   416 2   PCW PCW A . 
R 7 Z3P 1   417 1   Z3P Z3P A . 
S 8 HOH 1   501 159 HOH HOH A . 
S 8 HOH 2   502 150 HOH HOH A . 
S 8 HOH 3   503 126 HOH HOH A . 
S 8 HOH 4   504 161 HOH HOH A . 
S 8 HOH 5   505 67  HOH HOH A . 
S 8 HOH 6   506 167 HOH HOH A . 
S 8 HOH 7   507 153 HOH HOH A . 
S 8 HOH 8   508 44  HOH HOH A . 
S 8 HOH 9   509 157 HOH HOH A . 
S 8 HOH 10  510 62  HOH HOH A . 
S 8 HOH 11  511 24  HOH HOH A . 
S 8 HOH 12  512 36  HOH HOH A . 
S 8 HOH 13  513 77  HOH HOH A . 
S 8 HOH 14  514 58  HOH HOH A . 
S 8 HOH 15  515 84  HOH HOH A . 
S 8 HOH 16  516 80  HOH HOH A . 
S 8 HOH 17  517 160 HOH HOH A . 
S 8 HOH 18  518 81  HOH HOH A . 
S 8 HOH 19  519 41  HOH HOH A . 
S 8 HOH 20  520 61  HOH HOH A . 
S 8 HOH 21  521 26  HOH HOH A . 
S 8 HOH 22  522 1   HOH HOH A . 
S 8 HOH 23  523 8   HOH HOH A . 
S 8 HOH 24  524 14  HOH HOH A . 
S 8 HOH 25  525 137 HOH HOH A . 
S 8 HOH 26  526 17  HOH HOH A . 
S 8 HOH 27  527 35  HOH HOH A . 
S 8 HOH 28  528 106 HOH HOH A . 
S 8 HOH 29  529 52  HOH HOH A . 
S 8 HOH 30  530 33  HOH HOH A . 
S 8 HOH 31  531 40  HOH HOH A . 
S 8 HOH 32  532 92  HOH HOH A . 
S 8 HOH 33  533 19  HOH HOH A . 
S 8 HOH 34  534 23  HOH HOH A . 
S 8 HOH 35  535 83  HOH HOH A . 
S 8 HOH 36  536 12  HOH HOH A . 
S 8 HOH 37  537 117 HOH HOH A . 
S 8 HOH 38  538 21  HOH HOH A . 
S 8 HOH 39  539 87  HOH HOH A . 
S 8 HOH 40  540 66  HOH HOH A . 
S 8 HOH 41  541 49  HOH HOH A . 
S 8 HOH 42  542 5   HOH HOH A . 
S 8 HOH 43  543 74  HOH HOH A . 
S 8 HOH 44  544 29  HOH HOH A . 
S 8 HOH 45  545 47  HOH HOH A . 
S 8 HOH 46  546 2   HOH HOH A . 
S 8 HOH 47  547 86  HOH HOH A . 
S 8 HOH 48  548 15  HOH HOH A . 
S 8 HOH 49  549 43  HOH HOH A . 
S 8 HOH 50  550 16  HOH HOH A . 
S 8 HOH 51  551 94  HOH HOH A . 
S 8 HOH 52  552 90  HOH HOH A . 
S 8 HOH 53  553 138 HOH HOH A . 
S 8 HOH 54  554 96  HOH HOH A . 
S 8 HOH 55  555 13  HOH HOH A . 
S 8 HOH 56  556 162 HOH HOH A . 
S 8 HOH 57  557 4   HOH HOH A . 
S 8 HOH 58  558 37  HOH HOH A . 
S 8 HOH 59  559 85  HOH HOH A . 
S 8 HOH 60  560 101 HOH HOH A . 
S 8 HOH 61  561 79  HOH HOH A . 
S 8 HOH 62  562 148 HOH HOH A . 
S 8 HOH 63  563 55  HOH HOH A . 
