data_6OR7
# 
_entry.id   6OR7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6OR7         
WWPDB D_1000241188 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6OR7 
_pdbx_database_status.recvd_initial_deposition_date   2019-04-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bertoletti, N.' 1 0000-0001-5167-402X 
'Chan, A.H.'     2 0000-0001-5809-8483 
'Anderson, K.S.' 3 0000-0003-3433-0780 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            28 
_citation.language                  ? 
_citation.page_first                1664 
_citation.page_last                 1675 
_citation.title                     
;Structural insights into the recognition of nucleoside reverse transcriptase inhibitors by HIV-1 reverse transcriptase: First crystal structures with reverse transcriptase and the active triphosphate forms of lamivudine and emtricitabine.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3681 
_citation.pdbx_database_id_PubMed   31301259 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bertoletti, N.' 1 0000-0001-5167-402X 
primary 'Chan, A.H.'     2 ?                   
primary 'Schinazi, R.F.' 3 ?                   
primary 'Yin, Y.W.'      4 ?                   
primary 'Anderson, K.S.' 5 0000-0003-3433-0780 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6OR7 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     166.499 
_cell.length_a_esd                 ? 
_cell.length_b                     169.825 
_cell.length_b_esd                 ? 
_cell.length_c                     103.283 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6OR7 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Reverse transcriptase/ribonuclease H' 64653.090 1  '2.7.7.49, 2.7.7.7, 3.1.26.13' 'C280S, Q258C' ? ? 
2 polymer     man 'p51 RT' 52748.418 1  ?                              C280S          ? ? 
3 polymer     syn 'DNA Primer 20-mer' 6460.241  1  ?                              ?              ? ? 
4 polymer     syn 'DNA template 27-mer' 8408.397  1  ?                              ?              ? ? 
5 non-polymer syn 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
487.186   1  ?                              ?              ? ? 
6 non-polymer syn 'MAGNESIUM ION' 24.305    2  ?                              ?              ? ? 
7 non-polymer syn 'SULFATE ION' 96.063    3  ?                              ?              ? ? 
8 water       nat water 18.015    48 ?                              ?              ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
A ? 
2 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(G47)(DC)(DG)(DC)
(DC)(DDG)
;
ACAGTCCCTGTTCGGGCGCCG P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DG)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGGCGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ILE n 
1 4   SER n 
1 5   PRO n 
1 6   ILE n 
1 7   GLU n 
1 8   THR n 
1 9   VAL n 
1 10  PRO n 
1 11  VAL n 
1 12  LYS n 
1 13  LEU n 
1 14  LYS n 
1 15  PRO n 
1 16  GLY n 
1 17  MET n 
1 18  ASP n 
1 19  GLY n 
1 20  PRO n 
1 21  LYS n 
1 22  VAL n 
1 23  LYS n 
1 24  GLN n 
1 25  TRP n 
1 26  PRO n 
1 27  LEU n 
1 28  THR n 
1 29  GLU n 
1 30  GLU n 
1 31  LYS n 
1 32  ILE n 
1 33  LYS n 
1 34  ALA n 
1 35  LEU n 
1 36  VAL n 
1 37  GLU n 
1 38  ILE n 
1 39  CYS n 
1 40  THR n 
1 41  GLU n 
1 42  MET n 
1 43  GLU n 
1 44  LYS n 
1 45  GLU n 
1 46  GLY n 
1 47  LYS n 
1 48  ILE n 
1 49  SER n 
1 50  LYS n 
1 51  ILE n 
1 52  GLY n 
1 53  PRO n 
1 54  GLU n 
1 55  ASN n 
1 56  PRO n 
1 57  TYR n 
1 58  ASN n 
1 59  THR n 
1 60  PRO n 
1 61  VAL n 
1 62  PHE n 
1 63  ALA n 
1 64  ILE n 
1 65  LYS n 
1 66  LYS n 
1 67  LYS n 
1 68  ASP n 
1 69  SER n 
1 70  THR n 
1 71  LYS n 
1 72  TRP n 
1 73  ARG n 
1 74  LYS n 
1 75  LEU n 
1 76  VAL n 
1 77  ASP n 
1 78  PHE n 
1 79  ARG n 
1 80  GLU n 
1 81  LEU n 
1 82  ASN n 
1 83  LYS n 
1 84  ARG n 
1 85  THR n 
1 86  GLN n 
1 87  ASP n 
1 88  PHE n 
1 89  TRP n 
1 90  GLU n 
1 91  VAL n 
1 92  GLN n 
1 93  LEU n 
1 94  GLY n 
1 95  ILE n 
1 96  PRO n 
1 97  HIS n 
1 98  PRO n 
1 99  ALA n 
1 100 GLY n 
1 101 LEU n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 LYS n 
1 106 SER n 
1 107 VAL n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 ASP n 
1 112 VAL n 
1 113 GLY n 
1 114 ASP n 
1 115 ALA n 
1 116 TYR n 
1 117 PHE n 
1 118 SER n 
1 119 VAL n 
1 120 PRO n 
1 121 LEU n 
1 122 ASP n 
1 123 GLU n 
1 124 ASP n 
1 125 PHE n 
1 126 ARG n 
1 127 LYS n 
1 128 TYR n 
1 129 THR n 
1 130 ALA n 
1 131 PHE n 
1 132 THR n 
1 133 ILE n 
1 134 PRO n 
1 135 SER n 
1 136 ILE n 
1 137 ASN n 
1 138 ASN n 
1 139 GLU n 
1 140 THR n 
1 141 PRO n 
1 142 GLY n 
1 143 ILE n 
1 144 ARG n 
1 145 TYR n 
1 146 GLN n 
1 147 TYR n 
1 148 ASN n 
1 149 VAL n 
1 150 LEU n 
1 151 PRO n 
1 152 GLN n 
1 153 GLY n 
1 154 TRP n 
1 155 LYS n 
1 156 GLY n 
1 157 SER n 
1 158 PRO n 
1 159 ALA n 
1 160 ILE n 
1 161 PHE n 
1 162 GLN n 
1 163 SER n 
1 164 SER n 
1 165 MET n 
1 166 THR n 
1 167 LYS n 
1 168 ILE n 
1 169 LEU n 
1 170 GLU n 
1 171 PRO n 
1 172 PHE n 
1 173 ARG n 
1 174 LYS n 
1 175 GLN n 
1 176 ASN n 
1 177 PRO n 
1 178 ASP n 
1 179 ILE n 
1 180 VAL n 
1 181 ILE n 
1 182 TYR n 
1 183 GLN n 
1 184 TYR n 
1 185 MET n 
1 186 ASP n 
1 187 ASP n 
1 188 LEU n 
1 189 TYR n 
1 190 VAL n 
1 191 GLY n 
1 192 SER n 
1 193 ASP n 
1 194 LEU n 
1 195 GLU n 
1 196 ILE n 
1 197 GLY n 
1 198 GLN n 
1 199 HIS n 
1 200 ARG n 
1 201 THR n 
1 202 LYS n 
1 203 ILE n 
1 204 GLU n 
1 205 GLU n 
1 206 LEU n 
1 207 ARG n 
1 208 GLN n 
1 209 HIS n 
1 210 LEU n 
1 211 LEU n 
1 212 ARG n 
1 213 TRP n 
1 214 GLY n 
1 215 LEU n 
1 216 THR n 
1 217 THR n 
1 218 PRO n 
1 219 ASP n 
1 220 LYS n 
1 221 LYS n 
1 222 HIS n 
1 223 GLN n 
1 224 LYS n 
1 225 GLU n 
1 226 PRO n 
1 227 PRO n 
1 228 PHE n 
1 229 LEU n 
1 230 TRP n 
1 231 MET n 
1 232 GLY n 
1 233 TYR n 
1 234 GLU n 
1 235 LEU n 
1 236 HIS n 
1 237 PRO n 
1 238 ASP n 
1 239 LYS n 
1 240 TRP n 
1 241 THR n 
1 242 VAL n 
1 243 GLN n 
1 244 PRO n 
1 245 ILE n 
1 246 VAL n 
1 247 LEU n 
1 248 PRO n 
1 249 GLU n 
1 250 LYS n 
1 251 ASP n 
1 252 SER n 
1 253 TRP n 
1 254 THR n 
1 255 VAL n 
1 256 ASN n 
1 257 ASP n 
1 258 ILE n 
1 259 CYS n 
1 260 LYS n 
1 261 LEU n 
1 262 VAL n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 ASN n 
1 267 TRP n 
1 268 ALA n 
1 269 SER n 
1 270 GLN n 
1 271 ILE n 
1 272 TYR n 
1 273 PRO n 
1 274 GLY n 
1 275 ILE n 
1 276 LYS n 
1 277 VAL n 
1 278 ARG n 
1 279 GLN n 
1 280 LEU n 
1 281 SER n 
1 282 LYS n 
1 283 LEU n 
1 284 LEU n 
1 285 ARG n 
1 286 GLY n 
1 287 THR n 
1 288 LYS n 
1 289 ALA n 
1 290 LEU n 
1 291 THR n 
1 292 GLU n 
1 293 VAL n 
1 294 ILE n 
1 295 PRO n 
1 296 LEU n 
1 297 THR n 
1 298 GLU n 
1 299 GLU n 
1 300 ALA n 
1 301 GLU n 
1 302 LEU n 
1 303 GLU n 
1 304 LEU n 
1 305 ALA n 
1 306 GLU n 
1 307 ASN n 
1 308 ARG n 
1 309 GLU n 
1 310 ILE n 
1 311 LEU n 
1 312 LYS n 
1 313 GLU n 
1 314 PRO n 
1 315 VAL n 
1 316 HIS n 
1 317 GLY n 
1 318 VAL n 
1 319 TYR n 
1 320 TYR n 
1 321 ASP n 
1 322 PRO n 
1 323 SER n 
1 324 LYS n 
1 325 ASP n 
1 326 LEU n 
1 327 ILE n 
1 328 ALA n 
1 329 GLU n 
1 330 ILE n 
1 331 GLN n 
1 332 LYS n 
1 333 GLN n 
1 334 GLY n 
1 335 GLN n 
1 336 GLY n 
1 337 GLN n 
1 338 TRP n 
1 339 THR n 
1 340 TYR n 
1 341 GLN n 
1 342 ILE n 
1 343 TYR n 
1 344 GLN n 
1 345 GLU n 
1 346 PRO n 
1 347 PHE n 
1 348 LYS n 
1 349 ASN n 
1 350 LEU n 
1 351 LYS n 
1 352 THR n 
1 353 GLY n 
1 354 LYS n 
1 355 TYR n 
1 356 ALA n 
1 357 ARG n 
1 358 MET n 
1 359 ARG n 
1 360 GLY n 
1 361 ALA n 
1 362 HIS n 
1 363 THR n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLN n 
1 369 LEU n 
1 370 THR n 
1 371 GLU n 
1 372 ALA n 
1 373 VAL n 
1 374 GLN n 
1 375 LYS n 
1 376 ILE n 
1 377 THR n 
1 378 THR n 
1 379 GLU n 
1 380 SER n 
1 381 ILE n 
1 382 VAL n 
1 383 ILE n 
1 384 TRP n 
1 385 GLY n 
1 386 LYS n 
1 387 THR n 
1 388 PRO n 
1 389 LYS n 
1 390 PHE n 
1 391 LYS n 
1 392 LEU n 
1 393 PRO n 
1 394 ILE n 
1 395 GLN n 
1 396 LYS n 
1 397 GLU n 
1 398 THR n 
1 399 TRP n 
1 400 GLU n 
1 401 THR n 
1 402 TRP n 
1 403 TRP n 
1 404 THR n 
1 405 GLU n 
1 406 TYR n 
1 407 TRP n 
1 408 GLN n 
1 409 ALA n 
1 410 THR n 
1 411 TRP n 
1 412 ILE n 
1 413 PRO n 
1 414 GLU n 
1 415 TRP n 
1 416 GLU n 
1 417 PHE n 
1 418 VAL n 
1 419 ASN n 
1 420 THR n 
1 421 PRO n 
1 422 PRO n 
1 423 LEU n 
1 424 VAL n 
1 425 LYS n 
1 426 LEU n 
1 427 TRP n 
1 428 TYR n 
1 429 GLN n 
1 430 LEU n 
1 431 GLU n 
1 432 LYS n 
1 433 GLU n 
1 434 PRO n 
1 435 ILE n 
1 436 VAL n 
1 437 GLY n 
1 438 ALA n 
1 439 GLU n 
1 440 THR n 
1 441 PHE n 
1 442 TYR n 
1 443 VAL n 
1 444 ASP n 
1 445 GLY n 
1 446 ALA n 
1 447 ALA n 
1 448 ASN n 
1 449 ARG n 
1 450 GLU n 
1 451 THR n 
1 452 LYS n 
1 453 LEU n 
1 454 GLY n 
1 455 LYS n 
1 456 ALA n 
1 457 GLY n 
1 458 TYR n 
1 459 VAL n 
1 460 THR n 
1 461 ASN n 
1 462 ARG n 
1 463 GLY n 
1 464 ARG n 
1 465 GLN n 
1 466 LYS n 
1 467 VAL n 
1 468 VAL n 
1 469 THR n 
1 470 LEU n 
1 471 THR n 
1 472 ASP n 
1 473 THR n 
1 474 THR n 
1 475 ASN n 
1 476 GLN n 
1 477 LYS n 
1 478 THR n 
1 479 GLU n 
1 480 LEU n 
1 481 GLN n 
1 482 ALA n 
1 483 ILE n 
1 484 TYR n 
1 485 LEU n 
1 486 ALA n 
1 487 LEU n 
1 488 GLN n 
1 489 ASP n 
1 490 SER n 
1 491 GLY n 
1 492 LEU n 
1 493 GLU n 
1 494 VAL n 
1 495 ASN n 
1 496 ILE n 
1 497 VAL n 
1 498 THR n 
1 499 ASP n 
1 500 SER n 
1 501 GLN n 
1 502 TYR n 
1 503 ALA n 
1 504 LEU n 
1 505 GLY n 
1 506 ILE n 
1 507 ILE n 
1 508 GLN n 
1 509 ALA n 
1 510 GLN n 
1 511 PRO n 
1 512 ASP n 
1 513 GLN n 
1 514 SER n 
1 515 GLU n 
1 516 SER n 
1 517 GLU n 
1 518 LEU n 
1 519 VAL n 
1 520 ASN n 
1 521 GLN n 
1 522 ILE n 
1 523 ILE n 
1 524 GLU n 
1 525 GLN n 
1 526 LEU n 
1 527 ILE n 
1 528 LYS n 
1 529 LYS n 
1 530 GLU n 
1 531 LYS n 
1 532 VAL n 
1 533 TYR n 
1 534 LEU n 
1 535 ALA n 
1 536 TRP n 
1 537 VAL n 
1 538 PRO n 
1 539 ALA n 
1 540 HIS n 
1 541 LYS n 
1 542 GLY n 
1 543 ILE n 
1 544 GLY n 
1 545 GLY n 
1 546 ASN n 
1 547 GLU n 
1 548 GLN n 
1 549 VAL n 
1 550 ASP n 
1 551 LYS n 
1 552 LEU n 
1 553 VAL n 
1 554 SER n 
1 555 ALA n 
1 556 GLY n 
1 557 ILE n 
1 558 ARG n 
1 559 LYS n 
1 560 VAL n 
1 561 LEU n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  SER n 
2 13  PRO n 
2 14  ILE n 
2 15  SER n 
2 16  PRO n 
2 17  ILE n 
2 18  GLU n 
2 19  THR n 
2 20  VAL n 
2 21  PRO n 
2 22  VAL n 
2 23  LYS n 
2 24  LEU n 
2 25  LYS n 
2 26  PRO n 
2 27  GLY n 
2 28  MET n 
2 29  ASP n 
2 30  GLY n 
2 31  PRO n 
2 32  LYS n 
2 33  VAL n 
2 34  LYS n 
2 35  GLN n 
2 36  TRP n 
2 37  PRO n 
2 38  LEU n 
2 39  THR n 
2 40  GLU n 
2 41  GLU n 
2 42  LYS n 
2 43  ILE n 
2 44  LYS n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  GLU n 
2 49  ILE n 
2 50  CYS n 
2 51  THR n 
2 52  GLU n 
2 53  MET n 
2 54  GLU n 
2 55  LYS n 
2 56  GLU n 
2 57  GLY n 
2 58  LYS n 
2 59  ILE n 
2 60  SER n 
2 61  LYS n 
2 62  ILE n 
2 63  GLY n 
2 64  PRO n 
2 65  GLU n 
2 66  ASN n 
2 67  PRO n 
2 68  TYR n 
2 69  ASN n 
2 70  THR n 
2 71  PRO n 
2 72  VAL n 
2 73  PHE n 
2 74  ALA n 
2 75  ILE n 
2 76  LYS n 
2 77  LYS n 
2 78  LYS n 
2 79  ASP n 
2 80  SER n 
2 81  THR n 
2 82  LYS n 
2 83  TRP n 
2 84  ARG n 
2 85  LYS n 
2 86  LEU n 
2 87  VAL n 
2 88  ASP n 
2 89  PHE n 
2 90  ARG n 
2 91  GLU n 
2 92  LEU n 
2 93  ASN n 
2 94  LYS n 
2 95  ARG n 
2 96  THR n 
2 97  GLN n 
2 98  ASP n 
2 99  PHE n 
2 100 TRP n 
2 101 GLU n 
2 102 VAL n 
2 103 GLN n 
2 104 LEU n 
2 105 GLY n 
2 106 ILE n 
2 107 PRO n 
2 108 HIS n 
2 109 PRO n 
2 110 ALA n 
2 111 GLY n 
2 112 LEU n 
2 113 LYS n 
2 114 LYS n 
2 115 LYS n 
2 116 LYS n 
2 117 SER n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 LEU n 
2 122 ASP n 
2 123 VAL n 
2 124 GLY n 
2 125 ASP n 
2 126 ALA n 
2 127 TYR n 
2 128 PHE n 
2 129 SER n 
2 130 VAL n 
2 131 PRO n 
2 132 LEU n 
2 133 ASP n 
2 134 GLU n 
2 135 ASP n 
2 136 PHE n 
2 137 ARG n 
2 138 LYS n 
2 139 TYR n 
2 140 THR n 
2 141 ALA n 
2 142 PHE n 
2 143 THR n 
2 144 ILE n 
2 145 PRO n 
2 146 SER n 
2 147 ILE n 
2 148 ASN n 
2 149 ASN n 
2 150 GLU n 
2 151 THR n 
2 152 PRO n 
2 153 GLY n 
2 154 ILE n 
2 155 ARG n 
2 156 TYR n 
2 157 GLN n 
2 158 TYR n 
2 159 ASN n 
2 160 VAL n 
2 161 LEU n 
2 162 PRO n 
2 163 GLN n 
2 164 GLY n 
2 165 TRP n 
2 166 LYS n 
2 167 GLY n 
2 168 SER n 
2 169 PRO n 
2 170 ALA n 
2 171 ILE n 
2 172 PHE n 
2 173 GLN n 
2 174 SER n 
2 175 SER n 
2 176 MET n 
2 177 THR n 
2 178 LYS n 
2 179 ILE n 
2 180 LEU n 
2 181 GLU n 
2 182 PRO n 
2 183 PHE n 
2 184 ARG n 
2 185 LYS n 
2 186 GLN n 
2 187 ASN n 
2 188 PRO n 
2 189 ASP n 
2 190 ILE n 
2 191 VAL n 
2 192 ILE n 
2 193 TYR n 
2 194 GLN n 
2 195 TYR n 
2 196 MET n 
2 197 ASP n 
2 198 ASP n 
2 199 LEU n 
2 200 TYR n 
2 201 VAL n 
2 202 GLY n 
2 203 SER n 
2 204 ASP n 
2 205 LEU n 
2 206 GLU n 
2 207 ILE n 
2 208 GLY n 
2 209 GLN n 
2 210 HIS n 
2 211 ARG n 
2 212 THR n 
2 213 LYS n 
2 214 ILE n 
2 215 GLU n 
2 216 GLU n 
2 217 LEU n 
2 218 ARG n 
2 219 GLN n 
2 220 HIS n 
2 221 LEU n 
2 222 LEU n 
2 223 ARG n 
2 224 TRP n 
2 225 GLY n 
2 226 LEU n 
2 227 THR n 
2 228 THR n 
2 229 PRO n 
2 230 ASP n 
2 231 LYS n 
2 232 LYS n 
2 233 HIS n 
2 234 GLN n 
2 235 LYS n 
2 236 GLU n 
2 237 PRO n 
2 238 PRO n 
2 239 PHE n 
2 240 LEU n 
2 241 TRP n 
2 242 MET n 
2 243 GLY n 
2 244 TYR n 
2 245 GLU n 
2 246 LEU n 
2 247 HIS n 
2 248 PRO n 
2 249 ASP n 
2 250 LYS n 
2 251 TRP n 
2 252 THR n 
2 253 VAL n 
2 254 GLN n 
2 255 PRO n 
2 256 ILE n 
2 257 VAL n 
2 258 LEU n 
2 259 PRO n 
2 260 GLU n 
2 261 LYS n 
2 262 ASP n 
2 263 SER n 
2 264 TRP n 
2 265 THR n 
2 266 VAL n 
2 267 ASN n 
2 268 ASP n 
2 269 ILE n 
2 270 GLN n 
2 271 LYS n 
2 272 LEU n 
2 273 VAL n 
2 274 GLY n 
2 275 LYS n 
2 276 LEU n 
2 277 ASN n 
2 278 TRP n 
2 279 ALA n 
2 280 SER n 
2 281 GLN n 
2 282 ILE n 
2 283 TYR n 
2 284 PRO n 
2 285 GLY n 
2 286 ILE n 
2 287 LYS n 
2 288 VAL n 
2 289 ARG n 
2 290 GLN n 
2 291 LEU n 
2 292 SER n 
2 293 LYS n 
2 294 LEU n 
2 295 LEU n 
2 296 ARG n 
2 297 GLY n 
2 298 THR n 
2 299 LYS n 
2 300 ALA n 
2 301 LEU n 
2 302 THR n 
2 303 GLU n 
2 304 VAL n 
2 305 ILE n 
2 306 PRO n 
2 307 LEU n 
2 308 THR n 
2 309 GLU n 
2 310 GLU n 
2 311 ALA n 
2 312 GLU n 
2 313 LEU n 
2 314 GLU n 
2 315 LEU n 
2 316 ALA n 
2 317 GLU n 
2 318 ASN n 
2 319 ARG n 
2 320 GLU n 
2 321 ILE n 
2 322 LEU n 
2 323 LYS n 
2 324 GLU n 
2 325 PRO n 
2 326 VAL n 
2 327 HIS n 
2 328 GLY n 
2 329 VAL n 
2 330 TYR n 
2 331 TYR n 
2 332 ASP n 
2 333 PRO n 
2 334 SER n 
2 335 LYS n 
2 336 ASP n 
2 337 LEU n 
2 338 ILE n 
2 339 ALA n 
2 340 GLU n 
2 341 ILE n 
2 342 GLN n 
2 343 LYS n 
2 344 GLN n 
2 345 GLY n 
2 346 GLN n 
2 347 GLY n 
2 348 GLN n 
2 349 TRP n 
2 350 THR n 
2 351 TYR n 
2 352 GLN n 
2 353 ILE n 
2 354 TYR n 
2 355 GLN n 
2 356 GLU n 
2 357 PRO n 
2 358 PHE n 
2 359 LYS n 
2 360 ASN n 
2 361 LEU n 
2 362 LYS n 
2 363 THR n 
2 364 GLY n 
2 365 LYS n 
2 366 TYR n 
2 367 ALA n 
2 368 ARG n 
2 369 MET n 
2 370 ARG n 
2 371 GLY n 
2 372 ALA n 
2 373 HIS n 
2 374 THR n 
2 375 ASN n 
2 376 ASP n 
2 377 VAL n 
2 378 LYS n 
2 379 GLN n 
2 380 LEU n 
2 381 THR n 
2 382 GLU n 
2 383 ALA n 
2 384 VAL n 
2 385 GLN n 
2 386 LYS n 
2 387 ILE n 
2 388 THR n 
2 389 THR n 
2 390 GLU n 
2 391 SER n 
2 392 ILE n 
2 393 VAL n 
2 394 ILE n 
2 395 TRP n 
2 396 GLY n 
2 397 LYS n 
2 398 THR n 
2 399 PRO n 
2 400 LYS n 
2 401 PHE n 
2 402 LYS n 
2 403 LEU n 
2 404 PRO n 
2 405 ILE n 
2 406 GLN n 
2 407 LYS n 
2 408 GLU n 
2 409 THR n 
2 410 TRP n 
2 411 GLU n 
2 412 THR n 
2 413 TRP n 
2 414 TRP n 
2 415 THR n 
2 416 GLU n 
2 417 TYR n 
2 418 TRP n 
2 419 GLN n 
2 420 ALA n 
2 421 THR n 
2 422 TRP n 
2 423 ILE n 
2 424 PRO n 
2 425 GLU n 
2 426 TRP n 
2 427 GLU n 
2 428 PHE n 
2 429 VAL n 
2 430 ASN n 
2 431 THR n 
2 432 PRO n 
2 433 PRO n 
2 434 LEU n 
2 435 VAL n 
2 436 LYS n 
2 437 LEU n 
2 438 TRP n 
2 439 TYR n 
2 440 GLN n 
2 441 LEU n 
2 442 GLU n 
2 443 LYS n 
2 444 GLU n 
2 445 PRO n 
2 446 ILE n 
2 447 VAL n 
2 448 GLY n 
2 449 ALA n 
2 450 GLU n 
2 451 THR n 
2 452 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  G47 n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DDG n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DG  n 
4 6   DC  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 561 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 452 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 6OR7      6OR7   ? 3 ? 1   
4 PDB 6OR7      6OR7   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6OR7 A 2  ? 561 ? P04585 588 ? 1147 ? 1   560 
2 2 6OR7 B 13 ? 452 ? P04585 588 ? 1027 ? 1   440 
3 3 6OR7 P 1  ? 21  ? 6OR7   802 ? 822  ? 802 822 
4 4 6OR7 T 1  ? 27  ? 6OR7   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6OR7 MET A 1   ? UNP P04585 ?   ?   'expression tag'      0   1  
1 6OR7 CYS A 259 ? UNP P04585 GLN 845 'engineered mutation' 258 2  
1 6OR7 SER A 281 ? UNP P04585 CYS 867 'engineered mutation' 280 3  
2 6OR7 MET B 1   ? UNP P04585 ?   ?   'expression tag'      -11 4  
2 6OR7 GLY B 2   ? UNP P04585 ?   ?   'expression tag'      -10 5  
2 6OR7 SER B 3   ? UNP P04585 ?   ?   'expression tag'      -9  6  
2 6OR7 SER B 4   ? UNP P04585 ?   ?   'expression tag'      -8  7  
2 6OR7 HIS B 5   ? UNP P04585 ?   ?   'expression tag'      -7  8  
2 6OR7 HIS B 6   ? UNP P04585 ?   ?   'expression tag'      -6  9  
2 6OR7 HIS B 7   ? UNP P04585 ?   ?   'expression tag'      -5  10 
2 6OR7 HIS B 8   ? UNP P04585 ?   ?   'expression tag'      -4  11 
2 6OR7 HIS B 9   ? UNP P04585 ?   ?   'expression tag'      -3  12 
2 6OR7 HIS B 10  ? UNP P04585 ?   ?   'expression tag'      -2  13 
2 6OR7 SER B 11  ? UNP P04585 ?   ?   'expression tag'      -1  14 
2 6OR7 SER B 12  ? UNP P04585 ?   ?   'expression tag'      0   15 
2 6OR7 SER B 292 ? UNP P04585 CYS 867 'engineered mutation' 280 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1RY non-polymer         . 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
? 'C8 H13 F N3 O12 P3 S' 487.186 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'           133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'         121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'      331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'       307.197 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'      331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'      347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'      322.208 
G47 'DNA linking'       n "N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C12 H18 N5 O7 P S'    407.339 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'           105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'              96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'          117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6OR7 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.77 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.55 
_exptl_crystal.description                 'thin plate' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '6-10% (w/v) PEG 8000, 15 mM magnesium sulfate, and 50 mM MES adjusted at pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC HF-4M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-08-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6OR7 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.53 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       48991 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.093 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.64 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.53 
_reflns_shell.d_res_low                   2.68 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.93 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           7702 
_reflns_shell.percent_possible_all        98.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.98 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.778 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6OR7 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.530 
_refine.ls_d_res_low                             47.572 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     48969 
_refine.ls_number_reflns_R_free                  2447 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.70 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2138 
_refine.ls_R_factor_R_free                       0.2493 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2119 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3KJV 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.52 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.530 
_refine_hist.d_res_low                        47.572 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               8245 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7309 
_refine_hist.pdbx_number_atoms_nucleic_acid   843 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 8495  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.569  ? 11784 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.273 ? 4877  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1316  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1352  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5302 2.5819  . . 137 2611 96.00  . . . 0.3798 . 0.3245 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5819 2.6380  . . 141 2673 100.00 . . . 0.3573 . 0.3156 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6380 2.6994  . . 142 2709 100.00 . . . 0.3793 . 0.3147 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6994 2.7669  . . 144 2739 100.00 . . . 0.3615 . 0.3533 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7669 2.8417  . . 142 2701 100.00 . . . 0.3761 . 0.3044 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8417 2.9253  . . 143 2721 100.00 . . . 0.3392 . 0.2702 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9253 3.0197  . . 143 2726 100.00 . . . 0.2789 . 0.2617 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0197 3.1276  . . 144 2727 100.00 . . . 0.3056 . 0.2705 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1276 3.2528  . . 143 2717 100.00 . . . 0.2787 . 0.2495 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2528 3.4008  . . 144 2736 100.00 . . . 0.2623 . 0.2436 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4008 3.5800  . . 143 2721 100.00 . . . 0.2983 . 0.2232 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5800 3.8043  . . 144 2740 100.00 . . . 0.2732 . 0.2050 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8043 4.0978  . . 146 2762 100.00 . . . 0.2218 . 0.1813 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0978 4.5099  . . 145 2761 100.00 . . . 0.2032 . 0.1656 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5099 5.1619  . . 146 2781 100.00 . . . 0.2219 . 0.1585 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1619 6.5008  . . 147 2792 100.00 . . . 0.1922 . 0.1936 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5008 47.5801 . . 153 2905 100.00 . . . 0.1927 . 0.1786 . . . . . . . . . . 
# 
_struct.entry_id                     6OR7 
_struct.title                        'Structure of HIV-1 Reverse Transcriptase (RT) in complex with DNA AND (-)FTC-TP' 
_struct.pdbx_descriptor              'Reverse transcriptase/ribonuclease H, p51 RT/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6OR7 
_struct_keywords.text            
;Reverse Transcriptase, ternary complex, (-)FTC-TP, chain terminator, emtricitabine, stereochemistry, TRANSFERASE, TRANSFERASE-DNA complex
;
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 28  ? GLU A 45  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 78  ? THR A 85  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 97  ? LEU A 101 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 115 ? VAL A 119 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 122 ? LYS A 127 ? ASP A 121 LYS A 126 1 ? 6  
HELX_P HELX_P6  AA6 TYR A 128 ? ALA A 130 ? TYR A 127 ALA A 129 5 ? 3  
HELX_P HELX_P7  AA7 GLY A 156 ? ASN A 176 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P8  AA8 GLU A 195 ? TRP A 213 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P9  AA9 PRO A 218 ? HIS A 222 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P10 AB1 THR A 254 ? SER A 269 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P11 AB2 VAL A 277 ? LYS A 282 ? VAL A 276 LYS A 281 1 ? 6  
HELX_P HELX_P12 AB3 LEU A 283 ? ARG A 285 ? LEU A 282 ARG A 284 5 ? 3  
HELX_P HELX_P13 AB4 THR A 297 ? LEU A 311 ? THR A 296 LEU A 310 1 ? 15 
HELX_P HELX_P14 AB5 ASN A 364 ? GLY A 385 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P15 AB6 GLN A 395 ? TYR A 406 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P16 AB7 THR A 474 ? SER A 490 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P17 AB8 SER A 500 ? ALA A 509 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P18 AB9 SER A 516 ? LYS A 529 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P19 AC1 GLY A 545 ? SER A 554 ? GLY A 544 SER A 553 1 ? 10 
HELX_P HELX_P20 AC2 THR B 39  ? GLU B 56  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P21 AC3 PHE B 89  ? THR B 96  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P22 AC4 GLY B 111 ? LYS B 115 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P23 AC5 GLY B 124 ? VAL B 130 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P24 AC6 ASP B 133 ? ALA B 141 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P25 AC7 SER B 146 ? GLU B 150 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P26 AC8 LYS B 166 ? GLN B 186 ? LYS B 154 GLN B 174 1 ? 21 
HELX_P HELX_P27 AC9 GLN B 209 ? LEU B 221 ? GLN B 197 LEU B 209 1 ? 13 
HELX_P HELX_P28 AD1 HIS B 247 ? TRP B 251 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P29 AD2 VAL B 266 ? SER B 280 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P30 AD3 VAL B 288 ? LEU B 294 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P31 AD4 THR B 308 ? LEU B 322 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P32 AD5 ASN B 375 ? GLY B 396 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P33 AD6 GLN B 406 ? TRP B 414 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P34 AD7 THR B 415 ? TYR B 417 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P35 AD8 PRO B 432 ? TYR B 439 ? PRO B 420 TYR B 427 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 111 OD1   ? ? ? 1_555 F MG  .  MG ? ? A ASP 110 A MG  602 1_555 ? ? ? ? ? ? ?            1.993 ? 
metalc2  metalc ?    ? A VAL 112 O     ? ? ? 1_555 F MG  .  MG ? ? A VAL 111 A MG  602 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc3  metalc ?    ? A ASP 186 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 185 A MG  602 1_555 ? ? ? ? ? ? ?            2.262 ? 
covale1  covale none ? A CYS 259 SG    ? ? ? 1_555 C G47 16 SG ? ? A CYS 258 P G47 817 1_555 ? ? ? ? ? ? ?            2.035 ? 
metalc4  metalc ?    ? A ASP 444 OD1   ? ? ? 1_555 G MG  .  MG ? ? A ASP 443 A MG  603 1_555 ? ? ? ? ? ? ?            2.125 ? 
metalc5  metalc ?    ? A GLU 479 OE2   ? ? ? 1_555 G MG  .  MG ? ? A GLU 478 A MG  603 1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc6  metalc ?    ? A ASP 499 OD2   ? ? ? 1_555 G MG  .  MG ? ? A ASP 498 A MG  603 1_555 ? ? ? ? ? ? ?            1.982 ? 
covale2  covale both ? C DG  15  "O3'" ? ? ? 1_555 C G47 16 P  ? ? P DG  816 P G47 817 1_555 ? ? ? ? ? ? ?            1.607 ? 
covale3  covale one  ? C G47 16  "O3'" ? ? ? 1_555 C DC  17 P  ? ? P G47 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale4  covale both ? C DC  20  "O3'" ? ? ? 1_555 C DDG 21 P  ? ? P DC  821 P DDG 822 1_555 ? ? ? ? ? ? ?            1.558 ? 
metalc7  metalc ?    ? E 1RY .   OAQ   ? ? ? 1_555 F MG  .  MG ? ? A 1RY 601 A MG  602 1_555 ? ? ? ? ? ? ?            2.577 ? 
metalc8  metalc ?    ? E 1RY .   OAD   ? ? ? 1_555 F MG  .  MG ? ? A 1RY 601 A MG  602 1_555 ? ? ? ? ? ? ?            2.696 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C G47 16  N1    ? ? ? 1_555 D DC  11 N3 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C G47 16  N2    ? ? ? 1_555 D DC  11 O2 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C G47 16  O6    ? ? ? 1_555 D DC  11 N4 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DDG 21  N1    ? ? ? 1_555 D DC  6  N3 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DDG 21  N2    ? ? ? 1_555 D DC  6  O2 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DDG 21  O6    ? ? ? 1_555 D DC  6  N4 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 226 A . ? PRO 225 A PRO 227 A ? PRO 226 A 1 0.33  
2 PRO 421 A . ? PRO 420 A PRO 422 A ? PRO 421 A 1 -4.39 
3 GLY 544 A . ? GLY 543 A GLY 545 A ? GLY 544 A 1 0.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 48  ? LYS A 50  ? ILE A 47  LYS A 49  
AA1 2 ARG A 144 ? TYR A 147 ? ARG A 143 TYR A 146 
AA1 3 PHE A 131 ? THR A 132 ? PHE A 130 THR A 131 
AA2 1 VAL A 61  ? LYS A 65  ? VAL A 60  LYS A 64  
AA2 2 TRP A 72  ? VAL A 76  ? TRP A 71  VAL A 75  
AA3 1 SER A 106 ? ASP A 111 ? SER A 105 ASP A 110 
AA3 2 ASP A 187 ? SER A 192 ? ASP A 186 SER A 191 
AA3 3 VAL A 180 ? GLN A 183 ? VAL A 179 GLN A 182 
AA4 1 PHE A 228 ? TRP A 230 ? PHE A 227 TRP A 229 
AA4 2 TYR A 233 ? LEU A 235 ? TYR A 232 LEU A 234 
AA4 3 LYS A 239 ? VAL A 242 ? LYS A 238 VAL A 241 
AA4 4 GLY A 317 ? VAL A 318 ? GLY A 316 VAL A 317 
AA5 1 LYS A 348 ? TYR A 355 ? LYS A 347 TYR A 354 
AA5 2 GLN A 337 ? GLU A 345 ? GLN A 336 GLU A 344 
AA5 3 ILE A 327 ? GLN A 333 ? ILE A 326 GLN A 332 
AA5 4 LYS A 389 ? LEU A 392 ? LYS A 388 LEU A 391 
AA5 5 TRP A 415 ? PHE A 417 ? TRP A 414 PHE A 416 
AA6 1 HIS A 362 ? THR A 363 ? HIS A 361 THR A 362 
AA6 2 GLN A 513 ? SER A 514 ? GLN A 512 SER A 513 
AA7 1 GLN A 465 ? LEU A 470 ? GLN A 464 LEU A 469 
AA7 2 GLY A 454 ? THR A 460 ? GLY A 453 THR A 459 
AA7 3 GLU A 439 ? ALA A 447 ? GLU A 438 ALA A 446 
AA7 4 GLU A 493 ? THR A 498 ? GLU A 492 THR A 497 
AA7 5 LYS A 531 ? TRP A 536 ? LYS A 530 TRP A 535 
AA8 1 ILE B 59  ? LYS B 61  ? ILE B 47  LYS B 49  
AA8 2 ILE B 154 ? TYR B 158 ? ILE B 142 TYR B 146 
AA8 3 PHE B 142 ? ILE B 144 ? PHE B 130 ILE B 132 
AA9 1 VAL B 72  ? LYS B 77  ? VAL B 60  LYS B 65  
AA9 2 LYS B 82  ? VAL B 87  ? LYS B 70  VAL B 75  
AB1 1 SER B 117 ? ASP B 122 ? SER B 105 ASP B 110 
AB1 2 ASP B 198 ? SER B 203 ? ASP B 186 SER B 191 
AB1 3 VAL B 191 ? TYR B 195 ? VAL B 179 TYR B 183 
AB2 1 TRP B 264 ? THR B 265 ? TRP B 252 THR B 253 
AB2 2 VAL B 304 ? ILE B 305 ? VAL B 292 ILE B 293 
AB3 1 LYS B 359 ? ALA B 367 ? LYS B 347 ALA B 355 
AB3 2 GLN B 348 ? GLU B 356 ? GLN B 336 GLU B 344 
AB3 3 ILE B 338 ? GLY B 345 ? ILE B 326 GLY B 333 
AB3 4 LYS B 400 ? LEU B 403 ? LYS B 388 LEU B 391 
AB3 5 TRP B 426 ? PHE B 428 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 49  ? N SER A 48  O GLN A 146 ? O GLN A 145 
AA1 2 3 O TYR A 145 ? O TYR A 144 N PHE A 131 ? N PHE A 130 
AA2 1 2 N ILE A 64  ? N ILE A 63  O ARG A 73  ? O ARG A 72  
AA3 1 2 N THR A 108 ? N THR A 107 O VAL A 190 ? O VAL A 189 
AA3 2 3 O GLY A 191 ? O GLY A 190 N VAL A 180 ? N VAL A 179 
AA4 1 2 N PHE A 228 ? N PHE A 227 O LEU A 235 ? O LEU A 234 
AA4 2 3 N GLU A 234 ? N GLU A 233 O THR A 241 ? O THR A 240 
AA4 3 4 N TRP A 240 ? N TRP A 239 O GLY A 317 ? O GLY A 316 
AA5 1 2 O LEU A 350 ? O LEU A 349 N ILE A 342 ? N ILE A 341 
AA5 2 3 O GLN A 337 ? O GLN A 336 N GLN A 333 ? N GLN A 332 
AA5 3 4 N ALA A 328 ? N ALA A 327 O LYS A 389 ? O LYS A 388 
AA5 4 5 N PHE A 390 ? N PHE A 389 O GLU A 416 ? O GLU A 415 
AA6 1 2 N THR A 363 ? N THR A 362 O GLN A 513 ? O GLN A 512 
AA7 1 2 O VAL A 468 ? O VAL A 467 N ALA A 456 ? N ALA A 455 
AA7 2 3 O VAL A 459 ? O VAL A 458 N TYR A 442 ? N TYR A 441 
AA7 3 4 N PHE A 441 ? N PHE A 440 O ASN A 495 ? O ASN A 494 
AA7 4 5 N THR A 498 ? N THR A 497 O ALA A 535 ? O ALA A 534 
AA8 1 2 N SER B 60  ? N SER B 48  O GLN B 157 ? O GLN B 145 
AA8 2 3 O ILE B 154 ? O ILE B 142 N ILE B 144 ? N ILE B 132 
AA9 1 2 N PHE B 73  ? N PHE B 61  O LEU B 86  ? O LEU B 74  
AB1 1 2 N SER B 117 ? N SER B 105 O SER B 203 ? O SER B 191 
AB1 2 3 O TYR B 200 ? O TYR B 188 N TYR B 193 ? N TYR B 181 
AB2 1 2 N TRP B 264 ? N TRP B 252 O ILE B 305 ? O ILE B 293 
AB3 1 2 O LEU B 361 ? O LEU B 349 N ILE B 353 ? N ILE B 341 
AB3 2 3 O TYR B 354 ? O TYR B 342 N ILE B 338 ? N ILE B 326 
AB3 3 4 N ALA B 339 ? N ALA B 327 O LYS B 402 ? O LYS B 390 
AB3 4 5 N LEU B 403 ? N LEU B 391 O GLU B 427 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 1RY 601 ? 14 'binding site for residue 1RY A 601' 
AC2 Software A MG  602 ? 4  'binding site for residue MG A 602'  
AC3 Software A MG  603 ? 3  'binding site for residue MG A 603'  
AC4 Software A SO4 604 ? 5  'binding site for residue SO4 A 604' 
AC5 Software P SO4 901 ? 4  'binding site for residue SO4 P 901' 
AC6 Software T SO4 801 ? 2  'binding site for residue SO4 T 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LYS A 66  ? LYS A 65  . ? 1_555 ? 
2  AC1 14 ARG A 73  ? ARG A 72  . ? 1_555 ? 
3  AC1 14 ASP A 111 ? ASP A 110 . ? 1_555 ? 
4  AC1 14 VAL A 112 ? VAL A 111 . ? 1_555 ? 
5  AC1 14 GLY A 113 ? GLY A 112 . ? 1_555 ? 
6  AC1 14 ASP A 114 ? ASP A 113 . ? 1_555 ? 
7  AC1 14 ALA A 115 ? ALA A 114 . ? 1_555 ? 
8  AC1 14 TYR A 116 ? TYR A 115 . ? 1_555 ? 
9  AC1 14 GLN A 152 ? GLN A 151 . ? 1_555 ? 
10 AC1 14 ASP A 186 ? ASP A 185 . ? 1_555 ? 
11 AC1 14 LYS A 221 ? LYS A 220 . ? 1_555 ? 
12 AC1 14 MG  F .   ? MG  A 602 . ? 1_555 ? 
13 AC1 14 DDG C 21  ? DDG P 822 . ? 1_555 ? 
14 AC1 14 DG  D 5   ? DG  T 705 . ? 1_555 ? 
15 AC2 4  ASP A 111 ? ASP A 110 . ? 1_555 ? 
16 AC2 4  VAL A 112 ? VAL A 111 . ? 1_555 ? 
17 AC2 4  ASP A 186 ? ASP A 185 . ? 1_555 ? 
18 AC2 4  1RY E .   ? 1RY A 601 . ? 1_555 ? 
19 AC3 3  ASP A 444 ? ASP A 443 . ? 1_555 ? 
20 AC3 3  GLU A 479 ? GLU A 478 . ? 1_555 ? 
21 AC3 3  ASP A 499 ? ASP A 498 . ? 1_555 ? 
22 AC4 5  ARG A 207 ? ARG A 206 . ? 7_554 ? 
23 AC4 5  GLN A 208 ? GLN A 207 . ? 7_554 ? 
24 AC4 5  ASN A 461 ? ASN A 460 . ? 1_555 ? 
25 AC4 5  ARG A 462 ? ARG A 461 . ? 1_555 ? 
26 AC4 5  ALA B 300 ? ALA B 288 . ? 1_555 ? 
27 AC5 4  G47 C 16  ? G47 P 817 . ? 1_555 ? 
28 AC5 4  DC  C 17  ? DC  P 818 . ? 1_555 ? 
29 AC5 4  DG  D 10  ? DG  T 710 . ? 1_555 ? 
30 AC5 4  DC  D 11  ? DC  T 711 . ? 1_555 ? 
31 AC6 2  DG  D 7   ? DG  T 707 . ? 1_555 ? 
32 AC6 2  DG  D 8   ? DG  T 708 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6OR7 
_atom_sites.fract_transf_matrix[1][1]   0.006006 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005888 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009682 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 2   ? 44.208 -10.333 -15.560 1.00 85.28  ? 1    PRO A N     1 
ATOM   2    C  CA    . PRO A 1 2   ? 42.934 -10.915 -15.118 1.00 85.09  ? 1    PRO A CA    1 
ATOM   3    C  C     . PRO A 1 2   ? 41.754 -9.960  -15.295 1.00 78.47  ? 1    PRO A C     1 
ATOM   4    O  O     . PRO A 1 2   ? 41.852 -8.995  -16.055 1.00 76.23  ? 1    PRO A O     1 
ATOM   5    C  CB    . PRO A 1 2   ? 43.181 -11.213 -13.635 1.00 87.45  ? 1    PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 2   ? 44.283 -10.286 -13.238 1.00 88.70  ? 1    PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 2   ? 45.158 -10.172 -14.446 1.00 87.48  ? 1    PRO A CD    1 
ATOM   8    N  N     . ILE A 1 3   ? 40.651 -10.234 -14.601 1.00 70.10  ? 2    ILE A N     1 
ATOM   9    C  CA    . ILE A 1 3   ? 39.440 -9.423  -14.673 1.00 62.25  ? 2    ILE A CA    1 
ATOM   10   C  C     . ILE A 1 3   ? 39.246 -8.731  -13.332 1.00 58.57  ? 2    ILE A C     1 
ATOM   11   O  O     . ILE A 1 3   ? 39.352 -9.367  -12.276 1.00 59.95  ? 2    ILE A O     1 
ATOM   12   C  CB    . ILE A 1 3   ? 38.210 -10.270 -15.045 1.00 59.79  ? 2    ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 3   ? 38.352 -10.820 -16.467 1.00 59.48  ? 2    ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 3   ? 36.937 -9.450  -14.925 1.00 58.58  ? 2    ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 3   ? 37.146 -11.601 -16.949 1.00 59.19  ? 2    ILE A CD1   1 
ATOM   16   N  N     . SER A 1 4   ? 38.970 -7.431  -13.377 1.00 53.99  ? 3    SER A N     1 
ATOM   17   C  CA    . SER A 1 4   ? 38.831 -6.648  -12.158 1.00 53.09  ? 3    SER A CA    1 
ATOM   18   C  C     . SER A 1 4   ? 37.648 -7.151  -11.335 1.00 52.37  ? 3    SER A C     1 
ATOM   19   O  O     . SER A 1 4   ? 36.557 -7.358  -11.887 1.00 49.06  ? 3    SER A O     1 
ATOM   20   C  CB    . SER A 1 4   ? 38.644 -5.168  -12.492 1.00 50.87  ? 3    SER A CB    1 
ATOM   21   O  OG    . SER A 1 4   ? 38.572 -4.382  -11.315 1.00 48.95  ? 3    SER A OG    1 
ATOM   22   N  N     . PRO A 1 5   ? 37.816 -7.358  -10.025 1.00 55.01  ? 4    PRO A N     1 
ATOM   23   C  CA    . PRO A 1 5   ? 36.677 -7.749  -9.185  1.00 57.73  ? 4    PRO A CA    1 
ATOM   24   C  C     . PRO A 1 5   ? 35.837 -6.550  -8.778  1.00 55.82  ? 4    PRO A C     1 
ATOM   25   O  O     . PRO A 1 5   ? 35.038 -6.628  -7.840  1.00 57.70  ? 4    PRO A O     1 
ATOM   26   C  CB    . PRO A 1 5   ? 37.349 -8.408  -7.977  1.00 50.87  ? 4    PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 5   ? 38.653 -7.695  -7.862  1.00 52.37  ? 4    PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 5   ? 39.083 -7.359  -9.272  1.00 54.18  ? 4    PRO A CD    1 
ATOM   29   N  N     . ILE A 1 6   ? 36.030 -5.427  -9.470  1.00 55.07  ? 5    ILE A N     1 
ATOM   30   C  CA    . ILE A 1 6   ? 35.246 -4.230  -9.204  1.00 53.60  ? 5    ILE A CA    1 
ATOM   31   C  C     . ILE A 1 6   ? 33.792 -4.473  -9.593  1.00 54.63  ? 5    ILE A C     1 
ATOM   32   O  O     . ILE A 1 6   ? 33.482 -5.297  -10.466 1.00 55.17  ? 5    ILE A O     1 
ATOM   33   C  CB    . ILE A 1 6   ? 35.835 -3.025  -9.961  1.00 51.96  ? 5    ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 6   ? 35.234 -1.711  -9.452  1.00 55.09  ? 5    ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 6   ? 35.617 -3.176  -11.460 1.00 49.22  ? 5    ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 6   ? 35.670 -0.488  -10.237 1.00 53.53  ? 5    ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 7   ? 32.887 -3.763  -8.926  1.00 55.24  ? 6    GLU A N     1 
ATOM   38   C  CA    . GLU A 1 7   ? 31.471 -3.875  -9.238  1.00 55.80  ? 6    GLU A CA    1 
ATOM   39   C  C     . GLU A 1 7   ? 31.180 -3.277  -10.611 1.00 51.62  ? 6    GLU A C     1 
ATOM   40   O  O     . GLU A 1 7   ? 31.842 -2.334  -11.056 1.00 52.11  ? 6    GLU A O     1 
ATOM   41   C  CB    . GLU A 1 7   ? 30.638 -3.179  -8.163  1.00 61.77  ? 6    GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 7   ? 30.978 -3.633  -6.751  1.00 73.49  ? 6    GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 7   ? 30.119 -2.969  -5.692  1.00 83.40  ? 6    GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 7   ? 29.512 -1.917  -5.986  1.00 85.87  ? 6    GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 7   ? 30.050 -3.504  -4.564  1.00 87.04  ? 6    GLU A OE2   1 
ATOM   46   N  N     . THR A 1 8   ? 30.185 -3.843  -11.288 1.00 49.50  ? 7    THR A N     1 
ATOM   47   C  CA    . THR A 1 8   ? 29.817 -3.377  -12.614 1.00 48.77  ? 7    THR A CA    1 
ATOM   48   C  C     . THR A 1 8   ? 28.973 -2.109  -12.530 1.00 52.28  ? 7    THR A C     1 
ATOM   49   O  O     . THR A 1 8   ? 28.318 -1.827  -11.522 1.00 53.97  ? 7    THR A O     1 
ATOM   50   C  CB    . THR A 1 8   ? 29.046 -4.454  -13.385 1.00 49.34  ? 7    THR A CB    1 
ATOM   51   O  OG1   . THR A 1 8   ? 27.968 -4.950  -12.580 1.00 50.57  ? 7    THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 8   ? 29.966 -5.601  -13.773 1.00 49.69  ? 7    THR A CG2   1 
ATOM   53   N  N     . VAL A 1 9   ? 29.000 -1.340  -13.613 1.00 50.08  ? 8    VAL A N     1 
ATOM   54   C  CA    . VAL A 1 9   ? 28.175 -0.145  -13.751 1.00 48.13  ? 8    VAL A CA    1 
ATOM   55   C  C     . VAL A 1 9   ? 26.886 -0.549  -14.460 1.00 51.58  ? 8    VAL A C     1 
ATOM   56   O  O     . VAL A 1 9   ? 26.951 -1.057  -15.592 1.00 52.27  ? 8    VAL A O     1 
ATOM   57   C  CB    . VAL A 1 9   ? 28.910 0.954   -14.528 1.00 48.03  ? 8    VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 9   ? 28.003 2.154   -14.745 1.00 47.23  ? 8    VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 9   ? 30.181 1.364   -13.791 1.00 48.55  ? 8    VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 10  ? 25.715 -0.353  -13.849 1.00 54.71  ? 9    PRO A N     1 
ATOM   61   C  CA    . PRO A 1 10  ? 24.462 -0.814  -14.467 1.00 57.75  ? 9    PRO A CA    1 
ATOM   62   C  C     . PRO A 1 10  ? 24.043 0.110   -15.603 1.00 59.72  ? 9    PRO A C     1 
ATOM   63   O  O     . PRO A 1 10  ? 23.801 1.302   -15.397 1.00 59.70  ? 9    PRO A O     1 
ATOM   64   C  CB    . PRO A 1 10  ? 23.461 -0.776  -13.306 1.00 55.12  ? 9    PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 10  ? 23.989 0.294   -12.406 1.00 55.30  ? 9    PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 10  ? 25.493 0.262   -12.529 1.00 54.40  ? 9    PRO A CD    1 
ATOM   67   N  N     . VAL A 1 11  ? 23.965 -0.448  -16.809 1.00 60.04  ? 10   VAL A N     1 
ATOM   68   C  CA    . VAL A 1 11  ? 23.526 0.279   -17.989 1.00 62.31  ? 10   VAL A CA    1 
ATOM   69   C  C     . VAL A 1 11  ? 22.226 -0.337  -18.486 1.00 66.12  ? 10   VAL A C     1 
ATOM   70   O  O     . VAL A 1 11  ? 21.861 -1.457  -18.124 1.00 71.10  ? 10   VAL A O     1 
ATOM   71   C  CB    . VAL A 1 11  ? 24.590 0.276   -19.106 1.00 63.51  ? 10   VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 11  ? 25.801 1.088   -18.684 1.00 62.61  ? 10   VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 11  ? 24.998 -1.147  -19.440 1.00 63.77  ? 10   VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 12  ? 21.523 0.418   -19.326 1.00 66.02  ? 11   LYS A N     1 
ATOM   75   C  CA    . LYS A 1 12  ? 20.255 -0.036  -19.873 1.00 67.08  ? 11   LYS A CA    1 
ATOM   76   C  C     . LYS A 1 12  ? 20.087 0.534   -21.272 1.00 66.59  ? 11   LYS A C     1 
ATOM   77   O  O     . LYS A 1 12  ? 20.692 1.547   -21.628 1.00 65.94  ? 11   LYS A O     1 
ATOM   78   C  CB    . LYS A 1 12  ? 19.075 0.374   -18.982 1.00 67.15  ? 11   LYS A CB    1 
ATOM   79   N  N     . LEU A 1 13  ? 19.264 -0.141  -22.068 1.00 66.87  ? 12   LEU A N     1 
ATOM   80   C  CA    . LEU A 1 13  ? 18.920 0.378   -23.380 1.00 67.05  ? 12   LEU A CA    1 
ATOM   81   C  C     . LEU A 1 13  ? 17.952 1.550   -23.249 1.00 67.15  ? 12   LEU A C     1 
ATOM   82   O  O     . LEU A 1 13  ? 17.290 1.734   -22.224 1.00 68.08  ? 12   LEU A O     1 
ATOM   83   C  CB    . LEU A 1 13  ? 18.296 -0.716  -24.247 1.00 69.05  ? 12   LEU A CB    1 
ATOM   84   C  CG    . LEU A 1 13  ? 19.207 -1.848  -24.722 1.00 67.05  ? 12   LEU A CG    1 
ATOM   85   C  CD1   . LEU A 1 13  ? 18.431 -2.810  -25.609 1.00 69.36  ? 12   LEU A CD1   1 
ATOM   86   C  CD2   . LEU A 1 13  ? 20.411 -1.289  -25.461 1.00 64.97  ? 12   LEU A CD2   1 
ATOM   87   N  N     . LYS A 1 14  ? 17.884 2.357   -24.304 1.00 67.85  ? 13   LYS A N     1 
ATOM   88   C  CA    . LYS A 1 14  ? 16.871 3.395   -24.359 1.00 72.56  ? 13   LYS A CA    1 
ATOM   89   C  C     . LYS A 1 14  ? 15.485 2.748   -24.361 1.00 79.81  ? 13   LYS A C     1 
ATOM   90   O  O     . LYS A 1 14  ? 15.306 1.655   -24.908 1.00 82.47  ? 13   LYS A O     1 
ATOM   91   C  CB    . LYS A 1 14  ? 17.058 4.265   -25.601 1.00 71.14  ? 13   LYS A CB    1 
ATOM   92   N  N     . PRO A 1 15  ? 14.495 3.388   -23.740 1.00 82.23  ? 14   PRO A N     1 
ATOM   93   C  CA    . PRO A 1 15  ? 13.178 2.753   -23.598 1.00 85.89  ? 14   PRO A CA    1 
ATOM   94   C  C     . PRO A 1 15  ? 12.578 2.358   -24.941 1.00 88.01  ? 14   PRO A C     1 
ATOM   95   O  O     . PRO A 1 15  ? 12.673 3.090   -25.928 1.00 88.00  ? 14   PRO A O     1 
ATOM   96   C  CB    . PRO A 1 15  ? 12.338 3.832   -22.906 1.00 88.42  ? 14   PRO A CB    1 
ATOM   97   C  CG    . PRO A 1 15  ? 13.337 4.672   -22.179 1.00 84.85  ? 14   PRO A CG    1 
ATOM   98   C  CD    . PRO A 1 15  ? 14.561 4.687   -23.048 1.00 81.57  ? 14   PRO A CD    1 
ATOM   99   N  N     . GLY A 1 16  ? 11.964 1.177   -24.966 1.00 91.23  ? 15   GLY A N     1 
ATOM   100  C  CA    . GLY A 1 16  ? 11.277 0.702   -26.150 1.00 96.46  ? 15   GLY A CA    1 
ATOM   101  C  C     . GLY A 1 16  ? 12.165 0.282   -27.299 1.00 97.78  ? 15   GLY A C     1 
ATOM   102  O  O     . GLY A 1 16  ? 11.698 0.235   -28.440 1.00 100.42 ? 15   GLY A O     1 
ATOM   103  N  N     . MET A 1 17  ? 13.431 -0.033  -27.037 1.00 94.68  ? 16   MET A N     1 
ATOM   104  C  CA    . MET A 1 17  ? 14.359 -0.443  -28.081 1.00 94.61  ? 16   MET A CA    1 
ATOM   105  C  C     . MET A 1 17  ? 15.019 -1.760  -27.695 1.00 92.74  ? 16   MET A C     1 
ATOM   106  O  O     . MET A 1 17  ? 15.085 -2.126  -26.519 1.00 88.54  ? 16   MET A O     1 
ATOM   107  C  CB    . MET A 1 17  ? 15.427 0.630   -28.337 1.00 91.91  ? 16   MET A CB    1 
ATOM   108  C  CG    . MET A 1 17  ? 14.861 1.991   -28.711 1.00 93.55  ? 16   MET A CG    1 
ATOM   109  S  SD    . MET A 1 17  ? 16.127 3.132   -29.297 1.00 91.60  ? 16   MET A SD    1 
ATOM   110  C  CE    . MET A 1 17  ? 15.183 4.647   -29.439 1.00 93.18  ? 16   MET A CE    1 
ATOM   111  N  N     . ASP A 1 18  ? 15.509 -2.471  -28.706 1.00 97.61  ? 17   ASP A N     1 
ATOM   112  C  CA    . ASP A 1 18  ? 16.151 -3.770  -28.539 1.00 99.94  ? 17   ASP A CA    1 
ATOM   113  C  C     . ASP A 1 18  ? 17.570 -3.727  -29.102 1.00 96.81  ? 17   ASP A C     1 
ATOM   114  O  O     . ASP A 1 18  ? 18.049 -2.693  -29.573 1.00 96.52  ? 17   ASP A O     1 
ATOM   115  C  CB    . ASP A 1 18  ? 15.329 -4.877  -29.205 1.00 107.31 ? 17   ASP A CB    1 
ATOM   116  C  CG    . ASP A 1 18  ? 14.124 -5.284  -28.380 1.00 113.98 ? 17   ASP A CG    1 
ATOM   117  O  OD1   . ASP A 1 18  ? 14.226 -5.273  -27.135 1.00 113.21 ? 17   ASP A OD1   1 
ATOM   118  O  OD2   . ASP A 1 18  ? 13.077 -5.616  -28.975 1.00 120.47 ? 17   ASP A OD2   1 
ATOM   119  N  N     . GLY A 1 19  ? 18.239 -4.877  -29.051 1.00 94.81  ? 18   GLY A N     1 
ATOM   120  C  CA    . GLY A 1 19  ? 19.624 -4.979  -29.448 1.00 89.80  ? 18   GLY A CA    1 
ATOM   121  C  C     . GLY A 1 19  ? 19.820 -4.988  -30.950 1.00 87.81  ? 18   GLY A C     1 
ATOM   122  O  O     . GLY A 1 19  ? 18.887 -5.225  -31.725 1.00 90.39  ? 18   GLY A O     1 
ATOM   123  N  N     . PRO A 1 20  ? 21.053 -4.739  -31.389 1.00 81.55  ? 19   PRO A N     1 
ATOM   124  C  CA    . PRO A 1 20  ? 21.322 -4.650  -32.827 1.00 81.70  ? 19   PRO A CA    1 
ATOM   125  C  C     . PRO A 1 20  ? 21.328 -6.019  -33.489 1.00 85.10  ? 19   PRO A C     1 
ATOM   126  O  O     . PRO A 1 20  ? 21.623 -7.040  -32.863 1.00 84.75  ? 19   PRO A O     1 
ATOM   127  C  CB    . PRO A 1 20  ? 22.710 -4.005  -32.881 1.00 77.41  ? 19   PRO A CB    1 
ATOM   128  C  CG    . PRO A 1 20  ? 23.365 -4.475  -31.626 1.00 74.68  ? 19   PRO A CG    1 
ATOM   129  C  CD    . PRO A 1 20  ? 22.272 -4.539  -30.586 1.00 75.23  ? 19   PRO A CD    1 
ATOM   130  N  N     . LYS A 1 21  ? 20.998 -6.032  -34.778 1.00 87.36  ? 20   LYS A N     1 
ATOM   131  C  CA    . LYS A 1 21  ? 20.970 -7.258  -35.570 1.00 88.24  ? 20   LYS A CA    1 
ATOM   132  C  C     . LYS A 1 21  ? 21.672 -7.042  -36.905 1.00 89.13  ? 20   LYS A C     1 
ATOM   133  O  O     . LYS A 1 21  ? 21.160 -7.385  -37.973 1.00 93.26  ? 20   LYS A O     1 
ATOM   134  C  CB    . LYS A 1 21  ? 19.537 -7.742  -35.779 1.00 91.70  ? 20   LYS A CB    1 
ATOM   135  C  CG    . LYS A 1 21  ? 18.755 -7.947  -34.490 1.00 86.02  ? 20   LYS A CG    1 
ATOM   136  C  CD    . LYS A 1 21  ? 17.613 -8.927  -34.689 1.00 90.90  ? 20   LYS A CD    1 
ATOM   137  C  CE    . LYS A 1 21  ? 16.750 -9.035  -33.444 1.00 93.29  ? 20   LYS A CE    1 
ATOM   138  N  NZ    . LYS A 1 21  ? 15.960 -7.795  -33.217 1.00 93.35  ? 20   LYS A NZ    1 
ATOM   139  N  N     . VAL A 1 22  ? 22.870 -6.461  -36.855 1.00 86.08  ? 21   VAL A N     1 
ATOM   140  C  CA    . VAL A 1 22  ? 23.649 -6.201  -38.060 1.00 86.53  ? 21   VAL A CA    1 
ATOM   141  C  C     . VAL A 1 22  ? 24.436 -7.447  -38.441 1.00 90.86  ? 21   VAL A C     1 
ATOM   142  O  O     . VAL A 1 22  ? 24.883 -8.218  -37.584 1.00 90.65  ? 21   VAL A O     1 
ATOM   143  C  CB    . VAL A 1 22  ? 24.578 -4.988  -37.854 1.00 79.11  ? 21   VAL A CB    1 
ATOM   144  N  N     . LYS A 1 23  ? 24.613 -7.645  -39.744 1.00 97.67  ? 22   LYS A N     1 
ATOM   145  C  CA    . LYS A 1 23  ? 25.293 -8.821  -40.265 1.00 100.76 ? 22   LYS A CA    1 
ATOM   146  C  C     . LYS A 1 23  ? 26.778 -8.542  -40.463 1.00 100.86 ? 22   LYS A C     1 
ATOM   147  O  O     . LYS A 1 23  ? 27.186 -7.420  -40.774 1.00 102.83 ? 22   LYS A O     1 
ATOM   148  C  CB    . LYS A 1 23  ? 24.666 -9.265  -41.588 1.00 106.91 ? 22   LYS A CB    1 
ATOM   149  N  N     . GLN A 1 24  ? 27.586 -9.583  -40.277 1.00 96.25  ? 23   GLN A N     1 
ATOM   150  C  CA    . GLN A 1 24  ? 29.031 -9.444  -40.394 1.00 92.42  ? 23   GLN A CA    1 
ATOM   151  C  C     . GLN A 1 24  ? 29.432 -9.213  -41.846 1.00 102.62 ? 23   GLN A C     1 
ATOM   152  O  O     . GLN A 1 24  ? 28.940 -9.889  -42.755 1.00 111.61 ? 23   GLN A O     1 
ATOM   153  C  CB    . GLN A 1 24  ? 29.726 -10.688 -39.845 1.00 86.50  ? 23   GLN A CB    1 
ATOM   154  C  CG    . GLN A 1 24  ? 31.240 -10.637 -39.941 1.00 83.43  ? 23   GLN A CG    1 
ATOM   155  C  CD    . GLN A 1 24  ? 31.840 -9.544  -39.076 1.00 80.15  ? 23   GLN A CD    1 
ATOM   156  O  OE1   . GLN A 1 24  ? 32.676 -8.763  -39.530 1.00 79.05  ? 23   GLN A OE1   1 
ATOM   157  N  NE2   . GLN A 1 24  ? 31.417 -9.489  -37.817 1.00 77.59  ? 23   GLN A NE2   1 
ATOM   158  N  N     . TRP A 1 25  ? 30.326 -8.251  -42.062 1.00 104.48 ? 24   TRP A N     1 
ATOM   159  C  CA    . TRP A 1 25  ? 30.877 -7.960  -43.376 1.00 111.85 ? 24   TRP A CA    1 
ATOM   160  C  C     . TRP A 1 25  ? 32.158 -8.754  -43.603 1.00 111.01 ? 24   TRP A C     1 
ATOM   161  O  O     . TRP A 1 25  ? 32.808 -9.191  -42.648 1.00 107.90 ? 24   TRP A O     1 
ATOM   162  C  CB    . TRP A 1 25  ? 31.136 -6.457  -43.512 1.00 116.48 ? 24   TRP A CB    1 
ATOM   163  C  CG    . TRP A 1 25  ? 31.809 -5.818  -42.327 1.00 116.59 ? 24   TRP A CG    1 
ATOM   164  C  CD1   . TRP A 1 25  ? 32.737 -6.383  -41.500 1.00 116.03 ? 24   TRP A CD1   1 
ATOM   165  C  CD2   . TRP A 1 25  ? 31.597 -4.487  -41.839 1.00 116.92 ? 24   TRP A CD2   1 
ATOM   166  N  NE1   . TRP A 1 25  ? 33.117 -5.486  -40.531 1.00 113.77 ? 24   TRP A NE1   1 
ATOM   167  C  CE2   . TRP A 1 25  ? 32.431 -4.315  -40.716 1.00 114.04 ? 24   TRP A CE2   1 
ATOM   168  C  CE3   . TRP A 1 25  ? 30.782 -3.424  -42.244 1.00 119.30 ? 24   TRP A CE3   1 
ATOM   169  C  CZ2   . TRP A 1 25  ? 32.475 -3.123  -39.994 1.00 111.18 ? 24   TRP A CZ2   1 
ATOM   170  C  CZ3   . TRP A 1 25  ? 30.827 -2.242  -41.525 1.00 116.76 ? 24   TRP A CZ3   1 
ATOM   171  C  CH2   . TRP A 1 25  ? 31.668 -2.101  -40.413 1.00 112.22 ? 24   TRP A CH2   1 
ATOM   172  N  N     . PRO A 1 26  ? 32.543 -8.979  -44.862 1.00 113.39 ? 25   PRO A N     1 
ATOM   173  C  CA    . PRO A 1 26  ? 33.730 -9.803  -45.126 1.00 112.82 ? 25   PRO A CA    1 
ATOM   174  C  C     . PRO A 1 26  ? 35.007 -9.132  -44.640 1.00 108.13 ? 25   PRO A C     1 
ATOM   175  O  O     . PRO A 1 26  ? 35.177 -7.916  -44.753 1.00 104.20 ? 25   PRO A O     1 
ATOM   176  C  CB    . PRO A 1 26  ? 33.724 -9.958  -46.652 1.00 118.74 ? 25   PRO A CB    1 
ATOM   177  C  CG    . PRO A 1 26  ? 32.937 -8.789  -47.145 1.00 120.27 ? 25   PRO A CG    1 
ATOM   178  C  CD    . PRO A 1 26  ? 31.879 -8.562  -46.109 1.00 117.34 ? 25   PRO A CD    1 
ATOM   179  N  N     . LEU A 1 27  ? 35.907 -9.946  -44.091 1.00 109.21 ? 26   LEU A N     1 
ATOM   180  C  CA    . LEU A 1 27  ? 37.174 -9.470  -43.561 1.00 107.33 ? 26   LEU A CA    1 
ATOM   181  C  C     . LEU A 1 27  ? 38.328 -10.232 -44.202 1.00 110.78 ? 26   LEU A C     1 
ATOM   182  O  O     . LEU A 1 27  ? 38.164 -11.343 -44.714 1.00 112.83 ? 26   LEU A O     1 
ATOM   183  C  CB    . LEU A 1 27  ? 37.230 -9.614  -42.034 1.00 100.11 ? 26   LEU A CB    1 
ATOM   184  N  N     . THR A 1 28  ? 39.504 -9.611  -44.166 1.00 111.08 ? 27   THR A N     1 
ATOM   185  C  CA    . THR A 1 28  ? 40.706 -10.221 -44.717 1.00 115.29 ? 27   THR A CA    1 
ATOM   186  C  C     . THR A 1 28  ? 41.137 -11.413 -43.869 1.00 115.78 ? 27   THR A C     1 
ATOM   187  O  O     . THR A 1 28  ? 40.984 -11.409 -42.645 1.00 111.41 ? 27   THR A O     1 
ATOM   188  C  CB    . THR A 1 28  ? 41.830 -9.184  -44.791 1.00 117.63 ? 27   THR A CB    1 
ATOM   189  O  OG1   . THR A 1 28  ? 41.424 -8.099  -45.634 1.00 120.82 ? 27   THR A OG1   1 
ATOM   190  C  CG2   . THR A 1 28  ? 43.111 -9.792  -45.347 1.00 124.31 ? 27   THR A CG2   1 
ATOM   191  N  N     . GLU A 1 29  ? 41.674 -12.442 -44.536 1.00 121.29 ? 28   GLU A N     1 
ATOM   192  C  CA    . GLU A 1 29  ? 42.132 -13.640 -43.838 1.00 122.40 ? 28   GLU A CA    1 
ATOM   193  C  C     . GLU A 1 29  ? 43.145 -13.314 -42.746 1.00 119.25 ? 28   GLU A C     1 
ATOM   194  O  O     . GLU A 1 29  ? 43.171 -13.982 -41.706 1.00 118.03 ? 28   GLU A O     1 
ATOM   195  C  CB    . GLU A 1 29  ? 42.732 -14.628 -44.840 1.00 126.51 ? 28   GLU A CB    1 
ATOM   196  N  N     . GLU A 1 30  ? 43.987 -12.301 -42.962 1.00 117.90 ? 29   GLU A N     1 
ATOM   197  C  CA    . GLU A 1 30  ? 44.905 -11.864 -41.915 1.00 114.25 ? 29   GLU A CA    1 
ATOM   198  C  C     . GLU A 1 30  ? 44.141 -11.314 -40.717 1.00 109.04 ? 29   GLU A C     1 
ATOM   199  O  O     . GLU A 1 30  ? 44.442 -11.646 -39.561 1.00 110.56 ? 29   GLU A O     1 
ATOM   200  C  CB    . GLU A 1 30  ? 45.867 -10.814 -42.474 1.00 117.38 ? 29   GLU A CB    1 
ATOM   201  C  CG    . GLU A 1 30  ? 46.690 -10.096 -41.419 1.00 117.69 ? 29   GLU A CG    1 
ATOM   202  C  CD    . GLU A 1 30  ? 47.552 -8.994  -42.003 1.00 121.33 ? 29   GLU A CD    1 
ATOM   203  O  OE1   . GLU A 1 30  ? 48.789 -9.057  -41.842 1.00 123.66 ? 29   GLU A OE1   1 
ATOM   204  O  OE2   . GLU A 1 30  ? 46.993 -8.069  -42.629 1.00 121.70 ? 29   GLU A OE2   1 
ATOM   205  N  N     . LYS A 1 31  ? 43.146 -10.462 -40.978 1.00 104.99 ? 30   LYS A N     1 
ATOM   206  C  CA    . LYS A 1 31  ? 42.295 -9.967  -39.902 1.00 96.47  ? 30   LYS A CA    1 
ATOM   207  C  C     . LYS A 1 31  ? 41.551 -11.110 -39.227 1.00 94.10  ? 30   LYS A C     1 
ATOM   208  O  O     . LYS A 1 31  ? 41.373 -11.107 -38.005 1.00 77.21  ? 30   LYS A O     1 
ATOM   209  C  CB    . LYS A 1 31  ? 41.313 -8.926  -40.442 1.00 91.85  ? 30   LYS A CB    1 
ATOM   210  N  N     . ILE A 1 32  ? 41.128 -12.110 -40.007 1.00 94.48  ? 31   ILE A N     1 
ATOM   211  C  CA    . ILE A 1 32  ? 40.429 -13.259 -39.436 1.00 92.23  ? 31   ILE A CA    1 
ATOM   212  C  C     . ILE A 1 32  ? 41.342 -14.029 -38.490 1.00 90.62  ? 31   ILE A C     1 
ATOM   213  O  O     . ILE A 1 32  ? 40.925 -14.439 -37.401 1.00 87.37  ? 31   ILE A O     1 
ATOM   214  C  CB    . ILE A 1 32  ? 39.880 -14.161 -40.558 1.00 96.41  ? 31   ILE A CB    1 
ATOM   215  C  CG1   . ILE A 1 32  ? 38.851 -13.401 -41.397 1.00 88.53  ? 31   ILE A CG1   1 
ATOM   216  C  CG2   . ILE A 1 32  ? 39.260 -15.424 -39.978 1.00 88.38  ? 31   ILE A CG2   1 
ATOM   217  C  CD1   . ILE A 1 32  ? 38.380 -14.156 -42.617 1.00 93.26  ? 31   ILE A CD1   1 
ATOM   218  N  N     . LYS A 1 33  ? 42.601 -14.237 -38.886 1.00 93.79  ? 32   LYS A N     1 
ATOM   219  C  CA    . LYS A 1 33  ? 43.539 -14.952 -38.025 1.00 92.34  ? 32   LYS A CA    1 
ATOM   220  C  C     . LYS A 1 33  ? 43.836 -14.165 -36.754 1.00 90.75  ? 32   LYS A C     1 
ATOM   221  O  O     . LYS A 1 33  ? 43.884 -14.737 -35.654 1.00 91.35  ? 32   LYS A O     1 
ATOM   222  C  CB    . LYS A 1 33  ? 44.830 -15.250 -38.788 1.00 94.99  ? 32   LYS A CB    1 
ATOM   223  N  N     . ALA A 1 34  ? 44.047 -12.853 -36.883 1.00 85.28  ? 33   ALA A N     1 
ATOM   224  C  CA    . ALA A 1 34  ? 44.238 -12.023 -35.698 1.00 81.62  ? 33   ALA A CA    1 
ATOM   225  C  C     . ALA A 1 34  ? 43.040 -12.132 -34.763 1.00 78.96  ? 33   ALA A C     1 
ATOM   226  O  O     . ALA A 1 34  ? 43.194 -12.301 -33.546 1.00 77.60  ? 33   ALA A O     1 
ATOM   227  C  CB    . ALA A 1 34  ? 44.477 -10.569 -36.106 1.00 80.83  ? 33   ALA A CB    1 
ATOM   228  N  N     . LEU A 1 35  ? 41.831 -12.064 -35.327 1.00 78.45  ? 34   LEU A N     1 
ATOM   229  C  CA    . LEU A 1 35  ? 40.621 -12.119 -34.517 1.00 74.56  ? 34   LEU A CA    1 
ATOM   230  C  C     . LEU A 1 35  ? 40.461 -13.473 -33.839 1.00 76.91  ? 34   LEU A C     1 
ATOM   231  O  O     . LEU A 1 35  ? 40.051 -13.535 -32.678 1.00 69.04  ? 34   LEU A O     1 
ATOM   232  C  CB    . LEU A 1 35  ? 39.398 -11.799 -35.378 1.00 74.30  ? 34   LEU A CB    1 
ATOM   233  C  CG    . LEU A 1 35  ? 39.247 -10.342 -35.830 1.00 73.11  ? 34   LEU A CG    1 
ATOM   234  C  CD1   . LEU A 1 35  ? 38.128 -10.204 -36.852 1.00 74.35  ? 34   LEU A CD1   1 
ATOM   235  C  CD2   . LEU A 1 35  ? 39.008 -9.419  -34.641 1.00 67.97  ? 34   LEU A CD2   1 
ATOM   236  N  N     . VAL A 1 36  ? 40.785 -14.570 -34.532 1.00 80.57  ? 35   VAL A N     1 
ATOM   237  C  CA    . VAL A 1 36  ? 40.605 -15.880 -33.910 1.00 80.88  ? 35   VAL A CA    1 
ATOM   238  C  C     . VAL A 1 36  ? 41.628 -16.088 -32.800 1.00 78.50  ? 35   VAL A C     1 
ATOM   239  O  O     . VAL A 1 36  ? 41.302 -16.645 -31.746 1.00 77.05  ? 35   VAL A O     1 
ATOM   240  C  CB    . VAL A 1 36  ? 40.644 -17.021 -34.950 1.00 87.87  ? 35   VAL A CB    1 
ATOM   241  C  CG1   . VAL A 1 36  ? 39.545 -16.848 -35.983 1.00 93.30  ? 35   VAL A CG1   1 
ATOM   242  C  CG2   . VAL A 1 36  ? 42.003 -17.146 -35.615 1.00 90.26  ? 35   VAL A CG2   1 
ATOM   243  N  N     . GLU A 1 37  ? 42.869 -15.631 -32.994 1.00 79.60  ? 36   GLU A N     1 
ATOM   244  C  CA    . GLU A 1 37  ? 43.846 -15.726 -31.912 1.00 74.60  ? 36   GLU A CA    1 
ATOM   245  C  C     . GLU A 1 37  ? 43.391 -14.918 -30.700 1.00 79.78  ? 36   GLU A C     1 
ATOM   246  O  O     . GLU A 1 37  ? 43.367 -15.424 -29.565 1.00 80.26  ? 36   GLU A O     1 
ATOM   247  C  CB    . GLU A 1 37  ? 45.219 -15.257 -32.397 1.00 76.11  ? 36   GLU A CB    1 
ATOM   248  N  N     . ILE A 1 38  ? 43.001 -13.659 -30.932 1.00 74.34  ? 37   ILE A N     1 
ATOM   249  C  CA    . ILE A 1 38  ? 42.517 -12.803 -29.852 1.00 68.94  ? 37   ILE A CA    1 
ATOM   250  C  C     . ILE A 1 38  ? 41.332 -13.446 -29.143 1.00 66.87  ? 37   ILE A C     1 
ATOM   251  O  O     . ILE A 1 38  ? 41.255 -13.447 -27.911 1.00 67.48  ? 37   ILE A O     1 
ATOM   252  C  CB    . ILE A 1 38  ? 42.160 -11.408 -30.402 1.00 67.70  ? 37   ILE A CB    1 
ATOM   253  C  CG1   . ILE A 1 38  ? 43.424 -10.666 -30.840 1.00 69.17  ? 37   ILE A CG1   1 
ATOM   254  C  CG2   . ILE A 1 38  ? 41.389 -10.596 -29.372 1.00 59.93  ? 37   ILE A CG2   1 
ATOM   255  C  CD1   . ILE A 1 38  ? 43.147 -9.357  -31.549 1.00 68.68  ? 37   ILE A CD1   1 
ATOM   256  N  N     . CYS A 1 39  ? 40.402 -14.024 -29.905 1.00 68.36  ? 38   CYS A N     1 
ATOM   257  C  CA    . CYS A 1 39  ? 39.170 -14.535 -29.319 1.00 69.75  ? 38   CYS A CA    1 
ATOM   258  C  C     . CYS A 1 39  ? 39.387 -15.838 -28.563 1.00 73.02  ? 38   CYS A C     1 
ATOM   259  O  O     . CYS A 1 39  ? 38.757 -16.055 -27.526 1.00 73.65  ? 38   CYS A O     1 
ATOM   260  C  CB    . CYS A 1 39  ? 38.110 -14.715 -30.402 1.00 72.01  ? 38   CYS A CB    1 
ATOM   261  S  SG    . CYS A 1 39  ? 37.263 -13.180 -30.805 1.00 71.81  ? 38   CYS A SG    1 
ATOM   262  N  N     . THR A 1 40  ? 40.261 -16.719 -29.053 1.00 74.13  ? 39   THR A N     1 
ATOM   263  C  CA    . THR A 1 40  ? 40.606 -17.898 -28.267 1.00 74.76  ? 39   THR A CA    1 
ATOM   264  C  C     . THR A 1 40  ? 41.248 -17.487 -26.948 1.00 73.20  ? 39   THR A C     1 
ATOM   265  O  O     . THR A 1 40  ? 40.884 -17.999 -25.878 1.00 75.71  ? 39   THR A O     1 
ATOM   266  C  CB    . THR A 1 40  ? 41.535 -18.821 -29.061 1.00 79.97  ? 39   THR A CB    1 
ATOM   267  O  OG1   . THR A 1 40  ? 42.665 -18.081 -29.536 1.00 80.38  ? 39   THR A OG1   1 
ATOM   268  C  CG2   . THR A 1 40  ? 40.797 -19.437 -30.241 1.00 77.29  ? 39   THR A CG2   1 
ATOM   269  N  N     . GLU A 1 41  ? 42.184 -16.531 -27.001 1.00 69.89  ? 40   GLU A N     1 
ATOM   270  C  CA    . GLU A 1 41  ? 42.826 -16.063 -25.775 1.00 66.14  ? 40   GLU A CA    1 
ATOM   271  C  C     . GLU A 1 41  ? 41.805 -15.474 -24.806 1.00 64.71  ? 40   GLU A C     1 
ATOM   272  O  O     . GLU A 1 41  ? 41.820 -15.778 -23.608 1.00 62.88  ? 40   GLU A O     1 
ATOM   273  C  CB    . GLU A 1 41  ? 43.909 -15.036 -26.111 1.00 67.31  ? 40   GLU A CB    1 
ATOM   274  N  N     . MET A 1 42  ? 40.898 -14.635 -25.312 1.00 63.73  ? 41   MET A N     1 
ATOM   275  C  CA    . MET A 1 42  ? 39.927 -13.975 -24.443 1.00 62.37  ? 41   MET A CA    1 
ATOM   276  C  C     . MET A 1 42  ? 38.888 -14.951 -23.909 1.00 63.18  ? 41   MET A C     1 
ATOM   277  O  O     . MET A 1 42  ? 38.417 -14.794 -22.777 1.00 58.51  ? 41   MET A O     1 
ATOM   278  C  CB    . MET A 1 42  ? 39.238 -12.831 -25.190 1.00 62.46  ? 41   MET A CB    1 
ATOM   279  C  CG    . MET A 1 42  ? 40.151 -11.671 -25.555 1.00 66.38  ? 41   MET A CG    1 
ATOM   280  S  SD    . MET A 1 42  ? 39.291 -10.370 -26.467 1.00 70.50  ? 41   MET A SD    1 
ATOM   281  C  CE    . MET A 1 42  ? 38.220 -9.703  -25.194 1.00 65.12  ? 41   MET A CE    1 
ATOM   282  N  N     . GLU A 1 43  ? 38.515 -15.959 -24.701 1.00 67.22  ? 42   GLU A N     1 
ATOM   283  C  CA    . GLU A 1 43  ? 37.540 -16.938 -24.242 1.00 70.67  ? 42   GLU A CA    1 
ATOM   284  C  C     . GLU A 1 43  ? 38.136 -17.832 -23.167 1.00 64.89  ? 42   GLU A C     1 
ATOM   285  O  O     . GLU A 1 43  ? 37.435 -18.236 -22.233 1.00 65.05  ? 42   GLU A O     1 
ATOM   286  C  CB    . GLU A 1 43  ? 37.034 -17.766 -25.424 1.00 73.35  ? 42   GLU A CB    1 
ATOM   287  C  CG    . GLU A 1 43  ? 35.648 -18.364 -25.228 1.00 75.32  ? 42   GLU A CG    1 
ATOM   288  C  CD    . GLU A 1 43  ? 35.669 -19.684 -24.481 1.00 79.67  ? 42   GLU A CD    1 
ATOM   289  O  OE1   . GLU A 1 43  ? 36.754 -20.294 -24.377 1.00 80.90  ? 42   GLU A OE1   1 
ATOM   290  O  OE2   . GLU A 1 43  ? 34.596 -20.112 -24.001 1.00 80.80  ? 42   GLU A OE2   1 
ATOM   291  N  N     . LYS A 1 44  ? 39.431 -18.150 -23.278 1.00 70.53  ? 43   LYS A N     1 
ATOM   292  C  CA    . LYS A 1 44  ? 40.080 -18.913 -22.215 1.00 73.68  ? 43   LYS A CA    1 
ATOM   293  C  C     . LYS A 1 44  ? 40.040 -18.160 -20.890 1.00 71.71  ? 43   LYS A C     1 
ATOM   294  O  O     . LYS A 1 44  ? 39.792 -18.756 -19.836 1.00 73.36  ? 43   LYS A O     1 
ATOM   295  C  CB    . LYS A 1 44  ? 41.523 -19.243 -22.598 1.00 75.95  ? 43   LYS A CB    1 
ATOM   296  C  CG    . LYS A 1 44  ? 41.662 -20.416 -23.554 1.00 78.37  ? 43   LYS A CG    1 
ATOM   297  C  CD    . LYS A 1 44  ? 43.075 -20.979 -23.537 1.00 81.37  ? 43   LYS A CD    1 
ATOM   298  C  CE    . LYS A 1 44  ? 43.175 -22.236 -24.390 1.00 88.24  ? 43   LYS A CE    1 
ATOM   299  N  NZ    . LYS A 1 44  ? 44.475 -22.944 -24.214 1.00 92.48  ? 43   LYS A NZ    1 
ATOM   300  N  N     . GLU A 1 45  ? 40.271 -16.848 -20.924 1.00 69.06  ? 44   GLU A N     1 
ATOM   301  C  CA    . GLU A 1 45  ? 40.302 -16.035 -19.715 1.00 66.38  ? 44   GLU A CA    1 
ATOM   302  C  C     . GLU A 1 45  ? 38.917 -15.626 -19.232 1.00 65.11  ? 44   GLU A C     1 
ATOM   303  O  O     . GLU A 1 45  ? 38.814 -14.980 -18.183 1.00 66.36  ? 44   GLU A O     1 
ATOM   304  C  CB    . GLU A 1 45  ? 41.149 -14.781 -19.946 1.00 66.87  ? 44   GLU A CB    1 
ATOM   305  C  CG    . GLU A 1 45  ? 42.508 -15.049 -20.564 1.00 71.22  ? 44   GLU A CG    1 
ATOM   306  C  CD    . GLU A 1 45  ? 43.233 -13.771 -20.940 1.00 72.98  ? 44   GLU A CD    1 
ATOM   307  O  OE1   . GLU A 1 45  ? 43.729 -13.075 -20.028 1.00 73.90  ? 44   GLU A OE1   1 
ATOM   308  O  OE2   . GLU A 1 45  ? 43.296 -13.454 -22.147 1.00 73.86  ? 44   GLU A OE2   1 
ATOM   309  N  N     . GLY A 1 46  ? 37.858 -15.972 -19.960 1.00 64.77  ? 45   GLY A N     1 
ATOM   310  C  CA    . GLY A 1 46  ? 36.519 -15.599 -19.551 1.00 64.21  ? 45   GLY A CA    1 
ATOM   311  C  C     . GLY A 1 46  ? 36.125 -14.171 -19.851 1.00 60.72  ? 45   GLY A C     1 
ATOM   312  O  O     . GLY A 1 46  ? 35.166 -13.667 -19.258 1.00 59.49  ? 45   GLY A O     1 
ATOM   313  N  N     . LYS A 1 47  ? 36.836 -13.496 -20.755 1.00 59.39  ? 46   LYS A N     1 
ATOM   314  C  CA    . LYS A 1 47  ? 36.462 -12.134 -21.118 1.00 58.77  ? 46   LYS A CA    1 
ATOM   315  C  C     . LYS A 1 47  ? 35.359 -12.111 -22.169 1.00 62.41  ? 46   LYS A C     1 
ATOM   316  O  O     . LYS A 1 47  ? 34.569 -11.161 -22.211 1.00 62.94  ? 46   LYS A O     1 
ATOM   317  C  CB    . LYS A 1 47  ? 37.694 -11.367 -21.601 1.00 54.66  ? 46   LYS A CB    1 
ATOM   318  C  CG    . LYS A 1 47  ? 38.707 -11.118 -20.495 1.00 52.94  ? 46   LYS A CG    1 
ATOM   319  C  CD    . LYS A 1 47  ? 40.087 -10.786 -21.037 1.00 53.44  ? 46   LYS A CD    1 
ATOM   320  C  CE    . LYS A 1 47  ? 41.083 -10.604 -19.897 1.00 51.56  ? 46   LYS A CE    1 
ATOM   321  N  NZ    . LYS A 1 47  ? 42.480 -10.445 -20.384 1.00 55.22  ? 46   LYS A NZ    1 
ATOM   322  N  N     . ILE A 1 48  ? 35.288 -13.137 -23.015 1.00 63.71  ? 47   ILE A N     1 
ATOM   323  C  CA    . ILE A 1 48  ? 34.171 -13.332 -23.928 1.00 64.02  ? 47   ILE A CA    1 
ATOM   324  C  C     . ILE A 1 48  ? 33.614 -14.730 -23.700 1.00 65.86  ? 47   ILE A C     1 
ATOM   325  O  O     . ILE A 1 48  ? 34.331 -15.644 -23.281 1.00 65.86  ? 47   ILE A O     1 
ATOM   326  C  CB    . ILE A 1 48  ? 34.570 -13.133 -25.409 1.00 65.15  ? 47   ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1 48  ? 35.673 -14.113 -25.813 1.00 65.30  ? 47   ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1 48  ? 35.007 -11.698 -25.659 1.00 63.53  ? 47   ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1 48  ? 36.134 -13.945 -27.243 1.00 64.95  ? 47   ILE A CD1   1 
ATOM   330  N  N     . SER A 1 49  ? 32.323 -14.892 -23.976 1.00 66.60  ? 48   SER A N     1 
ATOM   331  C  CA    . SER A 1 49  ? 31.624 -16.145 -23.727 1.00 70.27  ? 48   SER A CA    1 
ATOM   332  C  C     . SER A 1 49  ? 30.927 -16.604 -24.998 1.00 65.76  ? 48   SER A C     1 
ATOM   333  O  O     . SER A 1 49  ? 30.260 -15.808 -25.664 1.00 65.32  ? 48   SER A O     1 
ATOM   334  C  CB    . SER A 1 49  ? 30.605 -15.996 -22.592 1.00 62.76  ? 48   SER A CB    1 
ATOM   335  O  OG    . SER A 1 49  ? 31.252 -15.775 -21.353 1.00 61.05  ? 48   SER A OG    1 
ATOM   336  N  N     . LYS A 1 50  ? 31.085 -17.883 -25.330 1.00 71.03  ? 49   LYS A N     1 
ATOM   337  C  CA    . LYS A 1 50  ? 30.378 -18.445 -26.472 1.00 71.87  ? 49   LYS A CA    1 
ATOM   338  C  C     . LYS A 1 50  ? 28.873 -18.391 -26.240 1.00 73.02  ? 49   LYS A C     1 
ATOM   339  O  O     . LYS A 1 50  ? 28.389 -18.634 -25.131 1.00 72.99  ? 49   LYS A O     1 
ATOM   340  C  CB    . LYS A 1 50  ? 30.823 -19.887 -26.712 1.00 75.18  ? 49   LYS A CB    1 
ATOM   341  C  CG    . LYS A 1 50  ? 32.288 -20.035 -27.088 1.00 83.00  ? 49   LYS A CG    1 
ATOM   342  C  CD    . LYS A 1 50  ? 32.646 -21.495 -27.319 1.00 84.23  ? 49   LYS A CD    1 
ATOM   343  C  CE    . LYS A 1 50  ? 34.057 -21.638 -27.867 1.00 82.93  ? 49   LYS A CE    1 
ATOM   344  N  NZ    . LYS A 1 50  ? 34.407 -23.058 -28.152 1.00 87.96  ? 49   LYS A NZ    1 
ATOM   345  N  N     . ILE A 1 51  ? 28.132 -18.059 -27.295 1.00 74.38  ? 50   ILE A N     1 
ATOM   346  C  CA    . ILE A 1 51  ? 26.677 -17.973 -27.218 1.00 78.97  ? 50   ILE A CA    1 
ATOM   347  C  C     . ILE A 1 51  ? 26.060 -18.971 -28.188 1.00 82.80  ? 50   ILE A C     1 
ATOM   348  O  O     . ILE A 1 51  ? 26.774 -19.659 -28.926 1.00 82.22  ? 50   ILE A O     1 
ATOM   349  C  CB    . ILE A 1 51  ? 26.185 -16.545 -27.511 1.00 75.42  ? 50   ILE A CB    1 
ATOM   350  C  CG1   . ILE A 1 51  ? 26.587 -16.126 -28.926 1.00 74.40  ? 50   ILE A CG1   1 
ATOM   351  C  CG2   . ILE A 1 51  ? 26.735 -15.570 -26.484 1.00 70.85  ? 50   ILE A CG2   1 
ATOM   352  C  CD1   . ILE A 1 51  ? 26.220 -14.700 -29.267 1.00 72.53  ? 50   ILE A CD1   1 
ATOM   353  N  N     . GLY A 1 52  ? 24.732 -19.053 -28.195 1.00 84.76  ? 51   GLY A N     1 
ATOM   354  C  CA    . GLY A 1 52  ? 24.030 -19.960 -29.071 1.00 90.81  ? 51   GLY A CA    1 
ATOM   355  C  C     . GLY A 1 52  ? 22.899 -19.287 -29.824 1.00 94.46  ? 51   GLY A C     1 
ATOM   356  O  O     . GLY A 1 52  ? 22.886 -18.066 -30.015 1.00 91.55  ? 51   GLY A O     1 
ATOM   357  N  N     . PRO A 1 53  ? 21.922 -20.081 -30.274 1.00 100.93 ? 52   PRO A N     1 
ATOM   358  C  CA    . PRO A 1 53  ? 20.778 -19.504 -30.998 1.00 104.29 ? 52   PRO A CA    1 
ATOM   359  C  C     . PRO A 1 53  ? 19.823 -18.724 -30.111 1.00 103.82 ? 52   PRO A C     1 
ATOM   360  O  O     . PRO A 1 53  ? 18.974 -17.996 -30.643 1.00 104.92 ? 52   PRO A O     1 
ATOM   361  C  CB    . PRO A 1 53  ? 20.092 -20.734 -31.603 1.00 110.34 ? 52   PRO A CB    1 
ATOM   362  C  CG    . PRO A 1 53  ? 20.445 -21.846 -30.673 1.00 110.69 ? 52   PRO A CG    1 
ATOM   363  C  CD    . PRO A 1 53  ? 21.837 -21.549 -30.180 1.00 106.33 ? 52   PRO A CD    1 
ATOM   364  N  N     . GLU A 1 54  ? 19.928 -18.848 -28.786 1.00 102.52 ? 53   GLU A N     1 
ATOM   365  C  CA    . GLU A 1 54  ? 19.119 -18.033 -27.888 1.00 103.72 ? 53   GLU A CA    1 
ATOM   366  C  C     . GLU A 1 54  ? 19.495 -16.558 -27.941 1.00 101.14 ? 53   GLU A C     1 
ATOM   367  O  O     . GLU A 1 54  ? 18.747 -15.726 -27.416 1.00 100.81 ? 53   GLU A O     1 
ATOM   368  C  CB    . GLU A 1 54  ? 19.243 -18.544 -26.449 1.00 102.99 ? 53   GLU A CB    1 
ATOM   369  C  CG    . GLU A 1 54  ? 20.584 -18.254 -25.782 1.00 98.06  ? 53   GLU A CG    1 
ATOM   370  C  CD    . GLU A 1 54  ? 21.692 -19.184 -26.243 1.00 98.22  ? 53   GLU A CD    1 
ATOM   371  O  OE1   . GLU A 1 54  ? 21.398 -20.142 -26.990 1.00 101.23 ? 53   GLU A OE1   1 
ATOM   372  O  OE2   . GLU A 1 54  ? 22.858 -18.957 -25.855 1.00 94.24  ? 53   GLU A OE2   1 
ATOM   373  N  N     . ASN A 1 55  ? 20.630 -16.219 -28.555 1.00 98.42  ? 54   ASN A N     1 
ATOM   374  C  CA    . ASN A 1 55  ? 21.045 -14.835 -28.719 1.00 94.68  ? 54   ASN A CA    1 
ATOM   375  C  C     . ASN A 1 55  ? 20.685 -14.380 -30.124 1.00 97.25  ? 54   ASN A C     1 
ATOM   376  O  O     . ASN A 1 55  ? 21.348 -14.796 -31.087 1.00 99.29  ? 54   ASN A O     1 
ATOM   377  C  CB    . ASN A 1 55  ? 22.547 -14.694 -28.478 1.00 89.87  ? 54   ASN A CB    1 
ATOM   378  C  CG    . ASN A 1 55  ? 22.975 -13.255 -28.271 1.00 86.57  ? 54   ASN A CG    1 
ATOM   379  O  OD1   . ASN A 1 55  ? 22.463 -12.340 -28.915 1.00 87.64  ? 54   ASN A OD1   1 
ATOM   380  N  ND2   . ASN A 1 55  ? 23.922 -13.048 -27.362 1.00 83.71  ? 54   ASN A ND2   1 
ATOM   381  N  N     . PRO A 1 56  ? 19.661 -13.546 -30.301 1.00 96.34  ? 55   PRO A N     1 
ATOM   382  C  CA    . PRO A 1 56  ? 19.248 -13.126 -31.645 1.00 97.49  ? 55   PRO A CA    1 
ATOM   383  C  C     . PRO A 1 56  ? 19.983 -11.913 -32.197 1.00 93.23  ? 55   PRO A C     1 
ATOM   384  O  O     . PRO A 1 56  ? 19.691 -11.505 -33.326 1.00 95.19  ? 55   PRO A O     1 
ATOM   385  C  CB    . PRO A 1 56  ? 17.765 -12.798 -31.434 1.00 99.87  ? 55   PRO A CB    1 
ATOM   386  C  CG    . PRO A 1 56  ? 17.723 -12.252 -30.043 1.00 96.61  ? 55   PRO A CG    1 
ATOM   387  C  CD    . PRO A 1 56  ? 18.763 -13.018 -29.256 1.00 94.17  ? 55   PRO A CD    1 
ATOM   388  N  N     . TYR A 1 57  ? 20.912 -11.334 -31.446 1.00 86.48  ? 56   TYR A N     1 
ATOM   389  C  CA    . TYR A 1 57  ? 21.566 -10.091 -31.823 1.00 82.83  ? 56   TYR A CA    1 
ATOM   390  C  C     . TYR A 1 57  ? 22.914 -10.359 -32.482 1.00 82.84  ? 56   TYR A C     1 
ATOM   391  O  O     . TYR A 1 57  ? 23.465 -11.460 -32.401 1.00 84.55  ? 56   TYR A O     1 
ATOM   392  C  CB    . TYR A 1 57  ? 21.753 -9.195  -30.597 1.00 76.52  ? 56   TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 57  ? 20.501 -9.026  -29.768 1.00 76.99  ? 56   TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 57  ? 19.384 -8.385  -30.285 1.00 79.05  ? 56   TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 57  ? 20.440 -9.499  -28.464 1.00 75.57  ? 56   TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 57  ? 18.238 -8.225  -29.529 1.00 79.73  ? 56   TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 57  ? 19.300 -9.343  -27.700 1.00 76.00  ? 56   TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 57  ? 18.203 -8.705  -28.237 1.00 78.36  ? 56   TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 57  ? 17.067 -8.549  -27.478 1.00 81.14  ? 56   TYR A OH    1 
ATOM   400  N  N     . ASN A 1 58  ? 23.441 -9.328  -33.141 1.00 80.17  ? 57   ASN A N     1 
ATOM   401  C  CA    . ASN A 1 58  ? 24.774 -9.390  -33.727 1.00 77.07  ? 57   ASN A CA    1 
ATOM   402  C  C     . ASN A 1 58  ? 25.212 -7.990  -34.132 1.00 74.61  ? 57   ASN A C     1 
ATOM   403  O  O     . ASN A 1 58  ? 24.381 -7.115  -34.389 1.00 75.78  ? 57   ASN A O     1 
ATOM   404  C  CB    . ASN A 1 58  ? 24.821 -10.328 -34.939 1.00 79.04  ? 57   ASN A CB    1 
ATOM   405  C  CG    . ASN A 1 58  ? 26.238 -10.630 -35.378 1.00 76.66  ? 57   ASN A CG    1 
ATOM   406  O  OD1   . ASN A 1 58  ? 26.959 -11.367 -34.709 1.00 75.33  ? 57   ASN A OD1   1 
ATOM   407  N  ND2   . ASN A 1 58  ? 26.648 -10.055 -36.502 1.00 77.75  ? 57   ASN A ND2   1 
ATOM   408  N  N     . THR A 1 59  ? 26.533 -7.795  -34.184 1.00 71.50  ? 58   THR A N     1 
ATOM   409  C  CA    . THR A 1 59  ? 27.144 -6.541  -34.593 1.00 71.99  ? 58   THR A CA    1 
ATOM   410  C  C     . THR A 1 59  ? 28.484 -6.875  -35.234 1.00 72.97  ? 58   THR A C     1 
ATOM   411  O  O     . THR A 1 59  ? 29.180 -7.780  -34.751 1.00 71.58  ? 58   THR A O     1 
ATOM   412  C  CB    . THR A 1 59  ? 27.345 -5.580  -33.414 1.00 66.78  ? 58   THR A CB    1 
ATOM   413  O  OG1   . THR A 1 59  ? 26.583 -6.035  -32.288 1.00 65.41  ? 58   THR A OG1   1 
ATOM   414  C  CG2   . THR A 1 59  ? 26.880 -4.179  -33.781 1.00 66.18  ? 58   THR A CG2   1 
ATOM   415  N  N     . PRO A 1 60  ? 28.869 -6.185  -36.308 1.00 75.33  ? 59   PRO A N     1 
ATOM   416  C  CA    . PRO A 1 60  ? 30.097 -6.559  -37.021 1.00 76.93  ? 59   PRO A CA    1 
ATOM   417  C  C     . PRO A 1 60  ? 31.351 -6.232  -36.226 1.00 76.47  ? 59   PRO A C     1 
ATOM   418  O  O     . PRO A 1 60  ? 31.376 -5.314  -35.403 1.00 75.80  ? 59   PRO A O     1 
ATOM   419  C  CB    . PRO A 1 60  ? 30.030 -5.726  -38.309 1.00 77.62  ? 59   PRO A CB    1 
ATOM   420  C  CG    . PRO A 1 60  ? 28.599 -5.284  -38.420 1.00 78.17  ? 59   PRO A CG    1 
ATOM   421  C  CD    . PRO A 1 60  ? 28.128 -5.128  -37.012 1.00 75.27  ? 59   PRO A CD    1 
ATOM   422  N  N     . VAL A 1 61  ? 32.410 -7.003  -36.492 1.00 77.32  ? 60   VAL A N     1 
ATOM   423  C  CA    . VAL A 1 61  ? 33.706 -6.818  -35.854 1.00 74.79  ? 60   VAL A CA    1 
ATOM   424  C  C     . VAL A 1 61  ? 34.781 -6.699  -36.924 1.00 75.47  ? 60   VAL A C     1 
ATOM   425  O  O     . VAL A 1 61  ? 34.608 -7.126  -38.067 1.00 79.60  ? 60   VAL A O     1 
ATOM   426  C  CB    . VAL A 1 61  ? 34.059 -7.966  -34.882 1.00 75.34  ? 60   VAL A CB    1 
ATOM   427  C  CG1   . VAL A 1 61  ? 33.204 -7.889  -33.636 1.00 74.26  ? 60   VAL A CG1   1 
ATOM   428  C  CG2   . VAL A 1 61  ? 33.895 -9.313  -35.569 1.00 80.00  ? 60   VAL A CG2   1 
ATOM   429  N  N     . PHE A 1 62  ? 35.905 -6.110  -36.530 1.00 72.97  ? 61   PHE A N     1 
ATOM   430  C  CA    . PHE A 1 62  ? 37.079 -5.994  -37.388 1.00 72.62  ? 61   PHE A CA    1 
ATOM   431  C  C     . PHE A 1 62  ? 38.283 -5.716  -36.494 1.00 68.55  ? 61   PHE A C     1 
ATOM   432  O  O     . PHE A 1 62  ? 38.196 -5.801  -35.264 1.00 64.61  ? 61   PHE A O     1 
ATOM   433  C  CB    . PHE A 1 62  ? 36.877 -4.918  -38.464 1.00 73.63  ? 61   PHE A CB    1 
ATOM   434  C  CG    . PHE A 1 62  ? 36.610 -3.543  -37.917 1.00 72.36  ? 61   PHE A CG    1 
ATOM   435  C  CD1   . PHE A 1 62  ? 35.352 -3.200  -37.442 1.00 71.54  ? 61   PHE A CD1   1 
ATOM   436  C  CD2   . PHE A 1 62  ? 37.610 -2.585  -37.899 1.00 72.70  ? 61   PHE A CD2   1 
ATOM   437  C  CE1   . PHE A 1 62  ? 35.103 -1.934  -36.944 1.00 69.78  ? 61   PHE A CE1   1 
ATOM   438  C  CE2   . PHE A 1 62  ? 37.365 -1.316  -37.406 1.00 70.72  ? 61   PHE A CE2   1 
ATOM   439  C  CZ    . PHE A 1 62  ? 36.111 -0.990  -36.927 1.00 69.27  ? 61   PHE A CZ    1 
ATOM   440  N  N     . ALA A 1 63  ? 39.414 -5.384  -37.108 1.00 71.26  ? 62   ALA A N     1 
ATOM   441  C  CA    . ALA A 1 63  ? 40.628 -5.146  -36.344 1.00 72.93  ? 62   ALA A CA    1 
ATOM   442  C  C     . ALA A 1 63  ? 41.516 -4.169  -37.096 1.00 77.47  ? 62   ALA A C     1 
ATOM   443  O  O     . ALA A 1 63  ? 41.481 -4.092  -38.327 1.00 82.87  ? 62   ALA A O     1 
ATOM   444  C  CB    . ALA A 1 63  ? 41.385 -6.450  -36.065 1.00 73.91  ? 62   ALA A CB    1 
ATOM   445  N  N     . ILE A 1 64  ? 42.310 -3.417  -36.337 1.00 79.79  ? 63   ILE A N     1 
ATOM   446  C  CA    . ILE A 1 64  ? 43.256 -2.464  -36.899 1.00 83.75  ? 63   ILE A CA    1 
ATOM   447  C  C     . ILE A 1 64  ? 44.629 -2.726  -36.296 1.00 83.48  ? 63   ILE A C     1 
ATOM   448  O  O     . ILE A 1 64  ? 44.775 -3.437  -35.303 1.00 79.89  ? 63   ILE A O     1 
ATOM   449  C  CB    . ILE A 1 64  ? 42.835 -0.997  -36.668 1.00 85.98  ? 63   ILE A CB    1 
ATOM   450  C  CG1   . ILE A 1 64  ? 42.847 -0.664  -35.175 1.00 83.26  ? 63   ILE A CG1   1 
ATOM   451  C  CG2   . ILE A 1 64  ? 41.469 -0.728  -37.285 1.00 87.71  ? 63   ILE A CG2   1 
ATOM   452  C  CD1   . ILE A 1 64  ? 42.412 0.747   -34.855 1.00 84.55  ? 63   ILE A CD1   1 
ATOM   453  N  N     . LYS A 1 65  ? 45.647 -2.149  -36.925 1.00 87.56  ? 64   LYS A N     1 
ATOM   454  C  CA    . LYS A 1 65  ? 47.009 -2.271  -36.426 1.00 88.17  ? 64   LYS A CA    1 
ATOM   455  C  C     . LYS A 1 65  ? 47.217 -1.282  -35.285 1.00 87.12  ? 64   LYS A C     1 
ATOM   456  O  O     . LYS A 1 65  ? 46.983 -0.079  -35.447 1.00 89.20  ? 64   LYS A O     1 
ATOM   457  C  CB    . LYS A 1 65  ? 48.011 -2.025  -37.552 1.00 93.26  ? 64   LYS A CB    1 
ATOM   458  N  N     . LYS A 1 66  ? 47.644 -1.786  -34.129 1.00 83.87  ? 65   LYS A N     1 
ATOM   459  C  CA    . LYS A 1 66  ? 47.935 -0.914  -33.001 1.00 82.87  ? 65   LYS A CA    1 
ATOM   460  C  C     . LYS A 1 66  ? 49.172 -0.063  -33.289 1.00 92.35  ? 65   LYS A C     1 
ATOM   461  O  O     . LYS A 1 66  ? 49.896 -0.272  -34.268 1.00 93.44  ? 65   LYS A O     1 
ATOM   462  C  CB    . LYS A 1 66  ? 48.145 -1.729  -31.724 1.00 77.04  ? 65   LYS A CB    1 
ATOM   463  C  CG    . LYS A 1 66  ? 46.868 -2.258  -31.086 1.00 71.93  ? 65   LYS A CG    1 
ATOM   464  C  CD    . LYS A 1 66  ? 47.143 -2.892  -29.726 1.00 68.44  ? 65   LYS A CD    1 
ATOM   465  N  N     . LYS A 1 67  ? 49.407 0.917   -32.412 1.00 101.09 ? 66   LYS A N     1 
ATOM   466  C  CA    . LYS A 1 67  ? 50.609 1.736   -32.525 1.00 114.41 ? 66   LYS A CA    1 
ATOM   467  C  C     . LYS A 1 67  ? 51.867 0.894   -32.363 1.00 124.63 ? 66   LYS A C     1 
ATOM   468  O  O     . LYS A 1 67  ? 52.913 1.223   -32.935 1.00 130.11 ? 66   LYS A O     1 
ATOM   469  C  CB    . LYS A 1 67  ? 50.581 2.858   -31.487 1.00 113.76 ? 66   LYS A CB    1 
ATOM   470  N  N     . ASP A 1 68  ? 51.785 -0.189  -31.592 1.00 129.82 ? 67   ASP A N     1 
ATOM   471  C  CA    . ASP A 1 68  ? 52.889 -1.122  -31.462 1.00 133.47 ? 67   ASP A CA    1 
ATOM   472  C  C     . ASP A 1 68  ? 53.136 -1.834  -32.791 1.00 138.06 ? 67   ASP A C     1 
ATOM   473  O  O     . ASP A 1 68  ? 52.382 -1.690  -33.759 1.00 140.92 ? 67   ASP A O     1 
ATOM   474  C  CB    . ASP A 1 68  ? 52.617 -2.136  -30.351 1.00 129.18 ? 67   ASP A CB    1 
ATOM   475  N  N     . SER A 1 69  ? 54.217 -2.615  -32.824 1.00 141.83 ? 68   SER A N     1 
ATOM   476  C  CA    . SER A 1 69  ? 54.716 -3.137  -34.088 1.00 141.18 ? 68   SER A CA    1 
ATOM   477  C  C     . SER A 1 69  ? 53.687 -4.036  -34.764 1.00 132.41 ? 68   SER A C     1 
ATOM   478  O  O     . SER A 1 69  ? 53.173 -3.716  -35.843 1.00 134.51 ? 68   SER A O     1 
ATOM   479  C  CB    . SER A 1 69  ? 56.035 -3.888  -33.862 1.00 146.25 ? 68   SER A CB    1 
ATOM   480  N  N     . THR A 1 70  ? 53.359 -5.164  -34.134 1.00 121.98 ? 69   THR A N     1 
ATOM   481  C  CA    . THR A 1 70  ? 52.544 -6.184  -34.785 1.00 113.91 ? 69   THR A CA    1 
ATOM   482  C  C     . THR A 1 70  ? 51.290 -6.553  -33.998 1.00 101.68 ? 69   THR A C     1 
ATOM   483  O  O     . THR A 1 70  ? 50.663 -7.577  -34.299 1.00 100.60 ? 69   THR A O     1 
ATOM   484  C  CB    . THR A 1 70  ? 53.379 -7.444  -35.042 1.00 115.35 ? 69   THR A CB    1 
ATOM   485  N  N     . LYS A 1 71  ? 50.911 -5.762  -32.998 1.00 92.58  ? 70   LYS A N     1 
ATOM   486  C  CA    . LYS A 1 71  ? 49.712 -6.049  -32.226 1.00 84.31  ? 70   LYS A CA    1 
ATOM   487  C  C     . LYS A 1 71  ? 48.473 -5.561  -32.968 1.00 81.45  ? 70   LYS A C     1 
ATOM   488  O  O     . LYS A 1 71  ? 48.498 -4.521  -33.634 1.00 83.21  ? 70   LYS A O     1 
ATOM   489  C  CB    . LYS A 1 71  ? 49.794 -5.395  -30.846 1.00 82.29  ? 70   LYS A CB    1 
ATOM   490  N  N     . TRP A 1 72  ? 47.390 -6.326  -32.860 1.00 77.21  ? 71   TRP A N     1 
ATOM   491  C  CA    . TRP A 1 72  ? 46.111 -5.987  -33.470 1.00 76.19  ? 71   TRP A CA    1 
ATOM   492  C  C     . TRP A 1 72  ? 45.123 -5.558  -32.393 1.00 72.59  ? 71   TRP A C     1 
ATOM   493  O  O     . TRP A 1 72  ? 44.997 -6.223  -31.360 1.00 72.87  ? 71   TRP A O     1 
ATOM   494  C  CB    . TRP A 1 72  ? 45.539 -7.172  -34.252 1.00 78.89  ? 71   TRP A CB    1 
ATOM   495  C  CG    . TRP A 1 72  ? 46.182 -7.403  -35.587 1.00 86.01  ? 71   TRP A CG    1 
ATOM   496  C  CD1   . TRP A 1 72  ? 47.285 -8.162  -35.846 1.00 87.99  ? 71   TRP A CD1   1 
ATOM   497  C  CD2   . TRP A 1 72  ? 45.750 -6.880  -36.851 1.00 90.39  ? 71   TRP A CD2   1 
ATOM   498  N  NE1   . TRP A 1 72  ? 47.571 -8.140  -37.189 1.00 93.44  ? 71   TRP A NE1   1 
ATOM   499  C  CE2   . TRP A 1 72  ? 46.643 -7.361  -37.829 1.00 94.75  ? 71   TRP A CE2   1 
ATOM   500  C  CE3   . TRP A 1 72  ? 44.697 -6.049  -37.249 1.00 90.12  ? 71   TRP A CE3   1 
ATOM   501  C  CZ2   . TRP A 1 72  ? 46.516 -7.039  -39.179 1.00 100.07 ? 71   TRP A CZ2   1 
ATOM   502  C  CZ3   . TRP A 1 72  ? 44.573 -5.732  -38.591 1.00 95.16  ? 71   TRP A CZ3   1 
ATOM   503  C  CH2   . TRP A 1 72  ? 45.477 -6.226  -39.539 1.00 100.16 ? 71   TRP A CH2   1 
ATOM   504  N  N     . ARG A 1 73  ? 44.428 -4.451  -32.637 1.00 71.06  ? 72   ARG A N     1 
ATOM   505  C  CA    . ARG A 1 73  ? 43.329 -4.011  -31.791 1.00 68.36  ? 72   ARG A CA    1 
ATOM   506  C  C     . ARG A 1 73  ? 42.019 -4.503  -32.391 1.00 68.48  ? 72   ARG A C     1 
ATOM   507  O  O     . ARG A 1 73  ? 41.789 -4.355  -33.597 1.00 69.86  ? 72   ARG A O     1 
ATOM   508  C  CB    . ARG A 1 73  ? 43.316 -2.486  -31.649 1.00 66.55  ? 72   ARG A CB    1 
ATOM   509  C  CG    . ARG A 1 73  ? 42.129 -1.945  -30.865 1.00 62.92  ? 72   ARG A CG    1 
ATOM   510  C  CD    . ARG A 1 73  ? 42.195 -0.431  -30.688 1.00 57.70  ? 72   ARG A CD    1 
ATOM   511  N  NE    . ARG A 1 73  ? 43.067 -0.054  -29.579 1.00 57.57  ? 72   ARG A NE    1 
ATOM   512  C  CZ    . ARG A 1 73  ? 44.271 0.486   -29.724 1.00 65.19  ? 72   ARG A CZ    1 
ATOM   513  N  NH1   . ARG A 1 73  ? 44.747 0.733   -30.937 1.00 69.92  ? 72   ARG A NH1   1 
ATOM   514  N  NH2   . ARG A 1 73  ? 44.996 0.788   -28.657 1.00 65.45  ? 72   ARG A NH2   1 
ATOM   515  N  N     . LYS A 1 74  ? 41.178 -5.103  -31.548 1.00 66.91  ? 73   LYS A N     1 
ATOM   516  C  CA    . LYS A 1 74  ? 39.889 -5.646  -31.958 1.00 66.80  ? 73   LYS A CA    1 
ATOM   517  C  C     . LYS A 1 74  ? 38.797 -4.606  -31.735 1.00 65.20  ? 73   LYS A C     1 
ATOM   518  O  O     . LYS A 1 74  ? 38.654 -4.078  -30.628 1.00 63.55  ? 73   LYS A O     1 
ATOM   519  C  CB    . LYS A 1 74  ? 39.583 -6.922  -31.170 1.00 65.75  ? 73   LYS A CB    1 
ATOM   520  C  CG    . LYS A 1 74  ? 38.208 -7.522  -31.412 1.00 67.77  ? 73   LYS A CG    1 
ATOM   521  C  CD    . LYS A 1 74  ? 38.008 -8.761  -30.546 1.00 68.41  ? 73   LYS A CD    1 
ATOM   522  C  CE    . LYS A 1 74  ? 36.736 -9.512  -30.910 1.00 70.22  ? 73   LYS A CE    1 
ATOM   523  N  NZ    . LYS A 1 74  ? 35.509 -8.725  -30.613 1.00 70.07  ? 73   LYS A NZ    1 
ATOM   524  N  N     . LEU A 1 75  ? 38.029 -4.316  -32.785 1.00 68.35  ? 74   LEU A N     1 
ATOM   525  C  CA    . LEU A 1 75  ? 37.023 -3.266  -32.761 1.00 69.49  ? 74   LEU A CA    1 
ATOM   526  C  C     . LEU A 1 75  ? 35.672 -3.835  -33.167 1.00 72.11  ? 74   LEU A C     1 
ATOM   527  O  O     . LEU A 1 75  ? 35.589 -4.791  -33.945 1.00 76.35  ? 74   LEU A O     1 
ATOM   528  C  CB    . LEU A 1 75  ? 37.382 -2.108  -33.708 1.00 74.10  ? 74   LEU A CB    1 
ATOM   529  C  CG    . LEU A 1 75  ? 38.569 -1.180  -33.433 1.00 75.19  ? 74   LEU A CG    1 
ATOM   530  C  CD1   . LEU A 1 75  ? 39.881 -1.906  -33.549 1.00 76.92  ? 74   LEU A CD1   1 
ATOM   531  C  CD2   . LEU A 1 75  ? 38.552 -0.027  -34.410 1.00 78.19  ? 74   LEU A CD2   1 
ATOM   532  N  N     . VAL A 1 76  ? 34.611 -3.226  -32.643 1.00 69.34  ? 75   VAL A N     1 
ATOM   533  C  CA    . VAL A 1 76  ? 33.238 -3.588  -32.976 1.00 71.17  ? 75   VAL A CA    1 
ATOM   534  C  C     . VAL A 1 76  ? 32.519 -2.338  -33.463 1.00 70.00  ? 75   VAL A C     1 
ATOM   535  O  O     . VAL A 1 76  ? 32.543 -1.301  -32.789 1.00 67.99  ? 75   VAL A O     1 
ATOM   536  C  CB    . VAL A 1 76  ? 32.497 -4.201  -31.774 1.00 72.32  ? 75   VAL A CB    1 
ATOM   537  C  CG1   . VAL A 1 76  ? 31.149 -4.753  -32.215 1.00 74.26  ? 75   VAL A CG1   1 
ATOM   538  C  CG2   . VAL A 1 76  ? 33.341 -5.281  -31.108 1.00 71.49  ? 75   VAL A CG2   1 
ATOM   539  N  N     . ASP A 1 77  ? 31.879 -2.437  -34.629 1.00 71.86  ? 76   ASP A N     1 
ATOM   540  C  CA    . ASP A 1 77  ? 31.080 -1.337  -35.170 1.00 71.17  ? 76   ASP A CA    1 
ATOM   541  C  C     . ASP A 1 77  ? 29.737 -1.325  -34.444 1.00 70.16  ? 76   ASP A C     1 
ATOM   542  O  O     . ASP A 1 77  ? 28.717 -1.816  -34.933 1.00 72.54  ? 76   ASP A O     1 
ATOM   543  C  CB    . ASP A 1 77  ? 30.909 -1.481  -36.676 1.00 73.63  ? 76   ASP A CB    1 
ATOM   544  C  CG    . ASP A 1 77  ? 30.221 -0.280  -37.303 1.00 77.42  ? 76   ASP A CG    1 
ATOM   545  O  OD1   . ASP A 1 77  ? 30.010 0.727   -36.592 1.00 74.27  ? 76   ASP A OD1   1 
ATOM   546  O  OD2   . ASP A 1 77  ? 29.890 -0.344  -38.507 1.00 81.49  ? 76   ASP A OD2   1 
ATOM   547  N  N     . PHE A 1 78  ? 29.746 -0.738  -33.247 1.00 66.62  ? 77   PHE A N     1 
ATOM   548  C  CA    . PHE A 1 78  ? 28.587 -0.709  -32.365 1.00 67.38  ? 77   PHE A CA    1 
ATOM   549  C  C     . PHE A 1 78  ? 27.694 0.510   -32.588 1.00 66.02  ? 77   PHE A C     1 
ATOM   550  O  O     . PHE A 1 78  ? 26.959 0.896   -31.673 1.00 65.40  ? 77   PHE A O     1 
ATOM   551  C  CB    . PHE A 1 78  ? 29.040 -0.757  -30.903 1.00 59.78  ? 77   PHE A CB    1 
ATOM   552  C  CG    . PHE A 1 78  ? 29.109 -2.146  -30.330 1.00 64.07  ? 77   PHE A CG    1 
ATOM   553  C  CD1   . PHE A 1 78  ? 28.155 -3.094  -30.657 1.00 69.43  ? 77   PHE A CD1   1 
ATOM   554  C  CD2   . PHE A 1 78  ? 30.128 -2.502  -29.462 1.00 60.46  ? 77   PHE A CD2   1 
ATOM   555  C  CE1   . PHE A 1 78  ? 28.215 -4.372  -30.129 1.00 61.20  ? 77   PHE A CE1   1 
ATOM   556  C  CE2   . PHE A 1 78  ? 30.193 -3.779  -28.931 1.00 61.96  ? 77   PHE A CE2   1 
ATOM   557  C  CZ    . PHE A 1 78  ? 29.235 -4.715  -29.266 1.00 66.42  ? 77   PHE A CZ    1 
ATOM   558  N  N     . ARG A 1 79  ? 27.734 1.114   -33.780 1.00 69.25  ? 78   ARG A N     1 
ATOM   559  C  CA    . ARG A 1 79  ? 26.968 2.334   -34.022 1.00 75.56  ? 78   ARG A CA    1 
ATOM   560  C  C     . ARG A 1 79  ? 25.481 2.128   -33.752 1.00 78.19  ? 78   ARG A C     1 
ATOM   561  O  O     . ARG A 1 79  ? 24.816 3.009   -33.193 1.00 81.16  ? 78   ARG A O     1 
ATOM   562  C  CB    . ARG A 1 79  ? 27.197 2.824   -35.453 1.00 76.22  ? 78   ARG A CB    1 
ATOM   563  C  CG    . ARG A 1 79  ? 28.484 3.617   -35.627 1.00 75.65  ? 78   ARG A CG    1 
ATOM   564  C  CD    . ARG A 1 79  ? 28.702 4.049   -37.069 1.00 80.70  ? 78   ARG A CD    1 
ATOM   565  N  NE    . ARG A 1 79  ? 29.141 2.943   -37.915 1.00 81.88  ? 78   ARG A NE    1 
ATOM   566  C  CZ    . ARG A 1 79  ? 29.522 3.077   -39.181 1.00 90.11  ? 78   ARG A CZ    1 
ATOM   567  N  NH1   . ARG A 1 79  ? 29.519 4.273   -39.753 1.00 94.54  ? 78   ARG A NH1   1 
ATOM   568  N  NH2   . ARG A 1 79  ? 29.907 2.015   -39.875 1.00 90.91  ? 78   ARG A NH2   1 
ATOM   569  N  N     . GLU A 1 80  ? 24.946 0.962   -34.121 1.00 77.31  ? 79   GLU A N     1 
ATOM   570  C  CA    . GLU A 1 80  ? 23.535 0.690   -33.866 1.00 78.97  ? 79   GLU A CA    1 
ATOM   571  C  C     . GLU A 1 80  ? 23.259 0.577   -32.371 1.00 77.86  ? 79   GLU A C     1 
ATOM   572  O  O     . GLU A 1 80  ? 22.374 1.261   -31.839 1.00 79.99  ? 79   GLU A O     1 
ATOM   573  C  CB    . GLU A 1 80  ? 23.106 -0.582  -34.593 1.00 82.54  ? 79   GLU A CB    1 
ATOM   574  C  CG    . GLU A 1 80  ? 21.606 -0.801  -34.593 1.00 88.66  ? 79   GLU A CG    1 
ATOM   575  C  CD    . GLU A 1 80  ? 20.857 0.323   -35.284 1.00 95.78  ? 79   GLU A CD    1 
ATOM   576  O  OE1   . GLU A 1 80  ? 21.413 0.918   -36.232 1.00 98.06  ? 79   GLU A OE1   1 
ATOM   577  O  OE2   . GLU A 1 80  ? 19.713 0.615   -34.877 1.00 100.22 ? 79   GLU A OE2   1 
ATOM   578  N  N     . LEU A 1 81  ? 24.008 -0.284  -31.677 1.00 62.92  ? 80   LEU A N     1 
ATOM   579  C  CA    . LEU A 1 81  ? 23.852 -0.398  -30.230 1.00 60.99  ? 80   LEU A CA    1 
ATOM   580  C  C     . LEU A 1 81  ? 24.090 0.941   -29.544 1.00 59.87  ? 80   LEU A C     1 
ATOM   581  O  O     . LEU A 1 81  ? 23.414 1.273   -28.564 1.00 60.58  ? 80   LEU A O     1 
ATOM   582  C  CB    . LEU A 1 81  ? 24.800 -1.462  -29.678 1.00 59.11  ? 80   LEU A CB    1 
ATOM   583  C  CG    . LEU A 1 81  ? 24.809 -1.632  -28.156 1.00 56.63  ? 80   LEU A CG    1 
ATOM   584  C  CD1   . LEU A 1 81  ? 23.427 -2.017  -27.643 1.00 56.54  ? 80   LEU A CD1   1 
ATOM   585  C  CD2   . LEU A 1 81  ? 25.851 -2.654  -27.721 1.00 55.10  ? 80   LEU A CD2   1 
ATOM   586  N  N     . ASN A 1 82  ? 25.045 1.729   -30.049 1.00 59.19  ? 81   ASN A N     1 
ATOM   587  C  CA    . ASN A 1 82  ? 25.269 3.062   -29.494 1.00 57.41  ? 81   ASN A CA    1 
ATOM   588  C  C     . ASN A 1 82  ? 24.031 3.938   -29.649 1.00 62.70  ? 81   ASN A C     1 
ATOM   589  O  O     . ASN A 1 82  ? 23.687 4.702   -28.739 1.00 64.47  ? 81   ASN A O     1 
ATOM   590  C  CB    . ASN A 1 82  ? 26.479 3.716   -30.160 1.00 54.26  ? 81   ASN A CB    1 
ATOM   591  C  CG    . ASN A 1 82  ? 27.786 3.035   -29.796 1.00 55.61  ? 81   ASN A CG    1 
ATOM   592  O  OD1   . ASN A 1 82  ? 27.928 2.479   -28.706 1.00 57.31  ? 81   ASN A OD1   1 
ATOM   593  N  ND2   . ASN A 1 82  ? 28.747 3.072   -30.712 1.00 54.17  ? 81   ASN A ND2   1 
ATOM   594  N  N     . LYS A 1 83  ? 23.350 3.845   -30.795 1.00 65.82  ? 82   LYS A N     1 
ATOM   595  C  CA    . LYS A 1 83  ? 22.076 4.541   -30.949 1.00 67.17  ? 82   LYS A CA    1 
ATOM   596  C  C     . LYS A 1 83  ? 21.056 4.057   -29.925 1.00 70.17  ? 82   LYS A C     1 
ATOM   597  O  O     . LYS A 1 83  ? 20.330 4.864   -29.331 1.00 70.20  ? 82   LYS A O     1 
ATOM   598  C  CB    . LYS A 1 83  ? 21.530 4.351   -32.366 1.00 68.89  ? 82   LYS A CB    1 
ATOM   599  C  CG    . LYS A 1 83  ? 22.229 5.170   -33.438 1.00 68.67  ? 82   LYS A CG    1 
ATOM   600  C  CD    . LYS A 1 83  ? 21.587 4.948   -34.800 1.00 71.08  ? 82   LYS A CD    1 
ATOM   601  N  N     . ARG A 1 84  ? 20.988 2.743   -29.701 1.00 73.63  ? 83   ARG A N     1 
ATOM   602  C  CA    . ARG A 1 84  ? 19.977 2.175   -28.814 1.00 74.26  ? 83   ARG A CA    1 
ATOM   603  C  C     . ARG A 1 84  ? 20.304 2.334   -27.332 1.00 70.61  ? 83   ARG A C     1 
ATOM   604  O  O     . ARG A 1 84  ? 19.416 2.122   -26.499 1.00 70.14  ? 83   ARG A O     1 
ATOM   605  C  CB    . ARG A 1 84  ? 19.779 0.685   -29.111 1.00 79.40  ? 83   ARG A CB    1 
ATOM   606  C  CG    . ARG A 1 84  ? 19.717 0.314   -30.583 1.00 84.27  ? 83   ARG A CG    1 
ATOM   607  C  CD    . ARG A 1 84  ? 18.410 0.719   -31.233 1.00 88.94  ? 83   ARG A CD    1 
ATOM   608  N  NE    . ARG A 1 84  ? 18.266 0.103   -32.549 1.00 94.47  ? 83   ARG A NE    1 
ATOM   609  C  CZ    . ARG A 1 84  ? 17.763 -1.111  -32.753 1.00 98.22  ? 83   ARG A CZ    1 
ATOM   610  N  NH1   . ARG A 1 84  ? 17.670 -1.596  -33.983 1.00 101.44 ? 83   ARG A NH1   1 
ATOM   611  N  NH2   . ARG A 1 84  ? 17.351 -1.840  -31.725 1.00 97.46  ? 83   ARG A NH2   1 
ATOM   612  N  N     . THR A 1 85  ? 21.535 2.696   -26.981 1.00 67.78  ? 84   THR A N     1 
ATOM   613  C  CA    . THR A 1 85  ? 21.984 2.685   -25.594 1.00 65.71  ? 84   THR A CA    1 
ATOM   614  C  C     . THR A 1 85  ? 21.679 4.013   -24.904 1.00 64.34  ? 84   THR A C     1 
ATOM   615  O  O     . THR A 1 85  ? 21.643 5.072   -25.536 1.00 63.94  ? 84   THR A O     1 
ATOM   616  C  CB    . THR A 1 85  ? 23.486 2.381   -25.528 1.00 63.51  ? 84   THR A CB    1 
ATOM   617  O  OG1   . THR A 1 85  ? 23.749 1.151   -26.214 1.00 63.97  ? 84   THR A OG1   1 
ATOM   618  C  CG2   . THR A 1 85  ? 23.972 2.244   -24.089 1.00 61.15  ? 84   THR A CG2   1 
ATOM   619  N  N     . GLN A 1 86  ? 21.447 3.935   -23.592 1.00 63.92  ? 85   GLN A N     1 
ATOM   620  C  CA    . GLN A 1 86  ? 21.183 5.102   -22.760 1.00 62.54  ? 85   GLN A CA    1 
ATOM   621  C  C     . GLN A 1 86  ? 22.313 6.125   -22.859 1.00 62.51  ? 85   GLN A C     1 
ATOM   622  O  O     . GLN A 1 86  ? 23.438 5.816   -23.259 1.00 61.47  ? 85   GLN A O     1 
ATOM   623  C  CB    . GLN A 1 86  ? 21.030 4.691   -21.298 1.00 58.92  ? 85   GLN A CB    1 
ATOM   624  C  CG    . GLN A 1 86  ? 22.342 4.218   -20.681 1.00 54.42  ? 85   GLN A CG    1 
ATOM   625  C  CD    . GLN A 1 86  ? 22.289 4.133   -19.173 1.00 52.60  ? 85   GLN A CD    1 
ATOM   626  O  OE1   . GLN A 1 86  ? 21.901 3.108   -18.610 1.00 53.19  ? 85   GLN A OE1   1 
ATOM   627  N  NE2   . GLN A 1 86  ? 22.683 5.214   -18.505 1.00 48.44  ? 85   GLN A NE2   1 
ATOM   628  N  N     . ASP A 1 87  ? 22.004 7.354   -22.456 1.00 62.50  ? 86   ASP A N     1 
ATOM   629  C  CA    . ASP A 1 87  ? 23.007 8.407   -22.413 1.00 60.20  ? 86   ASP A CA    1 
ATOM   630  C  C     . ASP A 1 87  ? 23.832 8.317   -21.137 1.00 60.43  ? 86   ASP A C     1 
ATOM   631  O  O     . ASP A 1 87  ? 23.362 7.852   -20.094 1.00 60.82  ? 86   ASP A O     1 
ATOM   632  C  CB    . ASP A 1 87  ? 22.355 9.787   -22.500 1.00 60.24  ? 86   ASP A CB    1 
ATOM   633  C  CG    . ASP A 1 87  ? 21.819 10.088  -23.878 1.00 64.91  ? 86   ASP A CG    1 
ATOM   634  O  OD1   . ASP A 1 87  ? 22.377 9.554   -24.861 1.00 64.97  ? 86   ASP A OD1   1 
ATOM   635  O  OD2   . ASP A 1 87  ? 20.841 10.859  -23.976 1.00 68.17  ? 86   ASP A OD2   1 
ATOM   636  N  N     . PHE A 1 88  ? 25.076 8.771   -21.233 1.00 58.21  ? 87   PHE A N     1 
ATOM   637  C  CA    . PHE A 1 88  ? 25.985 8.850   -20.103 1.00 53.52  ? 87   PHE A CA    1 
ATOM   638  C  C     . PHE A 1 88  ? 26.411 10.297  -19.907 1.00 54.34  ? 87   PHE A C     1 
ATOM   639  O  O     . PHE A 1 88  ? 26.278 11.133  -20.804 1.00 54.80  ? 87   PHE A O     1 
ATOM   640  C  CB    . PHE A 1 88  ? 27.229 7.975   -20.314 1.00 48.77  ? 87   PHE A CB    1 
ATOM   641  C  CG    . PHE A 1 88  ? 26.923 6.532   -20.595 1.00 47.78  ? 87   PHE A CG    1 
ATOM   642  C  CD1   . PHE A 1 88  ? 26.619 6.110   -21.879 1.00 48.13  ? 87   PHE A CD1   1 
ATOM   643  C  CD2   . PHE A 1 88  ? 26.958 5.593   -19.577 1.00 46.11  ? 87   PHE A CD2   1 
ATOM   644  C  CE1   . PHE A 1 88  ? 26.340 4.781   -22.141 1.00 48.76  ? 87   PHE A CE1   1 
ATOM   645  C  CE2   . PHE A 1 88  ? 26.683 4.262   -19.832 1.00 47.22  ? 87   PHE A CE2   1 
ATOM   646  C  CZ    . PHE A 1 88  ? 26.373 3.854   -21.115 1.00 47.68  ? 87   PHE A CZ    1 
ATOM   647  N  N     . TRP A 1 89  ? 26.923 10.593  -18.717 1.00 54.86  ? 88   TRP A N     1 
ATOM   648  C  CA    . TRP A 1 89  ? 27.618 11.848  -18.473 1.00 49.28  ? 88   TRP A CA    1 
ATOM   649  C  C     . TRP A 1 89  ? 29.111 11.552  -18.493 1.00 46.10  ? 88   TRP A C     1 
ATOM   650  O  O     . TRP A 1 89  ? 29.621 10.841  -17.622 1.00 46.24  ? 88   TRP A O     1 
ATOM   651  C  CB    . TRP A 1 89  ? 27.203 12.492  -17.154 1.00 48.03  ? 88   TRP A CB    1 
ATOM   652  C  CG    . TRP A 1 89  ? 27.770 13.872  -17.033 1.00 45.33  ? 88   TRP A CG    1 
ATOM   653  C  CD1   . TRP A 1 89  ? 28.906 14.239  -16.371 1.00 43.08  ? 88   TRP A CD1   1 
ATOM   654  C  CD2   . TRP A 1 89  ? 27.253 15.064  -17.636 1.00 43.50  ? 88   TRP A CD2   1 
ATOM   655  N  NE1   . TRP A 1 89  ? 29.116 15.590  -16.507 1.00 41.50  ? 88   TRP A NE1   1 
ATOM   656  C  CE2   . TRP A 1 89  ? 28.118 16.119  -17.283 1.00 43.10  ? 88   TRP A CE2   1 
ATOM   657  C  CE3   . TRP A 1 89  ? 26.138 15.342  -18.435 1.00 44.01  ? 88   TRP A CE3   1 
ATOM   658  C  CZ2   . TRP A 1 89  ? 27.902 17.433  -17.698 1.00 40.02  ? 88   TRP A CZ2   1 
ATOM   659  C  CZ3   . TRP A 1 89  ? 25.924 16.647  -18.845 1.00 42.13  ? 88   TRP A CZ3   1 
ATOM   660  C  CH2   . TRP A 1 89  ? 26.802 17.675  -18.474 1.00 41.69  ? 88   TRP A CH2   1 
ATOM   661  N  N     . GLU A 1 90  ? 29.803 12.080  -19.498 1.00 46.66  ? 89   GLU A N     1 
ATOM   662  C  CA    . GLU A 1 90  ? 31.236 11.857  -19.614 1.00 48.02  ? 89   GLU A CA    1 
ATOM   663  C  C     . GLU A 1 90  ? 31.964 12.509  -18.446 1.00 49.37  ? 89   GLU A C     1 
ATOM   664  O  O     . GLU A 1 90  ? 31.615 13.611  -18.014 1.00 53.39  ? 89   GLU A O     1 
ATOM   665  C  CB    . GLU A 1 90  ? 31.754 12.414  -20.940 1.00 46.80  ? 89   GLU A CB    1 
ATOM   666  C  CG    . GLU A 1 90  ? 30.923 12.015  -22.156 1.00 50.25  ? 89   GLU A CG    1 
ATOM   667  C  CD    . GLU A 1 90  ? 30.987 10.527  -22.464 1.00 56.02  ? 89   GLU A CD    1 
ATOM   668  O  OE1   . GLU A 1 90  ? 31.945 9.861   -22.016 1.00 56.10  ? 89   GLU A OE1   1 
ATOM   669  O  OE2   . GLU A 1 90  ? 30.075 10.023  -23.158 1.00 58.29  ? 89   GLU A OE2   1 
ATOM   670  N  N     . VAL A 1 91  ? 32.977 11.815  -17.921 1.00 46.70  ? 90   VAL A N     1 
ATOM   671  C  CA    . VAL A 1 91  ? 33.748 12.338  -16.797 1.00 44.17  ? 90   VAL A CA    1 
ATOM   672  C  C     . VAL A 1 91  ? 35.086 12.926  -17.221 1.00 40.31  ? 90   VAL A C     1 
ATOM   673  O  O     . VAL A 1 91  ? 35.756 13.565  -16.392 1.00 37.56  ? 90   VAL A O     1 
ATOM   674  C  CB    . VAL A 1 91  ? 33.971 11.258  -15.716 1.00 43.83  ? 90   VAL A CB    1 
ATOM   675  C  CG1   . VAL A 1 91  ? 32.649 10.888  -15.065 1.00 41.16  ? 90   VAL A CG1   1 
ATOM   676  C  CG2   . VAL A 1 91  ? 34.644 10.032  -16.314 1.00 45.49  ? 90   VAL A CG2   1 
ATOM   677  N  N     . GLN A 1 92  ? 35.499 12.738  -18.473 1.00 38.57  ? 91   GLN A N     1 
ATOM   678  C  CA    . GLN A 1 92  ? 36.722 13.360  -18.979 1.00 39.62  ? 91   GLN A CA    1 
ATOM   679  C  C     . GLN A 1 92  ? 36.400 14.807  -19.332 1.00 44.55  ? 91   GLN A C     1 
ATOM   680  O  O     . GLN A 1 92  ? 35.787 15.087  -20.363 1.00 49.44  ? 91   GLN A O     1 
ATOM   681  C  CB    . GLN A 1 92  ? 37.264 12.599  -20.183 1.00 38.12  ? 91   GLN A CB    1 
ATOM   682  C  CG    . GLN A 1 92  ? 38.734 12.867  -20.458 1.00 37.30  ? 91   GLN A CG    1 
ATOM   683  C  CD    . GLN A 1 92  ? 39.618 12.456  -19.292 1.00 41.85  ? 91   GLN A CD    1 
ATOM   684  O  OE1   . GLN A 1 92  ? 39.519 11.336  -18.788 1.00 43.63  ? 91   GLN A OE1   1 
ATOM   685  N  NE2   . GLN A 1 92  ? 40.479 13.367  -18.850 1.00 40.47  ? 91   GLN A NE2   1 
ATOM   686  N  N     . LEU A 1 93  ? 36.812 15.734  -18.473 1.00 42.76  ? 92   LEU A N     1 
ATOM   687  C  CA    . LEU A 1 93  ? 36.457 17.138  -18.628 1.00 42.32  ? 92   LEU A CA    1 
ATOM   688  C  C     . LEU A 1 93  ? 37.469 17.920  -19.456 1.00 42.35  ? 92   LEU A C     1 
ATOM   689  O  O     . LEU A 1 93  ? 37.248 19.108  -19.720 1.00 42.36  ? 92   LEU A O     1 
ATOM   690  C  CB    . LEU A 1 93  ? 36.300 17.792  -17.250 1.00 38.33  ? 92   LEU A CB    1 
ATOM   691  C  CG    . LEU A 1 93  ? 35.423 17.050  -16.237 1.00 37.68  ? 92   LEU A CG    1 
ATOM   692  C  CD1   . LEU A 1 93  ? 35.194 17.897  -14.992 1.00 38.37  ? 92   LEU A CD1   1 
ATOM   693  C  CD2   . LEU A 1 93  ? 34.095 16.625  -16.854 1.00 36.49  ? 92   LEU A CD2   1 
ATOM   694  N  N     . GLY A 1 94  ? 38.557 17.290  -19.874 1.00 42.34  ? 93   GLY A N     1 
ATOM   695  C  CA    . GLY A 1 94  ? 39.586 17.988  -20.615 1.00 43.97  ? 93   GLY A CA    1 
ATOM   696  C  C     . GLY A 1 94  ? 40.840 17.148  -20.696 1.00 44.04  ? 93   GLY A C     1 
ATOM   697  O  O     . GLY A 1 94  ? 40.900 16.021  -20.194 1.00 45.20  ? 93   GLY A O     1 
ATOM   698  N  N     . ILE A 1 95  ? 41.845 17.724  -21.335 1.00 42.59  ? 94   ILE A N     1 
ATOM   699  C  CA    . ILE A 1 95  ? 43.106 17.046  -21.627 1.00 39.50  ? 94   ILE A CA    1 
ATOM   700  C  C     . ILE A 1 95  ? 44.191 17.660  -20.753 1.00 40.08  ? 94   ILE A C     1 
ATOM   701  O  O     . ILE A 1 95  ? 44.354 18.886  -20.760 1.00 41.61  ? 94   ILE A O     1 
ATOM   702  C  CB    . ILE A 1 95  ? 43.484 17.158  -23.117 1.00 38.55  ? 94   ILE A CB    1 
ATOM   703  C  CG1   . ILE A 1 95  ? 42.297 16.772  -24.006 1.00 38.90  ? 94   ILE A CG1   1 
ATOM   704  C  CG2   . ILE A 1 95  ? 44.702 16.304  -23.426 1.00 39.65  ? 94   ILE A CG2   1 
ATOM   705  C  CD1   . ILE A 1 95  ? 41.633 15.455  -23.630 1.00 33.53  ? 94   ILE A CD1   1 
ATOM   706  N  N     . PRO A 1 96  ? 44.944 16.864  -19.997 1.00 37.09  ? 95   PRO A N     1 
ATOM   707  C  CA    . PRO A 1 96  ? 46.038 17.429  -19.199 1.00 32.87  ? 95   PRO A CA    1 
ATOM   708  C  C     . PRO A 1 96  ? 47.142 17.981  -20.085 1.00 35.37  ? 95   PRO A C     1 
ATOM   709  O  O     . PRO A 1 96  ? 47.391 17.492  -21.190 1.00 36.08  ? 95   PRO A O     1 
ATOM   710  C  CB    . PRO A 1 96  ? 46.531 16.235  -18.373 1.00 33.75  ? 95   PRO A CB    1 
ATOM   711  C  CG    . PRO A 1 96  ? 46.127 15.032  -19.170 1.00 33.63  ? 95   PRO A CG    1 
ATOM   712  C  CD    . PRO A 1 96  ? 44.832 15.403  -19.836 1.00 35.82  ? 95   PRO A CD    1 
ATOM   713  N  N     . HIS A 1 97  ? 47.806 19.025  -19.586 1.00 36.89  ? 96   HIS A N     1 
ATOM   714  C  CA    . HIS A 1 97  ? 48.854 19.679  -20.348 1.00 33.99  ? 96   HIS A CA    1 
ATOM   715  C  C     . HIS A 1 97  ? 50.162 19.687  -19.567 1.00 32.98  ? 96   HIS A C     1 
ATOM   716  O  O     . HIS A 1 97  ? 50.159 19.951  -18.360 1.00 32.54  ? 96   HIS A O     1 
ATOM   717  C  CB    . HIS A 1 97  ? 48.461 21.118  -20.699 1.00 33.27  ? 96   HIS A CB    1 
ATOM   718  C  CG    . HIS A 1 97  ? 49.291 21.715  -21.791 1.00 32.16  ? 96   HIS A CG    1 
ATOM   719  N  ND1   . HIS A 1 97  ? 50.526 22.280  -21.561 1.00 32.28  ? 96   HIS A ND1   1 
ATOM   720  C  CD2   . HIS A 1 97  ? 49.072 21.815  -23.122 1.00 33.28  ? 96   HIS A CD2   1 
ATOM   721  C  CE1   . HIS A 1 97  ? 51.029 22.710  -22.704 1.00 33.42  ? 96   HIS A CE1   1 
ATOM   722  N  NE2   . HIS A 1 97  ? 50.166 22.441  -23.667 1.00 36.28  ? 96   HIS A NE2   1 
ATOM   723  N  N     . PRO A 1 98  ? 51.293 19.408  -20.221 1.00 30.94  ? 97   PRO A N     1 
ATOM   724  C  CA    . PRO A 1 98  ? 52.567 19.330  -19.488 1.00 34.74  ? 97   PRO A CA    1 
ATOM   725  C  C     . PRO A 1 98  ? 52.990 20.641  -18.847 1.00 36.55  ? 97   PRO A C     1 
ATOM   726  O  O     . PRO A 1 98  ? 53.753 20.617  -17.871 1.00 34.68  ? 97   PRO A O     1 
ATOM   727  C  CB    . PRO A 1 98  ? 53.566 18.883  -20.565 1.00 31.74  ? 97   PRO A CB    1 
ATOM   728  C  CG    . PRO A 1 98  ? 52.942 19.297  -21.859 1.00 32.55  ? 97   PRO A CG    1 
ATOM   729  C  CD    . PRO A 1 98  ? 51.463 19.143  -21.659 1.00 31.97  ? 97   PRO A CD    1 
ATOM   730  N  N     . ALA A 1 99  ? 52.524 21.784  -19.357 1.00 36.81  ? 98   ALA A N     1 
ATOM   731  C  CA    . ALA A 1 99  ? 52.857 23.059  -18.733 1.00 39.43  ? 98   ALA A CA    1 
ATOM   732  C  C     . ALA A 1 99  ? 52.230 23.203  -17.354 1.00 38.26  ? 98   ALA A C     1 
ATOM   733  O  O     . ALA A 1 99  ? 52.659 24.064  -16.578 1.00 40.15  ? 98   ALA A O     1 
ATOM   734  C  CB    . ALA A 1 99  ? 52.422 24.219  -19.630 1.00 43.19  ? 98   ALA A CB    1 
ATOM   735  N  N     . GLY A 1 100 ? 51.226 22.385  -17.037 1.00 35.37  ? 99   GLY A N     1 
ATOM   736  C  CA    . GLY A 1 100 ? 50.628 22.357  -15.719 1.00 33.70  ? 99   GLY A CA    1 
ATOM   737  C  C     . GLY A 1 100 ? 51.281 21.410  -14.740 1.00 36.66  ? 99   GLY A C     1 
ATOM   738  O  O     . GLY A 1 100 ? 50.903 21.393  -13.564 1.00 34.87  ? 99   GLY A O     1 
ATOM   739  N  N     . LEU A 1 101 ? 52.252 20.618  -15.193 1.00 32.14  ? 100  LEU A N     1 
ATOM   740  C  CA    . LEU A 1 101 ? 53.002 19.764  -14.284 1.00 33.50  ? 100  LEU A CA    1 
ATOM   741  C  C     . LEU A 1 101 ? 53.986 20.588  -13.461 1.00 38.31  ? 100  LEU A C     1 
ATOM   742  O  O     . LEU A 1 101 ? 54.492 21.625  -13.902 1.00 39.33  ? 100  LEU A O     1 
ATOM   743  C  CB    . LEU A 1 101 ? 53.757 18.681  -15.057 1.00 32.19  ? 100  LEU A CB    1 
ATOM   744  C  CG    . LEU A 1 101 ? 52.918 17.753  -15.934 1.00 32.63  ? 100  LEU A CG    1 
ATOM   745  C  CD1   . LEU A 1 101 ? 53.816 16.933  -16.839 1.00 30.01  ? 100  LEU A CD1   1 
ATOM   746  C  CD2   . LEU A 1 101 ? 52.050 16.855  -15.071 1.00 31.76  ? 100  LEU A CD2   1 
ATOM   747  N  N     . LYS A 1 102 ? 54.259 20.109  -12.254 1.00 39.56  ? 101  LYS A N     1 
ATOM   748  C  CA    . LYS A 1 102 ? 55.233 20.719  -11.365 1.00 41.36  ? 101  LYS A CA    1 
ATOM   749  C  C     . LYS A 1 102 ? 56.481 19.847  -11.301 1.00 44.76  ? 101  LYS A C     1 
ATOM   750  O  O     . LYS A 1 102 ? 56.448 18.656  -11.622 1.00 47.92  ? 101  LYS A O     1 
ATOM   751  C  CB    . LYS A 1 102 ? 54.637 20.924  -9.969  1.00 41.22  ? 101  LYS A CB    1 
ATOM   752  C  CG    . LYS A 1 102 ? 53.372 21.772  -9.986  1.00 43.83  ? 101  LYS A CG    1 
ATOM   753  C  CD    . LYS A 1 102 ? 52.698 21.840  -8.629  1.00 46.30  ? 101  LYS A CD    1 
ATOM   754  C  CE    . LYS A 1 102 ? 51.420 22.662  -8.705  1.00 47.03  ? 101  LYS A CE    1 
ATOM   755  N  NZ    . LYS A 1 102 ? 50.704 22.704  -7.402  1.00 48.97  ? 101  LYS A NZ    1 
ATOM   756  N  N     . LYS A 1 103 ? 57.591 20.460  -10.895 1.00 43.76  ? 102  LYS A N     1 
ATOM   757  C  CA    . LYS A 1 103 ? 58.854 19.737  -10.827 1.00 45.73  ? 102  LYS A CA    1 
ATOM   758  C  C     . LYS A 1 103 ? 58.775 18.623  -9.790  1.00 46.26  ? 102  LYS A C     1 
ATOM   759  O  O     . LYS A 1 103 ? 58.438 18.862  -8.626  1.00 46.47  ? 102  LYS A O     1 
ATOM   760  C  CB    . LYS A 1 103 ? 59.996 20.695  -10.488 1.00 45.24  ? 102  LYS A CB    1 
ATOM   761  N  N     . LYS A 1 104 ? 59.077 17.400  -10.219 1.00 43.20  ? 103  LYS A N     1 
ATOM   762  C  CA    . LYS A 1 104 ? 59.088 16.239  -9.340  1.00 43.95  ? 103  LYS A CA    1 
ATOM   763  C  C     . LYS A 1 104 ? 60.486 15.643  -9.296  1.00 44.81  ? 103  LYS A C     1 
ATOM   764  O  O     . LYS A 1 104 ? 61.180 15.587  -10.316 1.00 43.72  ? 103  LYS A O     1 
ATOM   765  C  CB    . LYS A 1 104 ? 58.085 15.171  -9.802  1.00 42.75  ? 103  LYS A CB    1 
ATOM   766  C  CG    . LYS A 1 104 ? 56.633 15.568  -9.615  1.00 43.07  ? 103  LYS A CG    1 
ATOM   767  C  CD    . LYS A 1 104 ? 56.328 15.843  -8.155  1.00 45.43  ? 103  LYS A CD    1 
ATOM   768  C  CE    . LYS A 1 104 ? 55.017 16.590  -8.000  1.00 46.62  ? 103  LYS A CE    1 
ATOM   769  N  NZ    . LYS A 1 104 ? 54.667 16.781  -6.570  1.00 48.41  ? 103  LYS A NZ    1 
ATOM   770  N  N     . LYS A 1 105 ? 60.896 15.202  -8.105  1.00 44.66  ? 104  LYS A N     1 
ATOM   771  C  CA    . LYS A 1 105 ? 62.182 14.526  -7.985  1.00 43.43  ? 104  LYS A CA    1 
ATOM   772  C  C     . LYS A 1 105 ? 62.198 13.242  -8.803  1.00 42.45  ? 104  LYS A C     1 
ATOM   773  O  O     . LYS A 1 105 ? 63.194 12.932  -9.466  1.00 44.23  ? 104  LYS A O     1 
ATOM   774  C  CB    . LYS A 1 105 ? 62.495 14.236  -6.517  1.00 45.45  ? 104  LYS A CB    1 
ATOM   775  N  N     . SER A 1 106 ? 61.097 12.493  -8.794  1.00 41.46  ? 105  SER A N     1 
ATOM   776  C  CA    . SER A 1 106 ? 61.065 11.202  -9.467  1.00 39.45  ? 105  SER A CA    1 
ATOM   777  C  C     . SER A 1 106 ? 59.763 11.026  -10.234 1.00 38.59  ? 105  SER A C     1 
ATOM   778  O  O     . SER A 1 106 ? 58.687 11.390  -9.747  1.00 38.89  ? 105  SER A O     1 
ATOM   779  C  CB    . SER A 1 106 ? 61.247 10.064  -8.466  1.00 38.75  ? 105  SER A CB    1 
ATOM   780  O  OG    . SER A 1 106 ? 62.513 10.143  -7.835  1.00 40.23  ? 105  SER A OG    1 
ATOM   781  N  N     . VAL A 1 107 ? 59.874 10.452  -11.432 1.00 37.17  ? 106  VAL A N     1 
ATOM   782  C  CA    . VAL A 1 107 ? 58.766 10.340  -12.374 1.00 33.89  ? 106  VAL A CA    1 
ATOM   783  C  C     . VAL A 1 107 ? 58.744 8.933   -12.956 1.00 40.11  ? 106  VAL A C     1 
ATOM   784  O  O     . VAL A 1 107 ? 59.792 8.361   -13.273 1.00 41.31  ? 106  VAL A O     1 
ATOM   785  C  CB    . VAL A 1 107 ? 58.880 11.389  -13.501 1.00 40.75  ? 106  VAL A CB    1 
ATOM   786  C  CG1   . VAL A 1 107 ? 57.843 11.133  -14.580 1.00 39.66  ? 106  VAL A CG1   1 
ATOM   787  C  CG2   . VAL A 1 107 ? 58.734 12.796  -12.942 1.00 32.73  ? 106  VAL A CG2   1 
ATOM   788  N  N     . THR A 1 108 ? 57.543 8.376   -13.095 1.00 34.23  ? 107  THR A N     1 
ATOM   789  C  CA    . THR A 1 108 ? 57.329 7.102   -13.763 1.00 34.95  ? 107  THR A CA    1 
ATOM   790  C  C     . THR A 1 108 ? 56.130 7.244   -14.687 1.00 39.58  ? 107  THR A C     1 
ATOM   791  O  O     . THR A 1 108 ? 55.174 7.947   -14.363 1.00 39.82  ? 107  THR A O     1 
ATOM   792  C  CB    . THR A 1 108 ? 57.090 5.966   -12.750 1.00 35.67  ? 107  THR A CB    1 
ATOM   793  O  OG1   . THR A 1 108 ? 58.255 5.788   -11.939 1.00 36.62  ? 107  THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 108 ? 56.773 4.657   -13.457 1.00 36.52  ? 107  THR A CG2   1 
ATOM   795  N  N     . VAL A 1 109 ? 56.186 6.602   -15.849 1.00 40.41  ? 108  VAL A N     1 
ATOM   796  C  CA    . VAL A 1 109 ? 55.037 6.509   -16.741 1.00 40.22  ? 108  VAL A CA    1 
ATOM   797  C  C     . VAL A 1 109 ? 54.769 5.038   -17.001 1.00 43.11  ? 108  VAL A C     1 
ATOM   798  O  O     . VAL A 1 109 ? 55.671 4.305   -17.420 1.00 47.14  ? 108  VAL A O     1 
ATOM   799  C  CB    . VAL A 1 109 ? 55.264 7.269   -18.060 1.00 40.71  ? 108  VAL A CB    1 
ATOM   800  C  CG1   . VAL A 1 109 ? 54.095 7.043   -19.000 1.00 37.60  ? 108  VAL A CG1   1 
ATOM   801  C  CG2   . VAL A 1 109 ? 55.450 8.756   -17.792 1.00 33.80  ? 108  VAL A CG2   1 
ATOM   802  N  N     . LEU A 1 110 ? 53.539 4.601   -16.738 1.00 44.02  ? 109  LEU A N     1 
ATOM   803  C  CA    . LEU A 1 110 ? 53.175 3.217   -17.005 1.00 44.11  ? 109  LEU A CA    1 
ATOM   804  C  C     . LEU A 1 110 ? 51.800 3.159   -17.657 1.00 44.02  ? 109  LEU A C     1 
ATOM   805  O  O     . LEU A 1 110 ? 51.052 4.141   -17.693 1.00 43.50  ? 109  LEU A O     1 
ATOM   806  C  CB    . LEU A 1 110 ? 53.230 2.351   -15.736 1.00 48.53  ? 109  LEU A CB    1 
ATOM   807  C  CG    . LEU A 1 110 ? 53.060 2.972   -14.352 1.00 51.12  ? 109  LEU A CG    1 
ATOM   808  C  CD1   . LEU A 1 110 ? 51.635 3.403   -14.144 1.00 54.63  ? 109  LEU A CD1   1 
ATOM   809  C  CD2   . LEU A 1 110 ? 53.473 1.974   -13.286 1.00 51.03  ? 109  LEU A CD2   1 
ATOM   810  N  N     . ASP A 1 111 ? 51.488 1.983   -18.196 1.00 44.99  ? 110  ASP A N     1 
ATOM   811  C  CA    . ASP A 1 111 ? 50.315 1.779   -19.032 1.00 50.17  ? 110  ASP A CA    1 
ATOM   812  C  C     . ASP A 1 111 ? 49.688 0.441   -18.671 1.00 46.83  ? 110  ASP A C     1 
ATOM   813  O  O     . ASP A 1 111 ? 50.394 -0.563  -18.543 1.00 48.20  ? 110  ASP A O     1 
ATOM   814  C  CB    . ASP A 1 111 ? 50.703 1.826   -20.520 1.00 60.87  ? 110  ASP A CB    1 
ATOM   815  C  CG    . ASP A 1 111 ? 49.510 1.705   -21.452 1.00 71.15  ? 110  ASP A CG    1 
ATOM   816  O  OD1   . ASP A 1 111 ? 48.923 0.607   -21.540 1.00 77.37  ? 110  ASP A OD1   1 
ATOM   817  O  OD2   . ASP A 1 111 ? 49.162 2.711   -22.106 1.00 76.34  ? 110  ASP A OD2   1 
ATOM   818  N  N     . VAL A 1 112 ? 48.369 0.433   -18.502 1.00 44.35  ? 111  VAL A N     1 
ATOM   819  C  CA    . VAL A 1 112 ? 47.647 -0.785  -18.151 1.00 39.05  ? 111  VAL A CA    1 
ATOM   820  C  C     . VAL A 1 112 ? 47.488 -1.654  -19.393 1.00 51.59  ? 111  VAL A C     1 
ATOM   821  O  O     . VAL A 1 112 ? 47.075 -1.173  -20.456 1.00 49.55  ? 111  VAL A O     1 
ATOM   822  C  CB    . VAL A 1 112 ? 46.282 -0.448  -17.531 1.00 51.46  ? 111  VAL A CB    1 
ATOM   823  C  CG1   . VAL A 1 112 ? 45.467 -1.714  -17.316 1.00 56.23  ? 111  VAL A CG1   1 
ATOM   824  C  CG2   . VAL A 1 112 ? 46.470 0.297   -16.218 1.00 49.97  ? 111  VAL A CG2   1 
ATOM   825  N  N     . GLY A 1 113 ? 47.809 -2.940  -19.259 1.00 50.13  ? 112  GLY A N     1 
ATOM   826  C  CA    . GLY A 1 113 ? 47.665 -3.862  -20.374 1.00 48.91  ? 112  GLY A CA    1 
ATOM   827  C  C     . GLY A 1 113 ? 46.245 -4.396  -20.473 1.00 50.94  ? 112  GLY A C     1 
ATOM   828  O  O     . GLY A 1 113 ? 45.633 -4.783  -19.478 1.00 53.56  ? 112  GLY A O     1 
ATOM   829  N  N     . ASP A 1 114 ? 45.727 -4.414  -21.703 1.00 52.23  ? 113  ASP A N     1 
ATOM   830  C  CA    . ASP A 1 114 ? 44.354 -4.825  -22.003 1.00 54.46  ? 113  ASP A CA    1 
ATOM   831  C  C     . ASP A 1 114 ? 43.365 -4.155  -21.050 1.00 51.26  ? 113  ASP A C     1 
ATOM   832  O  O     . ASP A 1 114 ? 42.620 -4.807  -20.316 1.00 53.42  ? 113  ASP A O     1 
ATOM   833  C  CB    . ASP A 1 114 ? 44.216 -6.349  -21.968 1.00 63.68  ? 113  ASP A CB    1 
ATOM   834  C  CG    . ASP A 1 114 ? 44.684 -7.003  -23.251 1.00 73.35  ? 113  ASP A CG    1 
ATOM   835  O  OD1   . ASP A 1 114 ? 45.206 -6.283  -24.129 1.00 75.29  ? 113  ASP A OD1   1 
ATOM   836  O  OD2   . ASP A 1 114 ? 44.524 -8.234  -23.385 1.00 79.34  ? 113  ASP A OD2   1 
ATOM   837  N  N     . ALA A 1 115 ? 43.376 -2.821  -21.087 1.00 47.31  ? 114  ALA A N     1 
ATOM   838  C  CA    . ALA A 1 115 ? 42.660 -2.023  -20.096 1.00 44.61  ? 114  ALA A CA    1 
ATOM   839  C  C     . ALA A 1 115 ? 41.165 -2.328  -20.097 1.00 45.70  ? 114  ALA A C     1 
ATOM   840  O  O     . ALA A 1 115 ? 40.607 -2.760  -19.081 1.00 41.25  ? 114  ALA A O     1 
ATOM   841  C  CB    . ALA A 1 115 ? 42.912 -0.537  -20.355 1.00 44.22  ? 114  ALA A CB    1 
ATOM   842  N  N     . TYR A 1 116 ? 40.496 -2.087  -21.229 1.00 41.72  ? 115  TYR A N     1 
ATOM   843  C  CA    . TYR A 1 116 ? 39.060 -2.344  -21.318 1.00 42.26  ? 115  TYR A CA    1 
ATOM   844  C  C     . TYR A 1 116 ? 38.729 -3.785  -20.959 1.00 47.38  ? 115  TYR A C     1 
ATOM   845  O  O     . TYR A 1 116 ? 37.781 -4.046  -20.209 1.00 50.23  ? 115  TYR A O     1 
ATOM   846  C  CB    . TYR A 1 116 ? 38.548 -2.036  -22.726 1.00 43.07  ? 115  TYR A CB    1 
ATOM   847  C  CG    . TYR A 1 116 ? 38.279 -0.577  -23.016 1.00 48.07  ? 115  TYR A CG    1 
ATOM   848  C  CD1   . TYR A 1 116 ? 38.764 0.426   -22.189 1.00 45.92  ? 115  TYR A CD1   1 
ATOM   849  C  CD2   . TYR A 1 116 ? 37.525 -0.207  -24.120 1.00 49.50  ? 115  TYR A CD2   1 
ATOM   850  C  CE1   . TYR A 1 116 ? 38.513 1.757   -22.462 1.00 45.36  ? 115  TYR A CE1   1 
ATOM   851  C  CE2   . TYR A 1 116 ? 37.270 1.114   -24.399 1.00 50.07  ? 115  TYR A CE2   1 
ATOM   852  C  CZ    . TYR A 1 116 ? 37.762 2.094   -23.568 1.00 48.89  ? 115  TYR A CZ    1 
ATOM   853  O  OH    . TYR A 1 116 ? 37.501 3.415   -23.854 1.00 48.78  ? 115  TYR A OH    1 
ATOM   854  N  N     . PHE A 1 117 ? 39.502 -4.732  -21.474 1.00 47.61  ? 116  PHE A N     1 
ATOM   855  C  CA    . PHE A 1 117 ? 39.191 -6.147  -21.319 1.00 51.49  ? 116  PHE A CA    1 
ATOM   856  C  C     . PHE A 1 117 ? 39.420 -6.659  -19.906 1.00 51.87  ? 116  PHE A C     1 
ATOM   857  O  O     . PHE A 1 117 ? 39.288 -7.872  -19.681 1.00 48.22  ? 116  PHE A O     1 
ATOM   858  C  CB    . PHE A 1 117 ? 40.006 -6.963  -22.323 1.00 54.97  ? 116  PHE A CB    1 
ATOM   859  C  CG    . PHE A 1 117 ? 39.740 -6.599  -23.759 1.00 56.05  ? 116  PHE A CG    1 
ATOM   860  C  CD1   . PHE A 1 117 ? 38.556 -5.976  -24.124 1.00 56.71  ? 116  PHE A CD1   1 
ATOM   861  C  CD2   . PHE A 1 117 ? 40.673 -6.880  -24.744 1.00 58.08  ? 116  PHE A CD2   1 
ATOM   862  C  CE1   . PHE A 1 117 ? 38.309 -5.637  -25.440 1.00 58.08  ? 116  PHE A CE1   1 
ATOM   863  C  CE2   . PHE A 1 117 ? 40.431 -6.547  -26.063 1.00 60.61  ? 116  PHE A CE2   1 
ATOM   864  C  CZ    . PHE A 1 117 ? 39.247 -5.924  -26.412 1.00 60.27  ? 116  PHE A CZ    1 
ATOM   865  N  N     . SER A 1 118 ? 39.754 -5.779  -18.961 1.00 45.67  ? 117  SER A N     1 
ATOM   866  C  CA    . SER A 1 118 ? 39.890 -6.151  -17.562 1.00 47.29  ? 117  SER A CA    1 
ATOM   867  C  C     . SER A 1 118 ? 38.745 -5.650  -16.694 1.00 49.42  ? 117  SER A C     1 
ATOM   868  O  O     . SER A 1 118 ? 38.636 -6.075  -15.539 1.00 52.14  ? 117  SER A O     1 
ATOM   869  C  CB    . SER A 1 118 ? 41.220 -5.629  -16.999 1.00 47.91  ? 117  SER A CB    1 
ATOM   870  O  OG    . SER A 1 118 ? 42.316 -6.164  -17.719 1.00 51.70  ? 117  SER A OG    1 
ATOM   871  N  N     . VAL A 1 119 ? 37.893 -4.777  -17.215 1.00 43.51  ? 118  VAL A N     1 
ATOM   872  C  CA    . VAL A 1 119 ? 36.782 -4.198  -16.465 1.00 47.00  ? 118  VAL A CA    1 
ATOM   873  C  C     . VAL A 1 119 ? 35.508 -4.935  -16.864 1.00 52.00  ? 118  VAL A C     1 
ATOM   874  O  O     . VAL A 1 119 ? 35.174 -4.966  -18.058 1.00 54.64  ? 118  VAL A O     1 
ATOM   875  C  CB    . VAL A 1 119 ? 36.655 -2.690  -16.725 1.00 45.01  ? 118  VAL A CB    1 
ATOM   876  C  CG1   . VAL A 1 119 ? 35.421 -2.130  -16.037 1.00 44.46  ? 118  VAL A CG1   1 
ATOM   877  C  CG2   . VAL A 1 119 ? 37.904 -1.976  -16.243 1.00 40.23  ? 118  VAL A CG2   1 
ATOM   878  N  N     . PRO A 1 120 ? 34.775 -5.522  -15.921 1.00 52.93  ? 119  PRO A N     1 
ATOM   879  C  CA    . PRO A 1 120 ? 33.617 -6.341  -16.290 1.00 51.61  ? 119  PRO A CA    1 
ATOM   880  C  C     . PRO A 1 120 ? 32.451 -5.493  -16.773 1.00 52.60  ? 119  PRO A C     1 
ATOM   881  O  O     . PRO A 1 120 ? 32.312 -4.318  -16.423 1.00 51.19  ? 119  PRO A O     1 
ATOM   882  C  CB    . PRO A 1 120 ? 33.269 -7.070  -14.987 1.00 51.84  ? 119  PRO A CB    1 
ATOM   883  C  CG    . PRO A 1 120 ? 33.753 -6.149  -13.913 1.00 52.53  ? 119  PRO A CG    1 
ATOM   884  C  CD    . PRO A 1 120 ? 34.984 -5.472  -14.463 1.00 51.11  ? 119  PRO A CD    1 
ATOM   885  N  N     . LEU A 1 121 ? 31.607 -6.116  -17.587 1.00 54.24  ? 120  LEU A N     1 
ATOM   886  C  CA    . LEU A 1 121 ? 30.426 -5.483  -18.150 1.00 54.91  ? 120  LEU A CA    1 
ATOM   887  C  C     . LEU A 1 121 ? 29.180 -5.950  -17.408 1.00 56.80  ? 120  LEU A C     1 
ATOM   888  O  O     . LEU A 1 121 ? 29.141 -7.055  -16.861 1.00 60.84  ? 120  LEU A O     1 
ATOM   889  C  CB    . LEU A 1 121 ? 30.303 -5.806  -19.642 1.00 56.26  ? 120  LEU A CB    1 
ATOM   890  C  CG    . LEU A 1 121 ? 29.147 -5.186  -20.428 1.00 56.04  ? 120  LEU A CG    1 
ATOM   891  C  CD1   . LEU A 1 121 ? 29.281 -3.673  -20.471 1.00 47.51  ? 120  LEU A CD1   1 
ATOM   892  C  CD2   . LEU A 1 121 ? 29.081 -5.768  -21.830 1.00 50.70  ? 120  LEU A CD2   1 
ATOM   893  N  N     . ASP A 1 122 ? 28.168 -5.084  -17.378 1.00 55.14  ? 121  ASP A N     1 
ATOM   894  C  CA    . ASP A 1 122 ? 26.892 -5.431  -16.766 1.00 59.18  ? 121  ASP A CA    1 
ATOM   895  C  C     . ASP A 1 122 ? 26.338 -6.701  -17.398 1.00 65.51  ? 121  ASP A C     1 
ATOM   896  O  O     . ASP A 1 122 ? 26.226 -6.800  -18.623 1.00 67.38  ? 121  ASP A O     1 
ATOM   897  C  CB    . ASP A 1 122 ? 25.901 -4.281  -16.933 1.00 59.82  ? 121  ASP A CB    1 
ATOM   898  C  CG    . ASP A 1 122 ? 24.668 -4.444  -16.072 1.00 63.86  ? 121  ASP A CG    1 
ATOM   899  O  OD1   . ASP A 1 122 ? 24.766 -5.089  -15.008 1.00 67.48  ? 121  ASP A OD1   1 
ATOM   900  O  OD2   . ASP A 1 122 ? 23.597 -3.934  -16.461 1.00 66.54  ? 121  ASP A OD2   1 
ATOM   901  N  N     . GLU A 1 123 ? 25.998 -7.679  -16.555 1.00 67.69  ? 122  GLU A N     1 
ATOM   902  C  CA    . GLU A 1 123 ? 25.566 -8.978  -17.064 1.00 74.95  ? 122  GLU A CA    1 
ATOM   903  C  C     . GLU A 1 123 ? 24.330 -8.845  -17.945 1.00 78.32  ? 122  GLU A C     1 
ATOM   904  O  O     . GLU A 1 123 ? 24.297 -9.367  -19.067 1.00 80.26  ? 122  GLU A O     1 
ATOM   905  C  CB    . GLU A 1 123 ? 25.311 -9.935  -15.900 1.00 78.33  ? 122  GLU A CB    1 
ATOM   906  C  CG    . GLU A 1 123 ? 26.520 -10.104 -14.994 1.00 80.43  ? 122  GLU A CG    1 
ATOM   907  C  CD    . GLU A 1 123 ? 26.465 -11.366 -14.159 1.00 85.59  ? 122  GLU A CD    1 
ATOM   908  O  OE1   . GLU A 1 123 ? 25.361 -11.927 -13.996 1.00 89.26  ? 122  GLU A OE1   1 
ATOM   909  O  OE2   . GLU A 1 123 ? 27.532 -11.798 -13.672 1.00 86.61  ? 122  GLU A OE2   1 
ATOM   910  N  N     . ASP A 1 124 ? 23.311 -8.125  -17.462 1.00 79.61  ? 123  ASP A N     1 
ATOM   911  C  CA    . ASP A 1 124 ? 22.075 -7.956  -18.225 1.00 81.87  ? 123  ASP A CA    1 
ATOM   912  C  C     . ASP A 1 124 ? 22.330 -7.388  -19.614 1.00 77.05  ? 123  ASP A C     1 
ATOM   913  O  O     . ASP A 1 124 ? 21.572 -7.669  -20.549 1.00 82.70  ? 123  ASP A O     1 
ATOM   914  C  CB    . ASP A 1 124 ? 21.108 -7.042  -17.470 1.00 90.11  ? 123  ASP A CB    1 
ATOM   915  C  CG    . ASP A 1 124 ? 20.689 -7.607  -16.130 1.00 99.51  ? 123  ASP A CG    1 
ATOM   916  O  OD1   . ASP A 1 124 ? 21.224 -8.664  -15.731 1.00 103.15 ? 123  ASP A OD1   1 
ATOM   917  O  OD2   . ASP A 1 124 ? 19.822 -6.990  -15.477 1.00 102.35 ? 123  ASP A OD2   1 
ATOM   918  N  N     . PHE A 1 125 ? 23.386 -6.593  -19.769 1.00 69.29  ? 124  PHE A N     1 
ATOM   919  C  CA    . PHE A 1 125 ? 23.699 -5.953  -21.038 1.00 63.92  ? 124  PHE A CA    1 
ATOM   920  C  C     . PHE A 1 125 ? 24.504 -6.842  -21.978 1.00 63.48  ? 124  PHE A C     1 
ATOM   921  O  O     . PHE A 1 125 ? 24.503 -6.595  -23.191 1.00 63.93  ? 124  PHE A O     1 
ATOM   922  C  CB    . PHE A 1 125 ? 24.474 -4.656  -20.781 1.00 58.33  ? 124  PHE A CB    1 
ATOM   923  C  CG    . PHE A 1 125 ? 24.215 -3.579  -21.792 1.00 58.26  ? 124  PHE A CG    1 
ATOM   924  C  CD1   . PHE A 1 125 ? 23.007 -2.904  -21.803 1.00 59.00  ? 124  PHE A CD1   1 
ATOM   925  C  CD2   . PHE A 1 125 ? 25.182 -3.227  -22.721 1.00 58.18  ? 124  PHE A CD2   1 
ATOM   926  C  CE1   . PHE A 1 125 ? 22.761 -1.905  -22.726 1.00 58.00  ? 124  PHE A CE1   1 
ATOM   927  C  CE2   . PHE A 1 125 ? 24.943 -2.226  -23.649 1.00 56.06  ? 124  PHE A CE2   1 
ATOM   928  C  CZ    . PHE A 1 125 ? 23.730 -1.565  -23.651 1.00 55.64  ? 124  PHE A CZ    1 
ATOM   929  N  N     . ARG A 1 126 ? 25.170 -7.876  -21.452 1.00 56.05  ? 125  ARG A N     1 
ATOM   930  C  CA    . ARG A 1 126 ? 26.108 -8.644  -22.267 1.00 61.84  ? 125  ARG A CA    1 
ATOM   931  C  C     . ARG A 1 126 ? 25.442 -9.205  -23.519 1.00 66.96  ? 125  ARG A C     1 
ATOM   932  O  O     . ARG A 1 126 ? 26.069 -9.267  -24.586 1.00 69.51  ? 125  ARG A O     1 
ATOM   933  C  CB    . ARG A 1 126 ? 26.730 -9.763  -21.429 1.00 61.37  ? 125  ARG A CB    1 
ATOM   934  C  CG    . ARG A 1 126 ? 27.492 -9.246  -20.218 1.00 60.28  ? 125  ARG A CG    1 
ATOM   935  C  CD    . ARG A 1 126 ? 28.108 -10.361 -19.393 1.00 58.62  ? 125  ARG A CD    1 
ATOM   936  N  NE    . ARG A 1 126 ? 28.787 -9.832  -18.214 1.00 54.67  ? 125  ARG A NE    1 
ATOM   937  C  CZ    . ARG A 1 126 ? 29.465 -10.570 -17.341 1.00 61.62  ? 125  ARG A CZ    1 
ATOM   938  N  NH1   . ARG A 1 126 ? 29.563 -11.881 -17.509 1.00 63.70  ? 125  ARG A NH1   1 
ATOM   939  N  NH2   . ARG A 1 126 ? 30.049 -9.995  -16.299 1.00 60.85  ? 125  ARG A NH2   1 
ATOM   940  N  N     . LYS A 1 127 ? 24.167 -9.595  -23.413 1.00 70.16  ? 126  LYS A N     1 
ATOM   941  C  CA    . LYS A 1 127 ? 23.385 -10.091 -24.543 1.00 71.23  ? 126  LYS A CA    1 
ATOM   942  C  C     . LYS A 1 127 ? 23.592 -9.265  -25.805 1.00 69.69  ? 126  LYS A C     1 
ATOM   943  O  O     . LYS A 1 127 ? 23.735 -9.817  -26.901 1.00 69.87  ? 126  LYS A O     1 
ATOM   944  C  CB    . LYS A 1 127 ? 21.890 -10.092 -24.207 1.00 75.93  ? 126  LYS A CB    1 
ATOM   945  C  CG    . LYS A 1 127 ? 21.424 -11.184 -23.268 1.00 78.33  ? 126  LYS A CG    1 
ATOM   946  C  CD    . LYS A 1 127 ? 19.900 -11.231 -23.227 1.00 81.47  ? 126  LYS A CD    1 
ATOM   947  C  CE    . LYS A 1 127 ? 19.311 -9.893  -22.806 1.00 81.57  ? 126  LYS A CE    1 
ATOM   948  N  NZ    . LYS A 1 127 ? 19.707 -9.517  -21.421 1.00 79.42  ? 126  LYS A NZ    1 
ATOM   949  N  N     . TYR A 1 128 ? 23.613 -7.942  -25.657 1.00 66.60  ? 127  TYR A N     1 
ATOM   950  C  CA    . TYR A 1 128 ? 23.586 -7.064  -26.819 1.00 67.86  ? 127  TYR A CA    1 
ATOM   951  C  C     . TYR A 1 128 ? 24.940 -6.924  -27.498 1.00 64.19  ? 127  TYR A C     1 
ATOM   952  O  O     . TYR A 1 128 ? 25.003 -6.351  -28.591 1.00 65.29  ? 127  TYR A O     1 
ATOM   953  C  CB    . TYR A 1 128 ? 23.057 -5.690  -26.409 1.00 67.89  ? 127  TYR A CB    1 
ATOM   954  C  CG    . TYR A 1 128 ? 21.756 -5.777  -25.646 1.00 70.28  ? 127  TYR A CG    1 
ATOM   955  C  CD1   . TYR A 1 128 ? 20.723 -6.592  -26.093 1.00 72.50  ? 127  TYR A CD1   1 
ATOM   956  C  CD2   . TYR A 1 128 ? 21.570 -5.070  -24.465 1.00 69.93  ? 127  TYR A CD2   1 
ATOM   957  C  CE1   . TYR A 1 128 ? 19.536 -6.687  -25.397 1.00 73.90  ? 127  TYR A CE1   1 
ATOM   958  C  CE2   . TYR A 1 128 ? 20.384 -5.160  -23.760 1.00 72.37  ? 127  TYR A CE2   1 
ATOM   959  C  CZ    . TYR A 1 128 ? 19.371 -5.969  -24.231 1.00 77.22  ? 127  TYR A CZ    1 
ATOM   960  O  OH    . TYR A 1 128 ? 18.189 -6.063  -23.534 1.00 81.35  ? 127  TYR A OH    1 
ATOM   961  N  N     . THR A 1 129 ? 26.014 -7.435  -26.895 1.00 61.66  ? 128  THR A N     1 
ATOM   962  C  CA    . THR A 1 129 ? 27.346 -7.316  -27.471 1.00 64.54  ? 128  THR A CA    1 
ATOM   963  C  C     . THR A 1 129 ? 27.710 -8.500  -28.361 1.00 65.03  ? 128  THR A C     1 
ATOM   964  O  O     . THR A 1 129 ? 28.899 -8.769  -28.564 1.00 65.82  ? 128  THR A O     1 
ATOM   965  C  CB    . THR A 1 129 ? 28.387 -7.149  -26.361 1.00 57.39  ? 128  THR A CB    1 
ATOM   966  O  OG1   . THR A 1 129 ? 28.388 -8.314  -25.528 1.00 66.74  ? 128  THR A OG1   1 
ATOM   967  C  CG2   . THR A 1 129 ? 28.060 -5.927  -25.512 1.00 57.58  ? 128  THR A CG2   1 
ATOM   968  N  N     . ALA A 1 130 ? 26.714 -9.199  -28.901 1.00 64.79  ? 129  ALA A N     1 
ATOM   969  C  CA    . ALA A 1 130 ? 26.964 -10.409 -29.671 1.00 63.78  ? 129  ALA A CA    1 
ATOM   970  C  C     . ALA A 1 130 ? 27.676 -10.095 -30.981 1.00 70.56  ? 129  ALA A C     1 
ATOM   971  O  O     . ALA A 1 130 ? 27.353 -9.122  -31.667 1.00 71.86  ? 129  ALA A O     1 
ATOM   972  C  CB    . ALA A 1 130 ? 25.650 -11.135 -29.954 1.00 67.11  ? 129  ALA A CB    1 
ATOM   973  N  N     . PHE A 1 131 ? 28.651 -10.934 -31.325 1.00 69.66  ? 130  PHE A N     1 
ATOM   974  C  CA    . PHE A 1 131 ? 29.350 -10.829 -32.597 1.00 70.26  ? 130  PHE A CA    1 
ATOM   975  C  C     . PHE A 1 131 ? 29.724 -12.230 -33.066 1.00 71.91  ? 130  PHE A C     1 
ATOM   976  O  O     . PHE A 1 131 ? 29.583 -13.210 -32.331 1.00 72.46  ? 130  PHE A O     1 
ATOM   977  C  CB    . PHE A 1 131 ? 30.585 -9.930  -32.485 1.00 65.38  ? 130  PHE A CB    1 
ATOM   978  C  CG    . PHE A 1 131 ? 31.676 -10.497 -31.620 1.00 62.62  ? 130  PHE A CG    1 
ATOM   979  C  CD1   . PHE A 1 131 ? 31.652 -10.322 -30.247 1.00 57.12  ? 130  PHE A CD1   1 
ATOM   980  C  CD2   . PHE A 1 131 ? 32.732 -11.195 -32.182 1.00 61.53  ? 130  PHE A CD2   1 
ATOM   981  C  CE1   . PHE A 1 131 ? 32.656 -10.838 -29.451 1.00 55.26  ? 130  PHE A CE1   1 
ATOM   982  C  CE2   . PHE A 1 131 ? 33.740 -11.714 -31.391 1.00 58.92  ? 130  PHE A CE2   1 
ATOM   983  C  CZ    . PHE A 1 131 ? 33.703 -11.532 -30.024 1.00 55.11  ? 130  PHE A CZ    1 
ATOM   984  N  N     . THR A 1 132 ? 30.201 -12.315 -34.308 1.00 74.13  ? 131  THR A N     1 
ATOM   985  C  CA    . THR A 1 132 ? 30.599 -13.581 -34.916 1.00 76.04  ? 131  THR A CA    1 
ATOM   986  C  C     . THR A 1 132 ? 31.957 -13.424 -35.581 1.00 75.76  ? 131  THR A C     1 
ATOM   987  O  O     . THR A 1 132 ? 32.148 -12.522 -36.403 1.00 75.49  ? 131  THR A O     1 
ATOM   988  C  CB    . THR A 1 132 ? 29.580 -14.058 -35.960 1.00 80.64  ? 131  THR A CB    1 
ATOM   989  O  OG1   . THR A 1 132 ? 29.513 -13.112 -37.034 1.00 83.13  ? 131  THR A OG1   1 
ATOM   990  C  CG2   . THR A 1 132 ? 28.206 -14.207 -35.348 1.00 82.70  ? 131  THR A CG2   1 
ATOM   991  N  N     . ILE A 1 133 ? 32.890 -14.304 -35.235 1.00 77.16  ? 132  ILE A N     1 
ATOM   992  C  CA    . ILE A 1 133 ? 34.185 -14.380 -35.905 1.00 79.88  ? 132  ILE A CA    1 
ATOM   993  C  C     . ILE A 1 133 ? 34.073 -15.421 -37.017 1.00 83.62  ? 132  ILE A C     1 
ATOM   994  O  O     . ILE A 1 133 ? 33.772 -16.588 -36.723 1.00 84.44  ? 132  ILE A O     1 
ATOM   995  C  CB    . ILE A 1 133 ? 35.308 -14.745 -34.928 1.00 79.74  ? 132  ILE A CB    1 
ATOM   996  C  CG1   . ILE A 1 133 ? 35.404 -13.710 -33.808 1.00 78.79  ? 132  ILE A CG1   1 
ATOM   997  C  CG2   . ILE A 1 133 ? 36.633 -14.829 -35.659 1.00 79.08  ? 132  ILE A CG2   1 
ATOM   998  C  CD1   . ILE A 1 133 ? 35.820 -12.333 -34.283 1.00 79.76  ? 132  ILE A CD1   1 
ATOM   999  N  N     . PRO A 1 134 ? 34.298 -15.050 -38.288 1.00 86.32  ? 133  PRO A N     1 
ATOM   1000 C  CA    . PRO A 1 134 ? 34.178 -15.956 -39.438 1.00 91.66  ? 133  PRO A CA    1 
ATOM   1001 C  C     . PRO A 1 134 ? 35.134 -17.144 -39.375 1.00 94.47  ? 133  PRO A C     1 
ATOM   1002 O  O     . PRO A 1 134 ? 35.080 -17.994 -40.266 1.00 100.24 ? 133  PRO A O     1 
ATOM   1003 C  CB    . PRO A 1 134 ? 34.519 -15.056 -40.631 1.00 92.00  ? 133  PRO A CB    1 
ATOM   1004 C  CG    . PRO A 1 134 ? 34.251 -13.671 -40.155 1.00 89.56  ? 133  PRO A CG    1 
ATOM   1005 C  CD    . PRO A 1 134 ? 34.621 -13.675 -38.704 1.00 85.07  ? 133  PRO A CD    1 
ATOM   1006 N  N     . ILE A 1 143 ? 32.138 -18.924 -35.301 1.00 87.44  ? 142  ILE A N     1 
ATOM   1007 C  CA    . ILE A 1 143 ? 31.968 -18.909 -33.853 1.00 85.51  ? 142  ILE A CA    1 
ATOM   1008 C  C     . ILE A 1 143 ? 31.381 -17.574 -33.405 1.00 81.55  ? 142  ILE A C     1 
ATOM   1009 O  O     . ILE A 1 143 ? 31.897 -16.514 -33.758 1.00 80.29  ? 142  ILE A O     1 
ATOM   1010 C  CB    . ILE A 1 143 ? 33.300 -19.183 -33.131 1.00 82.91  ? 142  ILE A CB    1 
ATOM   1011 C  CG1   . ILE A 1 143 ? 34.032 -20.356 -33.784 1.00 86.10  ? 142  ILE A CG1   1 
ATOM   1012 C  CG2   . ILE A 1 143 ? 33.057 -19.470 -31.657 1.00 80.79  ? 142  ILE A CG2   1 
ATOM   1013 C  CD1   . ILE A 1 143 ? 35.365 -20.676 -33.141 1.00 84.29  ? 142  ILE A CD1   1 
ATOM   1014 N  N     . ARG A 1 144 ? 30.299 -17.628 -32.633 1.00 83.58  ? 143  ARG A N     1 
ATOM   1015 C  CA    . ARG A 1 144 ? 29.672 -16.433 -32.087 1.00 81.63  ? 143  ARG A CA    1 
ATOM   1016 C  C     . ARG A 1 144 ? 30.062 -16.266 -30.624 1.00 80.66  ? 143  ARG A C     1 
ATOM   1017 O  O     . ARG A 1 144 ? 30.205 -17.249 -29.891 1.00 82.09  ? 143  ARG A O     1 
ATOM   1018 C  CB    . ARG A 1 144 ? 28.147 -16.494 -32.212 1.00 81.96  ? 143  ARG A CB    1 
ATOM   1019 C  CG    . ARG A 1 144 ? 27.642 -17.362 -33.349 1.00 83.65  ? 143  ARG A CG    1 
ATOM   1020 C  CD    . ARG A 1 144 ? 26.350 -16.827 -33.960 1.00 85.53  ? 143  ARG A CD    1 
ATOM   1021 N  NE    . ARG A 1 144 ? 25.314 -16.509 -32.980 1.00 85.54  ? 143  ARG A NE    1 
ATOM   1022 C  CZ    . ARG A 1 144 ? 24.990 -15.274 -32.609 1.00 86.31  ? 143  ARG A CZ    1 
ATOM   1023 N  NH1   . ARG A 1 144 ? 24.028 -15.077 -31.718 1.00 86.79  ? 143  ARG A NH1   1 
ATOM   1024 N  NH2   . ARG A 1 144 ? 25.628 -14.233 -33.128 1.00 86.25  ? 143  ARG A NH2   1 
ATOM   1025 N  N     . TYR A 1 145 ? 30.231 -15.016 -30.204 1.00 78.65  ? 144  TYR A N     1 
ATOM   1026 C  CA    . TYR A 1 145 ? 30.606 -14.697 -28.837 1.00 76.95  ? 144  TYR A CA    1 
ATOM   1027 C  C     . TYR A 1 145 ? 29.741 -13.559 -28.313 1.00 76.56  ? 144  TYR A C     1 
ATOM   1028 O  O     . TYR A 1 145 ? 28.966 -12.940 -29.046 1.00 79.15  ? 144  TYR A O     1 
ATOM   1029 C  CB    . TYR A 1 145 ? 32.082 -14.289 -28.728 1.00 75.54  ? 144  TYR A CB    1 
ATOM   1030 C  CG    . TYR A 1 145 ? 33.098 -15.347 -29.095 1.00 76.06  ? 144  TYR A CG    1 
ATOM   1031 C  CD1   . TYR A 1 145 ? 33.566 -16.246 -28.145 1.00 75.19  ? 144  TYR A CD1   1 
ATOM   1032 C  CD2   . TYR A 1 145 ? 33.622 -15.421 -30.380 1.00 77.26  ? 144  TYR A CD2   1 
ATOM   1033 C  CE1   . TYR A 1 145 ? 34.509 -17.202 -28.469 1.00 76.20  ? 144  TYR A CE1   1 
ATOM   1034 C  CE2   . TYR A 1 145 ? 34.566 -16.373 -30.713 1.00 78.22  ? 144  TYR A CE2   1 
ATOM   1035 C  CZ    . TYR A 1 145 ? 35.006 -17.261 -29.753 1.00 78.69  ? 144  TYR A CZ    1 
ATOM   1036 O  OH    . TYR A 1 145 ? 35.944 -18.215 -30.077 1.00 81.35  ? 144  TYR A OH    1 
ATOM   1037 N  N     . GLN A 1 146 ? 29.891 -13.297 -27.017 1.00 74.01  ? 145  GLN A N     1 
ATOM   1038 C  CA    . GLN A 1 146 ? 29.381 -12.091 -26.383 1.00 71.68  ? 145  GLN A CA    1 
ATOM   1039 C  C     . GLN A 1 146 ? 30.435 -11.591 -25.406 1.00 67.76  ? 145  GLN A C     1 
ATOM   1040 O  O     . GLN A 1 146 ? 31.278 -12.354 -24.928 1.00 67.12  ? 145  GLN A O     1 
ATOM   1041 C  CB    . GLN A 1 146 ? 28.055 -12.329 -25.651 1.00 72.36  ? 145  GLN A CB    1 
ATOM   1042 C  CG    . GLN A 1 146 ? 28.214 -12.947 -24.271 1.00 70.22  ? 145  GLN A CG    1 
ATOM   1043 C  CD    . GLN A 1 146 ? 26.898 -13.074 -23.532 1.00 71.14  ? 145  GLN A CD    1 
ATOM   1044 O  OE1   . GLN A 1 146 ? 25.825 -12.940 -24.122 1.00 72.10  ? 145  GLN A OE1   1 
ATOM   1045 N  NE2   . GLN A 1 146 ? 26.974 -13.333 -22.231 1.00 70.05  ? 145  GLN A NE2   1 
ATOM   1046 N  N     . TYR A 1 147 ? 30.376 -10.295 -25.112 1.00 63.51  ? 146  TYR A N     1 
ATOM   1047 C  CA    . TYR A 1 147 ? 31.359 -9.652  -24.252 1.00 59.23  ? 146  TYR A CA    1 
ATOM   1048 C  C     . TYR A 1 147 ? 30.949 -9.766  -22.790 1.00 57.22  ? 146  TYR A C     1 
ATOM   1049 O  O     . TYR A 1 147 ? 29.803 -9.476  -22.433 1.00 58.62  ? 146  TYR A O     1 
ATOM   1050 C  CB    . TYR A 1 147 ? 31.527 -8.179  -24.633 1.00 60.22  ? 146  TYR A CB    1 
ATOM   1051 C  CG    . TYR A 1 147 ? 32.586 -7.933  -25.683 1.00 60.15  ? 146  TYR A CG    1 
ATOM   1052 C  CD1   . TYR A 1 147 ? 32.282 -8.008  -27.036 1.00 62.91  ? 146  TYR A CD1   1 
ATOM   1053 C  CD2   . TYR A 1 147 ? 33.891 -7.627  -25.321 1.00 57.84  ? 146  TYR A CD2   1 
ATOM   1054 C  CE1   . TYR A 1 147 ? 33.249 -7.785  -28.001 1.00 62.97  ? 146  TYR A CE1   1 
ATOM   1055 C  CE2   . TYR A 1 147 ? 34.867 -7.404  -26.279 1.00 59.21  ? 146  TYR A CE2   1 
ATOM   1056 C  CZ    . TYR A 1 147 ? 34.539 -7.485  -27.618 1.00 60.98  ? 146  TYR A CZ    1 
ATOM   1057 O  OH    . TYR A 1 147 ? 35.501 -7.265  -28.579 1.00 60.41  ? 146  TYR A OH    1 
ATOM   1058 N  N     . ASN A 1 148 ? 31.888 -10.202 -21.951 1.00 53.90  ? 147  ASN A N     1 
ATOM   1059 C  CA    . ASN A 1 148 ? 31.755 -10.098 -20.506 1.00 51.87  ? 147  ASN A CA    1 
ATOM   1060 C  C     . ASN A 1 148 ? 32.502 -8.898  -19.952 1.00 55.21  ? 147  ASN A C     1 
ATOM   1061 O  O     . ASN A 1 148 ? 32.410 -8.624  -18.751 1.00 58.86  ? 147  ASN A O     1 
ATOM   1062 C  CB    . ASN A 1 148 ? 32.271 -11.371 -19.824 1.00 50.48  ? 147  ASN A CB    1 
ATOM   1063 C  CG    . ASN A 1 148 ? 31.657 -12.632 -20.400 1.00 52.91  ? 147  ASN A CG    1 
ATOM   1064 O  OD1   . ASN A 1 148 ? 30.587 -12.595 -21.006 1.00 53.78  ? 147  ASN A OD1   1 
ATOM   1065 N  ND2   . ASN A 1 148 ? 32.334 -13.759 -20.212 1.00 51.84  ? 147  ASN A ND2   1 
ATOM   1066 N  N     . VAL A 1 149 ? 33.242 -8.190  -20.802 1.00 51.79  ? 148  VAL A N     1 
ATOM   1067 C  CA    . VAL A 1 149 ? 34.049 -7.048  -20.425 1.00 48.70  ? 148  VAL A CA    1 
ATOM   1068 C  C     . VAL A 1 149 ? 33.705 -5.893  -21.361 1.00 50.08  ? 148  VAL A C     1 
ATOM   1069 O  O     . VAL A 1 149 ? 32.867 -6.024  -22.252 1.00 55.09  ? 148  VAL A O     1 
ATOM   1070 C  CB    . VAL A 1 149 ? 35.557 -7.370  -20.465 1.00 47.10  ? 148  VAL A CB    1 
ATOM   1071 C  CG1   . VAL A 1 149 ? 35.889 -8.457  -19.454 1.00 46.43  ? 148  VAL A CG1   1 
ATOM   1072 C  CG2   . VAL A 1 149 ? 35.965 -7.800  -21.862 1.00 45.07  ? 148  VAL A CG2   1 
ATOM   1073 N  N     . LEU A 1 150 ? 34.359 -4.759  -21.149 1.00 45.64  ? 149  LEU A N     1 
ATOM   1074 C  CA    . LEU A 1 150 ? 34.097 -3.574  -21.965 1.00 46.45  ? 149  LEU A CA    1 
ATOM   1075 C  C     . LEU A 1 150 ? 34.643 -3.762  -23.376 1.00 47.54  ? 149  LEU A C     1 
ATOM   1076 O  O     . LEU A 1 150 ? 35.843 -4.019  -23.537 1.00 48.99  ? 149  LEU A O     1 
ATOM   1077 C  CB    . LEU A 1 150 ? 34.719 -2.335  -21.324 1.00 44.21  ? 149  LEU A CB    1 
ATOM   1078 C  CG    . LEU A 1 150 ? 34.197 -1.937  -19.944 1.00 39.75  ? 149  LEU A CG    1 
ATOM   1079 C  CD1   . LEU A 1 150 ? 34.930 -0.706  -19.428 1.00 44.50  ? 149  LEU A CD1   1 
ATOM   1080 C  CD2   . LEU A 1 150 ? 32.698 -1.695  -19.993 1.00 41.05  ? 149  LEU A CD2   1 
ATOM   1081 N  N     . PRO A 1 151 ? 33.817 -3.654  -24.411 1.00 49.32  ? 150  PRO A N     1 
ATOM   1082 C  CA    . PRO A 1 151 ? 34.319 -3.725  -25.784 1.00 50.83  ? 150  PRO A CA    1 
ATOM   1083 C  C     . PRO A 1 151 ? 34.755 -2.360  -26.302 1.00 47.78  ? 150  PRO A C     1 
ATOM   1084 O  O     . PRO A 1 151 ? 34.394 -1.311  -25.765 1.00 45.05  ? 150  PRO A O     1 
ATOM   1085 C  CB    . PRO A 1 151 ? 33.102 -4.239  -26.563 1.00 55.11  ? 150  PRO A CB    1 
ATOM   1086 C  CG    . PRO A 1 151 ? 31.942 -3.656  -25.823 1.00 55.99  ? 150  PRO A CG    1 
ATOM   1087 C  CD    . PRO A 1 151 ? 32.345 -3.599  -24.362 1.00 52.09  ? 150  PRO A CD    1 
ATOM   1088 N  N     . GLN A 1 152 ? 35.542 -2.394  -27.375 1.00 49.24  ? 151  GLN A N     1 
ATOM   1089 C  CA    . GLN A 1 152 ? 36.066 -1.187  -28.006 1.00 52.50  ? 151  GLN A CA    1 
ATOM   1090 C  C     . GLN A 1 152 ? 35.219 -0.877  -29.235 1.00 55.99  ? 151  GLN A C     1 
ATOM   1091 O  O     . GLN A 1 152 ? 35.232 -1.627  -30.217 1.00 58.83  ? 151  GLN A O     1 
ATOM   1092 C  CB    . GLN A 1 152 ? 37.538 -1.360  -28.372 1.00 53.59  ? 151  GLN A CB    1 
ATOM   1093 C  CG    . GLN A 1 152 ? 38.400 -1.814  -27.205 1.00 54.74  ? 151  GLN A CG    1 
ATOM   1094 C  CD    . GLN A 1 152 ? 39.877 -1.584  -27.444 1.00 58.07  ? 151  GLN A CD    1 
ATOM   1095 O  OE1   . GLN A 1 152 ? 40.263 -0.695  -28.199 1.00 57.26  ? 151  GLN A OE1   1 
ATOM   1096 N  NE2   . GLN A 1 152 ? 40.712 -2.387  -26.797 1.00 62.93  ? 151  GLN A NE2   1 
ATOM   1097 N  N     . GLY A 1 153 ? 34.486 0.231   -29.178 1.00 53.52  ? 152  GLY A N     1 
ATOM   1098 C  CA    . GLY A 1 153 ? 33.534 0.574   -30.215 1.00 54.86  ? 152  GLY A CA    1 
ATOM   1099 C  C     . GLY A 1 153 ? 32.196 0.949   -29.614 1.00 55.44  ? 152  GLY A C     1 
ATOM   1100 O  O     . GLY A 1 153 ? 31.366 1.598   -30.258 1.00 57.66  ? 152  GLY A O     1 
ATOM   1101 N  N     . TRP A 1 154 ? 31.984 0.533   -28.368 1.00 53.21  ? 153  TRP A N     1 
ATOM   1102 C  CA    . TRP A 1 154 ? 30.800 0.918   -27.616 1.00 51.47  ? 153  TRP A CA    1 
ATOM   1103 C  C     . TRP A 1 154 ? 30.988 2.315   -27.041 1.00 47.45  ? 153  TRP A C     1 
ATOM   1104 O  O     . TRP A 1 154 ? 32.090 2.683   -26.621 1.00 45.75  ? 153  TRP A O     1 
ATOM   1105 C  CB    . TRP A 1 154 ? 30.541 -0.085  -26.492 1.00 51.96  ? 153  TRP A CB    1 
ATOM   1106 C  CG    . TRP A 1 154 ? 29.249 0.119   -25.764 1.00 53.25  ? 153  TRP A CG    1 
ATOM   1107 C  CD1   . TRP A 1 154 ? 28.035 0.422   -26.310 1.00 53.20  ? 153  TRP A CD1   1 
ATOM   1108 C  CD2   . TRP A 1 154 ? 29.043 0.036   -24.348 1.00 53.59  ? 153  TRP A CD2   1 
ATOM   1109 N  NE1   . TRP A 1 154 ? 27.085 0.528   -25.322 1.00 54.32  ? 153  TRP A NE1   1 
ATOM   1110 C  CE2   . TRP A 1 154 ? 27.679 0.297   -24.108 1.00 54.09  ? 153  TRP A CE2   1 
ATOM   1111 C  CE3   . TRP A 1 154 ? 29.880 -0.234  -23.260 1.00 53.02  ? 153  TRP A CE3   1 
ATOM   1112 C  CZ2   . TRP A 1 154 ? 27.133 0.295   -22.825 1.00 54.22  ? 153  TRP A CZ2   1 
ATOM   1113 C  CZ3   . TRP A 1 154 ? 29.336 -0.236  -21.987 1.00 52.44  ? 153  TRP A CZ3   1 
ATOM   1114 C  CH2   . TRP A 1 154 ? 27.975 0.026   -21.781 1.00 53.86  ? 153  TRP A CH2   1 
ATOM   1115 N  N     . LYS A 1 155 ? 29.905 3.096   -27.021 1.00 47.16  ? 154  LYS A N     1 
ATOM   1116 C  CA    . LYS A 1 155 ? 29.998 4.485   -26.584 1.00 49.17  ? 154  LYS A CA    1 
ATOM   1117 C  C     . LYS A 1 155 ? 30.095 4.626   -25.071 1.00 48.28  ? 154  LYS A C     1 
ATOM   1118 O  O     . LYS A 1 155 ? 30.608 5.641   -24.591 1.00 47.24  ? 154  LYS A O     1 
ATOM   1119 C  CB    . LYS A 1 155 ? 28.798 5.285   -27.099 1.00 50.12  ? 154  LYS A CB    1 
ATOM   1120 C  CG    . LYS A 1 155 ? 27.577 5.243   -26.198 1.00 48.10  ? 154  LYS A CG    1 
ATOM   1121 C  CD    . LYS A 1 155 ? 26.424 6.021   -26.803 1.00 49.94  ? 154  LYS A CD    1 
ATOM   1122 C  CE    . LYS A 1 155 ? 25.239 6.070   -25.859 1.00 54.61  ? 154  LYS A CE    1 
ATOM   1123 N  NZ    . LYS A 1 155 ? 24.001 6.535   -26.544 1.00 56.83  ? 154  LYS A NZ    1 
ATOM   1124 N  N     . GLY A 1 156 ? 29.625 3.640   -24.311 1.00 51.42  ? 155  GLY A N     1 
ATOM   1125 C  CA    . GLY A 1 156 ? 29.714 3.706   -22.868 1.00 46.56  ? 155  GLY A CA    1 
ATOM   1126 C  C     . GLY A 1 156 ? 31.016 3.226   -22.273 1.00 44.62  ? 155  GLY A C     1 
ATOM   1127 O  O     . GLY A 1 156 ? 31.191 3.293   -21.055 1.00 45.32  ? 155  GLY A O     1 
ATOM   1128 N  N     . SER A 1 157 ? 31.950 2.754   -23.103 1.00 45.55  ? 156  SER A N     1 
ATOM   1129 C  CA    . SER A 1 157 ? 33.183 2.180   -22.565 1.00 44.92  ? 156  SER A CA    1 
ATOM   1130 C  C     . SER A 1 157 ? 34.136 3.234   -22.014 1.00 43.15  ? 156  SER A C     1 
ATOM   1131 O  O     . SER A 1 157 ? 34.685 3.019   -20.918 1.00 44.14  ? 156  SER A O     1 
ATOM   1132 C  CB    . SER A 1 157 ? 33.858 1.311   -23.630 1.00 45.67  ? 156  SER A CB    1 
ATOM   1133 O  OG    . SER A 1 157 ? 33.113 0.130   -23.867 1.00 48.57  ? 156  SER A OG    1 
ATOM   1134 N  N     . PRO A 1 158 ? 34.410 4.352   -22.700 1.00 42.21  ? 157  PRO A N     1 
ATOM   1135 C  CA    . PRO A 1 158 ? 35.366 5.318   -22.126 1.00 41.64  ? 157  PRO A CA    1 
ATOM   1136 C  C     . PRO A 1 158 ? 34.969 5.818   -20.748 1.00 43.20  ? 157  PRO A C     1 
ATOM   1137 O  O     . PRO A 1 158 ? 35.794 5.796   -19.827 1.00 34.03  ? 157  PRO A O     1 
ATOM   1138 C  CB    . PRO A 1 158 ? 35.385 6.442   -23.171 1.00 41.88  ? 157  PRO A CB    1 
ATOM   1139 C  CG    . PRO A 1 158 ? 35.056 5.762   -24.445 1.00 37.93  ? 157  PRO A CG    1 
ATOM   1140 C  CD    . PRO A 1 158 ? 34.024 4.736   -24.072 1.00 44.12  ? 157  PRO A CD    1 
ATOM   1141 N  N     . ALA A 1 159 ? 33.720 6.255   -20.575 1.00 43.09  ? 158  ALA A N     1 
ATOM   1142 C  CA    . ALA A 1 159 ? 33.305 6.807   -19.289 1.00 40.51  ? 158  ALA A CA    1 
ATOM   1143 C  C     . ALA A 1 159 ? 33.294 5.741   -18.199 1.00 40.29  ? 158  ALA A C     1 
ATOM   1144 O  O     . ALA A 1 159 ? 33.727 5.998   -17.068 1.00 38.11  ? 158  ALA A O     1 
ATOM   1145 C  CB    . ALA A 1 159 ? 31.930 7.460   -19.418 1.00 36.58  ? 158  ALA A CB    1 
ATOM   1146 N  N     . ILE A 1 160 ? 32.794 4.543   -18.511 1.00 39.60  ? 159  ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 160 ? 32.771 3.479   -17.511 1.00 40.32  ? 159  ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 160 ? 34.189 3.118   -17.089 1.00 41.85  ? 159  ILE A C     1 
ATOM   1149 O  O     . ILE A 1 160 ? 34.471 2.950   -15.896 1.00 46.01  ? 159  ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 160 ? 32.001 2.254   -18.037 1.00 40.53  ? 159  ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 160 ? 30.503 2.555   -18.076 1.00 40.64  ? 159  ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 160 ? 32.274 1.036   -17.165 1.00 39.88  ? 159  ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 160 ? 29.664 1.417   -18.602 1.00 43.77  ? 159  ILE A CD1   1 
ATOM   1154 N  N     . PHE A 1 161 ? 35.113 3.026   -18.050 1.00 38.08  ? 160  PHE A N     1 
ATOM   1155 C  CA    . PHE A 1 161 ? 36.492 2.717   -17.687 1.00 37.48  ? 160  PHE A CA    1 
ATOM   1156 C  C     . PHE A 1 161 ? 37.113 3.834   -16.858 1.00 35.60  ? 160  PHE A C     1 
ATOM   1157 O  O     . PHE A 1 161 ? 37.822 3.565   -15.886 1.00 38.95  ? 160  PHE A O     1 
ATOM   1158 C  CB    . PHE A 1 161 ? 37.352 2.455   -18.923 1.00 38.50  ? 160  PHE A CB    1 
ATOM   1159 C  CG    . PHE A 1 161 ? 38.772 2.087   -18.584 1.00 38.80  ? 160  PHE A CG    1 
ATOM   1160 C  CD1   . PHE A 1 161 ? 39.119 0.768   -18.343 1.00 40.12  ? 160  PHE A CD1   1 
ATOM   1161 C  CD2   . PHE A 1 161 ? 39.753 3.063   -18.469 1.00 38.69  ? 160  PHE A CD2   1 
ATOM   1162 C  CE1   . PHE A 1 161 ? 40.420 0.425   -18.011 1.00 37.63  ? 160  PHE A CE1   1 
ATOM   1163 C  CE2   . PHE A 1 161 ? 41.054 2.725   -18.135 1.00 36.03  ? 160  PHE A CE2   1 
ATOM   1164 C  CZ    . PHE A 1 161 ? 41.387 1.405   -17.907 1.00 37.50  ? 160  PHE A CZ    1 
ATOM   1165 N  N     . GLN A 1 162 ? 36.880 5.091   -17.235 1.00 35.61  ? 161  GLN A N     1 
ATOM   1166 C  CA    . GLN A 1 162 ? 37.489 6.195   -16.498 1.00 34.47  ? 161  GLN A CA    1 
ATOM   1167 C  C     . GLN A 1 162 ? 36.964 6.262   -15.069 1.00 36.45  ? 161  GLN A C     1 
ATOM   1168 O  O     . GLN A 1 162 ? 37.743 6.433   -14.120 1.00 38.86  ? 161  GLN A O     1 
ATOM   1169 C  CB    . GLN A 1 162 ? 37.248 7.505   -17.244 1.00 31.73  ? 161  GLN A CB    1 
ATOM   1170 C  CG    . GLN A 1 162 ? 38.050 7.601   -18.537 1.00 32.36  ? 161  GLN A CG    1 
ATOM   1171 C  CD    . GLN A 1 162 ? 37.377 8.463   -19.584 1.00 35.76  ? 161  GLN A CD    1 
ATOM   1172 O  OE1   . GLN A 1 162 ? 36.305 9.020   -19.349 1.00 40.18  ? 161  GLN A OE1   1 
ATOM   1173 N  NE2   . GLN A 1 162 ? 37.998 8.570   -20.751 1.00 34.44  ? 161  GLN A NE2   1 
ATOM   1174 N  N     . SER A 1 163 ? 35.654 6.086   -14.890 1.00 36.34  ? 162  SER A N     1 
ATOM   1175 C  CA    . SER A 1 163 ? 35.090 6.075   -13.545 1.00 35.60  ? 162  SER A CA    1 
ATOM   1176 C  C     . SER A 1 163 ? 35.605 4.890   -12.736 1.00 37.71  ? 162  SER A C     1 
ATOM   1177 O  O     . SER A 1 163 ? 35.942 5.041   -11.553 1.00 41.53  ? 162  SER A O     1 
ATOM   1178 C  CB    . SER A 1 163 ? 33.565 6.058   -13.620 1.00 39.14  ? 162  SER A CB    1 
ATOM   1179 O  OG    . SER A 1 163 ? 32.993 6.180   -12.331 1.00 45.01  ? 162  SER A OG    1 