S 8 HOH 64  564 139 HOH HOH A . 
S 8 HOH 65  565 98  HOH HOH A . 
S 8 HOH 66  566 143 HOH HOH A . 
S 8 HOH 67  567 144 HOH HOH A . 
S 8 HOH 68  568 18  HOH HOH A . 
S 8 HOH 69  569 46  HOH HOH A . 
S 8 HOH 70  570 3   HOH HOH A . 
S 8 HOH 71  571 171 HOH HOH A . 
S 8 HOH 72  572 38  HOH HOH A . 
S 8 HOH 73  573 65  HOH HOH A . 
S 8 HOH 74  574 172 HOH HOH A . 
S 8 HOH 75  575 39  HOH HOH A . 
S 8 HOH 76  576 119 HOH HOH A . 
S 8 HOH 77  577 53  HOH HOH A . 
S 8 HOH 78  578 113 HOH HOH A . 
S 8 HOH 79  579 10  HOH HOH A . 
S 8 HOH 80  580 78  HOH HOH A . 
S 8 HOH 81  581 51  HOH HOH A . 
S 8 HOH 82  582 71  HOH HOH A . 
S 8 HOH 83  583 32  HOH HOH A . 
S 8 HOH 84  584 68  HOH HOH A . 
S 8 HOH 85  585 57  HOH HOH A . 
S 8 HOH 86  586 163 HOH HOH A . 
S 8 HOH 87  587 60  HOH HOH A . 
S 8 HOH 88  588 132 HOH HOH A . 
S 8 HOH 89  589 69  HOH HOH A . 
S 8 HOH 90  590 135 HOH HOH A . 
S 8 HOH 91  591 6   HOH HOH A . 
S 8 HOH 92  592 125 HOH HOH A . 
S 8 HOH 93  593 169 HOH HOH A . 
S 8 HOH 94  594 11  HOH HOH A . 
S 8 HOH 95  595 97  HOH HOH A . 
S 8 HOH 96  596 63  HOH HOH A . 
S 8 HOH 97  597 54  HOH HOH A . 
S 8 HOH 98  598 73  HOH HOH A . 
S 8 HOH 99  599 48  HOH HOH A . 
S 8 HOH 100 600 59  HOH HOH A . 
S 8 HOH 101 601 155 HOH HOH A . 
S 8 HOH 102 602 168 HOH HOH A . 
S 8 HOH 103 603 28  HOH HOH A . 
S 8 HOH 104 604 118 HOH HOH A . 
S 8 HOH 105 605 31  HOH HOH A . 
S 8 HOH 106 606 25  HOH HOH A . 
S 8 HOH 107 607 108 HOH HOH A . 
S 8 HOH 108 608 107 HOH HOH A . 
S 8 HOH 109 609 147 HOH HOH A . 
S 8 HOH 110 610 9   HOH HOH A . 
S 8 HOH 111 611 72  HOH HOH A . 
S 8 HOH 112 612 105 HOH HOH A . 
S 8 HOH 113 613 34  HOH HOH A . 
S 8 HOH 114 614 88  HOH HOH A . 
S 8 HOH 115 615 89  HOH HOH A . 
S 8 HOH 116 616 134 HOH HOH A . 
S 8 HOH 117 617 50  HOH HOH A . 
S 8 HOH 118 618 129 HOH HOH A . 
S 8 HOH 119 619 154 HOH HOH A . 
S 8 HOH 120 620 100 HOH HOH A . 
S 8 HOH 121 621 7   HOH HOH A . 
S 8 HOH 122 622 56  HOH HOH A . 
S 8 HOH 123 623 128 HOH HOH A . 
S 8 HOH 124 624 124 HOH HOH A . 
S 8 HOH 125 625 121 HOH HOH A . 
S 8 HOH 126 626 127 HOH HOH A . 
S 8 HOH 127 627 99  HOH HOH A . 
S 8 HOH 128 628 115 HOH HOH A . 