ATOM   1180 N  N     . SER A 1 164 ? 35.672 3.703   -13.349 1.00 38.14  ? 163  SER A N     1 
ATOM   1181 C  CA    . SER A 1 164 ? 36.183 2.537   -12.636 1.00 38.74  ? 163  SER A CA    1 
ATOM   1182 C  C     . SER A 1 164 ? 37.642 2.730   -12.243 1.00 36.44  ? 163  SER A C     1 
ATOM   1183 O  O     . SER A 1 164 ? 38.049 2.360   -11.137 1.00 38.36  ? 163  SER A O     1 
ATOM   1184 C  CB    . SER A 1 164 ? 36.017 1.283   -13.495 1.00 39.64  ? 163  SER A CB    1 
ATOM   1185 O  OG    . SER A 1 164 ? 34.655 1.062   -13.821 1.00 38.05  ? 163  SER A OG    1 
ATOM   1186 N  N     . MET A 1 165 ? 38.440 3.318   -13.138 1.00 35.87  ? 164  MET A N     1 
ATOM   1187 C  CA    . MET A 1 165 ? 39.839 3.598   -12.836 1.00 37.09  ? 164  MET A CA    1 
ATOM   1188 C  C     . MET A 1 165 ? 39.962 4.563   -11.668 1.00 38.45  ? 164  MET A C     1 
ATOM   1189 O  O     . MET A 1 165 ? 40.825 4.390   -10.799 1.00 40.39  ? 164  MET A O     1 
ATOM   1190 C  CB    . MET A 1 165 ? 40.530 4.164   -14.078 1.00 38.88  ? 164  MET A CB    1 
ATOM   1191 C  CG    . MET A 1 165 ? 42.026 4.402   -13.935 1.00 42.88  ? 164  MET A CG    1 
ATOM   1192 S  SD    . MET A 1 165 ? 42.931 2.893   -13.541 1.00 49.34  ? 164  MET A SD    1 
ATOM   1193 C  CE    . MET A 1 165 ? 44.509 3.219   -14.315 1.00 44.73  ? 164  MET A CE    1 
ATOM   1194 N  N     . THR A 1 166 ? 39.106 5.587   -11.632 1.00 39.84  ? 165  THR A N     1 
ATOM   1195 C  CA    . THR A 1 166 ? 39.130 6.535   -10.522 1.00 34.44  ? 165  THR A CA    1 
ATOM   1196 C  C     . THR A 1 166 ? 38.785 5.846   -9.207  1.00 33.99  ? 165  THR A C     1 
ATOM   1197 O  O     . THR A 1 166 ? 39.448 6.062   -8.184  1.00 35.54  ? 165  THR A O     1 
ATOM   1198 C  CB    . THR A 1 166 ? 38.164 7.691   -10.797 1.00 32.01  ? 165  THR A CB    1 
ATOM   1199 O  OG1   . THR A 1 166 ? 38.580 8.392   -11.975 1.00 31.20  ? 165  THR A OG1   1 
ATOM   1200 C  CG2   . THR A 1 166 ? 38.141 8.657   -9.629  1.00 29.31  ? 165  THR A CG2   1 
ATOM   1201 N  N     . LYS A 1 167 ? 37.742 5.011   -9.214  1.00 34.54  ? 166  LYS A N     1 
ATOM   1202 C  CA    . LYS A 1 167 ? 37.388 4.276   -8.002  1.00 37.24  ? 166  LYS A CA    1 
ATOM   1203 C  C     . LYS A 1 167 ? 38.531 3.372   -7.553  1.00 37.34  ? 166  LYS A C     1 
ATOM   1204 O  O     . LYS A 1 167 ? 38.804 3.251   -6.353  1.00 38.15  ? 166  LYS A O     1 
ATOM   1205 C  CB    . LYS A 1 167 ? 36.117 3.456   -8.224  1.00 42.40  ? 166  LYS A CB    1 
ATOM   1206 C  CG    . LYS A 1 167 ? 34.865 4.289   -8.429  1.00 49.38  ? 166  LYS A CG    1 
ATOM   1207 C  CD    . LYS A 1 167 ? 33.616 3.420   -8.401  1.00 52.77  ? 166  LYS A CD    1 
ATOM   1208 C  CE    . LYS A 1 167 ? 32.402 4.175   -8.926  1.00 55.56  ? 166  LYS A CE    1 
ATOM   1209 N  NZ    . LYS A 1 167 ? 32.091 5.395   -8.127  1.00 55.53  ? 166  LYS A NZ    1 
ATOM   1210 N  N     . ILE A 1 168 ? 39.214 2.735   -8.504  1.00 36.91  ? 167  ILE A N     1 
ATOM   1211 C  CA    . ILE A 1 168 ? 40.320 1.849   -8.160  1.00 37.28  ? 167  ILE A CA    1 
ATOM   1212 C  C     . ILE A 1 168 ? 41.475 2.640   -7.554  1.00 38.04  ? 167  ILE A C     1 
ATOM   1213 O  O     . ILE A 1 168 ? 42.078 2.220   -6.559  1.00 36.71  ? 167  ILE A O     1 
ATOM   1214 C  CB    . ILE A 1 168 ? 40.759 1.050   -9.402  1.00 34.92  ? 167  ILE A CB    1 
ATOM   1215 C  CG1   . ILE A 1 168 ? 39.694 0.015   -9.769  1.00 35.02  ? 167  ILE A CG1   1 
ATOM   1216 C  CG2   . ILE A 1 168 ? 42.104 0.389   -9.174  1.00 34.86  ? 167  ILE A CG2   1 
ATOM   1217 C  CD1   . ILE A 1 168 ? 39.984 -0.743  -11.049 1.00 34.94  ? 167  ILE A CD1   1 
ATOM   1218 N  N     . LEU A 1 169 ? 41.798 3.797   -8.133  1.00 37.56  ? 168  LEU A N     1 
ATOM   1219 C  CA    . LEU A 1 169 ? 42.921 4.580   -7.628  1.00 37.48  ? 168  LEU A CA    1 
ATOM   1220 C  C     . LEU A 1 169 ? 42.596 5.315   -6.333  1.00 37.98  ? 168  LEU A C     1 
ATOM   1221 O  O     . LEU A 1 169 ? 43.523 5.737   -5.634  1.00 38.53  ? 168  LEU A O     1 
ATOM   1222 C  CB    . LEU A 1 169 ? 43.389 5.582   -8.685  1.00 36.80  ? 168  LEU A CB    1 
ATOM   1223 C  CG    . LEU A 1 169 ? 44.104 5.004   -9.909  1.00 37.04  ? 168  LEU A CG    1 
ATOM   1224 C  CD1   . LEU A 1 169 ? 44.409 6.107   -10.906 1.00 34.89  ? 168  LEU A CD1   1 
ATOM   1225 C  CD2   . LEU A 1 169 ? 45.380 4.278   -9.506  1.00 28.55  ? 168  LEU A CD2   1 
ATOM   1226 N  N     . GLU A 1 170 ? 41.312 5.475   -5.998  1.00 38.83  ? 169  GLU A N     1 
ATOM   1227 C  CA    . GLU A 1 170 ? 40.925 6.246   -4.814  1.00 42.34  ? 169  GLU A CA    1 
ATOM   1228 C  C     . GLU A 1 170 ? 41.604 5.796   -3.522  1.00 45.09  ? 169  GLU A C     1 
ATOM   1229 O  O     . GLU A 1 170 ? 42.124 6.663   -2.799  1.00 48.77  ? 169  GLU A O     1 
ATOM   1230 C  CB    . GLU A 1 170 ? 39.393 6.220   -4.683  1.00 47.75  ? 169  GLU A CB    1 
ATOM   1231 C  CG    . GLU A 1 170 ? 38.812 7.228   -3.700  1.00 56.05  ? 169  GLU A CG    1 
ATOM   1232 C  CD    . GLU A 1 170 ? 38.801 6.730   -2.265  1.00 67.82  ? 169  GLU A CD    1 
ATOM   1233 O  OE1   . GLU A 1 170 ? 38.677 7.569   -1.347  1.00 72.35  ? 169  GLU A OE1   1 
ATOM   1234 O  OE2   . GLU A 1 170 ? 38.912 5.504   -2.052  1.00 72.29  ? 169  GLU A OE2   1 
ATOM   1235 N  N     . PRO A 1 171 ? 41.632 4.505   -3.157  1.00 40.89  ? 170  PRO A N     1 
ATOM   1236 C  CA    . PRO A 1 171 ? 42.321 4.138   -1.904  1.00 45.18  ? 170  PRO A CA    1 
ATOM   1237 C  C     . PRO A 1 171 ? 43.805 4.463   -1.907  1.00 42.03  ? 170  PRO A C     1 
ATOM   1238 O  O     . PRO A 1 171 ? 44.346 4.890   -0.877  1.00 46.29  ? 170  PRO A O     1 
ATOM   1239 C  CB    . PRO A 1 171 ? 42.068 2.626   -1.795  1.00 32.38  ? 170  PRO A CB    1 
ATOM   1240 C  CG    . PRO A 1 171 ? 40.834 2.394   -2.575  1.00 33.95  ? 170  PRO A CG    1 
ATOM   1241 C  CD    . PRO A 1 171 ? 40.920 3.351   -3.733  1.00 38.73  ? 170  PRO A CD    1 
ATOM   1242 N  N     . PHE A 1 172 ? 44.483 4.273   -3.041  1.00 37.08  ? 171  PHE A N     1 
ATOM   1243 C  CA    . PHE A 1 172 ? 45.905 4.600   -3.113  1.00 36.62  ? 171  PHE A CA    1 
ATOM   1244 C  C     . PHE A 1 172 ? 46.134 6.103   -2.997  1.00 38.46  ? 171  PHE A C     1 
ATOM   1245 O  O     . PHE A 1 172 ? 47.098 6.540   -2.357  1.00 41.32  ? 171  PHE A O     1 
ATOM   1246 C  CB    . PHE A 1 172 ? 46.506 4.064   -4.413  1.00 34.13  ? 171  PHE A CB    1 
ATOM   1247 C  CG    . PHE A 1 172 ? 48.000 4.215   -4.498  1.00 35.14  ? 171  PHE A CG    1 
ATOM   1248 C  CD1   . PHE A 1 172 ? 48.569 5.370   -5.016  1.00 32.39  ? 171  PHE A CD1   1 
ATOM   1249 C  CD2   . PHE A 1 172 ? 48.837 3.200   -4.062  1.00 35.78  ? 171  PHE A CD2   1 
ATOM   1250 C  CE1   . PHE A 1 172 ? 49.942 5.509   -5.094  1.00 32.33  ? 171  PHE A CE1   1 
ATOM   1251 C  CE2   . PHE A 1 172 ? 50.213 3.334   -4.136  1.00 36.73  ? 171  PHE A CE2   1 
ATOM   1252 C  CZ    . PHE A 1 172 ? 50.766 4.491   -4.653  1.00 32.64  ? 171  PHE A CZ    1 
ATOM   1253 N  N     . ARG A 1 173 ? 45.266 6.909   -3.617  1.00 35.30  ? 172  ARG A N     1 
ATOM   1254 C  CA    . ARG A 1 173 ? 45.396 8.357   -3.496  1.00 35.48  ? 172  ARG A CA    1 
ATOM   1255 C  C     . ARG A 1 173 ? 45.137 8.812   -2.066  1.00 37.53  ? 172  ARG A C     1 
ATOM   1256 O  O     . ARG A 1 173 ? 45.817 9.715   -1.565  1.00 38.00  ? 172  ARG A O     1 
ATOM   1257 C  CB    . ARG A 1 173 ? 44.443 9.064   -4.462  1.00 32.40  ? 172  ARG A CB    1 
ATOM   1258 C  CG    . ARG A 1 173 ? 44.847 8.995   -5.926  1.00 28.18  ? 172  ARG A CG    1 
ATOM   1259 C  CD    . ARG A 1 173 ? 44.058 10.006  -6.747  1.00 30.77  ? 172  ARG A CD    1 
ATOM   1260 N  NE    . ARG A 1 173 ? 44.529 10.099  -8.126  1.00 30.94  ? 172  ARG A NE    1 
ATOM   1261 C  CZ    . ARG A 1 173 ? 43.858 9.644   -9.180  1.00 31.06  ? 172  ARG A CZ    1 
ATOM   1262 N  NH1   . ARG A 1 173 ? 42.676 9.065   -9.018  1.00 31.58  ? 172  ARG A NH1   1 
ATOM   1263 N  NH2   . ARG A 1 173 ? 44.367 9.773   -10.397 1.00 26.91  ? 172  ARG A NH2   1 
ATOM   1264 N  N     . LYS A 1 174 ? 44.154 8.203   -1.397  1.00 39.98  ? 173  LYS A N     1 
ATOM   1265 C  CA    . LYS A 1 174 ? 43.920 8.497   0.013   1.00 43.83  ? 173  LYS A CA    1 
ATOM   1266 C  C     . LYS A 1 174 ? 45.155 8.185   0.845   1.00 46.81  ? 173  LYS A C     1 
ATOM   1267 O  O     . LYS A 1 174 ? 45.647 9.036   1.594   1.00 51.07  ? 173  LYS A O     1 
ATOM   1268 C  CB    . LYS A 1 174 ? 42.719 7.702   0.528   1.00 49.03  ? 173  LYS A CB    1 
ATOM   1269 C  CG    . LYS A 1 174 ? 41.371 8.295   0.174   1.00 53.65  ? 173  LYS A CG    1 
ATOM   1270 C  CD    . LYS A 1 174 ? 41.087 9.548   0.984   1.00 56.00  ? 173  LYS A CD    1 
ATOM   1271 C  CE    . LYS A 1 174 ? 39.706 10.093  0.670   1.00 58.13  ? 173  LYS A CE    1 
ATOM   1272 N  NZ    . LYS A 1 174 ? 39.575 10.425  -0.776  1.00 58.58  ? 173  LYS A NZ    1 
ATOM   1273 N  N     . GLN A 1 175 ? 45.679 6.964   0.716   1.00 46.36  ? 174  GLN A N     1 
ATOM   1274 C  CA    . GLN A 1 175 ? 46.837 6.569   1.506   1.00 48.72  ? 174  GLN A CA    1 
ATOM   1275 C  C     . GLN A 1 175 ? 48.101 7.330   1.118   1.00 45.13  ? 174  GLN A C     1 
ATOM   1276 O  O     . GLN A 1 175 ? 49.006 7.463   1.948   1.00 44.42  ? 174  GLN A O     1 
ATOM   1277 C  CB    . GLN A 1 175 ? 47.066 5.064   1.371   1.00 51.86  ? 174  GLN A CB    1 
ATOM   1278 C  CG    . GLN A 1 175 ? 48.129 4.508   2.290   1.00 57.60  ? 174  GLN A CG    1 
ATOM   1279 C  CD    . GLN A 1 175 ? 48.296 3.018   2.128   1.00 62.03  ? 174  GLN A CD    1 
ATOM   1280 O  OE1   . GLN A 1 175 ? 47.339 2.308   1.818   1.00 64.57  ? 174  GLN A OE1   1 
ATOM   1281 N  NE2   . GLN A 1 175 ? 49.516 2.532   2.327   1.00 62.86  ? 174  GLN A NE2   1 
ATOM   1282 N  N     . ASN A 1 176 ? 48.183 7.840   -0.111  1.00 37.68  ? 175  ASN A N     1 
ATOM   1283 C  CA    . ASN A 1 176 ? 49.374 8.529   -0.607  1.00 39.20  ? 175  ASN A CA    1 
ATOM   1284 C  C     . ASN A 1 176 ? 48.968 9.853   -1.242  1.00 43.70  ? 175  ASN A C     1 
ATOM   1285 O  O     . ASN A 1 176 ? 48.997 10.006  -2.469  1.00 46.62  ? 175  ASN A O     1 
ATOM   1286 C  CB    . ASN A 1 176 ? 50.133 7.655   -1.607  1.00 38.18  ? 175  ASN A CB    1 
ATOM   1287 C  CG    . ASN A 1 176 ? 50.517 6.307   -1.030  1.00 40.16  ? 175  ASN A CG    1 
ATOM   1288 O  OD1   . ASN A 1 176 ? 51.628 6.125   -0.535  1.00 44.83  ? 175  ASN A OD1   1 
ATOM   1289 N  ND2   . ASN A 1 176 ? 49.596 5.354   -1.089  1.00 36.56  ? 175  ASN A ND2   1 
ATOM   1290 N  N     . PRO A 1 177 ? 48.595 10.845  -0.427  1.00 42.77  ? 176  PRO A N     1 
ATOM   1291 C  CA    . PRO A 1 177 ? 48.131 12.122  -0.996  1.00 42.96  ? 176  PRO A CA    1 
ATOM   1292 C  C     . PRO A 1 177 ? 49.223 12.917  -1.685  1.00 45.72  ? 176  PRO A C     1 
ATOM   1293 O  O     . PRO A 1 177 ? 48.905 13.780  -2.512  1.00 47.78  ? 176  PRO A O     1 
ATOM   1294 C  CB    . PRO A 1 177 ? 47.591 12.874  0.227   1.00 40.94  ? 176  PRO A CB    1 
ATOM   1295 C  CG    . PRO A 1 177 ? 48.370 12.312  1.377   1.00 41.83  ? 176  PRO A CG    1 
ATOM   1296 C  CD    . PRO A 1 177 ? 48.604 10.861  1.048   1.00 39.98  ? 176  PRO A CD    1 
ATOM   1297 N  N     . ASP A 1 178 ? 50.491 12.661  -1.377  1.00 48.17  ? 177  ASP A N     1 
ATOM   1298 C  CA    . ASP A 1 178 ? 51.596 13.432  -1.925  1.00 51.93  ? 177  ASP A CA    1 
ATOM   1299 C  C     . ASP A 1 178 ? 52.290 12.727  -3.084  1.00 47.83  ? 177  ASP A C     1 
ATOM   1300 O  O     . ASP A 1 178 ? 53.359 13.164  -3.517  1.00 49.33  ? 177  ASP A O     1 
ATOM   1301 C  CB    . ASP A 1 178 ? 52.591 13.767  -0.816  1.00 61.17  ? 177  ASP A CB    1 
ATOM   1302 C  CG    . ASP A 1 178 ? 51.987 14.671  0.244   1.00 70.89  ? 177  ASP A CG    1 
ATOM   1303 O  OD1   . ASP A 1 178 ? 51.385 15.702  -0.128  1.00 72.42  ? 177  ASP A OD1   1 
ATOM   1304 O  OD2   . ASP A 1 178 ? 52.099 14.347  1.445   1.00 75.08  ? 177  ASP A OD2   1 
ATOM   1305 N  N     . ILE A 1 179 ? 51.707 11.647  -3.591  1.00 44.84  ? 178  ILE A N     1 
ATOM   1306 C  CA    . ILE A 1 179 ? 52.109 11.047  -4.855  1.00 41.12  ? 178  ILE A CA    1 
ATOM   1307 C  C     . ILE A 1 179 ? 51.097 11.499  -5.895  1.00 39.06  ? 178  ILE A C     1 
ATOM   1308 O  O     . ILE A 1 179 ? 49.895 11.250  -5.741  1.00 41.38  ? 178  ILE A O     1 
ATOM   1309 C  CB    . ILE A 1 179 ? 52.154 9.514   -4.763  1.00 40.61  ? 178  ILE A CB    1 
ATOM   1310 C  CG1   . ILE A 1 179 ? 52.963 9.065   -3.543  1.00 36.51  ? 178  ILE A CG1   1 
ATOM   1311 C  CG2   . ILE A 1 179 ? 52.727 8.927   -6.041  1.00 38.82  ? 178  ILE A CG2   1 
ATOM   1312 C  CD1   . ILE A 1 179 ? 54.452 8.982   -3.787  1.00 33.85  ? 178  ILE A CD1   1 
ATOM   1313 N  N     . VAL A 1 180 ? 51.561 12.173  -6.944  1.00 34.46  ? 179  VAL A N     1 
ATOM   1314 C  CA    . VAL A 1 180 ? 50.650 12.736  -7.934  1.00 33.03  ? 179  VAL A CA    1 
ATOM   1315 C  C     . VAL A 1 180 ? 50.497 11.755  -9.087  1.00 31.78  ? 179  VAL A C     1 
ATOM   1316 O  O     . VAL A 1 180 ? 51.489 11.295  -9.663  1.00 34.26  ? 179  VAL A O     1 
ATOM   1317 C  CB    . VAL A 1 180 ? 51.136 14.109  -8.429  1.00 34.11  ? 179  VAL A CB    1 
ATOM   1318 C  CG1   . VAL A 1 180 ? 52.599 14.065  -8.800  1.00 37.92  ? 179  VAL A CG1   1 
ATOM   1319 C  CG2   . VAL A 1 180 ? 50.306 14.553  -9.620  1.00 31.80  ? 179  VAL A CG2   1 
ATOM   1320 N  N     . ILE A 1 181 ? 49.251 11.428  -9.419  1.00 30.09  ? 180  ILE A N     1 
ATOM   1321 C  CA    . ILE A 1 181 ? 48.939 10.458  -10.464 1.00 28.84  ? 180  ILE A CA    1 
ATOM   1322 C  C     . ILE A 1 181 ? 48.063 11.161  -11.493 1.00 32.42  ? 180  ILE A C     1 
ATOM   1323 O  O     . ILE A 1 181 ? 46.863 11.368  -11.270 1.00 34.19  ? 180  ILE A O     1 
ATOM   1324 C  CB    . ILE A 1 181 ? 48.249 9.206   -9.910  1.00 29.85  ? 180  ILE A CB    1 
ATOM   1325 C  CG1   . ILE A 1 181 ? 48.969 8.708   -8.654  1.00 33.09  ? 180  ILE A CG1   1 
ATOM   1326 C  CG2   . ILE A 1 181 ? 48.222 8.111   -10.964 1.00 28.99  ? 180  ILE A CG2   1 
ATOM   1327 C  CD1   . ILE A 1 181 ? 48.440 7.390   -8.122  1.00 31.26  ? 180  ILE A CD1   1 
ATOM   1328 N  N     . TYR A 1 182 ? 48.662 11.538  -12.620 1.00 31.61  ? 181  TYR A N     1 
ATOM   1329 C  CA    . TYR A 1 182 ? 47.905 11.991  -13.781 1.00 31.81  ? 181  TYR A CA    1 
ATOM   1330 C  C     . TYR A 1 182 ? 47.375 10.761  -14.505 1.00 32.74  ? 181  TYR A C     1 
ATOM   1331 O  O     . TYR A 1 182 ? 48.150 9.955   -15.036 1.00 34.96  ? 181  TYR A O     1 
ATOM   1332 C  CB    . TYR A 1 182 ? 48.766 12.856  -14.695 1.00 30.71  ? 181  TYR A CB    1 
ATOM   1333 C  CG    . TYR A 1 182 ? 48.714 14.327  -14.348 1.00 32.02  ? 181  TYR A CG    1 
ATOM   1334 C  CD1   . TYR A 1 182 ? 49.396 14.823  -13.246 1.00 32.13  ? 181  TYR A CD1   1 
ATOM   1335 C  CD2   . TYR A 1 182 ? 47.979 15.216  -15.120 1.00 34.36  ? 181  TYR A CD2   1 
ATOM   1336 C  CE1   . TYR A 1 182 ? 49.350 16.160  -12.922 1.00 37.51  ? 181  TYR A CE1   1 
ATOM   1337 C  CE2   . TYR A 1 182 ? 47.928 16.561  -14.806 1.00 36.80  ? 181  TYR A CE2   1 
ATOM   1338 C  CZ    . TYR A 1 182 ? 48.616 17.027  -13.706 1.00 40.47  ? 181  TYR A CZ    1 
ATOM   1339 O  OH    . TYR A 1 182 ? 48.572 18.364  -13.385 1.00 42.22  ? 181  TYR A OH    1 
ATOM   1340 N  N     . GLN A 1 183 ? 46.058 10.619  -14.514 1.00 33.14  ? 182  GLN A N     1 
ATOM   1341 C  CA    . GLN A 1 183 ? 45.363 9.420   -14.963 1.00 35.73  ? 182  GLN A CA    1 
ATOM   1342 C  C     . GLN A 1 183 ? 44.589 9.771   -16.231 1.00 37.15  ? 182  GLN A C     1 
ATOM   1343 O  O     . GLN A 1 183 ? 43.456 10.251  -16.171 1.00 38.50  ? 182  GLN A O     1 
ATOM   1344 C  CB    . GLN A 1 183 ? 44.448 8.907   -13.846 1.00 36.73  ? 182  GLN A CB    1 
ATOM   1345 C  CG    . GLN A 1 183 ? 43.327 7.959   -14.251 1.00 36.25  ? 182  GLN A CG    1 
ATOM   1346 C  CD    . GLN A 1 183 ? 42.152 8.035   -13.284 1.00 40.03  ? 182  GLN A CD    1 
ATOM   1347 O  OE1   . GLN A 1 183 ? 42.296 8.491   -12.145 1.00 39.91  ? 182  GLN A OE1   1 
ATOM   1348 N  NE2   . GLN A 1 183 ? 40.980 7.603   -13.738 1.00 39.50  ? 182  GLN A NE2   1 
ATOM   1349 N  N     . TYR A 1 184 ? 45.219 9.563   -17.378 1.00 39.20  ? 183  TYR A N     1 
ATOM   1350 C  CA    . TYR A 1 184 ? 44.504 9.597   -18.640 1.00 41.52  ? 183  TYR A CA    1 
ATOM   1351 C  C     . TYR A 1 184 ? 44.275 8.144   -19.005 1.00 48.98  ? 183  TYR A C     1 
ATOM   1352 O  O     . TYR A 1 184 ? 44.962 7.268   -18.487 1.00 62.71  ? 183  TYR A O     1 
ATOM   1353 C  CB    . TYR A 1 184 ? 45.299 10.346  -19.711 1.00 37.31  ? 183  TYR A CB    1 
ATOM   1354 C  CG    . TYR A 1 184 ? 44.468 10.888  -20.853 1.00 31.92  ? 183  TYR A CG    1 
ATOM   1355 C  CD1   . TYR A 1 184 ? 44.410 10.218  -22.067 1.00 31.30  ? 183  TYR A CD1   1 
ATOM   1356 C  CD2   . TYR A 1 184 ? 43.751 12.075  -20.722 1.00 30.02  ? 183  TYR A CD2   1 
ATOM   1357 C  CE1   . TYR A 1 184 ? 43.666 10.706  -23.120 1.00 33.41  ? 183  TYR A CE1   1 
ATOM   1358 C  CE2   . TYR A 1 184 ? 43.000 12.577  -21.777 1.00 31.98  ? 183  TYR A CE2   1 
ATOM   1359 C  CZ    . TYR A 1 184 ? 42.964 11.884  -22.973 1.00 32.42  ? 183  TYR A CZ    1 
ATOM   1360 O  OH    . TYR A 1 184 ? 42.222 12.352  -24.030 1.00 33.44  ? 183  TYR A OH    1 
ATOM   1361 N  N     . MET A 1 185 ? 43.356 7.890   -19.934 1.00 45.02  ? 184  MET A N     1 
ATOM   1362 C  CA    . MET A 1 185 ? 42.460 6.742   -19.806 1.00 47.61  ? 184  MET A CA    1 
ATOM   1363 C  C     . MET A 1 185 ? 43.095 5.543   -19.104 1.00 47.58  ? 184  MET A C     1 
ATOM   1364 O  O     . MET A 1 185 ? 42.686 5.207   -17.990 1.00 49.72  ? 184  MET A O     1 
ATOM   1365 C  CB    . MET A 1 185 ? 41.971 6.318   -21.190 1.00 51.71  ? 184  MET A CB    1 
ATOM   1366 C  CG    . MET A 1 185 ? 40.739 5.437   -21.175 1.00 58.49  ? 184  MET A CG    1 
ATOM   1367 S  SD    . MET A 1 185 ? 39.364 6.289   -21.955 1.00 65.62  ? 184  MET A SD    1 
ATOM   1368 C  CE    . MET A 1 185 ? 40.245 7.303   -23.141 1.00 64.73  ? 184  MET A CE    1 
ATOM   1369 N  N     . ASP A 1 186 ? 44.151 4.956   -19.672 1.00 46.89  ? 185  ASP A N     1 
ATOM   1370 C  CA    . ASP A 1 186 ? 44.901 3.912   -18.982 1.00 49.19  ? 185  ASP A CA    1 
ATOM   1371 C  C     . ASP A 1 186 ? 46.365 4.264   -18.765 1.00 47.67  ? 185  ASP A C     1 
ATOM   1372 O  O     . ASP A 1 186 ? 47.066 3.525   -18.062 1.00 45.54  ? 185  ASP A O     1 
ATOM   1373 C  CB    . ASP A 1 186 ? 44.810 2.573   -19.735 1.00 52.04  ? 185  ASP A CB    1 
ATOM   1374 C  CG    . ASP A 1 186 ? 45.403 2.638   -21.131 1.00 57.37  ? 185  ASP A CG    1 
ATOM   1375 O  OD1   . ASP A 1 186 ? 45.674 3.753   -21.626 1.00 57.54  ? 185  ASP A OD1   1 
ATOM   1376 O  OD2   . ASP A 1 186 ? 45.599 1.563   -21.737 1.00 59.31  ? 185  ASP A OD2   1 
ATOM   1377 N  N     . ASP A 1 187 ? 46.845 5.350   -19.366 1.00 45.06  ? 186  ASP A N     1 
ATOM   1378 C  CA    . ASP A 1 187 ? 48.179 5.861   -19.097 1.00 47.38  ? 186  ASP A CA    1 
ATOM   1379 C  C     . ASP A 1 187 ? 48.214 6.590   -17.754 1.00 41.51  ? 186  ASP A C     1 
ATOM   1380 O  O     . ASP A 1 187 ? 47.359 7.439   -17.458 1.00 39.93  ? 186  ASP A O     1 
ATOM   1381 C  CB    . ASP A 1 187 ? 48.606 6.793   -20.230 1.00 56.94  ? 186  ASP A CB    1 
ATOM   1382 C  CG    . ASP A 1 187 ? 50.098 7.019   -20.269 1.00 68.30  ? 186  ASP A CG    1 
ATOM   1383 O  OD1   . ASP A 1 187 ? 50.618 7.728   -19.381 1.00 69.53  ? 186  ASP A OD1   1 
ATOM   1384 O  OD2   . ASP A 1 187 ? 50.753 6.474   -21.185 1.00 75.61  ? 186  ASP A OD2   1 
ATOM   1385 N  N     . LEU A 1 188 ? 49.210 6.254   -16.937 1.00 37.42  ? 187  LEU A N     1 
ATOM   1386 C  CA    . LEU A 1 188 ? 49.408 6.882   -15.640 1.00 36.09  ? 187  LEU A CA    1 
ATOM   1387 C  C     . LEU A 1 188 ? 50.795 7.506   -15.599 1.00 38.65  ? 187  LEU A C     1 
ATOM   1388 O  O     . LEU A 1 188 ? 51.803 6.814   -15.803 1.00 40.80  ? 187  LEU A O     1 
ATOM   1389 C  CB    . LEU A 1 188 ? 49.246 5.875   -14.501 1.00 34.90  ? 187  LEU A CB    1 
ATOM   1390 C  CG    . LEU A 1 188 ? 47.941 5.093   -14.387 1.00 36.20  ? 187  LEU A CG    1 
ATOM   1391 C  CD1   . LEU A 1 188 ? 48.038 4.129   -13.219 1.00 33.26  ? 187  LEU A CD1   1 
ATOM   1392 C  CD2   . LEU A 1 188 ? 46.763 6.034   -14.211 1.00 36.47  ? 187  LEU A CD2   1 
ATOM   1393 N  N     . TYR A 1 189 ? 50.835 8.812   -15.352 1.00 34.98  ? 188  TYR A N     1 
ATOM   1394 C  CA    . TYR A 1 189 ? 52.048 9.521   -14.969 1.00 33.64  ? 188  TYR A CA    1 
ATOM   1395 C  C     . TYR A 1 189 ? 52.060 9.621   -13.449 1.00 32.63  ? 188  TYR A C     1 
ATOM   1396 O  O     . TYR A 1 189 ? 51.064 10.027  -12.848 1.00 32.40  ? 188  TYR A O     1 
ATOM   1397 C  CB    . TYR A 1 189 ? 52.077 10.907  -15.625 1.00 36.25  ? 188  TYR A CB    1 
ATOM   1398 C  CG    . TYR A 1 189 ? 53.035 11.927  -15.034 1.00 34.54  ? 188  TYR A CG    1 
ATOM   1399 C  CD1   . TYR A 1 189 ? 52.715 12.625  -13.874 1.00 38.63  ? 188  TYR A CD1   1 
ATOM   1400 C  CD2   . TYR A 1 189 ? 54.233 12.234  -15.667 1.00 36.59  ? 188  TYR A CD2   1 
ATOM   1401 C  CE1   . TYR A 1 189 ? 53.575 13.567  -13.339 1.00 43.10  ? 188  TYR A CE1   1 
ATOM   1402 C  CE2   . TYR A 1 189 ? 55.099 13.182  -15.142 1.00 41.22  ? 188  TYR A CE2   1 
ATOM   1403 C  CZ    . TYR A 1 189 ? 54.763 13.844  -13.976 1.00 43.56  ? 188  TYR A CZ    1 
ATOM   1404 O  OH    . TYR A 1 189 ? 55.614 14.785  -13.442 1.00 45.26  ? 188  TYR A OH    1 
ATOM   1405 N  N     . VAL A 1 190 ? 53.173 9.239   -12.828 1.00 28.88  ? 189  VAL A N     1 
ATOM   1406 C  CA    . VAL A 1 190 ? 53.286 9.184   -11.375 1.00 28.99  ? 189  VAL A CA    1 
ATOM   1407 C  C     . VAL A 1 190 ? 54.515 9.981   -10.962 1.00 31.87  ? 189  VAL A C     1 
ATOM   1408 O  O     . VAL A 1 190 ? 55.641 9.621   -11.324 1.00 33.54  ? 189  VAL A O     1 
ATOM   1409 C  CB    . VAL A 1 190 ? 53.386 7.739   -10.859 1.00 29.43  ? 189  VAL A CB    1 
ATOM   1410 C  CG1   . VAL A 1 190 ? 53.378 7.723   -9.343  1.00 29.64  ? 189  VAL A CG1   1 
ATOM   1411 C  CG2   . VAL A 1 190 ? 52.254 6.890   -11.417 1.00 29.05  ? 189  VAL A CG2   1 
ATOM   1412 N  N     . GLY A 1 191 ? 54.303 11.050  -10.202 1.00 31.27  ? 190  GLY A N     1 
ATOM   1413 C  CA    . GLY A 1 191 ? 55.384 11.903  -9.749  1.00 30.61  ? 190  GLY A CA    1 
ATOM   1414 C  C     . GLY A 1 191 ? 55.459 11.949  -8.235  1.00 34.45  ? 190  GLY A C     1 
ATOM   1415 O  O     . GLY A 1 191 ? 54.437 11.910  -7.543  1.00 37.37  ? 190  GLY A O     1 
ATOM   1416 N  N     . SER A 1 192 ? 56.687 12.036  -7.723  1.00 34.64  ? 191  SER A N     1 
ATOM   1417 C  CA    . SER A 1 192 ? 56.910 12.091  -6.286  1.00 34.52  ? 191  SER A CA    1 
ATOM   1418 C  C     . SER A 1 192 ? 58.142 12.934  -5.984  1.00 36.50  ? 191  SER A C     1 
ATOM   1419 O  O     . SER A 1 192 ? 58.995 13.167  -6.847  1.00 38.93  ? 191  SER A O     1 
ATOM   1420 C  CB    . SER A 1 192 ? 57.087 10.692  -5.688  1.00 35.82  ? 191  SER A CB    1 
ATOM   1421 O  OG    . SER A 1 192 ? 58.392 10.198  -5.939  1.00 34.02  ? 191  SER A OG    1 
ATOM   1422 N  N     . ASP A 1 193 ? 58.228 13.375  -4.729  1.00 37.95  ? 192  ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 193 ? 59.382 14.100  -4.216  1.00 43.64  ? 192  ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 193 ? 60.317 13.201  -3.416  1.00 43.08  ? 192  ASP A C     1 
ATOM   1425 O  O     . ASP A 1 193 ? 61.070 13.693  -2.571  1.00 45.22  ? 192  ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 193 ? 58.925 15.280  -3.361  1.00 47.24  ? 192  ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 193 ? 57.987 16.203  -4.105  1.00 52.92  ? 192  ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 193 ? 58.258 16.488  -5.293  1.00 53.92  ? 192  ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 193 ? 56.977 16.631  -3.506  1.00 54.29  ? 192  ASP A OD2   1 
ATOM   1430 N  N     . LEU A 1 194 ? 60.269 11.898  -3.655  1.00 41.90  ? 193  LEU A N     1 
ATOM   1431 C  CA    . LEU A 1 194 ? 61.132 10.943  -2.981  1.00 41.86  ? 193  LEU A CA    1 
ATOM   1432 C  C     . LEU A 1 194 ? 62.398 10.714  -3.795  1.00 42.74  ? 193  LEU A C     1 
ATOM   1433 O  O     . LEU A 1 194 ? 62.440 10.958  -5.002  1.00 38.82  ? 193  LEU A O     1 
ATOM   1434 C  CB    . LEU A 1 194 ? 60.397 9.616   -2.774  1.00 39.22  ? 193  LEU A CB    1 
ATOM   1435 C  CG    . LEU A 1 194 ? 58.978 9.733   -2.212  1.00 39.35  ? 193  LEU A CG    1 
ATOM   1436 C  CD1   . LEU A 1 194 ? 58.245 8.409   -2.307  1.00 36.14  ? 193  LEU A CD1   1 
ATOM   1437 C  CD2   . LEU A 1 194 ? 59.015 10.224  -0.773  1.00 42.06  ? 193  LEU A CD2   1 
ATOM   1438 N  N     . GLU A 1 195 ? 63.442 10.246  -3.119  1.00 52.81  ? 194  GLU A N     1 
ATOM   1439 C  CA    . GLU A 1 195 ? 64.600 9.761   -3.849  1.00 53.36  ? 194  GLU A CA    1 
ATOM   1440 C  C     . GLU A 1 195 ? 64.208 8.522   -4.654  1.00 48.39  ? 194  GLU A C     1 
ATOM   1441 O  O     . GLU A 1 195 ? 63.187 7.878   -4.392  1.00 46.66  ? 194  GLU A O     1 
ATOM   1442 C  CB    . GLU A 1 195 ? 65.754 9.451   -2.897  1.00 64.49  ? 194  GLU A CB    1 
ATOM   1443 C  CG    . GLU A 1 195 ? 67.099 9.995   -3.363  1.00 75.79  ? 194  GLU A CG    1 
ATOM   1444 C  CD    . GLU A 1 195 ? 67.254 11.485  -3.106  1.00 82.62  ? 194  GLU A CD    1 
ATOM   1445 O  OE1   . GLU A 1 195 ? 67.269 11.889  -1.922  1.00 85.31  ? 194  GLU A OE1   1 
ATOM   1446 O  OE2   . GLU A 1 195 ? 67.359 12.253  -4.087  1.00 84.13  ? 194  GLU A OE2   1 
ATOM   1447 N  N     . ILE A 1 196 ? 65.042 8.185   -5.641  1.00 47.81  ? 195  ILE A N     1 
ATOM   1448 C  CA    . ILE A 1 196 ? 64.630 7.231   -6.671  1.00 46.30  ? 195  ILE A CA    1 
ATOM   1449 C  C     . ILE A 1 196 ? 64.283 5.865   -6.079  1.00 45.23  ? 195  ILE A C     1 
ATOM   1450 O  O     . ILE A 1 196 ? 63.357 5.198   -6.555  1.00 40.34  ? 195  ILE A O     1 
ATOM   1451 C  CB    . ILE A 1 196 ? 65.713 7.130   -7.766  1.00 47.86  ? 195  ILE A CB    1 
ATOM   1452 C  CG1   . ILE A 1 196 ? 65.204 6.296   -8.944  1.00 50.30  ? 195  ILE A CG1   1 
ATOM   1453 C  CG2   . ILE A 1 196 ? 67.014 6.562   -7.211  1.00 48.38  ? 195  ILE A CG2   1 
ATOM   1454 C  CD1   . ILE A 1 196 ? 63.914 6.820   -9.545  1.00 49.31  ? 195  ILE A CD1   1 
ATOM   1455 N  N     . GLY A 1 197 ? 64.982 5.439   -5.024  1.00 43.13  ? 196  GLY A N     1 
ATOM   1456 C  CA    . GLY A 1 197 ? 64.690 4.138   -4.436  1.00 47.65  ? 196  GLY A CA    1 
ATOM   1457 C  C     . GLY A 1 197 ? 63.328 4.086   -3.766  1.00 49.06  ? 196  GLY A C     1 
ATOM   1458 O  O     . GLY A 1 197 ? 62.531 3.170   -4.010  1.00 53.81  ? 196  GLY A O     1 
ATOM   1459 N  N     . GLN A 1 198 ? 63.047 5.062   -2.898  1.00 46.50  ? 197  GLN A N     1 
ATOM   1460 C  CA    . GLN A 1 198 ? 61.731 5.145   -2.273  1.00 47.44  ? 197  GLN A CA    1 
ATOM   1461 C  C     . GLN A 1 198 ? 60.640 5.327   -3.320  1.00 47.48  ? 197  GLN A C     1 
ATOM   1462 O  O     . GLN A 1 198 ? 59.528 4.801   -3.175  1.00 48.49  ? 197  GLN A O     1 
ATOM   1463 C  CB    . GLN A 1 198 ? 61.705 6.292   -1.264  1.00 50.87  ? 197  GLN A CB    1 
ATOM   1464 C  CG    . GLN A 1 198 ? 61.169 5.908   0.100   1.00 55.43  ? 197  GLN A CG    1 
ATOM   1465 C  CD    . GLN A 1 198 ? 60.987 7.104   1.011   1.00 59.22  ? 197  GLN A CD    1 
ATOM   1466 O  OE1   . GLN A 1 198 ? 61.958 7.716   1.458   1.00 62.03  ? 197  GLN A OE1   1 
ATOM   1467 N  NE2   . GLN A 1 198 ? 59.734 7.446   1.290   1.00 57.09  ? 197  GLN A NE2   1 
ATOM   1468 N  N     . HIS A 1 199 ? 60.944 6.063   -4.391  1.00 45.30  ? 198  HIS A N     1 
ATOM   1469 C  CA    . HIS A 1 199 ? 59.972 6.228   -5.463  1.00 44.14  ? 198  HIS A CA    1 
ATOM   1470 C  C     . HIS A 1 199 ? 59.652 4.895   -6.126  1.00 43.52  ? 198  HIS A C     1 
ATOM   1471 O  O     . HIS A 1 199 ? 58.484 4.594   -6.388  1.00 43.48  ? 198  HIS A O     1 
ATOM   1472 C  CB    . HIS A 1 199 ? 60.488 7.229   -6.493  1.00 36.44  ? 198  HIS A CB    1 
ATOM   1473 C  CG    . HIS A 1 199 ? 59.613 7.352   -7.700  1.00 35.07  ? 198  HIS A CG    1 
ATOM   1474 N  ND1   . HIS A 1 199 ? 58.452 8.094   -7.707  1.00 33.77  ? 198  HIS A ND1   1 
ATOM   1475 C  CD2   . HIS A 1 199 ? 59.733 6.831   -8.944  1.00 35.00  ? 198  HIS A CD2   1 
ATOM   1476 C  CE1   . HIS A 1 199 ? 57.892 8.022   -8.901  1.00 35.64  ? 198  HIS A CE1   1 
ATOM   1477 N  NE2   . HIS A 1 199 ? 58.649 7.260   -9.670  1.00 33.68  ? 198  HIS A NE2   1 
ATOM   1478 N  N     . ARG A 1 200 ? 60.675 4.084   -6.410  1.00 45.44  ? 199  ARG A N     1 
ATOM   1479 C  CA    . ARG A 1 200 ? 60.420 2.784   -7.026  1.00 47.05  ? 199  ARG A CA    1 
ATOM   1480 C  C     . ARG A 1 200 ? 59.649 1.870   -6.080  1.00 45.58  ? 199  ARG A C     1 
ATOM   1481 O  O     . ARG A 1 200 ? 58.804 1.082   -6.520  1.00 44.96  ? 199  ARG A O     1 
ATOM   1482 C  CB    . ARG A 1 200 ? 61.732 2.130   -7.458  1.00 51.49  ? 199  ARG A CB    1 
ATOM   1483 C  CG    . ARG A 1 200 ? 62.500 2.916   -8.505  1.00 57.98  ? 199  ARG A CG    1 
ATOM   1484 C  CD    . ARG A 1 200 ? 63.486 2.028   -9.245  1.00 66.82  ? 199  ARG A CD    1 
ATOM   1485 N  NE    . ARG A 1 200 ? 64.612 2.779   -9.793  1.00 72.92  ? 199  ARG A NE    1 
ATOM   1486 C  CZ    . ARG A 1 200 ? 65.831 2.786   -9.262  1.00 78.08  ? 199  ARG A CZ    1 
ATOM   1487 N  NH1   . ARG A 1 200 ? 66.086 2.077   -8.170  1.00 79.23  ? 199  ARG A NH1   1 
ATOM   1488 N  NH2   . ARG A 1 200 ? 66.798 3.498   -9.824  1.00 80.10  ? 199  ARG A NH2   1 
ATOM   1489 N  N     . THR A 1 201 ? 59.923 1.965   -4.778  1.00 48.12  ? 200  THR A N     1 
ATOM   1490 C  CA    . THR A 1 201 ? 59.126 1.218   -3.806  1.00 48.83  ? 200  THR A CA    1 
ATOM   1491 C  C     . THR A 1 201 ? 57.653 1.624   -3.863  1.00 45.98  ? 200  THR A C     1 
ATOM   1492 O  O     . THR A 1 201 ? 56.757 0.764   -3.866  1.00 42.39  ? 200  THR A O     1 
ATOM   1493 C  CB    . THR A 1 201 ? 59.701 1.424   -2.405  1.00 54.12  ? 200  THR A CB    1 
ATOM   1494 O  OG1   . THR A 1 201 ? 60.783 0.506   -2.199  1.00 52.58  ? 200  THR A OG1   1 
ATOM   1495 C  CG2   . THR A 1 201 ? 58.637 1.209   -1.343  1.00 60.62  ? 200  THR A CG2   1 
ATOM   1496 N  N     . LYS A 1 202 ? 57.382 2.931   -3.931  1.00 41.40  ? 201  LYS A N     1 
ATOM   1497 C  CA    . LYS A 1 202 ? 55.999 3.390   -4.049  1.00 38.87  ? 201  LYS A CA    1 
ATOM   1498 C  C     . LYS A 1 202 ? 55.375 2.945   -5.367  1.00 40.91  ? 201  LYS A C     1 
ATOM   1499 O  O     . LYS A 1 202 ? 54.176 2.646   -5.426  1.00 45.38  ? 201  LYS A O     1 
ATOM   1500 C  CB    . LYS A 1 202 ? 55.932 4.910   -3.913  1.00 39.70  ? 201  LYS A CB    1 
ATOM   1501 C  CG    . LYS A 1 202 ? 55.932 5.393   -2.478  1.00 44.40  ? 201  LYS A CG    1 
ATOM   1502 C  CD    . LYS A 1 202 ? 54.678 4.930   -1.755  1.00 43.51  ? 201  LYS A CD    1 
ATOM   1503 C  CE    . LYS A 1 202 ? 54.798 5.136   -0.260  1.00 45.56  ? 201  LYS A CE    1 
ATOM   1504 N  NZ    . LYS A 1 202 ? 53.577 4.658   0.441   1.00 49.16  ? 201  LYS A NZ    1 
ATOM   1505 N  N     . ILE A 1 203 ? 56.171 2.902   -6.436  1.00 36.56  ? 202  ILE A N     1 
ATOM   1506 C  CA    . ILE A 1 203 ? 55.656 2.450   -7.725  1.00 35.63  ? 202  ILE A CA    1 
ATOM   1507 C  C     . ILE A 1 203 ? 55.265 0.980   -7.655  1.00 36.15  ? 202  ILE A C     1 
ATOM   1508 O  O     . ILE A 1 203 ? 54.240 0.571   -8.211  1.00 32.83  ? 202  ILE A O     1 
ATOM   1509 C  CB    . ILE A 1 203 ? 56.686 2.708   -8.839  1.00 40.02  ? 202  ILE A CB    1 
ATOM   1510 C  CG1   . ILE A 1 203 ? 56.849 4.208   -9.080  1.00 43.17  ? 202  ILE A CG1   1 
ATOM   1511 C  CG2   . ILE A 1 203 ? 56.264 2.011   -10.126 1.00 39.51  ? 202  ILE A CG2   1 
ATOM   1512 C  CD1   . ILE A 1 203 ? 55.573 4.893   -9.496  1.00 40.27  ? 202  ILE A CD1   1 
ATOM   1513 N  N     . GLU A 1 204 ? 56.074 0.163   -6.979  1.00 34.54  ? 203  GLU A N     1 
ATOM   1514 C  CA    . GLU A 1 204 ? 55.713 -1.241  -6.800  1.00 38.98  ? 203  GLU A CA    1 
ATOM   1515 C  C     . GLU A 1 204 ? 54.448 -1.379  -5.965  1.00 39.78  ? 203  GLU A C     1 
ATOM   1516 O  O     . GLU A 1 204 ? 53.598 -2.232  -6.249  1.00 40.40  ? 203  GLU A O     1 
ATOM   1517 C  CB    . GLU A 1 204 ? 56.868 -2.013  -6.164  1.00 43.52  ? 203  GLU A CB    1 
ATOM   1518 C  CG    . GLU A 1 204 ? 57.938 -2.410  -7.162  1.00 51.83  ? 203  GLU A CG    1 
ATOM   1519 C  CD    . GLU A 1 204 ? 57.358 -3.123  -8.373  1.00 56.26  ? 203  GLU A CD    1 
ATOM   1520 O  OE1   . GLU A 1 204 ? 56.517 -4.033  -8.191  1.00 56.74  ? 203  GLU A OE1   1 
ATOM   1521 O  OE2   . GLU A 1 204 ? 57.736 -2.761  -9.508  1.00 56.88  ? 203  GLU A OE2   1 
ATOM   1522 N  N     . GLU A 1 205 ? 54.305 -0.549  -4.929  1.00 40.84  ? 204  GLU A N     1 
ATOM   1523 C  CA    . GLU A 1 205 ? 53.068 -0.548  -4.153  1.00 41.58  ? 204  GLU A CA    1 
ATOM   1524 C  C     . GLU A 1 205 ? 51.864 -0.230  -5.038  1.00 44.58  ? 204  GLU A C     1 
ATOM   1525 O  O     . GLU A 1 205 ? 50.829 -0.904  -4.959  1.00 41.13  ? 204  GLU A O     1 
ATOM   1526 C  CB    . GLU A 1 205 ? 53.179 0.455   -3.004  1.00 47.95  ? 204  GLU A CB    1 
ATOM   1527 C  CG    . GLU A 1 205 ? 52.010 0.452   -2.031  1.00 52.65  ? 204  GLU A CG    1 
ATOM   1528 C  CD    . GLU A 1 205 ? 52.089 1.595   -1.029  1.00 56.53  ? 204  GLU A CD    1 
ATOM   1529 O  OE1   . GLU A 1 205 ? 51.091 2.337   -0.883  1.00 55.50  ? 204  GLU A OE1   1 
ATOM   1530 O  OE2   . GLU A 1 205 ? 53.156 1.756   -0.398  1.00 57.58  ? 204  GLU A OE2   1 
ATOM   1531 N  N     . LEU A 1 206 ? 51.992 0.784   -5.902  1.00 45.00  ? 205  LEU A N     1 
ATOM   1532 C  CA    . LEU A 1 206 ? 50.898 1.150   -6.802  1.00 41.83  ? 205  LEU A CA    1 
ATOM   1533 C  C     . LEU A 1 206 ? 50.590 0.036   -7.798  1.00 40.54  ? 205  LEU A C     1 
ATOM   1534 O  O     . LEU A 1 206 ? 49.420 -0.221  -8.114  1.00 41.28  ? 205  LEU A O     1 
ATOM   1535 C  CB    . LEU A 1 206 ? 51.237 2.446   -7.542  1.00 37.30  ? 205  LEU A CB    1 
ATOM   1536 C  CG    . LEU A 1 206 ? 50.247 2.914   -8.614  1.00 35.63  ? 205  LEU A CG    1 
ATOM   1537 C  CD1   . LEU A 1 206 ? 48.899 3.241   -7.999  1.00 29.53  ? 205  LEU A CD1   1 
ATOM   1538 C  CD2   . LEU A 1 206 ? 50.791 4.111   -9.391  1.00 37.16  ? 205  LEU A CD2   1 
ATOM   1539 N  N     . ARG A 1 207 ? 51.626 -0.633  -8.309  1.00 40.08  ? 206  ARG A N     1 
ATOM   1540 C  CA    . ARG A 1 207 ? 51.402 -1.722  -9.253  1.00 40.20  ? 206  ARG A CA    1 
ATOM   1541 C  C     . ARG A 1 207 ? 50.701 -2.895  -8.582  1.00 43.85  ? 206  ARG A C     1 
ATOM   1542 O  O     . ARG A 1 207 ? 49.804 -3.506  -9.173  1.00 45.67  ? 206  ARG A O     1 
ATOM   1543 C  CB    . ARG A 1 207 ? 52.724 -2.171  -9.874  1.00 39.42  ? 206  ARG A CB    1 
ATOM   1544 C  CG    . ARG A 1 207 ? 53.364 -1.127  -10.768 1.00 37.03  ? 206  ARG A CG    1 
ATOM   1545 C  CD    . ARG A 1 207 ? 54.620 -1.649  -11.447 1.00 35.22  ? 206  ARG A CD    1 
ATOM   1546 N  NE    . ARG A 1 207 ? 54.336 -2.745  -12.370 1.00 37.55  ? 206  ARG A NE    1 
ATOM   1547 C  CZ    . ARG A 1 207 ? 54.767 -3.992  -12.205 1.00 41.85  ? 206  ARG A CZ    1 
ATOM   1548 N  NH1   . ARG A 1 207 ? 55.510 -4.305  -11.152 1.00 39.64  ? 206  ARG A NH1   1 
ATOM   1549 N  NH2   . ARG A 1 207 ? 54.465 -4.925  -13.098 1.00 43.48  ? 206  ARG A NH2   1 
ATOM   1550 N  N     . GLN A 1 208 ? 51.089 -3.221  -7.346  1.00 44.48  ? 207  GLN A N     1 
ATOM   1551 C  CA    . GLN A 1 208 ? 50.409 -4.292  -6.622  1.00 44.40  ? 207  GLN A CA    1 
ATOM   1552 C  C     . GLN A 1 208 ? 48.972 -3.906  -6.293  1.00 44.95  ? 207  GLN A C     1 
ATOM   1553 O  O     . GLN A 1 208 ? 48.075 -4.759  -6.304  1.00 44.21  ? 207  GLN A O     1 
ATOM   1554 C  CB    . GLN A 1 208 ? 51.175 -4.641  -5.348  1.00 47.99  ? 207  GLN A CB    1 
ATOM   1555 C  CG    . GLN A 1 208 ? 52.568 -5.201  -5.593  1.00 56.57  ? 207  GLN A CG    1 
ATOM   1556 C  CD    . GLN A 1 208 ? 52.556 -6.437  -6.472  1.00 64.05  ? 207  GLN A CD    1 
ATOM   1557 O  OE1   . GLN A 1 208 ? 52.025 -7.481  -6.091  1.00 62.23  ? 207  GLN A OE1   1 
ATOM   1558 N  NE2   . GLN A 1 208 ? 53.141 -6.323  -7.661  1.00 69.48  ? 207  GLN A NE2   1 
ATOM   1559 N  N     . HIS A 1 209 ? 48.733 -2.624  -6.002  1.00 43.04  ? 208  HIS A N     1 
ATOM   1560 C  CA    . HIS A 1 209 ? 47.369 -2.156  -5.775  1.00 38.79  ? 208  HIS A CA    1 
ATOM   1561 C  C     . HIS A 1 209 ? 46.515 -2.349  -7.022  1.00 39.41  ? 208  HIS A C     1 
ATOM   1562 O  O     . HIS A 1 209 ? 45.389 -2.854  -6.946  1.00 40.53  ? 208  HIS A O     1 
ATOM   1563 C  CB    . HIS A 1 209 ? 47.383 -0.686  -5.351  1.00 37.26  ? 208  HIS A CB    1 
ATOM   1564 C  CG    . HIS A 1 209 ? 46.019 -0.079  -5.232  1.00 41.37  ? 208  HIS A CG    1 
ATOM   1565 N  ND1   . HIS A 1 209 ? 45.284 -0.118  -4.067  1.00 41.69  ? 208  HIS A ND1   1 
ATOM   1566 C  CD2   . HIS A 1 209 ? 45.255 0.580   -6.136  1.00 41.24  ? 208  HIS A CD2   1 
ATOM   1567 C  CE1   . HIS A 1 209 ? 44.127 0.492   -4.256  1.00 40.46  ? 208  HIS A CE1   1 
ATOM   1568 N  NE2   . HIS A 1 209 ? 44.084 0.923   -5.504  1.00 41.75  ? 208  HIS A NE2   1 
ATOM   1569 N  N     . LEU A 1 210 ? 47.042 -1.956  -8.185  1.00 39.65  ? 209  LEU A N     1 
ATOM   1570 C  CA    . LEU A 1 210 ? 46.291 -2.131  -9.425  1.00 35.23  ? 209  LEU A CA    1 
ATOM   1571 C  C     . LEU A 1 210 ? 46.075 -3.607  -9.736  1.00 36.15  ? 209  LEU A C     1 
ATOM   1572 O  O     . LEU A 1 210 ? 44.985 -4.007  -10.161 1.00 36.80  ? 209  LEU A O     1 
ATOM   1573 C  CB    . LEU A 1 210 ? 47.013 -1.441  -10.582 1.00 35.45  ? 209  LEU A CB    1 
ATOM   1574 C  CG    . LEU A 1 210 ? 47.095 0.085   -10.530 1.00 36.06  ? 209  LEU A CG    1 
ATOM   1575 C  CD1   . LEU A 1 210 ? 47.990 0.607   -11.645 1.00 35.46  ? 209  LEU A CD1   1 
ATOM   1576 C  CD2   . LEU A 1 210 ? 45.704 0.707   -10.617 1.00 33.16  ? 209  LEU A CD2   1 
ATOM   1577 N  N     . LEU A 1 211 ? 47.104 -4.433  -9.529  1.00 39.23  ? 210  LEU A N     1 
ATOM   1578 C  CA    . LEU A 1 211 ? 46.989 -5.861  -9.809  1.00 38.84  ? 210  LEU A CA    1 
ATOM   1579 C  C     . LEU A 1 211 ? 45.940 -6.514  -8.920  1.00 38.35  ? 210  LEU A C     1 
ATOM   1580 O  O     . LEU A 1 211 ? 45.187 -7.383  -9.372  1.00 34.83  ? 210  LEU A O     1 
ATOM   1581 C  CB    . LEU A 1 211 ? 48.347 -6.533  -9.622  1.00 39.32  ? 210  LEU A CB    1 
ATOM   1582 C  CG    . LEU A 1 211 ? 48.448 -8.022  -9.940  1.00 39.78  ? 210  LEU A CG    1 
ATOM   1583 C  CD1   . LEU A 1 211 ? 48.248 -8.268  -11.425 1.00 35.71  ? 210  LEU A CD1   1 
ATOM   1584 C  CD2   . LEU A 1 211 ? 49.795 -8.542  -9.479  1.00 40.93  ? 210  LEU A CD2   1 
ATOM   1585 N  N     . ARG A 1 212 ? 45.871 -6.102  -7.650  1.00 37.43  ? 211  ARG A N     1 
ATOM   1586 C  CA    . ARG A 1 212 ? 44.787 -6.548  -6.783  1.00 40.32  ? 211  ARG A CA    1 
ATOM   1587 C  C     . ARG A 1 212 ? 43.425 -6.256  -7.402  1.00 41.76  ? 211  ARG A C     1 
ATOM   1588 O  O     . ARG A 1 212 ? 42.482 -7.034  -7.226  1.00 40.97  ? 211  ARG A O     1 
ATOM   1589 C  CB    . ARG A 1 212 ? 44.916 -5.880  -5.408  1.00 42.23  ? 211  ARG A CB    1 
ATOM   1590 C  CG    . ARG A 1 212 ? 43.806 -6.207  -4.417  1.00 44.98  ? 211  ARG A CG    1 
ATOM   1591 C  CD    . ARG A 1 212 ? 42.728 -5.129  -4.412  1.00 49.61  ? 211  ARG A CD    1 
ATOM   1592 N  NE    . ARG A 1 212 ? 41.652 -5.424  -3.470  1.00 55.69  ? 211  ARG A NE    1 
ATOM   1593 C  CZ    . ARG A 1 212 ? 40.635 -6.240  -3.726  1.00 59.24  ? 211  ARG A CZ    1 
ATOM   1594 N  NH1   . ARG A 1 212 ? 40.554 -6.858  -4.897  1.00 61.32  ? 211  ARG A NH1   1 
ATOM   1595 N  NH2   . ARG A 1 212 ? 39.701 -6.444  -2.808  1.00 60.94  ? 211  ARG A NH2   1 
ATOM   1596 N  N     . TRP A 1 213 ? 43.305 -5.146  -8.134  1.00 42.61  ? 212  TRP A N     1 
ATOM   1597 C  CA    . TRP A 1 213 ? 42.075 -4.796  -8.833  1.00 41.74  ? 212  TRP A CA    1 
ATOM   1598 C  C     . TRP A 1 213 ? 42.094 -5.226  -10.297 1.00 42.75  ? 212  TRP A C     1 
ATOM   1599 O  O     . TRP A 1 213 ? 41.403 -4.626  -11.127 1.00 45.77  ? 212  TRP A O     1 
ATOM   1600 C  CB    . TRP A 1 213 ? 41.805 -3.295  -8.722  1.00 41.10  ? 212  TRP A CB    1 
ATOM   1601 C  CG    . TRP A 1 213 ? 41.410 -2.880  -7.342  1.00 41.08  ? 212  TRP A CG    1 
ATOM   1602 C  CD1   . TRP A 1 213 ? 42.148 -2.141  -6.463  1.00 40.91  ? 212  TRP A CD1   1 
ATOM   1603 C  CD2   . TRP A 1 213 ? 40.187 -3.203  -6.668  1.00 40.67  ? 212  TRP A CD2   1 
ATOM   1604 N  NE1   . TRP A 1 213 ? 41.455 -1.974  -5.286  1.00 42.64  ? 212  TRP A NE1   1 
ATOM   1605 C  CE2   . TRP A 1 213 ? 40.249 -2.617  -5.386  1.00 39.59  ? 212  TRP A CE2   1 
ATOM   1606 C  CE3   . TRP A 1 213 ? 39.044 -3.926  -7.026  1.00 39.25  ? 212  TRP A CE3   1 
ATOM   1607 C  CZ2   . TRP A 1 213 ? 39.212 -2.732  -4.463  1.00 36.41  ? 212  TRP A CZ2   1 
ATOM   1608 C  CZ3   . TRP A 1 213 ? 38.016 -4.039  -6.110  1.00 39.62  ? 212  TRP A CZ3   1 
ATOM   1609 C  CH2   . TRP A 1 213 ? 38.106 -3.444  -4.842  1.00 39.43  ? 212  TRP A CH2   1 
ATOM   1610 N  N     . GLY A 1 214 ? 42.885 -6.243  -10.632 1.00 39.14  ? 213  GLY A N     1 
ATOM   1611 C  CA    . GLY A 1 214 ? 42.831 -6.857  -11.943 1.00 38.57  ? 213  GLY A CA    1 
ATOM   1612 C  C     . GLY A 1 214 ? 43.479 -6.090  -13.073 1.00 38.71  ? 213  GLY A C     1 
ATOM   1613 O  O     . GLY A 1 214 ? 43.276 -6.455  -14.236 1.00 41.16  ? 213  GLY A O     1 
ATOM   1614 N  N     . LEU A 1 215 ? 44.252 -5.047  -12.782 1.00 36.91  ? 214  LEU A N     1 
ATOM   1615 C  CA    . LEU A 1 215 ? 44.881 -4.224  -13.811 1.00 34.23  ? 214  LEU A CA    1 
ATOM   1616 C  C     . LEU A 1 215 ? 46.382 -4.492  -13.809 1.00 36.96  ? 214  LEU A C     1 
ATOM   1617 O  O     . LEU A 1 215 ? 47.085 -4.128  -12.860 1.00 40.59  ? 214  LEU A O     1 
ATOM   1618 C  CB    . LEU A 1 215 ? 44.585 -2.743  -13.586 1.00 33.54  ? 214  LEU A CB    1 
ATOM   1619 C  CG    . LEU A 1 215 ? 43.115 -2.326  -13.689 1.00 36.03  ? 214  LEU A CG    1 
ATOM   1620 C  CD1   . LEU A 1 215 ? 42.942 -0.843  -13.383 1.00 33.26  ? 214  LEU A CD1   1 
ATOM   1621 C  CD2   . LEU A 1 215 ? 42.562 -2.657  -15.066 1.00 34.46  ? 214  LEU A CD2   1 
ATOM   1622 N  N     . THR A 1 216 ? 46.867 -5.127  -14.871 1.00 37.71  ? 215  THR A N     1 
ATOM   1623 C  CA    . THR A 1 216 ? 48.291 -5.376  -15.017 1.00 38.99  ? 215  THR A CA    1 
ATOM   1624 C  C     . THR A 1 216 ? 48.999 -4.135  -15.543 1.00 43.23  ? 215  THR A C     1 
ATOM   1625 O  O     . THR A 1 216 ? 48.410 -3.300  -16.236 1.00 45.89  ? 215  THR A O     1 
ATOM   1626 C  CB    . THR A 1 216 ? 48.548 -6.544  -15.970 1.00 39.88  ? 215  THR A CB    1 
ATOM   1627 O  OG1   . THR A 1 216 ? 48.097 -6.190  -17.283 1.00 39.72  ? 215  THR A OG1   1 
ATOM   1628 C  CG2   . THR A 1 216 ? 47.819 -7.796  -15.502 1.00 36.33  ? 215  THR A CG2   1 
ATOM   1629 N  N     . THR A 1 217 ? 50.280 -4.022  -15.207 1.00 41.66  ? 216  THR A N     1 
ATOM   1630 C  CA    . THR A 1 217 ? 51.139 -2.951  -15.705 1.00 38.53  ? 216  THR A CA    1 
ATOM   1631 C  C     . THR A 1 217 ? 52.371 -3.616  -16.299 1.00 37.82  ? 216  THR A C     1 
ATOM   1632 O  O     . THR A 1 217 ? 53.389 -3.791  -15.615 1.00 37.69  ? 216  THR A O     1 
ATOM   1633 C  CB    . THR A 1 217 ? 51.502 -1.961  -14.602 1.00 36.98  ? 216  THR A CB    1 
ATOM   1634 O  OG1   . THR A 1 217 ? 51.868 -2.678  -13.417 1.00 37.90  ? 216  THR A OG1   1 
ATOM   1635 C  CG2   . THR A 1 217 ? 50.321 -1.053  -14.297 1.00 31.97  ? 216  THR A CG2   1 
ATOM   1636 N  N     . PRO A 1 218 ? 52.312 -4.005  -17.570 1.00 35.70  ? 217  PRO A N     1 
ATOM   1637 C  CA    . PRO A 1 218 ? 53.423 -4.755  -18.164 1.00 41.81  ? 217  PRO A CA    1 
ATOM   1638 C  C     . PRO A 1 218 ? 54.677 -3.906  -18.289 1.00 43.48  ? 217  PRO A C     1 
ATOM   1639 O  O     . PRO A 1 218 ? 54.624 -2.704  -18.564 1.00 41.79  ? 217  PRO A O     1 
ATOM   1640 C  CB    . PRO A 1 218 ? 52.882 -5.160  -19.541 1.00 37.84  ? 217  PRO A CB    1 
ATOM   1641 C  CG    . PRO A 1 218 ? 51.834 -4.145  -19.846 1.00 38.25  ? 217  PRO A CG    1 
ATOM   1642 C  CD    . PRO A 1 218 ? 51.214 -3.782  -18.525 1.00 35.59  ? 217  PRO A CD    1 
ATOM   1643 N  N     . ASP A 1 219 ? 55.822 -4.565  -18.092 1.00 44.10  ? 218  ASP A N     1 
ATOM   1644 C  CA    . ASP A 1 219 ? 57.100 -3.864  -18.057 1.00 43.63  ? 218  ASP A CA    1 
ATOM   1645 C  C     . ASP A 1 219 ? 57.432 -3.215  -19.395 1.00 46.78  ? 218  ASP A C     1 
ATOM   1646 O  O     . ASP A 1 219 ? 58.122 -2.188  -19.429 1.00 46.35  ? 218  ASP A O     1 
ATOM   1647 C  CB    . ASP A 1 219 ? 58.208 -4.834  -17.644 1.00 45.63  ? 218  ASP A CB    1 
ATOM   1648 C  CG    . ASP A 1 219 ? 59.483 -4.126  -17.242 1.00 49.29  ? 218  ASP A CG    1 
ATOM   1649 O  OD1   . ASP A 1 219 ? 59.474 -3.436  -16.199 1.00 52.37  ? 218  ASP A OD1   1 
ATOM   1650 O  OD2   . ASP A 1 219 ? 60.493 -4.258  -17.967 1.00 46.58  ? 218  ASP A OD2   1 
ATOM   1651 N  N     . LYS A 1 220 ? 56.952 -3.790  -20.502 1.00 47.54  ? 219  LYS A N     1 
ATOM   1652 C  CA    . LYS A 1 220 ? 57.253 -3.245  -21.822 1.00 46.37  ? 219  LYS A CA    1 
ATOM   1653 C  C     . LYS A 1 220 ? 56.767 -1.810  -21.981 1.00 49.42  ? 219  LYS A C     1 
ATOM   1654 O  O     . LYS A 1 220 ? 57.319 -1.070  -22.801 1.00 53.74  ? 219  LYS A O     1 
ATOM   1655 C  CB    . LYS A 1 220 ? 56.644 -4.129  -22.913 1.00 41.78  ? 219  LYS A CB    1 
ATOM   1656 N  N     . LYS A 1 221 ? 55.753 -1.399  -21.217 1.00 49.13  ? 220  LYS A N     1 
ATOM   1657 C  CA    . LYS A 1 221 ? 55.269 -0.023  -21.229 1.00 49.64  ? 220  LYS A CA    1 
ATOM   1658 C  C     . LYS A 1 221 ? 55.505 0.682   -19.897 1.00 47.46  ? 220  LYS A C     1 
ATOM   1659 O  O     . LYS A 1 221 ? 54.793 1.635   -19.567 1.00 45.42  ? 220  LYS A O     1 
ATOM   1660 C  CB    . LYS A 1 221 ? 53.786 0.018   -21.598 1.00 52.82  ? 220  LYS A CB    1 
ATOM   1661 C  CG    . LYS A 1 221 ? 53.496 -0.429  -23.020 1.00 60.69  ? 220  LYS A CG    1 
ATOM   1662 C  CD    . LYS A 1 221 ? 52.068 -0.105  -23.416 1.00 65.37  ? 220  LYS A CD    1 
ATOM   1663 C  CE    . LYS A 1 221 ? 51.791 -0.495  -24.857 1.00 69.21  ? 220  LYS A CE    1 
ATOM   1664 N  NZ    . LYS A 1 221 ? 50.426 -0.073  -25.278 1.00 71.34  ? 220  LYS A NZ    1 
ATOM   1665 N  N     . HIS A 1 222 ? 56.490 0.228   -19.127 1.00 48.13  ? 221  HIS A N     1 
ATOM   1666 C  CA    . HIS A 1 222 ? 56.854 0.844   -17.852 1.00 43.88  ? 221  HIS A CA    1 
ATOM   1667 C  C     . HIS A 1 222 ? 58.087 1.706   -18.100 1.00 42.63  ? 221  HIS A C     1 
ATOM   1668 O  O     . HIS A 1 222 ? 59.210 1.201   -18.161 1.00 42.67  ? 221  HIS A O     1 
ATOM   1669 C  CB    . HIS A 1 222 ? 57.108 -0.224  -16.792 1.00 42.51  ? 221  HIS A CB    1 
ATOM   1670 C  CG    . HIS A 1 222 ? 57.392 0.322   -15.426 1.00 44.89  ? 221  HIS A CG    1 
ATOM   1671 N  ND1   . HIS A 1 222 ? 57.511 -0.485  -14.316 1.00 46.30  ? 221  HIS A ND1   1 
ATOM   1672 C  CD2   . HIS A 1 222 ? 57.582 1.590   -14.990 1.00 45.99  ? 221  HIS A CD2   1 
ATOM   1673 C  CE1   . HIS A 1 222 ? 57.763 0.261   -13.254 1.00 45.93  ? 221  HIS A CE1   1 
ATOM   1674 N  NE2   . HIS A 1 222 ? 57.812 1.524   -13.636 1.00 45.38  ? 221  HIS A NE2   1 
ATOM   1675 N  N     . GLN A 1 223 ? 57.877 3.010   -18.250 1.00 41.91  ? 222  GLN A N     1 
ATOM   1676 C  CA    . GLN A 1 223 ? 58.969 3.936   -18.515 1.00 44.44  ? 222  GLN A CA    1 
ATOM   1677 C  C     . GLN A 1 223 ? 59.578 4.392   -17.195 1.00 46.93  ? 222  GLN A C     1 
ATOM   1678 O  O     . GLN A 1 223 ? 58.865 4.866   -16.305 1.00 47.08  ? 222  GLN A O     1 
ATOM   1679 C  CB    . GLN A 1 223 ? 58.479 5.136   -19.324 1.00 42.92  ? 222  GLN A CB    1 
ATOM   1680 C  CG    . GLN A 1 223 ? 57.669 4.767   -20.555 1.00 35.80  ? 222  GLN A CG    1 
ATOM   1681 C  CD    . GLN A 1 223 ? 57.254 5.986   -21.357 1.00 39.41  ? 222  GLN A CD    1 
ATOM   1682 O  OE1   . GLN A 1 223 ? 58.092 6.803   -21.745 1.00 38.93  ? 222  GLN A OE1   1 
ATOM   1683 N  NE2   . GLN A 1 223 ? 55.956 6.121   -21.601 1.00 36.13  ? 222  GLN A NE2   1 
ATOM   1684 N  N     . LYS A 1 224 ? 60.896 4.246   -17.074 1.00 51.14  ? 223  LYS A N     1 
ATOM   1685 C  CA    . LYS A 1 224 ? 61.591 4.505   -15.823 1.00 50.74  ? 223  LYS A CA    1 
ATOM   1686 C  C     . LYS A 1 224 ? 62.670 5.573   -15.926 1.00 51.85  ? 223  LYS A C     1 
ATOM   1687 O  O     . LYS A 1 224 ? 63.259 5.928   -14.899 1.00 52.26  ? 223  LYS A O     1 
ATOM   1688 C  CB    . LYS A 1 224 ? 62.215 3.207   -15.291 1.00 51.26  ? 223  LYS A CB    1 
ATOM   1689 C  CG    . LYS A 1 224 ? 61.233 2.054   -15.190 1.00 53.06  ? 223  LYS A CG    1 
ATOM   1690 C  CD    . LYS A 1 224 ? 61.942 0.751   -14.871 1.00 55.85  ? 223  LYS A CD    1 
ATOM   1691 C  CE    . LYS A 1 224 ? 61.010 -0.430  -15.041 1.00 57.56  ? 223  LYS A CE    1 
ATOM   1692 N  NZ    . LYS A 1 224 ? 61.727 -1.716  -14.836 1.00 65.49  ? 223  LYS A NZ    1 
ATOM   1693 N  N     . GLU A 1 225 ? 62.949 6.094   -17.117 1.00 57.54  ? 224  GLU A N     1 
ATOM   1694 C  CA    . GLU A 1 225 ? 63.990 7.096   -17.303 1.00 63.42  ? 224  GLU A CA    1 
ATOM   1695 C  C     . GLU A 1 225 ? 63.574 8.102   -18.365 1.00 61.29  ? 224  GLU A C     1 
ATOM   1696 O  O     . GLU A 1 225 ? 62.885 7.746   -19.329 1.00 60.07  ? 224  GLU A O     1 
ATOM   1697 C  CB    . GLU A 1 225 ? 65.327 6.456   -17.707 1.00 71.62  ? 224  GLU A CB    1 
ATOM   1698 C  CG    . GLU A 1 225 ? 66.115 5.891   -16.541 1.00 80.94  ? 224  GLU A CG    1 
ATOM   1699 C  CD    . GLU A 1 225 ? 67.526 5.498   -16.928 1.00 92.64  ? 224  GLU A CD    1 
ATOM   1700 O  OE1   . GLU A 1 225 ? 68.003 4.446   -16.451 1.00 97.33  ? 224  GLU A OE1   1 
ATOM   1701 O  OE2   . GLU A 1 225 ? 68.158 6.240   -17.712 1.00 96.91  ? 224  GLU A OE2   1 
ATOM   1702 N  N     . PRO A 1 226 ? 63.984 9.359   -18.219 1.00 61.62  ? 225  PRO A N     1 
ATOM   1703 C  CA    . PRO A 1 226 ? 63.647 10.376  -19.219 1.00 58.23  ? 225  PRO A CA    1 
ATOM   1704 C  C     . PRO A 1 226 ? 64.445 10.170  -20.494 1.00 57.61  ? 225  PRO A C     1 
ATOM   1705 O  O     . PRO A 1 226 ? 65.533 9.576   -20.465 1.00 56.94  ? 225  PRO A O     1 
ATOM   1706 C  CB    . PRO A 1 226 ? 64.029 11.691  -18.523 1.00 57.31  ? 225  PRO A CB    1 
ATOM   1707 C  CG    . PRO A 1 226 ? 65.085 11.301  -17.556 1.00 58.91  ? 225  PRO A CG    1 
ATOM   1708 C  CD    . PRO A 1 226 ? 64.728 9.926   -17.081 1.00 60.62  ? 225  PRO A CD    1 
ATOM   1709 N  N     . PRO A 1 227 ? 63.940 10.649  -21.643 1.00 57.01  ? 226  PRO A N     1 
ATOM   1710 C  CA    . PRO A 1 227 ? 62.669 11.372  -21.783 1.00 52.42  ? 226  PRO A CA    1 
ATOM   1711 C  C     . PRO A 1 227 ? 61.444 10.457  -21.743 1.00 50.87  ? 226  PRO A C     1 
ATOM   1712 O  O     . PRO A 1 227 ? 61.422 9.421   -22.408 1.00 53.97  ? 226  PRO A O     1 
ATOM   1713 C  CB    . PRO A 1 227 ? 62.802 12.038  -23.154 1.00 52.52  ? 226  PRO A CB    1 
ATOM   1714 C  CG    . PRO A 1 227 ? 63.683 11.116  -23.921 1.00 55.40  ? 226  PRO A CG    1 
ATOM   1715 C  CD    . PRO A 1 227 ? 64.662 10.554  -22.925 1.00 55.63  ? 226  PRO A CD    1 
ATOM   1716 N  N     . PHE A 1 228 ? 60.440 10.840  -20.960 1.00 45.03  ? 227  PHE A N     1 
ATOM   1717 C  CA    . PHE A 1 228 ? 59.213 10.064  -20.871 1.00 43.90  ? 227  PHE A CA    1 
ATOM   1718 C  C     . PHE A 1 228 ? 58.279 10.434  -22.016 1.00 45.12  ? 227  PHE A C     1 
ATOM   1719 O  O     . PHE A 1 228 ? 58.036 11.614  -22.271 1.00 46.64  ? 227  PHE A O     1 
ATOM   1720 C  CB    . PHE A 1 228 ? 58.525 10.302  -19.526 1.00 40.64  ? 227  PHE A CB    1 
ATOM   1721 C  CG    . PHE A 1 228 ? 59.365 9.920   -18.339 1.00 42.16  ? 227  PHE A CG    1 
ATOM   1722 C  CD1   . PHE A 1 228 ? 59.373 8.615   -17.870 1.00 41.52  ? 227  PHE A CD1   1 
ATOM   1723 C  CD2   . PHE A 1 228 ? 60.147 10.864  -17.692 1.00 42.61  ? 227  PHE A CD2   1 
ATOM   1724 C  CE1   . PHE A 1 228 ? 60.147 8.259   -16.778 1.00 40.21  ? 227  PHE A CE1   1 
ATOM   1725 C  CE2   . PHE A 1 228 ? 60.922 10.514  -16.601 1.00 41.72  ? 227  PHE A CE2   1 
ATOM   1726 C  CZ    . PHE A 1 228 ? 60.922 9.208   -16.144 1.00 40.85  ? 227  PHE A CZ    1 
ATOM   1727 N  N     . LEU A 1 229 ? 57.763 9.428   -22.713 1.00 45.66  ? 228  LEU A N     1 
ATOM   1728 C  CA    . LEU A 1 229 ? 56.772 9.644   -23.758 1.00 45.79  ? 228  LEU A CA    1 
ATOM   1729 C  C     . LEU A 1 229 ? 55.390 9.668   -23.113 1.00 46.07  ? 228  LEU A C     1 
ATOM   1730 O  O     . LEU A 1 229 ? 54.952 8.664   -22.541 1.00 45.23  ? 228  LEU A O     1 
ATOM   1731 C  CB    . LEU A 1 229 ? 56.864 8.553   -24.824 1.00 47.82  ? 228  LEU A CB    1 
ATOM   1732 C  CG    . LEU A 1 229 ? 57.828 8.759   -25.999 1.00 51.99  ? 228  LEU A CG    1 
ATOM   1733 C  CD1   . LEU A 1 229 ? 59.123 9.443   -25.579 1.00 52.42  ? 228  LEU A CD1   1 
ATOM   1734 C  CD2   . LEU A 1 229 ? 58.130 7.422   -26.664 1.00 51.69  ? 228  LEU A CD2   1 
ATOM   1735 N  N     . TRP A 1 230 ? 54.708 10.810  -23.196 1.00 44.03  ? 229  TRP A N     1 
ATOM   1736 C  CA    . TRP A 1 230 ? 53.464 10.986  -22.452 1.00 40.58  ? 229  TRP A CA    1 
ATOM   1737 C  C     . TRP A 1 230 ? 52.561 11.980  -23.167 1.00 40.73  ? 229  TRP A C     1 
ATOM   1738 O  O     . TRP A 1 230 ? 52.932 13.146  -23.331 1.00 39.06  ? 229  TRP A O     1 
ATOM   1739 C  CB    . TRP A 1 230 ? 53.758 11.454  -21.026 1.00 40.43  ? 229  TRP A CB    1 
ATOM   1740 C  CG    . TRP A 1 230 ? 52.538 11.733  -20.213 1.00 38.54  ? 229  TRP A CG    1 
ATOM   1741 C  CD1   . TRP A 1 230 ? 51.701 10.816  -19.649 1.00 36.57  ? 229  TRP A CD1   1 
ATOM   1742 C  CD2   . TRP A 1 230 ? 52.022 13.020  -19.856 1.00 38.19  ? 229  TRP A CD2   1 
ATOM   1743 N  NE1   . TRP A 1 230 ? 50.690 11.452  -18.970 1.00 34.01  ? 229  TRP A NE1   1 
ATOM   1744 C  CE2   . TRP A 1 230 ? 50.867 12.806  -19.080 1.00 36.06  ? 229  TRP A CE2   1 
ATOM   1745 C  CE3   . TRP A 1 230 ? 52.421 14.333  -20.124 1.00 38.04  ? 229  TRP A CE3   1 
ATOM   1746 C  CZ2   . TRP A 1 230 ? 50.105 13.856  -18.571 1.00 35.71  ? 229  TRP A CZ2   1 
ATOM   1747 C  CZ3   . TRP A 1 230 ? 51.667 15.372  -19.616 1.00 36.00  ? 229  TRP A CZ3   1 
ATOM   1748 C  CH2   . TRP A 1 230 ? 50.522 15.128  -18.847 1.00 35.66  ? 229  TRP A CH2   1 
ATOM   1749 N  N     . MET A 1 231 ? 51.380 11.513  -23.581 1.00 41.23  ? 230  MET A N     1 
ATOM   1750 C  CA    . MET A 1 231 ? 50.335 12.359  -24.164 1.00 39.29  ? 230  MET A CA    1 
ATOM   1751 C  C     . MET A 1 231 ? 50.814 13.089  -25.417 1.00 45.58  ? 230  MET A C     1 
ATOM   1752 O  O     . MET A 1 231 ? 50.358 14.198  -25.715 1.00 48.76  ? 230  MET A O     1 
ATOM   1753 C  CB    . MET A 1 231 ? 49.799 13.359  -23.136 1.00 36.29  ? 230  MET A CB    1 
ATOM   1754 C  CG    . MET A 1 231 ? 49.140 12.709  -21.933 1.00 34.03  ? 230  MET A CG    1 
ATOM   1755 S  SD    . MET A 1 231 ? 47.612 11.848  -22.343 1.00 39.19  ? 230  MET A SD    1 
ATOM   1756 C  CE    . MET A 1 231 ? 46.512 13.231  -22.633 1.00 37.39  ? 230  MET A CE    1 
ATOM   1757 N  N     . GLY A 1 232 ? 51.720 12.473  -26.171 1.00 43.93  ? 231  GLY A N     1 
ATOM   1758 C  CA    . GLY A 1 232 ? 52.271 13.113  -27.347 1.00 43.76  ? 231  GLY A CA    1 
ATOM   1759 C  C     . GLY A 1 232 ? 53.417 14.060  -27.079 1.00 43.78  ? 231  GLY A C     1 
ATOM   1760 O  O     . GLY A 1 232 ? 53.811 14.804  -27.984 1.00 44.00  ? 231  GLY A O     1 
ATOM   1761 N  N     . TYR A 1 233 ? 53.962 14.058  -25.866 1.00 43.73  ? 232  TYR A N     1 
ATOM   1762 C  CA    . TYR A 1 233 ? 55.085 14.899  -25.491 1.00 42.58  ? 232  TYR A CA    1 
ATOM   1763 C  C     . TYR A 1 233 ? 56.263 14.038  -25.058 1.00 46.79  ? 232  TYR A C     1 
ATOM   1764 O  O     . TYR A 1 233 ? 56.119 12.851  -24.744 1.00 49.31  ? 232  TYR A O     1 
ATOM   1765 C  CB    . TYR A 1 233 ? 54.723 15.852  -24.343 1.00 40.12  ? 232  TYR A CB    1 
ATOM   1766 C  CG    . TYR A 1 233 ? 53.434 16.618  -24.528 1.00 41.73  ? 232  TYR A CG    1 
ATOM   1767 C  CD1   . TYR A 1 233 ? 53.415 17.842  -25.191 1.00 40.66  ? 232  TYR A CD1   1 
ATOM   1768 C  CD2   . TYR A 1 233 ? 52.237 16.128  -24.021 1.00 38.04  ? 232  TYR A CD2   1 
ATOM   1769 C  CE1   . TYR A 1 233 ? 52.235 18.548  -25.353 1.00 40.09  ? 232  TYR A CE1   1 
ATOM   1770 C  CE2   . TYR A 1 233 ? 51.055 16.824  -24.179 1.00 37.83  ? 232  TYR A CE2   1 
ATOM   1771 C  CZ    . TYR A 1 233 ? 51.058 18.034  -24.844 1.00 39.18  ? 232  TYR A CZ    1 
ATOM   1772 O  OH    . TYR A 1 233 ? 49.878 18.727  -24.996 1.00 36.64  ? 232  TYR A OH    1 
ATOM   1773 N  N     . GLU A 1 234 ? 57.432 14.667  -25.031 1.00 47.67  ? 233  GLU A N     1 
ATOM   1774 C  CA    . GLU A 1 234 ? 58.640 14.102  -24.444 1.00 46.83  ? 233  GLU A CA    1 
ATOM   1775 C  C     . GLU A 1 234 ? 58.968 14.937  -23.212 1.00 46.92  ? 233  GLU A C     1 
ATOM   1776 O  O     . GLU A 1 234 ? 59.302 16.123  -23.329 1.00 50.52  ? 233  GLU A O     1 
ATOM   1777 C  CB    . GLU A 1 234 ? 59.794 14.096  -25.445 1.00 45.14  ? 233  GLU A CB    1 
ATOM   1778 N  N     . LEU A 1 235 ? 58.845 14.324  -22.038 1.00 44.64  ? 234  LEU A N     1 
ATOM   1779 C  CA    . LEU A 1 235 ? 59.064 14.986  -20.760 1.00 44.77  ? 234  LEU A CA    1 
ATOM   1780 C  C     . LEU A 1 235 ? 60.492 14.732  -20.299 1.00 49.86  ? 234  LEU A C     1 
ATOM   1781 O  O     . LEU A 1 235 ? 60.891 13.579  -20.098 1.00 49.83  ? 234  LEU A O     1 
ATOM   1782 C  CB    . LEU A 1 235 ? 58.077 14.483  -19.707 1.00 41.85  ? 234  LEU A CB    1 
ATOM   1783 C  CG    . LEU A 1 235 ? 56.584 14.519  -20.030 1.00 40.25  ? 234  LEU A CG    1 
ATOM   1784 C  CD1   . LEU A 1 235 ? 55.786 14.013  -18.840 1.00 37.93  ? 234  LEU A CD1   1 
ATOM   1785 C  CD2   . LEU A 1 235 ? 56.146 15.924  -20.419 1.00 40.37  ? 234  LEU A CD2   1 
ATOM   1786 N  N     . HIS A 1 236 ? 61.248 15.800  -20.137 1.00 52.02  ? 235  HIS A N     1 
ATOM   1787 C  CA    . HIS A 1 236 ? 62.570 15.787  -19.537 1.00 50.38  ? 235  HIS A CA    1 
ATOM   1788 C  C     . HIS A 1 236 ? 62.484 16.313  -18.112 1.00 48.08  ? 235  HIS A C     1 
ATOM   1789 O  O     . HIS A 1 236 ? 61.437 16.807  -17.684 1.00 43.93  ? 235  HIS A O     1 
ATOM   1790 C  CB    . HIS A 1 236 ? 63.528 16.625  -20.386 1.00 52.39  ? 235  HIS A CB    1 
ATOM   1791 C  CG    . HIS A 1 236 ? 63.677 16.129  -21.791 1.00 55.29  ? 235  HIS A CG    1 
ATOM   1792 N  ND1   . HIS A 1 236 ? 62.829 16.509  -22.809 1.00 55.14  ? 235  HIS A ND1   1 
ATOM   1793 C  CD2   . HIS A 1 236 ? 64.570 15.275  -22.345 1.00 56.69  ? 235  HIS A CD2   1 
ATOM   1794 C  CE1   . HIS A 1 236 ? 63.198 15.917  -23.931 1.00 55.07  ? 235  HIS A CE1   1 
ATOM   1795 N  NE2   . HIS A 1 236 ? 64.251 15.161  -23.676 1.00 57.19  ? 235  HIS A NE2   1 
ATOM   1796 N  N     . PRO A 1 237 ? 63.557 16.187  -17.322 1.00 51.35  ? 236  PRO A N     1 
ATOM   1797 C  CA    . PRO A 1 237 ? 63.480 16.673  -15.930 1.00 52.25  ? 236  PRO A CA    1 
ATOM   1798 C  C     . PRO A 1 237 ? 63.108 18.143  -15.809 1.00 52.73  ? 236  PRO A C     1 
ATOM   1799 O  O     . PRO A 1 237 ? 62.250 18.494  -14.989 1.00 53.96  ? 236  PRO A O     1 
ATOM   1800 C  CB    . PRO A 1 237 ? 64.887 16.387  -15.392 1.00 54.39  ? 236  PRO A CB    1 
ATOM   1801 C  CG    . PRO A 1 237 ? 65.343 15.213  -16.171 1.00 54.91  ? 236  PRO A CG    1 
ATOM   1802 C  CD    . PRO A 1 237 ? 64.783 15.398  -17.553 1.00 54.34  ? 236  PRO A CD    1 
ATOM   1803 N  N     . ASP A 1 238 ? 63.723 19.017  -16.605 1.00 53.48  ? 237  ASP A N     1 
ATOM   1804 C  CA    . ASP A 1 238 ? 63.486 20.449  -16.494 1.00 56.45  ? 237  ASP A CA    1 
ATOM   1805 C  C     . ASP A 1 238 ? 62.732 21.042  -17.677 1.00 58.30  ? 237  ASP A C     1 
ATOM   1806 O  O     . ASP A 1 238 ? 62.260 22.180  -17.577 1.00 61.31  ? 237  ASP A O     1 
ATOM   1807 C  CB    . ASP A 1 238 ? 64.818 21.195  -16.320 1.00 56.08  ? 237  ASP A CB    1 
ATOM   1808 N  N     . LYS A 1 239 ? 62.601 20.314  -18.782 1.00 55.88  ? 238  LYS A N     1 
ATOM   1809 C  CA    . LYS A 1 239 ? 61.951 20.819  -19.981 1.00 52.43  ? 238  LYS A CA    1 
ATOM   1810 C  C     . LYS A 1 239 ? 61.001 19.761  -20.528 1.00 51.41  ? 238  LYS A C     1 
ATOM   1811 O  O     . LYS A 1 239 ? 61.019 18.600  -20.114 1.00 47.34  ? 238  LYS A O     1 
ATOM   1812 C  CB    . LYS A 1 239 ? 62.980 21.221  -21.048 1.00 49.76  ? 238  LYS A CB    1 
ATOM   1813 N  N     . TRP A 1 240 ? 60.148 20.182  -21.458 1.00 50.47  ? 239  TRP A N     1 
ATOM   1814 C  CA    . TRP A 1 240 ? 59.274 19.269  -22.176 1.00 48.89  ? 239  TRP A CA    1 
ATOM   1815 C  C     . TRP A 1 240 ? 59.159 19.743  -23.615 1.00 51.89  ? 239  TRP A C     1 
ATOM   1816 O  O     . TRP A 1 240 ? 59.172 20.948  -23.882 1.00 53.30  ? 239  TRP A O     1 
ATOM   1817 C  CB    . TRP A 1 240 ? 57.882 19.170  -21.525 1.00 45.40  ? 239  TRP A CB    1 
ATOM   1818 C  CG    . TRP A 1 240 ? 57.075 20.442  -21.560 1.00 43.46  ? 239  TRP A CG    1 
ATOM   1819 C  CD1   . TRP A 1 240 ? 57.009 21.400  -20.586 1.00 41.28  ? 239  TRP A CD1   1 
ATOM   1820 C  CD2   . TRP A 1 240 ? 56.210 20.884  -22.614 1.00 39.09  ? 239  TRP A CD2   1 
ATOM   1821 N  NE1   . TRP A 1 240 ? 56.164 22.412  -20.973 1.00 36.59  ? 239  TRP A NE1   1 
ATOM   1822 C  CE2   . TRP A 1 240 ? 55.660 22.121  -22.214 1.00 37.75  ? 239  TRP A CE2   1 
ATOM   1823 C  CE3   . TRP A 1 240 ? 55.851 20.359  -23.860 1.00 38.50  ? 239  TRP A CE3   1 
ATOM   1824 C  CZ2   . TRP A 1 240 ? 54.773 22.838  -23.014 1.00 37.79  ? 239  TRP A CZ2   1 
ATOM   1825 C  CZ3   . TRP A 1 240 ? 54.968 21.073  -24.652 1.00 39.63  ? 239  TRP A CZ3   1 
ATOM   1826 C  CH2   . TRP A 1 240 ? 54.439 22.299  -24.225 1.00 39.06  ? 239  TRP A CH2   1 
ATOM   1827 N  N     . THR A 1 241 ? 59.074 18.791  -24.541 1.00 52.30  ? 240  THR A N     1 
ATOM   1828 C  CA    . THR A 1 241 ? 58.912 19.104  -25.953 1.00 55.72  ? 240  THR A CA    1 
ATOM   1829 C  C     . THR A 1 241 ? 57.711 18.351  -26.503 1.00 58.49  ? 240  THR A C     1 
ATOM   1830 O  O     . THR A 1 241 ? 57.205 17.409  -25.888 1.00 59.60  ? 240  THR A O     1 
ATOM   1831 C  CB    . THR A 1 241 ? 60.160 18.746  -26.781 1.00 58.68  ? 240  THR A CB    1 
ATOM   1832 O  OG1   . THR A 1 241 ? 60.314 17.322  -26.830 1.00 61.46  ? 240  THR A OG1   1 
ATOM   1833 C  CG2   . THR A 1 241 ? 61.412 19.368  -26.179 1.00 58.87  ? 240  THR A CG2   1 
ATOM   1834 N  N     . VAL A 1 242 ? 57.260 18.775  -27.678 1.00 57.60  ? 241  VAL A N     1 
ATOM   1835 C  CA    . VAL A 1 242 ? 56.196 18.096  -28.403 1.00 56.98  ? 241  VAL A CA    1 
ATOM   1836 C  C     . VAL A 1 242 ? 56.841 17.146  -29.401 1.00 59.33  ? 241  VAL A C     1 
ATOM   1837 O  O     . VAL A 1 242 ? 57.811 17.513  -30.076 1.00 60.98  ? 241  VAL A O     1 
ATOM   1838 C  CB    . VAL A 1 242 ? 55.271 19.101  -29.111 1.00 57.33  ? 241  VAL A CB    1 
ATOM   1839 C  CG1   . VAL A 1 242 ? 54.285 18.383  -30.010 1.00 58.65  ? 241  VAL A CG1   1 
ATOM   1840 C  CG2   . VAL A 1 242 ? 54.532 19.947  -28.090 1.00 57.65  ? 241  VAL A CG2   1 
ATOM   1841 N  N     . GLN A 1 243 ? 56.322 15.924  -29.479 1.00 59.07  ? 242  GLN A N     1 
ATOM   1842 C  CA    . GLN A 1 243 ? 56.818 14.977  -30.467 1.00 62.82  ? 242  GLN A CA    1 
ATOM   1843 C  C     . GLN A 1 243 ? 56.669 15.572  -31.868 1.00 65.64  ? 242  GLN A C     1 
ATOM   1844 O  O     . GLN A 1 243 ? 55.704 16.301  -32.131 1.00 65.41  ? 242  GLN A O     1 
ATOM   1845 C  CB    . GLN A 1 243 ? 56.068 13.648  -30.346 1.00 60.86  ? 242  GLN A CB    1 
ATOM   1846 C  CG    . GLN A 1 243 ? 56.305 12.959  -29.008 1.00 59.63  ? 242  GLN A CG    1 
ATOM   1847 C  CD    . GLN A 1 243 ? 55.445 11.726  -28.808 1.00 61.38  ? 242  GLN A CD    1 
ATOM   1848 O  OE1   . GLN A 1 243 ? 55.043 11.069  -29.769 1.00 63.87  ? 242  GLN A OE1   1 
ATOM   1849 N  NE2   . GLN A 1 243 ? 55.157 11.405  -27.549 1.00 59.12  ? 242  GLN A NE2   1 
ATOM   1850 N  N     . PRO A 1 244 ? 57.599 15.291  -32.785 1.00 69.06  ? 243  PRO A N     1 
ATOM   1851 C  CA    . PRO A 1 244 ? 57.713 16.113  -33.999 1.00 71.41  ? 243  PRO A CA    1 
ATOM   1852 C  C     . PRO A 1 244 ? 56.441 16.123  -34.835 1.00 71.79  ? 243  PRO A C     1 
ATOM   1853 O  O     . PRO A 1 244 ? 55.738 15.117  -34.955 1.00 71.94  ? 243  PRO A O     1 
ATOM   1854 C  CB    . PRO A 1 244 ? 58.875 15.464  -34.758 1.00 73.87  ? 243  PRO A CB    1 
ATOM   1855 C  CG    . PRO A 1 244 ? 58.923 14.064  -34.258 1.00 73.69  ? 243  PRO A CG    1 
ATOM   1856 C  CD    . PRO A 1 244 ? 58.533 14.151  -32.807 1.00 71.30  ? 243  PRO A CD    1 
ATOM   1857 N  N     . ILE A 1 245 ? 56.160 17.283  -35.425 1.00 70.76  ? 244  ILE A N     1 
ATOM   1858 C  CA    . ILE A 1 245 ? 54.993 17.495  -36.274 1.00 69.84  ? 244  ILE A CA    1 
ATOM   1859 C  C     . ILE A 1 245 ? 55.462 17.547  -37.720 1.00 72.40  ? 244  ILE A C     1 
ATOM   1860 O  O     . ILE A 1 245 ? 56.279 18.401  -38.086 1.00 74.13  ? 244  ILE A O     1 
ATOM   1861 C  CB    . ILE A 1 245 ? 54.242 18.777  -35.888 1.00 66.96  ? 244  ILE A CB    1 
ATOM   1862 C  CG1   . ILE A 1 245 ? 53.560 18.591  -34.533 1.00 63.42  ? 244  ILE A CG1   1 
ATOM   1863 C  CG2   . ILE A 1 245 ? 53.234 19.154  -36.965 1.00 68.20  ? 244  ILE A CG2   1 
ATOM   1864 C  CD1   . ILE A 1 245 ? 53.535 19.834  -33.683 1.00 60.20  ? 244  ILE A CD1   1 
ATOM   1865 N  N     . VAL A 1 246 ? 54.947 16.637  -38.540 1.00 72.54  ? 245  VAL A N     1 
ATOM   1866 C  CA    . VAL A 1 246 ? 55.296 16.558  -39.952 1.00 73.42  ? 245  VAL A CA    1 
ATOM   1867 C  C     . VAL A 1 246 ? 54.126 17.149  -40.731 1.00 76.46  ? 245  VAL A C     1 
ATOM   1868 O  O     . VAL A 1 246 ? 53.080 16.512  -40.884 1.00 78.02  ? 245  VAL A O     1 
ATOM   1869 C  CB    . VAL A 1 246 ? 55.595 15.120  -40.386 1.00 70.49  ? 245  VAL A CB    1 
ATOM   1870 C  CG1   . VAL A 1 246 ? 56.303 15.110  -41.733 1.00 72.55  ? 245  VAL A CG1   1 
ATOM   1871 C  CG2   . VAL A 1 246 ? 56.423 14.404  -39.330 1.00 65.76  ? 245  VAL A CG2   1 
ATOM   1872 N  N     . LEU A 1 247 ? 54.300 18.368  -41.222 1.00 78.84  ? 246  LEU A N     1 
ATOM   1873 C  CA    . LEU A 1 247 ? 53.249 18.992  -42.011 1.00 82.52  ? 246  LEU A CA    1 
ATOM   1874 C  C     . LEU A 1 247 ? 53.338 18.518  -43.461 1.00 89.85  ? 246  LEU A C     1 
ATOM   1875 O  O     . LEU A 1 247 ? 54.440 18.396  -44.003 1.00 92.60  ? 246  LEU A O     1 
ATOM   1876 C  CB    . LEU A 1 247 ? 53.361 20.513  -41.950 1.00 80.91  ? 246  LEU A CB    1 
ATOM   1877 N  N     . PRO A 1 248 ? 52.202 18.234  -44.101 1.00 94.09  ? 247  PRO A N     1 
ATOM   1878 C  CA    . PRO A 1 248 ? 52.237 17.755  -45.490 1.00 98.94  ? 247  PRO A CA    1 
ATOM   1879 C  C     . PRO A 1 248 ? 52.909 18.757  -46.418 1.00 103.50 ? 247  PRO A C     1 
ATOM   1880 O  O     . PRO A 1 248 ? 52.863 19.970  -46.199 1.00 104.86 ? 247  PRO A O     1 
ATOM   1881 C  CB    . PRO A 1 248 ? 50.754 17.574  -45.840 1.00 97.73  ? 247  PRO A CB    1 
ATOM   1882 C  CG    . PRO A 1 248 ? 50.072 17.381  -44.523 1.00 94.28  ? 247  PRO A CG    1 
ATOM   1883 C  CD    . PRO A 1 248 ? 50.836 18.232  -43.547 1.00 92.16  ? 247  PRO A CD    1 
ATOM   1884 N  N     . GLU A 1 249 ? 53.541 18.233  -47.467 1.00 107.83 ? 248  GLU A N     1 
ATOM   1885 C  CA    . GLU A 1 249 ? 54.313 19.026  -48.422 1.00 110.30 ? 248  GLU A CA    1 
ATOM   1886 C  C     . GLU A 1 249 ? 53.912 18.685  -49.852 1.00 114.44 ? 248  GLU A C     1 
ATOM   1887 O  O     . GLU A 1 249 ? 54.752 18.466  -50.727 1.00 120.36 ? 248  GLU A O     1 
ATOM   1888 C  CB    . GLU A 1 249 ? 55.812 18.811  -48.224 1.00 111.90 ? 248  GLU A CB    1 
ATOM   1889 N  N     . LYS A 1 250 ? 52.609 18.640  -50.107 1.00 112.42 ? 249  LYS A N     1 
ATOM   1890 C  CA    . LYS A 1 250 ? 52.113 18.292  -51.428 1.00 111.01 ? 249  LYS A CA    1 
ATOM   1891 C  C     . LYS A 1 250 ? 52.145 19.504  -52.358 1.00 108.63 ? 249  LYS A C     1 
ATOM   1892 O  O     . LYS A 1 250 ? 52.349 20.645  -51.936 1.00 106.25 ? 249  LYS A O     1 
ATOM   1893 C  CB    . LYS A 1 250 ? 50.694 17.733  -51.335 1.00 108.20 ? 249  LYS A CB    1 
ATOM   1894 N  N     . ASP A 1 251 ? 51.945 19.238  -53.649 1.00 110.77 ? 250  ASP A N     1 
ATOM   1895 C  CA    . ASP A 1 251 ? 51.805 20.289  -54.650 1.00 115.20 ? 250  ASP A CA    1 
ATOM   1896 C  C     . ASP A 1 251 ? 50.357 20.554  -55.028 1.00 116.95 ? 250  ASP A C     1 
ATOM   1897 O  O     . ASP A 1 251 ? 50.027 21.671  -55.438 1.00 117.10 ? 250  ASP A O     1 
ATOM   1898 C  CB    . ASP A 1 251 ? 52.597 19.936  -55.914 1.00 121.42 ? 250  ASP A CB    1 
ATOM   1899 C  CG    . ASP A 1 251 ? 54.094 19.924  -55.679 1.00 123.99 ? 250  ASP A CG    1 
ATOM   1900 O  OD1   . ASP A 1 251 ? 54.551 20.594  -54.729 1.00 122.01 ? 250  ASP A OD1   1 
ATOM   1901 O  OD2   . ASP A 1 251 ? 54.813 19.247  -56.445 1.00 127.49 ? 250  ASP A OD2   1 
ATOM   1902 N  N     . SER A 1 252 ? 49.492 19.552  -54.907 1.00 120.28 ? 251  SER A N     1 
ATOM   1903 C  CA    . SER A 1 252 ? 48.054 19.719  -55.050 1.00 122.01 ? 251  SER A CA    1 
ATOM   1904 C  C     . SER A 1 252 ? 47.411 19.662  -53.671 1.00 114.87 ? 251  SER A C     1 
ATOM   1905 O  O     . SER A 1 252 ? 47.799 18.844  -52.831 1.00 115.40 ? 251  SER A O     1 
ATOM   1906 C  CB    . SER A 1 252 ? 47.460 18.638  -55.957 1.00 127.31 ? 251  SER A CB    1 
ATOM   1907 O  OG    . SER A 1 252 ? 46.053 18.767  -56.053 1.00 130.11 ? 251  SER A OG    1 
ATOM   1908 N  N     . TRP A 1 253 ? 46.431 20.531  -53.437 1.00 107.74 ? 252  TRP A N     1 
ATOM   1909 C  CA    . TRP A 1 253 ? 45.816 20.674  -52.123 1.00 99.31  ? 252  TRP A CA    1 
ATOM   1910 C  C     . TRP A 1 253 ? 44.316 20.444  -52.227 1.00 95.88  ? 252  TRP A C     1 
ATOM   1911 O  O     . TRP A 1 253 ? 43.623 21.161  -52.956 1.00 97.58  ? 252  TRP A O     1 
ATOM   1912 C  CB    . TRP A 1 253 ? 46.108 22.054  -51.532 1.00 96.21  ? 252  TRP A CB    1 
ATOM   1913 C  CG    . TRP A 1 253 ? 47.511 22.200  -51.031 1.00 93.38  ? 252  TRP A CG    1 
ATOM   1914 C  CD1   . TRP A 1 253 ? 48.537 22.861  -51.640 1.00 93.70  ? 252  TRP A CD1   1 
ATOM   1915 C  CD2   . TRP A 1 253 ? 48.044 21.663  -49.815 1.00 90.26  ? 252  TRP A CD2   1 
ATOM   1916 N  NE1   . TRP A 1 253 ? 49.676 22.774  -50.876 1.00 91.57  ? 252  TRP A NE1   1 
ATOM   1917 C  CE2   . TRP A 1 253 ? 49.400 22.042  -49.751 1.00 89.53  ? 252  TRP A CE2   1 
ATOM   1918 C  CE3   . TRP A 1 253 ? 47.506 20.902  -48.773 1.00 86.79  ? 252  TRP A CE3   1 
ATOM   1919 C  CZ2   . TRP A 1 253 ? 50.224 21.683  -48.686 1.00 87.11  ? 252  TRP A CZ2   1 
ATOM   1920 C  CZ3   . TRP A 1 253 ? 48.325 20.547  -47.719 1.00 83.39  ? 252  TRP A CZ3   1 
ATOM   1921 C  CH2   . TRP A 1 253 ? 49.669 20.938  -47.682 1.00 83.78  ? 252  TRP A CH2   1 
ATOM   1922 N  N     . THR A 1 254 ? 43.823 19.451  -51.495 1.00 91.29  ? 253  THR A N     1 
ATOM   1923 C  CA    . THR A 1 254 ? 42.397 19.188  -51.373 1.00 89.18  ? 253  THR A CA    1 
ATOM   1924 C  C     . THR A 1 254 ? 41.893 19.676  -50.018 1.00 86.88  ? 253  THR A C     1 
ATOM   1925 O  O     . THR A 1 254 ? 42.669 20.028  -49.126 1.00 85.63  ? 253  THR A O     1 
ATOM   1926 C  CB    . THR A 1 254 ? 42.102 17.696  -51.545 1.00 87.38  ? 253  THR A CB    1 
ATOM   1927 O  OG1   . THR A 1 254 ? 42.403 17.005  -50.327 1.00 84.22  ? 253  THR A OG1   1 
ATOM   1928 C  CG2   . THR A 1 254 ? 42.948 17.114  -52.664 1.00 90.16  ? 253  THR A CG2   1 
ATOM   1929 N  N     . VAL A 1 255 ? 40.566 19.686  -49.871 1.00 87.32  ? 254  VAL A N     1 
ATOM   1930 C  CA    . VAL A 1 255 ? 39.954 20.168  -48.635 1.00 85.04  ? 254  VAL A CA    1 
ATOM   1931 C  C     . VAL A 1 255 ? 40.399 19.321  -47.448 1.00 84.55  ? 254  VAL A C     1 
ATOM   1932 O  O     . VAL A 1 255 ? 40.685 19.846  -46.365 1.00 83.92  ? 254  VAL A O     1 
ATOM   1933 C  CB    . VAL A 1 255 ? 38.420 20.195  -48.777 1.00 84.95  ? 254  VAL A CB    1 
ATOM   1934 C  CG1   . VAL A 1 255 ? 37.752 20.284  -47.413 1.00 81.40  ? 254  VAL A CG1   1 
ATOM   1935 C  CG2   . VAL A 1 255 ? 37.993 21.360  -49.658 1.00 85.91  ? 254  VAL A CG2   1 
ATOM   1936 N  N     . ASN A 1 256 ? 40.474 18.002  -47.634 1.00 87.44  ? 255  ASN A N     1 
ATOM   1937 C  CA    . ASN A 1 256 ? 40.922 17.126  -46.555 1.00 86.60  ? 255  ASN A CA    1 
ATOM   1938 C  C     . ASN A 1 256 ? 42.370 17.417  -46.175 1.00 84.20  ? 255  ASN A C     1 
ATOM   1939 O  O     . ASN A 1 256 ? 42.720 17.434  -44.986 1.00 82.17  ? 255  ASN A O     1 
ATOM   1940 C  CB    . ASN A 1 256 ? 40.754 15.665  -46.974 1.00 91.10  ? 255  ASN A CB    1 
ATOM   1941 C  CG    . ASN A 1 256 ? 40.916 14.703  -45.817 1.00 90.97  ? 255  ASN A CG    1 
ATOM   1942 O  OD1   . ASN A 1 256 ? 39.955 14.399  -45.110 1.00 90.53  ? 255  ASN A OD1   1 
ATOM   1943 N  ND2   . ASN A 1 256 ? 42.134 14.213  -45.621 1.00 91.30  ? 255  ASN A ND2   1 
ATOM   1944 N  N     . ASP A 1 257 ? 43.226 17.653  -47.173 1.00 85.58  ? 256  ASP A N     1 
ATOM   1945 C  CA    . ASP A 1 257 ? 44.610 18.025  -46.897 1.00 83.81  ? 256  ASP A CA    1 
ATOM   1946 C  C     . ASP A 1 257 ? 44.682 19.332  -46.117 1.00 79.78  ? 256  ASP A C     1 
ATOM   1947 O  O     . ASP A 1 257 ? 45.495 19.470  -45.194 1.00 76.44  ? 256  ASP A O     1 
ATOM   1948 C  CB    . ASP A 1 257 ? 45.396 18.141  -48.204 1.00 88.17  ? 256  ASP A CB    1 
ATOM   1949 C  CG    . ASP A 1 257 ? 45.451 16.835  -48.976 1.00 90.81  ? 256  ASP A CG    1 
ATOM   1950 O  OD1   . ASP A 1 257 ? 45.381 15.761  -48.342 1.00 90.31  ? 256  ASP A OD1   1 
ATOM   1951 O  OD2   . ASP A 1 257 ? 45.572 16.883  -50.219 1.00 93.80  ? 256  ASP A OD2   1 
ATOM   1952 N  N     . ILE A 1 258 ? 43.837 20.303  -46.474 1.00 78.86  ? 257  ILE A N     1 
ATOM   1953 C  CA    . ILE A 1 258 ? 43.824 21.579  -45.763 1.00 75.82  ? 257  ILE A CA    1 
ATOM   1954 C  C     . ILE A 1 258 ? 43.384 21.381  -44.318 1.00 73.56  ? 257  ILE A C     1 
ATOM   1955 O  O     . ILE A 1 258 ? 43.955 21.973  -43.395 1.00 66.72  ? 257  ILE A O     1 
ATOM   1956 C  CB    . ILE A 1 258 ? 42.928 22.594  -46.496 1.00 77.41  ? 257  ILE A CB    1 
ATOM   1957 C  CG1   . ILE A 1 258 ? 43.485 22.891  -47.890 1.00 82.43  ? 257  ILE A CG1   1 
ATOM   1958 C  CG2   . ILE A 1 258 ? 42.805 23.883  -45.692 1.00 73.55  ? 257  ILE A CG2   1 
ATOM   1959 C  CD1   . ILE A 1 258 ? 44.829 23.585  -47.877 1.00 83.16  ? 257  ILE A CD1   1 
ATOM   1960 N  N     . CYS A 1 259 ? 42.359 20.552  -44.096 1.00 80.48  ? 258  CYS A N     1 
ATOM   1961 C  CA    . CYS A 1 259 ? 41.925 20.279  -42.728 1.00 83.89  ? 258  CYS A CA    1 
ATOM   1962 C  C     . CYS A 1 259 ? 43.039 19.628  -41.918 1.00 74.33  ? 258  CYS A C     1 
ATOM   1963 O  O     . CYS A 1 259 ? 43.274 20.000  -40.762 1.00 71.99  ? 258  CYS A O     1 
ATOM   1964 C  CB    . CYS A 1 259 ? 40.675 19.399  -42.730 1.00 97.64  ? 258  CYS A CB    1 
ATOM   1965 S  SG    . CYS A 1 259 ? 39.151 20.266  -43.161 1.00 109.68 ? 258  CYS A SG    1 
ATOM   1966 N  N     . LYS A 1 260 ? 43.746 18.664  -42.514 1.00 70.35  ? 259  LYS A N     1 
ATOM   1967 C  CA    . LYS A 1 260 ? 44.849 18.013  -41.808 1.00 68.10  ? 259  LYS A CA    1 
ATOM   1968 C  C     . LYS A 1 260 ? 45.956 19.008  -41.473 1.00 68.81  ? 259  LYS A C     1 
ATOM   1969 O  O     . LYS A 1 260 ? 46.480 19.016  -40.350 1.00 67.05  ? 259  LYS A O     1 
ATOM   1970 C  CB    . LYS A 1 260 ? 45.397 16.855  -42.645 1.00 67.50  ? 259  LYS A CB    1 
ATOM   1971 N  N     . LEU A 1 261 ? 46.314 19.864  -42.433 1.00 71.21  ? 260  LEU A N     1 
ATOM   1972 C  CA    . LEU A 1 261 ? 47.370 20.846  -42.207 1.00 71.31  ? 260  LEU A CA    1 
ATOM   1973 C  C     . LEU A 1 261 ? 46.976 21.849  -41.130 1.00 68.35  ? 260  LEU A C     1 
ATOM   1974 O  O     . LEU A 1 261 ? 47.792 22.200  -40.268 1.00 68.55  ? 260  LEU A O     1 
ATOM   1975 C  CB    . LEU A 1 261 ? 47.695 21.565  -43.515 1.00 76.01  ? 260  LEU A CB    1 
ATOM   1976 C  CG    . LEU A 1 261 ? 48.650 22.755  -43.449 1.00 75.50  ? 260  LEU A CG    1 
ATOM   1977 C  CD1   . LEU A 1 261 ? 50.069 22.302  -43.143 1.00 75.15  ? 260  LEU A CD1   1 
ATOM   1978 C  CD2   . LEU A 1 261 ? 48.592 23.527  -44.753 1.00 77.83  ? 260  LEU A CD2   1 
ATOM   1979 N  N     . VAL A 1 262 ? 45.729 22.319  -41.160 1.00 66.81  ? 261  VAL A N     1 
ATOM   1980 C  CA    . VAL A 1 262 ? 45.277 23.286  -40.166 1.00 63.98  ? 261  VAL A CA    1 
ATOM   1981 C  C     . VAL A 1 262 ? 45.228 22.647  -38.784 1.00 60.22  ? 261  VAL A C     1 
ATOM   1982 O  O     . VAL A 1 262 ? 45.586 23.280  -37.783 1.00 58.50  ? 261  VAL A O     1 
ATOM   1983 C  CB    . VAL A 1 262 ? 43.916 23.881  -40.575 1.00 63.31  ? 261  VAL A CB    1 
ATOM   1984 C  CG1   . VAL A 1 262 ? 43.302 24.662  -39.425 1.00 60.58  ? 261  VAL A CG1   1 
ATOM   1985 C  CG2   . VAL A 1 262 ? 44.081 24.782  -41.789 1.00 65.04  ? 261  VAL A CG2   1 
ATOM   1986 N  N     . GLY A 1 263 ? 44.798 21.385  -38.702 1.00 58.58  ? 262  GLY A N     1 
ATOM   1987 C  CA    . GLY A 1 263 ? 44.809 20.697  -37.421 1.00 55.65  ? 262  GLY A CA    1 
ATOM   1988 C  C     . GLY A 1 263 ? 46.210 20.527  -36.865 1.00 53.61  ? 262  GLY A C     1 
ATOM   1989 O  O     . GLY A 1 263 ? 46.444 20.729  -35.669 1.00 53.01  ? 262  GLY A O     1 
ATOM   1990 N  N     . LYS A 1 264 ? 47.163 20.164  -37.728 1.00 54.09  ? 263  LYS A N     1 
ATOM   1991 C  CA    . LYS A 1 264 ? 48.549 20.044  -37.283 1.00 52.22  ? 263  LYS A CA    1 
ATOM   1992 C  C     . LYS A 1 264 ? 49.101 21.388  -36.817 1.00 52.97  ? 263  LYS A C     1 
ATOM   1993 O  O     . LYS A 1 264 ? 49.809 21.459  -35.806 1.00 50.98  ? 263  LYS A O     1 
ATOM   1994 C  CB    . LYS A 1 264 ? 49.411 19.461  -38.403 1.00 54.84  ? 263  LYS A CB    1 
ATOM   1995 C  CG    . LYS A 1 264 ? 49.217 17.966  -38.612 1.00 58.12  ? 263  LYS A CG    1 
ATOM   1996 C  CD    . LYS A 1 264 ? 50.140 17.427  -39.695 1.00 62.30  ? 263  LYS A CD    1 
ATOM   1997 C  CE    . LYS A 1 264 ? 50.089 15.904  -39.760 1.00 63.16  ? 263  LYS A CE    1 
ATOM   1998 N  NZ    . LYS A 1 264 ? 50.581 15.273  -38.502 1.00 60.25  ? 263  LYS A NZ    1 
ATOM   1999 N  N     . LEU A 1 265 ? 48.783 22.470  -37.533 1.00 52.53  ? 264  LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 265 ? 49.275 23.782  -37.124 1.00 53.12  ? 264  LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 265 ? 48.651 24.225  -35.803 1.00 53.75  ? 264  LEU A C     1 
ATOM   2002 O  O     . LEU A 1 265 ? 49.333 24.816  -34.954 1.00 52.89  ? 264  LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 265 ? 49.010 24.807  -38.225 1.00 54.02  ? 264  LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 265 ? 49.894 24.680  -39.469 1.00 53.17  ? 264  LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 265 ? 49.422 25.618  -40.565 1.00 52.68  ? 264  LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 265 ? 51.351 24.954  -39.123 1.00 51.72  ? 264  LEU A CD2   1 
ATOM   2007 N  N     . ASN A 1 266 ? 47.358 23.946  -35.607 1.00 53.00  ? 265  ASN A N     1 
ATOM   2008 C  CA    . ASN A 1 266 ? 46.718 24.264  -34.334 1.00 51.53  ? 265  ASN A CA    1 
ATOM   2009 C  C     . ASN A 1 266 ? 47.353 23.482  -33.194 1.00 49.78  ? 265  ASN A C     1 
ATOM   2010 O  O     . ASN A 1 266 ? 47.586 24.029  -32.109 1.00 51.96  ? 265  ASN A O     1 
ATOM   2011 C  CB    . ASN A 1 266 ? 45.219 23.975  -34.409 1.00 56.08  ? 265  ASN A CB    1 
ATOM   2012 C  CG    . ASN A 1 266 ? 44.496 24.877  -35.392 1.00 62.24  ? 265  ASN A CG    1 
ATOM   2013 O  OD1   . ASN A 1 266 ? 44.792 26.068  -35.497 1.00 63.50  ? 265  ASN A OD1   1 
ATOM   2014 N  ND2   . ASN A 1 266 ? 43.540 24.309  -36.119 1.00 64.64  ? 265  ASN A ND2   1 
ATOM   2015 N  N     . TRP A 1 267 ? 47.639 22.199  -33.420 1.00 49.50  ? 266  TRP A N     1 
ATOM   2016 C  CA    . TRP A 1 267 ? 48.332 21.402  -32.412 1.00 46.07  ? 266  TRP A CA    1 
ATOM   2017 C  C     . TRP A 1 267 ? 49.728 21.952  -32.134 1.00 46.12  ? 266  TRP A C     1 
ATOM   2018 O  O     . TRP A 1 267 ? 50.202 21.918  -30.993 1.00 45.22  ? 266  TRP A O     1 
ATOM   2019 C  CB    . TRP A 1 267 ? 48.401 19.946  -32.871 1.00 45.51  ? 266  TRP A CB    1 
ATOM   2020 C  CG    . TRP A 1 267 ? 49.217 19.057  -31.994 1.00 45.30  ? 266  TRP A CG    1 
ATOM   2021 C  CD1   . TRP A 1 267 ? 50.405 18.460  -32.308 1.00 47.20  ? 266  TRP A CD1   1 
ATOM   2022 C  CD2   . TRP A 1 267 ? 48.907 18.653  -30.655 1.00 43.63  ? 266  TRP A CD2   1 
ATOM   2023 N  NE1   . TRP A 1 267 ? 50.853 17.709  -31.248 1.00 45.45  ? 266  TRP A NE1   1 
ATOM   2024 C  CE2   . TRP A 1 267 ? 49.952 17.811  -30.220 1.00 44.14  ? 266  TRP A CE2   1 
ATOM   2025 C  CE3   . TRP A 1 267 ? 47.847 18.919  -29.783 1.00 42.29  ? 266  TRP A CE3   1 
ATOM   2026 C  CZ2   . TRP A 1 267 ? 49.967 17.237  -28.952 1.00 42.66  ? 266  TRP A CZ2   1 
ATOM   2027 C  CZ3   . TRP A 1 267 ? 47.865 18.350  -28.523 1.00 41.39  ? 266  TRP A CZ3   1 
ATOM   2028 C  CH2   . TRP A 1 267 ? 48.918 17.518  -28.120 1.00 43.53  ? 266  TRP A CH2   1 
ATOM   2029 N  N     . ALA A 1 268 ? 50.398 22.469  -33.166 1.00 47.73  ? 267  ALA A N     1 
ATOM   2030 C  CA    . ALA A 1 268 ? 51.747 22.997  -32.990 1.00 46.06  ? 267  ALA A CA    1 
ATOM   2031 C  C     . ALA A 1 268 ? 51.749 24.319  -32.234 1.00 44.86  ? 267  ALA A C     1 
ATOM   2032 O  O     . ALA A 1 268 ? 52.713 24.624  -31.521 1.00 42.68  ? 267  ALA A O     1 
ATOM   2033 C  CB    . ALA A 1 268 ? 52.420 23.175  -34.350 1.00 44.75  ? 267  ALA A CB    1 
ATOM   2034 N  N     . SER A 1 269 ? 50.690 25.115  -32.380 1.00 45.24  ? 268  SER A N     1 
ATOM   2035 C  CA    . SER A 1 269 ? 50.676 26.455  -31.804 1.00 46.76  ? 268  SER A CA    1 
ATOM   2036 C  C     . SER A 1 269 ? 50.749 26.462  -30.280 1.00 46.06  ? 268  SER A C     1 
ATOM   2037 O  O     . SER A 1 269 ? 50.946 27.533  -29.695 1.00 45.37  ? 268  SER A O     1 
ATOM   2038 C  CB    . SER A 1 269 ? 49.424 27.203  -32.258 1.00 48.93  ? 268  SER A CB    1 
ATOM   2039 O  OG    . SER A 1 269 ? 48.252 26.566  -31.782 1.00 52.32  ? 268  SER A OG    1 
ATOM   2040 N  N     . GLN A 1 270 ? 50.596 25.310  -29.623 1.00 42.98  ? 269  GLN A N     1 
ATOM   2041 C  CA    . GLN A 1 270 ? 50.689 25.275  -28.169 1.00 37.58  ? 269  GLN A CA    1 
ATOM   2042 C  C     . GLN A 1 270 ? 52.102 25.547  -27.671 1.00 38.41  ? 269  GLN A C     1 
ATOM   2043 O  O     . GLN A 1 270 ? 52.269 25.973  -26.524 1.00 37.46  ? 269  GLN A O     1 
ATOM   2044 C  CB    . GLN A 1 270 ? 50.211 23.923  -27.638 1.00 35.58  ? 269  GLN A CB    1 
ATOM   2045 C  CG    . GLN A 1 270 ? 51.116 22.760  -28.008 1.00 34.52  ? 269  GLN A CG    1 
ATOM   2046 C  CD    . GLN A 1 270 ? 50.621 21.440  -27.455 1.00 36.91  ? 269  GLN A CD    1 
ATOM   2047 O  OE1   . GLN A 1 270 ? 50.402 21.300  -26.250 1.00 36.49  ? 269  GLN A OE1   1 
ATOM   2048 N  NE2   . GLN A 1 270 ? 50.431 20.463  -28.337 1.00 35.55  ? 269  GLN A NE2   1 
ATOM   2049 N  N     . ILE A 1 271 ? 53.119 25.292  -28.491 1.00 40.27  ? 270  ILE A N     1 
ATOM   2050 C  CA    . ILE A 1 271 ? 54.495 25.583  -28.098 1.00 42.53  ? 270  ILE A CA    1 
ATOM   2051 C  C     . ILE A 1 271 ? 55.262 26.378  -29.143 1.00 45.40  ? 270  ILE A C     1 
ATOM   2052 O  O     . ILE A 1 271 ? 56.258 27.040  -28.799 1.00 48.53  ? 270  ILE A O     1 
ATOM   2053 C  CB    . ILE A 1 271 ? 55.244 24.273  -27.751 1.00 42.56  ? 270  ILE A CB    1 
ATOM   2054 C  CG1   . ILE A 1 271 ? 56.578 24.567  -27.058 1.00 39.25  ? 270  ILE A CG1   1 
ATOM   2055 C  CG2   . ILE A 1 271 ? 55.444 23.422  -28.994 1.00 36.52  ? 270  ILE A CG2   1 
ATOM   2056 C  CD1   . ILE A 1 271 ? 56.447 25.427  -25.814 1.00 37.48  ? 270  ILE A CD1   1 
ATOM   2057 N  N     . TYR A 1 272 ? 54.841 26.388  -30.408 1.00 48.23  ? 271  TYR A N     1 
ATOM   2058 C  CA    . TYR A 1 272 ? 55.491 27.198  -31.431 1.00 52.42  ? 271  TYR A CA    1 
ATOM   2059 C  C     . TYR A 1 272 ? 54.798 28.550  -31.531 1.00 53.22  ? 271  TYR A C     1 
ATOM   2060 O  O     . TYR A 1 272 ? 53.608 28.598  -31.870 1.00 56.27  ? 271  TYR A O     1 
ATOM   2061 C  CB    . TYR A 1 272 ? 55.447 26.503  -32.781 1.00 57.04  ? 271  TYR A CB    1 
ATOM   2062 C  CG    . TYR A 1 272 ? 56.356 25.303  -32.902 1.00 60.03  ? 271  TYR A CG    1 
ATOM   2063 C  CD1   . TYR A 1 272 ? 55.930 24.039  -32.508 1.00 59.68  ? 271  TYR A CD1   1 
ATOM   2064 C  CD2   . TYR A 1 272 ? 57.637 25.429  -33.424 1.00 62.62  ? 271  TYR A CD2   1 
ATOM   2065 C  CE1   . TYR A 1 272 ? 56.760 22.937  -32.623 1.00 59.67  ? 271  TYR A CE1   1 
ATOM   2066 C  CE2   . TYR A 1 272 ? 58.473 24.333  -33.543 1.00 64.79  ? 271  TYR A CE2   1 
ATOM   2067 C  CZ    . TYR A 1 272 ? 58.029 23.091  -33.142 1.00 63.83  ? 271  TYR A CZ    1 
ATOM   2068 O  OH    . TYR A 1 272 ? 58.859 22.001  -33.259 1.00 67.82  ? 271  TYR A OH    1 
ATOM   2069 N  N     . PRO A 1 273 ? 55.482 29.656  -31.252 1.00 51.04  ? 272  PRO A N     1 
ATOM   2070 C  CA    . PRO A 1 273 ? 54.838 30.969  -31.348 1.00 51.20  ? 272  PRO A CA    1 
ATOM   2071 C  C     . PRO A 1 273 ? 54.722 31.456  -32.784 1.00 52.30  ? 272  PRO A C     1 
ATOM   2072 O  O     . PRO A 1 273 ? 55.536 31.131  -33.651 1.00 55.21  ? 272  PRO A O     1 
ATOM   2073 C  CB    . PRO A 1 273 ? 55.773 31.874  -30.538 1.00 50.23  ? 272  PRO A CB    1 
ATOM   2074 C  CG    . PRO A 1 273 ? 57.111 31.237  -30.694 1.00 52.34  ? 272  PRO A CG    1 
ATOM   2075 C  CD    . PRO A 1 273 ? 56.857 29.749  -30.733 1.00 51.68  ? 272  PRO A CD    1 
ATOM   2076 N  N     . GLY A 1 274 ? 53.680 32.251  -33.026 1.00 50.60  ? 273  GLY A N     1 
ATOM   2077 C  CA    . GLY A 1 274 ? 53.491 32.902  -34.304 1.00 52.79  ? 273  GLY A CA    1 
ATOM   2078 C  C     . GLY A 1 274 ? 52.692 32.131  -35.332 1.00 55.41  ? 273  GLY A C     1 
ATOM   2079 O  O     . GLY A 1 274 ? 52.581 32.597  -36.473 1.00 60.39  ? 273  GLY A O     1 
ATOM   2080 N  N     . ILE A 1 275 ? 52.134 30.971  -34.974 1.00 53.32  ? 274  ILE A N     1 
ATOM   2081 C  CA    . ILE A 1 275 ? 51.368 30.187  -35.936 1.00 54.26  ? 274  ILE A CA    1 
ATOM   2082 C  C     . ILE A 1 275 ? 50.125 30.959  -36.364 1.00 54.72  ? 274  ILE A C     1 
ATOM   2083 O  O     . ILE A 1 275 ? 49.440 31.581  -35.542 1.00 55.21  ? 274  ILE A O     1 
ATOM   2084 C  CB    . ILE A 1 275 ? 50.996 28.821  -35.333 1.00 55.19  ? 274  ILE A CB    1 
ATOM   2085 C  CG1   . ILE A 1 275 ? 52.255 28.014  -35.010 1.00 56.22  ? 274  ILE A CG1   1 
ATOM   2086 C  CG2   . ILE A 1 275 ? 50.093 28.037  -36.280 1.00 54.45  ? 274  ILE A CG2   1 
ATOM   2087 C  CD1   . ILE A 1 275 ? 53.019 27.561  -36.235 1.00 57.68  ? 274  ILE A CD1   1 
ATOM   2088 N  N     . LYS A 1 276 ? 49.835 30.932  -37.666 1.00 54.40  ? 275  LYS A N     1 
ATOM   2089 C  CA    . LYS A 1 276 ? 48.659 31.582  -38.229 1.00 55.60  ? 275  LYS A CA    1 
ATOM   2090 C  C     . LYS A 1 276 ? 47.964 30.623  -39.184 1.00 59.49  ? 275  LYS A C     1 
ATOM   2091 O  O     . LYS A 1 276 ? 48.620 29.962  -39.995 1.00 63.85  ? 275  LYS A O     1 
ATOM   2092 C  CB    . LYS A 1 276 ? 49.032 32.879  -38.967 1.00 56.85  ? 275  LYS A CB    1 
ATOM   2093 C  CG    . LYS A 1 276 ? 49.633 33.965  -38.082 1.00 52.39  ? 275  LYS A CG    1 
ATOM   2094 C  CD    . LYS A 1 276 ? 50.126 35.142  -38.913 1.00 52.09  ? 275  LYS A CD    1 
ATOM   2095 N  N     . VAL A 1 277 ? 46.635 30.541  -39.083 1.00 59.37  ? 276  VAL A N     1 
ATOM   2096 C  CA    . VAL A 1 277 ? 45.852 29.612  -39.890 1.00 61.48  ? 276  VAL A CA    1 
ATOM   2097 C  C     . VAL A 1 277 ? 44.656 30.267  -40.564 1.00 65.40  ? 276  VAL A C     1 
ATOM   2098 O  O     . VAL A 1 277 ? 43.893 29.577  -41.243 1.00 67.24  ? 276  VAL A O     1 
ATOM   2099 C  CB    . VAL A 1 277 ? 45.384 28.401  -39.055 1.00 57.21  ? 276  VAL A CB    1 
ATOM   2100 C  CG1   . VAL A 1 277 ? 46.576 27.644  -38.485 1.00 55.12  ? 276  VAL A CG1   1 
ATOM   2101 C  CG2   . VAL A 1 277 ? 44.441 28.850  -37.946 1.00 54.90  ? 276  VAL A CG2   1 
ATOM   2102 N  N     . ARG A 1 278 ? 44.466 31.580  -40.409 1.00 66.96  ? 277  ARG A N     1 
ATOM   2103 C  CA    . ARG A 1 278 ? 43.238 32.218  -40.879 1.00 68.83  ? 277  ARG A CA    1 
ATOM   2104 C  C     . ARG A 1 278 ? 43.110 32.140  -42.395 1.00 72.03  ? 277  ARG A C     1 
ATOM   2105 O  O     . ARG A 1 278 ? 42.052 31.776  -42.921 1.00 74.00  ? 277  ARG A O     1 
ATOM   2106 C  CB    . ARG A 1 278 ? 43.190 33.673  -40.413 1.00 70.00  ? 277  ARG A CB    1 
ATOM   2107 N  N     . GLN A 1 279 ? 44.177 32.492  -43.117 1.00 75.49  ? 278  GLN A N     1 
ATOM   2108 C  CA    . GLN A 1 279 ? 44.111 32.488  -44.575 1.00 77.93  ? 278  GLN A CA    1 
ATOM   2109 C  C     . GLN A 1 279 ? 43.952 31.079  -45.131 1.00 79.60  ? 278  GLN A C     1 
ATOM   2110 O  O     . GLN A 1 279 ? 43.335 30.896  -46.187 1.00 83.38  ? 278  GLN A O     1 
ATOM   2111 C  CB    . GLN A 1 279 ? 45.352 33.159  -45.163 1.00 78.69  ? 278  GLN A CB    1 
ATOM   2112 C  CG    . GLN A 1 279 ? 45.316 34.674  -45.083 1.00 78.79  ? 278  GLN A CG    1 
ATOM   2113 C  CD    . GLN A 1 279 ? 44.072 35.256  -45.727 1.00 79.26  ? 278  GLN A CD    1 
ATOM   2114 O  OE1   . GLN A 1 279 ? 43.828 35.064  -46.919 1.00 82.94  ? 278  GLN A OE1   1 
ATOM   2115 N  NE2   . GLN A 1 279 ? 43.273 35.963  -44.938 1.00 76.64  ? 278  GLN A NE2   1 
ATOM   2116 N  N     . LEU A 1 280 ? 44.497 30.075  -44.442 1.00 75.80  ? 279  LEU A N     1 
ATOM   2117 C  CA    . LEU A 1 280 ? 44.290 28.697  -44.870 1.00 73.71  ? 279  LEU A CA    1 
ATOM   2118 C  C     . LEU A 1 280 ? 42.879 28.225  -44.539 1.00 73.62  ? 279  LEU A C     1 
ATOM   2119 O  O     . LEU A 1 280 ? 42.276 27.468  -45.309 1.00 74.76  ? 279  LEU A O     1 
ATOM   2120 C  CB    . LEU A 1 280 ? 45.336 27.789  -44.224 1.00 68.97  ? 279  LEU A CB    1 
ATOM   2121 C  CG    . LEU A 1 280 ? 46.778 28.007  -44.685 1.00 65.92  ? 279  LEU A CG    1 
ATOM   2122 C  CD1   . LEU A 1 280 ? 47.760 27.427  -43.681 1.00 64.51  ? 279  LEU A CD1   1 
ATOM   2123 C  CD2   . LEU A 1 280 ? 46.993 27.389  -46.055 1.00 67.24  ? 279  LEU A CD2   1 
ATOM   2124 N  N     . SER A 1 281 ? 42.330 28.669  -43.405 1.00 71.78  ? 280  SER A N     1 
ATOM   2125 C  CA    . SER A 1 281 ? 40.968 28.288  -43.046 1.00 72.20  ? 280  SER A CA    1 
ATOM   2126 C  C     . SER A 1 281 ? 39.940 28.924  -43.973 1.00 75.52  ? 280  SER A C     1 
ATOM   2127 O  O     . SER A 1 281 ? 38.895 28.320  -44.243 1.00 76.67  ? 280  SER A O     1 
ATOM   2128 C  CB    . SER A 1 281 ? 40.677 28.670  -41.594 1.00 69.42  ? 280  SER A CB    1 
ATOM   2129 O  OG    . SER A 1 281 ? 41.464 27.910  -40.692 1.00 69.41  ? 280  SER A OG    1 
ATOM   2130 N  N     . LYS A 1 282 ? 40.215 30.136  -44.467 1.00 77.73  ? 281  LYS A N     1 
ATOM   2131 C  CA    . LYS A 1 282 ? 39.287 30.801  -45.377 1.00 79.45  ? 281  LYS A CA    1 
ATOM   2132 C  C     . LYS A 1 282 ? 39.082 30.022  -46.669 1.00 82.02  ? 281  LYS A C     1 
ATOM   2133 O  O     . LYS A 1 282 ? 38.069 30.224  -47.345 1.00 83.77  ? 281  LYS A O     1 
ATOM   2134 C  CB    . LYS A 1 282 ? 39.781 32.213  -45.697 1.00 81.50  ? 281  LYS A CB    1 
ATOM   2135 N  N     . LEU A 1 283 ? 40.014 29.138  -47.025 1.00 84.35  ? 282  LEU A N     1 
ATOM   2136 C  CA    . LEU A 1 283 ? 39.891 28.308  -48.218 1.00 87.14  ? 282  LEU A CA    1 
ATOM   2137 C  C     . LEU A 1 283 ? 38.769 27.282  -48.124 1.00 87.95  ? 282  LEU A C     1 
ATOM   2138 O  O     . LEU A 1 283 ? 38.512 26.585  -49.112 1.00 89.96  ? 282  LEU A O     1 
ATOM   2139 C  CB    . LEU A 1 283 ? 41.214 27.588  -48.491 1.00 86.56  ? 282  LEU A CB    1 
ATOM   2140 C  CG    . LEU A 1 283 ? 42.233 28.239  -49.429 1.00 89.86  ? 282  LEU A CG    1 
ATOM   2141 C  CD1   . LEU A 1 283 ? 42.545 29.663  -49.008 1.00 89.35  ? 282  LEU A CD1   1 
ATOM   2142 C  CD2   . LEU A 1 283 ? 43.507 27.407  -49.482 1.00 90.39  ? 282  LEU A CD2   1 
ATOM   2143 N  N     . LEU A 1 284 ? 38.093 27.172  -46.980 1.00 87.73  ? 283  LEU A N     1 
ATOM   2144 C  CA    . LEU A 1 284 ? 37.127 26.110  -46.736 1.00 89.61  ? 283  LEU A CA    1 
ATOM   2145 C  C     . LEU A 1 284 ? 35.689 26.617  -46.703 1.00 95.21  ? 283  LEU A C     1 
ATOM   2146 O  O     . LEU A 1 284 ? 34.807 25.931  -46.176 1.00 94.71  ? 283  LEU A O     1 
ATOM   2147 C  CB    . LEU A 1 284 ? 37.469 25.394  -45.430 1.00 82.92  ? 283  LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1 284 ? 38.897 24.851  -45.370 1.00 81.31  ? 283  LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1 284 ? 39.431 24.910  -43.953 1.00 77.54  ? 283  LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1 284 ? 38.947 23.430  -45.903 1.00 84.40  ? 283  LEU A CD2   1 
ATOM   2151 N  N     . ARG A 1 285 ? 35.431 27.800  -47.255 1.00 100.52 ? 284  ARG A N     1 
ATOM   2152 C  CA    . ARG A 1 285 ? 34.082 28.350  -47.273 1.00 102.78 ? 284  ARG A CA    1 
ATOM   2153 C  C     . ARG A 1 285 ? 33.258 27.660  -48.356 1.00 104.43 ? 284  ARG A C     1 
ATOM   2154 O  O     . ARG A 1 285 ? 33.653 27.639  -49.527 1.00 104.98 ? 284  ARG A O     1 
ATOM   2155 C  CB    . ARG A 1 285 ? 34.118 29.858  -47.513 1.00 106.43 ? 284  ARG A CB    1 
ATOM   2156 C  CG    . ARG A 1 285 ? 35.051 30.630  -46.596 1.00 105.32 ? 284  ARG A CG    1 
ATOM   2157 C  CD    . ARG A 1 285 ? 34.661 30.501  -45.136 1.00 104.09 ? 284  ARG A CD    1 
ATOM   2158 N  NE    . ARG A 1 285 ? 35.476 31.369  -44.291 1.00 104.24 ? 284  ARG A NE    1 
ATOM   2159 C  CZ    . ARG A 1 285 ? 35.092 32.564  -43.855 1.00 104.30 ? 284  ARG A CZ    1 
ATOM   2160 N  NH1   . ARG A 1 285 ? 33.895 33.035  -44.175 1.00 106.69 ? 284  ARG A NH1   1 
ATOM   2161 N  NH2   . ARG A 1 285 ? 35.903 33.286  -43.095 1.00 101.63 ? 284  ARG A NH2   1 
ATOM   2162 N  N     . GLY A 1 286 ? 32.119 27.091  -47.963 1.00 105.59 ? 285  GLY A N     1 
ATOM   2163 C  CA    . GLY A 1 286 ? 31.159 26.538  -48.896 1.00 110.36 ? 285  GLY A CA    1 
ATOM   2164 C  C     . GLY A 1 286 ? 31.616 25.347  -49.709 1.00 113.43 ? 285  GLY A C     1 
ATOM   2165 O  O     . GLY A 1 286 ? 30.872 24.911  -50.595 1.00 118.00 ? 285  GLY A O     1 
ATOM   2166 N  N     . THR A 1 287 ? 32.807 24.808  -49.454 1.00 111.83 ? 286  THR A N     1 
ATOM   2167 C  CA    . THR A 1 287 ? 33.267 23.642  -50.197 1.00 114.04 ? 286  THR A CA    1 
ATOM   2168 C  C     . THR A 1 287 ? 32.356 22.450  -49.927 1.00 113.51 ? 286  THR A C     1 
ATOM   2169 O  O     . THR A 1 287 ? 31.914 22.226  -48.797 1.00 111.50 ? 286  THR A O     1 
ATOM   2170 C  CB    . THR A 1 287 ? 34.711 23.303  -49.823 1.00 113.11 ? 286  THR A CB    1 
ATOM   2171 O  OG1   . THR A 1 287 ? 34.814 23.130  -48.405 1.00 109.74 ? 286  THR A OG1   1 
ATOM   2172 C  CG2   . THR A 1 287 ? 35.650 24.417  -50.265 1.00 113.92 ? 286  THR A CG2   1 
ATOM   2173 N  N     . LYS A 1 288 ? 32.074 21.681  -50.980 1.00 115.50 ? 287  LYS A N     1 
ATOM   2174 C  CA    . LYS A 1 288 ? 31.072 20.625  -50.880 1.00 114.73 ? 287  LYS A CA    1 
ATOM   2175 C  C     . LYS A 1 288 ? 31.602 19.423  -50.105 1.00 111.59 ? 287  LYS A C     1 
ATOM   2176 O  O     . LYS A 1 288 ? 31.075 19.073  -49.042 1.00 108.97 ? 287  LYS A O     1 
ATOM   2177 C  CB    . LYS A 1 288 ? 30.615 20.208  -52.280 1.00 120.11 ? 287  LYS A CB    1 
ATOM   2178 N  N     . ALA A 1 289 ? 32.649 18.780  -50.617 1.00 109.64 ? 288  ALA A N     1 
ATOM   2179 C  CA    . ALA A 1 289 ? 33.152 17.535  -50.052 1.00 104.36 ? 288  ALA A CA    1 
ATOM   2180 C  C     . ALA A 1 289 ? 34.651 17.650  -49.806 1.00 97.61  ? 288  ALA A C     1 
ATOM   2181 O  O     . ALA A 1 289 ? 35.286 18.658  -50.132 1.00 97.17  ? 288  ALA A O     1 
ATOM   2182 C  CB    . ALA A 1 289 ? 32.839 16.345  -50.969 1.00 107.56 ? 288  ALA A CB    1 
ATOM   2183 N  N     . LEU A 1 290 ? 35.218 16.586  -49.229 1.00 92.44  ? 289  LEU A N     1 
ATOM   2184 C  CA    . LEU A 1 290 ? 36.624 16.603  -48.836 1.00 89.29  ? 289  LEU A CA    1 
ATOM   2185 C  C     . LEU A 1 290 ? 37.548 16.558  -50.048 1.00 92.98  ? 289  LEU A C     1 
ATOM   2186 O  O     . LEU A 1 290 ? 38.600 17.207  -50.055 1.00 93.54  ? 289  LEU A O     1 
ATOM   2187 C  CB    . LEU A 1 290 ? 36.916 15.432  -47.898 1.00 87.17  ? 289  LEU A CB    1 
ATOM   2188 C  CG    . LEU A 1 290 ? 36.135 15.385  -46.583 1.00 84.62  ? 289  LEU A CG    1 
ATOM   2189 C  CD1   . LEU A 1 290 ? 36.407 14.086  -45.842 1.00 83.58  ? 289  LEU A CD1   1 
ATOM   2190 C  CD2   . LEU A 1 290 ? 36.484 16.580  -45.710 1.00 82.25  ? 289  LEU A CD2   1 
ATOM   2191 N  N     . THR A 1 291 ? 37.178 15.799  -51.080 1.00 95.39  ? 290  THR A N     1 
ATOM   2192 C  CA    . THR A 1 291 ? 38.044 15.631  -52.243 1.00 97.90  ? 290  THR A CA    1 
ATOM   2193 C  C     . THR A 1 291 ? 38.107 16.866  -53.136 1.00 97.96  ? 290  THR A C     1 
ATOM   2194 O  O     . THR A 1 291 ? 38.824 16.835  -54.142 1.00 100.52 ? 290  THR A O     1 
ATOM   2195 C  CB    . THR A 1 291 ? 37.589 14.427  -53.072 1.00 101.27 ? 290  THR A CB    1 
ATOM   2196 O  OG1   . THR A 1 291 ? 36.223 14.604  -53.467 1.00 102.81 ? 290  THR A OG1   1 
ATOM   2197 C  CG2   . THR A 1 291 ? 37.718 13.141  -52.268 1.00 99.03  ? 290  THR A CG2   1 
ATOM   2198 N  N     . GLU A 1 292 ? 37.390 17.939  -52.807 1.00 95.17  ? 291  GLU A N     1 
ATOM   2199 C  CA    . GLU A 1 292 ? 37.388 19.133  -53.645 1.00 96.98  ? 291  GLU A CA    1 
ATOM   2200 C  C     . GLU A 1 292 ? 38.760 19.798  -53.617 1.00 96.72  ? 291  GLU A C     1 
ATOM   2201 O  O     . GLU A 1 292 ? 39.238 20.210  -52.555 1.00 93.62  ? 291  GLU A O     1 
ATOM   2202 C  CB    . GLU A 1 292 ? 36.311 20.107  -53.174 1.00 96.39  ? 291  GLU A CB    1 
ATOM   2203 N  N     . VAL A 1 293 ? 39.394 19.900  -54.785 1.00 101.50 ? 292  VAL A N     1 
ATOM   2204 C  CA    . VAL A 1 293 ? 40.685 20.568  -54.883 1.00 100.51 ? 292  VAL A CA    1 
ATOM   2205 C  C     . VAL A 1 293 ? 40.494 22.068  -54.705 1.00 101.40 ? 292  VAL A C     1 
ATOM   2206 O  O     . VAL A 1 293 ? 39.631 22.683  -55.345 1.00 104.00 ? 292  VAL A O     1 
ATOM   2207 C  CB    . VAL A 1 293 ? 41.359 20.242  -56.224 1.00 99.85  ? 292  VAL A CB    1 
ATOM   2208 C  CG1   . VAL A 1 293 ? 42.320 21.350  -56.630 1.00 98.28  ? 292  VAL A CG1   1 
ATOM   2209 C  CG2   . VAL A 1 293 ? 42.096 18.916  -56.131 1.00 98.87  ? 292  VAL A CG2   1 
ATOM   2210 N  N     . ILE A 1 294 ? 41.297 22.663  -53.828 1.00 98.78  ? 293  ILE A N     1 
ATOM   2211 C  CA    . ILE A 1 294 ? 41.231 24.098  -53.565 1.00 97.54  ? 293  ILE A CA    1 
ATOM   2212 C  C     . ILE A 1 294 ? 42.577 24.729  -53.903 1.00 100.34 ? 293  ILE A C     1 
ATOM   2213 O  O     . ILE A 1 294 ? 43.560 24.514  -53.179 1.00 97.98  ? 293  ILE A O     1 
ATOM   2214 C  CB    . ILE A 1 294 ? 40.839 24.380  -52.106 1.00 90.74  ? 293  ILE A CB    1 
ATOM   2215 N  N     . PRO A 1 295 ? 42.673 25.496  -54.989 1.00 105.18 ? 294  PRO A N     1 
ATOM   2216 C  CA    . PRO A 1 295 ? 43.931 26.193  -55.292 1.00 107.12 ? 294  PRO A CA    1 
ATOM   2217 C  C     . PRO A 1 295 ? 44.269 27.208  -54.210 1.00 104.26 ? 294  PRO A C     1 
ATOM   2218 O  O     . PRO A 1 295 ? 43.418 27.989  -53.777 1.00 101.96 ? 294  PRO A O     1 
ATOM   2219 C  CB    . PRO A 1 295 ? 43.645 26.870  -56.639 1.00 111.80 ? 294  PRO A CB    1 
ATOM   2220 C  CG    . PRO A 1 295 ? 42.514 26.086  -57.230 1.00 113.50 ? 294  PRO A CG    1 
ATOM   2221 C  CD    . PRO A 1 295 ? 41.677 25.658  -56.061 1.00 109.44 ? 294  PRO A CD    1 
ATOM   2222 N  N     . LEU A 1 296 ? 45.527 27.191  -53.775 1.00 104.19 ? 295  LEU A N     1 
ATOM   2223 C  CA    . LEU A 1 296 ? 45.954 28.036  -52.667 1.00 101.07 ? 295  LEU A CA    1 
ATOM   2224 C  C     . LEU A 1 296 ? 45.974 29.504  -53.074 1.00 104.21 ? 295  LEU A C     1 
ATOM   2225 O  O     . LEU A 1 296 ? 46.486 29.860  -54.140 1.00 109.52 ? 295  LEU A O     1 
ATOM   2226 C  CB    . LEU A 1 296 ? 47.338 27.608  -52.181 1.00 96.81  ? 295  LEU A CB    1 
ATOM   2227 C  CG    . LEU A 1 296 ? 47.392 26.771  -50.902 1.00 89.60  ? 295  LEU A CG    1 
ATOM   2228 C  CD1   . LEU A 1 296 ? 46.411 25.617  -50.971 1.00 89.20  ? 295  LEU A CD1   1 
ATOM   2229 C  CD2   . LEU A 1 296 ? 48.804 26.260  -50.663 1.00 88.26  ? 295  LEU A CD2   1 
ATOM   2230 N  N     . THR A 1 297 ? 45.413 30.355  -52.219 1.00 102.40 ? 296  THR A N     1 
ATOM   2231 C  CA    . THR A 1 297 ? 45.513 31.794  -52.408 1.00 105.76 ? 296  THR A CA    1 
ATOM   2232 C  C     . THR A 1 297 ? 46.950 32.250  -52.172 1.00 107.06 ? 296  THR A C     1 
ATOM   2233 O  O     . THR A 1 297 ? 47.718 31.605  -51.454 1.00 105.01 ? 296  THR A O     1 
ATOM   2234 C  CB    . THR A 1 297 ? 44.565 32.524  -51.451 1.00 105.48 ? 296  THR A CB    1 
ATOM   2235 O  OG1   . THR A 1 297 ? 43.306 31.841  -51.411 1.00 106.79 ? 296  THR A OG1   1 
ATOM   2236 C  CG2   . THR A 1 297 ? 44.333 33.962  -51.903 1.00 107.66 ? 296  THR A CG2   1 
ATOM   2237 N  N     . GLU A 1 298 ? 47.317 33.368  -52.805 1.00 109.26 ? 297  GLU A N     1 
ATOM   2238 C  CA    . GLU A 1 298 ? 48.634 33.951  -52.564 1.00 108.57 ? 297  GLU A CA    1 
ATOM   2239 C  C     . GLU A 1 298 ? 48.834 34.254  -51.084 1.00 103.38 ? 297  GLU A C     1 
ATOM   2240 O  O     . GLU A 1 298 ? 49.907 33.991  -50.525 1.00 103.80 ? 297  GLU A O     1 
ATOM   2241 C  CB    . GLU A 1 298 ? 48.810 35.216  -53.403 1.00 111.29 ? 297  GLU A CB    1 
ATOM   2242 N  N     . GLU A 1 299 ? 47.805 34.800  -50.431 1.00 99.17  ? 298  GLU A N     1 
ATOM   2243 C  CA    . GLU A 1 299 ? 47.877 35.018  -48.990 1.00 95.94  ? 298  GLU A CA    1 
ATOM   2244 C  C     . GLU A 1 299 ? 48.015 33.697  -48.244 1.00 96.14  ? 298  GLU A C     1 
ATOM   2245 O  O     . GLU A 1 299 ? 48.793 33.593  -47.287 1.00 93.75  ? 298  GLU A O     1 
ATOM   2246 C  CB    . GLU A 1 299 ? 46.641 35.780  -48.513 1.00 93.67  ? 298  GLU A CB    1 
ATOM   2247 N  N     . ALA A 1 300 ? 47.273 32.672  -48.673 1.00 98.40  ? 299  ALA A N     1 
ATOM   2248 C  CA    . ALA A 1 300 ? 47.401 31.357  -48.054 1.00 97.55  ? 299  ALA A CA    1 
ATOM   2249 C  C     . ALA A 1 300 ? 48.788 30.773  -48.290 1.00 98.30  ? 299  ALA A C     1 
ATOM   2250 O  O     . ALA A 1 300 ? 49.365 30.145  -47.396 1.00 95.62  ? 299  ALA A O     1 
ATOM   2251 C  CB    . ALA A 1 300 ? 46.320 30.417  -48.589 1.00 97.83  ? 299  ALA A CB    1 
ATOM   2252 N  N     . GLU A 1 301 ? 49.341 30.977  -49.489 1.00 102.21 ? 300  GLU A N     1 
ATOM   2253 C  CA    . GLU A 1 301 ? 50.697 30.517  -49.774 1.00 105.79 ? 300  GLU A CA    1 
ATOM   2254 C  C     . GLU A 1 301 ? 51.705 31.162  -48.831 1.00 103.51 ? 300  GLU A C     1 
ATOM   2255 O  O     . GLU A 1 301 ? 52.562 30.480  -48.255 1.00 101.75 ? 300  GLU A O     1 
ATOM   2256 C  CB    . GLU A 1 301 ? 51.054 30.815  -51.231 1.00 114.70 ? 300  GLU A CB    1 
ATOM   2257 C  CG    . GLU A 1 301 ? 50.403 29.885  -52.243 1.00 122.24 ? 300  GLU A CG    1 
ATOM   2258 C  CD    . GLU A 1 301 ? 50.702 30.282  -53.677 1.00 130.60 ? 300  GLU A CD    1 
ATOM   2259 O  OE1   . GLU A 1 301 ? 50.166 31.314  -54.135 1.00 133.02 ? 300  GLU A OE1   1 
ATOM   2260 O  OE2   . GLU A 1 301 ? 51.481 29.569  -54.345 1.00 134.39 ? 300  GLU A OE2   1 
ATOM   2261 N  N     . LEU A 1 302 ? 51.615 32.484  -48.661 1.00 103.32 ? 301  LEU A N     1 
ATOM   2262 C  CA    . LEU A 1 302 ? 52.559 33.180  -47.791 1.00 101.39 ? 301  LEU A CA    1 
ATOM   2263 C  C     . LEU A 1 302 ? 52.394 32.755  -46.336 1.00 97.70  ? 301  LEU A C     1 
ATOM   2264 O  O     . LEU A 1 302 ? 53.388 32.569  -45.621 1.00 97.80  ? 301  LEU A O     1 
ATOM   2265 C  CB    . LEU A 1 302 ? 52.390 34.693  -47.935 1.00 100.86 ? 301  LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1 302 ? 53.326 35.394  -48.923 1.00 103.50 ? 301  LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1 302 ? 54.771 35.271  -48.462 1.00 103.20 ? 301  LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1 302 ? 53.165 34.842  -50.334 1.00 106.75 ? 301  LEU A CD2   1 
ATOM   2269 N  N     . GLU A 1 303 ? 51.148 32.599  -45.880 1.00 94.42  ? 302  GLU A N     1 
ATOM   2270 C  CA    . GLU A 1 303 ? 50.912 32.151  -44.512 1.00 89.05  ? 302  GLU A CA    1 
ATOM   2271 C  C     . GLU A 1 303 ? 51.495 30.763  -44.283 1.00 85.19  ? 302  GLU A C     1 
ATOM   2272 O  O     . GLU A 1 303 ? 52.129 30.505  -43.249 1.00 83.04  ? 302  GLU A O     1 
ATOM   2273 C  CB    . GLU A 1 303 ? 49.413 32.165  -44.212 1.00 88.01  ? 302  GLU A CB    1 
ATOM   2274 C  CG    . GLU A 1 303 ? 49.061 32.015  -42.741 1.00 85.48  ? 302  GLU A CG    1 
ATOM   2275 C  CD    . GLU A 1 303 ? 47.566 31.915  -42.511 1.00 85.69  ? 302  GLU A CD    1 
ATOM   2276 O  OE1   . GLU A 1 303 ? 46.911 31.108  -43.204 1.00 87.66  ? 302  GLU A OE1   1 
ATOM   2277 O  OE2   . GLU A 1 303 ? 47.043 32.648  -41.645 1.00 84.05  ? 302  GLU A OE2   1 
ATOM   2278 N  N     . LEU A 1 304 ? 51.297 29.856  -45.243 1.00 85.53  ? 303  LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 304 ? 51.849 28.513  -45.119 1.00 84.57  ? 303  LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 304 ? 53.370 28.543  -45.100 1.00 84.94  ? 303  LEU A C     1 
ATOM   2281 O  O     . LEU A 1 304 ? 54.000 27.812  -44.329 1.00 83.93  ? 303  LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 304 ? 51.339 27.629  -46.258 1.00 86.89  ? 303  LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 304 ? 51.850 26.188  -46.279 1.00 86.05  ? 303  LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 304 ? 51.608 25.520  -44.934 1.00 81.19  ? 303  LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 304 ? 51.191 25.401  -47.401 1.00 86.89  ? 303  LEU A CD2   1 
ATOM   2286 N  N     . ALA A 1 305 ? 53.980 29.383  -45.941 1.00 86.02  ? 304  ALA A N     1 
ATOM   2287 C  CA    . ALA A 1 305 ? 55.436 29.496  -45.941 1.00 86.17  ? 304  ALA A CA    1 
ATOM   2288 C  C     . ALA A 1 305 ? 55.952 29.992  -44.594 1.00 81.89  ? 304  ALA A C     1 
ATOM   2289 O  O     . ALA A 1 305 ? 56.944 29.469  -44.067 1.00 81.57  ? 304  ALA A O     1 
ATOM   2290 C  CB    . ALA A 1 305 ? 55.891 30.423  -47.068 1.00 89.60  ? 304  ALA A CB    1 
ATOM   2291 N  N     . GLU A 1 306 ? 55.289 30.999  -44.020 1.00 78.55  ? 305  GLU A N     1 
ATOM   2292 C  CA    . GLU A 1 306 ? 55.714 31.514  -42.720 1.00 77.39  ? 305  GLU A CA    1 
ATOM   2293 C  C     . GLU A 1 306 ? 55.583 30.451  -41.633 1.00 74.25  ? 305  GLU A C     1 
ATOM   2294 O  O     . GLU A 1 306 ? 56.476 30.301  -40.787 1.00 72.98  ? 305  GLU A O     1 
ATOM   2295 C  CB    . GLU A 1 306 ? 54.904 32.759  -42.358 1.00 76.44  ? 305  GLU A CB    1 
ATOM   2296 N  N     . ASN A 1 307 ? 54.473 29.705  -41.637 1.00 71.91  ? 306  ASN A N     1 
ATOM   2297 C  CA    . ASN A 1 307 ? 54.306 28.629  -40.662 1.00 66.35  ? 306  ASN A CA    1 
ATOM   2298 C  C     . ASN A 1 307 ? 55.383 27.561  -40.824 1.00 68.75  ? 306  ASN A C     1 
ATOM   2299 O  O     . ASN A 1 307 ? 55.948 27.082  -39.831 1.00 68.30  ? 306  ASN A O     1 
ATOM   2300 C  CB    . ASN A 1 307 ? 52.914 28.010  -40.793 1.00 62.35  ? 306  ASN A CB    1 
ATOM   2301 C  CG    . ASN A 1 307 ? 51.815 28.916  -40.269 1.00 58.87  ? 306  ASN A CG    1 
ATOM   2302 O  OD1   . ASN A 1 307 ? 51.903 29.450  -39.162 1.00 56.70  ? 306  ASN A OD1   1 
ATOM   2303 N  ND2   . ASN A 1 307 ? 50.767 29.091  -41.066 1.00 60.27  ? 306  ASN A ND2   1 
ATOM   2304 N  N     . ARG A 1 308 ? 55.680 27.172  -42.069 1.00 71.77  ? 307  ARG A N     1 
ATOM   2305 C  CA    . ARG A 1 308 ? 56.714 26.170  -42.310 1.00 76.71  ? 307  ARG A CA    1 
ATOM   2306 C  C     . ARG A 1 308 ? 58.069 26.647  -41.811 1.00 80.07  ? 307  ARG A C     1 
ATOM   2307 O  O     . ARG A 1 308 ? 58.845 25.864  -41.251 1.00 79.84  ? 307  ARG A O     1 
ATOM   2308 C  CB    . ARG A 1 308 ? 56.794 25.829  -43.798 1.00 80.06  ? 307  ARG A CB    1 
ATOM   2309 C  CG    . ARG A 1 308 ? 55.538 25.202  -44.373 1.00 81.53  ? 307  ARG A CG    1 
ATOM   2310 C  CD    . ARG A 1 308 ? 55.767 24.703  -45.791 1.00 86.20  ? 307  ARG A CD    1 
ATOM   2311 N  NE    . ARG A 1 308 ? 56.234 23.322  -45.793 1.00 89.13  ? 307  ARG A NE    1 
ATOM   2312 C  CZ    . ARG A 1 308 ? 55.432 22.267  -45.892 1.00 90.41  ? 307  ARG A CZ    1 
ATOM   2313 N  NH1   . ARG A 1 308 ? 54.121 22.436  -46.007 1.00 89.67  ? 307  ARG A NH1   1 
ATOM   2314 N  NH2   . ARG A 1 308 ? 55.939 21.043  -45.878 1.00 91.63  ? 307  ARG A NH2   1 
ATOM   2315 N  N     . GLU A 1 309 ? 58.375 27.931  -42.008 1.00 83.09  ? 308  GLU A N     1 
ATOM   2316 C  CA    . GLU A 1 309 ? 59.653 28.446  -41.532 1.00 85.57  ? 308  GLU A CA    1 
ATOM   2317 C  C     . GLU A 1 309 ? 59.712 28.461  -40.010 1.00 81.85  ? 308  GLU A C     1 
ATOM   2318 O  O     . GLU A 1 309 ? 60.732 28.082  -39.421 1.00 81.14  ? 308  GLU A O     1 
ATOM   2319 C  CB    . GLU A 1 309 ? 59.910 29.838  -42.104 1.00 90.61  ? 308  GLU A CB    1 
ATOM   2320 C  CG    . GLU A 1 309 ? 60.183 29.825  -43.597 1.00 99.05  ? 308  GLU A CG    1 
ATOM   2321 C  CD    . GLU A 1 309 ? 61.220 28.784  -43.987 1.00 104.33 ? 308  GLU A CD    1 
ATOM   2322 O  OE1   . GLU A 1 309 ? 62.279 28.716  -43.327 1.00 105.07 ? 308  GLU A OE1   1 
ATOM   2323 O  OE2   . GLU A 1 309 ? 60.969 28.026  -44.948 1.00 106.71 ? 308  GLU A OE2   1 
ATOM   2324 N  N     . ILE A 1 310 ? 58.628 28.880  -39.352 1.00 78.97  ? 309  ILE A N     1 
ATOM   2325 C  CA    . ILE A 1 310 ? 58.653 28.924  -37.894 1.00 77.11  ? 309  ILE A CA    1 
ATOM   2326 C  C     . ILE A 1 310 ? 58.660 27.523  -37.288 1.00 75.52  ? 309  ILE A C     1 
ATOM   2327 O  O     . ILE A 1 310 ? 59.110 27.349  -36.149 1.00 72.09  ? 309  ILE A O     1 
ATOM   2328 C  CB    . ILE A 1 310 ? 57.478 29.760  -37.350 1.00 75.52  ? 309  ILE A CB    1 
ATOM   2329 C  CG1   . ILE A 1 310 ? 57.921 30.555  -36.120 1.00 76.05  ? 309  ILE A CG1   1 
ATOM   2330 C  CG2   . ILE A 1 310 ? 56.301 28.876  -36.989 1.00 72.49  ? 309  ILE A CG2   1 
ATOM   2331 C  CD1   . ILE A 1 310 ? 59.090 31.484  -36.379 1.00 77.75  ? 309  ILE A CD1   1 
ATOM   2332 N  N     . LEU A 1 311 ? 58.189 26.513  -38.024 1.00 76.40  ? 310  LEU A N     1 
ATOM   2333 C  CA    . LEU A 1 311 ? 58.209 25.146  -37.516 1.00 76.31  ? 310  LEU A CA    1 
ATOM   2334 C  C     . LEU A 1 311 ? 59.587 24.496  -37.578 1.00 78.31  ? 310  LEU A C     1 
ATOM   2335 O  O     . LEU A 1 311 ? 59.770 23.418  -37.002 1.00 74.96  ? 310  LEU A O     1 
ATOM   2336 C  CB    . LEU A 1 311 ? 57.205 24.281  -38.283 1.00 77.02  ? 310  LEU A CB    1 
ATOM   2337 C  CG    . LEU A 1 311 ? 55.778 24.238  -37.734 1.00 74.56  ? 310  LEU A CG    1 
ATOM   2338 C  CD1   . LEU A 1 311 ? 54.897 23.369  -38.614 1.00 76.07  ? 310  LEU A CD1   1 
ATOM   2339 C  CD2   . LEU A 1 311 ? 55.774 23.727  -36.302 1.00 71.60  ? 310  LEU A CD2   1 
ATOM   2340 N  N     . LYS A 1 312 ? 60.556 25.114  -38.255 1.00 83.34  ? 311  LYS A N     1 
ATOM   2341 C  CA    . LYS A 1 312 ? 61.888 24.531  -38.355 1.00 86.88  ? 311  LYS A CA    1 
ATOM   2342 C  C     . LYS A 1 312 ? 62.744 24.786  -37.121 1.00 88.73  ? 311  LYS A C     1 
ATOM   2343 O  O     . LYS A 1 312 ? 63.717 24.058  -36.900 1.00 90.19  ? 311  LYS A O     1 
ATOM   2344 C  CB    . LYS A 1 312 ? 62.606 25.069  -39.595 1.00 88.54  ? 311  LYS A CB    1 
ATOM   2345 C  CG    . LYS A 1 312 ? 61.985 24.623  -40.907 1.00 89.46  ? 311  LYS A CG    1 
ATOM   2346 C  CD    . LYS A 1 312 ? 62.624 25.330  -42.091 1.00 92.39  ? 311  LYS A CD    1 
ATOM   2347 C  CE    . LYS A 1 312 ? 61.974 24.908  -43.398 1.00 93.86  ? 311  LYS A CE    1 
ATOM   2348 N  NZ    . LYS A 1 312 ? 62.440 25.739  -44.543 1.00 97.42  ? 311  LYS A NZ    1 
ATOM   2349 N  N     . GLU A 1 313 ? 62.409 25.793  -36.318 1.00 91.26  ? 312  GLU A N     1 
ATOM   2350 C  CA    . GLU A 1 313 ? 63.214 26.127  -35.156 1.00 87.09  ? 312  GLU A CA    1 
ATOM   2351 C  C     . GLU A 1 313 ? 62.917 25.180  -33.993 1.00 83.07  ? 312  GLU A C     1 
ATOM   2352 O  O     . GLU A 1 313 ? 61.786 24.709  -33.838 1.00 80.85  ? 312  GLU A O     1 
ATOM   2353 C  CB    . GLU A 1 313 ? 62.953 27.567  -34.726 1.00 84.31  ? 312  GLU A CB    1 
ATOM   2354 N  N     . PRO A 1 314 ? 63.918 24.879  -33.168 1.00 79.90  ? 313  PRO A N     1 
ATOM   2355 C  CA    . PRO A 1 314 ? 63.675 24.044  -31.986 1.00 75.58  ? 313  PRO A CA    1 
ATOM   2356 C  C     . PRO A 1 314 ? 63.067 24.856  -30.854 1.00 71.10  ? 313  PRO A C     1 
ATOM   2357 O  O     . PRO A 1 314 ? 63.417 26.019  -30.635 1.00 71.33  ? 313  PRO A O     1 
ATOM   2358 C  CB    . PRO A 1 314 ? 65.076 23.541  -31.621 1.00 77.97  ? 313  PRO A CB    1 
ATOM   2359 C  CG    . PRO A 1 314 ? 65.978 24.642  -32.078 1.00 81.06  ? 313  PRO A CG    1 
ATOM   2360 C  CD    . PRO A 1 314 ? 65.345 25.218  -33.322 1.00 82.37  ? 313  PRO A CD    1 
ATOM   2361 N  N     . VAL A 1 315 ? 62.146 24.228  -30.124 1.00 66.00  ? 314  VAL A N     1 
ATOM   2362 C  CA    . VAL A 1 315 ? 61.426 24.905  -29.055 1.00 61.66  ? 314  VAL A CA    1 
ATOM   2363 C  C     . VAL A 1 315 ? 61.043 23.880  -27.996 1.00 55.92  ? 314  VAL A C     1 
ATOM   2364 O  O     . VAL A 1 315 ? 60.921 22.684  -28.276 1.00 55.55  ? 314  VAL A O     1 
ATOM   2365 C  CB    . VAL A 1 315 ? 60.184 25.652  -29.602 1.00 63.94  ? 314  VAL A CB    1 
ATOM   2366 C  CG1   . VAL A 1 315 ? 59.064 24.670  -29.937 1.00 62.97  ? 314  VAL A CG1   1 
ATOM   2367 C  CG2   . VAL A 1 315 ? 59.715 26.719  -28.619 1.00 63.48  ? 314  VAL A CG2   1 
ATOM   2368 N  N     . HIS A 1 316 ? 60.866 24.357  -26.768 1.00 52.95  ? 315  HIS A N     1 
ATOM   2369 C  CA    . HIS A 1 316 ? 60.485 23.507  -25.652 1.00 53.16  ? 315  HIS A CA    1 
ATOM   2370 C  C     . HIS A 1 316 ? 59.725 24.351  -24.640 1.00 50.83  ? 315  HIS A C     1 
ATOM   2371 O  O     . HIS A 1 316 ? 59.675 25.579  -24.736 1.00 51.71  ? 315  HIS A O     1 
ATOM   2372 C  CB    . HIS A 1 316 ? 61.708 22.848  -25.005 1.00 54.78  ? 315  HIS A CB    1 
ATOM   2373 C  CG    . HIS A 1 316 ? 62.697 23.825  -24.451 1.00 57.47  ? 315  HIS A CG    1 
ATOM   2374 N  ND1   . HIS A 1 316 ? 62.548 24.417  -23.215 1.00 56.41  ? 315  HIS A ND1   1 
ATOM   2375 C  CD2   . HIS A 1 316 ? 63.848 24.320  -24.968 1.00 59.56  ? 315  HIS A CD2   1 
ATOM   2376 C  CE1   . HIS A 1 316 ? 63.565 25.230  -22.993 1.00 57.84  ? 315  HIS A CE1   1 
ATOM   2377 N  NE2   . HIS A 1 316 ? 64.368 25.190  -24.041 1.00 59.39  ? 315  HIS A NE2   1 
ATOM   2378 N  N     . GLY A 1 317 ? 59.119 23.670  -23.664 1.00 48.29  ? 316  GLY A N     1 
ATOM   2379 C  CA    . GLY A 1 317 ? 58.442 24.324  -22.570 1.00 44.88  ? 316  GLY A CA    1 
ATOM   2380 C  C     . GLY A 1 317 ? 59.107 23.989  -21.243 1.00 46.11  ? 316  GLY A C     1 
ATOM   2381 O  O     . GLY A 1 317 ? 60.033 23.174  -21.168 1.00 52.53  ? 316  GLY A O     1 
ATOM   2382 N  N     . VAL A 1 318 ? 58.622 24.641  -20.190 1.00 41.98  ? 317  VAL A N     1 
ATOM   2383 C  CA    . VAL A 1 318 ? 59.078 24.385  -18.833 1.00 39.85  ? 317  VAL A CA    1 
ATOM   2384 C  C     . VAL A 1 318 ? 57.873 23.979  -17.991 1.00 38.70  ? 317  VAL A C     1 
ATOM   2385 O  O     . VAL A 1 318 ? 56.727 24.045  -18.432 1.00 40.38  ? 317  VAL A O     1 
ATOM   2386 C  CB    . VAL A 1 318 ? 59.796 25.600  -18.217 1.00 40.02  ? 317  VAL A CB    1 
ATOM   2387 C  CG1   . VAL A 1 318 ? 61.018 25.963  -19.042 1.00 41.14  ? 317  VAL A CG1   1 
ATOM   2388 C  CG2   . VAL A 1 318 ? 58.843 26.777  -18.110 1.00 35.91  ? 317  VAL A CG2   1 
ATOM   2389 N  N     . TYR A 1 319 ? 58.152 23.550  -16.765 1.00 40.31  ? 318  TYR A N     1 
ATOM   2390 C  CA    . TYR A 1 319 ? 57.107 23.134  -15.844 1.00 37.81  ? 318  TYR A CA    1 
ATOM   2391 C  C     . TYR A 1 319 ? 56.699 24.291  -14.933 1.00 34.80  ? 318  TYR A C     1 
ATOM   2392 O  O     . TYR A 1 319 ? 57.368 25.321  -14.847 1.00 36.32  ? 318  TYR A O     1 
ATOM   2393 C  CB    . TYR A 1 319 ? 57.569 21.931  -15.022 1.00 34.25  ? 318  TYR A CB    1 
ATOM   2394 C  CG    . TYR A 1 319 ? 57.917 20.726  -15.867 1.00 39.93  ? 318  TYR A CG    1 
ATOM   2395 C  CD1   . TYR A 1 319 ? 56.943 20.070  -16.611 1.00 40.74  ? 318  TYR A CD1   1 
ATOM   2396 C  CD2   . TYR A 1 319 ? 59.217 20.241  -15.919 1.00 41.08  ? 318  TYR A CD2   1 
ATOM   2397 C  CE1   . TYR A 1 319 ? 57.255 18.967  -17.388 1.00 40.71  ? 318  TYR A CE1   1 
ATOM   2398 C  CE2   . TYR A 1 319 ? 59.538 19.139  -16.692 1.00 43.47  ? 318  TYR A CE2   1 
ATOM   2399 C  CZ    . TYR A 1 319 ? 58.552 18.507  -17.423 1.00 43.26  ? 318  TYR A CZ    1 
ATOM   2400 O  OH    . TYR A 1 319 ? 58.866 17.411  -18.194 1.00 47.53  ? 318  TYR A OH    1 
ATOM   2401 N  N     . TYR A 1 320 ? 55.585 24.098  -14.234 1.00 35.06  ? 319  TYR A N     1 
ATOM   2402 C  CA    . TYR A 1 320 ? 54.966 25.147  -13.437 1.00 33.57  ? 319  TYR A CA    1 
ATOM   2403 C  C     . TYR A 1 320 ? 55.536 25.169  -12.024 1.00 37.30  ? 319  TYR A C     1 
ATOM   2404 O  O     . TYR A 1 320 ? 55.580 24.137  -11.347 1.00 39.96  ? 319  TYR A O     1 
ATOM   2405 C  CB    . TYR A 1 320 ? 53.452 24.941  -13.393 1.00 33.42  ? 319  TYR A CB    1 
ATOM   2406 C  CG    . TYR A 1 320 ? 52.697 25.942  -12.550 1.00 35.99  ? 319  TYR A CG    1 
ATOM   2407 C  CD1   . TYR A 1 320 ? 52.753 27.301  -12.829 1.00 39.57  ? 319  TYR A CD1   1 
ATOM   2408 C  CD2   . TYR A 1 320 ? 51.904 25.523  -11.491 1.00 38.48  ? 319  TYR A CD2   1 
ATOM   2409 C  CE1   . TYR A 1 320 ? 52.051 28.218  -12.065 1.00 40.02  ? 319  TYR A CE1   1 
ATOM   2410 C  CE2   . TYR A 1 320 ? 51.201 26.428  -10.721 1.00 41.25  ? 319  TYR A CE2   1 
ATOM   2411 C  CZ    . TYR A 1 320 ? 51.277 27.774  -11.013 1.00 41.76  ? 319  TYR A CZ    1 
ATOM   2412 O  OH    . TYR A 1 320 ? 50.576 28.674  -10.246 1.00 42.45  ? 319  TYR A OH    1 
ATOM   2413 N  N     . ASP A 1 321 ? 55.968 26.351  -11.588 1.00 40.68  ? 320  ASP A N     1 
ATOM   2414 C  CA    . ASP A 1 321 ? 56.370 26.596  -10.208 1.00 41.14  ? 320  ASP A CA    1 
ATOM   2415 C  C     . ASP A 1 321 ? 55.294 27.437  -9.536  1.00 44.15  ? 320  ASP A C     1 
ATOM   2416 O  O     . ASP A 1 321 ? 55.162 28.630  -9.855  1.00 45.44  ? 320  ASP A O     1 
ATOM   2417 C  CB    . ASP A 1 321 ? 57.723 27.308  -10.158 1.00 43.62  ? 320  ASP A CB    1 
ATOM   2418 C  CG    . ASP A 1 321 ? 58.191 27.597  -8.738  1.00 48.51  ? 320  ASP A CG    1 
ATOM   2419 O  OD1   . ASP A 1 321 ? 57.508 27.194  -7.772  1.00 48.74  ? 320  ASP A OD1   1 
ATOM   2420 O  OD2   . ASP A 1 321 ? 59.257 28.232  -8.590  1.00 50.86  ? 320  ASP A OD2   1 
ATOM   2421 N  N     . PRO A 1 322 ? 54.511 26.880  -8.607  1.00 45.33  ? 321  PRO A N     1 
ATOM   2422 C  CA    . PRO A 1 322 ? 53.377 27.634  -8.049  1.00 43.68  ? 321  PRO A CA    1 
ATOM   2423 C  C     . PRO A 1 322 ? 53.780 28.793  -7.154  1.00 46.74  ? 321  PRO A C     1 
ATOM   2424 O  O     . PRO A 1 322 ? 52.921 29.626  -6.836  1.00 48.53  ? 321  PRO A O     1 
ATOM   2425 C  CB    . PRO A 1 322 ? 52.605 26.570  -7.259  1.00 43.75  ? 321  PRO A CB    1 
ATOM   2426 C  CG    . PRO A 1 322 ? 53.639 25.559  -6.892  1.00 43.52  ? 321  PRO A CG    1 
ATOM   2427 C  CD    . PRO A 1 322 ? 54.613 25.525  -8.038  1.00 45.03  ? 321  PRO A CD    1 
ATOM   2428 N  N     . SER A 1 323 ? 55.041 28.879  -6.737  1.00 48.82  ? 322  SER A N     1 
ATOM   2429 C  CA    . SER A 1 323 ? 55.499 29.991  -5.914  1.00 49.98  ? 322  SER A CA    1 
ATOM   2430 C  C     . SER A 1 323 ? 55.879 31.219  -6.734  1.00 51.30  ? 322  SER A C     1 
ATOM   2431 O  O     . SER A 1 323 ? 56.419 32.177  -6.171  1.00 53.57  ? 322  SER A O     1 
ATOM   2432 C  CB    . SER A 1 323 ? 56.689 29.556  -5.053  1.00 55.08  ? 322  SER A CB    1 
ATOM   2433 O  OG    . SER A 1 323 ? 57.839 29.325  -5.847  1.00 58.10  ? 322  SER A OG    1 
ATOM   2434 N  N     . LYS A 1 324 ? 55.615 31.215  -8.039  1.00 52.52  ? 323  LYS A N     1 
ATOM   2435 C  CA    . LYS A 1 324 ? 55.951 32.330  -8.912  1.00 53.83  ? 323  LYS A CA    1 
ATOM   2436 C  C     . LYS A 1 324 ? 54.738 32.718  -9.747  1.00 54.80  ? 323  LYS A C     1 
ATOM   2437 O  O     . LYS A 1 324 ? 53.779 31.955  -9.885  1.00 55.03  ? 323  LYS A O     1 
ATOM   2438 C  CB    . LYS A 1 324 ? 57.144 31.991  -9.816  1.00 54.35  ? 323  LYS A CB    1 
ATOM   2439 C  CG    . LYS A 1 324 ? 58.472 32.063  -9.087  1.00 60.38  ? 323  LYS A CG    1 
ATOM   2440 C  CD    . LYS A 1 324 ? 59.543 31.225  -9.752  1.00 64.55  ? 323  LYS A CD    1 
ATOM   2441 C  CE    . LYS A 1 324 ? 60.818 31.234  -8.919  1.00 70.46  ? 323  LYS A CE    1 
ATOM   2442 N  NZ    . LYS A 1 324 ? 60.546 30.943  -7.479  1.00 72.15  ? 323  LYS A NZ    1 
ATOM   2443 N  N     . ASP A 1 325 ? 54.799 33.922  -10.308 1.00 55.79  ? 324  ASP A N     1 
ATOM   2444 C  CA    . ASP A 1 325 ? 53.667 34.493  -11.022 1.00 56.19  ? 324  ASP A CA    1 
ATOM   2445 C  C     . ASP A 1 325 ? 53.498 33.868  -12.401 1.00 51.52  ? 324  ASP A C     1 
ATOM   2446 O  O     . ASP A 1 325 ? 54.464 33.449  -13.045 1.00 49.57  ? 324  ASP A O     1 
ATOM   2447 C  CB    . ASP A 1 325 ? 53.837 36.006  -11.168 1.00 62.25  ? 324  ASP A CB    1 
ATOM   2448 C  CG    . ASP A 1 325 ? 53.326 36.767  -9.963  1.00 68.66  ? 324  ASP A CG    1 
ATOM   2449 O  OD1   . ASP A 1 325 ? 52.187 36.492  -9.532  1.00 71.04  ? 324  ASP A OD1   1 
ATOM   2450 O  OD2   . ASP A 1 325 ? 54.061 37.632  -9.443  1.00 70.60  ? 324  ASP A OD2   1 
ATOM   2451 N  N     . LEU A 1 326 ? 52.247 33.810  -12.849 1.00 48.08  ? 325  LEU A N     1 
ATOM   2452 C  CA    . LEU A 1 326 ? 51.923 33.458  -14.223 1.00 46.75  ? 325  LEU A CA    1 
ATOM   2453 C  C     . LEU A 1 326 ? 51.808 34.734  -15.044 1.00 43.96  ? 325  LEU A C     1 
ATOM   2454 O  O     . LEU A 1 326 ? 51.094 35.664  -14.657 1.00 43.74  ? 325  LEU A O     1 
ATOM   2455 C  CB    . LEU A 1 326 ? 50.615 32.673  -14.293 1.00 50.92  ? 325  LEU A CB    1 
ATOM   2456 C  CG    . LEU A 1 326 ? 50.686 31.153  -14.189 1.00 54.67  ? 325  LEU A CG    1 
ATOM   2457 C  CD1   . LEU A 1 326 ? 49.280 30.581  -14.145 1.00 52.92  ? 325  LEU A CD1   1 
ATOM   2458 C  CD2   . LEU A 1 326 ? 51.466 30.583  -15.363 1.00 56.74  ? 325  LEU A CD2   1 
ATOM   2459 N  N     . ILE A 1 327 ? 52.506 34.779  -16.175 1.00 41.39  ? 326  ILE A N     1 
ATOM   2460 C  CA    . ILE A 1 327 ? 52.524 35.962  -17.025 1.00 42.49  ? 326  ILE A CA    1 
ATOM   2461 C  C     . ILE A 1 327 ? 52.152 35.549  -18.440 1.00 42.93  ? 326  ILE A C     1 
ATOM   2462 O  O     . ILE A 1 327 ? 52.837 34.721  -19.049 1.00 47.39  ? 326  ILE A O     1 
ATOM   2463 C  CB    . ILE A 1 327 ? 53.890 36.665  -17.009 1.00 41.66  ? 326  ILE A CB    1 
ATOM   2464 C  CG1   . ILE A 1 327 ? 54.323 36.956  -15.571 1.00 37.22  ? 326  ILE A CG1   1 
ATOM   2465 C  CG2   . ILE A 1 327 ? 53.822 37.956  -17.804 1.00 40.02  ? 326  ILE A CG2   1 
ATOM   2466 C  CD1   . ILE A 1 327 ? 55.739 37.454  -15.455 1.00 37.42  ? 326  ILE A CD1   1 
ATOM   2467 N  N     . ALA A 1 328 ? 51.079 36.132  -18.962 1.00 42.15  ? 327  ALA A N     1 
ATOM   2468 C  CA    . ALA A 1 328 ? 50.666 35.952  -20.348 1.00 42.93  ? 327  ALA A CA    1 
ATOM   2469 C  C     . ALA A 1 328 ? 50.927 37.246  -21.108 1.00 48.69  ? 327  ALA A C     1 
ATOM   2470 O  O     . ALA A 1 328 ? 50.372 38.294  -20.764 1.00 49.43  ? 327  ALA A O     1 
ATOM   2471 C  CB    . ALA A 1 328 ? 49.189 35.567  -20.435 1.00 39.50  ? 327  ALA A CB    1 
ATOM   2472 N  N     . GLU A 1 329 ? 51.776 37.172  -22.128 1.00 50.35  ? 328  GLU A N     1 
ATOM   2473 C  CA    . GLU A 1 329 ? 52.075 38.305  -22.993 1.00 53.18  ? 328  GLU A CA    1 
ATOM   2474 C  C     . GLU A 1 329 ? 51.451 38.056  -24.358 1.00 49.88  ? 328  GLU A C     1 
ATOM   2475 O  O     . GLU A 1 329 ? 51.586 36.958  -24.911 1.00 48.11  ? 328  GLU A O     1 
ATOM   2476 C  CB    . GLU A 1 329 ? 53.584 38.514  -23.126 1.00 63.58  ? 328  GLU A CB    1 
ATOM   2477 C  CG    . GLU A 1 329 ? 53.972 39.752  -23.920 1.00 72.87  ? 328  GLU A CG    1 
ATOM   2478 C  CD    . GLU A 1 329 ? 55.474 39.939  -24.013 1.00 81.98  ? 328  GLU A CD    1 
ATOM   2479 O  OE1   . GLU A 1 329 ? 56.213 39.132  -23.407 1.00 84.21  ? 328  GLU A OE1   1 
ATOM   2480 O  OE2   . GLU A 1 329 ? 55.914 40.891  -24.693 1.00 85.32  ? 328  GLU A OE2   1 
ATOM   2481 N  N     . ILE A 1 330 ? 50.772 39.069  -24.899 1.00 47.47  ? 329  ILE A N     1 
ATOM   2482 C  CA    . ILE A 1 330 ? 50.013 38.921  -26.138 1.00 45.30  ? 329  ILE A CA    1 
ATOM   2483 C  C     . ILE A 1 330 ? 50.616 39.806  -27.223 1.00 49.70  ? 329  ILE A C     1 
ATOM   2484 O  O     . ILE A 1 330 ? 51.021 40.943  -26.958 1.00 54.49  ? 329  ILE A O     1 
ATOM   2485 C  CB    . ILE A 1 330 ? 48.521 39.255  -25.933 1.00 41.57  ? 329  ILE A CB    1 
ATOM   2486 C  CG1   . ILE A 1 330 ? 47.937 38.429  -24.790 1.00 37.94  ? 329  ILE A CG1   1 
ATOM   2487 C  CG2   . ILE A 1 330 ? 47.728 38.993  -27.204 1.00 40.90  ? 329  ILE A CG2   1 
ATOM   2488 C  CD1   . ILE A 1 330 ? 46.448 38.641  -24.595 1.00 38.98  ? 329  ILE A CD1   1 
ATOM   2489 N  N     . GLN A 1 331 ? 50.668 39.277  -28.448 1.00 50.01  ? 330  GLN A N     1 
ATOM   2490 C  CA    . GLN A 1 331 ? 51.104 40.014  -29.626 1.00 54.55  ? 330  GLN A CA    1 
ATOM   2491 C  C     . GLN A 1 331 ? 50.034 39.936  -30.705 1.00 55.02  ? 330  GLN A C     1 
ATOM   2492 O  O     . GLN A 1 331 ? 49.324 38.934  -30.832 1.00 54.13  ? 330  GLN A O     1 
ATOM   2493 C  CB    . GLN A 1 331 ? 52.430 39.478  -30.190 1.00 60.56  ? 330  GLN A CB    1 
ATOM   2494 C  CG    . GLN A 1 331 ? 53.640 39.726  -29.308 1.00 65.84  ? 330  GLN A CG    1 
ATOM   2495 C  CD    . GLN A 1 331 ? 53.995 38.524  -28.455 1.00 69.07  ? 330  GLN A CD    1 
ATOM   2496 O  OE1   . GLN A 1 331 ? 53.632 37.390  -28.775 1.00 68.85  ? 330  GLN A OE1   1 
ATOM   2497 N  NE2   . GLN A 1 331 ? 54.710 38.767  -27.361 1.00 69.36  ? 330  GLN A NE2   1 
ATOM   2498 N  N     . LYS A 1 332 ? 49.939 41.004  -31.491 1.00 58.18  ? 331  LYS A N     1 
ATOM   2499 C  CA    . LYS A 1 332 ? 48.943 41.135  -32.543 1.00 59.32  ? 331  LYS A CA    1 
ATOM   2500 C  C     . LYS A 1 332 ? 49.572 40.912  -33.912 1.00 63.73  ? 331  LYS A C     1 
ATOM   2501 O  O     . LYS A 1 332 ? 50.696 41.353  -34.169 1.00 64.54  ? 331  LYS A O     1 
ATOM   2502 C  CB    . LYS A 1 332 ? 48.296 42.523  -32.490 1.00 56.08  ? 331  LYS A CB    1 
ATOM   2503 C  CG    . LYS A 1 332 ? 47.698 43.002  -33.804 1.00 57.81  ? 331  LYS A CG    1 
ATOM   2504 C  CD    . LYS A 1 332 ? 47.252 44.454  -33.715 1.00 60.40  ? 331  LYS A CD    1 
ATOM   2505 C  CE    . LYS A 1 332 ? 47.047 45.059  -35.096 1.00 64.18  ? 331  LYS A CE    1 
ATOM   2506 N  NZ    . LYS A 1 332 ? 45.965 44.375  -35.856 1.00 65.47  ? 331  LYS A NZ    1 
ATOM   2507 N  N     . GLN A 1 333 ? 48.850 40.212  -34.783 1.00 69.19  ? 332  GLN A N     1 
ATOM   2508 C  CA    . GLN A 1 333 ? 49.098 40.212  -36.215 1.00 79.77  ? 332  GLN A CA    1 
ATOM   2509 C  C     . GLN A 1 333 ? 47.831 40.678  -36.921 1.00 87.70  ? 332  GLN A C     1 
ATOM   2510 O  O     . GLN A 1 333 ? 46.781 40.871  -36.301 1.00 90.98  ? 332  GLN A O     1 
ATOM   2511 C  CB    . GLN A 1 333 ? 49.520 38.825  -36.718 1.00 81.39  ? 332  GLN A CB    1 
ATOM   2512 C  CG    . GLN A 1 333 ? 50.901 38.390  -36.256 1.00 82.62  ? 332  GLN A CG    1 
ATOM   2513 C  CD    . GLN A 1 333 ? 50.850 37.329  -35.177 1.00 78.64  ? 332  GLN A CD    1 
ATOM   2514 O  OE1   . GLN A 1 333 ? 49.800 36.744  -34.917 1.00 77.82  ? 332  GLN A OE1   1 
ATOM   2515 N  NE2   . GLN A 1 333 ? 51.989 37.073  -34.545 1.00 77.52  ? 332  GLN A NE2   1 
ATOM   2516 N  N     . GLY A 1 334 ? 47.930 40.860  -38.231 1.00 96.24  ? 333  GLY A N     1 
ATOM   2517 C  CA    . GLY A 1 334 ? 46.801 41.324  -39.006 1.00 102.25 ? 333  GLY A CA    1 
ATOM   2518 C  C     . GLY A 1 334 ? 45.683 40.298  -39.070 1.00 100.57 ? 333  GLY A C     1 
ATOM   2519 O  O     . GLY A 1 334 ? 45.730 39.224  -38.469 1.00 98.82  ? 333  GLY A O     1 
ATOM   2520 N  N     . GLN A 1 335 ? 44.640 40.663  -39.816 1.00 101.34 ? 334  GLN A N     1 
ATOM   2521 C  CA    . GLN A 1 335 ? 43.511 39.784  -40.123 1.00 101.47 ? 334  GLN A CA    1 
ATOM   2522 C  C     . GLN A 1 335 ? 42.774 39.312  -38.874 1.00 97.71  ? 334  GLN A C     1 
ATOM   2523 O  O     . GLN A 1 335 ? 42.054 38.309  -38.919 1.00 104.18 ? 334  GLN A O     1 
ATOM   2524 C  CB    . GLN A 1 335 ? 43.963 38.575  -40.952 1.00 106.99 ? 334  GLN A CB    1 
ATOM   2525 C  CG    . GLN A 1 335 ? 44.582 38.940  -42.291 1.00 113.62 ? 334  GLN A CG    1 
ATOM   2526 C  CD    . GLN A 1 335 ? 43.583 39.573  -43.239 1.00 119.49 ? 334  GLN A CD    1 
ATOM   2527 O  OE1   . GLN A 1 335 ? 43.708 40.743  -43.604 1.00 122.23 ? 334  GLN A OE1   1 
ATOM   2528 N  NE2   . GLN A 1 335 ? 42.583 38.799  -43.647 1.00 120.65 ? 334  GLN A NE2   1 
ATOM   2529 N  N     . GLY A 1 336 ? 42.932 40.014  -37.757 1.00 85.76  ? 335  GLY A N     1 
ATOM   2530 C  CA    . GLY A 1 336 ? 42.290 39.586  -36.528 1.00 74.29  ? 335  GLY A CA    1 
ATOM   2531 C  C     . GLY A 1 336 ? 42.900 38.337  -35.929 1.00 63.97  ? 335  GLY A C     1 
ATOM   2532 O  O     . GLY A 1 336 ? 42.165 37.437  -35.500 1.00 62.01  ? 335  GLY A O     1 
ATOM   2533 N  N     . GLN A 1 337 ? 44.228 38.258  -35.895 1.00 57.57  ? 336  GLN A N     1 
ATOM   2534 C  CA    . GLN A 1 337 ? 44.943 37.112  -35.355 1.00 54.56  ? 336  GLN A CA    1 
ATOM   2535 C  C     . GLN A 1 337 ? 45.868 37.570  -34.237 1.00 51.74  ? 336  GLN A C     1 
ATOM   2536 O  O     . GLN A 1 337 ? 46.456 38.654  -34.305 1.00 53.15  ? 336  GLN A O     1 
ATOM   2537 C  CB    . GLN A 1 337 ? 45.743 36.397  -36.448 1.00 57.54  ? 336  GLN A CB    1 
ATOM   2538 C  CG    . GLN A 1 337 ? 44.881 35.867  -37.582 1.00 61.99  ? 336  GLN A CG    1 
ATOM   2539 C  CD    . GLN A 1 337 ? 45.682 35.121  -38.629 1.00 66.70  ? 336  GLN A CD    1 
ATOM   2540 O  OE1   . GLN A 1 337 ? 46.014 33.948  -38.455 1.00 67.89  ? 336  GLN A OE1   1 
ATOM   2541 N  NE2   . GLN A 1 337 ? 45.990 35.796  -39.729 1.00 69.24  ? 336  GLN A NE2   1 
ATOM   2542 N  N     . TRP A 1 338 ? 45.985 36.745  -33.199 1.00 47.40  ? 337  TRP A N     1 
ATOM   2543 C  CA    . TRP A 1 338 ? 46.761 37.099  -32.022 1.00 50.50  ? 337  TRP A CA    1 
ATOM   2544 C  C     . TRP A 1 338 ? 47.518 35.873  -31.543 1.00 51.27  ? 337  TRP A C     1 
ATOM   2545 O  O     . TRP A 1 338 ? 47.008 34.755  -31.622 1.00 53.28  ? 337  TRP A O     1 
ATOM   2546 C  CB    . TRP A 1 338 ? 45.853 37.629  -30.900 1.00 51.22  ? 337  TRP A CB    1 
ATOM   2547 C  CG    . TRP A 1 338 ? 44.918 38.717  -31.345 1.00 52.01  ? 337  TRP A CG    1 
ATOM   2548 C  CD1   . TRP A 1 338 ? 43.795 38.574  -32.110 1.00 53.28  ? 337  TRP A CD1   1 
ATOM   2549 C  CD2   . TRP A 1 338 ? 45.023 40.114  -31.047 1.00 53.56  ? 337  TRP A CD2   1 
ATOM   2550 N  NE1   . TRP A 1 338 ? 43.202 39.796  -32.316 1.00 55.14  ? 337  TRP A NE1   1 
ATOM   2551 C  CE2   . TRP A 1 338 ? 43.934 40.757  -31.670 1.00 54.84  ? 337  TRP A CE2   1 
ATOM   2552 C  CE3   . TRP A 1 338 ? 45.931 40.883  -30.314 1.00 52.40  ? 337  TRP A CE3   1 
ATOM   2553 C  CZ2   . TRP A 1 338 ? 43.731 42.131  -31.584 1.00 53.54  ? 337  TRP A CZ2   1 
ATOM   2554 C  CZ3   . TRP A 1 338 ? 45.726 42.246  -30.228 1.00 53.79  ? 337  TRP A CZ3   1 
ATOM   2555 C  CH2   . TRP A 1 338 ? 44.636 42.857  -30.861 1.00 54.12  ? 337  TRP A CH2   1 
ATOM   2556 N  N     . THR A 1 339 ? 48.735 36.081  -31.055 1.00 51.33  ? 338  THR A N     1 
ATOM   2557 C  CA    . THR A 1 339 ? 49.495 35.021  -30.413 1.00 52.41  ? 338  THR A CA    1 
ATOM   2558 C  C     . THR A 1 339 ? 49.767 35.410  -28.968 1.00 53.11  ? 338  THR A C     1 
ATOM   2559 O  O     . THR A 1 339 ? 49.666 36.578  -28.589 1.00 49.87  ? 338  THR A O     1 
ATOM   2560 C  CB    . THR A 1 339 ? 50.817 34.739  -31.141 1.00 56.20  ? 338  THR A CB    1 
ATOM   2561 O  OG1   . THR A 1 339 ? 51.308 35.947  -31.735 1.00 61.22  ? 338  THR A OG1   1 
ATOM   2562 C  CG2   . THR A 1 339 ? 50.619 33.685  -32.219 1.00 58.19  ? 338  THR A CG2   1 
ATOM   2563 N  N     . TYR A 1 340 ? 50.096 34.414  -28.152 1.00 52.59  ? 339  TYR A N     1 
ATOM   2564 C  CA    . TYR A 1 340 ? 50.403 34.699  -26.761 1.00 48.98  ? 339  TYR A CA    1 
ATOM   2565 C  C     . TYR A 1 340 ? 51.375 33.665  -26.221 1.00 49.31  ? 339  TYR A C     1 
ATOM   2566 O  O     . TYR A 1 340 ? 51.378 32.504  -26.645 1.00 51.49  ? 339  TYR A O     1 
ATOM   2567 C  CB    . TYR A 1 340 ? 49.138 34.751  -25.894 1.00 47.06  ? 339  TYR A CB    1 
ATOM   2568 C  CG    . TYR A 1 340 ? 48.286 33.499  -25.910 1.00 46.70  ? 339  TYR A CG    1 
ATOM   2569 C  CD1   . TYR A 1 340 ? 48.497 32.477  -24.990 1.00 44.53  ? 339  TYR A CD1   1 
ATOM   2570 C  CD2   . TYR A 1 340 ? 47.250 33.352  -26.823 1.00 45.73  ? 339  TYR A CD2   1 
ATOM   2571 C  CE1   . TYR A 1 340 ? 47.714 31.340  -24.991 1.00 41.16  ? 339  TYR A CE1   1 
ATOM   2572 C  CE2   . TYR A 1 340 ? 46.460 32.221  -26.828 1.00 45.67  ? 339  TYR A CE2   1 
ATOM   2573 C  CZ    . TYR A 1 340 ? 46.696 31.218  -25.911 1.00 44.74  ? 339  TYR A CZ    1 
ATOM   2574 O  OH    . TYR A 1 340 ? 45.912 30.086  -25.918 1.00 48.74  ? 339  TYR A OH    1 
ATOM   2575 N  N     . GLN A 1 341 ? 52.203 34.114  -25.281 1.00 47.62  ? 340  GLN A N     1 
ATOM   2576 C  CA    . GLN A 1 341 ? 53.149 33.266  -24.572 1.00 47.66  ? 340  GLN A CA    1 
ATOM   2577 C  C     . GLN A 1 341 ? 52.878 33.367  -23.079 1.00 44.96  ? 340  GLN A C     1 
ATOM   2578 O  O     . GLN A 1 341 ? 52.780 34.471  -22.535 1.00 46.61  ? 340  GLN A O     1 
ATOM   2579 C  CB    . GLN A 1 341 ? 54.598 33.667  -24.872 1.00 52.13  ? 340  GLN A CB    1 
ATOM   2580 C  CG    . GLN A 1 341 ? 55.019 33.498  -26.325 1.00 57.87  ? 340  GLN A CG    1 
ATOM   2581 C  CD    . GLN A 1 341 ? 54.953 34.797  -27.107 1.00 66.16  ? 340  GLN A CD    1 
ATOM   2582 O  OE1   . GLN A 1 341 ? 54.719 35.864  -26.538 1.00 70.02  ? 340  GLN A OE1   1 
ATOM   2583 N  NE2   . GLN A 1 341 ? 55.162 34.713  -28.416 1.00 68.12  ? 340  GLN A NE2   1 
ATOM   2584 N  N     . ILE A 1 342 ? 52.747 32.216  -22.424 1.00 41.56  ? 341  ILE A N     1 
ATOM   2585 C  CA    . ILE A 1 342 ? 52.553 32.131  -20.984 1.00 40.82  ? 341  ILE A CA    1 
ATOM   2586 C  C     . ILE A 1 342 ? 53.839 31.585  -20.381 1.00 41.97  ? 341  ILE A C     1 
ATOM   2587 O  O     . ILE A 1 342 ? 54.280 30.479  -20.732 1.00 42.35  ? 341  ILE A O     1 
ATOM   2588 C  CB    . ILE A 1 342 ? 51.349 31.249  -20.623 1.00 39.12  ? 341  ILE A CB    1 
ATOM   2589 C  CG1   . ILE A 1 342 ? 50.088 31.772  -21.314 1.00 33.33  ? 341  ILE A CG1   1 
ATOM   2590 C  CG2   . ILE A 1 342 ? 51.166 31.201  -19.115 1.00 39.35  ? 341  ILE A CG2   1 
ATOM   2591 C  CD1   . ILE A 1 342 ? 48.819 31.084  -20.874 1.00 33.13  ? 341  ILE A CD1   1 
ATOM   2592 N  N     . TYR A 1 343 ? 54.425 32.365  -19.473 1.00 43.12  ? 342  TYR A N     1 
ATOM   2593 C  CA    . TYR A 1 343 ? 55.733 32.094  -18.898 1.00 45.91  ? 342  TYR A CA    1 
ATOM   2594 C  C     . TYR A 1 343 ? 55.758 32.598  -17.461 1.00 48.15  ? 342  TYR A C     1 
ATOM   2595 O  O     . TYR A 1 343 ? 54.850 33.299  -17.008 1.00 48.74  ? 342  TYR A O     1 
ATOM   2596 C  CB    . TYR A 1 343 ? 56.849 32.756  -19.712 1.00 48.83  ? 342  TYR A CB    1 
ATOM   2597 C  CG    . TYR A 1 343 ? 56.787 34.271  -19.732 1.00 50.51  ? 342  TYR A CG    1 
ATOM   2598 C  CD1   . TYR A 1 343 ? 56.017 34.943  -20.673 1.00 50.60  ? 342  TYR A CD1   1 
ATOM   2599 C  CD2   . TYR A 1 343 ? 57.507 35.030  -18.816 1.00 53.74  ? 342  TYR A CD2   1 
ATOM   2600 C  CE1   . TYR A 1 343 ? 55.962 36.325  -20.698 1.00 52.62  ? 342  TYR A CE1   1 
ATOM   2601 C  CE2   . TYR A 1 343 ? 57.457 36.412  -18.832 1.00 54.53  ? 342  TYR A CE2   1 
ATOM   2602 C  CZ    . TYR A 1 343 ? 56.684 37.054  -19.775 1.00 53.89  ? 342  TYR A CZ    1 
ATOM   2603 O  OH    . TYR A 1 343 ? 56.631 38.428  -19.795 1.00 57.07  ? 342  TYR A OH    1 
ATOM   2604 N  N     . GLN A 1 344 ? 56.819 32.229  -16.745 1.00 49.91  ? 343  GLN A N     1 
ATOM   2605 C  CA    . GLN A 1 344 ? 57.087 32.738  -15.405 1.00 50.06  ? 343  GLN A CA    1 
ATOM   2606 C  C     . GLN A 1 344 ? 58.405 33.490  -15.337 1.00 55.24  ? 343  GLN A C     1 
ATOM   2607 O  O     . GLN A 1 344 ? 58.453 34.602  -14.799 1.00 56.32  ? 343  GLN A O     1 
ATOM   2608 C  CB    . GLN A 1 344 ? 57.075 31.585  -14.386 1.00 48.65  ? 343  GLN A CB    1 
ATOM   2609 C  CG    . GLN A 1 344 ? 55.728 30.890  -14.268 1.00 44.91  ? 343  GLN A CG    1 
ATOM   2610 C  CD    . GLN A 1 344 ? 55.707 29.815  -13.203 1.00 47.33  ? 343  GLN A CD    1 
ATOM   2611 O  OE1   . GLN A 1 344 ? 56.375 28.785  -13.326 1.00 52.01  ? 343  GLN A OE1   1 
ATOM   2612 N  NE2   . GLN A 1 344 ? 54.934 30.046  -12.148 1.00 45.21  ? 343  GLN A NE2   1 
ATOM   2613 N  N     . GLU A 1 345 ? 59.492 32.906  -15.878 1.00 59.17  ? 344  GLU A N     1 
ATOM   2614 C  CA    . GLU A 1 345 ? 60.776 33.543  -16.121 1.00 60.64  ? 344  GLU A CA    1 
ATOM   2615 C  C     . GLU A 1 345 ? 60.793 34.135  -17.528 1.00 62.25  ? 344  GLU A C     1 
ATOM   2616 O  O     . GLU A 1 345 ? 60.144 33.602  -18.432 1.00 61.72  ? 344  GLU A O     1 
ATOM   2617 C  CB    . GLU A 1 345 ? 61.910 32.534  -15.966 1.00 61.61  ? 344  GLU A CB    1 
ATOM   2618 N  N     . PRO A 1 346 ? 61.540 35.229  -17.734 1.00 67.29  ? 345  PRO A N     1 
ATOM   2619 C  CA    . PRO A 1 346 ? 61.329 36.054  -18.943 1.00 66.61  ? 345  PRO A CA    1 
ATOM   2620 C  C     . PRO A 1 346 ? 61.276 35.298  -20.264 1.00 64.64  ? 345  PRO A C     1 
ATOM   2621 O  O     . PRO A 1 346 ? 60.306 35.454  -21.017 1.00 66.58  ? 345  PRO A O     1 
ATOM   2622 C  CB    . PRO A 1 346 ? 62.514 37.026  -18.891 1.00 70.05  ? 345  PRO A CB    1 
ATOM   2623 C  CG    . PRO A 1 346 ? 62.800 37.170  -17.437 1.00 71.28  ? 345  PRO A CG    1 
ATOM   2624 C  CD    . PRO A 1 346 ? 62.563 35.810  -16.846 1.00 70.84  ? 345  PRO A CD    1 
ATOM   2625 N  N     . PHE A 1 347 ? 62.280 34.483  -20.573 1.00 63.24  ? 346  PHE A N     1 
ATOM   2626 C  CA    . PHE A 1 347 ? 62.344 33.780  -21.851 1.00 66.21  ? 346  PHE A CA    1 
ATOM   2627 C  C     . PHE A 1 347 ? 62.239 32.267  -21.676 1.00 65.86  ? 346  PHE A C     1 
ATOM   2628 O  O     . PHE A 1 347 ? 62.952 31.499  -22.325 1.00 68.53  ? 346  PHE A O     1 
ATOM   2629 C  CB    . PHE A 1 347 ? 63.621 34.143  -22.605 1.00 71.61  ? 346  PHE A CB    1 
ATOM   2630 C  CG    . PHE A 1 347 ? 63.507 35.403  -23.419 1.00 74.77  ? 346  PHE A CG    1 
ATOM   2631 C  CD1   . PHE A 1 347 ? 62.960 35.372  -24.692 1.00 75.07  ? 346  PHE A CD1   1 
ATOM   2632 C  CD2   . PHE A 1 347 ? 63.946 36.617  -22.914 1.00 76.10  ? 346  PHE A CD2   1 
ATOM   2633 C  CE1   . PHE A 1 347 ? 62.852 36.527  -25.446 1.00 75.53  ? 346  PHE A CE1   1 
ATOM   2634 C  CE2   . PHE A 1 347 ? 63.843 37.776  -23.665 1.00 76.45  ? 346  PHE A CE2   1 
ATOM   2635 C  CZ    . PHE A 1 347 ? 63.295 37.730  -24.932 1.00 76.05  ? 346  PHE A CZ    1 
ATOM   2636 N  N     . LYS A 1 348 ? 61.335 31.823  -20.801 1.00 59.53  ? 347  LYS A N     1 
ATOM   2637 C  CA    . LYS A 1 348 ? 61.115 30.403  -20.519 1.00 52.32  ? 347  LYS A CA    1 
ATOM   2638 C  C     . LYS A 1 348 ? 59.608 30.161  -20.503 1.00 46.74  ? 347  LYS A C     1 
ATOM   2639 O  O     . LYS A 1 348 ? 58.963 30.250  -19.454 1.00 46.59  ? 347  LYS A O     1 
ATOM   2640 C  CB    . LYS A 1 348 ? 61.774 30.004  -19.205 1.00 53.74  ? 347  LYS A CB    1 
ATOM   2641 C  CG    . LYS A 1 348 ? 63.296 29.967  -19.253 1.00 56.32  ? 347  LYS A CG    1 
ATOM   2642 C  CD    . LYS A 1 348 ? 63.894 30.301  -17.894 1.00 59.85  ? 347  LYS A CD    1 
ATOM   2643 C  CE    . LYS A 1 348 ? 65.360 29.908  -17.796 1.00 64.60  ? 347  LYS A CE    1 
ATOM   2644 N  NZ    . LYS A 1 348 ? 65.524 28.447  -17.545 1.00 66.79  ? 347  LYS A NZ    1 
ATOM   2645 N  N     . ASN A 1 349 ? 59.052 29.843  -21.668 1.00 43.29  ? 348  ASN A N     1 
ATOM   2646 C  CA    . ASN A 1 349 ? 57.607 29.734  -21.811 1.00 41.52  ? 348  ASN A CA    1 
ATOM   2647 C  C     . ASN A 1 349 ? 57.075 28.479  -21.134 1.00 44.74  ? 348  ASN A C     1 
ATOM   2648 O  O     . ASN A 1 349 ? 57.619 27.385  -21.312 1.00 48.57  ? 348  ASN A O     1 
ATOM   2649 C  CB    . ASN A 1 349 ? 57.220 29.716  -23.289 1.00 39.66  ? 348  ASN A CB    1 
ATOM   2650 C  CG    . ASN A 1 349 ? 57.394 31.062  -23.953 1.00 41.99  ? 348  ASN A CG    1 
ATOM   2651 O  OD1   . ASN A 1 349 ? 57.522 32.085  -23.281 1.00 44.70  ? 348  ASN A OD1   1 
ATOM   2652 N  ND2   . ASN A 1 349 ? 57.387 31.072  -25.281 1.00 40.62  ? 348  ASN A ND2   1 
ATOM   2653 N  N     . LEU A 1 350 ? 56.003 28.638  -20.355 1.00 43.60  ? 349  LEU A N     1 
ATOM   2654 C  CA    . LEU A 1 350 ? 55.183 27.481  -20.014 1.00 39.89  ? 349  LEU A CA    1 
ATOM   2655 C  C     . LEU A 1 350 ? 54.526 26.925  -21.267 1.00 38.91  ? 349  LEU A C     1 
ATOM   2656 O  O     . LEU A 1 350 ? 54.623 25.725  -21.553 1.00 39.36  ? 349  LEU A O     1 
ATOM   2657 C  CB    . LEU A 1 350 ? 54.123 27.850  -18.973 1.00 36.87  ? 349  LEU A CB    1 
ATOM   2658 C  CG    . LEU A 1 350 ? 54.513 27.870  -17.493 1.00 38.40  ? 349  LEU A CG    1 
ATOM   2659 C  CD1   . LEU A 1 350 ? 55.177 26.570  -17.091 1.00 36.92  ? 349  LEU A CD1   1 
ATOM   2660 C  CD2   . LEU A 1 350 ? 55.425 29.038  -17.194 1.00 42.76  ? 349  LEU A CD2   1 
ATOM   2661 N  N     . LYS A 1 351 ? 53.874 27.791  -22.039 1.00 39.70  ? 350  LYS A N     1 
ATOM   2662 C  CA    . LYS A 1 351 ? 53.280 27.374  -23.306 1.00 38.72  ? 350  LYS A CA    1 
ATOM   2663 C  C     . LYS A 1 351 ? 52.990 28.609  -24.150 1.00 40.29  ? 350  LYS A C     1 
ATOM   2664 O  O     . LYS A 1 351 ? 53.269 29.741  -23.748 1.00 39.50  ? 350  LYS A O     1 
ATOM   2665 C  CB    . LYS A 1 351 ? 52.013 26.539  -23.082 1.00 34.43  ? 350  LYS A CB    1 
ATOM   2666 C  CG    . LYS A 1 351 ? 50.857 27.295  -22.460 1.00 34.12  ? 350  LYS A CG    1 
ATOM   2667 C  CD    . LYS A 1 351 ? 49.710 26.352  -22.127 1.00 35.08  ? 350  LYS A CD    1 
ATOM   2668 C  CE    . LYS A 1 351 ? 49.203 25.624  -23.363 1.00 34.78  ? 350  LYS A CE    1 
ATOM   2669 N  NZ    . LYS A 1 351 ? 48.635 26.563  -24.371 1.00 39.58  ? 350  LYS A NZ    1 
ATOM   2670 N  N     . THR A 1 352 ? 52.441 28.378  -25.342 1.00 37.85  ? 351  THR A N     1 
ATOM   2671 C  CA    . THR A 1 352 ? 52.031 29.442  -26.250 1.00 36.59  ? 351  THR A CA    1 
ATOM   2672 C  C     . THR A 1 352 ? 50.631 29.133  -26.769 1.00 38.64  ? 351  THR A C     1 
ATOM   2673 O  O     . THR A 1 352 ? 50.024 28.117  -26.414 1.00 41.24  ? 351  THR A O     1 
ATOM   2674 C  CB    . THR A 1 352 ? 53.017 29.606  -27.416 1.00 37.78  ? 351  THR A CB    1 
ATOM   2675 O  OG1   . THR A 1 352 ? 52.982 28.440  -28.244 1.00 36.93  ? 351  THR A OG1   1 
ATOM   2676 C  CG2   . THR A 1 352 ? 54.440 29.821  -26.905 1.00 37.32  ? 351  THR A CG2   1 
ATOM   2677 N  N     . GLY A 1 353 ? 50.108 30.026  -27.601 1.00 39.67  ? 352  GLY A N     1 
ATOM   2678 C  CA    . GLY A 1 353 ? 48.794 29.800  -28.187 1.00 38.95  ? 352  GLY A CA    1 
ATOM   2679 C  C     . GLY A 1 353 ? 48.421 30.894  -29.164 1.00 42.31  ? 352  GLY A C     1 
ATOM   2680 O  O     . GLY A 1 353 ? 49.098 31.922  -29.276 1.00 42.83  ? 352  GLY A O     1 
ATOM   2681 N  N     . LYS A 1 354 ? 47.313 30.653  -29.867 1.00 44.77  ? 353  LYS A N     1 
ATOM   2682 C  CA    . LYS A 1 354 ? 46.726 31.582  -30.824 1.00 48.55  ? 353  LYS A CA    1 
ATOM   2683 C  C     . LYS A 1 354 ? 45.342 32.025  -30.364 1.00 47.70  ? 353  LYS A C     1 
ATOM   2684 O  O     . LYS A 1 354 ? 44.758 31.479  -29.424 1.00 47.65  ? 353  LYS A O     1 
ATOM   2685 C  CB    . LYS A 1 354 ? 46.579 30.957  -32.217 1.00 55.04  ? 353  LYS A CB    1 
ATOM   2686 C  CG    . LYS A 1 354 ? 47.792 30.272  -32.787 1.00 61.70  ? 353  LYS A CG    1 
ATOM   2687 C  CD    . LYS A 1 354 ? 47.447 29.607  -34.122 1.00 65.00  ? 353  LYS A CD    1 
ATOM   2688 C  CE    . LYS A 1 354 ? 46.234 28.684  -34.015 1.00 66.54  ? 353  LYS A CE    1 
ATOM   2689 N  NZ    . LYS A 1 354 ? 44.961 29.333  -34.454 1.00 69.18  ? 353  LYS A NZ    1 
ATOM   2690 N  N     . TYR A 1 355 ? 44.816 33.020  -31.073 1.00 45.74  ? 354  TYR A N     1 
ATOM   2691 C  CA    . TYR A 1 355 ? 43.403 33.378  -30.999 1.00 43.69  ? 354  TYR A CA    1 
ATOM   2692 C  C     . TYR A 1 355 ? 43.038 34.088  -32.293 1.00 47.07  ? 354  TYR A C     1 
ATOM   2693 O  O     . TYR A 1 355 ? 43.665 35.094  -32.642 1.00 50.91  ? 354  TYR A O     1 
ATOM   2694 C  CB    . TYR A 1 355 ? 43.103 34.266  -29.789 1.00 41.63  ? 354  TYR A CB    1 
ATOM   2695 C  CG    . TYR A 1 355 ? 41.665 34.729  -29.763 1.00 43.88  ? 354  TYR A CG    1 
ATOM   2696 C  CD1   . TYR A 1 355 ? 40.651 33.878  -29.339 1.00 40.94  ? 354  TYR A CD1   1 
ATOM   2697 C  CD2   . TYR A 1 355 ? 41.316 36.005  -30.191 1.00 42.63  ? 354  TYR A CD2   1 
ATOM   2698 C  CE1   . TYR A 1 355 ? 39.333 34.288  -29.329 1.00 42.94  ? 354  TYR A CE1   1 
ATOM   2699 C  CE2   . TYR A 1 355 ? 40.001 36.424  -30.186 1.00 45.29  ? 354  TYR A CE2   1 
ATOM   2700 C  CZ    . TYR A 1 355 ? 39.013 35.562  -29.755 1.00 47.95  ? 354  TYR A CZ    1 
ATOM   2701 O  OH    . TYR A 1 355 ? 37.699 35.974  -29.749 1.00 50.88  ? 354  TYR A OH    1 
ATOM   2702 N  N     . ALA A 1 356 ? 42.038 33.569  -33.014 1.00 47.04  ? 355  ALA A N     1 
ATOM   2703 C  CA    . ALA A 1 356 ? 41.666 34.181  -34.285 1.00 49.90  ? 355  ALA A CA    1 
ATOM   2704 C  C     . ALA A 1 356 ? 40.159 34.240  -34.522 1.00 53.28  ? 355  ALA A C     1 
ATOM   2705 O  O     . ALA A 1 356 ? 39.738 34.457  -35.663 1.00 58.21  ? 355  ALA A O     1 
ATOM   2706 C  CB    . ALA A 1 356 ? 42.325 33.452  -35.460 1.00 50.01  ? 355  ALA A CB    1 
ATOM   2707 N  N     . ARG A 1 357 ? 39.333 34.055  -33.493 1.00 53.36  ? 356  ARG A N     1 
ATOM   2708 C  CA    . ARG A 1 357 ? 37.891 34.031  -33.705 1.00 60.07  ? 356  ARG A CA    1 
ATOM   2709 C  C     . ARG A 1 357 ? 37.383 35.398  -34.147 1.00 61.97  ? 356  ARG A C     1 
ATOM   2710 O  O     . ARG A 1 357 ? 37.759 36.428  -33.579 1.00 63.32  ? 356  ARG A O     1 
ATOM   2711 C  CB    . ARG A 1 357 ? 37.160 33.596  -32.436 1.00 64.36  ? 356  ARG A CB    1 
ATOM   2712 C  CG    . ARG A 1 357 ? 37.068 32.094  -32.234 1.00 67.86  ? 356  ARG A CG    1 
ATOM   2713 C  CD    . ARG A 1 357 ? 35.953 31.754  -31.254 1.00 69.54  ? 356  ARG A CD    1 
ATOM   2714 N  NE    . ARG A 1 357 ? 34.631 31.892  -31.862 1.00 71.19  ? 356  ARG A NE    1 
ATOM   2715 C  CZ    . ARG A 1 357 ? 33.487 31.849  -31.186 1.00 72.13  ? 356  ARG A CZ    1 
ATOM   2716 N  NH1   . ARG A 1 357 ? 33.497 31.684  -29.870 1.00 71.18  ? 356  ARG A NH1   1 
ATOM   2717 N  NH2   . ARG A 1 357 ? 32.332 31.979  -31.826 1.00 73.52  ? 356  ARG A NH2   1 
ATOM   2718 N  N     . MET A 1 358 ? 36.525 35.405  -35.163 1.00 65.40  ? 357  MET A N     1 
ATOM   2719 C  CA    . MET A 1 358 ? 35.834 36.613  -35.606 1.00 71.35  ? 357  MET A CA    1 
ATOM   2720 C  C     . MET A 1 358 ? 34.456 36.614  -34.954 1.00 69.91  ? 357  MET A C     1 
ATOM   2721 O  O     . MET A 1 358 ? 33.546 35.908  -35.395 1.00 70.89  ? 357  MET A O     1 
ATOM   2722 C  CB    . MET A 1 358 ? 35.744 36.669  -37.128 1.00 79.62  ? 357  MET A CB    1 
ATOM   2723 C  CG    . MET A 1 358 ? 34.940 37.846  -37.667 1.00 85.80  ? 357  MET A CG    1 
ATOM   2724 S  SD    . MET A 1 358 ? 35.445 39.437  -36.977 1.00 88.45  ? 357  MET A SD    1 