S 8 HOH 129 629 22  HOH HOH A . 
S 8 HOH 130 630 75  HOH HOH A . 
S 8 HOH 131 631 146 HOH HOH A . 
S 8 HOH 132 632 20  HOH HOH A . 
S 8 HOH 133 633 140 HOH HOH A . 
S 8 HOH 134 634 10  HOH HOH A . 
S 8 HOH 135 635 103 HOH HOH A . 
S 8 HOH 136 636 141 HOH HOH A . 
S 8 HOH 137 637 122 HOH HOH A . 
S 8 HOH 138 638 112 HOH HOH A . 
S 8 HOH 139 639 166 HOH HOH A . 
S 8 HOH 140 640 42  HOH HOH A . 
S 8 HOH 141 641 175 HOH HOH A . 
S 8 HOH 142 642 173 HOH HOH A . 
S 8 HOH 143 643 156 HOH HOH A . 
S 8 HOH 144 644 133 HOH HOH A . 
S 8 HOH 145 645 130 HOH HOH A . 
S 8 HOH 146 646 27  HOH HOH A . 
S 8 HOH 147 647 91  HOH HOH A . 
S 8 HOH 148 648 158 HOH HOH A . 
S 8 HOH 149 649 70  HOH HOH A . 
S 8 HOH 150 650 45  HOH HOH A . 
S 8 HOH 151 651 93  HOH HOH A . 
S 8 HOH 152 652 136 HOH HOH A . 
S 8 HOH 153 653 151 HOH HOH A . 
S 8 HOH 154 654 76  HOH HOH A . 
S 8 HOH 155 655 123 HOH HOH A . 
S 8 HOH 156 656 149 HOH HOH A . 
S 8 HOH 157 657 174 HOH HOH A . 
S 8 HOH 158 658 120 HOH HOH A . 
S 8 HOH 159 659 170 HOH HOH A . 
S 8 HOH 160 660 131 HOH HOH A . 
S 8 HOH 161 661 110 HOH HOH A . 
S 8 HOH 162 662 109 HOH HOH A . 
S 8 HOH 163 663 142 HOH HOH A . 
S 8 HOH 164 664 104 HOH HOH A . 
S 8 HOH 165 665 82  HOH HOH A . 
S 8 HOH 166 666 30  HOH HOH A . 
S 8 HOH 167 667 95  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 31740 ? 
1 MORE         -243  ? 
1 'SSA (A^2)'  43210 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_545 -x,-y-1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 -105.9550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_445 -y-1/2,x-1/2,z 0.0000000000  -1.0000000000 0.0000000000 -52.9775000000 1.0000000000  
0.0000000000  0.0000000000 -52.9775000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_545 y+1/2,-x-1/2,z 0.0000000000  1.0000000000  0.0000000000 52.9775000000  -1.0000000000 
0.0000000000  0.0000000000 -52.9775000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K  404 ? E K  . 
2 1 A K  405 ? F K  . 
3 1 A K  406 ? G K  . 
4 1 A K  407 ? H K  . 
5 1 A K  408 ? I K  . 
6 1 A K  409 ? J K  . 
7 1 A K  410 ? K K  . 
8 1 A BA 413 ? N BA . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ALA 95 ? A ALA 95  ? 1_555 K  ? M K  . ? A K  412 ? 1_555 OG1 ? A THR 96 ? A THR 96  ? 1_555 40.0 ? 
2  O   ? A ALA 95 ? A ALA 95  ? 1_555 K  ? M K  . ? A K  412 ? 1_555 O   ? S HOH .  ? A HOH 634 ? 1_555 91.0 ? 
3  OG1 ? A THR 96 ? A THR 96  ? 1_555 K  ? M K  . ? A K  412 ? 1_555 O   ? S HOH .  ? A HOH 634 ? 1_555 94.6 ? 
4  O   ? A THR 96 ? A THR 96  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A THR 96 ? A THR 96  ? 1_555 0.0  ? 
5  O   ? A THR 96 ? A THR 96  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 74.4 ? 
6  O   ? A THR 96 ? A THR 96  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 74.4 ? 
7  O   ? A THR 96 ? A THR 96  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 74.4 ? 
8  O   ? A THR 96 ? A THR 96  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 74.4 ? 
9  O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? H K  . ? A K  407 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 0.0  ? 