ATOM   2725 C  CE    . MET A 1 358 ? 37.170 39.495  -37.461 1.00 88.97  ? 357  MET A CE    1 
ATOM   2726 N  N     . ARG A 1 359 ? 34.310 37.404  -33.893 1.00 67.28  ? 358  ARG A N     1 
ATOM   2727 C  CA    . ARG A 1 359 ? 33.076 37.468  -33.113 1.00 67.45  ? 358  ARG A CA    1 
ATOM   2728 C  C     . ARG A 1 359 ? 32.284 38.689  -33.569 1.00 67.14  ? 358  ARG A C     1 
ATOM   2729 O  O     . ARG A 1 359 ? 32.607 39.824  -33.208 1.00 66.82  ? 358  ARG A O     1 
ATOM   2730 C  CB    . ARG A 1 359 ? 33.388 37.531  -31.621 1.00 68.73  ? 358  ARG A CB    1 
ATOM   2731 C  CG    . ARG A 1 359 ? 34.376 36.477  -31.148 1.00 70.10  ? 358  ARG A CG    1 
ATOM   2732 C  CD    . ARG A 1 359 ? 33.679 35.218  -30.660 1.00 72.57  ? 358  ARG A CD    1 
ATOM   2733 N  NE    . ARG A 1 359 ? 33.069 35.404  -29.346 1.00 75.45  ? 358  ARG A NE    1 
ATOM   2734 C  CZ    . ARG A 1 359 ? 31.779 35.652  -29.147 1.00 79.29  ? 358  ARG A CZ    1 
ATOM   2735 N  NH1   . ARG A 1 359 ? 30.951 35.741  -30.179 1.00 82.45  ? 358  ARG A NH1   1 
ATOM   2736 N  NH2   . ARG A 1 359 ? 31.315 35.808  -27.916 1.00 79.23  ? 358  ARG A NH2   1 
ATOM   2737 N  N     . GLY A 1 360 ? 31.250 38.454  -34.365 1.00 65.96  ? 359  GLY A N     1 
ATOM   2738 C  CA    . GLY A 1 360 ? 30.361 39.512  -34.790 1.00 62.17  ? 359  GLY A CA    1 
ATOM   2739 C  C     . GLY A 1 360 ? 30.654 39.985  -36.205 1.00 62.60  ? 359  GLY A C     1 
ATOM   2740 O  O     . GLY A 1 360 ? 31.735 39.774  -36.759 1.00 64.65  ? 359  GLY A O     1 
ATOM   2741 N  N     . ALA A 1 361 ? 29.656 40.645  -36.797 1.00 61.36  ? 360  ALA A N     1 
ATOM   2742 C  CA    . ALA A 1 361 ? 29.821 41.199  -38.135 1.00 61.77  ? 360  ALA A CA    1 
ATOM   2743 C  C     . ALA A 1 361 ? 30.793 42.372  -38.147 1.00 61.36  ? 360  ALA A C     1 
ATOM   2744 O  O     . ALA A 1 361 ? 31.415 42.647  -39.180 1.00 62.15  ? 360  ALA A O     1 
ATOM   2745 C  CB    . ALA A 1 361 ? 28.466 41.632  -38.696 1.00 62.80  ? 360  ALA A CB    1 
ATOM   2746 N  N     . HIS A 1 362 ? 30.934 43.074  -37.023 1.00 59.37  ? 361  HIS A N     1 
ATOM   2747 C  CA    . HIS A 1 362 ? 31.761 44.269  -36.948 1.00 59.01  ? 361  HIS A CA    1 
ATOM   2748 C  C     . HIS A 1 362 ? 32.500 44.286  -35.619 1.00 57.30  ? 361  HIS A C     1 
ATOM   2749 O  O     . HIS A 1 362 ? 31.915 43.991  -34.574 1.00 61.97  ? 361  HIS A O     1 
ATOM   2750 C  CB    . HIS A 1 362 ? 30.913 45.538  -37.094 1.00 54.25  ? 361  HIS A CB    1 
ATOM   2751 C  CG    . HIS A 1 362 ? 29.736 45.377  -38.004 1.00 56.88  ? 361  HIS A CG    1 
ATOM   2752 N  ND1   . HIS A 1 362 ? 29.863 45.230  -39.369 1.00 60.92  ? 361  HIS A ND1   1 
ATOM   2753 C  CD2   . HIS A 1 362 ? 28.408 45.336  -37.744 1.00 57.95  ? 361  HIS A CD2   1 
ATOM   2754 C  CE1   . HIS A 1 362 ? 28.664 45.109  -39.910 1.00 61.32  ? 361  HIS A CE1   1 
ATOM   2755 N  NE2   . HIS A 1 362 ? 27.763 45.169  -38.946 1.00 60.70  ? 361  HIS A NE2   1 
ATOM   2756 N  N     . THR A 1 363 ? 33.782 44.641  -35.662 1.00 54.66  ? 362  THR A N     1 
ATOM   2757 C  CA    . THR A 1 363 ? 34.620 44.598  -34.471 1.00 51.72  ? 362  THR A CA    1 
ATOM   2758 C  C     . THR A 1 363 ? 35.821 45.513  -34.668 1.00 46.76  ? 362  THR A C     1 
ATOM   2759 O  O     . THR A 1 363 ? 36.059 46.036  -35.759 1.00 48.48  ? 362  THR A O     1 
ATOM   2760 C  CB    . THR A 1 363 ? 35.081 43.167  -34.163 1.00 49.32  ? 362  THR A CB    1 
ATOM   2761 O  OG1   . THR A 1 363 ? 35.921 43.171  -33.003 1.00 48.35  ? 362  THR A OG1   1 
ATOM   2762 C  CG2   . THR A 1 363 ? 35.860 42.598  -35.337 1.00 46.00  ? 362  THR A CG2   1 
ATOM   2763 N  N     . ASN A 1 364 ? 36.577 45.698  -33.585 1.00 45.04  ? 363  ASN A N     1 
ATOM   2764 C  CA    . ASN A 1 364 ? 37.845 46.413  -33.621 1.00 46.38  ? 363  ASN A CA    1 
ATOM   2765 C  C     . ASN A 1 364 ? 38.865 45.632  -32.801 1.00 44.93  ? 363  ASN A C     1 
ATOM   2766 O  O     . ASN A 1 364 ? 38.576 44.553  -32.275 1.00 43.51  ? 363  ASN A O     1 
ATOM   2767 C  CB    . ASN A 1 364 ? 37.693 47.858  -33.125 1.00 45.41  ? 363  ASN A CB    1 
ATOM   2768 C  CG    . ASN A 1 364 ? 37.114 47.948  -31.727 1.00 48.07  ? 363  ASN A CG    1 
ATOM   2769 O  OD1   . ASN A 1 364 ? 37.512 47.215  -30.819 1.00 45.08  ? 363  ASN A OD1   1 
ATOM   2770 N  ND2   . ASN A 1 364 ? 36.166 48.861  -31.546 1.00 45.17  ? 363  ASN A ND2   1 
ATOM   2771 N  N     . ASP A 1 365 ? 40.071 46.193  -32.682 1.00 45.77  ? 364  ASP A N     1 
ATOM   2772 C  CA    . ASP A 1 365 ? 41.169 45.465  -32.055 1.00 45.68  ? 364  ASP A CA    1 
ATOM   2773 C  C     . ASP A 1 365 ? 41.065 45.431  -30.537 1.00 44.72  ? 364  ASP A C     1 
ATOM   2774 O  O     . ASP A 1 365 ? 41.580 44.497  -29.913 1.00 44.72  ? 364  ASP A O     1 
ATOM   2775 C  CB    . ASP A 1 365 ? 42.508 46.068  -32.475 1.00 52.15  ? 364  ASP A CB    1 
ATOM   2776 C  CG    . ASP A 1 365 ? 42.910 45.661  -33.875 1.00 59.74  ? 364  ASP A CG    1 
ATOM   2777 O  OD1   . ASP A 1 365 ? 42.029 45.217  -34.642 1.00 63.77  ? 364  ASP A OD1   1 
ATOM   2778 O  OD2   . ASP A 1 365 ? 44.108 45.770  -34.206 1.00 63.20  ? 364  ASP A OD2   1 
ATOM   2779 N  N     . VAL A 1 366 ? 40.411 46.418  -29.922 1.00 43.05  ? 365  VAL A N     1 
ATOM   2780 C  CA    . VAL A 1 366 ? 40.249 46.386  -28.470 1.00 42.96  ? 365  VAL A CA    1 
ATOM   2781 C  C     . VAL A 1 366 ? 39.302 45.259  -28.062 1.00 39.90  ? 365  VAL A C     1 
ATOM   2782 O  O     . VAL A 1 366 ? 39.558 44.535  -27.090 1.00 40.80  ? 365  VAL A O     1 
ATOM   2783 C  CB    . VAL A 1 366 ? 39.768 47.755  -27.955 1.00 47.06  ? 365  VAL A CB    1 
ATOM   2784 C  CG1   . VAL A 1 366 ? 39.676 47.744  -26.443 1.00 38.89  ? 365  VAL A CG1   1 
ATOM   2785 C  CG2   . VAL A 1 366 ? 40.708 48.854  -28.417 1.00 40.76  ? 365  VAL A CG2   1 
ATOM   2786 N  N     . LYS A 1 367 ? 38.197 45.093  -28.797 1.00 40.74  ? 366  LYS A N     1 
ATOM   2787 C  CA    . LYS A 1 367 ? 37.298 43.966  -28.562 1.00 38.61  ? 366  LYS A CA    1 
ATOM   2788 C  C     . LYS A 1 367 ? 38.036 42.639  -28.684 1.00 42.38  ? 366  LYS A C     1 
ATOM   2789 O  O     . LYS A 1 367 ? 37.889 41.751  -27.835 1.00 43.94  ? 366  LYS A O     1 
ATOM   2790 C  CB    . LYS A 1 367 ? 36.131 44.002  -29.550 1.00 39.96  ? 366  LYS A CB    1 
ATOM   2791 C  CG    . LYS A 1 367 ? 35.090 45.081  -29.306 1.00 44.17  ? 366  LYS A CG    1 
ATOM   2792 C  CD    . LYS A 1 367 ? 33.989 44.977  -30.354 1.00 45.65  ? 366  LYS A CD    1 
ATOM   2793 C  CE    . LYS A 1 367 ? 32.815 45.891  -30.047 1.00 48.44  ? 366  LYS A CE    1 
ATOM   2794 N  NZ    . LYS A 1 367 ? 31.737 45.756  -31.071 1.00 45.80  ? 366  LYS A NZ    1 
ATOM   2795 N  N     . GLN A 1 368 ? 38.827 42.482  -29.747 1.00 45.41  ? 367  GLN A N     1 
ATOM   2796 C  CA    . GLN A 1 368 ? 39.526 41.220  -29.961 1.00 46.09  ? 367  GLN A CA    1 
ATOM   2797 C  C     . GLN A 1 368 ? 40.572 40.978  -28.881 1.00 46.81  ? 367  GLN A C     1 
ATOM   2798 O  O     . GLN A 1 368 ? 40.773 39.836  -28.452 1.00 45.85  ? 367  GLN A O     1 
ATOM   2799 C  CB    . GLN A 1 368 ? 40.167 41.202  -31.345 1.00 49.36  ? 367  GLN A CB    1 
ATOM   2800 C  CG    . GLN A 1 368 ? 39.176 41.183  -32.490 1.00 53.79  ? 367  GLN A CG    1 
ATOM   2801 C  CD    . GLN A 1 368 ? 39.867 41.136  -33.834 1.00 61.11  ? 367  GLN A CD    1 
ATOM   2802 O  OE1   . GLN A 1 368 ? 41.065 40.872  -33.913 1.00 61.36  ? 367  GLN A OE1   1 
ATOM   2803 N  NE2   . GLN A 1 368 ? 39.119 41.402  -34.899 1.00 66.13  ? 367  GLN A NE2   1 
ATOM   2804 N  N     . LEU A 1 369 ? 41.244 42.037  -28.424 1.00 46.51  ? 368  LEU A N     1 
ATOM   2805 C  CA    . LEU A 1 369 ? 42.192 41.880  -27.326 1.00 43.52  ? 368  LEU A CA    1 
ATOM   2806 C  C     . LEU A 1 369 ? 41.483 41.435  -26.052 1.00 44.42  ? 368  LEU A C     1 
ATOM   2807 O  O     . LEU A 1 369 ? 41.976 40.559  -25.332 1.00 46.36  ? 368  LEU A O     1 
ATOM   2808 C  CB    . LEU A 1 369 ? 42.954 43.184  -27.100 1.00 40.93  ? 368  LEU A CB    1 
ATOM   2809 C  CG    . LEU A 1 369 ? 44.046 43.158  -26.029 1.00 42.05  ? 368  LEU A CG    1 
ATOM   2810 C  CD1   . LEU A 1 369 ? 45.037 42.020  -26.274 1.00 37.62  ? 368  LEU A CD1   1 
ATOM   2811 C  CD2   . LEU A 1 369 ? 44.762 44.497  -25.988 1.00 43.82  ? 368  LEU A CD2   1 
ATOM   2812 N  N     . THR A 1 370 ? 40.313 42.014  -25.769 1.00 43.31  ? 369  THR A N     1 
ATOM   2813 C  CA    . THR A 1 370 ? 39.550 41.600  -24.593 1.00 44.29  ? 369  THR A CA    1 
ATOM   2814 C  C     . THR A 1 370 ? 39.107 40.143  -24.707 1.00 44.11  ? 369  THR A C     1 
ATOM   2815 O  O     . THR A 1 370 ? 39.154 39.387  -23.726 1.00 48.14  ? 369  THR A O     1 
ATOM   2816 C  CB    . THR A 1 370 ? 38.341 42.517  -24.406 1.00 45.60  ? 369  THR A CB    1 
ATOM   2817 O  OG1   . THR A 1 370 ? 38.759 43.884  -24.507 1.00 43.53  ? 369  THR A OG1   1 
ATOM   2818 C  CG2   . THR A 1 370 ? 37.714 42.296  -23.042 1.00 47.53  ? 369  THR A CG2   1 
ATOM   2819 N  N     . GLU A 1 371 ? 38.684 39.730  -25.902 1.00 41.93  ? 370  GLU A N     1 
ATOM   2820 C  CA    . GLU A 1 371 ? 38.259 38.348  -26.105 1.00 43.43  ? 370  GLU A CA    1 
ATOM   2821 C  C     . GLU A 1 371 ? 39.424 37.376  -25.943 1.00 43.24  ? 370  GLU A C     1 
ATOM   2822 O  O     . GLU A 1 371 ? 39.268 36.300  -25.348 1.00 41.30  ? 370  GLU A O     1 
ATOM   2823 C  CB    . GLU A 1 371 ? 37.620 38.204  -27.484 1.00 42.65  ? 370  GLU A CB    1 
ATOM   2824 C  CG    . GLU A 1 371 ? 36.297 38.934  -27.618 1.00 47.45  ? 370  GLU A CG    1 
ATOM   2825 C  CD    . GLU A 1 371 ? 35.977 39.300  -29.054 1.00 54.65  ? 370  GLU A CD    1 
ATOM   2826 O  OE1   . GLU A 1 371 ? 35.208 40.263  -29.264 1.00 56.18  ? 370  GLU A OE1   1 
ATOM   2827 O  OE2   . GLU A 1 371 ? 36.501 38.632  -29.972 1.00 56.19  ? 370  GLU A OE2   1 
ATOM   2828 N  N     . ALA A 1 372 ? 40.598 37.739  -26.468 1.00 41.76  ? 371  ALA A N     1 
ATOM   2829 C  CA    . ALA A 1 372 ? 41.781 36.905  -26.290 1.00 40.08  ? 371  ALA A CA    1 
ATOM   2830 C  C     . ALA A 1 372 ? 42.165 36.807  -24.820 1.00 45.09  ? 371  ALA A C     1 
ATOM   2831 O  O     . ALA A 1 372 ? 42.565 35.736  -24.346 1.00 48.73  ? 371  ALA A O     1 
ATOM   2832 C  CB    . ALA A 1 372 ? 42.944 37.459  -27.114 1.00 37.44  ? 371  ALA A CB    1 
ATOM   2833 N  N     . VAL A 1 373 ? 42.046 37.916  -24.083 1.00 42.29  ? 372  VAL A N     1 
ATOM   2834 C  CA    . VAL A 1 373 ? 42.316 37.889  -22.649 1.00 38.17  ? 372  VAL A CA    1 
ATOM   2835 C  C     . VAL A 1 373 ? 41.363 36.931  -21.945 1.00 40.34  ? 372  VAL A C     1 
ATOM   2836 O  O     . VAL A 1 373 ? 41.771 36.164  -21.066 1.00 40.70  ? 372  VAL A O     1 
ATOM   2837 C  CB    . VAL A 1 373 ? 42.232 39.310  -22.059 1.00 36.67  ? 372  VAL A CB    1 
ATOM   2838 C  CG1   . VAL A 1 373 ? 42.179 39.260  -20.540 1.00 31.06  ? 372  VAL A CG1   1 
ATOM   2839 C  CG2   . VAL A 1 373 ? 43.419 40.148  -22.517 1.00 38.11  ? 372  VAL A CG2   1 
ATOM   2840 N  N     . GLN A 1 374 ? 40.081 36.958  -22.320 1.00 41.04  ? 373  GLN A N     1 
ATOM   2841 C  CA    . GLN A 1 374 ? 39.114 36.047  -21.708 1.00 41.08  ? 373  GLN A CA    1 
ATOM   2842 C  C     . GLN A 1 374 ? 39.467 34.589  -21.990 1.00 37.48  ? 373  GLN A C     1 
ATOM   2843 O  O     . GLN A 1 374 ? 39.447 33.742  -21.083 1.00 37.88  ? 373  GLN A O     1 
ATOM   2844 C  CB    . GLN A 1 374 ? 37.705 36.358  -22.211 1.00 46.84  ? 373  GLN A CB    1 
ATOM   2845 C  CG    . GLN A 1 374 ? 36.925 37.290  -21.315 1.00 55.13  ? 373  GLN A CG    1 
ATOM   2846 C  CD    . GLN A 1 374 ? 36.387 38.497  -22.056 1.00 61.93  ? 373  GLN A CD    1 
ATOM   2847 O  OE1   . GLN A 1 374 ? 36.660 39.638  -21.681 1.00 66.98  ? 373  GLN A OE1   1 
ATOM   2848 N  NE2   . GLN A 1 374 ? 35.607 38.254  -23.105 1.00 59.33  ? 373  GLN A NE2   1 
ATOM   2849 N  N     . LYS A 1 375 ? 39.775 34.276  -23.252 1.00 37.28  ? 374  LYS A N     1 
ATOM   2850 C  CA    . LYS A 1 375 ? 40.131 32.905  -23.612 1.00 39.44  ? 374  LYS A CA    1 
ATOM   2851 C  C     . LYS A 1 375 ? 41.356 32.435  -22.835 1.00 38.45  ? 374  LYS A C     1 
ATOM   2852 O  O     . LYS A 1 375 ? 41.374 31.322  -22.290 1.00 37.72  ? 374  LYS A O     1 
ATOM   2853 C  CB    . LYS A 1 375 ? 40.378 32.798  -25.118 1.00 43.41  ? 374  LYS A CB    1 
ATOM   2854 C  CG    . LYS A 1 375 ? 40.910 31.435  -25.552 1.00 47.96  ? 374  LYS A CG    1 
ATOM   2855 C  CD    . LYS A 1 375 ? 41.378 31.434  -27.000 1.00 50.01  ? 374  LYS A CD    1 
ATOM   2856 N  N     . ILE A 1 376 ? 42.394 33.276  -22.779 1.00 35.46  ? 375  ILE A N     1 
ATOM   2857 C  CA    . ILE A 1 376 ? 43.611 32.915  -22.059 1.00 33.61  ? 375  ILE A CA    1 
ATOM   2858 C  C     . ILE A 1 376 ? 43.323 32.734  -20.575 1.00 34.46  ? 375  ILE A C     1 
ATOM   2859 O  O     . ILE A 1 376 ? 43.862 31.826  -19.930 1.00 33.73  ? 375  ILE A O     1 
ATOM   2860 C  CB    . ILE A 1 376 ? 44.699 33.975  -22.300 1.00 33.00  ? 375  ILE A CB    1 
ATOM   2861 C  CG1   . ILE A 1 376 ? 45.116 33.973  -23.767 1.00 33.69  ? 375  ILE A CG1   1 
ATOM   2862 C  CG2   . ILE A 1 376 ? 45.898 33.741  -21.391 1.00 32.53  ? 375  ILE A CG2   1 
ATOM   2863 C  CD1   . ILE A 1 376 ? 45.959 35.156  -24.144 1.00 35.43  ? 375  ILE A CD1   1 
ATOM   2864 N  N     . THR A 1 377 ? 42.463 33.583  -20.011 1.00 33.54  ? 376  THR A N     1 
ATOM   2865 C  CA    . THR A 1 377 ? 42.129 33.465  -18.598 1.00 35.29  ? 376  THR A CA    1 
ATOM   2866 C  C     . THR A 1 377 ? 41.457 32.131  -18.307 1.00 35.18  ? 376  THR A C     1 
ATOM   2867 O  O     . THR A 1 377 ? 41.812 31.446  -17.345 1.00 32.90  ? 376  THR A O     1 
ATOM   2868 C  CB    . THR A 1 377 ? 41.232 34.629  -18.174 1.00 36.29  ? 376  THR A CB    1 
ATOM   2869 O  OG1   . THR A 1 377 ? 41.986 35.846  -18.205 1.00 36.89  ? 376  THR A OG1   1 
ATOM   2870 C  CG2   . THR A 1 377 ? 40.691 34.409  -16.772 1.00 29.32  ? 376  THR A CG2   1 
ATOM   2871 N  N     . THR A 1 378 ? 40.487 31.742  -19.137 1.00 39.93  ? 377  THR A N     1 
ATOM   2872 C  CA    . THR A 1 378 ? 39.806 30.465  -18.928 1.00 42.38  ? 377  THR A CA    1 
ATOM   2873 C  C     . THR A 1 378 ? 40.771 29.291  -19.081 1.00 40.40  ? 377  THR A C     1 
ATOM   2874 O  O     . THR A 1 378 ? 40.775 28.354  -18.266 1.00 38.57  ? 377  THR A O     1 
ATOM   2875 C  CB    . THR A 1 378 ? 38.637 30.334  -19.906 1.00 48.90  ? 377  THR A CB    1 
ATOM   2876 O  OG1   . THR A 1 378 ? 37.759 31.455  -19.751 1.00 56.27  ? 377  THR A OG1   1 
ATOM   2877 C  CG2   . THR A 1 378 ? 37.864 29.052  -19.645 1.00 49.71  ? 377  THR A CG2   1 
ATOM   2878 N  N     . GLU A 1 379 ? 41.600 29.325  -20.130 1.00 40.61  ? 378  GLU A N     1 
ATOM   2879 C  CA    . GLU A 1 379 ? 42.579 28.264  -20.344 1.00 42.12  ? 378  GLU A CA    1 
ATOM   2880 C  C     . GLU A 1 379 ? 43.538 28.150  -19.164 1.00 43.51  ? 378  GLU A C     1 
ATOM   2881 O  O     . GLU A 1 379 ? 43.910 27.041  -18.753 1.00 43.81  ? 378  GLU A O     1 
ATOM   2882 C  CB    . GLU A 1 379 ? 43.335 28.531  -21.645 1.00 48.76  ? 378  GLU A CB    1 
ATOM   2883 C  CG    . GLU A 1 379 ? 44.553 27.662  -21.874 1.00 59.56  ? 378  GLU A CG    1 
ATOM   2884 C  CD    . GLU A 1 379 ? 45.239 27.984  -23.187 1.00 66.83  ? 378  GLU A CD    1 
ATOM   2885 O  OE1   . GLU A 1 379 ? 44.629 28.702  -24.013 1.00 67.73  ? 378  GLU A OE1   1 
ATOM   2886 O  OE2   . GLU A 1 379 ? 46.386 27.527  -23.391 1.00 67.45  ? 378  GLU A OE2   1 
ATOM   2887 N  N     . SER A 1 380 ? 43.927 29.289  -18.587 1.00 40.90  ? 379  SER A N     1 
ATOM   2888 C  CA    . SER A 1 380 ? 44.837 29.270  -17.451 1.00 37.83  ? 379  SER A CA    1 
ATOM   2889 C  C     . SER A 1 380 ? 44.142 28.770  -16.194 1.00 37.46  ? 379  SER A C     1 
ATOM   2890 O  O     . SER A 1 380 ? 44.760 28.085  -15.372 1.00 41.05  ? 379  SER A O     1 
ATOM   2891 C  CB    . SER A 1 380 ? 45.422 30.662  -17.229 1.00 42.61  ? 379  SER A CB    1 
ATOM   2892 O  OG    . SER A 1 380 ? 46.081 31.115  -18.397 1.00 46.35  ? 379  SER A OG    1 
ATOM   2893 N  N     . ILE A 1 381 ? 42.863 29.106  -16.015 1.00 34.15  ? 380  ILE A N     1 
ATOM   2894 C  CA    . ILE A 1 381 ? 42.121 28.544  -14.891 1.00 36.03  ? 380  ILE A CA    1 
ATOM   2895 C  C     . ILE A 1 381 ? 42.107 27.025  -14.989 1.00 38.74  ? 380  ILE A C     1 
ATOM   2896 O  O     . ILE A 1 381 ? 42.269 26.318  -13.986 1.00 39.00  ? 380  ILE A O     1 
ATOM   2897 C  CB    . ILE A 1 381 ? 40.690 29.110  -14.832 1.00 38.15  ? 380  ILE A CB    1 
ATOM   2898 C  CG1   . ILE A 1 381 ? 40.698 30.633  -14.673 1.00 39.04  ? 380  ILE A CG1   1 
ATOM   2899 C  CG2   . ILE A 1 381 ? 39.912 28.455  -13.692 1.00 36.95  ? 380  ILE A CG2   1 
ATOM   2900 C  CD1   . ILE A 1 381 ? 41.429 31.123  -13.461 1.00 43.05  ? 380  ILE A CD1   1 
ATOM   2901 N  N     . VAL A 1 382 ? 41.925 26.499  -16.202 1.00 36.32  ? 381  VAL A N     1 
ATOM   2902 C  CA    . VAL A 1 382 ? 41.911 25.048  -16.372 1.00 34.25  ? 381  VAL A CA    1 
ATOM   2903 C  C     . VAL A 1 382 ? 43.281 24.454  -16.057 1.00 35.93  ? 381  VAL A C     1 
ATOM   2904 O  O     . VAL A 1 382 ? 43.399 23.514  -15.263 1.00 35.33  ? 381  VAL A O     1 
ATOM   2905 C  CB    . VAL A 1 382 ? 41.452 24.672  -17.791 1.00 33.38  ? 381  VAL A CB    1 
ATOM   2906 C  CG1   . VAL A 1 382 ? 41.747 23.206  -18.064 1.00 30.54  ? 381  VAL A CG1   1 
ATOM   2907 C  CG2   . VAL A 1 382 ? 39.975 24.957  -17.960 1.00 31.34  ? 381  VAL A CG2   1 
ATOM   2908 N  N     . ILE A 1 383 ? 44.338 25.001  -16.663 1.00 36.01  ? 382  ILE A N     1 
ATOM   2909 C  CA    . ILE A 1 383 ? 45.641 24.343  -16.593 1.00 34.41  ? 382  ILE A CA    1 
ATOM   2910 C  C     . ILE A 1 383 ? 46.302 24.534  -15.227 1.00 39.17  ? 382  ILE A C     1 
ATOM   2911 O  O     . ILE A 1 383 ? 46.844 23.581  -14.656 1.00 42.23  ? 382  ILE A O     1 
ATOM   2912 C  CB    . ILE A 1 383 ? 46.543 24.834  -17.739 1.00 32.57  ? 382  ILE A CB    1 
ATOM   2913 C  CG1   . ILE A 1 383 ? 46.037 24.286  -19.078 1.00 28.81  ? 382  ILE A CG1   1 
ATOM   2914 C  CG2   . ILE A 1 383 ? 47.982 24.410  -17.507 1.00 31.34  ? 382  ILE A CG2   1 
ATOM   2915 C  CD1   . ILE A 1 383 ? 46.828 24.767  -20.275 1.00 26.52  ? 382  ILE A CD1   1 
ATOM   2916 N  N     . TRP A 1 384 ? 46.277 25.752  -14.677 1.00 37.66  ? 383  TRP A N     1 
ATOM   2917 C  CA    . TRP A 1 384 ? 46.989 26.049  -13.439 1.00 34.54  ? 383  TRP A CA    1 
ATOM   2918 C  C     . TRP A 1 384 ? 46.084 26.414  -12.271 1.00 35.38  ? 383  TRP A C     1 
ATOM   2919 O  O     . TRP A 1 384 ? 46.585 26.570  -11.152 1.00 38.54  ? 383  TRP A O     1 
ATOM   2920 C  CB    . TRP A 1 384 ? 47.987 27.196  -13.656 1.00 33.33  ? 383  TRP A CB    1 
ATOM   2921 C  CG    . TRP A 1 384 ? 48.997 26.922  -14.721 1.00 32.13  ? 383  TRP A CG    1 
ATOM   2922 C  CD1   . TRP A 1 384 ? 50.092 26.115  -14.623 1.00 31.94  ? 383  TRP A CD1   1 
ATOM   2923 C  CD2   . TRP A 1 384 ? 49.014 27.462  -16.047 1.00 31.53  ? 383  TRP A CD2   1 
ATOM   2924 N  NE1   . TRP A 1 384 ? 50.787 26.114  -15.808 1.00 32.03  ? 383  TRP A NE1   1 
ATOM   2925 C  CE2   . TRP A 1 384 ? 50.147 26.935  -16.698 1.00 30.61  ? 383  TRP A CE2   1 
ATOM   2926 C  CE3   . TRP A 1 384 ? 48.179 28.337  -16.748 1.00 30.45  ? 383  TRP A CE3   1 
ATOM   2927 C  CZ2   . TRP A 1 384 ? 50.466 27.253  -18.014 1.00 29.79  ? 383  TRP A CZ2   1 
ATOM   2928 C  CZ3   . TRP A 1 384 ? 48.498 28.652  -18.054 1.00 29.44  ? 383  TRP A CZ3   1 
ATOM   2929 C  CH2   . TRP A 1 384 ? 49.630 28.110  -18.675 1.00 30.77  ? 383  TRP A CH2   1 
ATOM   2930 N  N     . GLY A 1 385 ? 44.782 26.570  -12.494 1.00 35.34  ? 384  GLY A N     1 
ATOM   2931 C  CA    . GLY A 1 385 ? 43.875 26.919  -11.422 1.00 31.45  ? 384  GLY A CA    1 
ATOM   2932 C  C     . GLY A 1 385 ? 43.943 28.354  -10.955 1.00 35.76  ? 384  GLY A C     1 
ATOM   2933 O  O     . GLY A 1 385 ? 43.417 28.661  -9.879  1.00 39.92  ? 384  GLY A O     1 
ATOM   2934 N  N     . LYS A 1 386 ? 44.580 29.243  -11.714 1.00 37.00  ? 385  LYS A N     1 
ATOM   2935 C  CA    . LYS A 1 386 ? 44.609 30.656  -11.364 1.00 41.38  ? 385  LYS A CA    1 
ATOM   2936 C  C     . LYS A 1 386 ? 44.729 31.477  -12.640 1.00 43.47  ? 385  LYS A C     1 
ATOM   2937 O  O     . LYS A 1 386 ? 45.020 30.954  -13.719 1.00 44.22  ? 385  LYS A O     1 
ATOM   2938 C  CB    . LYS A 1 386 ? 45.755 30.977  -10.396 1.00 42.18  ? 385  LYS A CB    1 
ATOM   2939 C  CG    . LYS A 1 386 ? 47.142 30.728  -10.962 1.00 45.11  ? 385  LYS A CG    1 
ATOM   2940 C  CD    . LYS A 1 386 ? 48.189 30.688  -9.856  1.00 49.93  ? 385  LYS A CD    1 
ATOM   2941 C  CE    . LYS A 1 386 ? 48.485 32.070  -9.293  1.00 53.83  ? 385  LYS A CE    1 
ATOM   2942 N  NZ    . LYS A 1 386 ? 49.259 32.905  -10.250 1.00 55.46  ? 385  LYS A NZ    1 
ATOM   2943 N  N     . THR A 1 387 ? 44.490 32.776  -12.503 1.00 42.97  ? 386  THR A N     1 
ATOM   2944 C  CA    . THR A 1 387 ? 44.533 33.795  -13.544 1.00 41.98  ? 386  THR A CA    1 
ATOM   2945 C  C     . THR A 1 387 ? 45.942 34.368  -13.659 1.00 40.69  ? 386  THR A C     1 
ATOM   2946 O  O     . THR A 1 387 ? 46.594 34.615  -12.641 1.00 46.45  ? 386  THR A O     1 
ATOM   2947 C  CB    . THR A 1 387 ? 43.542 34.916  -13.231 1.00 47.01  ? 386  THR A CB    1 
ATOM   2948 O  OG1   . THR A 1 387 ? 42.208 34.394  -13.276 1.00 48.93  ? 386  THR A OG1   1 
ATOM   2949 C  CG2   . THR A 1 387 ? 43.668 36.071  -14.224 1.00 46.42  ? 386  THR A CG2   1 
ATOM   2950 N  N     . PRO A 1 388 ? 46.450 34.567  -14.870 1.00 39.40  ? 387  PRO A N     1 
ATOM   2951 C  CA    . PRO A 1 388 ? 47.778 35.161  -15.033 1.00 38.58  ? 387  PRO A CA    1 
ATOM   2952 C  C     . PRO A 1 388 ? 47.736 36.683  -15.069 1.00 39.93  ? 387  PRO A C     1 
ATOM   2953 O  O     . PRO A 1 388 ? 46.692 37.305  -15.270 1.00 40.03  ? 387  PRO A O     1 
ATOM   2954 C  CB    . PRO A 1 388 ? 48.236 34.601  -16.386 1.00 36.37  ? 387  PRO A CB    1 
ATOM   2955 C  CG    . PRO A 1 388 ? 46.962 34.469  -17.156 1.00 35.03  ? 387  PRO A CG    1 
ATOM   2956 C  CD    . PRO A 1 388 ? 45.891 34.106  -16.155 1.00 35.94  ? 387  PRO A CD    1 
ATOM   2957 N  N     . LYS A 1 389 ? 48.911 37.271  -14.848 1.00 53.11  ? 388  LYS A N     1 
ATOM   2958 C  CA    . LYS A 1 389 ? 49.119 38.696  -15.062 1.00 47.05  ? 388  LYS A CA    1 
ATOM   2959 C  C     . LYS A 1 389 ? 49.447 38.940  -16.528 1.00 48.45  ? 388  LYS A C     1 
ATOM   2960 O  O     . LYS A 1 389 ? 50.200 38.179  -17.139 1.00 51.68  ? 388  LYS A O     1 
ATOM   2961 C  CB    . LYS A 1 389 ? 50.257 39.210  -14.183 1.00 49.20  ? 388  LYS A CB    1 
ATOM   2962 C  CG    . LYS A 1 389 ? 50.001 39.126  -12.690 1.00 53.47  ? 388  LYS A CG    1 
ATOM   2963 C  CD    . LYS A 1 389 ? 51.237 39.554  -11.912 1.00 58.62  ? 388  LYS A CD    1 
ATOM   2964 C  CE    . LYS A 1 389 ? 50.923 39.812  -10.445 1.00 63.85  ? 388  LYS A CE    1 
ATOM   2965 N  NZ    . LYS A 1 389 ? 50.397 38.606  -9.749  1.00 64.82  ? 388  LYS A NZ    1 
ATOM   2966 N  N     . PHE A 1 390 ? 48.895 40.010  -17.091 1.00 47.77  ? 389  PHE A N     1 
ATOM   2967 C  CA    . PHE A 1 390 ? 48.918 40.212  -18.533 1.00 48.24  ? 389  PHE A CA    1 
ATOM   2968 C  C     . PHE A 1 390 ? 49.884 41.316  -18.946 1.00 48.78  ? 389  PHE A C     1 
ATOM   2969 O  O     . PHE A 1 390 ? 50.026 42.332  -18.259 1.00 48.19  ? 389  PHE A O     1 
ATOM   2970 C  CB    . PHE A 1 390 ? 47.515 40.526  -19.056 1.00 46.77  ? 389  PHE A CB    1 
ATOM   2971 C  CG    . PHE A 1 390 ? 46.626 39.323  -19.136 1.00 40.92  ? 389  PHE A CG    1 
ATOM   2972 C  CD1   . PHE A 1 390 ? 46.652 38.502  -20.252 1.00 40.66  ? 389  PHE A CD1   1 
ATOM   2973 C  CD2   . PHE A 1 390 ? 45.774 39.002  -18.093 1.00 41.33  ? 389  PHE A CD2   1 
ATOM   2974 C  CE1   . PHE A 1 390 ? 45.840 37.387  -20.330 1.00 40.83  ? 389  PHE A CE1   1 
ATOM   2975 C  CE2   . PHE A 1 390 ? 44.958 37.887  -18.165 1.00 43.09  ? 389  PHE A CE2   1 
ATOM   2976 C  CZ    . PHE A 1 390 ? 44.991 37.079  -19.286 1.00 41.26  ? 389  PHE A CZ    1 
ATOM   2977 N  N     . LYS A 1 391 ? 50.558 41.085  -20.070 1.00 48.16  ? 390  LYS A N     1 
ATOM   2978 C  CA    . LYS A 1 391 ? 51.345 42.086  -20.776 1.00 46.57  ? 390  LYS A CA    1 
ATOM   2979 C  C     . LYS A 1 391 ? 50.714 42.267  -22.150 1.00 48.93  ? 390  LYS A C     1 
ATOM   2980 O  O     . LYS A 1 391 ? 50.616 41.306  -22.928 1.00 52.05  ? 390  LYS A O     1 
ATOM   2981 C  CB    . LYS A 1 391 ? 52.813 41.666  -20.887 1.00 43.27  ? 390  LYS A CB    1 
ATOM   2982 N  N     . LEU A 1 392 ? 50.253 43.487  -22.430 1.00 47.47  ? 391  LEU A N     1 
ATOM   2983 C  CA    . LEU A 1 392 ? 49.411 43.765  -23.582 1.00 48.34  ? 391  LEU A CA    1 
ATOM   2984 C  C     . LEU A 1 392 ? 49.937 44.967  -24.356 1.00 50.31  ? 391  LEU A C     1 
ATOM   2985 O  O     . LEU A 1 392 ? 50.384 45.953  -23.755 1.00 48.97  ? 391  LEU A O     1 
ATOM   2986 C  CB    . LEU A 1 392 ? 47.963 44.034  -23.144 1.00 39.93  ? 391  LEU A CB    1 
ATOM   2987 C  CG    . LEU A 1 392 ? 47.315 43.061  -22.156 1.00 46.48  ? 391  LEU A CG    1 
ATOM   2988 C  CD1   . LEU A 1 392 ? 45.892 43.492  -21.833 1.00 39.35  ? 391  LEU A CD1   1 
ATOM   2989 C  CD2   . LEU A 1 392 ? 47.341 41.636  -22.689 1.00 45.48  ? 391  LEU A CD2   1 
ATOM   2990 N  N     . PRO A 1 393 ? 49.889 44.919  -25.688 1.00 48.50  ? 392  PRO A N     1 
ATOM   2991 C  CA    . PRO A 1 393 ? 50.363 46.044  -26.513 1.00 47.07  ? 392  PRO A CA    1 
ATOM   2992 C  C     . PRO A 1 393 ? 49.294 47.118  -26.691 1.00 48.77  ? 392  PRO A C     1 
ATOM   2993 O  O     . PRO A 1 393 ? 48.850 47.418  -27.803 1.00 47.37  ? 392  PRO A O     1 
ATOM   2994 C  CB    . PRO A 1 393 ? 50.722 45.346  -27.830 1.00 46.49  ? 392  PRO A CB    1 
ATOM   2995 C  CG    . PRO A 1 393 ? 49.717 44.247  -27.926 1.00 46.20  ? 392  PRO A CG    1 
ATOM   2996 C  CD    . PRO A 1 393 ? 49.470 43.771  -26.512 1.00 47.11  ? 392  PRO A CD    1 
ATOM   2997 N  N     . ILE A 1 394 ? 48.864 47.702  -25.578 1.00 49.19  ? 393  ILE A N     1 
ATOM   2998 C  CA    . ILE A 1 394 ? 47.825 48.727  -25.595 1.00 47.42  ? 393  ILE A CA    1 
ATOM   2999 C  C     . ILE A 1 394 ? 48.116 49.725  -24.485 1.00 49.44  ? 393  ILE A C     1 
ATOM   3000 O  O     . ILE A 1 394 ? 48.391 49.339  -23.345 1.00 49.54  ? 393  ILE A O     1 
ATOM   3001 C  CB    . ILE A 1 394 ? 46.413 48.117  -25.448 1.00 43.64  ? 393  ILE A CB    1 
ATOM   3002 C  CG1   . ILE A 1 394 ? 45.348 49.216  -25.442 1.00 43.66  ? 393  ILE A CG1   1 
ATOM   3003 C  CG2   . ILE A 1 394 ? 46.315 47.252  -24.198 1.00 42.27  ? 393  ILE A CG2   1 
ATOM   3004 C  CD1   . ILE A 1 394 ? 43.932 48.696  -25.348 1.00 42.22  ? 393  ILE A CD1   1 
ATOM   3005 N  N     . GLN A 1 395 ? 48.076 51.011  -24.825 1.00 52.19  ? 394  GLN A N     1 
ATOM   3006 C  CA    . GLN A 1 395 ? 48.291 52.052  -23.832 1.00 56.00  ? 394  GLN A CA    1 
ATOM   3007 C  C     . GLN A 1 395 ? 47.204 52.005  -22.765 1.00 54.14  ? 394  GLN A C     1 
ATOM   3008 O  O     . GLN A 1 395 ? 46.057 51.635  -23.030 1.00 53.70  ? 394  GLN A O     1 
ATOM   3009 C  CB    . GLN A 1 395 ? 48.294 53.427  -24.500 1.00 62.91  ? 394  GLN A CB    1 
ATOM   3010 C  CG    . GLN A 1 395 ? 49.158 53.525  -25.745 1.00 69.55  ? 394  GLN A CG    1 
ATOM   3011 C  CD    . GLN A 1 395 ? 50.592 53.902  -25.435 1.00 77.08  ? 394  GLN A CD    1 
ATOM   3012 O  OE1   . GLN A 1 395 ? 51.154 53.480  -24.423 1.00 80.00  ? 394  GLN A OE1   1 
ATOM   3013 N  NE2   . GLN A 1 395 ? 51.191 54.709  -26.303 1.00 79.18  ? 394  GLN A NE2   1 
ATOM   3014 N  N     . LYS A 1 396 ? 47.576 52.386  -21.541 1.00 55.58  ? 395  LYS A N     1 
ATOM   3015 C  CA    . LYS A 1 396 ? 46.576 52.548  -20.492 1.00 57.27  ? 395  LYS A CA    1 
ATOM   3016 C  C     . LYS A 1 396 ? 45.534 53.591  -20.876 1.00 58.52  ? 395  LYS A C     1 
ATOM   3017 O  O     . LYS A 1 396 ? 44.355 53.443  -20.535 1.00 59.07  ? 395  LYS A O     1 
ATOM   3018 C  CB    . LYS A 1 396 ? 47.250 52.931  -19.175 1.00 60.96  ? 395  LYS A CB    1 
ATOM   3019 C  CG    . LYS A 1 396 ? 47.996 51.793  -18.497 1.00 64.39  ? 395  LYS A CG    1 
ATOM   3020 C  CD    . LYS A 1 396 ? 47.035 50.836  -17.810 1.00 65.60  ? 395  LYS A CD    1 
ATOM   3021 C  CE    . LYS A 1 396 ? 47.770 49.662  -17.179 1.00 66.05  ? 395  LYS A CE    1 
ATOM   3022 N  NZ    . LYS A 1 396 ? 46.833 48.720  -16.506 1.00 66.92  ? 395  LYS A NZ    1 
ATOM   3023 N  N     . GLU A 1 397 ? 45.944 54.641  -21.596 1.00 58.32  ? 396  GLU A N     1 
ATOM   3024 C  CA    . GLU A 1 397 ? 45.005 55.686  -21.994 1.00 55.79  ? 396  GLU A CA    1 
ATOM   3025 C  C     . GLU A 1 397 ? 44.029 55.186  -23.052 1.00 53.34  ? 396  GLU A C     1 
ATOM   3026 O  O     . GLU A 1 397 ? 42.851 55.560  -23.042 1.00 52.99  ? 396  GLU A O     1 
ATOM   3027 C  CB    . GLU A 1 397 ? 45.766 56.911  -22.505 1.00 56.30  ? 396  GLU A CB    1 
ATOM   3028 N  N     . THR A 1 398 ? 44.500 54.343  -23.975 1.00 51.09  ? 397  THR A N     1 
ATOM   3029 C  CA    . THR A 1 398 ? 43.606 53.769  -24.976 1.00 51.09  ? 397  THR A CA    1 
ATOM   3030 C  C     . THR A 1 398 ? 42.511 52.940  -24.315 1.00 54.25  ? 397  THR A C     1 
ATOM   3031 O  O     . THR A 1 398 ? 41.320 53.096  -24.620 1.00 53.95  ? 397  THR A O     1 
ATOM   3032 C  CB    . THR A 1 398 ? 44.405 52.914  -25.961 1.00 50.87  ? 397  THR A CB    1 
ATOM   3033 O  OG1   . THR A 1 398 ? 45.465 53.695  -26.526 1.00 52.95  ? 397  THR A OG1   1 
ATOM   3034 C  CG2   . THR A 1 398 ? 43.507 52.401  -27.078 1.00 48.00  ? 397  THR A CG2   1 
ATOM   3035 N  N     . TRP A 1 399 ? 42.901 52.055  -23.395 1.00 54.99  ? 398  TRP A N     1 
ATOM   3036 C  CA    . TRP A 1 399 ? 41.921 51.237  -22.693 1.00 55.94  ? 398  TRP A CA    1 
ATOM   3037 C  C     . TRP A 1 399 ? 41.004 52.093  -21.829 1.00 56.87  ? 398  TRP A C     1 
ATOM   3038 O  O     . TRP A 1 399 ? 39.803 51.817  -21.724 1.00 58.63  ? 398  TRP A O     1 
ATOM   3039 C  CB    . TRP A 1 399 ? 42.628 50.186  -21.841 1.00 58.48  ? 398  TRP A CB    1 
ATOM   3040 C  CG    . TRP A 1 399 ? 41.676 49.403  -21.015 1.00 60.39  ? 398  TRP A CG    1 
ATOM   3041 C  CD1   . TRP A 1 399 ? 41.445 49.540  -19.678 1.00 61.63  ? 398  TRP A CD1   1 
ATOM   3042 C  CD2   . TRP A 1 399 ? 40.795 48.373  -21.474 1.00 59.62  ? 398  TRP A CD2   1 
ATOM   3043 N  NE1   . TRP A 1 399 ? 40.482 48.648  -19.273 1.00 63.76  ? 398  TRP A NE1   1 
ATOM   3044 C  CE2   . TRP A 1 399 ? 40.066 47.921  -20.358 1.00 61.75  ? 398  TRP A CE2   1 
ATOM   3045 C  CE3   . TRP A 1 399 ? 40.557 47.786  -22.720 1.00 58.02  ? 398  TRP A CE3   1 
ATOM   3046 C  CZ2   . TRP A 1 399 ? 39.115 46.909  -20.450 1.00 62.11  ? 398  TRP A CZ2   1 
ATOM   3047 C  CZ3   . TRP A 1 399 ? 39.612 46.783  -22.810 1.00 59.03  ? 398  TRP A CZ3   1 
ATOM   3048 C  CH2   . TRP A 1 399 ? 38.902 46.354  -21.682 1.00 60.91  ? 398  TRP A CH2   1 
ATOM   3049 N  N     . GLU A 1 400 ? 41.558 53.124  -21.186 1.00 59.34  ? 399  GLU A N     1 
ATOM   3050 C  CA    . GLU A 1 400 ? 40.740 54.043  -20.402 1.00 63.50  ? 399  GLU A CA    1 
ATOM   3051 C  C     . GLU A 1 400 ? 39.651 54.669  -21.260 1.00 59.47  ? 399  GLU A C     1 
ATOM   3052 O  O     . GLU A 1 400 ? 38.468 54.629  -20.907 1.00 58.39  ? 399  GLU A O     1 
ATOM   3053 C  CB    . GLU A 1 400 ? 41.620 55.126  -19.777 1.00 70.84  ? 399  GLU A CB    1 
ATOM   3054 C  CG    . GLU A 1 400 ? 42.045 54.837  -18.352 1.00 78.66  ? 399  GLU A CG    1 
ATOM   3055 C  CD    . GLU A 1 400 ? 40.923 55.057  -17.359 1.00 85.59  ? 399  GLU A CD    1 
ATOM   3056 O  OE1   . GLU A 1 400 ? 39.942 55.745  -17.714 1.00 87.28  ? 399  GLU A OE1   1 
ATOM   3057 O  OE2   . GLU A 1 400 ? 41.020 54.542  -16.225 1.00 89.31  ? 399  GLU A OE2   1 
ATOM   3058 N  N     . THR A 1 401 ? 40.041 55.256  -22.394 1.00 57.93  ? 400  THR A N     1 
ATOM   3059 C  CA    . THR A 1 401 ? 39.076 55.813  -23.336 1.00 57.90  ? 400  THR A CA    1 
ATOM   3060 C  C     . THR A 1 401 ? 38.017 54.786  -23.720 1.00 57.62  ? 400  THR A C     1 
ATOM   3061 O  O     . THR A 1 401 ? 36.811 55.062  -23.653 1.00 55.47  ? 400  THR A O     1 
ATOM   3062 C  CB    . THR A 1 401 ? 39.800 56.314  -24.587 1.00 57.53  ? 400  THR A CB    1 
ATOM   3063 O  OG1   . THR A 1 401 ? 40.734 57.338  -24.227 1.00 61.91  ? 400  THR A OG1   1 
ATOM   3064 C  CG2   . THR A 1 401 ? 38.805 56.862  -25.597 1.00 56.88  ? 400  THR A CG2   1 
ATOM   3065 N  N     . TRP A 1 402 ? 38.457 53.588  -24.122 1.00 56.46  ? 401  TRP A N     1 
ATOM   3066 C  CA    . TRP A 1 402 ? 37.521 52.587  -24.624 1.00 55.28  ? 401  TRP A CA    1 
ATOM   3067 C  C     . TRP A 1 402 ? 36.497 52.208  -23.564 1.00 59.68  ? 401  TRP A C     1 
ATOM   3068 O  O     . TRP A 1 402 ? 35.287 52.315  -23.789 1.00 58.47  ? 401  TRP A O     1 
ATOM   3069 C  CB    . TRP A 1 402 ? 38.264 51.341  -25.106 1.00 52.87  ? 401  TRP A CB    1 
ATOM   3070 C  CG    . TRP A 1 402 ? 37.318 50.224  -25.440 1.00 49.97  ? 401  TRP A CG    1 
ATOM   3071 C  CD1   . TRP A 1 402 ? 37.106 49.084  -24.719 1.00 48.27  ? 401  TRP A CD1   1 
ATOM   3072 C  CD2   . TRP A 1 402 ? 36.427 50.160  -26.562 1.00 47.75  ? 401  TRP A CD2   1 
ATOM   3073 N  NE1   . TRP A 1 402 ? 36.153 48.306  -25.334 1.00 46.07  ? 401  TRP A NE1   1 
ATOM   3074 C  CE2   . TRP A 1 402 ? 35.719 48.945  -26.465 1.00 45.90  ? 401  TRP A CE2   1 
ATOM   3075 C  CE3   . TRP A 1 402 ? 36.165 51.009  -27.643 1.00 46.93  ? 401  TRP A CE3   1 
ATOM   3076 C  CZ2   . TRP A 1 402 ? 34.768 48.556  -27.407 1.00 47.96  ? 401  TRP A CZ2   1 
ATOM   3077 C  CZ3   . TRP A 1 402 ? 35.220 50.621  -28.578 1.00 46.83  ? 401  TRP A CZ3   1 
ATOM   3078 C  CH2   . TRP A 1 402 ? 34.532 49.406  -28.454 1.00 47.35  ? 401  TRP A CH2   1 
ATOM   3079 N  N     . TRP A 1 403 ? 36.962 51.761  -22.395 1.00 68.02  ? 402  TRP A N     1 
ATOM   3080 C  CA    . TRP A 1 403 ? 36.019 51.274  -21.396 1.00 77.81  ? 402  TRP A CA    1 
ATOM   3081 C  C     . TRP A 1 403 ? 35.251 52.408  -20.727 1.00 80.11  ? 402  TRP A C     1 
ATOM   3082 O  O     . TRP A 1 403 ? 34.178 52.160  -20.167 1.00 83.94  ? 402  TRP A O     1 
ATOM   3083 C  CB    . TRP A 1 403 ? 36.733 50.396  -20.358 1.00 88.02  ? 402  TRP A CB    1 
ATOM   3084 C  CG    . TRP A 1 403 ? 37.218 51.099  -19.125 1.00 98.57  ? 402  TRP A CG    1 
ATOM   3085 C  CD1   . TRP A 1 403 ? 38.478 51.569  -18.893 1.00 103.91 ? 402  TRP A CD1   1 
ATOM   3086 C  CD2   . TRP A 1 403 ? 36.461 51.382  -17.941 1.00 103.11 ? 402  TRP A CD2   1 
ATOM   3087 N  NE1   . TRP A 1 403 ? 38.548 52.140  -17.645 1.00 107.34 ? 402  TRP A NE1   1 
ATOM   3088 C  CE2   . TRP A 1 403 ? 37.322 52.039  -17.041 1.00 107.00 ? 402  TRP A CE2   1 
ATOM   3089 C  CE3   . TRP A 1 403 ? 35.137 51.150  -17.558 1.00 104.56 ? 402  TRP A CE3   1 
ATOM   3090 C  CZ2   . TRP A 1 403 ? 36.902 52.468  -15.785 1.00 109.19 ? 402  TRP A CZ2   1 
ATOM   3091 C  CZ3   . TRP A 1 403 ? 34.722 51.579  -16.314 1.00 107.70 ? 402  TRP A CZ3   1 
ATOM   3092 C  CH2   . TRP A 1 403 ? 35.601 52.229  -15.442 1.00 109.83 ? 402  TRP A CH2   1 
ATOM   3093 N  N     . THR A 1 404 ? 35.745 53.647  -20.802 1.00 79.89  ? 403  THR A N     1 
ATOM   3094 C  CA    . THR A 1 404 ? 34.952 54.776  -20.334 1.00 79.84  ? 403  THR A CA    1 
ATOM   3095 C  C     . THR A 1 404 ? 33.800 55.068  -21.286 1.00 77.42  ? 403  THR A C     1 
ATOM   3096 O  O     . THR A 1 404 ? 32.673 55.322  -20.846 1.00 80.18  ? 403  THR A O     1 
ATOM   3097 C  CB    . THR A 1 404 ? 35.842 56.011  -20.172 1.00 80.05  ? 403  THR A CB    1 
ATOM   3098 O  OG1   . THR A 1 404 ? 36.814 55.773  -19.146 1.00 80.56  ? 403  THR A OG1   1 
ATOM   3099 C  CG2   . THR A 1 404 ? 35.010 57.232  -19.801 1.00 80.67  ? 403  THR A CG2   1 
ATOM   3100 N  N     . GLU A 1 405 ? 34.054 55.018  -22.593 1.00 73.20  ? 404  GLU A N     1 
ATOM   3101 C  CA    . GLU A 1 405 ? 33.049 55.399  -23.577 1.00 71.67  ? 404  GLU A CA    1 
ATOM   3102 C  C     . GLU A 1 405 ? 32.231 54.228  -24.111 1.00 73.04  ? 404  GLU A C     1 
ATOM   3103 O  O     . GLU A 1 405 ? 31.323 54.451  -24.919 1.00 74.51  ? 404  GLU A O     1 
ATOM   3104 C  CB    . GLU A 1 405 ? 33.714 56.128  -24.749 1.00 70.80  ? 404  GLU A CB    1 
ATOM   3105 N  N     . TYR A 1 406 ? 32.515 52.995  -23.695 1.00 69.33  ? 405  TYR A N     1 
ATOM   3106 C  CA    . TYR A 1 406 ? 31.800 51.833  -24.209 1.00 64.36  ? 405  TYR A CA    1 
ATOM   3107 C  C     . TYR A 1 406 ? 30.620 51.503  -23.302 1.00 64.95  ? 405  TYR A C     1 
ATOM   3108 O  O     . TYR A 1 406 ? 30.755 51.490  -22.074 1.00 64.86  ? 405  TYR A O     1 
ATOM   3109 C  CB    . TYR A 1 406 ? 32.735 50.627  -24.339 1.00 60.21  ? 405  TYR A CB    1 
ATOM   3110 C  CG    . TYR A 1 406 ? 32.183 49.524  -25.215 1.00 57.90  ? 405  TYR A CG    1 
ATOM   3111 C  CD1   . TYR A 1 406 ? 31.554 49.820  -26.415 1.00 57.03  ? 405  TYR A CD1   1 
ATOM   3112 C  CD2   . TYR A 1 406 ? 32.301 48.186  -24.851 1.00 57.28  ? 405  TYR A CD2   1 
ATOM   3113 C  CE1   . TYR A 1 406 ? 31.048 48.825  -27.224 1.00 56.22  ? 405  TYR A CE1   1 
ATOM   3114 C  CE2   . TYR A 1 406 ? 31.797 47.179  -25.659 1.00 54.59  ? 405  TYR A CE2   1 
ATOM   3115 C  CZ    . TYR A 1 406 ? 31.172 47.507  -26.843 1.00 54.41  ? 405  TYR A CZ    1 
ATOM   3116 O  OH    . TYR A 1 406 ? 30.665 46.521  -27.657 1.00 55.41  ? 405  TYR A OH    1 
ATOM   3117 N  N     . TRP A 1 407 ? 29.465 51.230  -23.913 1.00 66.42  ? 406  TRP A N     1 
ATOM   3118 C  CA    . TRP A 1 407 ? 28.227 51.028  -23.169 1.00 70.05  ? 406  TRP A CA    1 
ATOM   3119 C  C     . TRP A 1 407 ? 28.128 49.656  -22.517 1.00 69.50  ? 406  TRP A C     1 
ATOM   3120 O  O     . TRP A 1 407 ? 27.163 49.408  -21.785 1.00 72.66  ? 406  TRP A O     1 
ATOM   3121 C  CB    . TRP A 1 407 ? 27.019 51.238  -24.091 1.00 76.24  ? 406  TRP A CB    1 
ATOM   3122 C  CG    . TRP A 1 407 ? 27.146 50.552  -25.420 1.00 82.50  ? 406  TRP A CG    1 
ATOM   3123 C  CD1   . TRP A 1 407 ? 27.568 51.110  -26.592 1.00 84.94  ? 406  TRP A CD1   1 
ATOM   3124 C  CD2   . TRP A 1 407 ? 26.854 49.178  -25.712 1.00 85.95  ? 406  TRP A CD2   1 
ATOM   3125 N  NE1   . TRP A 1 407 ? 27.555 50.171  -27.596 1.00 86.48  ? 406  TRP A NE1   1 
ATOM   3126 C  CE2   . TRP A 1 407 ? 27.121 48.977  -27.082 1.00 87.10  ? 406  TRP A CE2   1 
ATOM   3127 C  CE3   . TRP A 1 407 ? 26.393 48.100  -24.950 1.00 88.72  ? 406  TRP A CE3   1 
ATOM   3128 C  CZ2   . TRP A 1 407 ? 26.942 47.743  -27.704 1.00 88.14  ? 406  TRP A CZ2   1 
ATOM   3129 C  CZ3   . TRP A 1 407 ? 26.215 46.876  -25.570 1.00 90.27  ? 406  TRP A CZ3   1 
ATOM   3130 C  CH2   . TRP A 1 407 ? 26.490 46.707  -26.933 1.00 89.66  ? 406  TRP A CH2   1 
ATOM   3131 N  N     . GLN A 1 408 ? 29.083 48.766  -22.757 1.00 66.65  ? 407  GLN A N     1 
ATOM   3132 C  CA    . GLN A 1 408 ? 29.043 47.419  -22.213 1.00 66.87  ? 407  GLN A CA    1 
ATOM   3133 C  C     . GLN A 1 408 ? 30.055 47.280  -21.084 1.00 63.40  ? 407  GLN A C     1 
ATOM   3134 O  O     . GLN A 1 408 ? 31.069 47.982  -21.042 1.00 60.57  ? 407  GLN A O     1 
ATOM   3135 C  CB    . GLN A 1 408 ? 29.326 46.380  -23.303 1.00 69.95  ? 407  GLN A CB    1 
ATOM   3136 C  CG    . GLN A 1 408 ? 28.287 45.276  -23.379 1.00 76.63  ? 407  GLN A CG    1 
ATOM   3137 C  CD    . GLN A 1 408 ? 28.562 44.275  -24.485 1.00 80.31  ? 407  GLN A CD    1 
ATOM   3138 O  OE1   . GLN A 1 408 ? 27.641 43.648  -25.010 1.00 81.78  ? 407  GLN A OE1   1 
ATOM   3139 N  NE2   . GLN A 1 408 ? 29.832 44.112  -24.837 1.00 80.53  ? 407  GLN A NE2   1 
ATOM   3140 N  N     . ALA A 1 409 ? 29.762 46.372  -20.159 1.00 61.63  ? 408  ALA A N     1 
ATOM   3141 C  CA    . ALA A 1 409 ? 30.702 46.063  -19.092 1.00 61.59  ? 408  ALA A CA    1 
ATOM   3142 C  C     . ALA A 1 409 ? 31.852 45.236  -19.653 1.00 60.23  ? 408  ALA A C     1 
ATOM   3143 O  O     . ALA A 1 409 ? 31.641 44.128  -20.157 1.00 61.19  ? 408  ALA A O     1 
ATOM   3144 C  CB    . ALA A 1 409 ? 30.000 45.313  -17.963 1.00 63.51  ? 408  ALA A CB    1 
ATOM   3145 N  N     . THR A 1 410 ? 33.064 45.778  -19.578 1.00 58.32  ? 409  THR A N     1 
ATOM   3146 C  CA    . THR A 1 410 ? 34.253 45.087  -20.051 1.00 59.69  ? 409  THR A CA    1 
ATOM   3147 C  C     . THR A 1 410 ? 35.394 45.362  -19.085 1.00 64.17  ? 409  THR A C     1 
ATOM   3148 O  O     . THR A 1 410 ? 35.535 46.480  -18.583 1.00 69.43  ? 409  THR A O     1 
ATOM   3149 C  CB    . THR A 1 410 ? 34.632 45.522  -21.475 1.00 59.98  ? 409  THR A CB    1 
ATOM   3150 O  OG1   . THR A 1 410 ? 35.881 44.925  -21.844 1.00 63.13  ? 409  THR A OG1   1 
ATOM   3151 C  CG2   . THR A 1 410 ? 34.745 47.037  -21.573 1.00 59.05  ? 409  THR A CG2   1 
ATOM   3152 N  N     . TRP A 1 411 ? 36.196 44.336  -18.814 1.00 63.88  ? 410  TRP A N     1 
ATOM   3153 C  CA    . TRP A 1 411 ? 37.250 44.451  -17.818 1.00 64.11  ? 410  TRP A CA    1 
ATOM   3154 C  C     . TRP A 1 411 ? 38.390 43.504  -18.160 1.00 65.26  ? 410  TRP A C     1 
ATOM   3155 O  O     . TRP A 1 411 ? 38.162 42.351  -18.536 1.00 66.48  ? 410  TRP A O     1 
ATOM   3156 C  CB    . TRP A 1 411 ? 36.714 44.152  -16.413 1.00 65.14  ? 410  TRP A CB    1 
ATOM   3157 C  CG    . TRP A 1 411 ? 37.767 44.154  -15.341 1.00 66.47  ? 410  TRP A CG    1 
ATOM   3158 C  CD1   . TRP A 1 411 ? 38.423 45.241  -14.836 1.00 65.87  ? 410  TRP A CD1   1 
ATOM   3159 C  CD2   . TRP A 1 411 ? 38.273 43.015  -14.632 1.00 65.23  ? 410  TRP A CD2   1 
ATOM   3160 N  NE1   . TRP A 1 411 ? 39.310 44.848  -13.862 1.00 66.07  ? 410  TRP A NE1   1 
ATOM   3161 C  CE2   . TRP A 1 411 ? 39.237 43.487  -13.718 1.00 64.82  ? 410  TRP A CE2   1 
ATOM   3162 C  CE3   . TRP A 1 411 ? 38.006 41.644  -14.683 1.00 65.11  ? 410  TRP A CE3   1 
ATOM   3163 C  CZ2   . TRP A 1 411 ? 39.934 42.637  -12.863 1.00 65.71  ? 410  TRP A CZ2   1 
ATOM   3164 C  CZ3   . TRP A 1 411 ? 38.699 40.800  -13.832 1.00 65.72  ? 410  TRP A CZ3   1 
ATOM   3165 C  CH2   . TRP A 1 411 ? 39.652 41.300  -12.935 1.00 66.05  ? 410  TRP A CH2   1 
ATOM   3166 N  N     . ILE A 1 412 ? 39.609 44.004  -18.027 1.00 64.23  ? 411  ILE A N     1 
ATOM   3167 C  CA    . ILE A 1 412 ? 40.829 43.212  -18.164 1.00 64.22  ? 411  ILE A CA    1 
ATOM   3168 C  C     . ILE A 1 412 ? 41.438 43.054  -16.778 1.00 63.83  ? 411  ILE A C     1 
ATOM   3169 O  O     . ILE A 1 412 ? 41.533 44.043  -16.042 1.00 63.71  ? 411  ILE A O     1 
ATOM   3170 C  CB    . ILE A 1 412 ? 41.837 43.873  -19.124 1.00 65.95  ? 411  ILE A CB    1 
ATOM   3171 C  CG1   . ILE A 1 412 ? 41.238 44.012  -20.523 1.00 66.15  ? 411  ILE A CG1   1 
ATOM   3172 C  CG2   . ILE A 1 412 ? 43.136 43.080  -19.177 1.00 66.45  ? 411  ILE A CG2   1 
ATOM   3173 C  CD1   . ILE A 1 412 ? 42.175 44.670  -21.517 1.00 64.94  ? 411  ILE A CD1   1 
ATOM   3174 N  N     . PRO A 1 413 ? 41.867 41.856  -16.388 1.00 64.81  ? 412  PRO A N     1 
ATOM   3175 C  CA    . PRO A 1 413 ? 42.524 41.702  -15.083 1.00 65.78  ? 412  PRO A CA    1 
ATOM   3176 C  C     . PRO A 1 413 ? 43.853 42.438  -15.029 1.00 65.60  ? 412  PRO A C     1 
ATOM   3177 O  O     . PRO A 1 413 ? 44.217 43.136  -15.981 1.00 66.10  ? 412  PRO A O     1 
ATOM   3178 C  CB    . PRO A 1 413 ? 42.702 40.183  -14.949 1.00 65.88  ? 412  PRO A CB    1 
ATOM   3179 C  CG    . PRO A 1 413 ? 42.617 39.656  -16.343 1.00 65.19  ? 412  PRO A CG    1 
ATOM   3180 C  CD    . PRO A 1 413 ? 41.683 40.567  -17.076 1.00 66.14  ? 412  PRO A CD    1 
ATOM   3181 N  N     . GLU A 1 414 ? 44.562 42.308  -13.908 1.00 67.58  ? 413  GLU A N     1 
ATOM   3182 C  CA    . GLU A 1 414 ? 45.821 43.014  -13.684 1.00 70.23  ? 413  GLU A CA    1 
ATOM   3183 C  C     . GLU A 1 414 ? 46.743 42.896  -14.890 1.00 66.71  ? 413  GLU A C     1 
ATOM   3184 O  O     . GLU A 1 414 ? 47.144 41.793  -15.274 1.00 64.75  ? 413  GLU A O     1 
ATOM   3185 C  CB    . GLU A 1 414 ? 46.506 42.452  -12.437 1.00 76.24  ? 413  GLU A CB    1 
ATOM   3186 C  CG    . GLU A 1 414 ? 47.625 43.321  -11.895 1.00 84.43  ? 413  GLU A CG    1 
ATOM   3187 C  CD    . GLU A 1 414 ? 48.500 42.591  -10.895 1.00 91.77  ? 413  GLU A CD    1 
ATOM   3188 O  OE1   . GLU A 1 414 ? 49.718 42.865  -10.863 1.00 93.74  ? 413  GLU A OE1   1 
ATOM   3189 O  OE2   . GLU A 1 414 ? 47.973 41.737  -10.149 1.00 93.70  ? 413  GLU A OE2   1 
ATOM   3190 N  N     . TRP A 1 415 ? 47.072 44.037  -15.494 1.00 63.76  ? 414  TRP A N     1 
ATOM   3191 C  CA    . TRP A 1 415 ? 47.866 44.031  -16.713 1.00 60.27  ? 414  TRP A CA    1 
ATOM   3192 C  C     . TRP A 1 415 ? 48.786 45.242  -16.740 1.00 58.46  ? 414  TRP A C     1 
ATOM   3193 O  O     . TRP A 1 415 ? 48.577 46.225  -16.026 1.00 59.91  ? 414  TRP A O     1 
ATOM   3194 C  CB    . TRP A 1 415 ? 46.976 44.004  -17.963 1.00 58.55  ? 414  TRP A CB    1 
ATOM   3195 C  CG    . TRP A 1 415 ? 46.194 45.262  -18.203 1.00 57.71  ? 414  TRP A CG    1 
ATOM   3196 C  CD1   . TRP A 1 415 ? 45.014 45.621  -17.618 1.00 57.37  ? 414  TRP A CD1   1 
ATOM   3197 C  CD2   . TRP A 1 415 ? 46.528 46.317  -19.113 1.00 55.58  ? 414  TRP A CD2   1 
ATOM   3198 N  NE1   . TRP A 1 415 ? 44.597 46.839  -18.102 1.00 54.90  ? 414  TRP A NE1   1 
ATOM   3199 C  CE2   . TRP A 1 415 ? 45.509 47.287  -19.021 1.00 54.31  ? 414  TRP A CE2   1 
ATOM   3200 C  CE3   . TRP A 1 415 ? 47.591 46.538  -19.993 1.00 55.23  ? 414  TRP A CE3   1 
ATOM   3201 C  CZ2   . TRP A 1 415 ? 45.523 48.456  -19.775 1.00 55.86  ? 414  TRP A CZ2   1 
ATOM   3202 C  CZ3   . TRP A 1 415 ? 47.604 47.701  -20.739 1.00 54.77  ? 414  TRP A CZ3   1 
ATOM   3203 C  CH2   . TRP A 1 415 ? 46.578 48.645  -20.625 1.00 55.29  ? 414  TRP A CH2   1 
ATOM   3204 N  N     . GLU A 1 416 ? 49.818 45.149  -17.577 1.00 57.53  ? 415  GLU A N     1 
ATOM   3205 C  CA    . GLU A 1 416 ? 50.770 46.228  -17.785 1.00 57.05  ? 415  GLU A CA    1 
ATOM   3206 C  C     . GLU A 1 416 ? 51.065 46.348  -19.274 1.00 57.32  ? 415  GLU A C     1 
ATOM   3207 O  O     . GLU A 1 416 ? 50.927 45.387  -20.035 1.00 56.15  ? 415  GLU A O     1 
ATOM   3208 C  CB    . GLU A 1 416 ? 52.068 46.001  -16.995 1.00 55.85  ? 415  GLU A CB    1 
ATOM   3209 N  N     . PHE A 1 417 ? 51.477 47.546  -19.681 1.00 59.60  ? 416  PHE A N     1 
ATOM   3210 C  CA    . PHE A 1 417 ? 51.703 47.845  -21.089 1.00 60.58  ? 416  PHE A CA    1 
ATOM   3211 C  C     . PHE A 1 417 ? 53.070 47.347  -21.539 1.00 64.41  ? 416  PHE A C     1 
ATOM   3212 O  O     . PHE A 1 417 ? 54.057 47.450  -20.807 1.00 63.97  ? 416  PHE A O     1 
ATOM   3213 C  CB    . PHE A 1 417 ? 51.588 49.353  -21.324 1.00 62.61  ? 416  PHE A CB    1 
ATOM   3214 C  CG    . PHE A 1 417 ? 52.022 49.798  -22.694 1.00 64.85  ? 416  PHE A CG    1 
ATOM   3215 C  CD1   . PHE A 1 417 ? 51.366 49.348  -23.826 1.00 65.13  ? 416  PHE A CD1   1 
ATOM   3216 C  CD2   . PHE A 1 417 ? 53.073 50.686  -22.846 1.00 68.06  ? 416  PHE A CD2   1 
ATOM   3217 C  CE1   . PHE A 1 417 ? 51.756 49.765  -25.085 1.00 66.42  ? 416  PHE A CE1   1 
ATOM   3218 C  CE2   . PHE A 1 417 ? 53.467 51.106  -24.104 1.00 69.54  ? 416  PHE A CE2   1 
ATOM   3219 C  CZ    . PHE A 1 417 ? 52.809 50.643  -25.224 1.00 68.31  ? 416  PHE A CZ    1 
ATOM   3220 N  N     . VAL A 1 418 ? 53.123 46.803  -22.754 1.00 70.66  ? 417  VAL A N     1 
ATOM   3221 C  CA    . VAL A 1 418 ? 54.367 46.348  -23.362 1.00 80.15  ? 417  VAL A CA    1 
ATOM   3222 C  C     . VAL A 1 418 ? 54.579 47.124  -24.655 1.00 91.39  ? 417  VAL A C     1 
ATOM   3223 O  O     . VAL A 1 418 ? 53.626 47.394  -25.394 1.00 91.19  ? 417  VAL A O     1 
ATOM   3224 C  CB    . VAL A 1 418 ? 54.366 44.822  -23.610 1.00 75.92  ? 417  VAL A CB    1 
ATOM   3225 C  CG1   . VAL A 1 418 ? 53.330 44.429  -24.652 1.00 73.56  ? 417  VAL A CG1   1 
ATOM   3226 C  CG2   . VAL A 1 418 ? 55.754 44.345  -24.012 1.00 76.33  ? 417  VAL A CG2   1 
ATOM   3227 N  N     . ASN A 1 419 ? 55.834 47.488  -24.924 1.00 104.36 ? 418  ASN A N     1 
ATOM   3228 C  CA    . ASN A 1 419 ? 56.174 48.448  -25.969 1.00 111.58 ? 418  ASN A CA    1 
ATOM   3229 C  C     . ASN A 1 419 ? 56.406 47.800  -27.329 1.00 108.12 ? 418  ASN A C     1 
ATOM   3230 O  O     . ASN A 1 419 ? 57.139 48.360  -28.155 1.00 110.49 ? 418  ASN A O     1 
ATOM   3231 C  CB    . ASN A 1 419 ? 57.408 49.250  -25.553 1.00 124.98 ? 418  ASN A CB    1 
ATOM   3232 C  CG    . ASN A 1 419 ? 57.356 49.691  -24.105 1.00 133.62 ? 418  ASN A CG    1 
ATOM   3233 O  OD1   . ASN A 1 419 ? 56.319 50.136  -23.617 1.00 136.20 ? 418  ASN A OD1   1 
ATOM   3234 N  ND2   . ASN A 1 419 ? 58.476 49.557  -23.405 1.00 137.91 ? 418  ASN A ND2   1 
ATOM   3235 N  N     . THR A 1 420 ? 55.807 46.639  -27.593 1.00 97.88  ? 419  THR A N     1 
ATOM   3236 C  CA    . THR A 1 420 ? 56.045 45.934  -28.845 1.00 90.92  ? 419  THR A CA    1 
ATOM   3237 C  C     . THR A 1 420 ? 54.966 46.283  -29.855 1.00 85.41  ? 419  THR A C     1 
ATOM   3238 O  O     . THR A 1 420 ? 53.781 46.018  -29.596 1.00 86.83  ? 419  THR A O     1 
ATOM   3239 C  CB    . THR A 1 420 ? 56.076 44.428  -28.620 1.00 87.12  ? 419  THR A CB    1 
ATOM   3240 O  OG1   . THR A 1 420 ? 54.749 43.956  -28.357 1.00 83.05  ? 419  THR A OG1   1 
ATOM   3241 C  CG2   . THR A 1 420 ? 56.975 44.085  -27.442 1.00 87.14  ? 419  THR A CG2   1 
ATOM   3242 N  N     . PRO A 1 421 ? 55.311 46.864  -31.000 1.00 79.59  ? 420  PRO A N     1 
ATOM   3243 C  CA    . PRO A 1 421 ? 54.319 47.082  -32.058 1.00 73.33  ? 420  PRO A CA    1 
ATOM   3244 C  C     . PRO A 1 421 ? 53.919 45.765  -32.700 1.00 65.97  ? 420  PRO A C     1 
ATOM   3245 O  O     . PRO A 1 421 ? 54.617 44.753  -32.535 1.00 66.99  ? 420  PRO A O     1 
ATOM   3246 C  CB    . PRO A 1 421 ? 55.059 47.990  -33.056 1.00 76.30  ? 420  PRO A CB    1 
ATOM   3247 C  CG    . PRO A 1 421 ? 56.210 48.567  -32.286 1.00 79.54  ? 420  PRO A CG    1 
ATOM   3248 C  CD    . PRO A 1 421 ? 56.601 47.499  -31.314 1.00 80.06  ? 420  PRO A CD    1 
ATOM   3249 N  N     . PRO A 1 422 ? 52.794 45.725  -33.434 1.00 60.43  ? 421  PRO A N     1 
ATOM   3250 C  CA    . PRO A 1 422 ? 51.826 46.814  -33.627 1.00 59.71  ? 421  PRO A CA    1 
ATOM   3251 C  C     . PRO A 1 422 ? 50.927 47.043  -32.412 1.00 57.03  ? 421  PRO A C     1 
ATOM   3252 O  O     . PRO A 1 422 ? 50.223 46.129  -31.982 1.00 57.15  ? 421  PRO A O     1 
ATOM   3253 C  CB    . PRO A 1 422 ? 51.005 46.344  -34.833 1.00 58.76  ? 421  PRO A CB    1 
ATOM   3254 C  CG    . PRO A 1 422 ? 51.115 44.866  -34.807 1.00 60.05  ? 421  PRO A CG    1 
ATOM   3255 C  CD    . PRO A 1 422 ? 52.490 44.564  -34.288 1.00 59.65  ? 421  PRO A CD    1 
ATOM   3256 N  N     . LEU A 1 423 ? 50.961 48.257  -31.869 1.00 55.96  ? 422  LEU A N     1 
ATOM   3257 C  CA    . LEU A 1 423 ? 50.137 48.590  -30.717 1.00 55.07  ? 422  LEU A CA    1 
ATOM   3258 C  C     . LEU A 1 423 ? 48.657 48.558  -31.081 1.00 54.78  ? 422  LEU A C     1 
ATOM   3259 O  O     . LEU A 1 423 ? 48.261 48.864  -32.210 1.00 54.79  ? 422  LEU A O     1 
ATOM   3260 C  CB    . LEU A 1 423 ? 50.504 49.971  -30.172 1.00 55.37  ? 422  LEU A CB    1 
ATOM   3261 C  CG    . LEU A 1 423 ? 51.961 50.225  -29.776 1.00 59.05  ? 422  LEU A CG    1 
ATOM   3262 C  CD1   . LEU A 1 423 ? 52.104 51.607  -29.154 1.00 45.79  ? 422  LEU A CD1   1 
ATOM   3263 C  CD2   . LEU A 1 423 ? 52.473 49.147  -28.829 1.00 44.96  ? 422  LEU A CD2   1 
ATOM   3264 N  N     . VAL A 1 424 ? 47.839 48.173  -30.108 1.00 55.44  ? 423  VAL A N     1 
ATOM   3265 C  CA    . VAL A 1 424 ? 46.389 48.182  -30.271 1.00 53.77  ? 423  VAL A CA    1 
ATOM   3266 C  C     . VAL A 1 424 ? 45.895 49.605  -30.053 1.00 56.92  ? 423  VAL A C     1 
ATOM   3267 O  O     . VAL A 1 424 ? 46.167 50.216  -29.013 1.00 60.87  ? 423  VAL A O     1 
ATOM   3268 C  CB    . VAL A 1 424 ? 45.712 47.210  -29.294 1.00 52.36  ? 423  VAL A CB    1 
ATOM   3269 C  CG1   . VAL A 1 424 ? 44.199 47.295  -29.426 1.00 51.16  ? 423  VAL A CG1   1 
ATOM   3270 C  CG2   . VAL A 1 424 ? 46.198 45.792  -29.533 1.00 53.35  ? 423  VAL A CG2   1 
ATOM   3271 N  N     . LYS A 1 425 ? 45.168 50.134  -31.031 1.00 55.65  ? 424  LYS A N     1 
ATOM   3272 C  CA    . LYS A 1 425 ? 44.664 51.496  -30.958 1.00 53.88  ? 424  LYS A CA    1 
ATOM   3273 C  C     . LYS A 1 425 ? 43.290 51.563  -31.606 1.00 53.74  ? 424  LYS A C     1 
ATOM   3274 O  O     . LYS A 1 425 ? 42.951 50.752  -32.471 1.00 54.90  ? 424  LYS A O     1 
ATOM   3275 C  CB    . LYS A 1 425 ? 45.618 52.487  -31.642 1.00 50.75  ? 424  LYS A CB    1 
ATOM   3276 N  N     . LEU A 1 426 ? 42.499 52.532  -31.161 1.00 52.01  ? 425  LEU A N     1 
ATOM   3277 C  CA    . LEU A 1 426 ? 41.262 52.892  -31.834 1.00 49.25  ? 425  LEU A CA    1 
ATOM   3278 C  C     . LEU A 1 426 ? 41.585 53.910  -32.920 1.00 49.90  ? 425  LEU A C     1 
ATOM   3279 O  O     . LEU A 1 426 ? 42.325 54.870  -32.678 1.00 48.64  ? 425  LEU A O     1 
ATOM   3280 C  CB    . LEU A 1 426 ? 40.251 53.455  -30.837 1.00 50.48  ? 425  LEU A CB    1 
ATOM   3281 C  CG    . LEU A 1 426 ? 39.796 52.455  -29.773 1.00 51.22  ? 425  LEU A CG    1 
ATOM   3282 C  CD1   . LEU A 1 426 ? 39.054 53.158  -28.644 1.00 53.24  ? 425  LEU A CD1   1 
ATOM   3283 C  CD2   . LEU A 1 426 ? 38.925 51.383  -30.409 1.00 49.72  ? 425  LEU A CD2   1 
ATOM   3284 N  N     . TRP A 1 427 ? 41.045 53.694  -34.115 1.00 51.95  ? 426  TRP A N     1 
ATOM   3285 C  CA    . TRP A 1 427 ? 41.495 54.438  -35.283 1.00 56.18  ? 426  TRP A CA    1 
ATOM   3286 C  C     . TRP A 1 427 ? 40.716 55.721  -35.533 1.00 53.57  ? 426  TRP A C     1 
ATOM   3287 O  O     . TRP A 1 427 ? 41.149 56.535  -36.356 1.00 49.76  ? 426  TRP A O     1 
ATOM   3288 C  CB    . TRP A 1 427 ? 41.440 53.541  -36.523 1.00 61.36  ? 426  TRP A CB    1 
ATOM   3289 C  CG    . TRP A 1 427 ? 42.480 52.470  -36.482 1.00 68.26  ? 426  TRP A CG    1 
ATOM   3290 C  CD1   . TRP A 1 427 ? 42.276 51.130  -36.328 1.00 69.95  ? 426  TRP A CD1   1 
ATOM   3291 C  CD2   . TRP A 1 427 ? 43.899 52.654  -36.564 1.00 74.13  ? 426  TRP A CD2   1 
ATOM   3292 N  NE1   . TRP A 1 427 ? 43.480 50.465  -36.326 1.00 73.74  ? 426  TRP A NE1   1 
ATOM   3293 C  CE2   . TRP A 1 427 ? 44.492 51.379  -36.469 1.00 76.62  ? 426  TRP A CE2   1 
ATOM   3294 C  CE3   . TRP A 1 427 ? 44.724 53.773  -36.716 1.00 76.92  ? 426  TRP A CE3   1 
ATOM   3295 C  CZ2   . TRP A 1 427 ? 45.873 51.193  -36.521 1.00 78.61  ? 426  TRP A CZ2   1 
ATOM   3296 C  CZ3   . TRP A 1 427 ? 46.094 53.587  -36.768 1.00 79.16  ? 426  TRP A CZ3   1 
ATOM   3297 C  CH2   . TRP A 1 427 ? 46.655 52.307  -36.671 1.00 79.73  ? 426  TRP A CH2   1 
ATOM   3298 N  N     . TYR A 1 428 ? 39.594 55.929  -34.850 1.00 53.26  ? 427  TYR A N     1 
ATOM   3299 C  CA    . TYR A 1 428 ? 38.879 57.192  -34.946 1.00 52.16  ? 427  TYR A CA    1 
ATOM   3300 C  C     . TYR A 1 428 ? 38.015 57.355  -33.707 1.00 56.69  ? 427  TYR A C     1 
ATOM   3301 O  O     . TYR A 1 428 ? 37.686 56.382  -33.024 1.00 58.29  ? 427  TYR A O     1 
ATOM   3302 C  CB    . TYR A 1 428 ? 38.031 57.273  -36.220 1.00 49.45  ? 427  TYR A CB    1 
ATOM   3303 C  CG    . TYR A 1 428 ? 36.989 56.185  -36.342 1.00 46.85  ? 427  TYR A CG    1 
ATOM   3304 C  CD1   . TYR A 1 428 ? 35.720 56.353  -35.810 1.00 44.06  ? 427  TYR A CD1   1 
ATOM   3305 C  CD2   . TYR A 1 428 ? 37.274 54.994  -36.996 1.00 45.26  ? 427  TYR A CD2   1 
ATOM   3306 C  CE1   . TYR A 1 428 ? 34.768 55.367  -35.917 1.00 44.83  ? 427  TYR A CE1   1 
ATOM   3307 C  CE2   . TYR A 1 428 ? 36.325 54.002  -37.110 1.00 46.27  ? 427  TYR A CE2   1 
ATOM   3308 C  CZ    . TYR A 1 428 ? 35.073 54.195  -36.567 1.00 47.04  ? 427  TYR A CZ    1 
ATOM   3309 O  OH    . TYR A 1 428 ? 34.119 53.213  -36.674 1.00 48.45  ? 427  TYR A OH    1 
ATOM   3310 N  N     . GLN A 1 429 ? 37.648 58.603  -33.430 1.00 63.97  ? 428  GLN A N     1 
ATOM   3311 C  CA    . GLN A 1 429 ? 36.856 58.949  -32.259 1.00 67.11  ? 428  GLN A CA    1 
ATOM   3312 C  C     . GLN A 1 429 ? 35.664 59.787  -32.689 1.00 60.70  ? 428  GLN A C     1 
ATOM   3313 O  O     . GLN A 1 429 ? 35.824 60.777  -33.409 1.00 66.93  ? 428  GLN A O     1 
ATOM   3314 C  CB    . GLN A 1 429 ? 37.697 59.713  -31.228 1.00 78.53  ? 428  GLN A CB    1 
ATOM   3315 C  CG    . GLN A 1 429 ? 38.641 58.839  -30.416 1.00 88.92  ? 428  GLN A CG    1 
ATOM   3316 C  CD    . GLN A 1 429 ? 37.915 58.020  -29.365 1.00 97.07  ? 428  GLN A CD    1 
ATOM   3317 O  OE1   . GLN A 1 429 ? 36.894 58.448  -28.824 1.00 97.86  ? 428  GLN A OE1   1 
ATOM   3318 N  NE2   . GLN A 1 429 ? 38.438 56.834  -29.071 1.00 98.78  ? 428  GLN A NE2   1 
ATOM   3319 N  N     . LEU A 1 430 ? 34.475 59.383  -32.256 1.00 52.71  ? 429  LEU A N     1 
ATOM   3320 C  CA    . LEU A 1 430 ? 33.286 60.197  -32.442 1.00 49.75  ? 429  LEU A CA    1 
ATOM   3321 C  C     . LEU A 1 430 ? 33.244 61.299  -31.393 1.00 49.97  ? 429  LEU A C     1 
ATOM   3322 O  O     . LEU A 1 430 ? 33.632 61.094  -30.240 1.00 51.67  ? 429  LEU A O     1 
ATOM   3323 C  CB    . LEU A 1 430 ? 32.026 59.337  -32.347 1.00 48.00  ? 429  LEU A CB    1 
ATOM   3324 C  CG    . LEU A 1 430 ? 31.898 58.207  -33.369 1.00 48.05  ? 429  LEU A CG    1 
ATOM   3325 C  CD1   . LEU A 1 430 ? 30.622 57.414  -33.138 1.00 46.46  ? 429  LEU A CD1   1 
ATOM   3326 C  CD2   . LEU A 1 430 ? 31.937 58.761  -34.782 1.00 49.51  ? 429  LEU A CD2   1 
ATOM   3327 N  N     . GLU A 1 431 ? 32.779 62.475  -31.801 1.00 46.59  ? 430  GLU A N     1 
ATOM   3328 C  CA    . GLU A 1 431 ? 32.677 63.592  -30.876 1.00 45.03  ? 430  GLU A CA    1 
ATOM   3329 C  C     . GLU A 1 431 ? 31.520 63.381  -29.910 1.00 42.92  ? 430  GLU A C     1 
ATOM   3330 O  O     . GLU A 1 431 ? 30.512 62.752  -30.239 1.00 36.75  ? 430  GLU A O     1 
ATOM   3331 C  CB    . GLU A 1 431 ? 32.478 64.904  -31.636 1.00 44.15  ? 430  GLU A CB    1 
ATOM   3332 C  CG    . GLU A 1 431 ? 33.609 65.258  -32.573 1.00 45.81  ? 430  GLU A CG    1 
ATOM   3333 C  CD    . GLU A 1 431 ? 34.925 65.441  -31.849 1.00 52.04  ? 430  GLU A CD    1 
ATOM   3334 O  OE1   . GLU A 1 431 ? 35.847 64.629  -32.074 1.00 55.31  ? 430  GLU A OE1   1 
ATOM   3335 O  OE2   . GLU A 1 431 ? 35.037 66.392  -31.049 1.00 56.68  ? 430  GLU A OE2   1 
ATOM   3336 N  N     . LYS A 1 432 ? 31.674 63.919  -28.700 1.00 45.08  ? 431  LYS A N     1 
ATOM   3337 C  CA    . LYS A 1 432 ? 30.573 63.930  -27.747 1.00 45.18  ? 431  LYS A CA    1 
ATOM   3338 C  C     . LYS A 1 432 ? 29.635 65.111  -27.956 1.00 44.17  ? 431  LYS A C     1 
ATOM   3339 O  O     . LYS A 1 432 ? 28.469 65.035  -27.558 1.00 46.34  ? 431  LYS A O     1 
ATOM   3340 C  CB    . LYS A 1 432 ? 31.114 63.943  -26.314 1.00 47.40  ? 431  LYS A CB    1 
ATOM   3341 N  N     . GLU A 1 433 ? 30.107 66.187  -28.579 1.00 44.95  ? 432  GLU A N     1 
ATOM   3342 C  CA    . GLU A 1 433 ? 29.315 67.384  -28.812 1.00 46.57  ? 432  GLU A CA    1 
ATOM   3343 C  C     . GLU A 1 433 ? 29.345 67.750  -30.288 1.00 42.02  ? 432  GLU A C     1 
ATOM   3344 O  O     . GLU A 1 433 ? 30.309 67.428  -30.989 1.00 41.52  ? 432  GLU A O     1 
ATOM   3345 C  CB    . GLU A 1 433 ? 29.844 68.564  -27.981 1.00 50.66  ? 432  GLU A CB    1 
ATOM   3346 C  CG    . GLU A 1 433 ? 29.951 68.284  -26.489 1.00 58.11  ? 432  GLU A CG    1 
ATOM   3347 C  CD    . GLU A 1 433 ? 28.598 68.136  -25.811 1.00 65.84  ? 432  GLU A CD    1 
ATOM   3348 O  OE1   . GLU A 1 433 ? 27.581 68.578  -26.388 1.00 67.03  ? 432  GLU A OE1   1 
ATOM   3349 O  OE2   . GLU A 1 433 ? 28.555 67.575  -24.694 1.00 69.81  ? 432  GLU A OE2   1 
ATOM   3350 N  N     . PRO A 1 434 ? 28.304 68.416  -30.790 1.00 40.93  ? 433  PRO A N     1 
ATOM   3351 C  CA    . PRO A 1 434 ? 28.323 68.853  -32.192 1.00 40.12  ? 433  PRO A CA    1 
ATOM   3352 C  C     . PRO A 1 434 ? 29.455 69.838  -32.451 1.00 40.26  ? 433  PRO A C     1 
ATOM   3353 O  O     . PRO A 1 434 ? 29.911 70.551  -31.554 1.00 41.76  ? 433  PRO A O     1 
ATOM   3354 C  CB    . PRO A 1 434 ? 26.949 69.509  -32.381 1.00 39.32  ? 433  PRO A CB    1 
ATOM   3355 C  CG    . PRO A 1 434 ? 26.521 69.896  -31.005 1.00 40.68  ? 433  PRO A CG    1 
ATOM   3356 C  CD    . PRO A 1 434 ? 27.067 68.828  -30.103 1.00 40.62  ? 433  PRO A CD    1 
ATOM   3357 N  N     . ILE A 1 435 ? 29.909 69.871  -33.701 1.00 42.28  ? 434  ILE A N     1 
ATOM   3358 C  CA    . ILE A 1 435 ? 31.108 70.604  -34.090 1.00 42.70  ? 434  ILE A CA    1 
ATOM   3359 C  C     . ILE A 1 435 ? 30.708 71.961  -34.653 1.00 44.16  ? 434  ILE A C     1 
ATOM   3360 O  O     . ILE A 1 435 ? 29.898 72.040  -35.585 1.00 42.23  ? 434  ILE A O     1 
ATOM   3361 C  CB    . ILE A 1 435 ? 31.930 69.808  -35.119 1.00 41.15  ? 434  ILE A CB    1 
ATOM   3362 C  CG1   . ILE A 1 435 ? 32.009 68.336  -34.709 1.00 39.66  ? 434  ILE A CG1   1 
ATOM   3363 C  CG2   . ILE A 1 435 ? 33.326 70.397  -35.254 1.00 42.13  ? 434  ILE A CG2   1 
ATOM   3364 C  CD1   . ILE A 1 435 ? 32.367 67.399  -35.845 1.00 37.88  ? 434  ILE A CD1   1 
ATOM   3365 N  N     . VAL A 1 436 ? 31.276 73.029  -34.089 1.00 43.45  ? 435  VAL A N     1 
ATOM   3366 C  CA    . VAL A 1 436 ? 31.100 74.360  -34.658 1.00 49.82  ? 435  VAL A CA    1 
ATOM   3367 C  C     . VAL A 1 436 ? 31.908 74.462  -35.943 1.00 49.45  ? 435  VAL A C     1 
ATOM   3368 O  O     . VAL A 1 436 ? 33.074 74.050  -35.998 1.00 53.57  ? 435  VAL A O     1 
ATOM   3369 C  CB    . VAL A 1 436 ? 31.520 75.443  -33.650 1.00 51.14  ? 435  VAL A CB    1 
ATOM   3370 C  CG1   . VAL A 1 436 ? 31.537 76.813  -34.314 1.00 48.31  ? 435  VAL A CG1   1 
ATOM   3371 C  CG2   . VAL A 1 436 ? 30.585 75.454  -32.452 1.00 47.13  ? 435  VAL A CG2   1 
ATOM   3372 N  N     . GLY A 1 437 ? 31.290 75.004  -36.989 1.00 47.07  ? 436  GLY A N     1 
ATOM   3373 C  CA    . GLY A 1 437 ? 31.961 75.187  -38.256 1.00 47.28  ? 436  GLY A CA    1 
ATOM   3374 C  C     . GLY A 1 437 ? 31.928 73.989  -39.176 1.00 49.97  ? 436  GLY A C     1 
ATOM   3375 O  O     . GLY A 1 437 ? 32.511 74.048  -40.266 1.00 52.88  ? 436  GLY A O     1 
ATOM   3376 N  N     . ALA A 1 438 ? 31.275 72.904  -38.779 1.00 48.15  ? 437  ALA A N     1 
ATOM   3377 C  CA    . ALA A 1 438 ? 31.142 71.726  -39.620 1.00 39.84  ? 437  ALA A CA    1 
ATOM   3378 C  C     . ALA A 1 438 ? 29.747 71.703  -40.227 1.00 45.72  ? 437  ALA A C     1 
ATOM   3379 O  O     . ALA A 1 438 ? 28.753 71.905  -39.520 1.00 44.34  ? 437  ALA A O     1 
ATOM   3380 C  CB    . ALA A 1 438 ? 31.401 70.448  -38.820 1.00 48.82  ? 437  ALA A CB    1 
ATOM   3381 N  N     . GLU A 1 439 ? 29.683 71.479  -41.536 1.00 38.32  ? 438  GLU A N     1 
ATOM   3382 C  CA    . GLU A 1 439 ? 28.403 71.387  -42.224 1.00 39.42  ? 438  GLU A CA    1 
ATOM   3383 C  C     . GLU A 1 439 ? 27.561 70.264  -41.631 1.00 40.98  ? 438  GLU A C     1 
ATOM   3384 O  O     . GLU A 1 439 ? 28.080 69.212  -41.246 1.00 37.67  ? 438  GLU A O     1 
ATOM   3385 C  CB    . GLU A 1 439 ? 28.637 71.154  -43.715 1.00 40.12  ? 438  GLU A CB    1 
ATOM   3386 C  CG    . GLU A 1 439 ? 27.401 71.263  -44.578 1.00 40.94  ? 438  GLU A CG    1 
ATOM   3387 C  CD    . GLU A 1 439 ? 27.727 71.147  -46.051 1.00 44.18  ? 438  GLU A CD    1 
ATOM   3388 O  OE1   . GLU A 1 439 ? 28.863 70.736  -46.380 1.00 42.47  ? 438  GLU A OE1   1 
ATOM   3389 O  OE2   . GLU A 1 439 ? 26.850 71.470  -46.878 1.00 47.32  ? 438  GLU A OE2   1 
ATOM   3390 N  N     . THR A 1 440 ? 26.252 70.494  -41.548 1.00 36.34  ? 439  THR A N     1 
ATOM   3391 C  CA    . THR A 1 440 ? 25.333 69.563  -40.901 1.00 39.24  ? 439  THR A CA    1 
ATOM   3392 C  C     . THR A 1 440 ? 24.593 68.768  -41.973 1.00 43.51  ? 439  THR A C     1 
ATOM   3393 O  O     . THR A 1 440 ? 23.803 69.329  -42.740 1.00 45.59  ? 439  THR A O     1 
ATOM   3394 C  CB    . THR A 1 440 ? 24.351 70.304  -39.995 1.00 36.78  ? 439  THR A CB    1 
ATOM   3395 O  OG1   . THR A 1 440 ? 25.075 71.002  -38.973 1.00 40.27  ? 439  THR A OG1   1 
ATOM   3396 C  CG2   . THR A 1 440 ? 23.389 69.321  -39.345 1.00 34.81  ? 439  THR A CG2   1 
ATOM   3397 N  N     . PHE A 1 441 ? 24.852 67.463  -42.021 1.00 39.99  ? 440  PHE A N     1 
ATOM   3398 C  CA    . PHE A 1 441 ? 24.202 66.559  -42.960 1.00 36.58  ? 440  PHE A CA    1 
ATOM   3399 C  C     . PHE A 1 441 ? 23.042 65.850  -42.272 1.00 36.63  ? 440  PHE A C     1 
ATOM   3400 O  O     . PHE A 1 441 ? 23.216 65.262  -41.199 1.00 40.89  ? 440  PHE A O     1 
ATOM   3401 C  CB    . PHE A 1 441 ? 25.190 65.525  -43.505 1.00 33.77  ? 440  PHE A CB    1 
ATOM   3402 C  CG    . PHE A 1 441 ? 26.143 66.069  -44.537 1.00 34.61  ? 440  PHE A CG    1 
ATOM   3403 C  CD1   . PHE A 1 441 ? 27.110 66.994  -44.191 1.00 35.11  ? 440  PHE A CD1   1 
ATOM   3404 C  CD2   . PHE A 1 441 ? 26.078 65.637  -45.853 1.00 34.87  ? 440  PHE A CD2   1 
ATOM   3405 C  CE1   . PHE A 1 441 ? 27.985 67.491  -45.139 1.00 36.37  ? 440  PHE A CE1   1 
ATOM   3406 C  CE2   . PHE A 1 441 ? 26.950 66.126  -46.804 1.00 35.30  ? 440  PHE A CE2   1 
ATOM   3407 C  CZ    . PHE A 1 441 ? 27.905 67.054  -46.448 1.00 37.68  ? 440  PHE A CZ    1 
ATOM   3408 N  N     . TYR A 1 442 ? 21.863 65.914  -42.883 1.00 33.30  ? 441  TYR A N     1 
ATOM   3409 C  CA    . TYR A 1 442 ? 20.721 65.094  -42.507 1.00 32.70  ? 441  TYR A CA    1 
ATOM   3410 C  C     . TYR A 1 442 ? 20.602 64.013  -43.574 1.00 38.98  ? 441  TYR A C     1 
ATOM   3411 O  O     . TYR A 1 442 ? 20.351 64.315  -44.747 1.00 41.29  ? 441  TYR A O     1 
ATOM   3412 C  CB    . TYR A 1 442 ? 19.446 65.931  -42.404 1.00 32.99  ? 441  TYR A CB    1 
ATOM   3413 C  CG    . TYR A 1 442 ? 19.495 66.975  -41.317 1.00 41.90  ? 441  TYR A CG    1 
ATOM   3414 C  CD1   . TYR A 1 442 ? 20.002 68.244  -41.568 1.00 33.59  ? 441  TYR A CD1   1 
ATOM   3415 C  CD2   . TYR A 1 442 ? 19.044 66.693  -40.037 1.00 33.83  ? 441  TYR A CD2   1 
ATOM   3416 C  CE1   . TYR A 1 442 ? 20.055 69.201  -40.575 1.00 34.23  ? 441  TYR A CE1   1 
ATOM   3417 C  CE2   . TYR A 1 442 ? 19.094 67.643  -39.038 1.00 42.66  ? 441  TYR A CE2   1 
ATOM   3418 C  CZ    . TYR A 1 442 ? 19.602 68.894  -39.314 1.00 40.62  ? 441  TYR A CZ    1 
ATOM   3419 O  OH    . TYR A 1 442 ? 19.653 69.841  -38.326 1.00 41.99  ? 441  TYR A OH    1 
ATOM   3420 N  N     . VAL A 1 443 ? 20.804 62.761  -43.174 1.00 38.60  ? 442  VAL A N     1 
ATOM   3421 C  CA    . VAL A 1 443 ? 20.843 61.645  -44.106 1.00 40.44  ? 442  VAL A CA    1 
ATOM   3422 C  C     . VAL A 1 443 ? 19.620 60.770  -43.884 1.00 41.75  ? 442  VAL A C     1 
ATOM   3423 O  O     . VAL A 1 443 ? 19.010 60.761  -42.810 1.00 43.68  ? 442  VAL A O     1 
ATOM   3424 C  CB    . VAL A 1 443 ? 22.137 60.814  -43.965 1.00 38.22  ? 442  VAL A CB    1 
ATOM   3425 C  CG1   . VAL A 1 443 ? 23.355 61.708  -44.065 1.00 33.24  ? 442  VAL A CG1   1 
ATOM   3426 C  CG2   . VAL A 1 443 ? 22.140 60.045  -42.652 1.00 32.68  ? 442  VAL A CG2   1 
ATOM   3427 N  N     . ASP A 1 444 ? 19.257 60.029  -44.928 1.00 41.08  ? 443  ASP A N     1 
ATOM   3428 C  CA    . ASP A 1 444 ? 18.206 59.029  -44.798 1.00 44.29  ? 443  ASP A CA    1 
ATOM   3429 C  C     . ASP A 1 444 ? 18.253 58.097  -45.998 1.00 42.14  ? 443  ASP A C     1 
ATOM   3430 O  O     . ASP A 1 444 ? 18.750 58.452  -47.073 1.00 44.04  ? 443  ASP A O     1 
ATOM   3431 C  CB    . ASP A 1 444 ? 16.814 59.662  -44.670 1.00 50.99  ? 443  ASP A CB    1 
ATOM   3432 C  CG    . ASP A 1 444 ? 15.789 58.702  -44.079 1.00 58.91  ? 443  ASP A CG    1 
ATOM   3433 O  OD1   . ASP A 1 444 ? 16.188 57.614  -43.612 1.00 63.90  ? 443  ASP A OD1   1 
ATOM   3434 O  OD2   . ASP A 1 444 ? 14.584 59.033  -44.079 1.00 62.82  ? 443  ASP A OD2   1 
ATOM   3435 N  N     . GLY A 1 445 ? 17.712 56.900  -45.796 1.00 38.47  ? 444  GLY A N     1 
ATOM   3436 C  CA    . GLY A 1 445 ? 17.561 55.930  -46.857 1.00 40.10  ? 444  GLY A CA    1 
ATOM   3437 C  C     . GLY A 1 445 ? 16.232 55.211  -46.769 1.00 44.90  ? 444  GLY A C     1 
ATOM   3438 O  O     . GLY A 1 445 ? 15.741 54.933  -45.671 1.00 49.32  ? 444  GLY A O     1 
ATOM   3439 N  N     . ALA A 1 446 ? 15.636 54.919  -47.920 1.00 47.47  ? 445  ALA A N     1 
ATOM   3440 C  CA    . ALA A 1 446 ? 14.392 54.169  -47.997 1.00 40.58  ? 445  ALA A CA    1 
ATOM   3441 C  C     . ALA A 1 446 ? 14.561 53.011  -48.968 1.00 46.27  ? 445  ALA A C     1 
ATOM   3442 O  O     . ALA A 1 446 ? 15.309 53.103  -49.944 1.00 45.66  ? 445  ALA A O     1 
ATOM   3443 C  CB    . ALA A 1 446 ? 13.223 55.056  -48.438 1.00 40.81  ? 445  ALA A CB    1 
ATOM   3444 N  N     . ALA A 1 447 ? 13.866 51.911  -48.688 1.00 49.10  ? 446  ALA A N     1 
ATOM   3445 C  CA    . ALA A 1 447 ? 13.912 50.733  -49.541 1.00 45.29  ? 446  ALA A CA    1 
ATOM   3446 C  C     . ALA A 1 447 ? 12.511 50.171  -49.707 1.00 47.82  ? 446  ALA A C     1 
ATOM   3447 O  O     . ALA A 1 447 ? 11.713 50.184  -48.767 1.00 50.63  ? 446  ALA A O     1 
ATOM   3448 C  CB    . ALA A 1 447 ? 14.844 49.658  -48.971 1.00 45.50  ? 446  ALA A CB    1 
ATOM   3449 N  N     . ASN A 1 448 ? 12.219 49.681  -50.908 1.00 48.94  ? 447  ASN A N     1 
ATOM   3450 C  CA    . ASN A 1 448 ? 10.928 49.077  -51.214 1.00 55.78  ? 447  ASN A CA    1 
ATOM   3451 C  C     . ASN A 1 448 ? 11.054 47.569  -51.029 1.00 59.08  ? 447  ASN A C     1 
ATOM   3452 O  O     . ASN A 1 448 ? 11.785 46.906  -51.771 1.00 62.76  ? 447  ASN A O     1 
ATOM   3453 C  CB    . ASN A 1 448 ? 10.495 49.426  -52.635 1.00 58.63  ? 447  ASN A CB    1 
ATOM   3454 C  CG    . ASN A 1 448 ? 9.116  48.899  -52.968 1.00 66.05  ? 447  ASN A CG    1 
ATOM   3455 O  OD1   . ASN A 1 448 ? 8.951  47.722  -53.284 1.00 70.33  ? 447  ASN A OD1   1 
ATOM   3456 N  ND2   . ASN A 1 448 ? 8.117  49.771  -52.903 1.00 67.67  ? 447  ASN A ND2   1 
ATOM   3457 N  N     . ARG A 1 449 ? 10.343 47.026  -50.037 1.00 61.26  ? 448  ARG A N     1 
ATOM   3458 C  CA    . ARG A 1 449 ? 10.466 45.609  -49.713 1.00 61.66  ? 448  ARG A CA    1 
ATOM   3459 C  C     . ARG A 1 449 ? 9.973  44.697  -50.829 1.00 66.77  ? 448  ARG A C     1 
ATOM   3460 O  O     . ARG A 1 449 ? 10.269 43.497  -50.798 1.00 72.52  ? 448  ARG A O     1 
ATOM   3461 C  CB    . ARG A 1 449 ? 9.708  45.299  -48.420 1.00 61.39  ? 448  ARG A CB    1 
ATOM   3462 N  N     . GLU A 1 450 ? 9.242  45.225  -51.811 1.00 59.59  ? 449  GLU A N     1 
ATOM   3463 C  CA    . GLU A 1 450 ? 8.735  44.406  -52.908 1.00 64.91  ? 449  GLU A CA    1 
ATOM   3464 C  C     . GLU A 1 450 ? 9.717  44.364  -54.078 1.00 66.57  ? 449  GLU A C     1 
ATOM   3465 O  O     . GLU A 1 450 ? 10.138 43.284  -54.505 1.00 69.31  ? 449  GLU A O     1 
ATOM   3466 C  CB    . GLU A 1 450 ? 7.368  44.927  -53.366 1.00 66.59  ? 449  GLU A CB    1 
ATOM   3467 N  N     . THR A 1 451 ? 10.091 45.531  -54.602 1.00 62.55  ? 450  THR A N     1 
ATOM   3468 C  CA    . THR A 1 451 ? 10.974 45.611  -55.759 1.00 59.96  ? 450  THR A CA    1 
ATOM   3469 C  C     . THR A 1 451 ? 12.453 45.595  -55.394 1.00 55.80  ? 450  THR A C     1 
ATOM   3470 O  O     . THR A 1 451 ? 13.292 45.499  -56.295 1.00 55.36  ? 450  THR A O     1 
ATOM   3471 C  CB    . THR A 1 451 ? 10.681 46.880  -56.565 1.00 59.21  ? 450  THR A CB    1 
ATOM   3472 O  OG1   . THR A 1 451 ? 11.024 48.033  -55.784 1.00 57.73  ? 450  THR A OG1   1 
ATOM   3473 C  CG2   . THR A 1 451 ? 9.209  46.945  -56.941 1.00 59.57  ? 450  THR A CG2   1 
ATOM   3474 N  N     . LYS A 1 452 ? 12.787 45.702  -54.108 1.00 53.94  ? 451  LYS A N     1 
ATOM   3475 C  CA    . LYS A 1 452 ? 14.157 45.783  -53.605 1.00 52.97  ? 451  LYS A CA    1 
ATOM   3476 C  C     . LYS A 1 452 ? 14.901 47.020  -54.106 1.00 53.11  ? 451  LYS A C     1 
ATOM   3477 O  O     . LYS A 1 452 ? 16.114 47.137  -53.892 1.00 52.10  ? 451  LYS A O     1 
ATOM   3478 C  CB    . LYS A 1 452 ? 14.955 44.514  -53.937 1.00 48.85  ? 451  LYS A CB    1 
ATOM   3479 N  N     . LEU A 1 453 ? 14.210 47.947  -54.765 1.00 53.57  ? 452  LEU A N     1 
ATOM   3480 C  CA    . LEU A 1 453 ? 14.814 49.209  -55.160 1.00 52.70  ? 452  LEU A CA    1 
ATOM   3481 C  C     . LEU A 1 453 ? 14.835 50.166  -53.975 1.00 49.48  ? 452  LEU A C     1 
ATOM   3482 O  O     . LEU A 1 453 ? 13.940 50.153  -53.125 1.00 49.02  ? 452  LEU A O     1 
ATOM   3483 C  CB    . LEU A 1 453 ? 14.045 49.840  -56.322 1.00 53.76  ? 452  LEU A CB    1 
ATOM   3484 C  CG    . LEU A 1 453 ? 13.886 49.019  -57.604 1.00 57.97  ? 452  LEU A CG    1 
ATOM   3485 C  CD1   . LEU A 1 453 ? 13.146 49.820  -58.664 1.00 60.58  ? 452  LEU A CD1   1 
ATOM   3486 C  CD2   . LEU A 1 453 ? 15.235 48.560  -58.125 1.00 57.66  ? 452  LEU A CD2   1 
ATOM   3487 N  N     . GLY A 1 454 ? 15.871 51.004  -53.920 1.00 46.12  ? 453  GLY A N     1 
ATOM   3488 C  CA    . GLY A 1 454 ? 16.001 51.930  -52.814 1.00 44.11  ? 453  GLY A CA    1 
ATOM   3489 C  C     . GLY A 1 454 ? 16.614 53.249  -53.232 1.00 44.53  ? 453  GLY A C     1 
ATOM   3490 O  O     . GLY A 1 454 ? 17.074 53.426  -54.362 1.00 44.01  ? 453  GLY A O     1 
ATOM   3491 N  N     . LYS A 1 455 ? 16.618 54.179  -52.281 1.00 41.18  ? 454  LYS A N     1 
ATOM   3492 C  CA    . LYS A 1 455 ? 17.305 55.452  -52.427 1.00 42.44  ? 454  LYS A CA    1 
ATOM   3493 C  C     . LYS A 1 455 ? 17.999 55.799  -51.120 1.00 42.78  ? 454  LYS A C     1 
ATOM   3494 O  O     . LYS A 1 455 ? 17.531 55.447  -50.035 1.00 41.77  ? 454  LYS A O     1 
ATOM   3495 C  CB    . LYS A 1 455 ? 16.345 56.582  -52.826 1.00 43.82  ? 454  LYS A CB    1 
ATOM   3496 C  CG    . LYS A 1 455 ? 15.874 56.518  -54.268 1.00 47.31  ? 454  LYS A CG    1 
ATOM   3497 C  CD    . LYS A 1 455 ? 14.909 57.648  -54.582 1.00 49.54  ? 454  LYS A CD    1 