10 O   ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 OG1 ? A THR 96 ? A THR 96  ? 1_555 61.2 ? 
11 O   ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 O   ? A THR 96 ? A THR 96  ? 1_555 0.0  ? 
12 OG1 ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 O   ? A THR 96 ? A THR 96  ? 1_555 61.2 ? 
13 O   ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 OG1 ? A THR 96 ? A THR 96  ? 1_555 61.2 ? 
14 OG1 ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 OG1 ? A THR 96 ? A THR 96  ? 1_555 0.0  ? 
15 O   ? A THR 96 ? A THR 96  ? 1_555 BA ? N BA . ? A BA 413 ? 1_555 OG1 ? A THR 96 ? A THR 96  ? 1_555 61.2 ? 
16 O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A ILE 97 ? A ILE 97  ? 1_555 0.0  ? 
17 O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 70.2 ? 
18 O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 70.2 ? 
19 O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 70.2 ? 
20 O   ? A ILE 97 ? A ILE 97  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 70.2 ? 
21 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? G K  . ? A K  406 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 0.0  ? 
22 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A GLY 98 ? A GLY 98  ? 1_555 0.0  ? 
23 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A TYR 99 ? A TYR 99  ? 1_555 70.0 ? 
24 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A TYR 99 ? A TYR 99  ? 1_555 70.0 ? 
25 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A TYR 99 ? A TYR 99  ? 1_555 70.0 ? 
26 O   ? A GLY 98 ? A GLY 98  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A TYR 99 ? A TYR 99  ? 1_555 70.0 ? 
27 O   ? A TYR 99 ? A TYR 99  ? 1_555 K  ? F K  . ? A K  405 ? 1_555 O   ? A TYR 99 ? A TYR 99  ? 1_555 0.0  ? 
28 O   ? S HOH .  ? A HOH 656 ? 1_555 K  ? K K  . ? A K  410 ? 1_555 O   ? S HOH .  ? A HOH 656 ? 2_545 84.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-05-27 
2 'Structure model' 1 1 2020-12-09 
3 'Structure model' 1 2 2020-12-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
3 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation               
2 2 'Structure model' citation_author        
3 2 'Structure model' pdbx_struct_conn_angle 
4 2 'Structure model' struct_conn            
5 3 'Structure model' citation               
6 3 'Structure model' citation_author        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                           
2  2 'Structure model' '_citation.journal_abbrev'                    
3  2 'Structure model' '_citation.journal_id_CSD'                    
4  2 'Structure model' '_citation.journal_id_ISSN'                   
5  2 'Structure model' '_citation.pdbx_database_id_DOI'              
6  2 'Structure model' '_citation.pdbx_database_id_PubMed'           
7  2 'Structure model' '_citation.title'                             
8  2 'Structure model' '_citation.year'                              
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
24 2 'Structure model' '_pdbx_struct_conn_angle.value'               
25 2 'Structure model' '_struct_conn.pdbx_dist_value'                
26 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
27 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
28 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
29 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
30 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
31 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
32 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
33 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
34 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
35 2 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
36 2 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
37 2 'Structure model' '_struct_conn.ptnr2_symmetry'                 
38 3 'Structure model' '_citation.journal_volume'                    
39 3 'Structure model' '_citation.page_first'                        
40 3 'Structure model' '_citation.page_last'                         
41 3 'Structure model' '_citation.title'                             
42 3 'Structure model' '_citation_author.identifier_ORCID'           
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.12_2829 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24      2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DENZO       ? ? ? .         3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .         5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HE  A ARG 257 ? ? O A HOH 507 ? ? 1.58 
2 1 O   A HOH 591 ? ? O A HOH 619 ? ? 2.07 
3 1 OE2 A GLU 292 ? ? O A HOH 501 ? ? 2.09 
4 1 O   A HOH 612 ? ? O A HOH 657 ? ? 2.10 
5 1 O   A HOH 595 ? ? O A HOH 621 ? ? 2.10 
6 1 OD1 A ASP 73  ? ? O A HOH 502 ? ? 2.11 
7 1 O   A HOH 509 ? ? O A HOH 586 ? ? 2.14 
8 1 O   A HOH 608 ? ? O A HOH 627 ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     571 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     640 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_445 
_pdbx_validate_symm_contact.dist              2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 36  ? ? -148.54 52.84  
2 1 LEU A 210 ? ? -124.12 -59.21 
3 1 LEU A 210 ? ? -124.51 -59.21 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A TRP 33  ? CG  ? A TRP 33  CG  
2   1 Y 1 A TRP 33  ? CD1 ? A TRP 33  CD1 
3   1 Y 1 A TRP 33  ? CD2 ? A TRP 33  CD2 
4   1 Y 1 A TRP 33  ? NE1 ? A TRP 33  NE1 
5   1 Y 1 A TRP 33  ? CE2 ? A TRP 33  CE2 
6   1 Y 1 A TRP 33  ? CE3 ? A TRP 33  CE3 
7   1 Y 1 A TRP 33  ? CZ2 ? A TRP 33  CZ2 
8   1 Y 1 A TRP 33  ? CZ3 ? A TRP 33  CZ3 