ATOM   3498 C  CE    . LYS A 1 455 ? 14.445 57.593  -56.027 1.00 52.32  ? 454  LYS A CE    1 
ATOM   3499 N  NZ    . LYS A 1 455 ? 13.493 58.697  -56.334 1.00 55.85  ? 454  LYS A NZ    1 
ATOM   3500 N  N     . ALA A 1 456 ? 19.135 56.479  -51.238 1.00 42.13  ? 455  ALA A N     1 
ATOM   3501 C  CA    . ALA A 1 456 ? 19.866 57.004  -50.095 1.00 41.93  ? 455  ALA A CA    1 
ATOM   3502 C  C     . ALA A 1 456 ? 20.229 58.447  -50.398 1.00 45.24  ? 455  ALA A C     1 
ATOM   3503 O  O     . ALA A 1 456 ? 20.357 58.827  -51.560 1.00 46.65  ? 455  ALA A O     1 
ATOM   3504 C  CB    . ALA A 1 456 ? 21.133 56.188  -49.803 1.00 39.28  ? 455  ALA A CB    1 
ATOM   3505 N  N     . GLY A 1 457 ? 20.368 59.269  -49.369 1.00 43.82  ? 456  GLY A N     1 
ATOM   3506 C  CA    . GLY A 1 457 ? 20.707 60.644  -49.681 1.00 41.72  ? 456  GLY A CA    1 
ATOM   3507 C  C     . GLY A 1 457 ? 20.795 61.522  -48.457 1.00 39.41  ? 456  GLY A C     1 
ATOM   3508 O  O     . GLY A 1 457 ? 20.630 61.073  -47.315 1.00 39.99  ? 456  GLY A O     1 
ATOM   3509 N  N     . TYR A 1 458 ? 21.057 62.798  -48.730 1.00 37.62  ? 457  TYR A N     1 
ATOM   3510 C  CA    . TYR A 1 458 ? 21.246 63.790  -47.683 1.00 39.52  ? 457  TYR A CA    1 
ATOM   3511 C  C     . TYR A 1 458 ? 20.748 65.150  -48.152 1.00 41.39  ? 457  TYR A C     1 
ATOM   3512 O  O     . TYR A 1 458 ? 20.687 65.437  -49.353 1.00 40.10  ? 457  TYR A O     1 
ATOM   3513 C  CB    . TYR A 1 458 ? 22.720 63.895  -47.260 1.00 38.39  ? 457  TYR A CB    1 
ATOM   3514 C  CG    . TYR A 1 458 ? 23.661 64.317  -48.374 1.00 41.64  ? 457  TYR A CG    1 
ATOM   3515 C  CD1   . TYR A 1 458 ? 23.768 65.650  -48.762 1.00 41.68  ? 457  TYR A CD1   1 
ATOM   3516 C  CD2   . TYR A 1 458 ? 24.458 63.383  -49.024 1.00 42.53  ? 457  TYR A CD2   1 
ATOM   3517 C  CE1   . TYR A 1 458 ? 24.623 66.033  -49.775 1.00 42.74  ? 457  TYR A CE1   1 
ATOM   3518 C  CE2   . TYR A 1 458 ? 25.320 63.760  -50.036 1.00 40.94  ? 457  TYR A CE2   1 
ATOM   3519 C  CZ    . TYR A 1 458 ? 25.398 65.083  -50.407 1.00 43.75  ? 457  TYR A CZ    1 
ATOM   3520 O  OH    . TYR A 1 458 ? 26.257 65.455  -51.416 1.00 47.55  ? 457  TYR A OH    1 
ATOM   3521 N  N     . VAL A 1 459 ? 20.386 65.980  -47.171 1.00 39.47  ? 458  VAL A N     1 
ATOM   3522 C  CA    . VAL A 1 459 ? 20.315 67.427  -47.330 1.00 42.11  ? 458  VAL A CA    1 
ATOM   3523 C  C     . VAL A 1 459 ? 21.258 68.043  -46.304 1.00 43.28  ? 458  VAL A C     1 
ATOM   3524 O  O     . VAL A 1 459 ? 21.640 67.407  -45.320 1.00 40.79  ? 458  VAL A O     1 
ATOM   3525 C  CB    . VAL A 1 459 ? 18.888 67.994  -47.166 1.00 40.64  ? 458  VAL A CB    1 
ATOM   3526 C  CG1   . VAL A 1 459 ? 17.954 67.419  -48.223 1.00 41.38  ? 458  VAL A CG1   1 
ATOM   3527 C  CG2   . VAL A 1 459 ? 18.364 67.726  -45.762 1.00 39.20  ? 458  VAL A CG2   1 
ATOM   3528 N  N     . THR A 1 460 ? 21.664 69.288  -46.556 1.00 40.29  ? 459  THR A N     1 
ATOM   3529 C  CA    . THR A 1 460 ? 22.580 69.979  -45.659 1.00 38.11  ? 459  THR A CA    1 
ATOM   3530 C  C     . THR A 1 460 ? 22.048 71.364  -45.323 1.00 43.27  ? 459  THR A C     1 
ATOM   3531 O  O     . THR A 1 460 ? 21.305 71.971  -46.100 1.00 46.65  ? 459  THR A O     1 
ATOM   3532 C  CB    . THR A 1 460 ? 23.989 70.113  -46.257 1.00 38.80  ? 459  THR A CB    1 
ATOM   3533 O  OG1   . THR A 1 460 ? 23.989 71.134  -47.262 1.00 46.12  ? 459  THR A OG1   1 
ATOM   3534 C  CG2   . THR A 1 460 ? 24.453 68.793  -46.870 1.00 34.41  ? 459  THR A CG2   1 
ATOM   3535 N  N     . ASN A 1 461 ? 22.450 71.865  -44.152 1.00 43.47  ? 460  ASN A N     1 
ATOM   3536 C  CA    . ASN A 1 461 ? 22.051 73.201  -43.726 1.00 43.22  ? 460  ASN A CA    1 
ATOM   3537 C  C     . ASN A 1 461 ? 22.608 74.292  -44.627 1.00 42.33  ? 460  ASN A C     1 
ATOM   3538 O  O     . ASN A 1 461 ? 22.195 75.449  -44.498 1.00 43.62  ? 460  ASN A O     1 
ATOM   3539 C  CB    . ASN A 1 461 ? 22.500 73.451  -42.286 1.00 46.00  ? 460  ASN A CB    1 
ATOM   3540 C  CG    . ASN A 1 461 ? 24.003 73.581  -42.161 1.00 51.42  ? 460  ASN A CG    1 
ATOM   3541 O  OD1   . ASN A 1 461 ? 24.736 72.605  -42.327 1.00 51.48  ? 460  ASN A OD1   1 
ATOM   3542 N  ND2   . ASN A 1 461 ? 24.472 74.788  -41.861 1.00 37.42  ? 460  ASN A ND2   1 
ATOM   3543 N  N     . ARG A 1 462 ? 23.531 73.960  -45.524 1.00 37.29  ? 461  ARG A N     1 
ATOM   3544 C  CA    . ARG A 1 462 ? 24.088 74.914  -46.468 1.00 38.82  ? 461  ARG A CA    1 
ATOM   3545 C  C     . ARG A 1 462 ? 23.473 74.789  -47.855 1.00 39.46  ? 461  ARG A C     1 
ATOM   3546 O  O     . ARG A 1 462 ? 24.028 75.326  -48.817 1.00 40.75  ? 461  ARG A O     1 
ATOM   3547 C  CB    . ARG A 1 462 ? 25.606 74.754  -46.539 1.00 38.76  ? 461  ARG A CB    1 
ATOM   3548 C  CG    . ARG A 1 462 ? 26.280 74.974  -45.198 1.00 38.56  ? 461  ARG A CG    1 
ATOM   3549 C  CD    . ARG A 1 462 ? 27.778 74.765  -45.257 1.00 46.48  ? 461  ARG A CD    1 
ATOM   3550 N  NE    . ARG A 1 462 ? 28.379 74.889  -43.930 1.00 49.95  ? 461  ARG A NE    1 
ATOM   3551 C  CZ    . ARG A 1 462 ? 29.642 74.586  -43.649 1.00 49.02  ? 461  ARG A CZ    1 
ATOM   3552 N  NH1   . ARG A 1 462 ? 30.448 74.137  -44.605 1.00 45.12  ? 461  ARG A NH1   1 
ATOM   3553 N  NH2   . ARG A 1 462 ? 30.099 74.731  -42.411 1.00 45.78  ? 461  ARG A NH2   1 
ATOM   3554 N  N     . GLY A 1 463 ? 22.346 74.086  -47.981 1.00 38.83  ? 462  GLY A N     1 
ATOM   3555 C  CA    . GLY A 1 463 ? 21.592 74.049  -49.216 1.00 39.79  ? 462  GLY A CA    1 
ATOM   3556 C  C     . GLY A 1 463 ? 21.863 72.875  -50.132 1.00 42.16  ? 462  GLY A C     1 
ATOM   3557 O  O     . GLY A 1 463 ? 21.174 72.743  -51.150 1.00 45.12  ? 462  GLY A O     1 
ATOM   3558 N  N     . ARG A 1 464 ? 22.832 72.020  -49.813 1.00 38.52  ? 463  ARG A N     1 
ATOM   3559 C  CA    . ARG A 1 464 ? 23.157 70.898  -50.683 1.00 41.23  ? 463  ARG A CA    1 
ATOM   3560 C  C     . ARG A 1 464 ? 22.213 69.728  -50.433 1.00 41.67  ? 463  ARG A C     1 
ATOM   3561 O  O     . ARG A 1 464 ? 21.786 69.481  -49.301 1.00 39.16  ? 463  ARG A O     1 
ATOM   3562 C  CB    . ARG A 1 464 ? 24.603 70.448  -50.469 1.00 40.81  ? 463  ARG A CB    1 
ATOM   3563 C  CG    . ARG A 1 464 ? 25.647 71.506  -50.779 1.00 46.29  ? 463  ARG A CG    1 
ATOM   3564 C  CD    . ARG A 1 464 ? 26.977 71.157  -50.129 1.00 49.29  ? 463  ARG A CD    1 
ATOM   3565 N  NE    . ARG A 1 464 ? 27.567 69.956  -50.710 1.00 50.34  ? 463  ARG A NE    1 
ATOM   3566 C  CZ    . ARG A 1 464 ? 28.486 69.201  -50.117 1.00 46.40  ? 463  ARG A CZ    1 
ATOM   3567 N  NH1   . ARG A 1 464 ? 28.934 69.501  -48.904 1.00 35.70  ? 463  ARG A NH1   1 
ATOM   3568 N  NH2   . ARG A 1 464 ? 28.959 68.138  -50.745 1.00 45.02  ? 463  ARG A NH2   1 
ATOM   3569 N  N     . GLN A 1 465 ? 21.884 69.009  -51.502 1.00 43.11  ? 464  GLN A N     1 
ATOM   3570 C  CA    . GLN A 1 465 ? 21.134 67.771  -51.378 1.00 43.50  ? 464  GLN A CA    1 
ATOM   3571 C  C     . GLN A 1 465 ? 21.582 66.816  -52.473 1.00 45.16  ? 464  GLN A C     1 
ATOM   3572 O  O     . GLN A 1 465 ? 21.945 67.237  -53.575 1.00 47.57  ? 464  GLN A O     1 
ATOM   3573 C  CB    . GLN A 1 465 ? 19.621 68.006  -51.449 1.00 45.99  ? 464  GLN A CB    1 
ATOM   3574 C  CG    . GLN A 1 465 ? 19.084 68.313  -52.833 1.00 51.97  ? 464  GLN A CG    1 
ATOM   3575 C  CD    . GLN A 1 465 ? 17.598 68.621  -52.819 1.00 56.78  ? 464  GLN A CD    1 
ATOM   3576 O  OE1   . GLN A 1 465 ? 17.127 69.434  -52.020 1.00 57.55  ? 464  GLN A OE1   1 
ATOM   3577 N  NE2   . GLN A 1 465 ? 16.849 67.966  -53.698 1.00 57.87  ? 464  GLN A NE2   1 
ATOM   3578 N  N     . LYS A 1 466 ? 21.574 65.525  -52.150 1.00 44.92  ? 465  LYS A N     1 
ATOM   3579 C  CA    . LYS A 1 466 ? 21.956 64.504  -53.118 1.00 43.01  ? 465  LYS A CA    1 
ATOM   3580 C  C     . LYS A 1 466 ? 21.198 63.217  -52.832 1.00 42.27  ? 465  LYS A C     1 
ATOM   3581 O  O     . LYS A 1 466 ? 20.945 62.882  -51.670 1.00 36.98  ? 465  LYS A O     1 
ATOM   3582 C  CB    . LYS A 1 466 ? 23.464 64.236  -53.099 1.00 42.86  ? 465  LYS A CB    1 
ATOM   3583 C  CG    . LYS A 1 466 ? 23.942 63.379  -54.265 1.00 47.18  ? 465  LYS A CG    1 
ATOM   3584 C  CD    . LYS A 1 466 ? 25.405 62.989  -54.130 1.00 49.44  ? 465  LYS A CD    1 
ATOM   3585 C  CE    . LYS A 1 466 ? 26.293 63.818  -55.040 1.00 54.67  ? 465  LYS A CE    1 
ATOM   3586 N  NZ    . LYS A 1 466 ? 27.697 63.320  -55.025 1.00 57.57  ? 465  LYS A NZ    1 
ATOM   3587 N  N     . VAL A 1 467 ? 20.844 62.503  -53.903 1.00 44.40  ? 466  VAL A N     1 
ATOM   3588 C  CA    . VAL A 1 467 ? 20.077 61.264  -53.826 1.00 45.19  ? 466  VAL A CA    1 
ATOM   3589 C  C     . VAL A 1 467 ? 20.687 60.252  -54.790 1.00 47.98  ? 466  VAL A C     1 
ATOM   3590 O  O     . VAL A 1 467 ? 20.811 60.526  -55.989 1.00 49.83  ? 466  VAL A O     1 
ATOM   3591 C  CB    . VAL A 1 467 ? 18.588 61.481  -54.151 1.00 45.71  ? 466  VAL A CB    1 
ATOM   3592 C  CG1   . VAL A 1 467 ? 17.875 60.147  -54.308 1.00 45.05  ? 466  VAL A CG1   1 
ATOM   3593 C  CG2   . VAL A 1 467 ? 17.930 62.301  -53.060 1.00 46.27  ? 466  VAL A CG2   1 
ATOM   3594 N  N     . VAL A 1 468 ? 21.063 59.087  -54.266 1.00 46.44  ? 467  VAL A N     1 
ATOM   3595 C  CA    . VAL A 1 468 ? 21.612 57.976  -55.031 1.00 46.08  ? 467  VAL A CA    1 
ATOM   3596 C  C     . VAL A 1 468 ? 20.572 56.863  -55.073 1.00 47.48  ? 467  VAL A C     1 
ATOM   3597 O  O     . VAL A 1 468 ? 19.984 56.514  -54.040 1.00 47.96  ? 467  VAL A O     1 
ATOM   3598 C  CB    . VAL A 1 468 ? 22.927 57.470  -54.411 1.00 45.78  ? 467  VAL A CB    1 
ATOM   3599 C  CG1   . VAL A 1 468 ? 23.326 56.134  -55.014 1.00 49.90  ? 467  VAL A CG1   1 
ATOM   3600 C  CG2   . VAL A 1 468 ? 24.034 58.492  -54.600 1.00 46.03  ? 467  VAL A CG2   1 
ATOM   3601 N  N     . THR A 1 469 ? 20.346 56.311  -56.262 1.00 47.76  ? 468  THR A N     1 
ATOM   3602 C  CA    . THR A 1 469 ? 19.445 55.182  -56.438 1.00 49.37  ? 468  THR A CA    1 
ATOM   3603 C  C     . THR A 1 469 ? 20.211 53.871  -56.295 1.00 50.15  ? 468  THR A C     1 
ATOM   3604 O  O     . THR A 1 469 ? 21.383 53.769  -56.667 1.00 52.45  ? 468  THR A O     1 
ATOM   3605 C  CB    . THR A 1 469 ? 18.757 55.240  -57.803 1.00 50.65  ? 468  THR A CB    1 
ATOM   3606 O  OG1   . THR A 1 469 ? 19.736 55.106  -58.840 1.00 52.00  ? 468  THR A OG1   1 
ATOM   3607 C  CG2   . THR A 1 469 ? 18.027 56.567  -57.975 1.00 50.48  ? 468  THR A CG2   1 
ATOM   3608 N  N     . LEU A 1 470 ? 19.534 52.862  -55.748 1.00 49.82  ? 469  LEU A N     1 
ATOM   3609 C  CA    . LEU A 1 470 ? 20.161 51.590  -55.427 1.00 50.54  ? 469  LEU A CA    1 
ATOM   3610 C  C     . LEU A 1 470 ? 19.247 50.448  -55.850 1.00 53.65  ? 469  LEU A C     1 
ATOM   3611 O  O     . LEU A 1 470 ? 18.020 50.571  -55.825 1.00 54.20  ? 469  LEU A O     1 
ATOM   3612 C  CB    . LEU A 1 470 ? 20.471 51.487  -53.925 1.00 45.77  ? 469  LEU A CB    1 
ATOM   3613 C  CG    . LEU A 1 470 ? 21.252 52.647  -53.298 1.00 44.80  ? 469  LEU A CG    1 
ATOM   3614 C  CD1   . LEU A 1 470 ? 21.196 52.584  -51.781 1.00 41.31  ? 469  LEU A CD1   1 
ATOM   3615 C  CD2   . LEU A 1 470 ? 22.695 52.658  -53.783 1.00 43.97  ? 469  LEU A CD2   1 
ATOM   3616 N  N     . THR A 1 471 ? 19.861 49.333  -56.236 1.00 56.06  ? 470  THR A N     1 
ATOM   3617 C  CA    . THR A 1 471 ? 19.146 48.131  -56.637 1.00 61.44  ? 470  THR A CA    1 
ATOM   3618 C  C     . THR A 1 471 ? 19.522 46.974  -55.721 1.00 64.19  ? 470  THR A C     1 
ATOM   3619 O  O     . THR A 1 471 ? 20.656 46.891  -55.238 1.00 64.40  ? 470  THR A O     1 
ATOM   3620 C  CB    . THR A 1 471 ? 19.454 47.753  -58.092 1.00 65.20  ? 470  THR A CB    1 
ATOM   3621 O  OG1   . THR A 1 471 ? 20.871 47.779  -58.303 1.00 66.58  ? 470  THR A OG1   1 
ATOM   3622 C  CG2   . THR A 1 471 ? 18.784 48.719  -59.055 1.00 65.87  ? 470  THR A CG2   1 
ATOM   3623 N  N     . ASP A 1 472 ? 18.558 46.081  -55.493 1.00 64.86  ? 471  ASP A N     1 
ATOM   3624 C  CA    . ASP A 1 472 ? 18.744 44.881  -54.676 1.00 63.73  ? 471  ASP A CA    1 
ATOM   3625 C  C     . ASP A 1 472 ? 19.307 45.234  -53.300 1.00 55.16  ? 471  ASP A C     1 
ATOM   3626 O  O     . ASP A 1 472 ? 20.376 44.775  -52.896 1.00 53.91  ? 471  ASP A O     1 
ATOM   3627 C  CB    . ASP A 1 472 ? 19.644 43.869  -55.390 1.00 72.81  ? 471  ASP A CB    1 
ATOM   3628 C  CG    . ASP A 1 472 ? 19.014 43.318  -56.653 1.00 84.80  ? 471  ASP A CG    1 
ATOM   3629 O  OD1   . ASP A 1 472 ? 17.801 43.018  -56.636 1.00 89.17  ? 471  ASP A OD1   1 
ATOM   3630 O  OD2   . ASP A 1 472 ? 19.734 43.185  -57.666 1.00 89.33  ? 471  ASP A OD2   1 
ATOM   3631 N  N     . THR A 1 473 ? 18.560 46.060  -52.575 1.00 52.01  ? 472  THR A N     1 
ATOM   3632 C  CA    . THR A 1 473 ? 19.035 46.630  -51.323 1.00 46.63  ? 472  THR A CA    1 
ATOM   3633 C  C     . THR A 1 473 ? 17.977 46.456  -50.240 1.00 46.58  ? 472  THR A C     1 
ATOM   3634 O  O     . THR A 1 473 ? 16.894 45.908  -50.473 1.00 45.66  ? 472  THR A O     1 
ATOM   3635 C  CB    . THR A 1 473 ? 19.397 48.110  -51.499 1.00 44.92  ? 472  THR A CB    1 
ATOM   3636 O  OG1   . THR A 1 473 ? 19.999 48.603  -50.297 1.00 46.08  ? 472  THR A OG1   1 
ATOM   3637 C  CG2   . THR A 1 473 ? 18.153 48.925  -51.809 1.00 45.50  ? 472  THR A CG2   1 
ATOM   3638 N  N     . THR A 1 474 ? 18.311 46.919  -49.036 1.00 46.16  ? 473  THR A N     1 
ATOM   3639 C  CA    . THR A 1 474 ? 17.444 46.844  -47.869 1.00 46.97  ? 473  THR A CA    1 
ATOM   3640 C  C     . THR A 1 474 ? 17.440 48.195  -47.166 1.00 48.16  ? 473  THR A C     1 
ATOM   3641 O  O     . THR A 1 474 ? 18.252 49.074  -47.463 1.00 50.16  ? 473  THR A O     1 
ATOM   3642 C  CB    . THR A 1 474 ? 17.900 45.750  -46.892 1.00 49.40  ? 473  THR A CB    1 
ATOM   3643 O  OG1   . THR A 1 474 ? 19.148 46.128  -46.300 1.00 49.11  ? 473  THR A OG1   1 
ATOM   3644 C  CG2   . THR A 1 474 ? 18.070 44.418  -47.610 1.00 47.99  ? 473  THR A CG2   1 
ATOM   3645 N  N     . ASN A 1 475 ? 16.517 48.350  -46.213 1.00 49.55  ? 474  ASN A N     1 
ATOM   3646 C  CA    . ASN A 1 475 ? 16.420 49.604  -45.468 1.00 48.09  ? 474  ASN A CA    1 
ATOM   3647 C  C     . ASN A 1 475 ? 17.716 49.907  -44.727 1.00 46.92  ? 474  ASN A C     1 
ATOM   3648 O  O     . ASN A 1 475 ? 18.254 51.021  -44.817 1.00 46.16  ? 474  ASN A O     1 
ATOM   3649 C  CB    . ASN A 1 475 ? 15.244 49.547  -44.492 1.00 50.26  ? 474  ASN A CB    1 
ATOM   3650 C  CG    . ASN A 1 475 ? 13.928 49.927  -45.141 1.00 56.71  ? 474  ASN A CG    1 
ATOM   3651 O  OD1   . ASN A 1 475 ? 13.033 49.095  -45.290 1.00 59.17  ? 474  ASN A OD1   1 
ATOM   3652 N  ND2   . ASN A 1 475 ? 13.801 51.195  -45.527 1.00 58.09  ? 474  ASN A ND2   1 
ATOM   3653 N  N     . GLN A 1 476 ? 18.228 48.924  -43.979 1.00 45.15  ? 475  GLN A N     1 
ATOM   3654 C  CA    . GLN A 1 476 ? 19.472 49.121  -43.243 1.00 45.83  ? 475  GLN A CA    1 
ATOM   3655 C  C     . GLN A 1 476 ? 20.617 49.474  -44.185 1.00 43.55  ? 475  GLN A C     1 
ATOM   3656 O  O     . GLN A 1 476 ? 21.435 50.360  -43.888 1.00 43.10  ? 475  GLN A O     1 
ATOM   3657 C  CB    . GLN A 1 476 ? 19.802 47.865  -42.434 1.00 51.58  ? 475  GLN A CB    1 
ATOM   3658 C  CG    . GLN A 1 476 ? 18.754 47.489  -41.387 1.00 57.31  ? 475  GLN A CG    1 
ATOM   3659 C  CD    . GLN A 1 476 ? 17.777 46.430  -41.879 1.00 66.66  ? 475  GLN A CD    1 
ATOM   3660 O  OE1   . GLN A 1 476 ? 17.527 46.306  -43.079 1.00 69.86  ? 475  GLN A OE1   1 
ATOM   3661 N  NE2   . GLN A 1 476 ? 17.227 45.654  -40.949 1.00 68.00  ? 475  GLN A NE2   1 
ATOM   3662 N  N     . LYS A 1 477 ? 20.680 48.801  -45.338 1.00 42.10  ? 476  LYS A N     1 
ATOM   3663 C  CA    . LYS A 1 477 ? 21.731 49.089  -46.306 1.00 42.59  ? 476  LYS A CA    1 
ATOM   3664 C  C     . LYS A 1 477 ? 21.610 50.504  -46.852 1.00 44.46  ? 476  LYS A C     1 
ATOM   3665 O  O     . LYS A 1 477 ? 22.621 51.185  -47.041 1.00 45.75  ? 476  LYS A O     1 
ATOM   3666 C  CB    . LYS A 1 477 ? 21.698 48.071  -47.445 1.00 40.22  ? 476  LYS A CB    1 
ATOM   3667 C  CG    . LYS A 1 477 ? 22.246 46.706  -47.075 1.00 39.21  ? 476  LYS A CG    1 
ATOM   3668 C  CD    . LYS A 1 477 ? 22.165 45.752  -48.255 1.00 41.23  ? 476  LYS A CD    1 
ATOM   3669 C  CE    . LYS A 1 477 ? 22.662 44.365  -47.886 1.00 43.26  ? 476  LYS A CE    1 
ATOM   3670 N  NZ    . LYS A 1 477 ? 22.577 43.442  -49.051 1.00 44.56  ? 476  LYS A NZ    1 
ATOM   3671 N  N     . THR A 1 478 ? 20.384 50.971  -47.111 1.00 41.85  ? 477  THR A N     1 
ATOM   3672 C  CA    . THR A 1 478 ? 20.227 52.333  -47.614 1.00 44.49  ? 477  THR A CA    1 
ATOM   3673 C  C     . THR A 1 478 ? 20.618 53.360  -46.558 1.00 45.69  ? 477  THR A C     1 
ATOM   3674 O  O     . THR A 1 478 ? 21.186 54.407  -46.888 1.00 44.46  ? 477  THR A O     1 
ATOM   3675 C  CB    . THR A 1 478 ? 18.793 52.577  -48.095 1.00 45.63  ? 477  THR A CB    1 
ATOM   3676 O  OG1   . THR A 1 478 ? 17.873 52.391  -47.013 1.00 49.00  ? 477  THR A OG1   1 
ATOM   3677 C  CG2   . THR A 1 478 ? 18.442 51.636  -49.240 1.00 44.04  ? 477  THR A CG2   1 
ATOM   3678 N  N     . GLU A 1 479 ? 20.338 53.077  -45.282 1.00 45.88  ? 478  GLU A N     1 
ATOM   3679 C  CA    . GLU A 1 479 ? 20.775 53.985  -44.221 1.00 46.80  ? 478  GLU A CA    1 
ATOM   3680 C  C     . GLU A 1 479 ? 22.299 54.066  -44.164 1.00 44.01  ? 478  GLU A C     1 
ATOM   3681 O  O     . GLU A 1 479 ? 22.881 55.161  -44.079 1.00 42.73  ? 478  GLU A O     1 
ATOM   3682 C  CB    . GLU A 1 479 ? 20.202 53.534  -42.875 1.00 50.23  ? 478  GLU A CB    1 
ATOM   3683 C  CG    . GLU A 1 479 ? 18.675 53.515  -42.806 1.00 56.84  ? 478  GLU A CG    1 
ATOM   3684 C  CD    . GLU A 1 479 ? 18.066 54.884  -42.530 1.00 62.98  ? 478  GLU A CD    1 
ATOM   3685 O  OE1   . GLU A 1 479 ? 18.767 55.904  -42.704 1.00 65.42  ? 478  GLU A OE1   1 
ATOM   3686 O  OE2   . GLU A 1 479 ? 16.883 54.942  -42.133 1.00 66.48  ? 478  GLU A OE2   1 
ATOM   3687 N  N     . LEU A 1 480 ? 22.964 52.908  -44.216 1.00 42.65  ? 479  LEU A N     1 
ATOM   3688 C  CA    . LEU A 1 480 ? 24.424 52.906  -44.239 1.00 38.41  ? 479  LEU A CA    1 
ATOM   3689 C  C     . LEU A 1 480 ? 24.962 53.628  -45.471 1.00 39.45  ? 479  LEU A C     1 
ATOM   3690 O  O     . LEU A 1 480 ? 25.951 54.366  -45.382 1.00 42.92  ? 479  LEU A O     1 
ATOM   3691 C  CB    . LEU A 1 480 ? 24.952 51.474  -44.176 1.00 35.93  ? 479  LEU A CB    1 
ATOM   3692 C  CG    . LEU A 1 480 ? 24.904 50.803  -42.804 1.00 37.55  ? 479  LEU A CG    1 
ATOM   3693 C  CD1   . LEU A 1 480 ? 25.373 49.362  -42.895 1.00 39.84  ? 479  LEU A CD1   1 
ATOM   3694 C  CD2   . LEU A 1 480 ? 25.752 51.577  -41.811 1.00 39.26  ? 479  LEU A CD2   1 
ATOM   3695 N  N     . GLN A 1 481 ? 24.318 53.437  -46.627 1.00 37.12  ? 480  GLN A N     1 
ATOM   3696 C  CA    . GLN A 1 481 ? 24.740 54.123  -47.846 1.00 38.29  ? 480  GLN A CA    1 
ATOM   3697 C  C     . GLN A 1 481 ? 24.595 55.635  -47.713 1.00 41.53  ? 480  GLN A C     1 
ATOM   3698 O  O     . GLN A 1 481 ? 25.434 56.389  -48.215 1.00 43.97  ? 480  GLN A O     1 
ATOM   3699 C  CB    . GLN A 1 481 ? 23.934 53.620  -49.046 1.00 37.84  ? 480  GLN A CB    1 
ATOM   3700 C  CG    . GLN A 1 481 ? 24.241 52.196  -49.485 1.00 39.92  ? 480  GLN A CG    1 
ATOM   3701 C  CD    . GLN A 1 481 ? 25.421 52.103  -50.431 1.00 41.24  ? 480  GLN A CD    1 
ATOM   3702 O  OE1   . GLN A 1 481 ? 26.030 53.112  -50.796 1.00 39.22  ? 480  GLN A OE1   1 
ATOM   3703 N  NE2   . GLN A 1 481 ? 25.750 50.884  -50.840 1.00 41.37  ? 480  GLN A NE2   1 
ATOM   3704 N  N     . ALA A 1 482 ? 23.527 56.097  -47.059 1.00 42.73  ? 481  ALA A N     1 
ATOM   3705 C  CA    . ALA A 1 482 ? 23.345 57.532  -46.862 1.00 46.28  ? 481  ALA A CA    1 
ATOM   3706 C  C     . ALA A 1 482 ? 24.444 58.106  -45.977 1.00 45.86  ? 481  ALA A C     1 
ATOM   3707 O  O     . ALA A 1 482 ? 25.007 59.171  -46.277 1.00 43.05  ? 481  ALA A O     1 
ATOM   3708 C  CB    . ALA A 1 482 ? 21.967 57.812  -46.259 1.00 29.83  ? 481  ALA A CB    1 
ATOM   3709 N  N     . ILE A 1 483 ? 24.763 57.412  -44.880 1.00 43.44  ? 482  ILE A N     1 
ATOM   3710 C  CA    . ILE A 1 483 ? 25.875 57.852  -44.036 1.00 42.30  ? 482  ILE A CA    1 
ATOM   3711 C  C     . ILE A 1 483 ? 27.174 57.889  -44.838 1.00 44.44  ? 482  ILE A C     1 
ATOM   3712 O  O     . ILE A 1 483 ? 27.963 58.841  -44.735 1.00 46.14  ? 482  ILE A O     1 
ATOM   3713 C  CB    . ILE A 1 483 ? 25.996 56.951  -42.794 1.00 42.33  ? 482  ILE A CB    1 
ATOM   3714 C  CG1   . ILE A 1 483 ? 24.851 57.239  -41.820 1.00 40.21  ? 482  ILE A CG1   1 
ATOM   3715 C  CG2   . ILE A 1 483 ? 27.348 57.145  -42.118 1.00 42.36  ? 482  ILE A CG2   1 
ATOM   3716 C  CD1   . ILE A 1 483 ? 24.909 56.421  -40.554 1.00 39.36  ? 482  ILE A CD1   1 
ATOM   3717 N  N     . TYR A 1 484 ? 27.405 56.862  -45.663 1.00 41.62  ? 483  TYR A N     1 
ATOM   3718 C  CA    . TYR A 1 484 ? 28.616 56.800  -46.478 1.00 39.83  ? 483  TYR A CA    1 
ATOM   3719 C  C     . TYR A 1 484 ? 28.678 57.950  -47.477 1.00 42.74  ? 483  TYR A C     1 
ATOM   3720 O  O     . TYR A 1 484 ? 29.748 58.522  -47.716 1.00 43.60  ? 483  TYR A O     1 
ATOM   3721 C  CB    . TYR A 1 484 ? 28.668 55.453  -47.198 1.00 37.02  ? 483  TYR A CB    1 
ATOM   3722 C  CG    . TYR A 1 484 ? 29.781 55.299  -48.205 1.00 37.71  ? 483  TYR A CG    1 
ATOM   3723 C  CD1   . TYR A 1 484 ? 31.112 55.408  -47.825 1.00 39.38  ? 483  TYR A CD1   1 
ATOM   3724 C  CD2   . TYR A 1 484 ? 29.501 55.006  -49.533 1.00 40.95  ? 483  TYR A CD2   1 
ATOM   3725 C  CE1   . TYR A 1 484 ? 32.133 55.252  -48.745 1.00 42.06  ? 483  TYR A CE1   1 
ATOM   3726 C  CE2   . TYR A 1 484 ? 30.515 54.847  -50.460 1.00 42.80  ? 483  TYR A CE2   1 
ATOM   3727 C  CZ    . TYR A 1 484 ? 31.827 54.971  -50.061 1.00 44.57  ? 483  TYR A CZ    1 
ATOM   3728 O  OH    . TYR A 1 484 ? 32.836 54.814  -50.984 1.00 50.07  ? 483  TYR A OH    1 
ATOM   3729 N  N     . LEU A 1 485 ? 27.536 58.300  -48.069 1.00 41.74  ? 484  LEU A N     1 
ATOM   3730 C  CA    . LEU A 1 485 ? 27.484 59.403  -49.023 1.00 41.15  ? 484  LEU A CA    1 
ATOM   3731 C  C     . LEU A 1 485 ? 27.788 60.733  -48.342 1.00 37.67  ? 484  LEU A C     1 
ATOM   3732 O  O     . LEU A 1 485 ? 28.523 61.568  -48.888 1.00 36.61  ? 484  LEU A O     1 
ATOM   3733 C  CB    . LEU A 1 485 ? 26.110 59.437  -49.692 1.00 40.94  ? 484  LEU A CB    1 
ATOM   3734 C  CG    . LEU A 1 485 ? 25.944 60.319  -50.925 1.00 44.22  ? 484  LEU A CG    1 
ATOM   3735 C  CD1   . LEU A 1 485 ? 26.707 59.729  -52.096 1.00 44.32  ? 484  LEU A CD1   1 
ATOM   3736 C  CD2   . LEU A 1 485 ? 24.468 60.491  -51.263 1.00 46.17  ? 484  LEU A CD2   1 
ATOM   3737 N  N     . ALA A 1 486 ? 27.228 60.944  -47.147 1.00 36.64  ? 485  ALA A N     1 
ATOM   3738 C  CA    . ALA A 1 486 ? 27.566 62.140  -46.378 1.00 34.87  ? 485  ALA A CA    1 
ATOM   3739 C  C     . ALA A 1 486 ? 29.060 62.200  -46.080 1.00 38.83  ? 485  ALA A C     1 
ATOM   3740 O  O     . ALA A 1 486 ? 29.682 63.260  -46.206 1.00 43.82  ? 485  ALA A O     1 
ATOM   3741 C  CB    . ALA A 1 486 ? 26.760 62.184  -45.081 1.00 29.38  ? 485  ALA A CB    1 
ATOM   3742 N  N     . LEU A 1 487 ? 29.656 61.070  -45.688 1.00 35.43  ? 486  LEU A N     1 
ATOM   3743 C  CA    . LEU A 1 487 ? 31.096 61.054  -45.434 1.00 34.81  ? 486  LEU A CA    1 
ATOM   3744 C  C     . LEU A 1 487 ? 31.890 61.359  -46.701 1.00 38.74  ? 486  LEU A C     1 
ATOM   3745 O  O     . LEU A 1 487 ? 32.941 62.010  -46.644 1.00 40.59  ? 486  LEU A O     1 
ATOM   3746 C  CB    . LEU A 1 487 ? 31.516 59.704  -44.855 1.00 33.71  ? 486  LEU A CB    1 
ATOM   3747 C  CG    . LEU A 1 487 ? 31.091 59.416  -43.416 1.00 36.51  ? 486  LEU A CG    1 
ATOM   3748 C  CD1   . LEU A 1 487 ? 31.458 57.989  -43.031 1.00 31.55  ? 486  LEU A CD1   1 
ATOM   3749 C  CD2   . LEU A 1 487 ? 31.734 60.415  -42.467 1.00 30.70  ? 486  LEU A CD2   1 
ATOM   3750 N  N     . GLN A 1 488 ? 31.411 60.886  -47.853 1.00 36.90  ? 487  GLN A N     1 
ATOM   3751 C  CA    . GLN A 1 488 ? 32.115 61.136  -49.106 1.00 37.67  ? 487  GLN A CA    1 
ATOM   3752 C  C     . GLN A 1 488 ? 32.076 62.611  -49.485 1.00 43.26  ? 487  GLN A C     1 
ATOM   3753 O  O     . GLN A 1 488 ? 33.091 63.173  -49.913 1.00 46.85  ? 487  GLN A O     1 
ATOM   3754 C  CB    . GLN A 1 488 ? 31.511 60.298  -50.231 1.00 39.11  ? 487  GLN A CB    1 
ATOM   3755 C  CG    . GLN A 1 488 ? 31.938 58.843  -50.248 1.00 44.30  ? 487  GLN A CG    1 
ATOM   3756 C  CD    . GLN A 1 488 ? 31.332 58.085  -51.413 1.00 45.79  ? 487  GLN A CD    1 
ATOM   3757 O  OE1   . GLN A 1 488 ? 30.118 57.881  -51.472 1.00 48.94  ? 487  GLN A OE1   1 
ATOM   3758 N  NE2   . GLN A 1 488 ? 32.174 57.674  -52.354 1.00 42.08  ? 487  GLN A NE2   1 
ATOM   3759 N  N     . ASP A 1 489 ? 30.919 63.254  -49.343 1.00 43.03  ? 488  ASP A N     1 
ATOM   3760 C  CA    . ASP A 1 489 ? 30.721 64.591  -49.885 1.00 45.71  ? 488  ASP A CA    1 
ATOM   3761 C  C     . ASP A 1 489 ? 30.949 65.704  -48.865 1.00 47.03  ? 488  ASP A C     1 
ATOM   3762 O  O     . ASP A 1 489 ? 30.605 66.856  -49.141 1.00 45.69  ? 488  ASP A O     1 
ATOM   3763 C  CB    . ASP A 1 489 ? 29.317 64.705  -50.483 1.00 44.85  ? 488  ASP A CB    1 
ATOM   3764 C  CG    . ASP A 1 489 ? 29.138 63.838  -51.716 1.00 48.55  ? 488  ASP A CG    1 
ATOM   3765 O  OD1   . ASP A 1 489 ? 30.137 63.246  -52.183 1.00 48.89  ? 488  ASP A OD1   1 
ATOM   3766 O  OD2   . ASP A 1 489 ? 28.000 63.750  -52.222 1.00 49.21  ? 488  ASP A OD2   1 
ATOM   3767 N  N     . SER A 1 490 ? 31.534 65.399  -47.712 1.00 46.05  ? 489  SER A N     1 
ATOM   3768 C  CA    . SER A 1 490 ? 31.731 66.380  -46.654 1.00 40.89  ? 489  SER A CA    1 
ATOM   3769 C  C     . SER A 1 490 ? 33.209 66.714  -46.490 1.00 40.07  ? 489  SER A C     1 
ATOM   3770 O  O     . SER A 1 490 ? 34.095 66.030  -47.009 1.00 39.22  ? 489  SER A O     1 
ATOM   3771 C  CB    . SER A 1 490 ? 31.158 65.869  -45.329 1.00 41.86  ? 489  SER A CB    1 
ATOM   3772 O  OG    . SER A 1 490 ? 31.746 64.629  -44.970 1.00 45.74  ? 489  SER A OG    1 
ATOM   3773 N  N     . GLY A 1 491 ? 33.465 67.789  -45.748 1.00 41.04  ? 490  GLY A N     1 
ATOM   3774 C  CA    . GLY A 1 491 ? 34.814 68.197  -45.427 1.00 36.81  ? 490  GLY A CA    1 
ATOM   3775 C  C     . GLY A 1 491 ? 35.396 67.360  -44.304 1.00 39.97  ? 490  GLY A C     1 
ATOM   3776 O  O     . GLY A 1 491 ? 34.824 66.363  -43.863 1.00 35.20  ? 490  GLY A O     1 
ATOM   3777 N  N     . LEU A 1 492 ? 36.563 67.797  -43.823 1.00 37.85  ? 491  LEU A N     1 
ATOM   3778 C  CA    . LEU A 1 492 ? 37.274 67.054  -42.788 1.00 39.23  ? 491  LEU A CA    1 
ATOM   3779 C  C     . LEU A 1 492 ? 36.535 67.036  -41.455 1.00 41.36  ? 491  LEU A C     1 
ATOM   3780 O  O     . LEU A 1 492 ? 36.864 66.216  -40.592 1.00 43.49  ? 491  LEU A O     1 
ATOM   3781 C  CB    . LEU A 1 492 ? 38.674 67.634  -42.596 1.00 40.06  ? 491  LEU A CB    1 
ATOM   3782 C  CG    . LEU A 1 492 ? 39.606 67.477  -43.799 1.00 41.34  ? 491  LEU A CG    1 
ATOM   3783 C  CD1   . LEU A 1 492 ? 41.010 67.959  -43.473 1.00 43.62  ? 491  LEU A CD1   1 
ATOM   3784 C  CD2   . LEU A 1 492 ? 39.619 66.027  -44.263 1.00 40.56  ? 491  LEU A CD2   1 
ATOM   3785 N  N     . GLU A 1 493 ? 35.560 67.919  -41.261 1.00 40.20  ? 492  GLU A N     1 
ATOM   3786 C  CA    . GLU A 1 493 ? 34.746 67.941  -40.053 1.00 39.41  ? 492  GLU A CA    1 
ATOM   3787 C  C     . GLU A 1 493 ? 33.287 67.993  -40.475 1.00 41.05  ? 492  GLU A C     1 
ATOM   3788 O  O     . GLU A 1 493 ? 32.926 68.775  -41.360 1.00 44.19  ? 492  GLU A O     1 
ATOM   3789 C  CB    . GLU A 1 493 ? 35.111 69.134  -39.157 1.00 37.43  ? 492  GLU A CB    1 
ATOM   3790 C  CG    . GLU A 1 493 ? 36.586 69.155  -38.753 1.00 40.48  ? 492  GLU A CG    1 
ATOM   3791 C  CD    . GLU A 1 493 ? 36.955 70.306  -37.826 1.00 44.02  ? 492  GLU A CD    1 
ATOM   3792 O  OE1   . GLU A 1 493 ? 38.165 70.591  -37.692 1.00 45.68  ? 492  GLU A OE1   1 
ATOM   3793 O  OE2   . GLU A 1 493 ? 36.048 70.921  -37.228 1.00 45.48  ? 492  GLU A OE2   1 
ATOM   3794 N  N     . VAL A 1 494 ? 32.451 67.158  -39.860 1.00 37.47  ? 493  VAL A N     1 
ATOM   3795 C  CA    . VAL A 1 494 ? 31.077 67.004  -40.325 1.00 37.23  ? 493  VAL A CA    1 
ATOM   3796 C  C     . VAL A 1 494 ? 30.185 66.571  -39.167 1.00 39.35  ? 493  VAL A C     1 
ATOM   3797 O  O     . VAL A 1 494 ? 30.551 65.702  -38.370 1.00 39.06  ? 493  VAL A O     1 
ATOM   3798 C  CB    . VAL A 1 494 ? 31.002 66.003  -41.501 1.00 37.43  ? 493  VAL A CB    1 
ATOM   3799 C  CG1   . VAL A 1 494 ? 31.592 64.649  -41.106 1.00 38.07  ? 493  VAL A CG1   1 
ATOM   3800 C  CG2   . VAL A 1 494 ? 29.571 65.849  -41.983 1.00 35.62  ? 493  VAL A CG2   1 
ATOM   3801 N  N     . ASN A 1 495 ? 29.015 67.203  -39.073 1.00 38.37  ? 494  ASN A N     1 
ATOM   3802 C  CA    . ASN A 1 495 ? 27.924 66.742  -38.225 1.00 32.74  ? 494  ASN A CA    1 
ATOM   3803 C  C     . ASN A 1 495 ? 26.963 65.928  -39.081 1.00 34.02  ? 494  ASN A C     1 
ATOM   3804 O  O     . ASN A 1 495 ? 26.554 66.378  -40.157 1.00 35.52  ? 494  ASN A O     1 
ATOM   3805 C  CB    . ASN A 1 495 ? 27.173 67.912  -37.580 1.00 32.19  ? 494  ASN A CB    1 
ATOM   3806 C  CG    . ASN A 1 495 ? 28.076 68.831  -36.774 1.00 47.34  ? 494  ASN A CG    1 
ATOM   3807 O  OD1   . ASN A 1 495 ? 28.639 68.432  -35.754 1.00 45.89  ? 494  ASN A OD1   1 
ATOM   3808 N  ND2   . ASN A 1 495 ? 28.194 70.079  -37.214 1.00 34.22  ? 494  ASN A ND2   1 
ATOM   3809 N  N     . ILE A 1 496 ? 26.605 64.735  -38.609 1.00 30.35  ? 495  ILE A N     1 
ATOM   3810 C  CA    . ILE A 1 496 ? 25.679 63.858  -39.320 1.00 33.91  ? 495  ILE A CA    1 
ATOM   3811 C  C     . ILE A 1 496 ? 24.540 63.491  -38.380 1.00 36.90  ? 495  ILE A C     1 
ATOM   3812 O  O     . ILE A 1 496 ? 24.775 62.919  -37.309 1.00 36.82  ? 495  ILE A O     1 
ATOM   3813 C  CB    . ILE A 1 496 ? 26.366 62.587  -39.849 1.00 34.33  ? 495  ILE A CB    1 
ATOM   3814 C  CG1   . ILE A 1 496 ? 27.502 62.946  -40.808 1.00 35.79  ? 495  ILE A CG1   1 
ATOM   3815 C  CG2   . ILE A 1 496 ? 25.353 61.696  -40.549 1.00 32.29  ? 495  ILE A CG2   1 
ATOM   3816 C  CD1   . ILE A 1 496 ? 28.208 61.740  -41.391 1.00 33.80  ? 495  ILE A CD1   1 
ATOM   3817 N  N     . VAL A 1 497 ? 23.313 63.813  -38.779 1.00 37.63  ? 496  VAL A N     1 
ATOM   3818 C  CA    . VAL A 1 497 ? 22.113 63.409  -38.057 1.00 37.02  ? 496  VAL A CA    1 
ATOM   3819 C  C     . VAL A 1 497 ? 21.485 62.251  -38.816 1.00 39.57  ? 496  VAL A C     1 
ATOM   3820 O  O     . VAL A 1 497 ? 21.089 62.403  -39.978 1.00 38.03  ? 496  VAL A O     1 
ATOM   3821 C  CB    . VAL A 1 497 ? 21.121 64.571  -37.912 1.00 36.28  ? 496  VAL A CB    1 
ATOM   3822 C  CG1   . VAL A 1 497 ? 19.888 64.107  -37.161 1.00 35.23  ? 496  VAL A CG1   1 
ATOM   3823 C  CG2   . VAL A 1 497 ? 21.777 65.744  -37.205 1.00 36.23  ? 496  VAL A CG2   1 
ATOM   3824 N  N     . THR A 1 498 ? 21.392 61.095  -38.167 1.00 43.26  ? 497  THR A N     1 
ATOM   3825 C  CA    . THR A 1 498 ? 20.929 59.888  -38.828 1.00 43.40  ? 497  THR A CA    1 
ATOM   3826 C  C     . THR A 1 498 ? 19.544 59.488  -38.342 1.00 49.21  ? 497  THR A C     1 
ATOM   3827 O  O     . THR A 1 498 ? 19.087 59.874  -37.261 1.00 45.62  ? 497  THR A O     1 
ATOM   3828 C  CB    . THR A 1 498 ? 21.895 58.717  -38.618 1.00 38.16  ? 497  THR A CB    1 
ATOM   3829 O  OG1   . THR A 1 498 ? 21.485 57.622  -39.446 1.00 39.33  ? 497  THR A OG1   1 
ATOM   3830 C  CG2   . THR A 1 498 ? 21.884 58.262  -37.169 1.00 35.48  ? 497  THR A CG2   1 
ATOM   3831 N  N     . ASP A 1 499 ? 18.888 58.696  -39.179 1.00 59.56  ? 498  ASP A N     1 
ATOM   3832 C  CA    . ASP A 1 499 ? 17.562 58.164  -38.918 1.00 63.68  ? 498  ASP A CA    1 
ATOM   3833 C  C     . ASP A 1 499 ? 17.607 56.817  -38.211 1.00 56.38  ? 498  ASP A C     1 
ATOM   3834 O  O     . ASP A 1 499 ? 16.691 56.491  -37.448 1.00 53.21  ? 498  ASP A O     1 
ATOM   3835 C  CB    . ASP A 1 499 ? 16.819 58.027  -40.251 1.00 68.46  ? 498  ASP A CB    1 
ATOM   3836 C  CG    . ASP A 1 499 ? 15.332 57.943  -40.084 1.00 69.82  ? 498  ASP A CG    1 
ATOM   3837 O  OD1   . ASP A 1 499 ? 14.714 58.996  -39.831 1.00 68.46  ? 498  ASP A OD1   1 
ATOM   3838 O  OD2   . ASP A 1 499 ? 14.785 56.829  -40.222 1.00 76.64  ? 498  ASP A OD2   1 
ATOM   3839 N  N     . SER A 1 500 ? 18.667 56.043  -38.432 1.00 53.42  ? 499  SER A N     1 
ATOM   3840 C  CA    . SER A 1 500 ? 18.703 54.618  -38.128 1.00 51.70  ? 499  SER A CA    1 
ATOM   3841 C  C     . SER A 1 500 ? 19.541 54.362  -36.883 1.00 46.32  ? 499  SER A C     1 
ATOM   3842 O  O     . SER A 1 500 ? 20.741 54.654  -36.866 1.00 44.84  ? 499  SER A O     1 
ATOM   3843 C  CB    . SER A 1 500 ? 19.268 53.839  -39.315 1.00 53.74  ? 499  SER A CB    1 
ATOM   3844 O  OG    . SER A 1 500 ? 19.786 52.588  -38.906 1.00 57.32  ? 499  SER A OG    1 
ATOM   3845 N  N     . GLN A 1 501 ? 18.911 53.799  -35.850 1.00 46.67  ? 500  GLN A N     1 
ATOM   3846 C  CA    . GLN A 1 501 ? 19.676 53.369  -34.687 1.00 50.50  ? 500  GLN A CA    1 
ATOM   3847 C  C     . GLN A 1 501 ? 20.503 52.125  -34.985 1.00 48.21  ? 500  GLN A C     1 
ATOM   3848 O  O     . GLN A 1 501 ? 21.447 51.838  -34.247 1.00 50.75  ? 500  GLN A O     1 
ATOM   3849 C  CB    . GLN A 1 501 ? 18.747 53.121  -33.496 1.00 58.48  ? 500  GLN A CB    1 
ATOM   3850 C  CG    . GLN A 1 501 ? 18.155 51.727  -33.423 1.00 63.62  ? 500  GLN A CG    1 
ATOM   3851 C  CD    . GLN A 1 501 ? 17.122 51.599  -32.318 1.00 68.48  ? 500  GLN A CD    1 
ATOM   3852 O  OE1   . GLN A 1 501 ? 17.091 50.606  -31.589 1.00 71.66  ? 500  GLN A OE1   1 
ATOM   3853 N  NE2   . GLN A 1 501 ? 16.265 52.608  -32.191 1.00 68.75  ? 500  GLN A NE2   1 
ATOM   3854 N  N     . TYR A 1 502 ? 20.176 51.394  -36.053 1.00 42.72  ? 501  TYR A N     1 
ATOM   3855 C  CA    . TYR A 1 502 ? 21.048 50.327  -36.535 1.00 39.94  ? 501  TYR A CA    1 
ATOM   3856 C  C     . TYR A 1 502 ? 22.426 50.870  -36.911 1.00 42.24  ? 501  TYR A C     1 
ATOM   3857 O  O     . TYR A 1 502 ? 23.455 50.451  -36.358 1.00 42.70  ? 501  TYR A O     1 
ATOM   3858 C  CB    . TYR A 1 502 ? 20.380 49.635  -37.727 1.00 38.79  ? 501  TYR A CB    1 
ATOM   3859 C  CG    . TYR A 1 502 ? 21.282 48.732  -38.538 1.00 39.99  ? 501  TYR A CG    1 
ATOM   3860 C  CD1   . TYR A 1 502 ? 21.559 47.433  -38.122 1.00 42.27  ? 501  TYR A CD1   1 
ATOM   3861 C  CD2   . TYR A 1 502 ? 21.839 49.170  -39.733 1.00 33.78  ? 501  TYR A CD2   1 
ATOM   3862 C  CE1   . TYR A 1 502 ? 22.380 46.600  -38.868 1.00 40.53  ? 501  TYR A CE1   1 
ATOM   3863 C  CE2   . TYR A 1 502 ? 22.660 48.350  -40.483 1.00 38.16  ? 501  TYR A CE2   1 
ATOM   3864 C  CZ    . TYR A 1 502 ? 22.926 47.064  -40.047 1.00 40.52  ? 501  TYR A CZ    1 
ATOM   3865 O  OH    . TYR A 1 502 ? 23.743 46.243  -40.787 1.00 41.13  ? 501  TYR A OH    1 
ATOM   3866 N  N     . ALA A 1 503 ? 22.461 51.816  -37.855 1.00 32.20  ? 502  ALA A N     1 
ATOM   3867 C  CA    . ALA A 1 503 ? 23.735 52.372  -38.302 1.00 34.68  ? 502  ALA A CA    1 
ATOM   3868 C  C     . ALA A 1 503 ? 24.436 53.123  -37.180 1.00 37.24  ? 502  ALA A C     1 
ATOM   3869 O  O     . ALA A 1 503 ? 25.667 53.076  -37.063 1.00 42.74  ? 502  ALA A O     1 
ATOM   3870 C  CB    . ALA A 1 503 ? 23.513 53.287  -39.504 1.00 34.34  ? 502  ALA A CB    1 
ATOM   3871 N  N     . LEU A 1 504 ? 23.669 53.820  -36.341 1.00 38.42  ? 503  LEU A N     1 
ATOM   3872 C  CA    . LEU A 1 504 ? 24.260 54.528  -35.211 1.00 41.00  ? 503  LEU A CA    1 
ATOM   3873 C  C     . LEU A 1 504 ? 24.914 53.555  -34.238 1.00 43.04  ? 503  LEU A C     1 
ATOM   3874 O  O     . LEU A 1 504 ? 26.036 53.784  -33.773 1.00 43.67  ? 503  LEU A O     1 
ATOM   3875 C  CB    . LEU A 1 504 ? 23.195 55.361  -34.502 1.00 44.61  ? 503  LEU A CB    1 
ATOM   3876 C  CG    . LEU A 1 504 ? 23.634 56.012  -33.192 1.00 46.12  ? 503  LEU A CG    1 
ATOM   3877 C  CD1   . LEU A 1 504 ? 24.563 57.189  -33.453 1.00 43.88  ? 503  LEU A CD1   1 
ATOM   3878 C  CD2   . LEU A 1 504 ? 22.423 56.438  -32.384 1.00 48.39  ? 503  LEU A CD2   1 
ATOM   3879 N  N     . GLY A 1 505 ? 24.221 52.463  -33.911 1.00 43.36  ? 504  GLY A N     1 
ATOM   3880 C  CA    . GLY A 1 505 ? 24.798 51.473  -33.018 1.00 42.61  ? 504  GLY A CA    1 
ATOM   3881 C  C     . GLY A 1 505 ? 26.037 50.820  -33.597 1.00 43.41  ? 504  GLY A C     1 
ATOM   3882 O  O     . GLY A 1 505 ? 26.980 50.503  -32.868 1.00 46.66  ? 504  GLY A O     1 
ATOM   3883 N  N     . ILE A 1 506 ? 26.058 50.615  -34.915 1.00 41.34  ? 505  ILE A N     1 
ATOM   3884 C  CA    . ILE A 1 506 ? 27.245 50.038  -35.541 1.00 44.28  ? 505  ILE A CA    1 
ATOM   3885 C  C     . ILE A 1 506 ? 28.421 51.005  -35.456 1.00 45.78  ? 505  ILE A C     1 
ATOM   3886 O  O     . ILE A 1 506 ? 29.528 50.629  -35.053 1.00 50.68  ? 505  ILE A O     1 
ATOM   3887 C  CB    . ILE A 1 506 ? 26.954 49.631  -36.996 1.00 45.68  ? 505  ILE A CB    1 
ATOM   3888 C  CG1   . ILE A 1 506 ? 26.150 48.330  -37.036 1.00 43.15  ? 505  ILE A CG1   1 
ATOM   3889 C  CG2   . ILE A 1 506 ? 28.255 49.473  -37.781 1.00 43.16  ? 505  ILE A CG2   1 
ATOM   3890 C  CD1   . ILE A 1 506 ? 25.856 47.848  -38.434 1.00 42.38  ? 505  ILE A CD1   1 
ATOM   3891 N  N     . ILE A 1 507 ? 28.200 52.269  -35.825 1.00 42.55  ? 506  ILE A N     1 
ATOM   3892 C  CA    . ILE A 1 507 ? 29.317 53.206  -35.909 1.00 41.18  ? 506  ILE A CA    1 
ATOM   3893 C  C     . ILE A 1 507 ? 29.807 53.619  -34.522 1.00 42.48  ? 506  ILE A C     1 
ATOM   3894 O  O     . ILE A 1 507 ? 31.008 53.848  -34.328 1.00 43.07  ? 506  ILE A O     1 
ATOM   3895 C  CB    . ILE A 1 507 ? 28.917 54.419  -36.772 1.00 41.77  ? 506  ILE A CB    1 
ATOM   3896 C  CG1   . ILE A 1 507 ? 28.562 53.952  -38.187 1.00 38.38  ? 506  ILE A CG1   1 
ATOM   3897 C  CG2   . ILE A 1 507 ? 30.042 55.449  -36.826 1.00 31.74  ? 506  ILE A CG2   1 
ATOM   3898 C  CD1   . ILE A 1 507 ? 28.058 55.049  -39.095 1.00 40.81  ? 506  ILE A CD1   1 
ATOM   3899 N  N     . GLN A 1 508 ? 28.912 53.697  -33.531 1.00 45.28  ? 507  GLN A N     1 
ATOM   3900 C  CA    . GLN A 1 508 ? 29.327 54.128  -32.197 1.00 46.65  ? 507  GLN A CA    1 
ATOM   3901 C  C     . GLN A 1 508 ? 30.303 53.149  -31.555 1.00 47.43  ? 507  GLN A C     1 
ATOM   3902 O  O     . GLN A 1 508 ? 31.096 53.543  -30.691 1.00 47.04  ? 507  GLN A O     1 
ATOM   3903 C  CB    . GLN A 1 508 ? 28.109 54.316  -31.294 1.00 54.35  ? 507  GLN A CB    1 
ATOM   3904 C  CG    . GLN A 1 508 ? 27.344 55.605  -31.539 1.00 63.33  ? 507  GLN A CG    1 
ATOM   3905 C  CD    . GLN A 1 508 ? 26.584 56.070  -30.313 1.00 71.49  ? 507  GLN A CD    1 
ATOM   3906 O  OE1   . GLN A 1 508 ? 25.354 56.032  -30.278 1.00 76.76  ? 507  GLN A OE1   1 
ATOM   3907 N  NE2   . GLN A 1 508 ? 27.316 56.517  -29.298 1.00 72.17  ? 507  GLN A NE2   1 
ATOM   3908 N  N     . ALA A 1 509 ? 30.265 51.879  -31.956 1.00 45.34  ? 508  ALA A N     1 
ATOM   3909 C  CA    . ALA A 1 509 ? 31.189 50.883  -31.429 1.00 46.72  ? 508  ALA A CA    1 
ATOM   3910 C  C     . ALA A 1 509 ? 32.586 50.996  -32.026 1.00 45.90  ? 508  ALA A C     1 
ATOM   3911 O  O     . ALA A 1 509 ? 33.457 50.195  -31.669 1.00 47.02  ? 508  ALA A O     1 
ATOM   3912 C  CB    . ALA A 1 509 ? 30.637 49.474  -31.667 1.00 46.87  ? 508  ALA A CB    1 
ATOM   3913 N  N     . GLN A 1 510 ? 32.809 51.958  -32.917 1.00 43.19  ? 509  GLN A N     1 
ATOM   3914 C  CA    . GLN A 1 510 ? 34.114 52.219  -33.516 1.00 42.66  ? 509  GLN A CA    1 
ATOM   3915 C  C     . GLN A 1 510 ? 34.761 50.976  -34.138 1.00 46.35  ? 509  GLN A C     1 
ATOM   3916 O  O     . GLN A 1 510 ? 35.866 50.588  -33.751 1.00 48.02  ? 509  GLN A O     1 
ATOM   3917 C  CB    . GLN A 1 510 ? 35.049 52.844  -32.490 1.00 40.16  ? 509  GLN A CB    1 
ATOM   3918 C  CG    . GLN A 1 510 ? 34.438 53.990  -31.704 1.00 42.17  ? 509  GLN A CG    1 
ATOM   3919 C  CD    . GLN A 1 510 ? 35.336 54.460  -30.579 1.00 46.34  ? 509  GLN A CD    1 
ATOM   3920 O  OE1   . GLN A 1 510 ? 36.383 55.065  -30.815 1.00 47.18  ? 509  GLN A OE1   1 
ATOM   3921 N  NE2   . GLN A 1 510 ? 34.936 54.176  -29.344 1.00 48.41  ? 509  GLN A NE2   1 
ATOM   3922 N  N     . PRO A 1 511 ? 34.108 50.338  -35.110 1.00 45.06  ? 510  PRO A N     1 
ATOM   3923 C  CA    . PRO A 1 511 ? 34.743 49.191  -35.768 1.00 45.43  ? 510  PRO A CA    1 
ATOM   3924 C  C     . PRO A 1 511 ? 35.861 49.638  -36.694 1.00 45.33  ? 510  PRO A C     1 
ATOM   3925 O  O     . PRO A 1 511 ? 35.761 50.665  -37.369 1.00 48.81  ? 510  PRO A O     1 
ATOM   3926 C  CB    . PRO A 1 511 ? 33.592 48.554  -36.553 1.00 43.12  ? 510  PRO A CB    1 
ATOM   3927 C  CG    . PRO A 1 511 ? 32.693 49.698  -36.855 1.00 36.56  ? 510  PRO A CG    1 
ATOM   3928 C  CD    . PRO A 1 511 ? 32.755 50.585  -35.643 1.00 36.63  ? 510  PRO A CD    1 
ATOM   3929 N  N     . ASP A 1 512 ? 36.944 48.860  -36.712 1.00 43.67  ? 511  ASP A N     1 
ATOM   3930 C  CA    . ASP A 1 512 ? 37.968 49.011  -37.733 1.00 44.55  ? 511  ASP A CA    1 
ATOM   3931 C  C     . ASP A 1 512 ? 37.924 47.907  -38.778 1.00 46.86  ? 511  ASP A C     1 
ATOM   3932 O  O     . ASP A 1 512 ? 38.548 48.051  -39.835 1.00 48.17  ? 511  ASP A O     1 
ATOM   3933 C  CB    . ASP A 1 512 ? 39.372 49.070  -37.104 1.00 48.57  ? 511  ASP A CB    1 
ATOM   3934 C  CG    . ASP A 1 512 ? 39.699 47.855  -36.248 1.00 57.17  ? 511  ASP A CG    1 
ATOM   3935 O  OD1   . ASP A 1 512 ? 39.517 46.709  -36.712 1.00 60.82  ? 511  ASP A OD1   1 
ATOM   3936 O  OD2   . ASP A 1 512 ? 40.177 48.051  -35.111 1.00 60.75  ? 511  ASP A OD2   1 
ATOM   3937 N  N     . GLN A 1 513 ? 37.199 46.821  -38.514 1.00 46.30  ? 512  GLN A N     1 
ATOM   3938 C  CA    . GLN A 1 513 ? 37.084 45.702  -39.435 1.00 46.49  ? 512  GLN A CA    1 
ATOM   3939 C  C     . GLN A 1 513 ? 35.633 45.250  -39.484 1.00 46.51  ? 512  GLN A C     1 
ATOM   3940 O  O     . GLN A 1 513 ? 34.933 45.256  -38.467 1.00 41.87  ? 512  GLN A O     1 
ATOM   3941 C  CB    . GLN A 1 513 ? 37.991 44.538  -39.014 1.00 55.09  ? 512  GLN A CB    1 
ATOM   3942 C  CG    . GLN A 1 513 ? 38.035 43.390  -40.010 1.00 65.85  ? 512  GLN A CG    1 
ATOM   3943 C  CD    . GLN A 1 513 ? 38.589 43.812  -41.358 1.00 73.28  ? 512  GLN A CD    1 
ATOM   3944 O  OE1   . GLN A 1 513 ? 37.840 44.024  -42.314 1.00 72.97  ? 512  GLN A OE1   1 
ATOM   3945 N  NE2   . GLN A 1 513 ? 39.910 43.934  -41.442 1.00 77.03  ? 512  GLN A NE2   1 
ATOM   3946 N  N     . SER A 1 514 ? 35.184 44.863  -40.673 1.00 41.90  ? 513  SER A N     1 
ATOM   3947 C  CA    . SER A 1 514 ? 33.823 44.387  -40.852 1.00 41.31  ? 513  SER A CA    1 
ATOM   3948 C  C     . SER A 1 514 ? 33.793 43.403  -42.010 1.00 44.04  ? 513  SER A C     1 
ATOM   3949 O  O     . SER A 1 514 ? 34.616 43.477  -42.927 1.00 44.84  ? 513  SER A O     1 
ATOM   3950 C  CB    . SER A 1 514 ? 32.856 45.547  -41.111 1.00 39.23  ? 513  SER A CB    1 
ATOM   3951 O  OG    . SER A 1 514 ? 31.579 45.079  -41.510 1.00 38.93  ? 513  SER A OG    1 
ATOM   3952 N  N     . GLU A 1 515 ? 32.842 42.473  -41.955 1.00 43.70  ? 514  GLU A N     1 
ATOM   3953 C  CA    . GLU A 1 515 ? 32.607 41.598  -43.095 1.00 52.18  ? 514  GLU A CA    1 
ATOM   3954 C  C     . GLU A 1 515 ? 31.778 42.273  -44.179 1.00 48.20  ? 514  GLU A C     1 
ATOM   3955 O  O     . GLU A 1 515 ? 31.736 41.777  -45.310 1.00 46.78  ? 514  GLU A O     1 
ATOM   3956 C  CB    . GLU A 1 515 ? 31.932 40.301  -42.638 1.00 57.49  ? 514  GLU A CB    1 
ATOM   3957 C  CG    . GLU A 1 515 ? 30.632 40.493  -41.877 1.00 64.80  ? 514  GLU A CG    1 
ATOM   3958 C  CD    . GLU A 1 515 ? 30.167 39.216  -41.196 1.00 73.21  ? 514  GLU A CD    1 
ATOM   3959 O  OE1   . GLU A 1 515 ? 31.024 38.357  -40.894 1.00 75.79  ? 514  GLU A OE1   1 
ATOM   3960 O  OE2   . GLU A 1 515 ? 28.947 39.070  -40.966 1.00 73.86  ? 514  GLU A OE2   1 
ATOM   3961 N  N     . SER A 1 516 ? 31.133 43.392  -43.862 1.00 40.75  ? 515  SER A N     1 
ATOM   3962 C  CA    . SER A 1 516 ? 30.418 44.176  -44.856 1.00 43.69  ? 515  SER A CA    1 
ATOM   3963 C  C     . SER A 1 516 ? 31.390 45.099  -45.580 1.00 47.69  ? 515  SER A C     1 
ATOM   3964 O  O     . SER A 1 516 ? 32.147 45.839  -44.944 1.00 52.47  ? 515  SER A O     1 
ATOM   3965 C  CB    . SER A 1 516 ? 29.308 44.986  -44.188 1.00 41.29  ? 515  SER A CB    1 
ATOM   3966 O  OG    . SER A 1 516 ? 28.788 45.970  -45.064 1.00 40.77  ? 515  SER A OG    1 
ATOM   3967 N  N     . GLU A 1 517 ? 31.377 45.046  -46.913 1.00 46.48  ? 516  GLU A N     1 
ATOM   3968 C  CA    . GLU A 1 517 ? 32.234 45.938  -47.688 1.00 45.63  ? 516  GLU A CA    1 
ATOM   3969 C  C     . GLU A 1 517 ? 31.794 47.390  -47.536 1.00 42.71  ? 516  GLU A C     1 
ATOM   3970 O  O     . GLU A 1 517 ? 32.633 48.298  -47.480 1.00 43.41  ? 516  GLU A O     1 
ATOM   3971 C  CB    . GLU A 1 517 ? 32.232 45.522  -49.159 1.00 45.32  ? 516  GLU A CB    1 
ATOM   3972 N  N     . LEU A 1 518 ? 30.481 47.626  -47.464 1.00 42.23  ? 517  LEU A N     1 
ATOM   3973 C  CA    . LEU A 1 518 ? 29.974 48.981  -47.268 1.00 41.39  ? 517  LEU A CA    1 
ATOM   3974 C  C     . LEU A 1 518 ? 30.458 49.567  -45.947 1.00 41.52  ? 517  LEU A C     1 
ATOM   3975 O  O     . LEU A 1 518 ? 30.894 50.725  -45.892 1.00 37.74  ? 517  LEU A O     1 
ATOM   3976 C  CB    . LEU A 1 518 ? 28.447 48.972  -47.332 1.00 38.49  ? 517  LEU A CB    1 
ATOM   3977 C  CG    . LEU A 1 518 ? 27.706 50.286  -47.090 1.00 42.50  ? 517  LEU A CG    1 
ATOM   3978 C  CD1   . LEU A 1 518 ? 28.142 51.352  -48.086 1.00 40.69  ? 517  LEU A CD1   1 
ATOM   3979 C  CD2   . LEU A 1 518 ? 26.211 50.044  -47.179 1.00 43.36  ? 517  LEU A CD2   1 
ATOM   3980 N  N     . VAL A 1 519 ? 30.406 48.774  -44.872 1.00 43.66  ? 518  VAL A N     1 
ATOM   3981 C  CA    . VAL A 1 519 ? 30.900 49.245  -43.583 1.00 41.96  ? 518  VAL A CA    1 
ATOM   3982 C  C     . VAL A 1 519 ? 32.410 49.455  -43.625 1.00 45.63  ? 518  VAL A C     1 
ATOM   3983 O  O     . VAL A 1 519 ? 32.931 50.352  -42.959 1.00 51.26  ? 518  VAL A O     1 
ATOM   3984 C  CB    . VAL A 1 519 ? 30.485 48.272  -42.463 1.00 40.91  ? 518  VAL A CB    1 
ATOM   3985 C  CG1   . VAL A 1 519 ? 31.075 48.696  -41.127 1.00 39.07  ? 518  VAL A CG1   1 
ATOM   3986 C  CG2   . VAL A 1 519 ? 28.971 48.203  -42.366 1.00 39.70  ? 518  VAL A CG2   1 
ATOM   3987 N  N     . ASN A 1 520 ? 33.135 48.667  -44.425 1.00 43.43  ? 519  ASN A N     1 
ATOM   3988 C  CA    . ASN A 1 520 ? 34.570 48.903  -44.574 1.00 43.43  ? 519  ASN A CA    1 
ATOM   3989 C  C     . ASN A 1 520 ? 34.847 50.234  -45.265 1.00 44.27  ? 519  ASN A C     1 
ATOM   3990 O  O     . ASN A 1 520 ? 35.750 50.976  -44.858 1.00 45.95  ? 519  ASN A O     1 
ATOM   3991 C  CB    . ASN A 1 520 ? 35.221 47.756  -45.346 1.00 44.18  ? 519  ASN A CB    1 
ATOM   3992 C  CG    . ASN A 1 520 ? 35.526 46.560  -44.466 1.00 45.78  ? 519  ASN A CG    1 
ATOM   3993 O  OD1   . ASN A 1 520 ? 35.833 46.709  -43.284 1.00 46.30  ? 519  ASN A OD1   1 
ATOM   3994 N  ND2   . ASN A 1 520 ? 35.444 45.365  -45.039 1.00 46.37  ? 519  ASN A ND2   1 
ATOM   3995 N  N     . GLN A 1 521 ? 34.091 50.549  -46.320 1.00 43.93  ? 520  GLN A N     1 
ATOM   3996 C  CA    . GLN A 1 521 ? 34.238 51.850  -46.968 1.00 46.67  ? 520  GLN A CA    1 
ATOM   3997 C  C     . GLN A 1 521 ? 33.915 52.982  -45.999 1.00 46.89  ? 520  GLN A C     1 
ATOM   3998 O  O     . GLN A 1 521 ? 34.608 54.012  -45.970 1.00 49.74  ? 520  GLN A O     1 
ATOM   3999 C  CB    . GLN A 1 521 ? 33.339 51.920  -48.202 1.00 51.43  ? 520  GLN A CB    1 
ATOM   4000 C  CG    . GLN A 1 521 ? 33.636 50.857  -49.248 1.00 57.50  ? 520  GLN A CG    1 
ATOM   4001 C  CD    . GLN A 1 521 ? 32.607 50.824  -50.365 1.00 62.98  ? 520  GLN A CD    1 
ATOM   4002 O  OE1   . GLN A 1 521 ? 32.927 50.501  -51.510 1.00 68.24  ? 520  GLN A OE1   1 
ATOM   4003 N  NE2   . GLN A 1 521 ? 31.363 51.152  -50.036 1.00 63.25  ? 520  GLN A NE2   1 
ATOM   4004 N  N     . ILE A 1 522 ? 32.867 52.801  -45.190 1.00 44.40  ? 521  ILE A N     1 
ATOM   4005 C  CA    . ILE A 1 522 ? 32.522 53.800  -44.182 1.00 41.44  ? 521  ILE A CA    1 
ATOM   4006 C  C     . ILE A 1 522 ? 33.665 53.974  -43.189 1.00 40.64  ? 521  ILE A C     1 
ATOM   4007 O  O     . ILE A 1 522 ? 34.002 55.098  -42.802 1.00 38.54  ? 521  ILE A O     1 
ATOM   4008 C  CB    . ILE A 1 522 ? 31.205 53.419  -43.480 1.00 40.08  ? 521  ILE A CB    1 
ATOM   4009 C  CG1   . ILE A 1 522 ? 30.030 53.531  -44.453 1.00 37.77  ? 521  ILE A CG1   1 
ATOM   4010 C  CG2   . ILE A 1 522 ? 30.965 54.297  -42.265 1.00 31.29  ? 521  ILE A CG2   1 
ATOM   4011 C  CD1   . ILE A 1 522 ? 28.692 53.174  -43.839 1.00 36.97  ? 521  ILE A CD1   1 
ATOM   4012 N  N     . ILE A 1 523 ? 34.274 52.865  -42.759 1.00 41.07  ? 522  ILE A N     1 
ATOM   4013 C  CA    . ILE A 1 523 ? 35.400 52.928  -41.828 1.00 39.94  ? 522  ILE A CA    1 
ATOM   4014 C  C     . ILE A 1 523 ? 36.556 53.702  -42.445 1.00 41.48  ? 522  ILE A C     1 
ATOM   4015 O  O     . ILE A 1 523 ? 37.204 54.519  -41.778 1.00 42.02  ? 522  ILE A O     1 
ATOM   4016 C  CB    . ILE A 1 523 ? 35.831 51.506  -41.417 1.00 39.66  ? 522  ILE A CB    1 
ATOM   4017 C  CG1   . ILE A 1 523 ? 34.804 50.880  -40.469 1.00 38.62  ? 522  ILE A CG1   1 
ATOM   4018 C  CG2   . ILE A 1 523 ? 37.219 51.513  -40.784 1.00 37.94  ? 522  ILE A CG2   1 
ATOM   4019 C  CD1   . ILE A 1 523 ? 34.999 49.387  -40.266 1.00 39.38  ? 522  ILE A CD1   1 
ATOM   4020 N  N     . GLU A 1 524 ? 36.845 53.441  -43.720 1.00 40.82  ? 523  GLU A N     1 
ATOM   4021 C  CA    . GLU A 1 524 ? 37.903 54.174  -44.408 1.00 46.07  ? 523  GLU A CA    1 
ATOM   4022 C  C     . GLU A 1 524 ? 37.633 55.675  -44.371 1.00 44.42  ? 523  GLU A C     1 
ATOM   4023 O  O     . GLU A 1 524 ? 38.502 56.473  -43.984 1.00 42.02  ? 523  GLU A O     1 
ATOM   4024 C  CB    . GLU A 1 524 ? 38.017 53.679  -45.850 1.00 52.72  ? 523  GLU A CB    1 
ATOM   4025 C  CG    . GLU A 1 524 ? 39.234 54.186  -46.596 1.00 63.91  ? 523  GLU A CG    1 
ATOM   4026 C  CD    . GLU A 1 524 ? 39.130 53.951  -48.091 1.00 73.51  ? 523  GLU A CD    1 
ATOM   4027 O  OE1   . GLU A 1 524 ? 38.821 54.915  -48.825 1.00 76.05  ? 523  GLU A OE1   1 
ATOM   4028 O  OE2   . GLU A 1 524 ? 39.341 52.800  -48.531 1.00 77.20  ? 523  GLU A OE2   1 
ATOM   4029 N  N     . GLN A 1 525 ? 36.416 56.072  -44.754 1.00 43.18  ? 524  GLN A N     1 
ATOM   4030 C  CA    . GLN A 1 525 ? 36.046 57.484  -44.708 1.00 39.76  ? 524  GLN A CA    1 
ATOM   4031 C  C     . GLN A 1 525 ? 36.213 58.056  -43.303 1.00 39.83  ? 524  GLN A C     1 
ATOM   4032 O  O     . GLN A 1 525 ? 36.796 59.132  -43.125 1.00 44.22  ? 524  GLN A O     1 
ATOM   4033 C  CB    . GLN A 1 525 ? 34.609 57.662  -45.197 1.00 37.63  ? 524  GLN A CB    1 
ATOM   4034 C  CG    . GLN A 1 525 ? 34.441 57.426  -46.687 1.00 37.15  ? 524  GLN A CG    1 
ATOM   4035 C  CD    . GLN A 1 525 ? 35.311 58.351  -47.514 1.00 41.59  ? 524  GLN A CD    1 
ATOM   4036 O  OE1   . GLN A 1 525 ? 36.021 57.912  -48.420 1.00 43.01  ? 524  GLN A OE1   1 
ATOM   4037 N  NE2   . GLN A 1 525 ? 35.262 59.642  -47.202 1.00 44.68  ? 524  GLN A NE2   1 
ATOM   4038 N  N     . LEU A 1 526 ? 35.721 57.338  -42.290 1.00 40.38  ? 525  LEU A N     1 
ATOM   4039 C  CA    . LEU A 1 526 ? 35.790 57.827  -40.915 1.00 38.96  ? 525  LEU A CA    1 
ATOM   4040 C  C     . LEU A 1 526 ? 37.231 58.027  -40.466 1.00 42.35  ? 525  LEU A C     1 
ATOM   4041 O  O     . LEU A 1 526 ? 37.548 59.011  -39.787 1.00 45.71  ? 525  LEU A O     1 
ATOM   4042 C  CB    . LEU A 1 526 ? 35.074 56.857  -39.975 1.00 35.76  ? 525  LEU A CB    1 
ATOM   4043 C  CG    . LEU A 1 526 ? 33.548 56.849  -40.031 1.00 36.42  ? 525  LEU A CG    1 
ATOM   4044 C  CD1   . LEU A 1 526 ? 32.981 55.767  -39.127 1.00 32.48  ? 525  LEU A CD1   1 
ATOM   4045 C  CD2   . LEU A 1 526 ? 33.009 58.215  -39.641 1.00 35.29  ? 525  LEU A CD2   1 
ATOM   4046 N  N     . ILE A 1 527 ? 38.115 57.095  -40.824 1.00 41.24  ? 526  ILE A N     1 
ATOM   4047 C  CA    . ILE A 1 527 ? 39.527 57.247  -40.485 1.00 41.80  ? 526  ILE A CA    1 
ATOM   4048 C  C     . ILE A 1 527 ? 40.106 58.472  -41.179 1.00 42.90  ? 526  ILE A C     1 
ATOM   4049 O  O     . ILE A 1 527 ? 40.950 59.182  -40.618 1.00 42.79  ? 526  ILE A O     1 
ATOM   4050 C  CB    . ILE A 1 527 ? 40.303 55.967  -40.845 1.00 42.47  ? 526  ILE A CB    1 
ATOM   4051 C  CG1   . ILE A 1 527 ? 39.858 54.804  -39.958 1.00 40.86  ? 526  ILE A CG1   1 
ATOM   4052 C  CG2   . ILE A 1 527 ? 41.798 56.180  -40.702 1.00 42.73  ? 526  ILE A CG2   1 
ATOM   4053 C  CD1   . ILE A 1 527 ? 40.462 53.482  -40.362 1.00 41.75  ? 526  ILE A CD1   1 
ATOM   4054 N  N     . LYS A 1 528 ? 39.649 58.752  -42.404 1.00 44.13  ? 527  LYS A N     1 
ATOM   4055 C  CA    . LYS A 1 528 ? 40.177 59.907  -43.124 1.00 44.11  ? 527  LYS A CA    1 
ATOM   4056 C  C     . LYS A 1 528 ? 39.768 61.230  -42.475 1.00 45.32  ? 527  LYS A C     1 
ATOM   4057 O  O     . LYS A 1 528 ? 40.495 62.224  -42.591 1.00 45.96  ? 527  LYS A O     1 
ATOM   4058 C  CB    . LYS A 1 528 ? 39.725 59.863  -44.585 1.00 38.82  ? 527  LYS A CB    1 
ATOM   4059 N  N     . LYS A 1 529 ? 38.632 61.265  -41.778 1.00 43.47  ? 528  LYS A N     1 
ATOM   4060 C  CA    . LYS A 1 529 ? 38.109 62.514  -41.242 1.00 43.10  ? 528  LYS A CA    1 
ATOM   4061 C  C     . LYS A 1 529 ? 38.927 62.991  -40.040 1.00 44.51  ? 528  LYS A C     1 
ATOM   4062 O  O     . LYS A 1 529 ? 39.724 62.255  -39.455 1.00 44.65  ? 528  LYS A O     1 
ATOM   4063 C  CB    . LYS A 1 529 ? 36.644 62.354  -40.837 1.00 35.25  ? 528  LYS A CB    1 
ATOM   4064 C  CG    . LYS A 1 529 ? 35.693 62.120  -41.994 1.00 37.62  ? 528  LYS A CG    1 
ATOM   4065 C  CD    . LYS A 1 529 ? 35.626 63.334  -42.908 1.00 36.38  ? 528  LYS A CD    1 
ATOM   4066 C  CE    . LYS A 1 529 ? 34.609 63.126  -44.016 1.00 36.54  ? 528  LYS A CE    1 
ATOM   4067 N  NZ    . LYS A 1 529 ? 34.611 64.247  -44.989 1.00 41.31  ? 528  LYS A NZ    1 
ATOM   4068 N  N     . GLU A 1 530 ? 38.709 64.256  -39.677 1.00 46.72  ? 529  GLU A N     1 
ATOM   4069 C  CA    . GLU A 1 530 ? 39.296 64.879  -38.495 1.00 49.99  ? 529  GLU A CA    1 
ATOM   4070 C  C     . GLU A 1 530 ? 38.343 64.906  -37.308 1.00 44.56  ? 529  GLU A C     1 
ATOM   4071 O  O     . GLU A 1 530 ? 38.754 64.619  -36.181 1.00 44.99  ? 529  GLU A O     1 
ATOM   4072 C  CB    . GLU A 1 530 ? 39.737 66.312  -38.814 1.00 59.99  ? 529  GLU A CB    1 
ATOM   4073 C  CG    . GLU A 1 530 ? 41.040 66.414  -39.587 1.00 71.33  ? 529  GLU A CG    1 
ATOM   4074 C  CD    . GLU A 1 530 ? 42.254 66.397  -38.679 1.00 82.02  ? 529  GLU A CD    1 
ATOM   4075 O  OE1   . GLU A 1 530 ? 42.164 66.942  -37.557 1.00 85.37  ? 529  GLU A OE1   1 
ATOM   4076 O  OE2   . GLU A 1 530 ? 43.295 65.837  -39.084 1.00 85.57  ? 529  GLU A OE2   1 
ATOM   4077 N  N     . LYS A 1 531 ? 37.081 65.260  -37.534 1.00 41.52  ? 530  LYS A N     1 
ATOM   4078 C  CA    . LYS A 1 531 ? 36.063 65.243  -36.492 1.00 40.87  ? 530  LYS A CA    1 
ATOM   4079 C  C     . LYS A 1 531 ? 34.755 64.765  -37.096 1.00 41.59  ? 530  LYS A C     1 
ATOM   4080 O  O     . LYS A 1 531 ? 34.354 65.238  -38.163 1.00 43.33  ? 530  LYS A O     1 
ATOM   4081 C  CB    . LYS A 1 531 ? 35.867 66.626  -35.865 1.00 40.97  ? 530  LYS A CB    1 
ATOM   4082 C  CG    . LYS A 1 531 ? 36.960 67.075  -34.915 1.00 44.04  ? 530  LYS A CG    1 
ATOM   4083 C  CD    . LYS A 1 531 ? 36.592 68.424  -34.313 1.00 43.97  ? 530  LYS A CD    1 
ATOM   4084 C  CE    . LYS A 1 531 ? 37.615 68.897  -33.300 1.00 46.72  ? 530  LYS A CE    1 
ATOM   4085 N  NZ    . LYS A 1 531 ? 37.154 70.141  -32.624 1.00 51.13  ? 530  LYS A NZ    1 
ATOM   4086 N  N     . VAL A 1 532 ? 34.097 63.827  -36.418 1.00 39.82  ? 531  VAL A N     1 
ATOM   4087 C  CA    . VAL A 1 532 ? 32.791 63.327  -36.825 1.00 38.82  ? 531  VAL A CA    1 
ATOM   4088 C  C     . VAL A 1 532 ? 31.881 63.346  -35.608 1.00 38.72  ? 531  VAL A C     1 
ATOM   4089 O  O     . VAL A 1 532 ? 32.247 62.831  -34.546 1.00 40.70  ? 531  VAL A O     1 
ATOM   4090 C  CB    . VAL A 1 532 ? 32.868 61.903  -37.413 1.00 42.40  ? 531  VAL A CB    1 
ATOM   4091 C  CG1   . VAL A 1 532 ? 31.498 61.466  -37.922 1.00 31.42  ? 531  VAL A CG1   1 
ATOM   4092 C  CG2   . VAL A 1 532 ? 33.898 61.835  -38.527 1.00 42.23  ? 531  VAL A CG2   1 
ATOM   4093 N  N     . TYR A 1 533 ? 30.706 63.949  -35.757 1.00 38.44  ? 532  TYR A N     1 
ATOM   4094 C  CA    . TYR A 1 533 ? 29.670 63.920  -34.734 1.00 37.84  ? 532  TYR A CA    1 
ATOM   4095 C  C     . TYR A 1 533 ? 28.427 63.292  -35.342 1.00 38.97  ? 532  TYR A C     1 
ATOM   4096 O  O     . TYR A 1 533 ? 27.929 63.767  -36.368 1.00 40.17  ? 532  TYR A O     1 
ATOM   4097 C  CB    . TYR A 1 533 ? 29.361 65.319  -34.199 1.00 39.68  ? 532  TYR A CB    1 
ATOM   4098 C  CG    . TYR A 1 533 ? 28.253 65.317  -33.171 1.00 40.17  ? 532  TYR A CG    1 
ATOM   4099 C  CD1   . TYR A 1 533 ? 28.489 64.889  -31.871 1.00 39.69  ? 532  TYR A CD1   1 
ATOM   4100 C  CD2   . TYR A 1 533 ? 26.967 65.729  -33.502 1.00 40.62  ? 532  TYR A CD2   1 
ATOM   4101 C  CE1   . TYR A 1 533 ? 27.478 64.879  -30.925 1.00 42.62  ? 532  TYR A CE1   1 
ATOM   4102 C  CE2   . TYR A 1 533 ? 25.950 65.721  -32.564 1.00 41.88  ? 532  TYR A CE2   1 
ATOM   4103 C  CZ    . TYR A 1 533 ? 26.212 65.295  -31.277 1.00 43.60  ? 532  TYR A CZ    1 
ATOM   4104 O  OH    . TYR A 1 533 ? 25.204 65.284  -30.340 1.00 45.30  ? 532  TYR A OH    1 
ATOM   4105 N  N     . LEU A 1 534 ? 27.931 62.232  -34.710 1.00 40.79  ? 533  LEU A N     1 
ATOM   4106 C  CA    . LEU A 1 534 ? 26.803 61.464  -35.220 1.00 43.45  ? 533  LEU A CA    1 
ATOM   4107 C  C     . LEU A 1 534 ? 25.670 61.529  -34.206 1.00 38.58  ? 533  LEU A C     1 
ATOM   4108 O  O     . LEU A 1 534 ? 25.832 61.095  -33.062 1.00 40.06  ? 533  LEU A O     1 
ATOM   4109 C  CB    . LEU A 1 534 ? 27.216 60.017  -35.494 1.00 50.28  ? 533  LEU A CB    1 
ATOM   4110 C  CG    . LEU A 1 534 ? 26.214 59.099  -36.194 1.00 54.36  ? 533  LEU A CG    1 
ATOM   4111 C  CD1   . LEU A 1 534 ? 25.659 59.755  -37.445 1.00 53.83  ? 533  LEU A CD1   1 
ATOM   4112 C  CD2   . LEU A 1 534 ? 26.879 57.777  -36.538 1.00 56.53  ? 533  LEU A CD2   1 
ATOM   4113 N  N     . ALA A 1 535 ? 24.533 62.075  -34.624 1.00 36.92  ? 534  ALA A N     1 
ATOM   4114 C  CA    . ALA A 1 535 ? 23.380 62.247  -33.756 1.00 35.74  ? 534  ALA A CA    1 
ATOM   4115 C  C     . ALA A 1 535 ? 22.183 61.498  -34.326 1.00 34.93  ? 534  ALA A C     1 
ATOM   4116 O  O     . ALA A 1 535 ? 22.139 61.163  -35.513 1.00 38.45  ? 534  ALA A O     1 
ATOM   4117 C  CB    . ALA A 1 535 ? 23.036 63.731  -33.575 1.00 36.88  ? 534  ALA A CB    1 
ATOM   4118 N  N     . TRP A 1 536 ? 21.208 61.238  -33.462 1.00 34.88  ? 535  TRP A N     1 
ATOM   4119 C  CA    . TRP A 1 536 ? 20.037 60.449  -33.812 1.00 38.64  ? 535  TRP A CA    1 
ATOM   4120 C  C     . TRP A 1 536 ? 18.768 61.249  -33.558 1.00 39.75  ? 535  TRP A C     1 
ATOM   4121 O  O     . TRP A 1 536 ? 18.687 62.015  -32.594 1.00 42.13  ? 535  TRP A O     1 
ATOM   4122 C  CB    . TRP A 1 536 ? 19.994 59.141  -33.009 1.00 37.34  ? 535  TRP A CB    1 
ATOM   4123 C  CG    . TRP A 1 536 ? 18.788 58.298  -33.307 1.00 39.54  ? 535  TRP A CG    1 
ATOM   4124 C  CD1   . TRP A 1 536 ? 18.640 57.412  -34.337 1.00 37.83  ? 535  TRP A CD1   1 
ATOM   4125 C  CD2   . TRP A 1 536 ? 17.558 58.265  -32.570 1.00 34.96  ? 535  TRP A CD2   1 
ATOM   4126 N  NE1   . TRP A 1 536 ? 17.396 56.831  -34.286 1.00 38.66  ? 535  TRP A NE1   1 
ATOM   4127 C  CE2   . TRP A 1 536 ? 16.712 57.335  -33.210 1.00 35.19  ? 535  TRP A CE2   1 
ATOM   4128 C  CE3   . TRP A 1 536 ? 17.091 58.929  -31.430 1.00 36.21  ? 535  TRP A CE3   1 
ATOM   4129 C  CZ2   . TRP A 1 536 ? 15.425 57.053  -32.748 1.00 36.65  ? 535  TRP A CZ2   1 
ATOM   4130 C  CZ3   . TRP A 1 536 ? 15.814 58.648  -30.974 1.00 37.64  ? 535  TRP A CZ3   1 
ATOM   4131 C  CH2   . TRP A 1 536 ? 14.996 57.717  -31.633 1.00 38.21  ? 535  TRP A CH2   1 
ATOM   4132 N  N     . VAL A 1 537 ? 17.782 61.065  -34.433 1.00 37.81  ? 536  VAL A N     1 
ATOM   4133 C  CA    . VAL A 1 537 ? 16.438 61.609  -34.222 1.00 39.27  ? 536  VAL A CA    1 
ATOM   4134 C  C     . VAL A 1 537 ? 15.413 60.556  -34.596 1.00 43.00  ? 536  VAL A C     1 
ATOM   4135 O  O     . VAL A 1 537 ? 15.638 59.718  -35.479 1.00 39.76  ? 536  VAL A O     1 
ATOM   4136 C  CB    . VAL A 1 537 ? 16.193 62.886  -35.055 1.00 37.67  ? 536  VAL A CB    1 
ATOM   4137 C  CG1   . VAL A 1 537 ? 16.959 64.067  -34.471 1.00 35.49  ? 536  VAL A CG1   1 
ATOM   4138 C  CG2   . VAL A 1 537 ? 16.581 62.652  -36.506 1.00 32.89  ? 536  VAL A CG2   1 
ATOM   4139 N  N     . PRO A 1 538 ? 14.263 60.572  -33.921 1.00 44.94  ? 537  PRO A N     1 
ATOM   4140 C  CA    . PRO A 1 538 ? 13.197 59.622  -34.269 1.00 43.64  ? 537  PRO A CA    1 
ATOM   4141 C  C     . PRO A 1 538 ? 12.633 59.913  -35.653 1.00 45.66  ? 537  PRO A C     1 
ATOM   4142 O  O     . PRO A 1 538 ? 12.322 61.059  -35.988 1.00 46.71  ? 537  PRO A O     1 
ATOM   4143 C  CB    . PRO A 1 538 ? 12.150 59.838  -33.170 1.00 45.01  ? 537  PRO A CB    1 
ATOM   4144 C  CG    . PRO A 1 538 ? 12.444 61.194  -32.618 1.00 46.70  ? 537  PRO A CG    1 
ATOM   4145 C  CD    . PRO A 1 538 ? 13.924 61.375  -32.735 1.00 44.75  ? 537  PRO A CD    1 
ATOM   4146 N  N     . ALA A 1 539 ? 12.509 58.858  -36.453 1.00 45.89  ? 538  ALA A N     1 
ATOM   4147 C  CA    . ALA A 1 539 ? 12.016 58.969  -37.816 1.00 44.50  ? 538  ALA A CA    1 
ATOM   4148 C  C     . ALA A 1 539 ? 10.531 59.318  -37.843 1.00 50.84  ? 538  ALA A C     1 
ATOM   4149 O  O     . ALA A 1 539 ? 9.779  59.046  -36.903 1.00 53.40  ? 538  ALA A O     1 
ATOM   4150 C  CB    . ALA A 1 539 ? 12.237 57.660  -38.568 1.00 41.74  ? 538  ALA A CB    1 
ATOM   4151 N  N     . HIS A 1 540 ? 10.116 59.925  -38.957 1.00 52.81  ? 539  HIS A N     1 
ATOM   4152 C  CA    . HIS A 1 540 ? 8.703  60.155  -39.262 1.00 55.12  ? 539  HIS A CA    1 
ATOM   4153 C  C     . HIS A 1 540 ? 8.011  60.957  -38.161 1.00 58.12  ? 539  HIS A C     1 
ATOM   4154 O  O     . HIS A 1 540 ? 6.866  60.686  -37.794 1.00 60.33  ? 539  HIS A O     1 
ATOM   4155 C  CB    . HIS A 1 540 ? 7.978  58.830  -39.513 1.00 55.48  ? 539  HIS A CB    1 
ATOM   4156 C  CG    . HIS A 1 540 ? 8.755  57.869  -40.359 1.00 54.85  ? 539  HIS A CG    1 
ATOM   4157 N  ND1   . HIS A 1 540 ? 9.128  58.151  -41.656 1.00 54.85  ? 539  HIS A ND1   1 
ATOM   4158 C  CD2   . HIS A 1 540 ? 9.234  56.630  -40.093 1.00 54.98  ? 539  HIS A CD2   1 
ATOM   4159 C  CE1   . HIS A 1 540 ? 9.803  57.128  -42.152 1.00 53.74  ? 539  HIS A CE1   1 
ATOM   4160 N  NE2   . HIS A 1 540 ? 9.881  56.192  -41.224 1.00 54.42  ? 539  HIS A NE2   1 
ATOM   4161 N  N     . LYS A 1 541 ? 8.715  61.954  -37.624 1.00 59.32  ? 540  LYS A N     1 
ATOM   4162 C  CA    . LYS A 1 541 ? 8.158  62.841  -36.609 1.00 59.85  ? 540  LYS A CA    1 
ATOM   4163 C  C     . LYS A 1 541 ? 8.166  64.299  -37.051 1.00 57.99  ? 540  LYS A C     1 
ATOM   4164 O  O     . LYS A 1 541 ? 7.913  65.187  -36.228 1.00 56.34  ? 540  LYS A O     1 
ATOM   4165 C  CB    . LYS A 1 541 ? 8.916  62.687  -35.286 1.00 59.45  ? 540  LYS A CB    1 
ATOM   4166 C  CG    . LYS A 1 541 ? 8.804  61.305  -34.661 1.00 59.50  ? 540  LYS A CG    1 
ATOM   4167 C  CD    . LYS A 1 541 ? 7.362  60.972  -34.321 1.00 64.39  ? 540  LYS A CD    1 
ATOM   4168 C  CE    . LYS A 1 541 ? 7.234  59.573  -33.740 1.00 66.60  ? 540  LYS A CE    1 
ATOM   4169 N  NZ    . LYS A 1 541 ? 5.829  59.260  -33.350 1.00 69.43  ? 540  LYS A NZ    1 
ATOM   4170 N  N     . GLY A 1 542 ? 8.448  64.567  -38.324 1.00 57.40  ? 541  GLY A N     1 
ATOM   4171 C  CA    . GLY A 1 542 ? 8.445  65.930  -38.821 1.00 59.61  ? 541  GLY A CA    1 
ATOM   4172 C  C     . GLY A 1 542 ? 9.568  66.792  -38.291 1.00 60.85  ? 541  GLY A C     1 
ATOM   4173 O  O     . GLY A 1 542 ? 9.418  68.015  -38.215 1.00 63.62  ? 541  GLY A O     1 
ATOM   4174 N  N     . ILE A 1 543 ? 10.691 66.188  -37.921 1.00 59.34  ? 542  ILE A N     1 
ATOM   4175 C  CA    . ILE A 1 543 ? 11.836 66.921  -37.395 1.00 59.20  ? 542  ILE A CA    1 
ATOM   4176 C  C     . ILE A 1 543 ? 12.722 67.315  -38.571 1.00 62.61  ? 542  ILE A C     1 
ATOM   4177 O  O     . ILE A 1 543 ? 13.345 66.460  -39.204 1.00 66.27  ? 542  ILE A O     1 
ATOM   4178 C  CB    . ILE A 1 543 ? 12.614 66.089  -36.370 1.00 55.06  ? 542  ILE A CB    1 
ATOM   4179 C  CG1   . ILE A 1 543 ? 11.739 65.778  -35.156 1.00 52.57  ? 542  ILE A CG1   1 
ATOM   4180 C  CG2   . ILE A 1 543 ? 13.879 66.817  -35.948 1.00 55.89  ? 542  ILE A CG2   1 
ATOM   4181 C  CD1   . ILE A 1 543 ? 12.397 64.855  -34.153 1.00 51.23  ? 542  ILE A CD1   1 
ATOM   4182 N  N     . GLY A 1 544 ? 12.776 68.610  -38.870 1.00 63.44  ? 543  GLY A N     1 
ATOM   4183 C  CA    . GLY A 1 544 ? 13.687 69.084  -39.892 1.00 60.70  ? 543  GLY A CA    1 
ATOM   4184 C  C     . GLY A 1 544 ? 15.128 69.025  -39.423 1.00 62.90  ? 543  GLY A C     1 
ATOM   4185 O  O     . GLY A 1 544 ? 15.432 69.202  -38.243 1.00 73.24  ? 543  GLY A O     1 
ATOM   4186 N  N     . GLY A 1 545 ? 16.032 68.765  -40.363 1.00 57.97  ? 544  GLY A N     1 
ATOM   4187 C  CA    . GLY A 1 545 ? 15.680 68.567  -41.756 1.00 55.42  ? 544  GLY A CA    1 
ATOM   4188 C  C     . GLY A 1 545 ? 15.592 67.109  -42.161 1.00 50.96  ? 544  GLY A C     1 
ATOM   4189 O  O     . GLY A 1 545 ? 15.582 66.791  -43.348 1.00 49.71  ? 544  GLY A O     1 
ATOM   4190 N  N     . ASN A 1 546 ? 15.535 66.218  -41.167 1.00 47.78  ? 545  ASN A N     1 
ATOM   4191 C  CA    . ASN A 1 546 ? 15.242 64.815  -41.441 1.00 45.10  ? 545  ASN A CA    1 
ATOM   4192 C  C     . ASN A 1 546 ? 13.954 64.670  -42.244 1.00 47.70  ? 545  ASN A C     1 
ATOM   4193 O  O     . ASN A 1 546 ? 13.830 63.756  -43.069 1.00 50.08  ? 545  ASN A O     1 
ATOM   4194 C  CB    . ASN A 1 546 ? 15.156 64.039  -40.123 1.00 41.38  ? 545  ASN A CB    1 
ATOM   4195 C  CG    . ASN A 1 546 ? 14.585 62.644  -40.298 1.00 41.11  ? 545  ASN A CG    1 
ATOM   4196 O  OD1   . ASN A 1 546 ? 13.393 62.417  -40.084 1.00 40.58  ? 545  ASN A OD1   1 
ATOM   4197 N  ND2   . ASN A 1 546 ? 15.435 61.701  -40.686 1.00 41.55  ? 545  ASN A ND2   1 
ATOM   4198 N  N     . GLU A 1 547 ? 12.994 65.570  -42.020 1.00 48.09  ? 546  GLU A N     1 
ATOM   4199 C  CA    . GLU A 1 547 ? 11.774 65.613  -42.822 1.00 52.43  ? 546  GLU A CA    1 
ATOM   4200 C  C     . GLU A 1 547 ? 12.091 65.749  -44.311 1.00 51.15  ? 546  GLU A C     1 
ATOM   4201 O  O     . GLU A 1 547 ? 11.527 65.034  -45.150 1.00 50.98  ? 546  GLU A O     1 
ATOM   4202 C  CB    . GLU A 1 547 ? 10.907 66.775  -42.337 1.00 59.02  ? 546  GLU A CB    1 
ATOM   4203 C  CG    . GLU A 1 547 ? 9.488  66.806  -42.863 1.00 66.90  ? 546  GLU A CG    1 
ATOM   4204 C  CD    . GLU A 1 547 ? 8.717  68.006  -42.341 1.00 73.64  ? 546  GLU A CD    1 
ATOM   4205 O  OE1   . GLU A 1 547 ? 7.650  68.324  -42.906 1.00 77.46  ? 546  GLU A OE1   1 
ATOM   4206 O  OE2   . GLU A 1 547 ? 9.183  68.636  -41.365 1.00 74.01  ? 546  GLU A OE2   1 
ATOM   4207 N  N     . GLN A 1 548 ? 13.005 66.664  -44.653 1.00 47.82  ? 547  GLN A N     1 
ATOM   4208 C  CA    . GLN A 1 548 ? 13.349 66.896  -46.054 1.00 49.09  ? 547  GLN A CA    1 
ATOM   4209 C  C     . GLN A 1 548 ? 14.008 65.669  -46.680 1.00 49.50  ? 547  GLN A C     1 
ATOM   4210 O  O     . GLN A 1 548 ? 13.651 65.264  -47.794 1.00 53.14  ? 547  GLN A O     1 
ATOM   4211 C  CB    . GLN A 1 548 ? 14.257 68.121  -46.175 1.00 49.32  ? 547  GLN A CB    1 
ATOM   4212 C  CG    . GLN A 1 548 ? 13.517 69.455  -46.255 1.00 52.73  ? 547  GLN A CG    1 
ATOM   4213 C  CD    . GLN A 1 548 ? 12.825 69.833  -44.957 1.00 54.90  ? 547  GLN A CD    1 
ATOM   4214 O  OE1   . GLN A 1 548 ? 11.631 69.589  -44.780 1.00 56.29  ? 547  GLN A OE1   1 
ATOM   4215 N  NE2   . GLN A 1 548 ? 13.574 70.435  -44.042 1.00 54.96  ? 547  GLN A NE2   1 
ATOM   4216 N  N     . VAL A 1 549 ? 14.975 65.063  -45.984 1.00 46.44  ? 548  VAL A N     1 
ATOM   4217 C  CA    . VAL A 1 549 ? 15.632 63.873  -46.526 1.00 47.97  ? 548  VAL A CA    1 
ATOM   4218 C  C     . VAL A 1 549 ? 14.627 62.750  -46.705 1.00 46.91  ? 548  VAL A C     1 
ATOM   4219 O  O     . VAL A 1 549 ? 14.658 62.023  -47.705 1.00 45.30  ? 548  VAL A O     1 
ATOM   4220 C  CB    . VAL A 1 549 ? 16.793 63.420  -45.623 1.00 50.19  ? 548  VAL A CB    1 
ATOM   4221 C  CG1   . VAL A 1 549 ? 17.968 62.967  -46.472 1.00 49.33  ? 548  VAL A CG1   1 
ATOM   4222 C  CG2   . VAL A 1 549 ? 17.187 64.508  -44.669 1.00 53.48  ? 548  VAL A CG2   1 
ATOM   4223 N  N     . ASP A 1 550 ? 13.743 62.569  -45.722 1.00 46.98  ? 549  ASP A N     1 
ATOM   4224 C  CA    . ASP A 1 550 ? 12.743 61.514  -45.811 1.00 47.74  ? 549  ASP A CA    1 
ATOM   4225 C  C     . ASP A 1 550 ? 11.856 61.713  -47.031 1.00 51.08  ? 549  ASP A C     1 
ATOM   4226 O  O     . ASP A 1 550 ? 11.595 60.766  -47.785 1.00 52.77  ? 549  ASP A O     1 
ATOM   4227 C  CB    . ASP A 1 550 ? 11.908 61.478  -44.534 1.00 48.81  ? 549  ASP A CB    1 
ATOM   4228 C  CG    . ASP A 1 550 ? 10.896 60.360  -44.540 1.00 57.14  ? 549  ASP A CG    1 
ATOM   4229 O  OD1   . ASP A 1 550 ? 11.282 59.211  -44.243 1.00 61.35  ? 549  ASP A OD1   1 
ATOM   4230 O  OD2   . ASP A 1 550 ? 9.717  60.628  -44.854 1.00 61.14  ? 549  ASP A OD2   1 
ATOM   4231 N  N     . LYS A 1 551 ? 11.394 62.948  -47.252 1.00 47.23  ? 550  LYS A N     1 
ATOM   4232 C  CA    . LYS A 1 551 ? 10.591 63.223  -48.438 1.00 46.90  ? 550  LYS A CA    1 
ATOM   4233 C  C     . LYS A 1 551 ? 11.388 63.000  -49.717 1.00 48.83  ? 550  LYS A C     1 
ATOM   4234 O  O     . LYS A 1 551 ? 10.824 62.585  -50.736 1.00 53.64  ? 550  LYS A O     1 
ATOM   4235 C  CB    . LYS A 1 551 ? 10.048 64.652  -48.391 1.00 47.54  ? 550  LYS A CB    1 
ATOM   4236 N  N     . LEU A 1 552 ? 12.697 63.256  -49.681 1.00 45.66  ? 551  LEU A N     1 
ATOM   4237 C  CA    . LEU A 1 552 ? 13.512 63.145  -50.887 1.00 44.59  ? 551  LEU A CA    1 
ATOM   4238 C  C     . LEU A 1 552 ? 13.756 61.686  -51.270 1.00 46.86  ? 551  LEU A C     1 
ATOM   4239 O  O     . LEU A 1 552 ? 13.547 61.293  -52.425 1.00 45.94  ? 551  LEU A O     1 
ATOM   4240 C  CB    . LEU A 1 552 ? 14.836 63.879  -50.677 1.00 44.73  ? 551  LEU A CB    1 
ATOM   4241 C  CG    . LEU A 1 552 ? 15.427 64.621  -51.874 1.00 49.87  ? 551  LEU A CG    1 
ATOM   4242 C  CD1   . LEU A 1 552 ? 14.414 65.588  -52.459 1.00 47.93  ? 551  LEU A CD1   1 
ATOM   4243 C  CD2   . LEU A 1 552 ? 16.689 65.361  -51.452 1.00 53.20  ? 551  LEU A CD2   1 
ATOM   4244 N  N     . VAL A 1 553 ? 14.207 60.863  -50.317 1.00 45.58  ? 552  VAL A N     1 
ATOM   4245 C  CA    . VAL A 1 553 ? 14.547 59.477  -50.640 1.00 47.63  ? 552  VAL A CA    1 
ATOM   4246 C  C     . VAL A 1 553 ? 13.329 58.581  -50.801 1.00 50.96  ? 552  VAL A C     1 
ATOM   4247 O  O     . VAL A 1 553 ? 13.476 57.436  -51.242 1.00 50.80  ? 552  VAL A O     1 
ATOM   4248 C  CB    . VAL A 1 553 ? 15.481 58.849  -49.586 1.00 42.10  ? 552  VAL A CB    1 
ATOM   4249 C  CG1   . VAL A 1 553 ? 16.767 59.656  -49.462 1.00 39.26  ? 552  VAL A CG1   1 
ATOM   4250 C  CG2   . VAL A 1 553 ? 14.782 58.718  -48.240 1.00 38.00  ? 552  VAL A CG2   1 
ATOM   4251 N  N     . SER A 1 554 ? 12.134 59.064  -50.472 1.00 53.45  ? 553  SER A N     1 
ATOM   4252 C  CA    . SER A 1 554 ? 10.919 58.266  -50.625 1.00 53.87  ? 553  SER A CA    1 
ATOM   4253 C  C     . SER A 1 554 ? 10.437 58.235  -52.074 1.00 52.71  ? 553  SER A C     1 
ATOM   4254 O  O     . SER A 1 554 ? 10.153 59.275  -52.669 1.00 52.58  ? 553  SER A O     1 
ATOM   4255 C  CB    . SER A 1 554 ? 9.810  58.803  -49.720 1.00 55.84  ? 553  SER A CB    1 
ATOM   4256 O  OG    . SER A 1 554 ? 10.192 58.738  -48.359 1.00 55.90  ? 553  SER A OG    1 
ATOM   4257 N  N     . THR B 2 19  ? 10.002 10.213  3.537   1.00 91.84  ? 7    THR B N     1 
ATOM   4258 C  CA    . THR B 2 19  ? 10.209 11.271  2.554   1.00 89.15  ? 7    THR B CA    1 
ATOM   4259 C  C     . THR B 2 19  ? 8.931  11.559  1.781   1.00 90.13  ? 7    THR B C     1 
ATOM   4260 O  O     . THR B 2 19  ? 7.974  10.787  1.837   1.00 92.63  ? 7    THR B O     1 
ATOM   4261 C  CB    . THR B 2 19  ? 11.318 10.909  1.547   1.00 84.65  ? 7    THR B CB    1 
ATOM   4262 O  OG1   . THR B 2 19  ? 10.927 9.749   0.802   1.00 86.52  ? 7    THR B OG1   1 
ATOM   4263 C  CG2   . THR B 2 19  ? 12.623 10.628  2.266   1.00 82.21  ? 7    THR B CG2   1 
ATOM   4264 N  N     . VAL B 2 20  ? 8.922  12.673  1.056   1.00 87.89  ? 8    VAL B N     1 
ATOM   4265 C  CA    . VAL B 2 20  ? 7.788  13.022  0.205   1.00 90.02  ? 8    VAL B CA    1 
ATOM   4266 C  C     . VAL B 2 20  ? 8.185  12.777  -1.247  1.00 87.98  ? 8    VAL B C     1 
ATOM   4267 O  O     . VAL B 2 20  ? 9.336  13.034  -1.630  1.00 84.42  ? 8    VAL B O     1 
ATOM   4268 C  CB    . VAL B 2 20  ? 7.329  14.473  0.441   1.00 89.51  ? 8    VAL B CB    1 
ATOM   4269 C  CG1   . VAL B 2 20  ? 7.147  14.736  1.930   1.00 92.15  ? 8    VAL B CG1   1 
ATOM   4270 C  CG2   . VAL B 2 20  ? 8.305  15.468  -0.160  1.00 85.55  ? 8    VAL B CG2   1 
ATOM   4271 N  N     . PRO B 2 21  ? 7.290  12.245  -2.079  1.00 87.48  ? 9    PRO B N     1 
ATOM   4272 C  CA    . PRO B 2 21  ? 7.630  12.054  -3.494  1.00 85.08  ? 9    PRO B CA    1 
ATOM   4273 C  C     . PRO B 2 21  ? 7.618  13.381  -4.239  1.00 83.32  ? 9    PRO B C     1 
ATOM   4274 O  O     . PRO B 2 21  ? 6.688  14.178  -4.105  1.00 87.66  ? 9    PRO B O     1 
ATOM   4275 C  CB    . PRO B 2 21  ? 6.535  11.108  -3.999  1.00 86.89  ? 9    PRO B CB    1 
ATOM   4276 C  CG    . PRO B 2 21  ? 5.381  11.362  -3.088  1.00 89.92  ? 9    PRO B CG    1 
ATOM   4277 C  CD    . PRO B 2 21  ? 5.972  11.680  -1.742  1.00 90.01  ? 9    PRO B CD    1 
ATOM   4278 N  N     . VAL B 2 22  ? 8.668  13.614  -5.023  1.00 78.22  ? 10   VAL B N     1 
ATOM   4279 C  CA    . VAL B 2 22  ? 8.817  14.831  -5.811  1.00 75.62  ? 10   VAL B CA    1 
ATOM   4280 C  C     . VAL B 2 22  ? 9.028  14.430  -7.262  1.00 76.87  ? 10   VAL B C     1 
ATOM   4281 O  O     . VAL B 2 22  ? 9.841  13.546  -7.553  1.00 77.36  ? 10   VAL B O     1 
ATOM   4282 C  CB    . VAL B 2 22  ? 9.990  15.698  -5.316  1.00 72.70  ? 10   VAL B CB    1 
ATOM   4283 C  CG1   . VAL B 2 22  ? 10.012 17.030  -6.052  1.00 71.39  ? 10   VAL B CG1   1 
ATOM   4284 C  CG2   . VAL B 2 22  ? 9.899  15.910  -3.813  1.00 73.75  ? 10   VAL B CG2   1 
ATOM   4285 N  N     . LYS B 2 23  ? 8.302  15.076  -8.168  1.00 79.71  ? 11   LYS B N     1 
ATOM   4286 C  CA    . LYS B 2 23  ? 8.380  14.775  -9.587  1.00 81.36  ? 11   LYS B CA    1 
ATOM   4287 C  C     . LYS B 2 23  ? 8.805  16.013  -10.365 1.00 79.14  ? 11   LYS B C     1 
ATOM   4288 O  O     . LYS B 2 23  ? 8.752  17.141  -9.866  1.00 77.90  ? 11   LYS B O     1 
ATOM   4289 C  CB    . LYS B 2 23  ? 7.036  14.259  -10.120 1.00 77.62  ? 11   LYS B CB    1 
ATOM   4290 N  N     . LEU B 2 24  ? 9.245  15.785  -11.599 1.00 78.35  ? 12   LEU B N     1 
ATOM   4291 C  CA    . LEU B 2 24  ? 9.506  16.881  -12.514 1.00 78.02  ? 12   LEU B CA    1 
ATOM   4292 C  C     . LEU B 2 24  ? 8.206  17.326  -13.179 1.00 83.12  ? 12   LEU B C     1 
ATOM   4293 O  O     . LEU B 2 24  ? 7.149  16.707  -13.021 1.00 86.27  ? 12   LEU B O     1 
ATOM   4294 C  CB    . LEU B 2 24  ? 10.528 16.470  -13.575 1.00 75.68  ? 12   LEU B CB    1 
ATOM   4295 C  CG    . LEU B 2 24  ? 11.932 16.058  -13.126 1.00 72.09  ? 12   LEU B CG    1 
ATOM   4296 C  CD1   . LEU B 2 24  ? 12.772 15.653  -14.329 1.00 71.71  ? 12   LEU B CD1   1 
ATOM   4297 C  CD2   . LEU B 2 24  ? 12.610 17.179  -12.352 1.00 69.70  ? 12   LEU B CD2   1 
ATOM   4298 N  N     . LYS B 2 25  ? 8.287  18.418  -13.929 1.00 84.81  ? 13   LYS B N     1 
ATOM   4299 C  CA    . LYS B 2 25  ? 7.139  18.850  -14.703 1.00 88.67  ? 13   LYS B CA    1 
ATOM   4300 C  C     . LYS B 2 25  ? 6.909  17.886  -15.866 1.00 92.01  ? 13   LYS B C     1 
ATOM   4301 O  O     . LYS B 2 25  ? 7.857  17.288  -16.383 1.00 90.56  ? 13   LYS B O     1 
ATOM   4302 C  CB    . LYS B 2 25  ? 7.342  20.274  -15.216 1.00 87.49  ? 13   LYS B CB    1 
ATOM   4303 C  CG    . LYS B 2 25  ? 7.266  21.321  -14.114 1.00 83.93  ? 13   LYS B CG    1 
ATOM   4304 C  CD    . LYS B 2 25  ? 7.457  22.730  -14.646 1.00 83.15  ? 13   LYS B CD    1 
ATOM   4305 C  CE    . LYS B 2 25  ? 7.337  23.750  -13.524 1.00 80.60  ? 13   LYS B CE    1 
ATOM   4306 N  NZ    . LYS B 2 25  ? 7.680  25.129  -13.965 1.00 81.46  ? 13   LYS B NZ    1 
ATOM   4307 N  N     . PRO B 2 26  ? 5.655  17.697  -16.277 1.00 95.94  ? 14   PRO B N     1 
ATOM   4308 C  CA    . PRO B 2 26  ? 5.355  16.694  -17.309 1.00 97.66  ? 14   PRO B CA    1 
ATOM   4309 C  C     . PRO B 2 26  ? 6.095  16.978  -18.609 1.00 97.12  ? 14   PRO B C     1 
ATOM   4310 O  O     . PRO B 2 26  ? 6.104  18.106  -19.108 1.00 97.00  ? 14   PRO B O     1 
ATOM   4311 C  CB    . PRO B 2 26  ? 3.837  16.812  -17.483 1.00 102.05 ? 14   PRO B CB    1 
ATOM   4312 C  CG    . PRO B 2 26  ? 3.353  17.365  -16.184 1.00 101.04 ? 14   PRO B CG    1 
ATOM   4313 C  CD    . PRO B 2 26  ? 4.431  18.301  -15.721 1.00 97.94  ? 14   PRO B CD    1 
ATOM   4314 N  N     . GLY B 2 27  ? 6.720  15.936  -19.154 1.00 97.11  ? 15   GLY B N     1 
ATOM   4315 C  CA    . GLY B 2 27  ? 7.456  16.061  -20.395 1.00 98.81  ? 15   GLY B CA    1 
ATOM   4316 C  C     . GLY B 2 27  ? 8.796  16.748  -20.282 1.00 95.04  ? 15   GLY B C     1 
ATOM   4317 O  O     . GLY B 2 27  ? 9.278  17.302  -21.274 1.00 96.47  ? 15   GLY B O     1 
ATOM   4318 N  N     . MET B 2 28  ? 9.417  16.730  -19.105 1.00 91.18  ? 16   MET B N     1 
ATOM   4319 C  CA    . MET B 2 28  ? 10.699 17.385  -18.888 1.00 89.29  ? 16   MET B CA    1 
ATOM   4320 C  C     . MET B 2 28  ? 11.678 16.416  -18.242 1.00 86.75  ? 16   MET B C     1 
ATOM   4321 O  O     . MET B 2 28  ? 11.310 15.647  -17.349 1.00 84.62  ? 16   MET B O     1 
ATOM   4322 C  CB    . MET B 2 28  ? 10.548 18.633  -18.010 1.00 88.69  ? 16   MET B CB    1 
ATOM   4323 C  CG    . MET B 2 28  ? 10.225 19.898  -18.784 1.00 91.95  ? 16   MET B CG    1 
ATOM   4324 S  SD    . MET B 2 28  ? 10.163 21.352  -17.721 1.00 91.51  ? 16   MET B SD    1 
ATOM   4325 C  CE    . MET B 2 28  ? 10.356 22.661  -18.928 1.00 94.42  ? 16   MET B CE    1 
ATOM   4326 N  N     . ASP B 2 29  ? 12.927 16.464  -18.700 1.00 68.95  ? 17   ASP B N     1 
ATOM   4327 C  CA    . ASP B 2 29  ? 14.003 15.645  -18.170 1.00 66.78  ? 17   ASP B CA    1 
ATOM   4328 C  C     . ASP B 2 29  ? 14.830 16.462  -17.177 1.00 62.96  ? 17   ASP B C     1 
ATOM   4329 O  O     . ASP B 2 29  ? 14.566 17.641  -16.927 1.00 62.34  ? 17   ASP B O     1 
ATOM   4330 C  CB    . ASP B 2 29  ? 14.866 15.107  -19.314 1.00 68.23  ? 17   ASP B CB    1 
ATOM   4331 C  CG    . ASP B 2 29  ? 15.647 13.866  -18.926 1.00 70.55  ? 17   ASP B CG    1 
ATOM   4332 O  OD1   . ASP B 2 29  ? 15.398 13.321  -17.829 1.00 70.74  ? 17   ASP B OD1   1 
ATOM   4333 O  OD2   . ASP B 2 29  ? 16.513 13.439  -19.718 1.00 71.85  ? 17   ASP B OD2   1 
ATOM   4334 N  N     . GLY B 2 30  ? 15.845 15.824  -16.602 1.00 60.77  ? 18   GLY B N     1 
ATOM   4335 C  CA    . GLY B 2 30  ? 16.698 16.472  -15.631 1.00 57.17  ? 18   GLY B CA    1 
ATOM   4336 C  C     . GLY B 2 30  ? 17.753 17.337  -16.282 1.00 54.74  ? 18   GLY B C     1 
ATOM   4337 O  O     . GLY B 2 30  ? 17.951 17.338  -17.508 1.00 56.62  ? 18   GLY B O     1 
ATOM   4338 N  N     . PRO B 2 31  ? 18.460 18.102  -15.451 1.00 49.40  ? 19   PRO B N     1 
ATOM   4339 C  CA    . PRO B 2 31  ? 19.481 19.013  -15.982 1.00 46.73  ? 19   PRO B CA    1 
ATOM   4340 C  C     . PRO B 2 31  ? 20.671 18.258  -16.553 1.00 48.12  ? 19   PRO B C     1 
ATOM   4341 O  O     . PRO B 2 31  ? 21.079 17.215  -16.037 1.00 47.79  ? 19   PRO B O     1 
ATOM   4342 C  CB    . PRO B 2 31  ? 19.883 19.847  -14.759 1.00 45.50  ? 19   PRO B CB    1 
ATOM   4343 C  CG    . PRO B 2 31  ? 19.554 18.979  -13.591 1.00 47.11  ? 19   PRO B CG    1 
ATOM   4344 C  CD    . PRO B 2 31  ? 18.325 18.211  -13.989 1.00 49.35  ? 19   PRO B CD    1 
ATOM   4345 N  N     . LYS B 2 32  ? 21.232 18.803  -17.628 1.00 46.80  ? 20   LYS B N     1 
ATOM   4346 C  CA    . LYS B 2 32  ? 22.418 18.251  -18.273 1.00 46.75  ? 20   LYS B CA    1 
ATOM   4347 C  C     . LYS B 2 32  ? 23.421 19.363  -18.567 1.00 47.66  ? 20   LYS B C     1 
ATOM   4348 O  O     . LYS B 2 32  ? 23.891 19.530  -19.693 1.00 49.08  ? 20   LYS B O     1 
ATOM   4349 C  CB    . LYS B 2 32  ? 22.037 17.488  -19.539 1.00 42.15  ? 20   LYS B CB    1 
ATOM   4350 C  CG    . LYS B 2 32  ? 21.158 16.269  -19.272 1.00 45.21  ? 20   LYS B CG    1 
ATOM   4351 C  CD    . LYS B 2 32  ? 20.957 15.424  -20.519 1.00 46.08  ? 20   LYS B CD    1 
ATOM   4352 C  CE    . LYS B 2 32  ? 20.153 14.166  -20.206 1.00 50.68  ? 20   LYS B CE    1 
ATOM   4353 N  NZ    . LYS B 2 32  ? 20.050 13.241  -21.370 1.00 52.71  ? 20   LYS B NZ    1 
ATOM   4354 N  N     . VAL B 2 33  ? 23.749 20.152  -17.545 1.00 48.04  ? 21   VAL B N     1 
ATOM   4355 C  CA    . VAL B 2 33  ? 24.594 21.332  -17.702 1.00 47.46  ? 21   VAL B CA    1 
ATOM   4356 C  C     . VAL B 2 33  ? 26.040 20.975  -17.380 1.00 46.91  ? 21   VAL B C     1 
ATOM   4357 O  O     . VAL B 2 33  ? 26.328 20.397  -16.326 1.00 45.04  ? 21   VAL B O     1 
ATOM   4358 C  CB    . VAL B 2 33  ? 24.102 22.477  -16.805 1.00 44.29  ? 21   VAL B CB    1 
ATOM   4359 C  CG1   . VAL B 2 33  ? 24.884 23.740  -17.100 1.00 43.14  ? 21   VAL B CG1   1 
ATOM   4360 C  CG2   . VAL B 2 33  ? 22.605 22.692  -17.003 1.00 45.58  ? 21   VAL B CG2   1 
ATOM   4361 N  N     . LYS B 2 34  ? 26.954 21.334  -18.280 1.00 50.63  ? 22   LYS B N     1 
ATOM   4362 C  CA    . LYS B 2 34  ? 28.363 21.022  -18.084 1.00 53.28  ? 22   LYS B CA    1 
ATOM   4363 C  C     . LYS B 2 34  ? 28.981 21.916  -17.013 1.00 52.37  ? 22   LYS B C     1 
ATOM   4364 O  O     . LYS B 2 34  ? 28.581 23.067  -16.821 1.00 58.98  ? 22   LYS B O     1 
ATOM   4365 C  CB    . LYS B 2 34  ? 29.132 21.170  -19.398 1.00 56.61  ? 22   LYS B CB    1 
ATOM   4366 C  CG    . LYS B 2 34  ? 28.621 20.269  -20.512 1.00 63.00  ? 22   LYS B CG    1 
ATOM   4367 C  CD    . LYS B 2 34  ? 29.413 20.447  -21.797 1.00 67.26  ? 22   LYS B CD    1 
ATOM   4368 C  CE    . LYS B 2 34  ? 30.813 19.868  -21.675 1.00 70.96  ? 22   LYS B CE    1 
ATOM   4369 N  NZ    . LYS B 2 34  ? 31.530 19.880  -22.984 1.00 75.60  ? 22   LYS B NZ    1 
ATOM   4370 N  N     . GLN B 2 35  ? 29.968 21.365  -16.309 1.00 47.15  ? 23   GLN B N     1 
ATOM   4371 C  CA    . GLN B 2 35  ? 30.670 22.094  -15.261 1.00 43.82  ? 23   GLN B CA    1 
ATOM   4372 C  C     . GLN B 2 35  ? 31.700 23.041  -15.866 1.00 43.70  ? 23   GLN B C     1 
ATOM   4373 O  O     . GLN B 2 35  ? 32.421 22.683  -16.802 1.00 45.91  ? 23   GLN B O     1 
ATOM   4374 C  CB    . GLN B 2 35  ? 31.355 21.111  -14.309 1.00 41.22  ? 23   GLN B CB    1 
ATOM   4375 C  CG    . GLN B 2 35  ? 32.370 21.732  -13.359 1.00 39.51  ? 23   GLN B CG    1 
ATOM   4376 C  CD    . GLN B 2 35  ? 31.722 22.496  -12.223 1.00 40.80  ? 23   GLN B CD    1 
ATOM   4377 O  OE1   . GLN B 2 35  ? 30.705 22.073  -11.674 1.00 39.92  ? 23   GLN B OE1   1 
ATOM   4378 N  NE2   . GLN B 2 35  ? 32.310 23.632  -11.864 1.00 44.44  ? 23   GLN B NE2   1 
ATOM   4379 N  N     . TRP B 2 36  ? 31.771 24.259  -15.323 1.00 41.45  ? 24   TRP B N     1 
ATOM   4380 C  CA    . TRP B 2 36  ? 32.730 25.221  -15.844 1.00 43.02  ? 24   TRP B CA    1 
ATOM   4381 C  C     . TRP B 2 36  ? 34.024 25.176  -15.039 1.00 41.89  ? 24   TRP B C     1 
ATOM   4382 O  O     . TRP B 2 36  ? 34.059 24.638  -13.928 1.00 37.67  ? 24   TRP B O     1 
ATOM   4383 C  CB    . TRP B 2 36  ? 32.127 26.630  -15.833 1.00 41.51  ? 24   TRP B CB    1 
ATOM   4384 C  CG    . TRP B 2 36  ? 31.698 27.144  -14.493 1.00 42.62  ? 24   TRP B CG    1 
ATOM   4385 C  CD1   . TRP B 2 36  ? 32.506 27.492  -13.447 1.00 45.08  ? 24   TRP B CD1   1 
ATOM   4386 C  CD2   . TRP B 2 36  ? 30.355 27.410  -14.069 1.00 43.33  ? 24   TRP B CD2   1 
ATOM   4387 N  NE1   . TRP B 2 36  ? 31.747 27.937  -12.390 1.00 46.82  ? 24   TRP B NE1   1 
ATOM   4388 C  CE2   . TRP B 2 36  ? 30.424 27.899  -12.746 1.00 44.01  ? 24   TRP B CE2   1 
ATOM   4389 C  CE3   . TRP B 2 36  ? 29.102 27.277  -14.675 1.00 40.75  ? 24   TRP B CE3   1 
ATOM   4390 C  CZ2   . TRP B 2 36  ? 29.286 28.252  -12.019 1.00 39.36  ? 24   TRP B CZ2   1 
ATOM   4391 C  CZ3   . TRP B 2 36  ? 27.972 27.630  -13.951 1.00 40.85  ? 24   TRP B CZ3   1 
ATOM   4392 C  CH2   . TRP B 2 36  ? 28.073 28.111  -12.637 1.00 39.49  ? 24   TRP B CH2   1 
ATOM   4393 N  N     . PRO B 2 37  ? 35.120 25.712  -15.584 1.00 43.06  ? 25   PRO B N     1 
ATOM   4394 C  CA    . PRO B 2 37  ? 36.403 25.647  -14.869 1.00 45.79  ? 25   PRO B CA    1 
ATOM   4395 C  C     . PRO B 2 37  ? 36.357 26.371  -13.531 1.00 48.22  ? 25   PRO B C     1 
ATOM   4396 O  O     . PRO B 2 37  ? 35.754 27.438  -13.397 1.00 51.81  ? 25   PRO B O     1 
ATOM   4397 C  CB    . PRO B 2 37  ? 37.378 26.324  -15.836 1.00 40.19  ? 25   PRO B CB    1 
ATOM   4398 C  CG    . PRO B 2 37  ? 36.750 26.173  -17.174 1.00 40.66  ? 25   PRO B CG    1 
ATOM   4399 C  CD    . PRO B 2 37  ? 35.279 26.248  -16.947 1.00 38.86  ? 25   PRO B CD    1 
ATOM   4400 N  N     . LEU B 2 38  ? 37.011 25.779  -12.535 1.00 45.46  ? 26   LEU B N     1 
ATOM   4401 C  CA    . LEU B 2 38  ? 37.103 26.349  -11.201 1.00 43.58  ? 26   LEU B CA    1 
ATOM   4402 C  C     . LEU B 2 38  ? 38.562 26.591  -10.841 1.00 44.57  ? 26   LEU B C     1 
ATOM   4403 O  O     . LEU B 2 38  ? 39.459 25.887  -11.314 1.00 46.89  ? 26   LEU B O     1 
ATOM   4404 C  CB    . LEU B 2 38  ? 36.467 25.433  -10.153 1.00 41.92  ? 26   LEU B CB    1 
ATOM   4405 C  CG    . LEU B 2 38  ? 34.980 25.125  -10.307 1.00 40.93  ? 26   LEU B CG    1 
ATOM   4406 C  CD1   . LEU B 2 38  ? 34.527 24.184  -9.202  1.00 37.74  ? 26   LEU B CD1   1 
ATOM   4407 C  CD2   . LEU B 2 38  ? 34.167 26.404  -10.298 1.00 40.46  ? 26   LEU B CD2   1 
ATOM   4408 N  N     . THR B 2 39  ? 38.791 27.594  -9.997  1.00 41.58  ? 27   THR B N     1 
ATOM   4409 C  CA    . THR B 2 39  ? 40.135 27.879  -9.523  1.00 44.15  ? 27   THR B CA    1 
ATOM   4410 C  C     . THR B 2 39  ? 40.554 26.851  -8.475  1.00 42.28  ? 27   THR B C     1 
ATOM   4411 O  O     . THR B 2 39  ? 39.743 26.075  -7.963  1.00 40.74  ? 27   THR B O     1 
ATOM   4412 C  CB    . THR B 2 39  ? 40.221 29.290  -8.942  1.00 45.62  ? 27   THR B CB    1 
ATOM   4413 O  OG1   . THR B 2 39  ? 39.153 29.489  -8.008  1.00 43.85  ? 27   THR B OG1   1 
ATOM   4414 C  CG2   . THR B 2 39  ? 40.131 30.332  -10.048 1.00 44.62  ? 27   THR B CG2   1 
ATOM   4415 N  N     . GLU B 2 40  ? 41.849 26.866  -8.150  1.00 44.56  ? 28   GLU B N     1 
ATOM   4416 C  CA    . GLU B 2 40  ? 42.399 25.872  -7.234  1.00 52.76  ? 28   GLU B CA    1 
ATOM   4417 C  C     . GLU B 2 40  ? 41.785 25.989  -5.843  1.00 54.06  ? 28   GLU B C     1 
ATOM   4418 O  O     . GLU B 2 40  ? 41.449 24.974  -5.220  1.00 55.62  ? 28   GLU B O     1 
ATOM   4419 C  CB    . GLU B 2 40  ? 43.920 26.011  -7.169  1.00 55.26  ? 28   GLU B CB    1 
ATOM   4420 C  CG    . GLU B 2 40  ? 44.605 24.967  -6.304  1.00 59.99  ? 28   GLU B CG    1 
ATOM   4421 C  CD    . GLU B 2 40  ? 46.110 24.954  -6.485  1.00 66.69  ? 28   GLU B CD    1 
ATOM   4422 O  OE1   . GLU B 2 40  ? 46.774 24.083  -5.886  1.00 70.73  ? 28   GLU B OE1   1 
ATOM   4423 O  OE2   . GLU B 2 40  ? 46.630 25.812  -7.229  1.00 70.95  ? 28   GLU B OE2   1 
ATOM   4424 N  N     . GLU B 2 41  ? 41.625 27.217  -5.339  1.00 55.20  ? 29   GLU B N     1 
ATOM   4425 C  CA    . GLU B 2 41  ? 41.075 27.395  -3.998  1.00 57.29  ? 29   GLU B CA    1 
ATOM   4426 C  C     . GLU B 2 41  ? 39.631 26.912  -3.922  1.00 52.77  ? 29   GLU B C     1 
ATOM   4427 O  O     . GLU B 2 41  ? 39.235 26.269  -2.941  1.00 54.63  ? 29   GLU B O     1 
ATOM   4428 C  CB    . GLU B 2 41  ? 41.181 28.861  -3.571  1.00 64.69  ? 29   GLU B CB    1 
ATOM   4429 C  CG    . GLU B 2 41  ? 40.538 29.843  -4.536  1.00 72.65  ? 29   GLU B CG    1 
ATOM   4430 C  CD    . GLU B 2 41  ? 40.544 31.268  -4.018  1.00 80.05  ? 29   GLU B CD    1 
ATOM   4431 O  OE1   . GLU B 2 41  ? 41.194 31.529  -2.983  1.00 83.57  ? 29   GLU B OE1   1 
ATOM   4432 O  OE2   . GLU B 2 41  ? 39.893 32.128  -4.649  1.00 81.01  ? 29   GLU B OE2   1 
ATOM   4433 N  N     . LYS B 2 42  ? 38.833 27.200  -4.952  1.00 48.74  ? 30   LYS B N     1 
ATOM   4434 C  CA    . LYS B 2 42  ? 37.456 26.720  -4.966  1.00 48.37  ? 30   LYS B CA    1 
ATOM   4435 C  C     . LYS B 2 42  ? 37.405 25.199  -5.022  1.00 46.77  ? 30   LYS B C     1 
ATOM   4436 O  O     . LYS B 2 42  ? 36.589 24.573  -4.336  1.00 46.24  ? 30   LYS B O     1 
ATOM   4437 C  CB    . LYS B 2 42  ? 36.692 27.324  -6.145  1.00 49.01  ? 30   LYS B CB    1 
ATOM   4438 C  CG    . LYS B 2 42  ? 36.504 28.832  -6.066  1.00 51.31  ? 30   LYS B CG    1 
ATOM   4439 C  CD    . LYS B 2 42  ? 35.322 29.272  -6.917  1.00 53.21  ? 30   LYS B CD    1 
ATOM   4440 C  CE    . LYS B 2 42  ? 35.131 30.778  -6.880  1.00 58.22  ? 30   LYS B CE    1 
ATOM   4441 N  NZ    . LYS B 2 42  ? 36.241 31.491  -7.569  1.00 64.39  ? 30   LYS B NZ    1 
ATOM   4442 N  N     . ILE B 2 43  ? 38.277 24.584  -5.824  1.00 45.93  ? 31   ILE B N     1 
ATOM   4443 C  CA    . ILE B 2 43  ? 38.280 23.127  -5.923  1.00 45.80  ? 31   ILE B CA    1 
ATOM   4444 C  C     . ILE B 2 43  ? 38.672 22.501  -4.591  1.00 47.18  ? 31   ILE B C     1 
ATOM   4445 O  O     . ILE B 2 43  ? 38.086 21.501  -4.167  1.00 47.91  ? 31   ILE B O     1 
ATOM   4446 C  CB    . ILE B 2 43  ? 39.203 22.662  -7.064  1.00 45.15  ? 31   ILE B CB    1 
ATOM   4447 C  CG1   . ILE B 2 43  ? 38.623 23.081  -8.415  1.00 41.16  ? 31   ILE B CG1   1 
ATOM   4448 C  CG2   . ILE B 2 43  ? 39.407 21.148  -7.009  1.00 41.57  ? 31   ILE B CG2   1 
ATOM   4449 C  CD1   . ILE B 2 43  ? 39.506 22.735  -9.588  1.00 41.08  ? 31   ILE B CD1   1 
ATOM   4450 N  N     . LYS B 2 44  ? 39.659 23.083  -3.903  1.00 47.23  ? 32   LYS B N     1 
ATOM   4451 C  CA    . LYS B 2 44  ? 40.070 22.535  -2.613  1.00 46.85  ? 32   LYS B CA    1 
ATOM   4452 C  C     . LYS B 2 44  ? 38.969 22.685  -1.569  1.00 49.40  ? 32   LYS B C     1 
ATOM   4453 O  O     . LYS B 2 44  ? 38.695 21.749  -0.801  1.00 55.35  ? 32   LYS B O     1 
ATOM   4454 C  CB    . LYS B 2 44  ? 41.355 23.211  -2.140  1.00 48.54  ? 32   LYS B CB    1 
ATOM   4455 C  CG    . LYS B 2 44  ? 42.579 22.862  -2.966  1.00 52.18  ? 32   LYS B CG    1 
ATOM   4456 C  CD    . LYS B 2 44  ? 43.828 23.523  -2.402  1.00 60.42  ? 32   LYS B CD    1 
ATOM   4457 C  CE    . LYS B 2 44  ? 45.070 23.113  -3.180  1.00 65.69  ? 32   LYS B CE    1 
ATOM   4458 N  NZ    . LYS B 2 44  ? 46.309 23.732  -2.628  1.00 71.94  ? 32   LYS B NZ    1 
ATOM   4459 N  N     . ALA B 2 45  ? 38.326 23.857  -1.526  1.00 46.41  ? 33   ALA B N     1 
ATOM   4460 C  CA    . ALA B 2 45  ? 37.203 24.050  -0.616  1.00 47.26  ? 33   ALA B CA    1 
ATOM   4461 C  C     . ALA B 2 45  ? 36.087 23.052  -0.900  1.00 47.14  ? 33   ALA B C     1 
ATOM   4462 O  O     . ALA B 2 45  ? 35.507 22.475  0.029   1.00 49.89  ? 33   ALA B O     1 
ATOM   4463 C  CB    . ALA B 2 45  ? 36.685 25.484  -0.719  1.00 44.07  ? 33   ALA B CB    1 
ATOM   4464 N  N     . LEU B 2 46  ? 35.780 22.826  -2.182  1.00 44.77  ? 34   LEU B N     1 
ATOM   4465 C  CA    . LEU B 2 46  ? 34.731 21.877  -2.537  1.00 43.64  ? 34   LEU B CA    1 
ATOM   4466 C  C     . LEU B 2 46  ? 35.123 20.452  -2.168  1.00 47.81  ? 34   LEU B C     1 
ATOM   4467 O  O     . LEU B 2 46  ? 34.278 19.675  -1.717  1.00 48.60  ? 34   LEU B O     1 
ATOM   4468 C  CB    . LEU B 2 46  ? 34.408 21.976  -4.027  1.00 38.98  ? 34   LEU B CB    1 
ATOM   4469 C  CG    . LEU B 2 46  ? 33.592 23.206  -4.427  1.00 40.03  ? 34   LEU B CG    1 
ATOM   4470 C  CD1   . LEU B 2 46  ? 33.332 23.236  -5.922  1.00 37.92  ? 34   LEU B CD1   1 
ATOM   4471 C  CD2   . LEU B 2 46  ? 32.285 23.244  -3.656  1.00 38.58  ? 34   LEU B CD2   1 
ATOM   4472 N  N     . VAL B 2 47  ? 36.395 20.091  -2.346  1.00 49.43  ? 35   VAL B N     1 
ATOM   4473 C  CA    . VAL B 2 47  ? 36.833 18.746  -1.990  1.00 54.54  ? 35   VAL B CA    1 
ATOM   4474 C  C     . VAL B 2 47  ? 36.677 18.516  -0.493  1.00 57.77  ? 35   VAL B C     1 
ATOM   4475 O  O     . VAL B 2 47  ? 36.171 17.473  -0.062  1.00 60.20  ? 35   VAL B O     1 
ATOM   4476 C  CB    . VAL B 2 47  ? 38.281 18.505  -2.460  1.00 52.27  ? 35   VAL B CB    1 
ATOM   4477 C  CG1   . VAL B 2 47  ? 38.861 17.267  -1.795  1.00 51.65  ? 35   VAL B CG1   1 
ATOM   4478 C  CG2   . VAL B 2 47  ? 38.325 18.346  -3.970  1.00 43.79  ? 35   VAL B CG2   1 
ATOM   4479 N  N     . GLU B 2 48  ? 37.071 19.497  0.324   1.00 58.06  ? 36   GLU B N     1 
ATOM   4480 C  CA    . GLU B 2 48  ? 36.917 19.340  1.770   1.00 60.52  ? 36   GLU B CA    1 
ATOM   4481 C  C     . GLU B 2 48  ? 35.443 19.265  2.169   1.00 57.53  ? 36   GLU B C     1 
ATOM   4482 O  O     . GLU B 2 48  ? 35.036 18.380  2.942   1.00 59.85  ? 36   GLU B O     1 
ATOM   4483 C  CB    . GLU B 2 48  ? 37.611 20.484  2.508   1.00 65.82  ? 36   GLU B CB    1 
ATOM   4484 C  CG    . GLU B 2 48  ? 37.592 20.309  4.018   1.00 74.57  ? 36   GLU B CG    1 
ATOM   4485 C  CD    . GLU B 2 48  ? 37.835 21.600  4.768   1.00 81.05  ? 36   GLU B CD    1 
ATOM   4486 O  OE1   . GLU B 2 48  ? 38.379 22.549  4.164   1.00 81.96  ? 36   GLU B OE1   1 
ATOM   4487 O  OE2   . GLU B 2 48  ? 37.475 21.666  5.963   1.00 84.48  ? 36   GLU B OE2   1 
ATOM   4488 N  N     . ILE B 2 49  ? 34.629 20.195  1.657   1.00 52.50  ? 37   ILE B N     1 
ATOM   4489 C  CA    . ILE B 2 49  ? 33.210 20.217  1.999   1.00 51.31  ? 37   ILE B CA    1 
ATOM   4490 C  C     . ILE B 2 49  ? 32.539 18.911  1.593   1.00 51.02  ? 37   ILE B C     1 
ATOM   4491 O  O     . ILE B 2 49  ? 31.753 18.337  2.357   1.00 52.62  ? 37   ILE B O     1 
ATOM   4492 C  CB    . ILE B 2 49  ? 32.524 21.433  1.348   1.00 47.34  ? 37   ILE B CB    1 
ATOM   4493 C  CG1   . ILE B 2 49  ? 32.974 22.727  2.031   1.00 47.29  ? 37   ILE B CG1   1 
ATOM   4494 C  CG2   . ILE B 2 49  ? 31.008 21.287  1.399   1.00 42.44  ? 37   ILE B CG2   1 
ATOM   4495 C  CD1   . ILE B 2 49  ? 32.527 23.985  1.308   1.00 45.94  ? 37   ILE B CD1   1 
ATOM   4496 N  N     . CYS B 2 50  ? 32.846 18.412  0.395   1.00 47.45  ? 38   CYS B N     1 
ATOM   4497 C  CA    . CYS B 2 50  ? 32.219 17.186  -0.073  1.00 49.65  ? 38   CYS B CA    1 
ATOM   4498 C  C     . CYS B 2 50  ? 32.727 15.965  0.681   1.00 52.14  ? 38   CYS B C     1 
ATOM   4499 O  O     . CYS B 2 50  ? 31.966 15.017  0.885   1.00 52.45  ? 38   CYS B O     1 
ATOM   4500 C  CB    . CYS B 2 50  ? 32.436 17.030  -1.576  1.00 50.12  ? 38   CYS B CB    1 
ATOM   4501 S  SG    . CYS B 2 50  ? 31.469 18.205  -2.558  1.00 52.58  ? 38   CYS B SG    1 
ATOM   4502 N  N     . THR B 2 51  ? 33.990 15.966  1.116   1.00 52.32  ? 39   THR B N     1 
ATOM   4503 C  CA    . THR B 2 51  ? 34.462 14.891  1.982   1.00 53.34  ? 39   THR B CA    1 
ATOM   4504 C  C     . THR B 2 51  ? 33.641 14.837  3.264   1.00 58.83  ? 39   THR B C     1 
ATOM   4505 O  O     . THR B 2 51  ? 33.191 13.764  3.688   1.00 61.24  ? 39   THR B O     1 
ATOM   4506 C  CB    . THR B 2 51  ? 35.947 15.079  2.299   1.00 52.52  ? 39   THR B CB    1 
ATOM   4507 O  OG1   . THR B 2 51  ? 36.721 14.896  1.107   1.00 52.37  ? 39   THR B OG1   1 
ATOM   4508 C  CG2   . THR B 2 51  ? 36.402 14.076  3.347   1.00 55.51  ? 39   THR B CG2   1 
ATOM   4509 N  N     . GLU B 2 52  ? 33.418 15.998  3.886   1.00 60.65  ? 40   GLU B N     1 
ATOM   4510 C  CA    . GLU B 2 52  ? 32.608 16.029  5.103   1.00 60.31  ? 40   GLU B CA    1 
ATOM   4511 C  C     . GLU B 2 52  ? 31.175 15.577  4.828   1.00 62.30  ? 40   GLU B C     1 
ATOM   4512 O  O     . GLU B 2 52  ? 30.607 14.773  5.579   1.00 66.92  ? 40   GLU B O     1 
ATOM   4513 C  CB    . GLU B 2 52  ? 32.625 17.430  5.713   1.00 57.18  ? 40   GLU B CB    1 
ATOM   4514 N  N     . MET B 2 53  ? 30.576 16.080  3.743   1.00 59.05  ? 41   MET B N     1 
ATOM   4515 C  CA    . MET B 2 53  ? 29.188 15.743  3.435   1.00 58.73  ? 41   MET B CA    1 
ATOM   4516 C  C     . MET B 2 53  ? 29.030 14.258  3.128   1.00 58.54  ? 41   MET B C     1 
ATOM   4517 O  O     . MET B 2 53  ? 28.024 13.642  3.498   1.00 59.35  ? 41   MET B O     1 
ATOM   4518 C  CB    . MET B 2 53  ? 28.687 16.584  2.261   1.00 57.04  ? 41   MET B CB    1 
ATOM   4519 C  CG    . MET B 2 53  ? 28.588 18.076  2.551   1.00 57.60  ? 41   MET B CG    1 
ATOM   4520 S  SD    . MET B 2 53  ? 27.836 18.990  1.190   1.00 57.74  ? 41   MET B SD    1 
ATOM   4521 C  CE    . MET B 2 53  ? 26.129 18.472  1.341   1.00 59.60  ? 41   MET B CE    1 
ATOM   4522 N  N     . GLU B 2 54  ? 30.012 13.668  2.448   1.00 57.17  ? 42   GLU B N     1 
ATOM   4523 C  CA    . GLU B 2 54  ? 29.969 12.242  2.163   1.00 57.24  ? 42   GLU B CA    1 
ATOM   4524 C  C     . GLU B 2 54  ? 30.153 11.423  3.435   1.00 61.54  ? 42   GLU B C     1 
ATOM   4525 O  O     . GLU B 2 54  ? 29.459 10.420  3.638   1.00 61.95  ? 42   GLU B O     1 
ATOM   4526 C  CB    . GLU B 2 54  ? 31.037 11.898  1.125   1.00 58.52  ? 42   GLU B CB    1 
ATOM   4527 C  CG    . GLU B 2 54  ? 31.272 10.416  0.914   1.00 63.60  ? 42   GLU B CG    1 
ATOM   4528 C  CD    . GLU B 2 54  ? 32.513 10.149  0.089   1.00 65.60  ? 42   GLU B CD    1 
ATOM   4529 O  OE1   . GLU B 2 54  ? 32.378 9.840   -1.112  1.00 66.75  ? 42   GLU B OE1   1 
ATOM   4530 O  OE2   . GLU B 2 54  ? 33.627 10.268  0.638   1.00 68.13  ? 42   GLU B OE2   1 
ATOM   4531 N  N     . LYS B 2 55  ? 31.069 11.842  4.315   1.00 62.40  ? 43   LYS B N     1 
ATOM   4532 C  CA    . LYS B 2 55  ? 31.243 11.138  5.579   1.00 60.63  ? 43   LYS B CA    1 
ATOM   4533 C  C     . LYS B 2 55  ? 30.033 11.280  6.492   1.00 63.90  ? 43   LYS B C     1 
ATOM   4534 O  O     . LYS B 2 55  ? 29.875 10.477  7.416   1.00 68.09  ? 43   LYS B O     1 
ATOM   4535 C  CB    . LYS B 2 55  ? 32.495 11.641  6.301   1.00 59.87  ? 43   LYS B CB    1 
ATOM   4536 N  N     . GLU B 2 56  ? 29.182 12.279  6.261   1.00 64.90  ? 44   GLU B N     1 
ATOM   4537 C  CA    . GLU B 2 56  ? 27.983 12.471  7.067   1.00 67.58  ? 44   GLU B CA    1 
ATOM   4538 C  C     . GLU B 2 56  ? 26.716 11.946  6.401   1.00 65.02  ? 44   GLU B C     1 
ATOM   4539 O  O     . GLU B 2 56  ? 25.629 12.099  6.967   1.00 64.88  ? 44   GLU B O     1 
ATOM   4540 C  CB    . GLU B 2 56  ? 27.813 13.955  7.410   1.00 71.31  ? 44   GLU B CB    1 
ATOM   4541 C  CG    . GLU B 2 56  ? 28.842 14.468  8.402   1.00 79.27  ? 44   GLU B CG    1 
ATOM   4542 C  CD    . GLU B 2 56  ? 28.841 15.977  8.521   1.00 84.27  ? 44   GLU B CD    1 
ATOM   4543 O  OE1   . GLU B 2 56  ? 28.334 16.647  7.597   1.00 84.49  ? 44   GLU B OE1   1 
ATOM   4544 O  OE2   . GLU B 2 56  ? 29.348 16.493  9.539   1.00 88.85  ? 44   GLU B OE2   1 
ATOM   4545 N  N     . GLY B 2 57  ? 26.826 11.330  5.225   1.00 60.22  ? 45   GLY B N     1 
ATOM   4546 C  CA    . GLY B 2 57  ? 25.673 10.770  4.549   1.00 60.43  ? 45   GLY B CA    1 
ATOM   4547 C  C     . GLY B 2 57  ? 24.854 11.743  3.730   1.00 61.23  ? 45   GLY B C     1 
ATOM   4548 O  O     . GLY B 2 57  ? 23.803 11.354  3.209   1.00 62.19  ? 45   GLY B O     1 
ATOM   4549 N  N     . LYS B 2 58  ? 25.298 12.995  3.590   1.00 55.98  ? 46   LYS B N     1 
ATOM   4550 C  CA    . LYS B 2 58  ? 24.508 13.975  2.851   1.00 54.26  ? 46   LYS B CA    1 
ATOM   4551 C  C     . LYS B 2 58  ? 24.576 13.742  1.346   1.00 52.80  ? 46   LYS B C     1 
ATOM   4552 O  O     . LYS B 2 58  ? 23.605 14.023  0.634   1.00 54.01  ? 46   LYS B O     1 
ATOM   4553 C  CB    . LYS B 2 58  ? 24.970 15.394  3.191   1.00 52.39  ? 46   LYS B CB    1 
ATOM   4554 C  CG    . LYS B 2 58  ? 24.322 15.998  4.434   1.00 56.64  ? 46   LYS B CG    1 
ATOM   4555 C  CD    . LYS B 2 58  ? 24.825 15.360  5.720   1.00 59.36  ? 46   LYS B CD    1 
ATOM   4556 N  N     . ILE B 2 59  ? 25.704 13.239  0.841   1.00 49.29  ? 47   ILE B N     1 
ATOM   4557 C  CA    . ILE B 2 59  ? 25.886 12.984  -0.582  1.00 47.66  ? 47   ILE B CA    1 
ATOM   4558 C  C     . ILE B 2 59  ? 26.563 11.632  -0.764  1.00 51.05  ? 47   ILE B C     1 
ATOM   4559 O  O     . ILE B 2 59  ? 27.172 11.084  0.157   1.00 54.75  ? 47   ILE B O     1 
ATOM   4560 C  CB    . ILE B 2 59  ? 26.715 14.088  -1.277  1.00 45.07  ? 47   ILE B CB    1 
ATOM   4561 C  CG1   . ILE B 2 59  ? 28.079 14.234  -0.600  1.00 44.37  ? 47   ILE B CG1   1 
ATOM   4562 C  CG2   . ILE B 2 59  ? 25.958 15.411  -1.283  1.00 46.68  ? 47   ILE B CG2   1 
ATOM   4563 C  CD1   . ILE B 2 59  ? 29.018 15.183  -1.308  1.00 41.67  ? 47   ILE B CD1   1 
ATOM   4564 N  N     . SER B 2 60  ? 26.453 11.097  -1.979  1.00 50.18  ? 48   SER B N     1 
ATOM   4565 C  CA    . SER B 2 60  ? 27.044 9.810   -2.319  1.00 50.99  ? 48   SER B CA    1 
ATOM   4566 C  C     . SER B 2 60  ? 27.705 9.880   -3.686  1.00 49.73  ? 48   SER B C     1 
ATOM   4567 O  O     . SER B 2 60  ? 27.184 10.518  -4.604  1.00 48.70  ? 48   SER B O     1 
ATOM   4568 C  CB    . SER B 2 60  ? 25.997 8.687   -2.313  1.00 53.06  ? 48   SER B CB    1 
ATOM   4569 O  OG    . SER B 2 60  ? 25.675 8.289   -0.992  1.00 54.85  ? 48   SER B OG    1 
ATOM   4570 N  N     . LYS B 2 61  ? 28.852 9.212   -3.813  1.00 52.55  ? 49   LYS B N     1 
ATOM   4571 C  CA    . LYS B 2 61  ? 29.517 9.098   -5.105  1.00 49.93  ? 49   LYS B CA    1 
ATOM   4572 C  C     . LYS B 2 61  ? 28.641 8.331   -6.088  1.00 50.55  ? 49   LYS B C     1 
ATOM   4573 O  O     . LYS B 2 61  ? 27.969 7.362   -5.723  1.00 48.35  ? 49   LYS B O     1 
ATOM   4574 C  CB    . LYS B 2 61  ? 30.865 8.390   -4.953  1.00 45.51  ? 49   LYS B CB    1 
ATOM   4575 C  CG    . LYS B 2 61  ? 31.965 9.234   -4.335  1.00 45.87  ? 49   LYS B CG    1 
ATOM   4576 C  CD    . LYS B 2 61  ? 33.274 8.455   -4.290  1.00 48.27  ? 49   LYS B CD    1 
ATOM   4577 C  CE    . LYS B 2 61  ? 34.450 9.346   -3.914  1.00 49.07  ? 49   LYS B CE    1 
ATOM   4578 N  NZ    . LYS B 2 61  ? 34.315 9.915   -2.547  1.00 50.51  ? 49   LYS B NZ    1 
ATOM   4579 N  N     . ILE B 2 62  ? 28.648 8.775   -7.345  1.00 51.97  ? 50   ILE B N     1 
ATOM   4580 C  CA    . ILE B 2 62  ? 27.884 8.143   -8.412  1.00 52.42  ? 50   ILE B CA    1 
ATOM   4581 C  C     . ILE B 2 62  ? 28.774 8.010   -9.640  1.00 49.00  ? 50   ILE B C     1 
ATOM   4582 O  O     . ILE B 2 62  ? 29.904 8.497   -9.676  1.00 48.75  ? 50   ILE B O     1 
ATOM   4583 C  CB    . ILE B 2 62  ? 26.602 8.924   -8.766  1.00 52.65  ? 50   ILE B CB    1 
ATOM   4584 C  CG1   . ILE B 2 62  ? 26.955 10.339  -9.219  1.00 52.58  ? 50   ILE B CG1   1 
ATOM   4585 C  CG2   . ILE B 2 62  ? 25.646 8.950   -7.590  1.00 52.65  ? 50   ILE B CG2   1 
ATOM   4586 C  CD1   . ILE B 2 62  ? 25.755 11.155  -9.608  1.00 55.08  ? 50   ILE B CD1   1 
ATOM   4587 N  N     . GLY B 2 63  ? 28.234 7.352   -10.663 1.00 48.54  ? 51   GLY B N     1 
ATOM   4588 C  CA    . GLY B 2 63  ? 28.983 7.066   -11.862 1.00 49.21  ? 51   GLY B CA    1 
ATOM   4589 C  C     . GLY B 2 63  ? 28.415 7.735   -13.097 1.00 48.23  ? 51   GLY B C     1 
ATOM   4590 O  O     . GLY B 2 63  ? 27.531 8.595   -13.023 1.00 45.67  ? 51   GLY B O     1 
ATOM   4591 N  N     . PRO B 2 64  ? 28.922 7.342   -14.269 1.00 48.18  ? 52   PRO B N     1 
ATOM   4592 C  CA    . PRO B 2 64  ? 28.476 7.972   -15.518 1.00 47.98  ? 52   PRO B CA    1 
ATOM   4593 C  C     . PRO B 2 64  ? 27.155 7.442   -16.052 1.00 51.56  ? 52   PRO B C     1 
ATOM   4594 O  O     . PRO B 2 64  ? 26.608 8.044   -16.986 1.00 53.36  ? 52   PRO B O     1 
ATOM   4595 C  CB    . PRO B 2 64  ? 29.624 7.659   -16.486 1.00 47.80  ? 52   PRO B CB    1 
ATOM   4596 C  CG    . PRO B 2 64  ? 30.162 6.364   -15.999 1.00 46.71  ? 52   PRO B CG    1 
ATOM   4597 C  CD    . PRO B 2 64  ? 30.009 6.373   -14.495 1.00 47.51  ? 52   PRO B CD    1 
ATOM   4598 N  N     . GLU B 2 65  ? 26.624 6.344   -15.506 1.00 52.19  ? 53   GLU B N     1 
ATOM   4599 C  CA    . GLU B 2 65  ? 25.324 5.858   -15.956 1.00 55.12  ? 53   GLU B CA    1 
ATOM   4600 C  C     . GLU B 2 65  ? 24.189 6.775   -15.524 1.00 52.31  ? 53   GLU B C     1 
ATOM   4601 O  O     . GLU B 2 65  ? 23.066 6.619   -16.017 1.00 52.72  ? 53   GLU B O     1 
ATOM   4602 C  CB    . GLU B 2 65  ? 25.075 4.437   -15.443 1.00 59.78  ? 53   GLU B CB    1 
ATOM   4603 C  CG    . GLU B 2 65  ? 24.619 4.351   -13.992 1.00 63.84  ? 53   GLU B CG    1 
ATOM   4604 C  CD    . GLU B 2 65  ? 25.744 4.568   -12.995 1.00 66.08  ? 53   GLU B CD    1 
ATOM   4605 O  OE1   . GLU B 2 65  ? 26.886 4.851   -13.418 1.00 65.36  ? 53   GLU B OE1   1 
ATOM   4606 O  OE2   . GLU B 2 65  ? 25.483 4.452   -11.780 1.00 68.08  ? 53   GLU B OE2   1 
ATOM   4607 N  N     . ASN B 2 66  ? 24.454 7.698   -14.607 1.00 49.28  ? 54   ASN B N     1 
ATOM   4608 C  CA    . ASN B 2 66  ? 23.564 8.823   -14.357 1.00 45.81  ? 54   ASN B CA    1 
ATOM   4609 C  C     . ASN B 2 66  ? 23.843 9.899   -15.401 1.00 56.62  ? 54   ASN B C     1 
ATOM   4610 O  O     . ASN B 2 66  ? 24.953 10.443  -15.429 1.00 53.68  ? 54   ASN B O     1 
ATOM   4611 C  CB    . ASN B 2 66  ? 23.790 9.362   -12.945 1.00 44.58  ? 54   ASN B CB    1 
ATOM   4612 C  CG    . ASN B 2 66  ? 22.862 10.518  -12.582 1.00 46.65  ? 54   ASN B CG    1 
ATOM   4613 O  OD1   . ASN B 2 66  ? 22.563 11.389  -13.401 1.00 47.43  ? 54   ASN B OD1   1 
ATOM   4614 N  ND2   . ASN B 2 66  ? 22.418 10.535  -11.332 1.00 47.19  ? 54   ASN B ND2   1 
ATOM   4615 N  N     . PRO B 2 67  ? 22.888 10.233  -16.266 1.00 55.53  ? 55   PRO B N     1 
ATOM   4616 C  CA    . PRO B 2 67  ? 23.145 11.194  -17.349 1.00 52.87  ? 55   PRO B CA    1 
ATOM   4617 C  C     . PRO B 2 67  ? 22.941 12.659  -16.988 1.00 49.26  ? 55   PRO B C     1 
ATOM   4618 O  O     . PRO B 2 67  ? 22.962 13.497  -17.893 1.00 51.04  ? 55   PRO B O     1 
ATOM   4619 C  CB    . PRO B 2 67  ? 22.119 10.766  -18.406 1.00 54.90  ? 55   PRO B CB    1 
ATOM   4620 C  CG    . PRO B 2 67  ? 20.958 10.293  -17.595 1.00 57.64  ? 55   PRO B CG    1 
ATOM   4621 C  CD    . PRO B 2 67  ? 21.544 9.635   -16.365 1.00 57.02  ? 55   PRO B CD    1 
ATOM   4622 N  N     . TYR B 2 68  ? 22.750 12.995  -15.718 1.00 48.22  ? 56   TYR B N     1 
ATOM   4623 C  CA    . TYR B 2 68  ? 22.432 14.355  -15.314 1.00 46.12  ? 56   TYR B CA    1 
ATOM   4624 C  C     . TYR B 2 68  ? 23.642 15.029  -14.680 1.00 44.14  ? 56   TYR B C     1 
ATOM   4625 O  O     . TYR B 2 68  ? 24.557 14.371  -14.177 1.00 44.80  ? 56   TYR B O     1 
ATOM   4626 C  CB    . TYR B 2 68  ? 21.249 14.365  -14.340 1.00 45.44  ? 56   TYR B CB    1 
ATOM   4627 C  CG    . TYR B 2 68  ? 20.064 13.578  -14.847 1.00 50.59  ? 56   TYR B CG    1 
ATOM   4628 C  CD1   . TYR B 2 68  ? 19.258 14.079  -15.861 1.00 51.03  ? 56   TYR B CD1   1 
ATOM   4629 C  CD2   . TYR B 2 68  ? 19.756 12.328  -14.322 1.00 52.48  ? 56   TYR B CD2   1 
ATOM   4630 C  CE1   . TYR B 2 68  ? 18.176 13.361  -16.334 1.00 53.26  ? 56   TYR B CE1   1 
ATOM   4631 C  CE2   . TYR B 2 68  ? 18.675 11.604  -14.787 1.00 53.16  ? 56   TYR B CE2   1 
ATOM   4632 C  CZ    . TYR B 2 68  ? 17.889 12.125  -15.793 1.00 55.61  ? 56   TYR B CZ    1 
ATOM   4633 O  OH    . TYR B 2 68  ? 16.812 11.408  -16.261 1.00 62.03  ? 56   TYR B OH    1 
ATOM   4634 N  N     . ASN B 2 69  ? 23.639 16.360  -14.714 1.00 43.72  ? 57   ASN B N     1 
ATOM   4635 C  CA    . ASN B 2 69  ? 24.716 17.121  -14.098 1.00 45.12  ? 57   ASN B CA    1 
ATOM   4636 C  C     . ASN B 2 69  ? 24.289 18.567  -13.907 1.00 49.25  ? 57   ASN B C     1 
ATOM   4637 O  O     . ASN B 2 69  ? 23.515 19.115  -14.697 1.00 52.70  ? 57   ASN B O     1 
ATOM   4638 C  CB    . ASN B 2 69  ? 25.996 17.063  -14.928 1.00 43.04  ? 57   ASN B CB    1 
ATOM   4639 C  CG    . ASN B 2 69  ? 27.196 17.595  -14.179 1.00 45.97  ? 57   ASN B CG    1 
ATOM   4640 O  OD1   . ASN B 2 69  ? 27.686 16.961  -13.246 1.00 46.41  ? 57   ASN B OD1   1 
ATOM   4641 N  ND2   . ASN B 2 69  ? 27.678 18.766  -14.582 1.00 47.62  ? 57   ASN B ND2   1 
ATOM   4642 N  N     . THR B 2 70  ? 24.826 19.181  -12.852 1.00 47.63  ? 58   THR B N     1 
ATOM   4643 C  CA    . THR B 2 70  ? 24.501 20.538  -12.464 1.00 50.48  ? 58   THR B CA    1 
ATOM   4644 C  C     . THR B 2 70  ? 25.785 21.186  -11.957 1.00 46.08  ? 58   THR B C     1 
ATOM   4645 O  O     . THR B 2 70  ? 26.474 20.600  -11.102 1.00 47.64  ? 58   THR B O     1 
ATOM   4646 C  CB    . THR B 2 70  ? 23.411 20.559  -11.389 1.00 52.87  ? 58   THR B CB    1 
ATOM   4647 O  OG1   . THR B 2 70  ? 22.137 20.305  -11.995 1.00 55.41  ? 58   THR B OG1   1 
ATOM   4648 C  CG2   . THR B 2 70  ? 23.374 21.893  -10.687 1.00 55.60  ? 58   THR B CG2   1 
ATOM   4649 N  N     . PRO B 2 71  ? 26.143 22.368  -12.456 1.00 39.52  ? 59   PRO B N     1 
ATOM   4650 C  CA    . PRO B 2 71  ? 27.435 22.958  -12.092 1.00 37.67  ? 59   PRO B CA    1 
ATOM   4651 C  C     . PRO B 2 71  ? 27.493 23.338  -10.623 1.00 35.93  ? 59   PRO B C     1 
ATOM   4652 O  O     . PRO B 2 71  ? 26.478 23.634  -9.988  1.00 40.11  ? 59   PRO B O     1 
ATOM   4653 C  CB    . PRO B 2 71  ? 27.530 24.195  -12.994 1.00 39.76  ? 59   PRO B CB    1 
ATOM   4654 C  CG    . PRO B 2 71  ? 26.123 24.526  -13.334 1.00 40.07  ? 59   PRO B CG    1 
ATOM   4655 C  CD    . PRO B 2 71  ? 25.384 23.221  -13.387 1.00 40.42  ? 59   PRO B CD    1 
ATOM   4656 N  N     . VAL B 2 72  ? 28.710 23.327  -10.084 1.00 35.78  ? 60   VAL B N     1 
ATOM   4657 C  CA    . VAL B 2 72  ? 28.946 23.594  -8.671  1.00 39.12  ? 60   VAL B CA    1 
ATOM   4658 C  C     . VAL B 2 72  ? 30.169 24.492  -8.545  1.00 40.96  ? 60   VAL B C     1 
ATOM   4659 O  O     . VAL B 2 72  ? 31.096 24.424  -9.357  1.00 42.26  ? 60   VAL B O     1 
ATOM   4660 C  CB    . VAL B 2 72  ? 29.136 22.280  -7.874  1.00 39.19  ? 60   VAL B CB    1 
ATOM   4661 C  CG1   . VAL B 2 72  ? 30.347 21.510  -8.387  1.00 38.23  ? 60   VAL B CG1   1 
ATOM   4662 C  CG2   . VAL B 2 72  ? 29.264 22.557  -6.389  1.00 42.30  ? 60   VAL B CG2   1 
ATOM   4663 N  N     . PHE B 2 73  ? 30.162 25.351  -7.528  1.00 43.62  ? 61   PHE B N     1 
ATOM   4664 C  CA    . PHE B 2 73  ? 31.338 26.151  -7.203  1.00 45.98  ? 61   PHE B CA    1 
ATOM   4665 C  C     . PHE B 2 73  ? 31.266 26.519  -5.725  1.00 44.91  ? 61   PHE B C     1 
ATOM   4666 O  O     . PHE B 2 73  ? 30.499 25.929  -4.961  1.00 42.46  ? 61   PHE B O     1 
ATOM   4667 C  CB    . PHE B 2 73  ? 31.456 27.370  -8.130  1.00 49.07  ? 61   PHE B CB    1 
ATOM   4668 C  CG    . PHE B 2 73  ? 30.314 28.339  -8.032  1.00 54.33  ? 61   PHE B CG    1 
ATOM   4669 C  CD1   . PHE B 2 73  ? 29.075 28.032  -8.566  1.00 56.76  ? 61   PHE B CD1   1 
ATOM   4670 C  CD2   . PHE B 2 73  ? 30.496 29.582  -7.444  1.00 60.16  ? 61   PHE B CD2   1 
ATOM   4671 C  CE1   . PHE B 2 73  ? 28.029 28.934  -8.490  1.00 59.96  ? 61   PHE B CE1   1 
ATOM   4672 C  CE2   . PHE B 2 73  ? 29.456 30.491  -7.367  1.00 61.78  ? 61   PHE B CE2   1 
ATOM   4673 C  CZ    . PHE B 2 73  ? 28.221 30.166  -7.892  1.00 61.69  ? 61   PHE B CZ    1 
ATOM   4674 N  N     . ALA B 2 74  ? 32.086 27.484  -5.311  1.00 45.69  ? 62   ALA B N     1 
ATOM   4675 C  CA    . ALA B 2 74  ? 32.156 27.870  -3.909  1.00 47.53  ? 62   ALA B CA    1 
ATOM   4676 C  C     . ALA B 2 74  ? 32.360 29.372  -3.792  1.00 51.16  ? 62   ALA B C     1 
ATOM   4677 O  O     . ALA B 2 74  ? 32.906 30.014  -4.693  1.00 54.48  ? 62   ALA B O     1 
ATOM   4678 C  CB    . ALA B 2 74  ? 33.283 27.131  -3.175  1.00 47.64  ? 62   ALA B CB    1 
ATOM   4679 N  N     . ILE B 2 75  ? 31.922 29.926  -2.663  1.00 52.67  ? 63   ILE B N     1 
ATOM   4680 C  CA    . ILE B 2 75  ? 32.050 31.352  -2.382  1.00 54.54  ? 63   ILE B CA    1 
ATOM   4681 C  C     . ILE B 2 75  ? 32.612 31.535  -0.979  1.00 59.58  ? 63   ILE B C     1 
ATOM   4682 O  O     . ILE B 2 75  ? 32.285 30.774  -0.063  1.00 57.89  ? 63   ILE B O     1 
ATOM   4683 C  CB    . ILE B 2 75  ? 30.703 32.092  -2.525  1.00 52.68  ? 63   ILE B CB    1 
ATOM   4684 C  CG1   . ILE B 2 75  ? 29.644 31.477  -1.606  1.00 49.89  ? 63   ILE B CG1   1 
ATOM   4685 C  CG2   . ILE B 2 75  ? 30.238 32.082  -3.974  1.00 38.84  ? 63   ILE B CG2   1 
ATOM   4686 C  CD1   . ILE B 2 75  ? 28.388 32.313  -1.473  1.00 49.74  ? 63   ILE B CD1   1 
ATOM   4687 N  N     . LYS B 2 76  ? 33.460 32.547  -0.813  1.00 68.31  ? 64   LYS B N     1 
ATOM   4688 C  CA    . LYS B 2 76  ? 34.055 32.883  0.476   1.00 76.11  ? 64   LYS B CA    1 
ATOM   4689 C  C     . LYS B 2 76  ? 33.482 34.214  0.942   1.00 83.68  ? 64   LYS B C     1 
ATOM   4690 O  O     . LYS B 2 76  ? 33.594 35.222  0.237   1.00 83.06  ? 64   LYS B O     1 
ATOM   4691 C  CB    . LYS B 2 76  ? 35.579 32.954  0.377   1.00 76.33  ? 64   LYS B CB    1 
ATOM   4692 N  N     . LYS B 2 77  ? 32.873 34.215  2.124   1.00 94.92  ? 65   LYS B N     1 
ATOM   4693 C  CA    . LYS B 2 77  ? 32.204 35.388  2.666   1.00 103.83 ? 65   LYS B CA    1 
ATOM   4694 C  C     . LYS B 2 77  ? 32.941 35.899  3.897   1.00 108.37 ? 65   LYS B C     1 
ATOM   4695 O  O     . LYS B 2 77  ? 33.381 35.110  4.741   1.00 113.50 ? 65   LYS B O     1 
ATOM   4696 C  CB    . LYS B 2 77  ? 30.750 35.069  3.026   1.00 107.51 ? 65   LYS B CB    1 
ATOM   4697 N  N     . LYS B 2 78  ? 33.068 37.222  3.989   1.00 106.90 ? 66   LYS B N     1 
ATOM   4698 C  CA    . LYS B 2 78  ? 33.691 37.890  5.132   1.00 107.27 ? 66   LYS B CA    1 
ATOM   4699 C  C     . LYS B 2 78  ? 35.095 37.363  5.422   1.00 105.00 ? 66   LYS B C     1 
ATOM   4700 O  O     . LYS B 2 78  ? 36.071 38.112  5.382   1.00 104.17 ? 66   LYS B O     1 
ATOM   4701 C  CB    . LYS B 2 78  ? 32.811 37.746  6.377   1.00 108.01 ? 66   LYS B CB    1 
ATOM   4702 N  N     . THR B 2 81  ? 37.349 33.159  6.221   1.00 107.06 ? 69   THR B N     1 
ATOM   4703 C  CA    . THR B 2 81  ? 38.064 32.019  5.656   1.00 106.12 ? 69   THR B CA    1 
ATOM   4704 C  C     . THR B 2 81  ? 37.177 30.778  5.604   1.00 102.98 ? 69   THR B C     1 
ATOM   4705 O  O     . THR B 2 81  ? 37.663 29.662  5.417   1.00 102.08 ? 69   THR B O     1 
ATOM   4706 C  CB    . THR B 2 81  ? 39.340 31.694  6.461   1.00 110.41 ? 69   THR B CB    1 
ATOM   4707 O  OG1   . THR B 2 81  ? 39.041 31.691  7.863   1.00 113.58 ? 69   THR B OG1   1 
ATOM   4708 C  CG2   . THR B 2 81  ? 40.431 32.716  6.173   1.00 112.10 ? 69   THR B CG2   1 
ATOM   4709 N  N     . LYS B 2 82  ? 35.873 30.980  5.773   1.00 101.43 ? 70   LYS B N     1 
ATOM   4710 C  CA    . LYS B 2 82  ? 34.897 29.901  5.708   1.00 94.74  ? 70   LYS B CA    1 
ATOM   4711 C  C     . LYS B 2 82  ? 34.255 29.901  4.327   1.00 88.94  ? 70   LYS B C     1 
ATOM   4712 O  O     . LYS B 2 82  ? 33.660 30.903  3.914   1.00 89.21  ? 70   LYS B O     1 
ATOM   4713 C  CB    . LYS B 2 82  ? 33.837 30.054  6.799   1.00 96.51  ? 70   LYS B CB    1 
ATOM   4714 N  N     . TRP B 2 83  ? 34.386 28.787  3.615   1.00 78.20  ? 71   TRP B N     1 
ATOM   4715 C  CA    . TRP B 2 83  ? 33.810 28.645  2.288   1.00 65.63  ? 71   TRP B CA    1 
ATOM   4716 C  C     . TRP B 2 83  ? 32.408 28.057  2.370   1.00 62.43  ? 71   TRP B C     1 
ATOM   4717 O  O     . TRP B 2 83  ? 32.066 27.336  3.312   1.00 62.49  ? 71   TRP B O     1 
ATOM   4718 C  CB    . TRP B 2 83  ? 34.686 27.755  1.407   1.00 57.80  ? 71   TRP B CB    1 
ATOM   4719 C  CG    . TRP B 2 83  ? 35.987 28.373  1.019   1.00 54.15  ? 71   TRP B CG    1 
ATOM   4720 C  CD1   . TRP B 2 83  ? 37.153 28.339  1.724   1.00 55.00  ? 71   TRP B CD1   1 
ATOM   4721 C  CD2   . TRP B 2 83  ? 36.263 29.110  -0.178  1.00 52.70  ? 71   TRP B CD2   1 
ATOM   4722 N  NE1   . TRP B 2 83  ? 38.138 29.013  1.044   1.00 56.18  ? 71   TRP B NE1   1 
ATOM   4723 C  CE2   . TRP B 2 83  ? 37.617 29.496  -0.128  1.00 54.19  ? 71   TRP B CE2   1 
ATOM   4724 C  CE3   . TRP B 2 83  ? 35.495 29.485  -1.285  1.00 51.26  ? 71   TRP B CE3   1 
ATOM   4725 C  CZ2   . TRP B 2 83  ? 38.220 30.239  -1.142  1.00 52.59  ? 71   TRP B CZ2   1 
ATOM   4726 C  CZ3   . TRP B 2 83  ? 36.097 30.223  -2.292  1.00 50.23  ? 71   TRP B CZ3   1 
ATOM   4727 C  CH2   . TRP B 2 83  ? 37.446 30.592  -2.212  1.00 50.85  ? 71   TRP B CH2   1 
ATOM   4728 N  N     . ARG B 2 84  ? 31.595 28.373  1.366   1.00 61.04  ? 72   ARG B N     1 
ATOM   4729 C  CA    . ARG B 2 84  ? 30.251 27.828  1.236   1.00 61.83  ? 72   ARG B CA    1 
ATOM   4730 C  C     . ARG B 2 84  ? 30.101 27.268  -0.168  1.00 57.48  ? 72   ARG B C     1 
ATOM   4731 O  O     . ARG B 2 84  ? 30.341 27.977  -1.152  1.00 56.25  ? 72   ARG B O     1 
ATOM   4732 C  CB    . ARG B 2 84  ? 29.181 28.890  1.509   1.00 66.85  ? 72   ARG B CB    1 
ATOM   4733 C  CG    . ARG B 2 84  ? 27.773 28.324  1.633   1.00 71.12  ? 72   ARG B CG    1 
ATOM   4734 C  CD    . ARG B 2 84  ? 26.723 29.424  1.581   1.00 77.49  ? 72   ARG B CD    1 
ATOM   4735 N  NE    . ARG B 2 84  ? 25.400 28.948  1.980   1.00 83.01  ? 72   ARG B NE    1 
ATOM   4736 C  CZ    . ARG B 2 84  ? 24.551 28.318  1.173   1.00 83.72  ? 72   ARG B CZ    1 
ATOM   4737 N  NH1   . ARG B 2 84  ? 24.883 28.076  -0.088  1.00 82.04  ? 72   ARG B NH1   1 
ATOM   4738 N  NH2   . ARG B 2 84  ? 23.368 27.927  1.629   1.00 84.78  ? 72   ARG B NH2   1 
ATOM   4739 N  N     . LYS B 2 85  ? 29.730 25.997  -0.253  1.00 55.84  ? 73   LYS B N     1 
ATOM   4740 C  CA    . LYS B 2 85  ? 29.436 25.381  -1.536  1.00 53.13  ? 73   LYS B CA    1 
ATOM   4741 C  C     . LYS B 2 85  ? 28.129 25.933  -2.087  1.00 53.21  ? 73   LYS B C     1 
ATOM   4742 O  O     . LYS B 2 85  ? 27.154 26.110  -1.352  1.00 58.13  ? 73   LYS B O     1 
ATOM   4743 C  CB    . LYS B 2 85  ? 29.351 23.864  -1.374  1.00 51.96  ? 73   LYS B CB    1 
ATOM   4744 C  CG    . LYS B 2 85  ? 28.829 23.116  -2.580  1.00 50.23  ? 73   LYS B CG    1 
ATOM   4745 C  CD    . LYS B 2 85  ? 28.242 21.786  -2.150  1.00 53.52  ? 73   LYS B CD    1 
ATOM   4746 C  CE    . LYS B 2 85  ? 27.949 20.896  -3.338  1.00 55.11  ? 73   LYS B CE    1 
ATOM   4747 N  NZ    . LYS B 2 85  ? 27.066 19.766  -2.947  1.00 58.48  ? 73   LYS B NZ    1 
ATOM   4748 N  N     . LEU B 2 86  ? 28.114 26.219  -3.387  1.00 50.21  ? 74   LEU B N     1 
ATOM   4749 C  CA    . LEU B 2 86  ? 26.935 26.742  -4.065  1.00 49.73  ? 74   LEU B CA    1 
ATOM   4750 C  C     . LEU B 2 86  ? 26.706 25.924  -5.326  1.00 47.24  ? 74   LEU B C     1 
ATOM   4751 O  O     . LEU B 2 86  ? 27.590 25.836  -6.187  1.00 48.93  ? 74   LEU B O     1 
ATOM   4752 C  CB    . LEU B 2 86  ? 27.100 28.226  -4.405  1.00 53.12  ? 74   LEU B CB    1 
ATOM   4753 C  CG    . LEU B 2 86  ? 25.804 28.982  -4.699  1.00 55.71  ? 74   LEU B CG    1 
ATOM   4754 C  CD1   . LEU B 2 86  ? 24.928 29.009  -3.461  1.00 59.84  ? 74   LEU B CD1   1 
ATOM   4755 C  CD2   . LEU B 2 86  ? 26.092 30.392  -5.173  1.00 56.41  ? 74   LEU B CD2   1 
ATOM   4756 N  N     . VAL B 2 87  ? 25.524 25.327  -5.429  1.00 45.51  ? 75   VAL B N     1 
ATOM   4757 C  CA    . VAL B 2 87  ? 25.138 24.523  -6.580  1.00 43.78  ? 75   VAL B CA    1 
ATOM   4758 C  C     . VAL B 2 87  ? 24.177 25.340  -7.431  1.00 44.16  ? 75   VAL B C     1 
ATOM   4759 O  O     . VAL B 2 87  ? 23.224 25.932  -6.910  1.00 43.84  ? 75   VAL B O     1 
ATOM   4760 C  CB    . VAL B 2 87  ? 24.498 23.197  -6.141  1.00 44.06  ? 75   VAL B CB    1 
ATOM   4761 C  CG1   . VAL B 2 87  ? 24.377 22.255  -7.319  1.00 42.22  ? 75   VAL B CG1   1 
ATOM   4762 C  CG2   . VAL B 2 87  ? 25.312 22.567  -5.029  1.00 44.92  ? 75   VAL B CG2   1 
ATOM   4763 N  N     . ASP B 2 88  ? 24.424 25.369  -8.741  1.00 43.65  ? 76   ASP B N     1 
ATOM   4764 C  CA    . ASP B 2 88  ? 23.623 26.167  -9.670  1.00 44.19  ? 76   ASP B CA    1 
ATOM   4765 C  C     . ASP B 2 88  ? 22.418 25.340  -10.113 1.00 45.03  ? 76   ASP B C     1 
ATOM   4766 O  O     . ASP B 2 88  ? 22.372 24.776  -11.208 1.00 47.93  ? 76   ASP B O     1 
ATOM   4767 C  CB    . ASP B 2 88  ? 24.476 26.617  -10.850 1.00 44.59  ? 76   ASP B CB    1 
ATOM   4768 C  CG    . ASP B 2 88  ? 23.714 27.492  -11.830 1.00 47.54  ? 76   ASP B CG    1 
ATOM   4769 O  OD1   . ASP B 2 88  ? 22.587 27.927  -11.507 1.00 49.80  ? 76   ASP B OD1   1 
ATOM   4770 O  OD2   . ASP B 2 88  ? 24.247 27.739  -12.932 1.00 48.80  ? 76   ASP B OD2   1 
ATOM   4771 N  N     . PHE B 2 89  ? 21.409 25.298  -9.241  1.00 45.02  ? 77   PHE B N     1 
ATOM   4772 C  CA    . PHE B 2 89  ? 20.185 24.536  -9.461  1.00 45.00  ? 77   PHE B CA    1 
ATOM   4773 C  C     . PHE B 2 89  ? 19.164 25.270  -10.328 1.00 47.40  ? 77   PHE B C     1 
ATOM   4774 O  O     . PHE B 2 89  ? 17.981 24.916  -10.276 1.00 52.99  ? 77   PHE B O     1 
ATOM   4775 C  CB    . PHE B 2 89  ? 19.540 24.174  -8.119  1.00 45.38  ? 77   PHE B CB    1 
ATOM   4776 C  CG    . PHE B 2 89  ? 20.160 22.987  -7.437  1.00 47.66  ? 77   PHE B CG    1 
ATOM   4777 C  CD1   . PHE B 2 89  ? 20.486 21.847  -8.155  1.00 48.02  ? 77   PHE B CD1   1 
ATOM   4778 C  CD2   . PHE B 2 89  ? 20.411 23.009  -6.074  1.00 48.98  ? 77   PHE B CD2   1 
ATOM   4779 C  CE1   . PHE B 2 89  ? 21.052 20.753  -7.527  1.00 46.07  ? 77   PHE B CE1   1 
ATOM   4780 C  CE2   . PHE B 2 89  ? 20.979 21.918  -5.440  1.00 47.96  ? 77   PHE B CE2   1 
ATOM   4781 C  CZ    . PHE B 2 89  ? 21.300 20.789  -6.169  1.00 45.91  ? 77   PHE B CZ    1 
ATOM   4782 N  N     . ARG B 2 90  ? 19.573 26.276  -11.106 1.00 44.51  ? 78   ARG B N     1 
ATOM   4783 C  CA    . ARG B 2 90  ? 18.608 27.046  -11.888 1.00 46.64  ? 78   ARG B CA    1 
ATOM   4784 C  C     . ARG B 2 90  ? 17.837 26.153  -12.855 1.00 49.21  ? 78   ARG B C     1 
ATOM   4785 O  O     . ARG B 2 90  ? 16.607 26.236  -12.948 1.00 51.23  ? 78   ARG B O     1 
ATOM   4786 C  CB    . ARG B 2 90  ? 19.315 28.177  -12.638 1.00 43.14  ? 78   ARG B CB    1 
ATOM   4787 C  CG    . ARG B 2 90  ? 19.502 29.440  -11.810 1.00 38.82  ? 78   ARG B CG    1 
ATOM   4788 C  CD    . ARG B 2 90  ? 20.205 30.527  -12.602 1.00 38.73  ? 78   ARG B CD    1 
ATOM   4789 N  NE    . ARG B 2 90  ? 21.587 30.169  -12.902 1.00 50.76  ? 78   ARG B NE    1 
ATOM   4790 C  CZ    . ARG B 2 90  ? 22.413 30.914  -13.630 1.00 48.73  ? 78   ARG B CZ    1 
ATOM   4791 N  NH1   . ARG B 2 90  ? 21.999 32.068  -14.142 1.00 48.03  ? 78   ARG B NH1   1 
ATOM   4792 N  NH2   . ARG B 2 90  ? 23.653 30.503  -13.846 1.00 46.23  ? 78   ARG B NH2   1 
ATOM   4793 N  N     . GLU B 2 91  ? 18.544 25.282  -13.575 1.00 49.55  ? 79   GLU B N     1 
ATOM   4794 C  CA    . GLU B 2 91  ? 17.877 24.390  -14.519 1.00 53.39  ? 79   GLU B CA    1 
ATOM   4795 C  C     . GLU B 2 91  ? 16.979 23.393  -13.790 1.00 53.18  ? 79   GLU B C     1 
ATOM   4796 O  O     . GLU B 2 91  ? 15.818 23.190  -14.172 1.00 53.74  ? 79   GLU B O     1 
ATOM   4797 C  CB    . GLU B 2 91  ? 18.922 23.669  -15.371 1.00 58.76  ? 79   GLU B CB    1 
ATOM   4798 C  CG    . GLU B 2 91  ? 18.423 23.200  -16.727 1.00 66.25  ? 79   GLU B CG    1 
ATOM   4799 C  CD    . GLU B 2 91  ? 17.974 24.346  -17.615 1.00 71.86  ? 79   GLU B CD    1 
ATOM   4800 O  OE1   . GLU B 2 91  ? 17.024 24.153  -18.403 1.00 75.16  ? 79   GLU B OE1   1 
ATOM   4801 O  OE2   . GLU B 2 91  ? 18.567 25.440  -17.524 1.00 72.57  ? 79   GLU B OE2   1 
ATOM   4802 N  N     . LEU B 2 92  ? 17.494 22.774  -12.723 1.00 51.13  ? 80   LEU B N     1 
ATOM   4803 C  CA    . LEU B 2 92  ? 16.701 21.807  -11.969 1.00 51.29  ? 80   LEU B CA    1 
ATOM   4804 C  C     . LEU B 2 92  ? 15.480 22.460  -11.335 1.00 52.54  ? 80   LEU B C     1 
ATOM   4805 O  O     . LEU B 2 92  ? 14.380 21.898  -11.371 1.00 55.83  ? 80   LEU B O     1 
ATOM   4806 C  CB    . LEU B 2 92  ? 17.562 21.139  -10.898 1.00 49.59  ? 80   LEU B CB    1 
ATOM   4807 C  CG    . LEU B 2 92  ? 16.807 20.224  -9.932  1.00 49.27  ? 80   LEU B CG    1 
ATOM   4808 C  CD1   . LEU B 2 92  ? 16.153 19.073  -10.681 1.00 48.75  ? 80   LEU B CD1   1 
ATOM   4809 C  CD2   . LEU B 2 92  ? 17.730 19.709  -8.839  1.00 48.73  ? 80   LEU B CD2   1 
ATOM   4810 N  N     . ASN B 2 93  ? 15.656 23.638  -10.732 1.00 54.93  ? 81   ASN B N     1 
ATOM   4811 C  CA    . ASN B 2 93  ? 14.509 24.370  -10.202 1.00 55.79  ? 81   ASN B CA    1 
ATOM   4812 C  C     . ASN B 2 93  ? 13.505 24.680  -11.303 1.00 59.62  ? 81   ASN B C     1 
ATOM   4813 O  O     . ASN B 2 93  ? 12.290 24.569  -11.099 1.00 63.29  ? 81   ASN B O     1 
ATOM   4814 C  CB    . ASN B 2 93  ? 14.973 25.660  -9.528  1.00 52.33  ? 81   ASN B CB    1 
ATOM   4815 C  CG    . ASN B 2 93  ? 15.773 25.404  -8.268  1.00 53.74  ? 81   ASN B CG    1 
ATOM   4816 O  OD1   . ASN B 2 93  ? 15.500 24.458  -7.529  1.00 57.22  ? 81   ASN B OD1   1 
ATOM   4817 N  ND2   . ASN B 2 93  ? 16.769 26.245  -8.016  1.00 51.05  ? 81   ASN B ND2   1 
ATOM   4818 N  N     . LYS B 2 94  ? 13.997 25.060  -12.483 1.00 59.65  ? 82   LYS B N     1 
ATOM   4819 C  CA    . LYS B 2 94  ? 13.111 25.371  -13.597 1.00 64.18  ? 82   LYS B CA    1 
ATOM   4820 C  C     . LYS B 2 94  ? 12.347 24.140  -14.068 1.00 66.19  ? 82   LYS B C     1 
ATOM   4821 O  O     . LYS B 2 94  ? 11.243 24.263  -14.610 1.00 70.07  ? 82   LYS B O     1 
ATOM   4822 C  CB    . LYS B 2 94  ? 13.933 25.975  -14.736 1.00 65.60  ? 82   LYS B CB    1 
ATOM   4823 C  CG    . LYS B 2 94  ? 13.140 26.646  -15.835 1.00 70.06  ? 82   LYS B CG    1 
ATOM   4824 C  CD    . LYS B 2 94  ? 14.032 27.617  -16.595 1.00 70.92  ? 82   LYS B CD    1 
ATOM   4825 C  CE    . LYS B 2 94  ? 15.374 26.983  -16.932 1.00 70.66  ? 82   LYS B CE    1 
ATOM   4826 N  NZ    . LYS B 2 94  ? 16.359 27.978  -17.441 1.00 72.39  ? 82   LYS B NZ    1 
ATOM   4827 N  N     . ARG B 2 95  ? 12.907 22.950  -13.860 1.00 68.14  ? 83   ARG B N     1 
ATOM   4828 C  CA    . ARG B 2 95  ? 12.291 21.709  -14.311 1.00 66.78  ? 83   ARG B CA    1 
ATOM   4829 C  C     . ARG B 2 95  ? 11.566 20.950  -13.204 1.00 69.60  ? 83   ARG B C     1 
ATOM   4830 O  O     . ARG B 2 95  ? 11.042 19.863  -13.463 1.00 75.04  ? 83   ARG B O     1 
ATOM   4831 C  CB    . ARG B 2 95  ? 13.349 20.803  -14.947 1.00 62.87  ? 83   ARG B CB    1 
ATOM   4832 C  CG    . ARG B 2 95  ? 13.883 21.322  -16.269 1.00 63.41  ? 83   ARG B CG    1 
ATOM   4833 C  CD    . ARG B 2 95  ? 15.333 20.933  -16.467 1.00 64.50  ? 83   ARG B CD    1 
ATOM   4834 N  NE    . ARG B 2 95  ? 15.876 21.467  -17.712 1.00 65.93  ? 83   ARG B NE    1 
ATOM   4835 C  CZ    . ARG B 2 95  ? 16.292 20.721  -18.728 1.00 66.94  ? 83   ARG B CZ    1 
ATOM   4836 N  NH1   . ARG B 2 95  ? 16.241 19.398  -18.646 1.00 68.43  ? 83   ARG B NH1   1 
ATOM   4837 N  NH2   . ARG B 2 95  ? 16.771 21.296  -19.822 1.00 68.13  ? 83   ARG B NH2   1 
ATOM   4838 N  N     . THR B 2 96  ? 11.516 21.489  -11.990 1.00 68.03  ? 84   THR B N     1 
ATOM   4839 C  CA    . THR B 2 96  ? 10.862 20.817  -10.876 1.00 66.27  ? 84   THR B CA    1 
ATOM   4840 C  C     . THR B 2 96  ? 9.404  21.255  -10.776 1.00 69.41  ? 84   THR B C     1 
ATOM   4841 O  O     . THR B 2 96  ? 9.057  22.396  -11.094 1.00 69.76  ? 84   THR B O     1 
ATOM   4842 C  CB    . THR B 2 96  ? 11.599 21.112  -9.564  1.00 64.86  ? 84   THR B CB    1 
ATOM   4843 O  OG1   . THR B 2 96  ? 12.975 20.735  -9.694  1.00 65.03  ? 84   THR B OG1   1 
ATOM   4844 C  CG2   . THR B 2 96  ? 10.989 20.340  -8.402  1.00 62.31  ? 84   THR B CG2   1 
ATOM   4845 N  N     . GLN B 2 97  ? 8.550  20.324  -10.348 1.00 71.14  ? 85   GLN B N     1 
ATOM   4846 C  CA    . GLN B 2 97  ? 7.128  20.602  -10.196 1.00 71.39  ? 85   GLN B CA    1 
ATOM   4847 C  C     . GLN B 2 97  ? 6.900  21.798  -9.276  1.00 73.09  ? 85   GLN B C     1 
ATOM   4848 O  O     . GLN B 2 97  ? 7.656  22.039  -8.331  1.00 73.00  ? 85   GLN B O     1 
ATOM   4849 C  CB    . GLN B 2 97  ? 6.403  19.373  -9.644  1.00 69.86  ? 85   GLN B CB    1 
ATOM   4850 N  N     . ASP B 2 98  ? 5.842  22.550  -9.563  1.00 75.24  ? 86   ASP B N     1 
ATOM   4851 C  CA    . ASP B 2 98  ? 5.526  23.757  -8.808  1.00 75.48  ? 86   ASP B CA    1 
ATOM   4852 C  C     . ASP B 2 98  ? 4.989  23.428  -7.416  1.00 74.66  ? 86   ASP B C     1 
ATOM   4853 O  O     . ASP B 2 98  ? 4.727  22.269  -7.096  1.00 73.19  ? 86   ASP B O     1 
ATOM   4854 C  CB    . ASP B 2 98  ? 4.513  24.613  -9.573  1.00 76.31  ? 86   ASP B CB    1 
ATOM   4855 N  N     . HIS B 2 108 ? 2.910  36.658  0.515   1.00 92.29  ? 96   HIS B N     1 
ATOM   4856 C  CA    . HIS B 2 108 ? 4.142  37.431  0.637   1.00 89.56  ? 96   HIS B CA    1 
ATOM   4857 C  C     . HIS B 2 108 ? 3.928  38.662  1.511   1.00 90.28  ? 96   HIS B C     1 
ATOM   4858 O  O     . HIS B 2 108 ? 3.033  39.465  1.249   1.00 91.69  ? 96   HIS B O     1 
ATOM   4859 C  CB    . HIS B 2 108 ? 4.656  37.848  -0.741  1.00 85.62  ? 96   HIS B CB    1 
ATOM   4860 C  CG    . HIS B 2 108 ? 5.867  38.727  -0.691  1.00 83.22  ? 96   HIS B CG    1 
ATOM   4861 N  ND1   . HIS B 2 108 ? 7.136  38.235  -0.471  1.00 81.60  ? 96   HIS B ND1   1 
ATOM   4862 C  CD2   . HIS B 2 108 ? 6.002  40.067  -0.823  1.00 82.71  ? 96   HIS B CD2   1 
ATOM   4863 C  CE1   . HIS B 2 108 ? 8.000  39.234  -0.475  1.00 80.64  ? 96   HIS B CE1   1 
ATOM   4864 N  NE2   . HIS B 2 108 ? 7.338  40.357  -0.686  1.00 80.87  ? 96   HIS B NE2   1 
ATOM   4865 N  N     . PRO B 2 109 ? 4.759  38.811  2.547   1.00 88.42  ? 97   PRO B N     1 
ATOM   4866 C  CA    . PRO B 2 109 ? 4.575  39.922  3.492   1.00 88.41  ? 97   PRO B CA    1 
ATOM   4867 C  C     . PRO B 2 109 ? 4.801  41.284  2.856   1.00 85.78  ? 97   PRO B C     1 
ATOM   4868 O  O     . PRO B 2 109 ? 5.926  41.620  2.471   1.00 83.66  ? 97   PRO B O     1 
ATOM   4869 C  CB    . PRO B 2 109 ? 5.622  39.638  4.580   1.00 89.18  ? 97   PRO B CB    1 
ATOM   4870 C  CG    . PRO B 2 109 ? 6.013  38.202  4.393   1.00 88.72  ? 97   PRO B CG    1 
ATOM   4871 C  CD    . PRO B 2 109 ? 5.879  37.937  2.930   1.00 86.84  ? 97   PRO B CD    1 
ATOM   4872 N  N     . ALA B 2 110 ? 3.735  42.079  2.747   1.00 86.23  ? 98   ALA B N     1 
ATOM   4873 C  CA    . ALA B 2 110 ? 3.865  43.420  2.194   1.00 84.58  ? 98   ALA B CA    1 
ATOM   4874 C  C     . ALA B 2 110 ? 4.589  44.367  3.139   1.00 84.45  ? 98   ALA B C     1 
ATOM   4875 O  O     . ALA B 2 110 ? 5.146  45.372  2.683   1.00 84.83  ? 98   ALA B O     1 
ATOM   4876 C  CB    . ALA B 2 110 ? 2.486  43.983  1.847   1.00 85.09  ? 98   ALA B CB    1 
ATOM   4877 N  N     . GLY B 2 111 ? 4.600  44.071  4.442   1.00 84.09  ? 99   GLY B N     1 
ATOM   4878 C  CA    . GLY B 2 111 ? 5.248  44.947  5.401   1.00 85.40  ? 99   GLY B CA    1 
ATOM   4879 C  C     . GLY B 2 111 ? 6.753  44.811  5.466   1.00 86.62  ? 99   GLY B C     1 
ATOM   4880 O  O     . GLY B 2 111 ? 7.420  45.709  5.991   1.00 89.11  ? 99   GLY B O     1 
ATOM   4881 N  N     . LEU B 2 112 ? 7.302  43.713  4.939   1.00 84.51  ? 100  LEU B N     1 
ATOM   4882 C  CA    . LEU B 2 112 ? 8.745  43.504  4.993   1.00 81.84  ? 100  LEU B CA    1 
ATOM   4883 C  C     . LEU B 2 112 ? 9.497  44.638  4.308   1.00 81.96  ? 100  LEU B C     1 
ATOM   4884 O  O     . LEU B 2 112 ? 10.536 45.092  4.802   1.00 82.50  ? 100  LEU B O     1 
ATOM   4885 C  CB    . LEU B 2 112 ? 9.106  42.164  4.353   1.00 77.52  ? 100  LEU B CB    1 
ATOM   4886 C  CG    . LEU B 2 112 ? 10.602 41.849  4.282   1.00 74.37  ? 100  LEU B CG    1 
ATOM   4887 C  CD1   . LEU B 2 112 ? 11.175 41.643  5.678   1.00 75.71  ? 100  LEU B CD1   1 
ATOM   4888 C  CD2   . LEU B 2 112 ? 10.862 40.638  3.402   1.00 71.90  ? 100  LEU B CD2   1 
ATOM   4889 N  N     . LYS B 2 113 ? 8.984  45.115  3.173   1.00 81.21  ? 101  LYS B N     1 
ATOM   4890 C  CA    . LYS B 2 113 ? 9.646  46.195  2.451   1.00 80.40  ? 101  LYS B CA    1 
ATOM   4891 C  C     . LYS B 2 113 ? 9.492  47.549  3.130   1.00 83.31  ? 101  LYS B C     1 
ATOM   4892 O  O     . LYS B 2 113 ? 10.063 48.529  2.638   1.00 83.20  ? 101  LYS B O     1 
ATOM   4893 C  CB    . LYS B 2 113 ? 9.119  46.273  1.015   1.00 79.52  ? 101  LYS B CB    1 
ATOM   4894 C  CG    . LYS B 2 113 ? 7.612  46.445  0.899   1.00 81.13  ? 101  LYS B CG    1 
ATOM   4895 C  CD    . LYS B 2 113 ? 7.199  46.730  -0.539  1.00 79.05  ? 101  LYS B CD    1 
ATOM   4896 C  CE    . LYS B 2 113 ? 5.686  46.729  -0.700  1.00 79.90  ? 101  LYS B CE    1 
ATOM   4897 N  NZ    . LYS B 2 113 ? 5.107  45.367  -0.528  1.00 80.97  ? 101  LYS B NZ    1 
ATOM   4898 N  N     . LYS B 2 114 ? 8.750  47.635  4.234   1.00 85.12  ? 102  LYS B N     1 
ATOM   4899 C  CA    . LYS B 2 114 ? 8.555  48.891  4.947   1.00 85.11  ? 102  LYS B CA    1 
ATOM   4900 C  C     . LYS B 2 114 ? 9.246  48.908  6.304   1.00 90.34  ? 102  LYS B C     1 
ATOM   4901 O  O     . LYS B 2 114 ? 9.064  49.860  7.070   1.00 95.26  ? 102  LYS B O     1 
ATOM   4902 C  CB    . LYS B 2 114 ? 7.060  49.175  5.114   1.00 79.79  ? 102  LYS B CB    1 
ATOM   4903 N  N     . LYS B 2 115 ? 10.035 47.884  6.621   1.00 91.65  ? 103  LYS B N     1 
ATOM   4904 C  CA    . LYS B 2 115 ? 10.701 47.807  7.912   1.00 93.42  ? 103  LYS B CA    1 
ATOM   4905 C  C     . LYS B 2 115 ? 11.961 48.664  7.921   1.00 97.37  ? 103  LYS B C     1 
ATOM   4906 O  O     . LYS B 2 115 ? 12.599 48.882  6.887   1.00 96.68  ? 103  LYS B O     1 
ATOM   4907 C  CB    . LYS B 2 115 ? 11.051 46.357  8.250   1.00 90.55  ? 103  LYS B CB    1 
ATOM   4908 N  N     . LYS B 2 116 ? 12.313 49.157  9.111   1.00 103.09 ? 104  LYS B N     1 
ATOM   4909 C  CA    . LYS B 2 116 ? 13.490 50.011  9.242   1.00 105.25 ? 104  LYS B CA    1 
ATOM   4910 C  C     . LYS B 2 116 ? 14.767 49.237  8.940   1.00 106.87 ? 104  LYS B C     1 
ATOM   4911 O  O     . LYS B 2 116 ? 15.589 49.668  8.123   1.00 111.48 ? 104  LYS B O     1 
ATOM   4912 C  CB    . LYS B 2 116 ? 13.543 50.619  10.644  1.00 108.30 ? 104  LYS B CB    1 
ATOM   4913 N  N     . SER B 2 117 ? 14.949 48.088  9.586   1.00 102.57 ? 105  SER B N     1 
ATOM   4914 C  CA    . SER B 2 117 ? 16.108 47.242  9.348   1.00 96.85  ? 105  SER B CA    1 
ATOM   4915 C  C     . SER B 2 117 ? 15.652 45.839  8.978   1.00 90.26  ? 105  SER B C     1 
ATOM   4916 O  O     . SER B 2 117 ? 14.629 45.351  9.466   1.00 89.67  ? 105  SER B O     1 
ATOM   4917 C  CB    . SER B 2 117 ? 17.031 47.184  10.573  1.00 100.21 ? 105  SER B CB    1 
ATOM   4918 O  OG    . SER B 2 117 ? 17.775 48.382  10.708  1.00 103.52 ? 105  SER B OG    1 
ATOM   4919 N  N     . VAL B 2 118 ? 16.418 45.202  8.094   1.00 86.24  ? 106  VAL B N     1 
ATOM   4920 C  CA    . VAL B 2 118 ? 16.164 43.831  7.665   1.00 81.17  ? 106  VAL B CA    1 
ATOM   4921 C  C     . VAL B 2 118 ? 17.497 43.098  7.616   1.00 79.11  ? 106  VAL B C     1 
ATOM   4922 O  O     . VAL B 2 118 ? 18.423 43.532  6.920   1.00 78.74  ? 106  VAL B O     1 
ATOM   4923 C  CB    . VAL B 2 118 ? 15.463 43.759  6.296   1.00 78.03  ? 106  VAL B CB    1 
ATOM   4924 C  CG1   . VAL B 2 118 ? 15.490 42.337  5.764   1.00 67.08  ? 106  VAL B CG1   1 
ATOM   4925 C  CG2   . VAL B 2 118 ? 14.029 44.244  6.410   1.00 69.66  ? 106  VAL B CG2   1 
ATOM   4926 N  N     . THR B 2 119 ? 17.597 41.998  8.354   1.00 78.40  ? 107  THR B N     1 
ATOM   4927 C  CA    . THR B 2 119 ? 18.783 41.154  8.382   1.00 78.17  ? 107  THR B CA    1 
ATOM   4928 C  C     . THR B 2 119 ? 18.521 39.869  7.606   1.00 76.52  ? 107  THR B C     1 
ATOM   4929 O  O     . THR B 2 119 ? 17.435 39.286  7.697   1.00 76.86  ? 107  THR B O     1 
ATOM   4930 C  CB    . THR B 2 119 ? 19.189 40.820  9.824   1.00 81.27  ? 107  THR B CB    1 
ATOM   4931 O  OG1   . THR B 2 119 ? 19.334 42.031  10.577  1.00 83.73  ? 107  THR B OG1   1 
ATOM   4932 C  CG2   . THR B 2 119 ? 20.508 40.057  9.854   1.00 80.91  ? 107  THR B CG2   1 
ATOM   4933 N  N     . VAL B 2 120 ? 19.518 39.437  6.838   1.00 75.48  ? 108  VAL B N     1 
ATOM   4934 C  CA    . VAL B 2 120 ? 19.453 38.200  6.067   1.00 74.44  ? 108  VAL B CA    1 
ATOM   4935 C  C     . VAL B 2 120 ? 20.219 37.124  6.824   1.00 79.50  ? 108  VAL B C     1 
ATOM   4936 O  O     . VAL B 2 120 ? 21.375 37.333  7.213   1.00 83.20  ? 108  VAL B O     1 
ATOM   4937 C  CB    . VAL B 2 120 ? 20.025 38.396  4.652   1.00 70.73  ? 108  VAL B CB    1 
ATOM   4938 C  CG1   . VAL B 2 120 ? 19.899 37.114  3.835   1.00 68.16  ? 108  VAL B CG1   1 
ATOM   4939 C  CG2   . VAL B 2 120 ? 19.327 39.555  3.956   1.00 69.68  ? 108  VAL B CG2   1 
ATOM   4940 N  N     . LEU B 2 121 ? 19.580 35.975  7.034   1.00 79.40  ? 109  LEU B N     1 
ATOM   4941 C  CA    . LEU B 2 121 ? 20.159 34.869  7.784   1.00 78.78  ? 109  LEU B CA    1 
ATOM   4942 C  C     . LEU B 2 121 ? 20.181 33.622  6.914   1.00 77.08  ? 109  LEU B C     1 
ATOM   4943 O  O     . LEU B 2 121 ? 19.166 33.271  6.305   1.00 77.01  ? 109  LEU B O     1 
ATOM   4944 C  CB    . LEU B 2 121 ? 19.365 34.596  9.063   1.00 79.68  ? 109  LEU B CB    1 
ATOM   4945 C  CG    . LEU B 2 121 ? 19.503 35.612  10.192  1.00 82.30  ? 109  LEU B CG    1 
ATOM   4946 C  CD1   . LEU B 2 121 ? 18.412 35.401  11.225  1.00 84.88  ? 109  LEU B CD1   1 
ATOM   4947 C  CD2   . LEU B 2 121 ? 20.874 35.489  10.830  1.00 83.67  ? 109  LEU B CD2   1 
ATOM   4948 N  N     . ASP B 2 122 ? 21.331 32.954  6.866   1.00 76.40  ? 110  ASP B N     1 
ATOM   4949 C  CA    . ASP B 2 122 ? 21.466 31.711  6.117   1.00 76.98  ? 110  ASP B CA    1 
ATOM   4950 C  C     . ASP B 2 122 ? 20.979 30.551  6.977   1.00 80.13  ? 110  ASP B C     1 
ATOM   4951 O  O     . ASP B 2 122 ? 21.564 30.259  8.026   1.00 83.23  ? 110  ASP B O     1 
ATOM   4952 C  CB    . ASP B 2 122 ? 22.918 31.502  5.694   1.00 78.13  ? 110  ASP B CB    1 
ATOM   4953 C  CG    . ASP B 2 122 ? 23.078 30.389  4.673   1.00 78.51  ? 110  ASP B CG    1 
ATOM   4954 O  OD1   . ASP B 2 122 ? 22.061 29.773  4.289   1.00 78.63  ? 110  ASP B OD1   1 
ATOM   4955 O  OD2   . ASP B 2 122 ? 24.225 30.132  4.250   1.00 78.31  ? 110  ASP B OD2   1 
ATOM   4956 N  N     . VAL B 2 123 ? 19.907 29.894  6.540   1.00 79.09  ? 111  VAL B N     1 
ATOM   4957 C  CA    . VAL B 2 123 ? 19.322 28.775  7.265   1.00 79.55  ? 111  VAL B CA    1 
ATOM   4958 C  C     . VAL B 2 123 ? 19.354 27.493  6.433   1.00 83.43  ? 111  VAL B C     1 
ATOM   4959 O  O     . VAL B 2 123 ? 18.562 26.585  6.661   1.00 84.09  ? 111  VAL B O     1 
ATOM   4960 C  CB    . VAL B 2 123 ? 17.890 29.104  7.727   1.00 75.96  ? 111  VAL B CB    1 
ATOM   4961 C  CG1   . VAL B 2 123 ? 17.900 30.297  8.665   1.00 75.97  ? 111  VAL B CG1   1 
ATOM   4962 C  CG2   . VAL B 2 123 ? 16.994 29.377  6.527   1.00 74.35  ? 111  VAL B CG2   1 
ATOM   4963 N  N     . GLY B 2 124 ? 20.277 27.410  5.472   1.00 86.75  ? 112  GLY B N     1 
ATOM   4964 C  CA    . GLY B 2 124 ? 20.300 26.273  4.568   1.00 91.21  ? 112  GLY B CA    1 
ATOM   4965 C  C     . GLY B 2 124 ? 20.663 24.961  5.235   1.00 96.15  ? 112  GLY B C     1 
ATOM   4966 O  O     . GLY B 2 124 ? 20.206 23.898  4.801   1.00 97.18  ? 112  GLY B O     1 
ATOM   4967 N  N     . ASP B 2 125 ? 21.483 25.010  6.291   1.00 101.34 ? 113  ASP B N     1 
ATOM   4968 C  CA    . ASP B 2 125 ? 21.916 23.783  6.958   1.00 108.56 ? 113  ASP B CA    1 
ATOM   4969 C  C     . ASP B 2 125 ? 20.738 22.961  7.465   1.00 104.74 ? 113  ASP B C     1 
ATOM   4970 O  O     . ASP B 2 125 ? 20.817 21.727  7.507   1.00 105.51 ? 113  ASP B O     1 
ATOM   4971 C  CB    . ASP B 2 125 ? 22.860 24.114  8.115   1.00 117.90 ? 113  ASP B CB    1 
ATOM   4972 C  CG    . ASP B 2 125 ? 24.314 24.161  7.686   1.00 122.08 ? 113  ASP B CG    1 
ATOM   4973 O  OD1   . ASP B 2 125 ? 24.589 23.967  6.483   1.00 122.61 ? 113  ASP B OD1   1 
ATOM   4974 O  OD2   . ASP B 2 125 ? 25.182 24.385  8.555   1.00 126.01 ? 113  ASP B OD2   1 
ATOM   4975 N  N     . ALA B 2 126 ? 19.639 23.621  7.840   1.00 97.25  ? 114  ALA B N     1 
ATOM   4976 C  CA    . ALA B 2 126 ? 18.459 22.906  8.312   1.00 90.82  ? 114  ALA B CA    1 
ATOM   4977 C  C     . ALA B 2 126 ? 17.928 21.918  7.283   1.00 82.53  ? 114  ALA B C     1 
ATOM   4978 O  O     . ALA B 2 126 ? 17.233 20.966  7.654   1.00 84.19  ? 114  ALA B O     1 
ATOM   4979 C  CB    . ALA B 2 126 ? 17.362 23.900  8.694   1.00 90.41  ? 114  ALA B CB    1 
ATOM   4980 N  N     . TYR B 2 127 ? 18.239 22.118  6.001   1.00 75.50  ? 115  TYR B N     1 
ATOM   4981 C  CA    . TYR B 2 127 ? 17.774 21.198  4.971   1.00 73.15  ? 115  TYR B CA    1 
ATOM   4982 C  C     . TYR B 2 127 ? 18.494 19.858  5.019   1.00 77.84  ? 115  TYR B C     1 
ATOM   4983 O  O     . TYR B 2 127 ? 17.950 18.860  4.534   1.00 78.03  ? 115  TYR B O     1 
ATOM   4984 C  CB    . TYR B 2 127 ? 17.945 21.832  3.590   1.00 66.12  ? 115  TYR B CB    1 
ATOM   4985 C  CG    . TYR B 2 127 ? 17.126 23.086  3.386   1.00 65.42  ? 115  TYR B CG    1 
ATOM   4986 C  CD1   . TYR B 2 127 ? 15.907 23.254  4.028   1.00 65.48  ? 115  TYR B CD1   1 
ATOM   4987 C  CD2   . TYR B 2 127 ? 17.574 24.105  2.553   1.00 64.05  ? 115  TYR B CD2   1 
ATOM   4988 C  CE1   . TYR B 2 127 ? 15.155 24.397  3.844   1.00 65.18  ? 115  TYR B CE1   1 
ATOM   4989 C  CE2   . TYR B 2 127 ? 16.827 25.253  2.363   1.00 61.80  ? 115  TYR B CE2   1 
ATOM   4990 C  CZ    . TYR B 2 127 ? 15.619 25.394  3.010   1.00 64.09  ? 115  TYR B CZ    1 
ATOM   4991 O  OH    . TYR B 2 127 ? 14.875 26.536  2.824   1.00 65.65  ? 115  TYR B OH    1 
ATOM   4992 N  N     . PHE B 2 128 ? 19.695 19.806  5.596   1.00 80.54  ? 116  PHE B N     1 
ATOM   4993 C  CA    . PHE B 2 128 ? 20.480 18.577  5.625   1.00 81.25  ? 116  PHE B CA    1 
ATOM   4994 C  C     . PHE B 2 128 ? 19.980 17.575  6.658   1.00 81.52  ? 116  PHE B C     1 
ATOM   4995 O  O     . PHE B 2 128 ? 20.658 16.572  6.907   1.00 82.00  ? 116  PHE B O     1 
ATOM   4996 C  CB    . PHE B 2 128 ? 21.956 18.898  5.885   1.00 85.25  ? 116  PHE B CB    1 
ATOM   4997 C  CG    . PHE B 2 128 ? 22.628 19.631  4.755   1.00 88.38  ? 116  PHE B CG    1 
ATOM   4998 C  CD1   . PHE B 2 128 ? 22.058 19.664  3.491   1.00 88.98  ? 116  PHE B CD1   1 
ATOM   4999 C  CD2   . PHE B 2 128 ? 23.834 20.284  4.957   1.00 90.07  ? 116  PHE B CD2   1 
ATOM   5000 C  CE1   . PHE B 2 128 ? 22.675 20.338  2.452   1.00 88.60  ? 116  PHE B CE1   1 
ATOM   5001 C  CE2   . PHE B 2 128 ? 24.455 20.959  3.923   1.00 90.06  ? 116  PHE B CE2   1 
ATOM   5002 C  CZ    . PHE B 2 128 ? 23.874 20.986  2.667   1.00 89.14  ? 116  PHE B CZ    1 
ATOM   5003 N  N     . SER B 2 129 ? 18.817 17.819  7.262   1.00 81.07  ? 117  SER B N     1 
ATOM   5004 C  CA    . SER B 2 129 ? 18.235 16.897  8.224   1.00 81.78  ? 117  SER B CA    1 
ATOM   5005 C  C     . SER B 2 129 ? 17.033 16.140  7.679   1.00 79.74  ? 117  SER B C     1 
ATOM   5006 O  O     . SER B 2 129 ? 16.516 15.257  8.372   1.00 80.61  ? 117  SER B O     1 
ATOM   5007 C  CB    . SER B 2 129 ? 17.821 17.648  9.499   1.00 84.57  ? 117  SER B CB    1 
ATOM   5008 O  OG    . SER B 2 129 ? 16.802 18.596  9.226   1.00 85.84  ? 117  SER B OG    1 
ATOM   5009 N  N     . VAL B 2 130 ? 16.579 16.453  6.476   1.00 75.79  ? 118  VAL B N     1 
ATOM   5010 C  CA    . VAL B 2 130 ? 15.410 15.822  5.868   1.00 74.30  ? 118  VAL B CA    1 
ATOM   5011 C  C     . VAL B 2 130 ? 15.882 15.004  4.674   1.00 73.10  ? 118  VAL B C     1 
ATOM   5012 O  O     . VAL B 2 130 ? 16.581 15.543  3.809   1.00 73.40  ? 118  VAL B O     1 
ATOM   5013 C  CB    . VAL B 2 130 ? 14.360 16.861  5.432   1.00 72.26  ? 118  VAL B CB    1 
ATOM   5014 C  CG1   . VAL B 2 130 ? 13.162 16.174  4.796   1.00 71.95  ? 118  VAL B CG1   1 
ATOM   5015 C  CG2   . VAL B 2 130 ? 13.929 17.704  6.619   1.00 68.66  ? 118  VAL B CG2   1 
ATOM   5016 N  N     . PRO B 2 131 ? 15.536 13.722  4.586   1.00 72.30  ? 119  PRO B N     1 
ATOM   5017 C  CA    . PRO B 2 131 ? 15.993 12.916  3.450   1.00 69.89  ? 119  PRO B CA    1 
ATOM   5018 C  C     . PRO B 2 131 ? 15.263 13.291  2.169   1.00 69.66  ? 119  PRO B C     1 
ATOM   5019 O  O     . PRO B 2 131 ? 14.125 13.768  2.188   1.00 71.51  ? 119  PRO B O     1 
ATOM   5020 C  CB    . PRO B 2 131 ? 15.666 11.476  3.874   1.00 71.94  ? 119  PRO B CB    1 
ATOM   5021 C  CG    . PRO B 2 131 ? 15.348 11.546  5.343   1.00 73.03  ? 119  PRO B CG    1 
ATOM   5022 C  CD    . PRO B 2 131 ? 14.798 12.915  5.570   1.00 73.40  ? 119  PRO B CD    1 
ATOM   5023 N  N     . LEU B 2 132 ? 15.937 13.065  1.046   1.00 69.82  ? 120  LEU B N     1 
ATOM   5024 C  CA    . LEU B 2 132 ? 15.402 13.369  -0.273  1.00 70.56  ? 120  LEU B CA    1 
ATOM   5025 C  C     . LEU B 2 132 ? 14.803 12.115  -0.898  1.00 75.79  ? 120  LEU B C     1 
ATOM   5026 O  O     . LEU B 2 132 ? 15.299 11.005  -0.683  1.00 77.79  ? 120  LEU B O     1 
ATOM   5027 C  CB    . LEU B 2 132 ? 16.495 13.940  -1.182  1.00 65.33  ? 120  LEU B CB    1 
ATOM   5028 C  CG    . LEU B 2 132 ? 16.133 14.224  -2.643  1.00 64.27  ? 120  LEU B CG    1 
ATOM   5029 C  CD1   . LEU B 2 132 ? 15.014 15.252  -2.738  1.00 57.86  ? 120  LEU B CD1   1 
ATOM   5030 C  CD2   . LEU B 2 132 ? 17.356 14.676  -3.431  1.00 60.93  ? 120  LEU B CD2   1 
ATOM   5031 N  N     . ASP B 2 133 ? 13.723 12.302  -1.659  1.00 79.43  ? 121  ASP B N     1 
ATOM   5032 C  CA    . ASP B 2 133 ? 13.075 11.200  -2.361  1.00 82.72  ? 121  ASP B CA    1 
ATOM   5033 C  C     . ASP B 2 133 ? 14.086 10.428  -3.199  1.00 80.65  ? 121  ASP B C     1 
ATOM   5034 O  O     . ASP B 2 133 ? 14.887 11.019  -3.929  1.00 78.47  ? 121  ASP B O     1 
ATOM   5035 C  CB    . ASP B 2 133 ? 11.950 11.742  -3.247  1.00 87.80  ? 121  ASP B CB    1 
ATOM   5036 C  CG    . ASP B 2 133 ? 11.170 10.644  -3.947  1.00 93.75  ? 121  ASP B CG    1 
ATOM   5037 O  OD1   . ASP B 2 133 ? 11.277 9.470   -3.534  1.00 97.27  ? 121  ASP B OD1   1 
ATOM   5038 O  OD2   . ASP B 2 133 ? 10.449 10.957  -4.917  1.00 95.13  ? 121  ASP B OD2   1 
ATOM   5039 N  N     . GLU B 2 134 ? 14.037 9.097   -3.090  1.00 82.70  ? 122  GLU B N     1 
ATOM   5040 C  CA    . GLU B 2 134 ? 15.071 8.257   -3.690  1.00 83.61  ? 122  GLU B CA    1 
ATOM   5041 C  C     . GLU B 2 134 ? 15.096 8.393   -5.207  1.00 78.91  ? 122  GLU B C     1 
ATOM   5042 O  O     . GLU B 2 134 ? 16.164 8.554   -5.808  1.00 75.44  ? 122  GLU B O     1 
ATOM   5043 C  CB    . GLU B 2 134 ? 14.862 6.797   -3.281  1.00 89.84  ? 122  GLU B CB    1 
ATOM   5044 C  CG    . GLU B 2 134 ? 15.670 5.794   -4.101  1.00 94.31  ? 122  GLU B CG    1 