9   1 Y 1 A TRP 33  ? CH2 ? A TRP 33  CH2 
10  1 Y 1 A LEU 34  ? CG  ? A LEU 34  CG  
11  1 Y 1 A LEU 34  ? CD1 ? A LEU 34  CD1 
12  1 Y 1 A LEU 34  ? CD2 ? A LEU 34  CD2 
13  1 Y 1 A ASP 35  ? CG  ? A ASP 35  CG  
14  1 Y 1 A ASP 35  ? OD1 ? A ASP 35  OD1 
15  1 Y 1 A ASP 35  ? OD2 ? A ASP 35  OD2 
16  1 Y 1 A LYS 101 ? CD  ? A LYS 101 CD  
17  1 Y 1 A LYS 101 ? CE  ? A LYS 101 CE  
18  1 Y 1 A LYS 101 ? NZ  ? A LYS 101 NZ  
19  1 Y 1 A HIS 298 ? CG  ? A HIS 298 CG  
20  1 Y 1 A HIS 298 ? ND1 ? A HIS 298 ND1 
21  1 Y 1 A HIS 298 ? CD2 ? A HIS 298 CD2 
22  1 Y 1 A HIS 298 ? CE1 ? A HIS 298 CE1 
23  1 Y 1 A HIS 298 ? NE2 ? A HIS 298 NE2 
24  1 N 1 A PCW 415 ? C1  ? P PCW 1   C1  
25  1 N 1 A PCW 415 ? C2  ? P PCW 1   C2  
26  1 N 1 A PCW 415 ? C3  ? P PCW 1   C3  
27  1 N 1 A PCW 415 ? C4  ? P PCW 1   C4  
28  1 N 1 A PCW 415 ? C5  ? P PCW 1   C5  
29  1 N 1 A PCW 415 ? C6  ? P PCW 1   C6  
30  1 N 1 A PCW 415 ? C7  ? P PCW 1   C7  
31  1 N 1 A PCW 415 ? C8  ? P PCW 1   C8  
32  1 N 1 A PCW 415 ? C11 ? P PCW 1   C11 
33  1 N 1 A PCW 415 ? C12 ? P PCW 1   C12 
34  1 N 1 A PCW 415 ? C13 ? P PCW 1   C13 
35  1 N 1 A PCW 415 ? C14 ? P PCW 1   C14 
36  1 N 1 A PCW 415 ? C15 ? P PCW 1   C15 
37  1 N 1 A PCW 415 ? C16 ? P PCW 1   C16 
38  1 N 1 A PCW 415 ? C17 ? P PCW 1   C17 
39  1 N 1 A PCW 415 ? C18 ? P PCW 1   C18 
40  1 N 1 A PCW 415 ? C19 ? P PCW 1   C19 
41  1 N 1 A PCW 415 ? C31 ? P PCW 1   C31 
42  1 N 1 A PCW 415 ? C32 ? P PCW 1   C32 
43  1 N 1 A PCW 415 ? C33 ? P PCW 1   C33 
44  1 N 1 A PCW 415 ? C34 ? P PCW 1   C34 
45  1 N 1 A PCW 415 ? C35 ? P PCW 1   C35 
46  1 N 1 A PCW 415 ? C36 ? P PCW 1   C36 
47  1 N 1 A PCW 415 ? C37 ? P PCW 1   C37 
48  1 N 1 A PCW 415 ? C38 ? P PCW 1   C38 
49  1 N 1 A PCW 415 ? C39 ? P PCW 1   C39 
50  1 N 1 A PCW 415 ? C40 ? P PCW 1   C40 
51  1 N 1 A PCW 415 ? C41 ? P PCW 1   C41 
52  1 N 1 A PCW 415 ? C42 ? P PCW 1   C42 
53  1 N 1 A PCW 415 ? C43 ? P PCW 1   C43 
54  1 N 1 A PCW 415 ? C44 ? P PCW 1   C44 
55  1 N 1 A PCW 415 ? C45 ? P PCW 1   C45 
56  1 N 1 A PCW 415 ? C46 ? P PCW 1   C46 
57  1 N 1 A PCW 415 ? C47 ? P PCW 1   C47 
58  1 N 1 A PCW 415 ? C48 ? P PCW 1   C48 
59  1 N 1 A PCW 415 ? N   ? P PCW 1   N   
60  1 N 1 A PCW 415 ? O2  ? P PCW 1   O2  
61  1 N 1 A PCW 415 ? O3  ? P PCW 1   O3  
62  1 N 1 A PCW 415 ? O11 ? P PCW 1   O11 
63  1 N 1 A PCW 415 ? O31 ? P PCW 1   O31 
64  1 N 1 A PCW 415 ? O1P ? P PCW 1   O1P 
65  1 N 1 A PCW 415 ? O2P ? P PCW 1   O2P 
66  1 N 1 A PCW 415 ? O3P ? P PCW 1   O3P 
67  1 N 1 A PCW 415 ? O4P ? P PCW 1   O4P 
68  1 N 1 A PCW 415 ? P   ? P PCW 1   P   
69  1 N 1 A PCW 416 ? C1  ? Q PCW 1   C1  
70  1 N 1 A PCW 416 ? C2  ? Q PCW 1   C2  
71  1 N 1 A PCW 416 ? C3  ? Q PCW 1   C3  
72  1 N 1 A PCW 416 ? C11 ? Q PCW 1   C11 
73  1 N 1 A PCW 416 ? C12 ? Q PCW 1   C12 
74  1 N 1 A PCW 416 ? C13 ? Q PCW 1   C13 
75  1 N 1 A PCW 416 ? C14 ? Q PCW 1   C14 
76  1 N 1 A PCW 416 ? C15 ? Q PCW 1   C15 
77  1 N 1 A PCW 416 ? C16 ? Q PCW 1   C16 
78  1 N 1 A PCW 416 ? C17 ? Q PCW 1   C17 
79  1 N 1 A PCW 416 ? C18 ? Q PCW 1   C18 
80  1 N 1 A PCW 416 ? C19 ? Q PCW 1   C19 
81  1 N 1 A PCW 416 ? C20 ? Q PCW 1   C20 
82  1 N 1 A PCW 416 ? C21 ? Q PCW 1   C21 
83  1 N 1 A PCW 416 ? C22 ? Q PCW 1   C22 
84  1 N 1 A PCW 416 ? C23 ? Q PCW 1   C23 
85  1 N 1 A PCW 416 ? C24 ? Q PCW 1   C24 
86  1 N 1 A PCW 416 ? C25 ? Q PCW 1   C25 
87  1 N 1 A PCW 416 ? C26 ? Q PCW 1   C26 
88  1 N 1 A PCW 416 ? C27 ? Q PCW 1   C27 
89  1 N 1 A PCW 416 ? C28 ? Q PCW 1   C28 
90  1 N 1 A PCW 416 ? C31 ? Q PCW 1   C31 
91  1 N 1 A PCW 416 ? C32 ? Q PCW 1   C32 
92  1 N 1 A PCW 416 ? C33 ? Q PCW 1   C33 
93  1 N 1 A PCW 416 ? C34 ? Q PCW 1   C34 
94  1 N 1 A PCW 416 ? C35 ? Q PCW 1   C35 
95  1 N 1 A PCW 416 ? C36 ? Q PCW 1   C36 
96  1 N 1 A PCW 416 ? C37 ? Q PCW 1   C37 
97  1 N 1 A PCW 416 ? C38 ? Q PCW 1   C38 
98  1 N 1 A PCW 416 ? C39 ? Q PCW 1   C39 
99  1 N 1 A PCW 416 ? C40 ? Q PCW 1   C40 
100 1 N 1 A PCW 416 ? C41 ? Q PCW 1   C41 
101 1 N 1 A PCW 416 ? C42 ? Q PCW 1   C42 
102 1 N 1 A PCW 416 ? C43 ? Q PCW 1   C43 
103 1 N 1 A PCW 416 ? C44 ? Q PCW 1   C44 
104 1 N 1 A PCW 416 ? C45 ? Q PCW 1   C45 
105 1 N 1 A PCW 416 ? C46 ? Q PCW 1   C46 
106 1 N 1 A PCW 416 ? C47 ? Q PCW 1   C47 
107 1 N 1 A PCW 416 ? C48 ? Q PCW 1   C48 
108 1 N 1 A PCW 416 ? O2  ? Q PCW 1   O2  
109 1 N 1 A PCW 416 ? O3  ? Q PCW 1   O3  
110 1 N 1 A PCW 416 ? O11 ? Q PCW 1   O11 
111 1 N 1 A PCW 416 ? O31 ? Q PCW 1   O31 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A MET 5   ? A MET 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A PRO 7   ? A PRO 7   
8  1 Y 1 A PRO 8   ? A PRO 8   
9  1 Y 1 A ALA 9   ? A ALA 9   
10 1 Y 1 A ARG 10  ? A ARG 10  
11 1 Y 1 A LYS 11  ? A LYS 11  
12 1 Y 1 A GLU 29  ? A GLU 29  
13 1 Y 1 A LYS 30  ? A LYS 30  
14 1 Y 1 A ARG 31  ? A ARG 31  
15 1 Y 1 A GLY 32  ? A GLY 32  
16 1 Y 1 A HIS 299 ? A HIS 299 
17 1 Y 1 A HIS 300 ? A HIS 300 
18 1 Y 1 A HIS 301 ? A HIS 301 
# 
_pdbx_audit_support.funding_organization   'National Health and Medical Research Council (NHMRC, Australia)' 
_pdbx_audit_support.country                Australia 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'trimethylamine oxide'                   TMO 
3 'POTASSIUM ION'                          K   
4 'BARIUM ION'                             BA  
5 'CHLORIDE ION'                           CL  
6 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE PCW 
7 
;3,3',3''-phosphoryltripropanoic acid
;
Z3P 
8 water                                    HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   homology 
_pdbx_struct_assembly_auth_evidence.details                ? 
#