ATOM   5045 C  CD    . GLU B 2 134 ? 17.170 6.040   -4.040  1.00 97.78  ? 122  GLU B CD    1 
ATOM   5046 O  OE1   . GLU B 2 134 ? 17.660 6.537   -3.004  1.00 99.92  ? 122  GLU B OE1   1 
ATOM   5047 O  OE2   . GLU B 2 134 ? 17.863 5.736   -5.036  1.00 97.71  ? 122  GLU B OE2   1 
ATOM   5048 N  N     . ASP B 2 135 ? 13.927 8.327   -5.849  1.00 78.70  ? 123  ASP B N     1 
ATOM   5049 C  CA    . ASP B 2 135 ? 13.880 8.409   -7.304  1.00 77.48  ? 123  ASP B CA    1 
ATOM   5050 C  C     . ASP B 2 135 ? 14.240 9.792   -7.832  1.00 73.08  ? 123  ASP B C     1 
ATOM   5051 O  O     . ASP B 2 135 ? 14.502 9.928   -9.032  1.00 71.66  ? 123  ASP B O     1 
ATOM   5052 C  CB    . ASP B 2 135 ? 12.497 8.005   -7.816  1.00 83.48  ? 123  ASP B CB    1 
ATOM   5053 C  CG    . ASP B 2 135 ? 12.198 6.534   -7.591  1.00 90.22  ? 123  ASP B CG    1 
ATOM   5054 O  OD1   . ASP B 2 135 ? 11.577 6.201   -6.560  1.00 94.12  ? 123  ASP B OD1   1 
ATOM   5055 O  OD2   . ASP B 2 135 ? 12.592 5.708   -8.442  1.00 91.27  ? 123  ASP B OD2   1 
ATOM   5056 N  N     . PHE B 2 136 ? 14.266 10.811  -6.975  1.00 69.74  ? 124  PHE B N     1 
ATOM   5057 C  CA    . PHE B 2 136 ? 14.620 12.157  -7.400  1.00 66.55  ? 124  PHE B CA    1 
ATOM   5058 C  C     . PHE B 2 136 ? 16.110 12.445  -7.273  1.00 63.42  ? 124  PHE B C     1 
ATOM   5059 O  O     . PHE B 2 136 ? 16.601 13.384  -7.911  1.00 60.17  ? 124  PHE B O     1 
ATOM   5060 C  CB    . PHE B 2 136 ? 13.829 13.188  -6.586  1.00 66.03  ? 124  PHE B CB    1 
ATOM   5061 C  CG    . PHE B 2 136 ? 13.771 14.547  -7.218  1.00 63.51  ? 124  PHE B CG    1 
ATOM   5062 C  CD1   . PHE B 2 136 ? 12.787 14.851  -8.145  1.00 64.75  ? 124  PHE B CD1   1 
ATOM   5063 C  CD2   . PHE B 2 136 ? 14.694 15.524  -6.885  1.00 61.36  ? 124  PHE B CD2   1 
ATOM   5064 C  CE1   . PHE B 2 136 ? 12.728 16.102  -8.731  1.00 63.90  ? 124  PHE B CE1   1 
ATOM   5065 C  CE2   . PHE B 2 136 ? 14.641 16.775  -7.467  1.00 60.39  ? 124  PHE B CE2   1 
ATOM   5066 C  CZ    . PHE B 2 136 ? 13.655 17.065  -8.391  1.00 61.39  ? 124  PHE B CZ    1 
ATOM   5067 N  N     . ARG B 2 137 ? 16.840 11.644  -6.490  1.00 62.28  ? 125  ARG B N     1 
ATOM   5068 C  CA    . ARG B 2 137 ? 18.236 11.950  -6.190  1.00 58.96  ? 125  ARG B CA    1 
ATOM   5069 C  C     . ARG B 2 137 ? 19.105 11.978  -7.440  1.00 56.18  ? 125  ARG B C     1 
ATOM   5070 O  O     . ARG B 2 137 ? 20.087 12.727  -7.492  1.00 55.36  ? 125  ARG B O     1 
ATOM   5071 C  CB    . ARG B 2 137 ? 18.783 10.936  -5.185  1.00 58.66  ? 125  ARG B CB    1 
ATOM   5072 C  CG    . ARG B 2 137 ? 18.073 10.993  -3.847  1.00 62.42  ? 125  ARG B CG    1 
ATOM   5073 C  CD    . ARG B 2 137 ? 18.579 9.946   -2.878  1.00 63.35  ? 125  ARG B CD    1 
ATOM   5074 N  NE    . ARG B 2 137 ? 17.919 10.073  -1.582  1.00 66.28  ? 125  ARG B NE    1 
ATOM   5075 C  CZ    . ARG B 2 137 ? 18.127 9.260   -0.553  1.00 68.01  ? 125  ARG B CZ    1 
ATOM   5076 N  NH1   . ARG B 2 137 ? 18.980 8.251   -0.665  1.00 66.34  ? 125  ARG B NH1   1 
ATOM   5077 N  NH2   . ARG B 2 137 ? 17.482 9.456   0.589   1.00 70.57  ? 125  ARG B NH2   1 
ATOM   5078 N  N     . LYS B 2 138 ? 18.763 11.181  -8.454  1.00 55.89  ? 126  LYS B N     1 
ATOM   5079 C  CA    . LYS B 2 138 ? 19.563 11.139  -9.673  1.00 54.07  ? 126  LYS B CA    1 
ATOM   5080 C  C     . LYS B 2 138 ? 19.626 12.491  -10.376 1.00 54.30  ? 126  LYS B C     1 
ATOM   5081 O  O     . LYS B 2 138 ? 20.573 12.741  -11.129 1.00 50.96  ? 126  LYS B O     1 
ATOM   5082 C  CB    . LYS B 2 138 ? 19.006 10.076  -10.625 1.00 54.30  ? 126  LYS B CB    1 
ATOM   5083 C  CG    . LYS B 2 138 ? 17.537 10.266  -10.976 1.00 56.67  ? 126  LYS B CG    1 
ATOM   5084 C  CD    . LYS B 2 138 ? 17.021 9.140   -11.859 1.00 57.79  ? 126  LYS B CD    1 
ATOM   5085 N  N     . TYR B 2 139 ? 18.649 13.368  -10.142 1.00 55.80  ? 127  TYR B N     1 
ATOM   5086 C  CA    . TYR B 2 139 ? 18.605 14.665  -10.804 1.00 54.75  ? 127  TYR B CA    1 
ATOM   5087 C  C     . TYR B 2 139 ? 19.505 15.708  -10.151 1.00 52.78  ? 127  TYR B C     1 
ATOM   5088 O  O     . TYR B 2 139 ? 19.724 16.769  -10.747 1.00 49.70  ? 127  TYR B O     1 
ATOM   5089 C  CB    . TYR B 2 139 ? 17.165 15.185  -10.837 1.00 56.01  ? 127  TYR B CB    1 
ATOM   5090 C  CG    . TYR B 2 139 ? 16.199 14.269  -11.549 1.00 59.39  ? 127  TYR B CG    1 
ATOM   5091 C  CD1   . TYR B 2 139 ? 16.531 13.683  -12.763 1.00 59.98  ? 127  TYR B CD1   1 
ATOM   5092 C  CD2   . TYR B 2 139 ? 14.954 13.981  -11.001 1.00 63.32  ? 127  TYR B CD2   1 
ATOM   5093 C  CE1   . TYR B 2 139 ? 15.648 12.841  -13.416 1.00 62.74  ? 127  TYR B CE1   1 
ATOM   5094 C  CE2   . TYR B 2 139 ? 14.066 13.141  -11.645 1.00 64.47  ? 127  TYR B CE2   1 
ATOM   5095 C  CZ    . TYR B 2 139 ? 14.418 12.573  -12.851 1.00 65.08  ? 127  TYR B CZ    1 
ATOM   5096 O  OH    . TYR B 2 139 ? 13.536 11.736  -13.497 1.00 67.72  ? 127  TYR B OH    1 
ATOM   5097 N  N     . THR B 2 140 ? 20.024 15.442  -8.952  1.00 52.68  ? 128  THR B N     1 
ATOM   5098 C  CA    . THR B 2 140 ? 20.843 16.400  -8.221  1.00 53.51  ? 128  THR B CA    1 
ATOM   5099 C  C     . THR B 2 140 ? 22.337 16.164  -8.419  1.00 49.61  ? 128  THR B C     1 
ATOM   5100 O  O     . THR B 2 140 ? 23.144 16.641  -7.615  1.00 49.13  ? 128  THR B O     1 
ATOM   5101 C  CB    . THR B 2 140 ? 20.500 16.362  -6.731  1.00 56.41  ? 128  THR B CB    1 
ATOM   5102 O  OG1   . THR B 2 140 ? 20.967 15.131  -6.164  1.00 58.73  ? 128  THR B OG1   1 
ATOM   5103 C  CG2   . THR B 2 140 ? 18.995 16.466  -6.527  1.00 56.41  ? 128  THR B CG2   1 
ATOM   5104 N  N     . ALA B 2 141 ? 22.715 15.448  -9.475  1.00 48.40  ? 129  ALA B N     1 
ATOM   5105 C  CA    . ALA B 2 141 ? 24.110 15.094  -9.699  1.00 44.51  ? 129  ALA B CA    1 
ATOM   5106 C  C     . ALA B 2 141 ? 24.968 16.325  -9.975  1.00 44.30  ? 129  ALA B C     1 
ATOM   5107 O  O     . ALA B 2 141 ? 24.527 17.281  -10.620 1.00 43.67  ? 129  ALA B O     1 
ATOM   5108 C  CB    . ALA B 2 141 ? 24.217 14.119  -10.870 1.00 42.98  ? 129  ALA B CB    1 
ATOM   5109 N  N     . PHE B 2 142 ? 26.208 16.291  -9.487  1.00 43.85  ? 130  PHE B N     1 
ATOM   5110 C  CA    . PHE B 2 142 ? 27.175 17.339  -9.785  1.00 43.38  ? 130  PHE B CA    1 
ATOM   5111 C  C     . PHE B 2 142 ? 28.571 16.731  -9.838  1.00 43.17  ? 130  PHE B C     1 
ATOM   5112 O  O     . PHE B 2 142 ? 28.815 15.635  -9.326  1.00 38.26  ? 130  PHE B O     1 
ATOM   5113 C  CB    . PHE B 2 142 ? 27.110 18.486  -8.765  1.00 39.64  ? 130  PHE B CB    1 
ATOM   5114 C  CG    . PHE B 2 142 ? 27.430 18.076  -7.359  1.00 44.29  ? 130  PHE B CG    1 
ATOM   5115 C  CD1   . PHE B 2 142 ? 28.718 18.195  -6.864  1.00 43.70  ? 130  PHE B CD1   1 
ATOM   5116 C  CD2   . PHE B 2 142 ? 26.441 17.584  -6.524  1.00 44.11  ? 130  PHE B CD2   1 
ATOM   5117 C  CE1   . PHE B 2 142 ? 29.017 17.820  -5.567  1.00 42.92  ? 130  PHE B CE1   1 
ATOM   5118 C  CE2   . PHE B 2 142 ? 26.734 17.210  -5.227  1.00 44.28  ? 130  PHE B CE2   1 
ATOM   5119 C  CZ    . PHE B 2 142 ? 28.025 17.329  -4.749  1.00 42.22  ? 130  PHE B CZ    1 
ATOM   5120 N  N     . THR B 2 143 ? 29.491 17.459  -10.469 1.00 40.95  ? 131  THR B N     1 
ATOM   5121 C  CA    . THR B 2 143 ? 30.819 16.946  -10.785 1.00 38.51  ? 131  THR B CA    1 
ATOM   5122 C  C     . THR B 2 143 ? 31.881 17.918  -10.290 1.00 43.27  ? 131  THR B C     1 
ATOM   5123 O  O     . THR B 2 143 ? 31.908 19.079  -10.714 1.00 45.52  ? 131  THR B O     1 
ATOM   5124 C  CB    . THR B 2 143 ? 30.976 16.724  -12.293 1.00 37.17  ? 131  THR B CB    1 
ATOM   5125 O  OG1   . THR B 2 143 ? 29.844 16.007  -12.797 1.00 40.51  ? 131  THR B OG1   1 
ATOM   5126 C  CG2   . THR B 2 143 ? 32.236 15.930  -12.587 1.00 35.64  ? 131  THR B CG2   1 
ATOM   5127 N  N     . ILE B 2 144 ? 32.760 17.439  -9.415  1.00 42.94  ? 132  ILE B N     1 
ATOM   5128 C  CA    . ILE B 2 144 ? 33.929 18.196  -8.973  1.00 45.29  ? 132  ILE B CA    1 
ATOM   5129 C  C     . ILE B 2 144 ? 35.052 17.980  -9.980  1.00 45.88  ? 132  ILE B C     1 
ATOM   5130 O  O     . ILE B 2 144 ? 35.438 16.829  -10.246 1.00 47.76  ? 132  ILE B O     1 
ATOM   5131 C  CB    . ILE B 2 144 ? 34.375 17.780  -7.563  1.00 45.18  ? 132  ILE B CB    1 
ATOM   5132 C  CG1   . ILE B 2 144 ? 33.236 17.962  -6.564  1.00 47.86  ? 132  ILE B CG1   1 
ATOM   5133 C  CG2   . ILE B 2 144 ? 35.588 18.589  -7.124  1.00 42.90  ? 132  ILE B CG2   1 
ATOM   5134 C  CD1   . ILE B 2 144 ? 33.592 17.496  -5.180  1.00 51.53  ? 132  ILE B CD1   1 
ATOM   5135 N  N     . PRO B 2 145 ? 35.594 19.049  -10.567 1.00 41.37  ? 133  PRO B N     1 
ATOM   5136 C  CA    . PRO B 2 145 ? 36.704 18.897  -11.514 1.00 39.30  ? 133  PRO B CA    1 
ATOM   5137 C  C     . PRO B 2 145 ? 38.048 18.846  -10.810 1.00 37.15  ? 133  PRO B C     1 
ATOM   5138 O  O     . PRO B 2 145 ? 38.118 18.957  -9.582  1.00 37.31  ? 133  PRO B O     1 
ATOM   5139 C  CB    . PRO B 2 145 ? 36.576 20.145  -12.391 1.00 42.35  ? 133  PRO B CB    1 
ATOM   5140 C  CG    . PRO B 2 145 ? 36.034 21.178  -11.446 1.00 43.96  ? 133  PRO B CG    1 
ATOM   5141 C  CD    . PRO B 2 145 ? 35.126 20.444  -10.483 1.00 42.57  ? 133  PRO B CD    1 
ATOM   5142 N  N     . SER B 2 146 ? 39.122 18.678  -11.577 1.00 36.93  ? 134  SER B N     1 
ATOM   5143 C  CA    . SER B 2 146 ? 40.472 18.656  -11.036 1.00 38.27  ? 134  SER B CA    1 
ATOM   5144 C  C     . SER B 2 146 ? 41.347 19.617  -11.826 1.00 38.28  ? 134  SER B C     1 
ATOM   5145 O  O     . SER B 2 146 ? 41.151 19.815  -13.028 1.00 37.72  ? 134  SER B O     1 
ATOM   5146 C  CB    . SER B 2 146 ? 41.079 17.242  -11.070 1.00 39.64  ? 134  SER B CB    1 
ATOM   5147 O  OG    . SER B 2 146 ? 41.186 16.760  -12.398 1.00 38.16  ? 134  SER B OG    1 
ATOM   5148 N  N     . ILE B 2 147 ? 42.313 20.221  -11.129 1.00 39.19  ? 135  ILE B N     1 
ATOM   5149 C  CA    . ILE B 2 147 ? 43.245 21.134  -11.778 1.00 37.66  ? 135  ILE B CA    1 
ATOM   5150 C  C     . ILE B 2 147 ? 44.029 20.387  -12.847 1.00 39.19  ? 135  ILE B C     1 
ATOM   5151 O  O     . ILE B 2 147 ? 44.549 19.290  -12.608 1.00 39.82  ? 135  ILE B O     1 
ATOM   5152 C  CB    . ILE B 2 147 ? 44.177 21.771  -10.737 1.00 40.03  ? 135  ILE B CB    1 
ATOM   5153 C  CG1   . ILE B 2 147 ? 43.392 22.718  -9.826  1.00 46.39  ? 135  ILE B CG1   1 
ATOM   5154 C  CG2   . ILE B 2 147 ? 45.319 22.515  -11.416 1.00 40.89  ? 135  ILE B CG2   1 
ATOM   5155 C  CD1   . ILE B 2 147 ? 43.322 22.266  -8.383  1.00 47.56  ? 135  ILE B CD1   1 
ATOM   5156 N  N     . ASN B 2 148 ? 44.102 20.978  -14.042 1.00 40.38  ? 136  ASN B N     1 
ATOM   5157 C  CA    . ASN B 2 148 ? 44.863 20.444  -15.171 1.00 39.76  ? 136  ASN B CA    1 
ATOM   5158 C  C     . ASN B 2 148 ? 44.366 19.070  -15.608 1.00 37.46  ? 136  ASN B C     1 
ATOM   5159 O  O     . ASN B 2 148 ? 45.096 18.325  -16.270 1.00 31.96  ? 136  ASN B O     1 
ATOM   5160 C  CB    . ASN B 2 148 ? 46.364 20.390  -14.852 1.00 39.59  ? 136  ASN B CB    1 
ATOM   5161 C  CG    . ASN B 2 148 ? 47.223 20.244  -16.095 1.00 34.28  ? 136  ASN B CG    1 
ATOM   5162 O  OD1   . ASN B 2 148 ? 46.802 20.588  -17.200 1.00 33.90  ? 136  ASN B OD1   1 
ATOM   5163 N  ND2   . ASN B 2 148 ? 48.430 19.723  -15.920 1.00 34.55  ? 136  ASN B ND2   1 
ATOM   5164 N  N     . ASN B 2 149 ? 43.130 18.725  -15.251 1.00 33.88  ? 137  ASN B N     1 
ATOM   5165 C  CA    . ASN B 2 149 ? 42.523 17.453  -15.641 1.00 34.77  ? 137  ASN B CA    1 
ATOM   5166 C  C     . ASN B 2 149 ? 43.429 16.282  -15.270 1.00 36.32  ? 137  ASN B C     1 
ATOM   5167 O  O     . ASN B 2 149 ? 43.607 15.335  -16.035 1.00 30.11  ? 137  ASN B O     1 
ATOM   5168 C  CB    . ASN B 2 149 ? 42.180 17.442  -17.129 1.00 30.66  ? 137  ASN B CB    1 
ATOM   5169 C  CG    . ASN B 2 149 ? 41.097 18.444  -17.478 1.00 36.29  ? 137  ASN B CG    1 
ATOM   5170 O  OD1   . ASN B 2 149 ? 39.918 18.211  -17.213 1.00 31.07  ? 137  ASN B OD1   1 
ATOM   5171 N  ND2   . ASN B 2 149 ? 41.490 19.569  -18.068 1.00 31.61  ? 137  ASN B ND2   1 
ATOM   5172 N  N     . GLU B 2 150 ? 44.033 16.377  -14.085 1.00 36.82  ? 138  GLU B N     1 
ATOM   5173 C  CA    . GLU B 2 150 ? 44.805 15.276  -13.528 1.00 34.63  ? 138  GLU B CA    1 
ATOM   5174 C  C     . GLU B 2 150 ? 43.960 14.023  -13.370 1.00 37.99  ? 138  GLU B C     1 
ATOM   5175 O  O     . GLU B 2 150 ? 44.497 12.910  -13.372 1.00 41.45  ? 138  GLU B O     1 
ATOM   5176 C  CB    . GLU B 2 150 ? 45.376 15.711  -12.174 1.00 33.25  ? 138  GLU B CB    1 
ATOM   5177 C  CG    . GLU B 2 150 ? 46.155 14.661  -11.405 1.00 36.28  ? 138  GLU B CG    1 
ATOM   5178 C  CD    . GLU B 2 150 ? 46.506 15.127  -10.004 1.00 45.28  ? 138  GLU B CD    1 
ATOM   5179 O  OE1   . GLU B 2 150 ? 46.198 14.402  -9.034  1.00 48.32  ? 138  GLU B OE1   1 
ATOM   5180 O  OE2   . GLU B 2 150 ? 47.077 16.231  -9.872  1.00 47.30  ? 138  GLU B OE2   1 
ATOM   5181 N  N     . THR B 2 151 ? 42.643 14.183  -13.274 1.00 38.39  ? 139  THR B N     1 
ATOM   5182 C  CA    . THR B 2 151 ? 41.750 13.155  -12.828 1.00 38.92  ? 139  THR B CA    1 
ATOM   5183 C  C     . THR B 2 151 ? 40.399 13.424  -13.474 1.00 45.26  ? 139  THR B C     1 
ATOM   5184 O  O     . THR B 2 151 ? 40.049 14.594  -13.687 1.00 49.25  ? 139  THR B O     1 
ATOM   5185 C  CB    . THR B 2 151 ? 41.662 13.171  -11.291 1.00 37.80  ? 139  THR B CB    1 
ATOM   5186 O  OG1   . THR B 2 151 ? 42.226 11.969  -10.756 1.00 44.24  ? 139  THR B OG1   1 
ATOM   5187 C  CG2   . THR B 2 151 ? 40.250 13.330  -10.797 1.00 34.46  ? 139  THR B CG2   1 
ATOM   5188 N  N     . PRO B 2 152 ? 39.656 12.386  -13.858 1.00 45.76  ? 140  PRO B N     1 
ATOM   5189 C  CA    . PRO B 2 152 ? 38.302 12.607  -14.378 1.00 43.19  ? 140  PRO B CA    1 
ATOM   5190 C  C     . PRO B 2 152 ? 37.414 13.231  -13.312 1.00 40.92  ? 140  PRO B C     1 
ATOM   5191 O  O     . PRO B 2 152 ? 37.662 13.106  -12.115 1.00 42.94  ? 140  PRO B O     1 
ATOM   5192 C  CB    . PRO B 2 152 ? 37.822 11.196  -14.746 1.00 43.23  ? 140  PRO B CB    1 
ATOM   5193 C  CG    . PRO B 2 152 ? 39.077 10.381  -14.889 1.00 42.12  ? 140  PRO B CG    1 
ATOM   5194 C  CD    . PRO B 2 152 ? 40.061 10.971  -13.924 1.00 43.73  ? 140  PRO B CD    1 
ATOM   5195 N  N     . GLY B 2 153 ? 36.367 13.915  -13.757 1.00 39.28  ? 141  GLY B N     1 
ATOM   5196 C  CA    . GLY B 2 153 ? 35.446 14.522  -12.815 1.00 41.83  ? 141  GLY B CA    1 
ATOM   5197 C  C     . GLY B 2 153 ? 34.889 13.544  -11.795 1.00 42.33  ? 141  GLY B C     1 
ATOM   5198 O  O     . GLY B 2 153 ? 34.533 12.416  -12.146 1.00 46.27  ? 141  GLY B O     1 
ATOM   5199 N  N     . ILE B 2 154 ? 34.822 13.952  -10.530 1.00 41.92  ? 142  ILE B N     1 
ATOM   5200 C  CA    . ILE B 2 154 ? 34.288 13.112  -9.460  1.00 41.21  ? 142  ILE B CA    1 
ATOM   5201 C  C     . ILE B 2 154 ? 32.832 13.501  -9.237  1.00 42.74  ? 142  ILE B C     1 
ATOM   5202 O  O     . ILE B 2 154 ? 32.538 14.647  -8.885  1.00 44.58  ? 142  ILE B O     1 
ATOM   5203 C  CB    . ILE B 2 154 ? 35.100 13.262  -8.165  1.00 42.18  ? 142  ILE B CB    1 
ATOM   5204 C  CG1   . ILE B 2 154 ? 36.603 13.320  -8.469  1.00 43.06  ? 142  ILE B CG1   1 
ATOM   5205 C  CG2   . ILE B 2 154 ? 34.766 12.129  -7.201  1.00 42.65  ? 142  ILE B CG2   1 
ATOM   5206 C  CD1   . ILE B 2 154 ? 37.292 11.973  -8.505  1.00 40.42  ? 142  ILE B CD1   1 
ATOM   5207 N  N     . ARG B 2 155 ? 31.917 12.555  -9.429  1.00 42.88  ? 143  ARG B N     1 
ATOM   5208 C  CA    . ARG B 2 155 ? 30.491 12.851  -9.469  1.00 43.27  ? 143  ARG B CA    1 
ATOM   5209 C  C     . ARG B 2 155 ? 29.791 12.403  -8.191  1.00 45.17  ? 143  ARG B C     1 
ATOM   5210 O  O     . ARG B 2 155 ? 30.031 11.300  -7.689  1.00 46.41  ? 143  ARG B O     1 
ATOM   5211 C  CB    . ARG B 2 155 ? 29.839 12.187  -10.685 1.00 44.56  ? 143  ARG B CB    1 
ATOM   5212 C  CG    . ARG B 2 155 ? 30.147 12.898  -11.994 1.00 44.34  ? 143  ARG B CG    1 
ATOM   5213 C  CD    . ARG B 2 155 ? 29.692 12.099  -13.203 1.00 44.74  ? 143  ARG B CD    1 
ATOM   5214 N  NE    . ARG B 2 155 ? 28.301 11.673  -13.099 1.00 44.21  ? 143  ARG B NE    1 
ATOM   5215 C  CZ    . ARG B 2 155 ? 27.258 12.468  -13.312 1.00 44.46  ? 143  ARG B CZ    1 
ATOM   5216 N  NH1   . ARG B 2 155 ? 27.445 13.741  -13.630 1.00 42.24  ? 143  ARG B NH1   1 
ATOM   5217 N  NH2   . ARG B 2 155 ? 26.027 11.991  -13.200 1.00 47.73  ? 143  ARG B NH2   1 
ATOM   5218 N  N     . TYR B 2 156 ? 28.904 13.263  -7.689  1.00 46.29  ? 144  TYR B N     1 
ATOM   5219 C  CA    . TYR B 2 156 ? 28.099 12.989  -6.508  1.00 41.33  ? 144  TYR B CA    1 
ATOM   5220 C  C     . TYR B 2 156 ? 26.628 13.238  -6.808  1.00 60.83  ? 144  TYR B C     1 
ATOM   5221 O  O     . TYR B 2 156 ? 26.268 13.933  -7.763  1.00 59.67  ? 144  TYR B O     1 
ATOM   5222 C  CB    . TYR B 2 156 ? 28.498 13.866  -5.312  1.00 41.89  ? 144  TYR B CB    1 
ATOM   5223 C  CG    . TYR B 2 156 ? 29.891 13.651  -4.780  1.00 46.87  ? 144  TYR B CG    1 
ATOM   5224 C  CD1   . TYR B 2 156 ? 30.973 14.329  -5.322  1.00 45.74  ? 144  TYR B CD1   1 
ATOM   5225 C  CD2   . TYR B 2 156 ? 30.122 12.791  -3.715  1.00 49.97  ? 144  TYR B CD2   1 
ATOM   5226 C  CE1   . TYR B 2 156 ? 32.251 14.144  -4.829  1.00 46.75  ? 144  TYR B CE1   1 
ATOM   5227 C  CE2   . TYR B 2 156 ? 31.395 12.599  -3.216  1.00 50.42  ? 144  TYR B CE2   1 
ATOM   5228 C  CZ    . TYR B 2 156 ? 32.455 13.279  -3.776  1.00 50.17  ? 144  TYR B CZ    1 
ATOM   5229 O  OH    . TYR B 2 156 ? 33.724 13.090  -3.281  1.00 54.59  ? 144  TYR B OH    1 
ATOM   5230 N  N     . GLN B 2 157 ? 25.780 12.666  -5.958  1.00 43.85  ? 145  GLN B N     1 
ATOM   5231 C  CA    . GLN B 2 157 ? 24.366 13.001  -5.909  1.00 50.42  ? 145  GLN B CA    1 
ATOM   5232 C  C     . GLN B 2 157 ? 23.967 13.218  -4.455  1.00 51.01  ? 145  GLN B C     1 
ATOM   5233 O  O     . GLN B 2 157 ? 24.644 12.763  -3.528  1.00 49.80  ? 145  GLN B O     1 
ATOM   5234 C  CB    . GLN B 2 157 ? 23.490 11.916  -6.551  1.00 48.34  ? 145  GLN B CB    1 
ATOM   5235 C  CG    . GLN B 2 157 ? 23.185 10.739  -5.648  1.00 49.55  ? 145  GLN B CG    1 
ATOM   5236 C  CD    . GLN B 2 157 ? 22.262 9.725   -6.302  1.00 52.10  ? 145  GLN B CD    1 
ATOM   5237 O  OE1   . GLN B 2 157 ? 22.006 9.783   -7.507  1.00 50.14  ? 145  GLN B OE1   1 
ATOM   5238 N  NE2   . GLN B 2 157 ? 21.755 8.789   -5.506  1.00 52.98  ? 145  GLN B NE2   1 
ATOM   5239 N  N     . TYR B 2 158 ? 22.862 13.931  -4.263  1.00 51.29  ? 146  TYR B N     1 
ATOM   5240 C  CA    . TYR B 2 158 ? 22.398 14.282  -2.930  1.00 53.08  ? 146  TYR B CA    1 
ATOM   5241 C  C     . TYR B 2 158 ? 21.510 13.188  -2.350  1.00 55.09  ? 146  TYR B C     1 
ATOM   5242 O  O     . TYR B 2 158 ? 20.783 12.500  -3.070  1.00 56.93  ? 146  TYR B O     1 
ATOM   5243 C  CB    . TYR B 2 158 ? 21.636 15.609  -2.954  1.00 53.11  ? 146  TYR B CB    1 
ATOM   5244 C  CG    . TYR B 2 158 ? 22.499 16.814  -2.654  1.00 53.05  ? 146  TYR B CG    1 
ATOM   5245 C  CD1   . TYR B 2 158 ? 22.693 17.243  -1.347  1.00 54.36  ? 146  TYR B CD1   1 
ATOM   5246 C  CD2   . TYR B 2 158 ? 23.121 17.523  -3.675  1.00 50.00  ? 146  TYR B CD2   1 
ATOM   5247 C  CE1   . TYR B 2 158 ? 23.480 18.341  -1.063  1.00 53.86  ? 146  TYR B CE1   1 
ATOM   5248 C  CE2   . TYR B 2 158 ? 23.912 18.622  -3.400  1.00 50.03  ? 146  TYR B CE2   1 
ATOM   5249 C  CZ    . TYR B 2 158 ? 24.087 19.027  -2.092  1.00 53.37  ? 146  TYR B CZ    1 
ATOM   5250 O  OH    . TYR B 2 158 ? 24.873 20.121  -1.807  1.00 55.73  ? 146  TYR B OH    1 
ATOM   5251 N  N     . ASN B 2 159 ? 21.586 13.032  -1.028  1.00 55.95  ? 147  ASN B N     1 
ATOM   5252 C  CA    . ASN B 2 159 ? 20.712 12.136  -0.283  1.00 60.31  ? 147  ASN B CA    1 
ATOM   5253 C  C     . ASN B 2 159 ? 19.742 12.878  0.625   1.00 64.84  ? 147  ASN B C     1 
ATOM   5254 O  O     . ASN B 2 159 ? 18.872 12.241  1.229   1.00 64.94  ? 147  ASN B O     1 
ATOM   5255 C  CB    . ASN B 2 159 ? 21.542 11.158  0.560   1.00 59.31  ? 147  ASN B CB    1 
ATOM   5256 C  CG    . ASN B 2 159 ? 22.395 10.231  -0.286  1.00 60.30  ? 147  ASN B CG    1 
ATOM   5257 O  OD1   . ASN B 2 159 ? 21.964 9.749   -1.333  1.00 60.87  ? 147  ASN B OD1   1 
ATOM   5258 N  ND2   . ASN B 2 159 ? 23.618 9.977   0.168   1.00 60.22  ? 147  ASN B ND2   1 
ATOM   5259 N  N     . VAL B 2 160 ? 19.875 14.199  0.740   1.00 63.88  ? 148  VAL B N     1 
ATOM   5260 C  CA    . VAL B 2 160 ? 19.034 15.028  1.587   1.00 65.90  ? 148  VAL B CA    1 
ATOM   5261 C  C     . VAL B 2 160 ? 18.586 16.242  0.779   1.00 65.69  ? 148  VAL B C     1 
ATOM   5262 O  O     . VAL B 2 160 ? 18.967 16.413  -0.378  1.00 67.62  ? 148  VAL B O     1 
ATOM   5263 C  CB    . VAL B 2 160 ? 19.758 15.465  2.877   1.00 66.58  ? 148  VAL B CB    1 
ATOM   5264 C  CG1   . VAL B 2 160 ? 20.085 14.257  3.743   1.00 59.66  ? 148  VAL B CG1   1 
ATOM   5265 C  CG2   . VAL B 2 160 ? 21.020 16.245  2.535   1.00 61.75  ? 148  VAL B CG2   1 
ATOM   5266 N  N     . LEU B 2 161 ? 17.764 17.086  1.406   1.00 64.36  ? 149  LEU B N     1 
ATOM   5267 C  CA    . LEU B 2 161 ? 17.317 18.323  0.776   1.00 61.71  ? 149  LEU B CA    1 
ATOM   5268 C  C     . LEU B 2 161 ? 18.523 19.209  0.487   1.00 58.99  ? 149  LEU B C     1 
ATOM   5269 O  O     . LEU B 2 161 ? 19.178 19.692  1.420   1.00 60.62  ? 149  LEU B O     1 
ATOM   5270 C  CB    . LEU B 2 161 ? 16.314 19.065  1.663   1.00 62.00  ? 149  LEU B CB    1 
ATOM   5271 C  CG    . LEU B 2 161 ? 14.999 18.360  2.003   1.00 63.88  ? 149  LEU B CG    1 
ATOM   5272 C  CD1   . LEU B 2 161 ? 14.057 19.325  2.702   1.00 64.07  ? 149  LEU B CD1   1 
ATOM   5273 C  CD2   . LEU B 2 161 ? 14.351 17.776  0.756   1.00 62.97  ? 149  LEU B CD2   1 
ATOM   5274 N  N     . PRO B 2 162 ? 18.855 19.439  -0.781  1.00 55.97  ? 150  PRO B N     1 
ATOM   5275 C  CA    . PRO B 2 162 ? 20.057 20.217  -1.095  1.00 55.66  ? 150  PRO B CA    1 
ATOM   5276 C  C     . PRO B 2 162 ? 19.798 21.714  -1.019  1.00 54.40  ? 150  PRO B C     1 
ATOM   5277 O  O     . PRO B 2 162 ? 18.720 22.199  -1.368  1.00 52.76  ? 150  PRO B O     1 
ATOM   5278 C  CB    . PRO B 2 162 ? 20.386 19.780  -2.528  1.00 52.77  ? 150  PRO B CB    1 
ATOM   5279 C  CG    . PRO B 2 162 ? 19.046 19.467  -3.120  1.00 52.44  ? 150  PRO B CG    1 
ATOM   5280 C  CD    . PRO B 2 162 ? 18.175 18.952  -1.995  1.00 54.52  ? 150  PRO B CD    1 
ATOM   5281 N  N     . GLN B 2 163 ? 20.806 22.445  -0.544  1.00 55.42  ? 151  GLN B N     1 
ATOM   5282 C  CA    . GLN B 2 163 ? 20.734 23.900  -0.528  1.00 53.92  ? 151  GLN B CA    1 
ATOM   5283 C  C     . GLN B 2 163 ? 20.644 24.440  -1.949  1.00 51.50  ? 151  GLN B C     1 
ATOM   5284 O  O     . GLN B 2 163 ? 21.387 24.013  -2.837  1.00 48.19  ? 151  GLN B O     1 
ATOM   5285 C  CB    . GLN B 2 163 ? 21.958 24.486  0.176   1.00 56.99  ? 151  GLN B CB    1 
ATOM   5286 C  CG    . GLN B 2 163 ? 21.977 24.292  1.681   1.00 64.48  ? 151  GLN B CG    1 
ATOM   5287 C  CD    . GLN B 2 163 ? 23.280 24.753  2.305   1.00 69.56  ? 151  GLN B CD    1 
ATOM   5288 O  OE1   . GLN B 2 163 ? 23.285 25.542  3.250   1.00 70.95  ? 151  GLN B OE1   1 
ATOM   5289 N  NE2   . GLN B 2 163 ? 24.394 24.257  1.781   1.00 72.55  ? 151  GLN B NE2   1 
ATOM   5290 N  N     . GLY B 2 164 ? 19.727 25.381  -2.162  1.00 51.96  ? 152  GLY B N     1 
ATOM   5291 C  CA    . GLY B 2 164 ? 19.566 26.011  -3.454  1.00 49.15  ? 152  GLY B CA    1 
ATOM   5292 C  C     . GLY B 2 164 ? 18.544 25.371  -4.367  1.00 49.30  ? 152  GLY B C     1 
ATOM   5293 O  O     . GLY B 2 164 ? 18.398 25.818  -5.511  1.00 48.70  ? 152  GLY B O     1 
ATOM   5294 N  N     . TRP B 2 165 ? 17.837 24.345  -3.907  1.00 51.08  ? 153  TRP B N     1 
ATOM   5295 C  CA    . TRP B 2 165 ? 16.815 23.680  -4.702  1.00 52.95  ? 153  TRP B CA    1 
ATOM   5296 C  C     . TRP B 2 165 ? 15.439 24.201  -4.310  1.00 54.94  ? 153  TRP B C     1 
ATOM   5297 O  O     . TRP B 2 165 ? 15.174 24.453  -3.131  1.00 55.86  ? 153  TRP B O     1 
ATOM   5298 C  CB    . TRP B 2 165 ? 16.886 22.161  -4.521  1.00 54.15  ? 153  TRP B CB    1 
ATOM   5299 C  CG    . TRP B 2 165 ? 15.764 21.404  -5.177  1.00 56.39  ? 153  TRP B CG    1 
ATOM   5300 C  CD1   . TRP B 2 165 ? 15.359 21.498  -6.478  1.00 55.27  ? 153  TRP B CD1   1 
ATOM   5301 C  CD2   . TRP B 2 165 ? 14.919 20.421  -4.564  1.00 56.16  ? 153  TRP B CD2   1 
ATOM   5302 N  NE1   . TRP B 2 165 ? 14.307 20.644  -6.709  1.00 56.96  ? 153  TRP B NE1   1 
ATOM   5303 C  CE2   . TRP B 2 165 ? 14.019 19.970  -5.550  1.00 57.59  ? 153  TRP B CE2   1 
ATOM   5304 C  CE3   . TRP B 2 165 ? 14.835 19.881  -3.277  1.00 55.72  ? 153  TRP B CE3   1 
ATOM   5305 C  CZ2   . TRP B 2 165 ? 13.046 19.006  -5.289  1.00 59.91  ? 153  TRP B CZ2   1 
ATOM   5306 C  CZ3   . TRP B 2 165 ? 13.867 18.926  -3.018  1.00 58.21  ? 153  TRP B CZ3   1 
ATOM   5307 C  CH2   . TRP B 2 165 ? 12.986 18.497  -4.020  1.00 59.74  ? 153  TRP B CH2   1 
ATOM   5308 N  N     . LYS B 2 166 ? 14.571 24.370  -5.312  1.00 62.02  ? 154  LYS B N     1 
ATOM   5309 C  CA    . LYS B 2 166 ? 13.242 24.924  -5.066  1.00 62.50  ? 154  LYS B CA    1 
ATOM   5310 C  C     . LYS B 2 166 ? 12.453 24.068  -4.083  1.00 59.88  ? 154  LYS B C     1 
ATOM   5311 O  O     . LYS B 2 166 ? 11.689 24.593  -3.264  1.00 56.99  ? 154  LYS B O     1 
ATOM   5312 C  CB    . LYS B 2 166 ? 12.475 25.059  -6.383  1.00 65.08  ? 154  LYS B CB    1 
ATOM   5313 C  CG    . LYS B 2 166 ? 11.037 25.528  -6.214  1.00 66.09  ? 154  LYS B CG    1 
ATOM   5314 C  CD    . LYS B 2 166 ? 10.125 24.953  -7.286  1.00 68.94  ? 154  LYS B CD    1 
ATOM   5315 C  CE    . LYS B 2 166 ? 10.478 25.480  -8.664  1.00 71.55  ? 154  LYS B CE    1 
ATOM   5316 N  NZ    . LYS B 2 166 ? 9.604  24.891  -9.719  1.00 73.36  ? 154  LYS B NZ    1 
ATOM   5317 N  N     . GLY B 2 167 ? 12.629 22.747  -4.143  1.00 59.14  ? 155  GLY B N     1 
ATOM   5318 C  CA    . GLY B 2 167 ? 11.836 21.859  -3.313  1.00 60.26  ? 155  GLY B CA    1 
ATOM   5319 C  C     . GLY B 2 167 ? 12.205 21.877  -1.845  1.00 62.37  ? 155  GLY B C     1 
ATOM   5320 O  O     . GLY B 2 167 ? 11.393 21.464  -1.012  1.00 64.67  ? 155  GLY B O     1 
ATOM   5321 N  N     . SER B 2 168 ? 13.408 22.344  -1.509  1.00 62.46  ? 156  SER B N     1 
ATOM   5322 C  CA    . SER B 2 168 ? 13.847 22.313  -0.115  1.00 64.04  ? 156  SER B CA    1 
ATOM   5323 C  C     . SER B 2 168 ? 12.999 23.197  0.791   1.00 65.53  ? 156  SER B C     1 
ATOM   5324 O  O     . SER B 2 168 ? 12.482 22.686  1.802   1.00 67.55  ? 156  SER B O     1 
ATOM   5325 C  CB    . SER B 2 168 ? 15.335 22.674  -0.032  1.00 65.43  ? 156  SER B CB    1 
ATOM   5326 O  OG    . SER B 2 168 ? 16.125 21.738  -0.744  1.00 67.86  ? 156  SER B OG    1 
ATOM   5327 N  N     . PRO B 2 169 ? 12.808 24.497  0.515   1.00 64.95  ? 157  PRO B N     1 
ATOM   5328 C  CA    . PRO B 2 169 ? 11.937 25.283  1.405   1.00 63.92  ? 157  PRO B CA    1 
ATOM   5329 C  C     . PRO B 2 169 ? 10.505 24.781  1.419   1.00 64.18  ? 157  PRO B C     1 
ATOM   5330 O  O     . PRO B 2 169 ? 9.860  24.795  2.472   1.00 65.05  ? 157  PRO B O     1 
ATOM   5331 C  CB    . PRO B 2 169 ? 12.045 26.706  0.836   1.00 60.41  ? 157  PRO B CB    1 
ATOM   5332 C  CG    . PRO B 2 169 ? 12.407 26.514  -0.584  1.00 60.75  ? 157  PRO B CG    1 
ATOM   5333 C  CD    . PRO B 2 169 ? 13.310 25.316  -0.604  1.00 63.71  ? 157  PRO B CD    1 
ATOM   5334 N  N     . ALA B 2 170 ? 9.999  24.304  0.280   1.00 62.10  ? 158  ALA B N     1 
ATOM   5335 C  CA    . ALA B 2 170 ? 8.638  23.781  0.235   1.00 61.18  ? 158  ALA B CA    1 
ATOM   5336 C  C     . ALA B 2 170 ? 8.473  22.588  1.171   1.00 64.35  ? 158  ALA B C     1 
ATOM   5337 O  O     . ALA B 2 170 ? 7.569  22.565  2.015   1.00 63.65  ? 158  ALA B O     1 
ATOM   5338 C  CB    . ALA B 2 170 ? 8.275  23.399  -1.200  1.00 59.32  ? 158  ALA B CB    1 
ATOM   5339 N  N     . ILE B 2 171 ? 9.349  21.588  1.043   1.00 65.19  ? 159  ILE B N     1 
ATOM   5340 C  CA    . ILE B 2 171 ? 9.225  20.379  1.850   1.00 67.29  ? 159  ILE B CA    1 
ATOM   5341 C  C     . ILE B 2 171 ? 9.541  20.661  3.316   1.00 69.69  ? 159  ILE B C     1 
ATOM   5342 O  O     . ILE B 2 171 ? 9.001  19.998  4.211   1.00 72.97  ? 159  ILE B O     1 
ATOM   5343 C  CB    . ILE B 2 171 ? 10.125 19.270  1.272   1.00 68.56  ? 159  ILE B CB    1 
ATOM   5344 C  CG1   . ILE B 2 171 ? 9.730  18.964  -0.172  1.00 61.40  ? 159  ILE B CG1   1 
ATOM   5345 C  CG2   . ILE B 2 171 ? 10.034 17.998  2.103   1.00 64.17  ? 159  ILE B CG2   1 
ATOM   5346 C  CD1   . ILE B 2 171 ? 10.715 18.070  -0.892  1.00 62.53  ? 159  ILE B CD1   1 
ATOM   5347 N  N     . PHE B 2 172 ? 10.395 21.647  3.597   1.00 69.34  ? 160  PHE B N     1 
ATOM   5348 C  CA    . PHE B 2 172 ? 10.754 21.957  4.975   1.00 68.38  ? 160  PHE B CA    1 
ATOM   5349 C  C     . PHE B 2 172 ? 9.821  22.976  5.626   1.00 66.33  ? 160  PHE B C     1 
ATOM   5350 O  O     . PHE B 2 172 ? 9.950  23.217  6.831   1.00 66.23  ? 160  PHE B O     1 
ATOM   5351 C  CB    . PHE B 2 172 ? 12.202 22.465  5.025   1.00 67.84  ? 160  PHE B CB    1 
ATOM   5352 C  CG    . PHE B 2 172 ? 12.788 22.509  6.408   1.00 67.83  ? 160  PHE B CG    1 
ATOM   5353 C  CD1   . PHE B 2 172 ? 13.181 21.345  7.045   1.00 69.98  ? 160  PHE B CD1   1 
ATOM   5354 C  CD2   . PHE B 2 172 ? 12.958 23.717  7.064   1.00 66.90  ? 160  PHE B CD2   1 
ATOM   5355 C  CE1   . PHE B 2 172 ? 13.722 21.386  8.316   1.00 72.90  ? 160  PHE B CE1   1 
ATOM   5356 C  CE2   . PHE B 2 172 ? 13.498 23.765  8.334   1.00 68.13  ? 160  PHE B CE2   1 
ATOM   5357 C  CZ    . PHE B 2 172 ? 13.881 22.599  8.961   1.00 71.75  ? 160  PHE B CZ    1 
ATOM   5358 N  N     . GLN B 2 173 ? 8.882  23.545  4.859   1.00 67.52  ? 161  GLN B N     1 
ATOM   5359 C  CA    . GLN B 2 173 ? 8.024  24.626  5.341   1.00 69.13  ? 161  GLN B CA    1 
ATOM   5360 C  C     . GLN B 2 173 ? 7.348  24.306  6.669   1.00 74.38  ? 161  GLN B C     1 
ATOM   5361 O  O     . GLN B 2 173 ? 7.290  25.160  7.560   1.00 75.99  ? 161  GLN B O     1 
ATOM   5362 C  CB    . GLN B 2 173 ? 6.972  24.950  4.279   1.00 66.82  ? 161  GLN B CB    1 
ATOM   5363 C  CG    . GLN B 2 173 ? 6.003  26.043  4.677   1.00 69.25  ? 161  GLN B CG    1 
ATOM   5364 C  CD    . GLN B 2 173 ? 6.693  27.373  4.891   1.00 71.40  ? 161  GLN B CD    1 
ATOM   5365 O  OE1   . GLN B 2 173 ? 7.229  27.966  3.954   1.00 70.52  ? 161  GLN B OE1   1 
ATOM   5366 N  NE2   . GLN B 2 173 ? 6.690  27.848  6.132   1.00 72.79  ? 161  GLN B NE2   1 
ATOM   5367 N  N     . SER B 2 174 ? 6.807  23.095  6.816   1.00 77.45  ? 162  SER B N     1 
ATOM   5368 C  CA    . SER B 2 174 ? 6.074  22.767  8.036   1.00 82.06  ? 162  SER B CA    1 
ATOM   5369 C  C     . SER B 2 174 ? 6.996  22.782  9.250   1.00 85.93  ? 162  SER B C     1 
ATOM   5370 O  O     . SER B 2 174 ? 6.660  23.351  10.298  1.00 89.31  ? 162  SER B O     1 
ATOM   5371 C  CB    . SER B 2 174 ? 5.394  21.407  7.887   1.00 84.07  ? 162  SER B CB    1 
ATOM   5372 O  OG    . SER B 2 174 ? 6.332  20.408  7.532   1.00 87.04  ? 162  SER B OG    1 
ATOM   5373 N  N     . SER B 2 175 ? 8.172  22.163  9.122   1.00 86.19  ? 163  SER B N     1 
ATOM   5374 C  CA    . SER B 2 175 ? 9.137  22.172  10.216  1.00 87.34  ? 163  SER B CA    1 
ATOM   5375 C  C     . SER B 2 175 ? 9.605  23.588  10.522  1.00 85.94  ? 163  SER B C     1 
ATOM   5376 O  O     . SER B 2 175 ? 9.772  23.958  11.691  1.00 88.00  ? 163  SER B O     1 
ATOM   5377 C  CB    . SER B 2 175 ? 10.325 21.276  9.868   1.00 87.14  ? 163  SER B CB    1 
ATOM   5378 O  OG    . SER B 2 175 ? 9.889  20.061  9.284   1.00 87.89  ? 163  SER B OG    1 
ATOM   5379 N  N     . MET B 2 176 ? 9.809  24.402  9.482   1.00 82.04  ? 164  MET B N     1 
ATOM   5380 C  CA    . MET B 2 176 ? 10.250 25.776  9.697   1.00 79.94  ? 164  MET B CA    1 
ATOM   5381 C  C     . MET B 2 176 ? 9.193  26.582  10.440  1.00 80.54  ? 164  MET B C     1 
ATOM   5382 O  O     . MET B 2 176 ? 9.517  27.367  11.339  1.00 81.95  ? 164  MET B O     1 
ATOM   5383 C  CB    . MET B 2 176 ? 10.586 26.439  8.361   1.00 77.24  ? 164  MET B CB    1 
ATOM   5384 C  CG    . MET B 2 176 ? 11.047 27.885  8.487   1.00 76.41  ? 164  MET B CG    1 
ATOM   5385 S  SD    . MET B 2 176 ? 12.673 28.057  9.252   1.00 75.27  ? 164  MET B SD    1 
ATOM   5386 C  CE    . MET B 2 176 ? 13.725 27.433  7.942   1.00 74.42  ? 164  MET B CE    1 
ATOM   5387 N  N     . THR B 2 177 ? 7.921  26.397  10.082  1.00 80.02  ? 165  THR B N     1 
ATOM   5388 C  CA    . THR B 2 177 ? 6.848  27.109  10.767  1.00 80.28  ? 165  THR B CA    1 
ATOM   5389 C  C     . THR B 2 177 ? 6.727  26.656  12.216  1.00 84.83  ? 165  THR B C     1 
ATOM   5390 O  O     . THR B 2 177 ? 6.521  27.482  13.116  1.00 86.77  ? 165  THR B O     1 
ATOM   5391 C  CB    . THR B 2 177 ? 5.525  26.906  10.029  1.00 77.32  ? 165  THR B CB    1 
ATOM   5392 O  OG1   . THR B 2 177 ? 5.686  27.266  8.652   1.00 75.01  ? 165  THR B OG1   1 
ATOM   5393 C  CG2   . THR B 2 177 ? 4.437  27.774  10.643  1.00 77.68  ? 165  THR B CG2   1 
ATOM   5394 N  N     . LYS B 2 178 ? 6.852  25.348  12.463  1.00 87.21  ? 166  LYS B N     1 
ATOM   5395 C  CA    . LYS B 2 178 ? 6.831  24.861  13.839  1.00 90.22  ? 166  LYS B CA    1 
ATOM   5396 C  C     . LYS B 2 178 ? 8.002  25.415  14.641  1.00 90.63  ? 166  LYS B C     1 
ATOM   5397 O  O     . LYS B 2 178 ? 7.870  25.664  15.844  1.00 93.48  ? 166  LYS B O     1 
ATOM   5398 C  CB    . LYS B 2 178 ? 6.844  23.331  13.856  1.00 91.16  ? 166  LYS B CB    1 
ATOM   5399 N  N     . ILE B 2 179 ? 9.147  25.622  13.989  1.00 89.60  ? 167  ILE B N     1 
ATOM   5400 C  CA    . ILE B 2 179 ? 10.298 26.212  14.667  1.00 91.44  ? 167  ILE B CA    1 
ATOM   5401 C  C     . ILE B 2 179 ? 10.044 27.680  14.990  1.00 91.75  ? 167  ILE B C     1 
ATOM   5402 O  O     . ILE B 2 179 ? 10.327 28.144  16.101  1.00 93.45  ? 167  ILE B O     1 
ATOM   5403 C  CB    . ILE B 2 179 ? 11.564 26.030  13.810  1.00 91.69  ? 167  ILE B CB    1 
ATOM   5404 C  CG1   . ILE B 2 179 ? 12.114 24.610  13.956  1.00 95.15  ? 167  ILE B CG1   1 
ATOM   5405 C  CG2   . ILE B 2 179 ? 12.622 27.063  14.174  1.00 91.97  ? 167  ILE B CG2   1 
ATOM   5406 C  CD1   . ILE B 2 179 ? 13.382 24.364  13.164  1.00 93.94  ? 167  ILE B CD1   1 
ATOM   5407 N  N     . LEU B 2 180 ? 9.502  28.433  14.033  1.00 89.80  ? 168  LEU B N     1 
ATOM   5408 C  CA    . LEU B 2 180 ? 9.415  29.882  14.156  1.00 88.24  ? 168  LEU B CA    1 
ATOM   5409 C  C     . LEU B 2 180 ? 8.141  30.374  14.834  1.00 93.86  ? 168  LEU B C     1 
ATOM   5410 O  O     . LEU B 2 180 ? 8.023  31.579  15.077  1.00 95.11  ? 168  LEU B O     1 
ATOM   5411 C  CB    . LEU B 2 180 ? 9.529  30.533  12.774  1.00 80.32  ? 168  LEU B CB    1 
ATOM   5412 C  CG    . LEU B 2 180 ? 10.860 30.342  12.046  1.00 74.65  ? 168  LEU B CG    1 
ATOM   5413 C  CD1   . LEU B 2 180 ? 10.853 31.079  10.717  1.00 71.40  ? 168  LEU B CD1   1 
ATOM   5414 C  CD2   . LEU B 2 180 ? 12.020 30.804  12.915  1.00 73.73  ? 168  LEU B CD2   1 
ATOM   5415 N  N     . GLU B 2 181 ? 7.187  29.489  15.133  1.00 98.26  ? 169  GLU B N     1 
ATOM   5416 C  CA    . GLU B 2 181 ? 5.959  29.931  15.796  1.00 101.08 ? 169  GLU B CA    1 
ATOM   5417 C  C     . GLU B 2 181 ? 6.205  30.652  17.119  1.00 103.58 ? 169  GLU B C     1 
ATOM   5418 O  O     . GLU B 2 181 ? 5.628  31.738  17.316  1.00 105.62 ? 169  GLU B O     1 
ATOM   5419 C  CB    . GLU B 2 181 ? 5.018  28.734  15.981  1.00 104.08 ? 169  GLU B CB    1 
ATOM   5420 N  N     . PRO B 2 182 ? 7.012  30.135  18.059  1.00 100.66 ? 170  PRO B N     1 
ATOM   5421 C  CA    . PRO B 2 182 ? 7.174  30.856  19.335  1.00 101.03 ? 170  PRO B CA    1 
ATOM   5422 C  C     . PRO B 2 182 ? 7.840  32.214  19.189  1.00 97.87  ? 170  PRO B C     1 
ATOM   5423 O  O     . PRO B 2 182 ? 7.421  33.176  19.845  1.00 99.61  ? 170  PRO B O     1 
ATOM   5424 C  CB    . PRO B 2 182 ? 8.029  29.895  20.175  1.00 101.57 ? 170  PRO B CB    1 
ATOM   5425 C  CG    . PRO B 2 182 ? 7.851  28.565  19.542  1.00 100.81 ? 170  PRO B CG    1 
ATOM   5426 C  CD    . PRO B 2 182 ? 7.718  28.841  18.083  1.00 98.83  ? 170  PRO B CD    1 
ATOM   5427 N  N     . PHE B 2 183 ? 8.874  32.320  18.350  1.00 93.09  ? 171  PHE B N     1 
ATOM   5428 C  CA    . PHE B 2 183 ? 9.536  33.607  18.165  1.00 90.83  ? 171  PHE B CA    1 
ATOM   5429 C  C     . PHE B 2 183 ? 8.603  34.630  17.530  1.00 90.18  ? 171  PHE B C     1 
ATOM   5430 O  O     . PHE B 2 183 ? 8.684  35.821  17.849  1.00 91.26  ? 171  PHE B O     1 
ATOM   5431 C  CB    . PHE B 2 183 ? 10.798 33.434  17.318  1.00 87.48  ? 171  PHE B CB    1 
ATOM   5432 C  CG    . PHE B 2 183 ? 11.717 34.624  17.348  1.00 86.45  ? 171  PHE B CG    1 
ATOM   5433 C  CD1   . PHE B 2 183 ? 12.656 34.763  18.358  1.00 87.99  ? 171  PHE B CD1   1 
ATOM   5434 C  CD2   . PHE B 2 183 ? 11.644 35.601  16.369  1.00 83.75  ? 171  PHE B CD2   1 
ATOM   5435 C  CE1   . PHE B 2 183 ? 13.504 35.855  18.391  1.00 87.61  ? 171  PHE B CE1   1 
ATOM   5436 C  CE2   . PHE B 2 183 ? 12.490 36.695  16.396  1.00 83.10  ? 171  PHE B CE2   1 
ATOM   5437 C  CZ    . PHE B 2 183 ? 13.421 36.822  17.410  1.00 85.26  ? 171  PHE B CZ    1 
ATOM   5438 N  N     . ARG B 2 184 ? 7.713  34.189  16.637  1.00 88.43  ? 172  ARG B N     1 
ATOM   5439 C  CA    . ARG B 2 184 ? 6.733  35.106  16.067  1.00 87.62  ? 172  ARG B CA    1 
ATOM   5440 C  C     . ARG B 2 184 ? 5.690  35.511  17.101  1.00 89.29  ? 172  ARG B C     1 
ATOM   5441 O  O     . ARG B 2 184 ? 5.248  36.665  17.122  1.00 89.20  ? 172  ARG B O     1 
ATOM   5442 C  CB    . ARG B 2 184 ? 6.057  34.475  14.850  1.00 87.61  ? 172  ARG B CB    1 
ATOM   5443 C  CG    . ARG B 2 184 ? 6.927  34.406  13.608  1.00 85.93  ? 172  ARG B CG    1 
ATOM   5444 C  CD    . ARG B 2 184 ? 6.095  34.053  12.386  1.00 85.24  ? 172  ARG B CD    1 
ATOM   5445 N  NE    . ARG B 2 184 ? 6.830  34.256  11.142  1.00 84.94  ? 172  ARG B NE    1 
ATOM   5446 C  CZ    . ARG B 2 184 ? 7.392  33.280  10.436  1.00 83.41  ? 172  ARG B CZ    1 
ATOM   5447 N  NH1   . ARG B 2 184 ? 7.299  32.023  10.848  1.00 83.00  ? 172  ARG B NH1   1 
ATOM   5448 N  NH2   . ARG B 2 184 ? 8.041  33.562  9.314   1.00 80.74  ? 172  ARG B NH2   1 
ATOM   5449 N  N     . LYS B 2 185 ? 5.278  34.574  17.958  1.00 90.21  ? 173  LYS B N     1 
ATOM   5450 C  CA    . LYS B 2 185 ? 4.287  34.896  18.981  1.00 92.62  ? 173  LYS B CA    1 
ATOM   5451 C  C     . LYS B 2 185 ? 4.825  35.938  19.956  1.00 93.20  ? 173  LYS B C     1 
ATOM   5452 O  O     . LYS B 2 185 ? 4.149  36.925  20.266  1.00 94.67  ? 173  LYS B O     1 
ATOM   5453 C  CB    . LYS B 2 185 ? 3.867  33.627  19.722  1.00 95.97  ? 173  LYS B CB    1 
ATOM   5454 N  N     . GLN B 2 186 ? 6.051  35.737  20.445  1.00 93.43  ? 174  GLN B N     1 
ATOM   5455 C  CA    . GLN B 2 186 ? 6.655  36.671  21.386  1.00 98.19  ? 174  GLN B CA    1 
ATOM   5456 C  C     . GLN B 2 186 ? 7.102  37.972  20.730  1.00 99.54  ? 174  GLN B C     1 
ATOM   5457 O  O     . GLN B 2 186 ? 7.504  38.895  21.445  1.00 102.94 ? 174  GLN B O     1 
ATOM   5458 C  CB    . GLN B 2 186 ? 7.846  36.014  22.087  1.00 98.89  ? 174  GLN B CB    1 
ATOM   5459 N  N     . ASN B 2 187 ? 7.046  38.068  19.403  1.00 97.51  ? 175  ASN B N     1 
ATOM   5460 C  CA    . ASN B 2 187 ? 7.437  39.278  18.679  1.00 98.70  ? 175  ASN B CA    1 
ATOM   5461 C  C     . ASN B 2 187 ? 6.496  39.470  17.501  1.00 99.53  ? 175  ASN B C     1 
ATOM   5462 O  O     . ASN B 2 187 ? 6.843  39.178  16.350  1.00 96.89  ? 175  ASN B O     1 
ATOM   5463 C  CB    . ASN B 2 187 ? 8.892  39.196  18.211  1.00 98.67  ? 175  ASN B CB    1 
ATOM   5464 C  CG    . ASN B 2 187 ? 9.872  39.117  19.363  1.00 103.34 ? 175  ASN B CG    1 
ATOM   5465 O  OD1   . ASN B 2 187 ? 10.356 40.137  19.853  1.00 105.63 ? 175  ASN B OD1   1 
ATOM   5466 N  ND2   . ASN B 2 187 ? 10.171 37.900  19.803  1.00 104.61 ? 175  ASN B ND2   1 
ATOM   5467 N  N     . PRO B 2 188 ? 5.281  39.966  17.752  1.00 102.50 ? 176  PRO B N     1 
ATOM   5468 C  CA    . PRO B 2 188 ? 4.310  40.109  16.656  1.00 101.62 ? 176  PRO B CA    1 
ATOM   5469 C  C     . PRO B 2 188 ? 4.649  41.220  15.676  1.00 100.28 ? 176  PRO B C     1 
ATOM   5470 O  O     . PRO B 2 188 ? 4.123  41.210  14.556  1.00 99.73  ? 176  PRO B O     1 
ATOM   5471 C  CB    . PRO B 2 188 ? 2.994  40.396  17.389  1.00 103.48 ? 176  PRO B CB    1 
ATOM   5472 C  CG    . PRO B 2 188 ? 3.421  41.051  18.660  1.00 105.80 ? 176  PRO B CG    1 
ATOM   5473 C  CD    . PRO B 2 188 ? 4.723  40.398  19.046  1.00 105.84 ? 176  PRO B CD    1 
ATOM   5474 N  N     . ASP B 2 189 ? 5.502  42.171  16.052  1.00 100.36 ? 177  ASP B N     1 
ATOM   5475 C  CA    . ASP B 2 189 ? 5.864  43.286  15.187  1.00 99.80  ? 177  ASP B CA    1 
ATOM   5476 C  C     . ASP B 2 189 ? 7.123  43.020  14.368  1.00 98.48  ? 177  ASP B C     1 
ATOM   5477 O  O     . ASP B 2 189 ? 7.653  43.949  13.750  1.00 98.55  ? 177  ASP B O     1 
ATOM   5478 C  CB    . ASP B 2 189 ? 6.044  44.560  16.017  1.00 102.45 ? 177  ASP B CB    1 
ATOM   5479 N  N     . ILE B 2 190 ? 7.610  41.781  14.348  1.00 97.10  ? 178  ILE B N     1 
ATOM   5480 C  CA    . ILE B 2 190 ? 8.787  41.394  13.579  1.00 93.32  ? 178  ILE B CA    1 
ATOM   5481 C  C     . ILE B 2 190 ? 8.327  40.543  12.405  1.00 89.92  ? 178  ILE B C     1 
ATOM   5482 O  O     . ILE B 2 190 ? 7.518  39.623  12.578  1.00 91.32  ? 178  ILE B O     1 
ATOM   5483 C  CB    . ILE B 2 190 ? 9.804  40.638  14.452  1.00 92.48  ? 178  ILE B CB    1 
ATOM   5484 C  CG1   . ILE B 2 190 ? 10.523 41.608  15.392  1.00 94.07  ? 178  ILE B CG1   1 
ATOM   5485 C  CG2   . ILE B 2 190 ? 10.801 39.881  13.591  1.00 90.46  ? 178  ILE B CG2   1 
ATOM   5486 C  CD1   . ILE B 2 190 ? 11.575 40.949  16.260  1.00 95.01  ? 178  ILE B CD1   1 
ATOM   5487 N  N     . VAL B 2 191 ? 8.837  40.846  11.213  1.00 85.66  ? 179  VAL B N     1 
ATOM   5488 C  CA    . VAL B 2 191 ? 8.408  40.187  9.983   1.00 81.88  ? 179  VAL B CA    1 
ATOM   5489 C  C     . VAL B 2 191 ? 9.512  39.236  9.541   1.00 79.92  ? 179  VAL B C     1 
ATOM   5490 O  O     . VAL B 2 191 ? 10.589 39.674  9.122   1.00 80.34  ? 179  VAL B O     1 
ATOM   5491 C  CB    . VAL B 2 191 ? 8.076  41.200  8.880   1.00 80.36  ? 179  VAL B CB    1 
ATOM   5492 C  CG1   . VAL B 2 191 ? 7.704  40.478  7.596   1.00 78.31  ? 179  VAL B CG1   1 
ATOM   5493 C  CG2   . VAL B 2 191 ? 6.951  42.121  9.325   1.00 82.10  ? 179  VAL B CG2   1 
ATOM   5494 N  N     . ILE B 2 192 ? 9.247  37.935  9.618   1.00 77.03  ? 180  ILE B N     1 
ATOM   5495 C  CA    . ILE B 2 192 ? 10.190 36.910  9.182   1.00 73.16  ? 180  ILE B CA    1 
ATOM   5496 C  C     . ILE B 2 192 ? 9.641  36.268  7.915   1.00 68.52  ? 180  ILE B C     1 
ATOM   5497 O  O     . ILE B 2 192 ? 8.589  35.617  7.945   1.00 66.97  ? 180  ILE B O     1 
ATOM   5498 C  CB    . ILE B 2 192 ? 10.431 35.858  10.275  1.00 73.53  ? 180  ILE B CB    1 
ATOM   5499 C  CG1   . ILE B 2 192 ? 10.955 36.522  11.550  1.00 74.81  ? 180  ILE B CG1   1 
ATOM   5500 C  CG2   . ILE B 2 192 ? 11.408 34.801  9.786   1.00 73.20  ? 180  ILE B CG2   1 
ATOM   5501 C  CD1   . ILE B 2 192 ? 11.197 35.551  12.690  1.00 76.06  ? 180  ILE B CD1   1 
ATOM   5502 N  N     . TYR B 2 193 ? 10.354 36.447  6.806   1.00 67.50  ? 181  TYR B N     1 
ATOM   5503 C  CA    . TYR B 2 193 ? 9.974  35.878  5.520   1.00 66.77  ? 181  TYR B CA    1 
ATOM   5504 C  C     . TYR B 2 193 ? 11.076 34.948  5.032   1.00 67.45  ? 181  TYR B C     1 
ATOM   5505 O  O     . TYR B 2 193 ? 12.257 35.194  5.273   1.00 68.33  ? 181  TYR B O     1 
ATOM   5506 C  CB    . TYR B 2 193 ? 9.711  36.977  4.486   1.00 66.73  ? 181  TYR B CB    1 
ATOM   5507 C  CG    . TYR B 2 193 ? 9.714  36.488  3.055   1.00 67.16  ? 181  TYR B CG    1 
ATOM   5508 C  CD1   . TYR B 2 193 ? 8.651  35.752  2.547   1.00 67.13  ? 181  TYR B CD1   1 
ATOM   5509 C  CD2   . TYR B 2 193 ? 10.781 36.766  2.211   1.00 66.43  ? 181  TYR B CD2   1 
ATOM   5510 C  CE1   . TYR B 2 193 ? 8.652  35.305  1.240   1.00 66.60  ? 181  TYR B CE1   1 
ATOM   5511 C  CE2   . TYR B 2 193 ? 10.791 36.323  0.904   1.00 66.50  ? 181  TYR B CE2   1 
ATOM   5512 C  CZ    . TYR B 2 193 ? 9.724  35.594  0.424   1.00 67.42  ? 181  TYR B CZ    1 
ATOM   5513 O  OH    . TYR B 2 193 ? 9.731  35.153  -0.879  1.00 69.58  ? 181  TYR B OH    1 
ATOM   5514 N  N     . GLN B 2 194 ? 10.699 33.873  4.353   1.00 67.38  ? 182  GLN B N     1 
ATOM   5515 C  CA    . GLN B 2 194 ? 11.668 32.889  3.892   1.00 66.71  ? 182  GLN B CA    1 
ATOM   5516 C  C     . GLN B 2 194 ? 11.735 32.894  2.372   1.00 64.01  ? 182  GLN B C     1 
ATOM   5517 O  O     . GLN B 2 194 ? 10.722 32.667  1.702   1.00 63.39  ? 182  GLN B O     1 
ATOM   5518 C  CB    . GLN B 2 194 ? 11.316 31.490  4.399   1.00 69.28  ? 182  GLN B CB    1 
ATOM   5519 C  CG    . GLN B 2 194 ? 12.323 30.423  3.993   1.00 72.24  ? 182  GLN B CG    1 
ATOM   5520 C  CD    . GLN B 2 194 ? 12.040 29.066  4.619   1.00 75.61  ? 182  GLN B CD    1 
ATOM   5521 O  OE1   . GLN B 2 194 ? 12.862 28.152  4.539   1.00 77.99  ? 182  GLN B OE1   1 
ATOM   5522 N  NE2   . GLN B 2 194 ? 10.875 28.928  5.244   1.00 76.23  ? 182  GLN B NE2   1 
ATOM   5523 N  N     . TYR B 2 195 ? 12.922 33.148  1.832   1.00 64.22  ? 183  TYR B N     1 
ATOM   5524 C  CA    . TYR B 2 195 ? 13.229 32.769  0.463   1.00 63.07  ? 183  TYR B CA    1 
ATOM   5525 C  C     . TYR B 2 195 ? 14.210 31.605  0.539   1.00 66.71  ? 183  TYR B C     1 
ATOM   5526 O  O     . TYR B 2 195 ? 14.652 31.235  1.629   1.00 76.71  ? 183  TYR B O     1 
ATOM   5527 C  CB    . TYR B 2 195 ? 13.760 33.959  -0.349  1.00 62.96  ? 183  TYR B CB    1 
ATOM   5528 C  CG    . TYR B 2 195 ? 13.792 33.691  -1.846  1.00 59.55  ? 183  TYR B CG    1 
ATOM   5529 C  CD1   . TYR B 2 195 ? 12.619 33.464  -2.561  1.00 55.50  ? 183  TYR B CD1   1 
ATOM   5530 C  CD2   . TYR B 2 195 ? 14.996 33.647  -2.536  1.00 61.45  ? 183  TYR B CD2   1 
ATOM   5531 C  CE1   . TYR B 2 195 ? 12.647 33.202  -3.920  1.00 57.55  ? 183  TYR B CE1   1 
ATOM   5532 C  CE2   . TYR B 2 195 ? 15.034 33.388  -3.893  1.00 62.23  ? 183  TYR B CE2   1 
ATOM   5533 C  CZ    . TYR B 2 195 ? 13.858 33.165  -4.580  1.00 61.42  ? 183  TYR B CZ    1 
ATOM   5534 O  OH    . TYR B 2 195 ? 13.890 32.906  -5.932  1.00 61.92  ? 183  TYR B OH    1 
ATOM   5535 N  N     . MET B 2 196 ? 14.597 31.074  -0.625  1.00 64.94  ? 184  MET B N     1 
ATOM   5536 C  CA    . MET B 2 196 ? 15.080 29.698  -0.747  1.00 67.26  ? 184  MET B CA    1 
ATOM   5537 C  C     . MET B 2 196 ? 15.906 29.224  0.447   1.00 65.49  ? 184  MET B C     1 
ATOM   5538 O  O     . MET B 2 196 ? 15.504 28.306  1.169   1.00 64.84  ? 184  MET B O     1 
ATOM   5539 C  CB    . MET B 2 196 ? 15.913 29.567  -2.026  1.00 70.41  ? 184  MET B CB    1 
ATOM   5540 C  CG    . MET B 2 196 ? 15.211 29.971  -3.302  1.00 72.99  ? 184  MET B CG    1 
ATOM   5541 S  SD    . MET B 2 196 ? 14.346 28.623  -4.126  1.00 77.07  ? 184  MET B SD    1 
ATOM   5542 C  CE    . MET B 2 196 ? 14.028 29.368  -5.728  1.00 76.58  ? 184  MET B CE    1 
ATOM   5543 N  N     . ASP B 2 197 ? 17.042 29.871  0.700   1.00 64.74  ? 185  ASP B N     1 
ATOM   5544 C  CA    . ASP B 2 197 ? 17.927 29.476  1.787   1.00 62.14  ? 185  ASP B CA    1 
ATOM   5545 C  C     . ASP B 2 197 ? 18.052 30.535  2.873   1.00 61.55  ? 185  ASP B C     1 
ATOM   5546 O  O     . ASP B 2 197 ? 18.849 30.357  3.801   1.00 63.26  ? 185  ASP B O     1 
ATOM   5547 C  CB    . ASP B 2 197 ? 19.322 29.141  1.240   1.00 64.04  ? 185  ASP B CB    1 
ATOM   5548 C  CG    . ASP B 2 197 ? 19.312 27.961  0.280   1.00 63.24  ? 185  ASP B CG    1 
ATOM   5549 O  OD1   . ASP B 2 197 ? 18.226 27.405  0.013   1.00 62.05  ? 185  ASP B OD1   1 
ATOM   5550 O  OD2   . ASP B 2 197 ? 20.397 27.586  -0.211  1.00 63.33  ? 185  ASP B OD2   1 
ATOM   5551 N  N     . ASP B 2 198 ? 17.286 31.620  2.799   1.00 61.24  ? 186  ASP B N     1 
ATOM   5552 C  CA    . ASP B 2 198 ? 17.486 32.758  3.682   1.00 62.62  ? 186  ASP B CA    1 
ATOM   5553 C  C     . ASP B 2 198 ? 16.197 33.127  4.401   1.00 61.77  ? 186  ASP B C     1 
ATOM   5554 O  O     . ASP B 2 198 ? 15.096 33.017  3.845   1.00 59.18  ? 186  ASP B O     1 
ATOM   5555 C  CB    . ASP B 2 198 ? 18.002 33.981  2.907   1.00 65.53  ? 186  ASP B CB    1 
ATOM   5556 C  CG    . ASP B 2 198 ? 19.086 33.627  1.906   1.00 67.63  ? 186  ASP B CG    1 
ATOM   5557 O  OD1   . ASP B 2 198 ? 20.084 32.984  2.298   1.00 69.19  ? 186  ASP B OD1   1 
ATOM   5558 O  OD2   . ASP B 2 198 ? 18.932 33.988  0.720   1.00 67.45  ? 186  ASP B OD2   1 
ATOM   5559 N  N     . LEU B 2 199 ? 16.354 33.559  5.649   1.00 65.17  ? 187  LEU B N     1 
ATOM   5560 C  CA    . LEU B 2 199 ? 15.309 34.249  6.390   1.00 67.65  ? 187  LEU B CA    1 
ATOM   5561 C  C     . LEU B 2 199 ? 15.608 35.742  6.385   1.00 70.33  ? 187  LEU B C     1 
ATOM   5562 O  O     . LEU B 2 199 ? 16.704 36.164  6.768   1.00 71.58  ? 187  LEU B O     1 
ATOM   5563 C  CB    . LEU B 2 199 ? 15.210 33.744  7.831   1.00 70.35  ? 187  LEU B CB    1 
ATOM   5564 C  CG    . LEU B 2 199 ? 14.752 32.307  8.089   1.00 72.01  ? 187  LEU B CG    1 
ATOM   5565 C  CD1   . LEU B 2 199 ? 14.477 32.105  9.571   1.00 72.42  ? 187  LEU B CD1   1 
ATOM   5566 C  CD2   . LEU B 2 199 ? 13.525 31.963  7.263   1.00 71.54  ? 187  LEU B CD2   1 
ATOM   5567 N  N     . TYR B 2 200 ? 14.642 36.529  5.932   1.00 71.59  ? 188  TYR B N     1 
ATOM   5568 C  CA    . TYR B 2 200 ? 14.697 37.980  5.996   1.00 75.31  ? 188  TYR B CA    1 
ATOM   5569 C  C     . TYR B 2 200 ? 13.890 38.416  7.211   1.00 77.45  ? 188  TYR B C     1 
ATOM   5570 O  O     . TYR B 2 200 ? 12.680 38.165  7.278   1.00 78.44  ? 188  TYR B O     1 
ATOM   5571 C  CB    . TYR B 2 200 ? 14.146 38.603  4.713   1.00 75.38  ? 188  TYR B CB    1 
ATOM   5572 C  CG    . TYR B 2 200 ? 14.910 38.206  3.469   1.00 74.37  ? 188  TYR B CG    1 
ATOM   5573 C  CD1   . TYR B 2 200 ? 14.665 36.992  2.836   1.00 74.08  ? 188  TYR B CD1   1 
ATOM   5574 C  CD2   . TYR B 2 200 ? 15.875 39.043  2.926   1.00 74.90  ? 188  TYR B CD2   1 
ATOM   5575 C  CE1   . TYR B 2 200 ? 15.363 36.623  1.701   1.00 74.04  ? 188  TYR B CE1   1 
ATOM   5576 C  CE2   . TYR B 2 200 ? 16.577 38.684  1.790   1.00 75.73  ? 188  TYR B CE2   1 
ATOM   5577 C  CZ    . TYR B 2 200 ? 16.318 37.474  1.182   1.00 75.31  ? 188  TYR B CZ    1 
ATOM   5578 O  OH    . TYR B 2 200 ? 17.016 37.114  0.053   1.00 76.46  ? 188  TYR B OH    1 
ATOM   5579 N  N     . VAL B 2 201 ? 14.564 39.037  8.174   1.00 78.25  ? 189  VAL B N     1 
ATOM   5580 C  CA    . VAL B 2 201 ? 13.964 39.424  9.445   1.00 78.76  ? 189  VAL B CA    1 
ATOM   5581 C  C     . VAL B 2 201 ? 13.939 40.944  9.493   1.00 80.86  ? 189  VAL B C     1 
ATOM   5582 O  O     . VAL B 2 201 ? 14.993 41.590  9.522   1.00 80.89  ? 189  VAL B O     1 
ATOM   5583 C  CB    . VAL B 2 201 ? 14.733 38.841  10.637  1.00 79.15  ? 189  VAL B CB    1 
ATOM   5584 C  CG1   . VAL B 2 201 ? 13.973 39.081  11.929  1.00 80.68  ? 189  VAL B CG1   1 
ATOM   5585 C  CG2   . VAL B 2 201 ? 14.994 37.357  10.425  1.00 78.21  ? 189  VAL B CG2   1 
ATOM   5586 N  N     . GLY B 2 202 ? 12.739 41.517  9.502   1.00 82.82  ? 190  GLY B N     1 
ATOM   5587 C  CA    . GLY B 2 202 ? 12.553 42.956  9.477   1.00 85.25  ? 190  GLY B CA    1 
ATOM   5588 C  C     . GLY B 2 202 ? 11.944 43.454  10.778  1.00 85.73  ? 190  GLY B C     1 
ATOM   5589 O  O     . GLY B 2 202 ? 10.956 42.897  11.269  1.00 86.06  ? 190  GLY B O     1 
ATOM   5590 N  N     . SER B 2 203 ? 12.554 44.509  11.321  1.00 86.37  ? 191  SER B N     1 
ATOM   5591 C  CA    . SER B 2 203 ? 12.065 45.176  12.519  1.00 89.29  ? 191  SER B CA    1 
ATOM   5592 C  C     . SER B 2 203 ? 12.172 46.685  12.339  1.00 91.93  ? 191  SER B C     1 
ATOM   5593 O  O     . SER B 2 203 ? 12.917 47.182  11.488  1.00 91.02  ? 191  SER B O     1 
ATOM   5594 C  CB    . SER B 2 203 ? 12.839 44.745  13.773  1.00 90.68  ? 191  SER B CB    1 
ATOM   5595 O  OG    . SER B 2 203 ? 14.052 45.468  13.898  1.00 91.45  ? 191  SER B OG    1 
ATOM   5596 N  N     . ASP B 2 204 ? 11.419 47.410  13.166  1.00 94.64  ? 192  ASP B N     1 
ATOM   5597 C  CA    . ASP B 2 204 ? 11.388 48.866  13.137  1.00 95.68  ? 192  ASP B CA    1 
ATOM   5598 C  C     . ASP B 2 204 ? 12.147 49.510  14.289  1.00 99.23  ? 192  ASP B C     1 
ATOM   5599 O  O     . ASP B 2 204 ? 12.187 50.742  14.370  1.00 102.42 ? 192  ASP B O     1 
ATOM   5600 C  CB    . ASP B 2 204 ? 9.937  49.367  13.149  1.00 94.30  ? 192  ASP B CB    1 
ATOM   5601 C  CG    . ASP B 2 204 ? 9.251  49.213  11.807  1.00 90.77  ? 192  ASP B CG    1 
ATOM   5602 O  OD1   . ASP B 2 204 ? 9.923  49.392  10.769  1.00 89.39  ? 192  ASP B OD1   1 
ATOM   5603 O  OD2   . ASP B 2 204 ? 8.037  48.919  11.791  1.00 89.40  ? 192  ASP B OD2   1 
ATOM   5604 N  N     . LEU B 2 205 ? 12.751 48.724  15.176  1.00 99.22  ? 193  LEU B N     1 
ATOM   5605 C  CA    . LEU B 2 205 ? 13.377 49.278  16.366  1.00 102.19 ? 193  LEU B CA    1 
ATOM   5606 C  C     . LEU B 2 205 ? 14.841 49.629  16.096  1.00 103.83 ? 193  LEU B C     1 
ATOM   5607 O  O     . LEU B 2 205 ? 15.381 49.384  15.015  1.00 102.15 ? 193  LEU B O     1 
ATOM   5608 C  CB    . LEU B 2 205 ? 13.225 48.310  17.540  1.00 100.80 ? 193  LEU B CB    1 
ATOM   5609 C  CG    . LEU B 2 205 ? 13.519 46.831  17.292  1.00 94.71  ? 193  LEU B CG    1 
ATOM   5610 C  CD1   . LEU B 2 205 ? 14.950 46.523  17.652  1.00 93.81  ? 193  LEU B CD1   1 
ATOM   5611 C  CD2   . LEU B 2 205 ? 12.562 45.943  18.075  1.00 93.37  ? 193  LEU B CD2   1 
ATOM   5612 N  N     . GLU B 2 206 ? 15.490 50.215  17.101  1.00 107.63 ? 194  GLU B N     1 
ATOM   5613 C  CA    . GLU B 2 206 ? 16.800 50.824  16.915  1.00 108.90 ? 194  GLU B CA    1 
ATOM   5614 C  C     . GLU B 2 206 ? 17.878 49.774  16.673  1.00 107.63 ? 194  GLU B C     1 
ATOM   5615 O  O     . GLU B 2 206 ? 17.801 48.645  17.164  1.00 107.28 ? 194  GLU B O     1 
ATOM   5616 C  CB    . GLU B 2 206 ? 17.170 51.668  18.135  1.00 112.33 ? 194  GLU B CB    1 
ATOM   5617 N  N     . ILE B 2 207 ? 18.897 50.165  15.902  1.00 108.31 ? 195  ILE B N     1 
ATOM   5618 C  CA    . ILE B 2 207 ? 20.048 49.295  15.698  1.00 108.35 ? 195  ILE B CA    1 
ATOM   5619 C  C     . ILE B 2 207 ? 20.785 49.122  17.018  1.00 113.65 ? 195  ILE B C     1 
ATOM   5620 O  O     . ILE B 2 207 ? 20.965 50.075  17.787  1.00 118.18 ? 195  ILE B O     1 
ATOM   5621 C  CB    . ILE B 2 207 ? 20.974 49.863  14.609  1.00 106.62 ? 195  ILE B CB    1 
ATOM   5622 N  N     . GLY B 2 208 ? 21.209 47.891  17.289  1.00 112.08 ? 196  GLY B N     1 
ATOM   5623 C  CA    . GLY B 2 208 ? 21.794 47.549  18.570  1.00 113.13 ? 196  GLY B CA    1 
ATOM   5624 C  C     . GLY B 2 208 ? 20.840 46.681  19.360  1.00 112.22 ? 196  GLY B C     1 
ATOM   5625 O  O     . GLY B 2 208 ? 21.247 45.699  19.989  1.00 114.66 ? 196  GLY B O     1 
ATOM   5626 N  N     . GLN B 2 209 ? 19.558 47.040  19.329  1.00 108.77 ? 197  GLN B N     1 
ATOM   5627 C  CA    . GLN B 2 209 ? 18.503 46.151  19.796  1.00 106.22 ? 197  GLN B CA    1 
ATOM   5628 C  C     . GLN B 2 209 ? 18.003 45.247  18.681  1.00 100.09 ? 197  GLN B C     1 
ATOM   5629 O  O     . GLN B 2 209 ? 17.551 44.127  18.949  1.00 98.65  ? 197  GLN B O     1 
ATOM   5630 C  CB    . GLN B 2 209 ? 17.340 46.963  20.374  1.00 108.17 ? 197  GLN B CB    1 
ATOM   5631 N  N     . HIS B 2 210 ? 18.085 45.718  17.433  1.00 95.80  ? 198  HIS B N     1 
ATOM   5632 C  CA    . HIS B 2 210 ? 17.800 44.865  16.285  1.00 88.36  ? 198  HIS B CA    1 
ATOM   5633 C  C     . HIS B 2 210 ? 18.785 43.706  16.221  1.00 87.97  ? 198  HIS B C     1 
ATOM   5634 O  O     . HIS B 2 210 ? 18.395 42.552  16.011  1.00 86.76  ? 198  HIS B O     1 
ATOM   5635 C  CB    . HIS B 2 210 ? 17.850 45.695  15.002  1.00 83.35  ? 198  HIS B CB    1 
ATOM   5636 C  CG    . HIS B 2 210 ? 17.514 44.925  13.763  1.00 78.09  ? 198  HIS B CG    1 
ATOM   5637 N  ND1   . HIS B 2 210 ? 16.224 44.788  13.299  1.00 75.53  ? 198  HIS B ND1   1 
ATOM   5638 C  CD2   . HIS B 2 210 ? 18.302 44.259  12.886  1.00 75.48  ? 198  HIS B CD2   1 
ATOM   5639 C  CE1   . HIS B 2 210 ? 16.230 44.067  12.192  1.00 72.71  ? 198  HIS B CE1   1 
ATOM   5640 N  NE2   . HIS B 2 210 ? 17.479 43.734  11.919  1.00 73.35  ? 198  HIS B NE2   1 
ATOM   5641 N  N     . ARG B 2 211 ? 20.074 43.999  16.410  1.00 89.59  ? 199  ARG B N     1 
ATOM   5642 C  CA    . ARG B 2 211 ? 21.072 42.938  16.476  1.00 90.08  ? 199  ARG B CA    1 
ATOM   5643 C  C     . ARG B 2 211 ? 20.833 42.021  17.667  1.00 92.79  ? 199  ARG B C     1 
ATOM   5644 O  O     . ARG B 2 211 ? 21.091 40.817  17.583  1.00 92.63  ? 199  ARG B O     1 
ATOM   5645 C  CB    . ARG B 2 211 ? 22.476 43.540  16.538  1.00 91.50  ? 199  ARG B CB    1 
ATOM   5646 N  N     . THR B 2 212 ? 20.329 42.566  18.778  1.00 96.17  ? 200  THR B N     1 
ATOM   5647 C  CA    . THR B 2 212 ? 20.010 41.729  19.931  1.00 97.90  ? 200  THR B CA    1 
ATOM   5648 C  C     . THR B 2 212 ? 18.879 40.756  19.611  1.00 96.75  ? 200  THR B C     1 
ATOM   5649 O  O     . THR B 2 212 ? 18.945 39.575  19.975  1.00 96.89  ? 200  THR B O     1 
ATOM   5650 C  CB    . THR B 2 212 ? 19.644 42.603  21.130  1.00 100.50 ? 200  THR B CB    1 
ATOM   5651 N  N     . LYS B 2 213 ? 17.837 41.230  18.923  1.00 95.25  ? 201  LYS B N     1 
ATOM   5652 C  CA    . LYS B 2 213 ? 16.751 40.336  18.534  1.00 93.11  ? 201  LYS B CA    1 
ATOM   5653 C  C     . LYS B 2 213 ? 17.216 39.316  17.501  1.00 89.75  ? 201  LYS B C     1 
ATOM   5654 O  O     . LYS B 2 213 ? 16.775 38.160  17.520  1.00 89.58  ? 201  LYS B O     1 
ATOM   5655 C  CB    . LYS B 2 213 ? 15.564 41.141  18.007  1.00 93.15  ? 201  LYS B CB    1 
ATOM   5656 C  CG    . LYS B 2 213 ? 14.580 41.534  19.092  1.00 97.28  ? 201  LYS B CG    1 
ATOM   5657 C  CD    . LYS B 2 213 ? 14.052 40.297  19.806  1.00 100.27 ? 201  LYS B CD    1 
ATOM   5658 C  CE    . LYS B 2 213 ? 13.346 40.652  21.105  1.00 104.48 ? 201  LYS B CE    1 
ATOM   5659 N  NZ    . LYS B 2 213 ? 12.173 41.541  20.882  1.00 105.18 ? 201  LYS B NZ    1 
ATOM   5660 N  N     . ILE B 2 214 ? 18.116 39.717  16.602  1.00 86.51  ? 202  ILE B N     1 
ATOM   5661 C  CA    . ILE B 2 214 ? 18.664 38.767  15.638  1.00 84.20  ? 202  ILE B CA    1 
ATOM   5662 C  C     . ILE B 2 214 ? 19.477 37.691  16.351  1.00 87.12  ? 202  ILE B C     1 
ATOM   5663 O  O     . ILE B 2 214 ? 19.410 36.508  15.997  1.00 86.53  ? 202  ILE B O     1 
ATOM   5664 C  CB    . ILE B 2 214 ? 19.493 39.506  14.572  1.00 80.30  ? 202  ILE B CB    1 
ATOM   5665 C  CG1   . ILE B 2 214 ? 18.574 40.319  13.659  1.00 76.01  ? 202  ILE B CG1   1 
ATOM   5666 C  CG2   . ILE B 2 214 ? 20.323 38.526  13.756  1.00 78.98  ? 202  ILE B CG2   1 
ATOM   5667 C  CD1   . ILE B 2 214 ? 17.538 39.483  12.943  1.00 72.10  ? 202  ILE B CD1   1 
ATOM   5668 N  N     . GLU B 2 215 ? 20.244 38.077  17.374  1.00 88.92  ? 203  GLU B N     1 
ATOM   5669 C  CA    . GLU B 2 215 ? 20.981 37.088  18.154  1.00 89.20  ? 203  GLU B CA    1 
ATOM   5670 C  C     . GLU B 2 215 ? 20.030 36.166  18.905  1.00 90.74  ? 203  GLU B C     1 
ATOM   5671 O  O     . GLU B 2 215 ? 20.278 34.959  19.007  1.00 91.66  ? 203  GLU B O     1 
ATOM   5672 C  CB    . GLU B 2 215 ? 21.936 37.784  19.122  1.00 91.75  ? 203  GLU B CB    1 
ATOM   5673 N  N     . GLU B 2 216 ? 18.933 36.714  19.433  1.00 90.78  ? 204  GLU B N     1 
ATOM   5674 C  CA    . GLU B 2 216 ? 17.932 35.877  20.088  1.00 91.01  ? 204  GLU B CA    1 
ATOM   5675 C  C     . GLU B 2 216 ? 17.332 34.872  19.111  1.00 89.14  ? 204  GLU B C     1 
ATOM   5676 O  O     . GLU B 2 216 ? 17.087 33.713  19.469  1.00 90.67  ? 204  GLU B O     1 
ATOM   5677 C  CB    . GLU B 2 216 ? 16.836 36.749  20.702  1.00 91.60  ? 204  GLU B CB    1 
ATOM   5678 N  N     . LEU B 2 217 ? 17.093 35.296  17.869  1.00 83.97  ? 205  LEU B N     1 
ATOM   5679 C  CA    . LEU B 2 217 ? 16.559 34.373  16.871  1.00 81.67  ? 205  LEU B CA    1 
ATOM   5680 C  C     . LEU B 2 217 ? 17.591 33.320  16.483  1.00 83.87  ? 205  LEU B C     1 
ATOM   5681 O  O     . LEU B 2 217 ? 17.238 32.162  16.231  1.00 82.27  ? 205  LEU B O     1 
ATOM   5682 C  CB    . LEU B 2 217 ? 16.082 35.139  15.639  1.00 79.18  ? 205  LEU B CB    1 
ATOM   5683 C  CG    . LEU B 2 217 ? 15.465 34.263  14.546  1.00 75.22  ? 205  LEU B CG    1 
ATOM   5684 C  CD1   . LEU B 2 217 ? 14.270 33.491  15.086  1.00 73.91  ? 205  LEU B CD1   1 
ATOM   5685 C  CD2   . LEU B 2 217 ? 15.070 35.094  13.336  1.00 73.84  ? 205  LEU B CD2   1 
ATOM   5686 N  N     . ARG B 2 218 ? 18.868 33.704  16.418  1.00 88.82  ? 206  ARG B N     1 
ATOM   5687 C  CA    . ARG B 2 218 ? 19.923 32.719  16.192  1.00 93.24  ? 206  ARG B CA    1 
ATOM   5688 C  C     . ARG B 2 218 ? 19.964 31.696  17.320  1.00 97.12  ? 206  ARG B C     1 
ATOM   5689 O  O     . ARG B 2 218 ? 20.217 30.509  17.085  1.00 94.94  ? 206  ARG B O     1 
ATOM   5690 C  CB    . ARG B 2 218 ? 21.278 33.412  16.045  1.00 98.68  ? 206  ARG B CB    1 
ATOM   5691 C  CG    . ARG B 2 218 ? 21.489 34.106  14.708  1.00 100.23 ? 206  ARG B CG    1 
ATOM   5692 C  CD    . ARG B 2 218 ? 21.621 33.108  13.562  1.00 100.62 ? 206  ARG B CD    1 
ATOM   5693 N  NE    . ARG B 2 218 ? 22.909 32.418  13.563  1.00 104.20 ? 206  ARG B NE    1 
ATOM   5694 C  CZ    . ARG B 2 218 ? 23.335 31.626  12.582  1.00 103.52 ? 206  ARG B CZ    1 
ATOM   5695 N  NH1   . ARG B 2 218 ? 24.521 31.039  12.666  1.00 105.06 ? 206  ARG B NH1   1 
ATOM   5696 N  NH2   . ARG B 2 218 ? 22.577 31.423  11.512  1.00 100.86 ? 206  ARG B NH2   1 
ATOM   5697 N  N     . GLN B 2 219 ? 19.728 32.142  18.557  1.00 104.26 ? 207  GLN B N     1 
ATOM   5698 C  CA    . GLN B 2 219 ? 19.590 31.203  19.667  1.00 110.22 ? 207  GLN B CA    1 
ATOM   5699 C  C     . GLN B 2 219 ? 18.398 30.279  19.452  1.00 111.36 ? 207  GLN B C     1 
ATOM   5700 O  O     . GLN B 2 219 ? 18.490 29.067  19.680  1.00 111.42 ? 207  GLN B O     1 
ATOM   5701 C  CB    . GLN B 2 219 ? 19.437 31.954  20.991  1.00 113.58 ? 207  GLN B CB    1 
ATOM   5702 C  CG    . GLN B 2 219 ? 20.527 32.970  21.297  1.00 116.20 ? 207  GLN B CG    1 
ATOM   5703 C  CD    . GLN B 2 219 ? 21.860 32.337  21.637  1.00 117.75 ? 207  GLN B CD    1 
ATOM   5704 O  OE1   . GLN B 2 219 ? 22.499 31.707  20.793  1.00 114.31 ? 207  GLN B OE1   1 
ATOM   5705 N  NE2   . GLN B 2 219 ? 22.293 32.508  22.881  1.00 122.11 ? 207  GLN B NE2   1 
ATOM   5706 N  N     . HIS B 2 220 ? 17.270 30.840  19.010  1.00 112.64 ? 208  HIS B N     1 
ATOM   5707 C  CA    . HIS B 2 220 ? 16.064 30.049  18.787  1.00 114.32 ? 208  HIS B CA    1 
ATOM   5708 C  C     . HIS B 2 220 ? 16.211 29.069  17.629  1.00 111.43 ? 208  HIS B C     1 
ATOM   5709 O  O     . HIS B 2 220 ? 15.491 28.065  17.591  1.00 111.39 ? 208  HIS B O     1 
ATOM   5710 C  CB    . HIS B 2 220 ? 14.873 30.978  18.540  1.00 115.87 ? 208  HIS B CB    1 
ATOM   5711 C  CG    . HIS B 2 220 ? 13.566 30.263  18.403  1.00 116.94 ? 208  HIS B CG    1 
ATOM   5712 N  ND1   . HIS B 2 220 ? 12.997 29.548  19.436  1.00 120.28 ? 208  HIS B ND1   1 
ATOM   5713 C  CD2   . HIS B 2 220 ? 12.715 30.152  17.356  1.00 114.26 ? 208  HIS B CD2   1 
ATOM   5714 C  CE1   . HIS B 2 220 ? 11.853 29.028  19.030  1.00 118.77 ? 208  HIS B CE1   1 
ATOM   5715 N  NE2   . HIS B 2 220 ? 11.658 29.379  17.772  1.00 114.98 ? 208  HIS B NE2   1 
ATOM   5716 N  N     . LEU B 2 221 ? 17.131 29.323  16.694  1.00 108.69 ? 209  LEU B N     1 
ATOM   5717 C  CA    . LEU B 2 221 ? 17.324 28.459  15.534  1.00 103.76 ? 209  LEU B CA    1 
ATOM   5718 C  C     . LEU B 2 221 ? 18.294 27.318  15.808  1.00 105.55 ? 209  LEU B C     1 
ATOM   5719 O  O     . LEU B 2 221 ? 18.932 26.809  14.876  1.00 104.43 ? 209  LEU B O     1 
ATOM   5720 C  CB    . LEU B 2 221 ? 17.793 29.278  14.331  1.00 100.29 ? 209  LEU B CB    1 
ATOM   5721 C  CG    . LEU B 2 221 ? 16.722 30.132  13.652  1.00 98.36  ? 209  LEU B CG    1 
ATOM   5722 C  CD1   . LEU B 2 221 ? 17.229 30.686  12.331  1.00 96.41  ? 209  LEU B CD1   1 
ATOM   5723 C  CD2   . LEU B 2 221 ? 15.451 29.326  13.448  1.00 96.97  ? 209  LEU B CD2   1 
ATOM   5724 N  N     . LEU B 2 222 ? 18.428 26.909  17.065  1.00 107.92 ? 210  LEU B N     1 
ATOM   5725 C  CA    . LEU B 2 222 ? 19.209 25.740  17.446  1.00 108.57 ? 210  LEU B CA    1 
ATOM   5726 C  C     . LEU B 2 222 ? 18.297 24.638  17.976  1.00 111.06 ? 210  LEU B C     1 
ATOM   5727 O  O     . LEU B 2 222 ? 18.614 23.953  18.949  1.00 115.48 ? 210  LEU B O     1 
ATOM   5728 C  CB    . LEU B 2 222 ? 20.273 26.112  18.474  1.00 107.60 ? 210  LEU B CB    1 
ATOM   5729 C  CG    . LEU B 2 222 ? 21.287 27.154  17.995  1.00 102.95 ? 210  LEU B CG    1 
ATOM   5730 C  CD1   . LEU B 2 222 ? 22.285 27.486  19.091  1.00 106.30 ? 210  LEU B CD1   1 
ATOM   5731 C  CD2   . LEU B 2 222 ? 22.002 26.669  16.743  1.00 98.88  ? 210  LEU B CD2   1 
ATOM   5732 N  N     . ARG B 2 223 ? 17.143 24.471  17.336  1.00 108.34 ? 211  ARG B N     1 
ATOM   5733 C  CA    . ARG B 2 223 ? 16.178 23.448  17.718  1.00 109.96 ? 211  ARG B CA    1 
ATOM   5734 C  C     . ARG B 2 223 ? 16.428 22.155  16.949  1.00 110.23 ? 211  ARG B C     1 
ATOM   5735 O  O     . ARG B 2 223 ? 16.688 22.178  15.746  1.00 107.01 ? 211  ARG B O     1 
ATOM   5736 C  CB    . ARG B 2 223 ? 14.749 23.940  17.475  1.00 106.80 ? 211  ARG B CB    1 
ATOM   5737 N  N     . GLU B 2 245 ? 23.151 43.774  6.023   1.00 92.88  ? 233  GLU B N     1 
ATOM   5738 C  CA    . GLU B 2 245 ? 22.130 44.483  6.786   1.00 94.32  ? 233  GLU B CA    1 
ATOM   5739 C  C     . GLU B 2 245 ? 21.423 45.521  5.916   1.00 98.01  ? 233  GLU B C     1 
ATOM   5740 O  O     . GLU B 2 245 ? 22.013 46.532  5.535   1.00 103.19 ? 233  GLU B O     1 
ATOM   5741 C  CB    . GLU B 2 245 ? 22.752 45.145  8.016   1.00 97.50  ? 233  GLU B CB    1 
ATOM   5742 C  CG    . GLU B 2 245 ? 21.759 45.860  8.914   1.00 98.58  ? 233  GLU B CG    1 
ATOM   5743 C  CD    . GLU B 2 245 ? 22.259 45.985  10.339  1.00 101.20 ? 233  GLU B CD    1 
ATOM   5744 O  OE1   . GLU B 2 245 ? 22.588 44.944  10.947  1.00 98.51  ? 233  GLU B OE1   1 
ATOM   5745 O  OE2   . GLU B 2 245 ? 22.332 47.122  10.849  1.00 106.45 ? 233  GLU B OE2   1 
ATOM   5746 N  N     . LEU B 2 246 ? 20.156 45.262  5.610   1.00 94.38  ? 234  LEU B N     1 
ATOM   5747 C  CA    . LEU B 2 246 ? 19.391 46.076  4.677   1.00 92.12  ? 234  LEU B CA    1 
ATOM   5748 C  C     . LEU B 2 246 ? 18.601 47.160  5.403   1.00 92.64  ? 234  LEU B C     1 
ATOM   5749 O  O     . LEU B 2 246 ? 18.369 47.097  6.613   1.00 89.76  ? 234  LEU B O     1 
ATOM   5750 C  CB    . LEU B 2 246 ? 18.431 45.203  3.867   1.00 86.82  ? 234  LEU B CB    1 
ATOM   5751 C  CG    . LEU B 2 246 ? 19.025 44.030  3.090   1.00 84.10  ? 234  LEU B CG    1 
ATOM   5752 C  CD1   . LEU B 2 246 ? 17.933 43.030  2.748   1.00 80.62  ? 234  LEU B CD1   1 
ATOM   5753 C  CD2   . LEU B 2 246 ? 19.724 44.514  1.830   1.00 85.97  ? 234  LEU B CD2   1 
ATOM   5754 N  N     . HIS B 2 247 ? 18.184 48.164  4.634   1.00 94.90  ? 235  HIS B N     1 
ATOM   5755 C  CA    . HIS B 2 247 ? 17.303 49.228  5.118   1.00 99.78  ? 235  HIS B CA    1 
ATOM   5756 C  C     . HIS B 2 247 ? 16.283 49.517  4.028   1.00 100.89 ? 235  HIS B C     1 
ATOM   5757 O  O     . HIS B 2 247 ? 16.438 50.454  3.236   1.00 105.21 ? 235  HIS B O     1 
ATOM   5758 C  CB    . HIS B 2 247 ? 18.098 50.483  5.490   1.00 106.98 ? 235  HIS B CB    1 
ATOM   5759 C  CG    . HIS B 2 247 ? 19.133 50.253  6.547   1.00 107.81 ? 235  HIS B CG    1 
ATOM   5760 N  ND1   . HIS B 2 247 ? 18.810 49.913  7.844   1.00 106.45 ? 235  HIS B ND1   1 
ATOM   5761 C  CD2   . HIS B 2 247 ? 20.485 50.316  6.501   1.00 109.76 ? 235  HIS B CD2   1 
ATOM   5762 C  CE1   . HIS B 2 247 ? 19.918 49.773  8.549   1.00 107.55 ? 235  HIS B CE1   1 
ATOM   5763 N  NE2   . HIS B 2 247 ? 20.949 50.013  7.758   1.00 109.84 ? 235  HIS B NE2   1 
ATOM   5764 N  N     . PRO B 2 248 ? 15.213 48.717  3.955   1.00 97.03  ? 236  PRO B N     1 
ATOM   5765 C  CA    . PRO B 2 248 ? 14.271 48.861  2.832   1.00 92.17  ? 236  PRO B CA    1 
ATOM   5766 C  C     . PRO B 2 248 ? 13.505 50.171  2.832   1.00 99.95  ? 236  PRO B C     1 
ATOM   5767 O  O     . PRO B 2 248 ? 13.152 50.662  1.752   1.00 99.74  ? 236  PRO B O     1 
ATOM   5768 C  CB    . PRO B 2 248 ? 13.328 47.662  3.009   1.00 92.73  ? 236  PRO B CB    1 
ATOM   5769 C  CG    . PRO B 2 248 ? 14.081 46.701  3.867   1.00 82.79  ? 236  PRO B CG    1 
ATOM   5770 C  CD    . PRO B 2 248 ? 14.898 47.548  4.791   1.00 91.46  ? 236  PRO B CD    1 
ATOM   5771 N  N     . ASP B 2 249 ? 13.235 50.759  3.996   1.00 101.95 ? 237  ASP B N     1 
ATOM   5772 C  CA    . ASP B 2 249 ? 12.471 52.008  3.997   1.00 107.22 ? 237  ASP B CA    1 
ATOM   5773 C  C     . ASP B 2 249 ? 13.287 53.205  3.511   1.00 113.76 ? 237  ASP B C     1 
ATOM   5774 O  O     . ASP B 2 249 ? 12.808 54.343  3.606   1.00 118.84 ? 237  ASP B O     1 
ATOM   5775 C  CB    . ASP B 2 249 ? 11.905 52.286  5.392   1.00 108.69 ? 237  ASP B CB    1 
ATOM   5776 C  CG    . ASP B 2 249 ? 12.978 52.632  6.408   1.00 111.98 ? 237  ASP B CG    1 
ATOM   5777 O  OD1   . ASP B 2 249 ? 14.115 52.132  6.279   1.00 111.21 ? 237  ASP B OD1   1 
ATOM   5778 O  OD2   . ASP B 2 249 ? 12.679 53.405  7.343   1.00 116.44 ? 237  ASP B OD2   1 
ATOM   5779 N  N     . LYS B 2 250 ? 14.496 52.978  2.998   1.00 114.07 ? 238  LYS B N     1 
ATOM   5780 C  CA    . LYS B 2 250 ? 15.315 54.034  2.425   1.00 121.32 ? 238  LYS B CA    1 
ATOM   5781 C  C     . LYS B 2 250 ? 15.560 53.852  0.934   1.00 122.17 ? 238  LYS B C     1 
ATOM   5782 O  O     . LYS B 2 250 ? 16.174 54.728  0.313   1.00 127.27 ? 238  LYS B O     1 
ATOM   5783 C  CB    . LYS B 2 250 ? 16.660 54.124  3.159   1.00 122.75 ? 238  LYS B CB    1 
ATOM   5784 N  N     . TRP B 2 251 ? 15.109 52.745  0.344   1.00 117.21 ? 239  TRP B N     1 
ATOM   5785 C  CA    . TRP B 2 251 ? 15.247 52.552  -1.094  1.00 117.82 ? 239  TRP B CA    1 
ATOM   5786 C  C     . TRP B 2 251 ? 14.450 53.613  -1.842  1.00 125.00 ? 239  TRP B C     1 
ATOM   5787 O  O     . TRP B 2 251 ? 13.296 53.894  -1.504  1.00 119.06 ? 239  TRP B O     1 
ATOM   5788 C  CB    . TRP B 2 251 ? 14.769 51.154  -1.494  1.00 109.25 ? 239  TRP B CB    1 
ATOM   5789 C  CG    . TRP B 2 251 ? 15.526 50.028  -0.848  1.00 103.08 ? 239  TRP B CG    1 
ATOM   5790 C  CD1   . TRP B 2 251 ? 16.706 50.113  -0.167  1.00 104.29 ? 239  TRP B CD1   1 
ATOM   5791 C  CD2   . TRP B 2 251 ? 15.148 48.645  -0.821  1.00 93.97  ? 239  TRP B CD2   1 
ATOM   5792 N  NE1   . TRP B 2 251 ? 17.086 48.871  0.281   1.00 96.55  ? 239  TRP B NE1   1 
ATOM   5793 C  CE2   . TRP B 2 251 ? 16.147 47.952  -0.107  1.00 91.58  ? 239  TRP B CE2   1 
ATOM   5794 C  CE3   . TRP B 2 251 ? 14.062 47.926  -1.330  1.00 92.01  ? 239  TRP B CE3   1 
ATOM   5795 C  CZ2   . TRP B 2 251 ? 16.091 46.576  0.110   1.00 85.51  ? 239  TRP B CZ2   1 
ATOM   5796 C  CZ3   . TRP B 2 251 ? 14.009 46.559  -1.113  1.00 86.06  ? 239  TRP B CZ3   1 
ATOM   5797 C  CH2   . TRP B 2 251 ? 15.018 45.899  -0.400  1.00 81.85  ? 239  TRP B CH2   1 
ATOM   5798 N  N     . THR B 2 252 ? 15.069 54.202  -2.861  1.00 130.88 ? 240  THR B N     1 
ATOM   5799 C  CA    . THR B 2 252 ? 14.466 55.289  -3.614  1.00 139.07 ? 240  THR B CA    1 
ATOM   5800 C  C     . THR B 2 252 ? 14.346 54.915  -5.085  1.00 143.99 ? 240  THR B C     1 
ATOM   5801 O  O     . THR B 2 252 ? 15.058 54.044  -5.592  1.00 141.10 ? 240  THR B O     1 
ATOM   5802 C  CB    . THR B 2 252 ? 15.280 56.584  -3.473  1.00 145.70 ? 240  THR B CB    1 
ATOM   5803 O  OG1   . THR B 2 252 ? 16.609 56.372  -3.965  1.00 146.75 ? 240  THR B OG1   1 
ATOM   5804 C  CG2   . THR B 2 252 ? 15.346 57.014  -2.016  1.00 145.49 ? 240  THR B CG2   1 
ATOM   5805 N  N     . VAL B 2 253 ? 13.424 55.593  -5.764  1.00 82.99  ? 241  VAL B N     1 
ATOM   5806 C  CA    . VAL B 2 253 ? 13.182 55.413  -7.191  1.00 82.47  ? 241  VAL B CA    1 
ATOM   5807 C  C     . VAL B 2 253 ? 13.931 56.497  -7.950  1.00 86.91  ? 241  VAL B C     1 
ATOM   5808 O  O     . VAL B 2 253 ? 14.013 57.646  -7.497  1.00 89.71  ? 241  VAL B O     1 
ATOM   5809 C  CB    . VAL B 2 253 ? 11.672 55.457  -7.501  1.00 80.16  ? 241  VAL B CB    1 
ATOM   5810 C  CG1   . VAL B 2 253 ? 11.418 55.353  -8.997  1.00 75.98  ? 241  VAL B CG1   1 
ATOM   5811 C  CG2   . VAL B 2 253 ? 10.948 54.347  -6.757  1.00 82.47  ? 241  VAL B CG2   1 
ATOM   5812 N  N     . GLN B 2 254 ? 14.487 56.133  -9.108  1.00 87.54  ? 242  GLN B N     1 
ATOM   5813 C  CA    . GLN B 2 254 ? 15.213 57.074  -9.946  1.00 89.56  ? 242  GLN B CA    1 
ATOM   5814 C  C     . GLN B 2 254 ? 14.328 57.490  -11.115 1.00 86.75  ? 242  GLN B C     1 
ATOM   5815 O  O     . GLN B 2 254 ? 14.197 56.732  -12.089 1.00 84.36  ? 242  GLN B O     1 
ATOM   5816 C  CB    . GLN B 2 254 ? 16.518 56.453  -10.451 1.00 93.05  ? 242  GLN B CB    1 
ATOM   5817 C  CG    . GLN B 2 254 ? 17.332 57.385  -11.324 1.00 96.13  ? 242  GLN B CG    1 
ATOM   5818 C  CD    . GLN B 2 254 ? 17.553 58.739  -10.677 1.00 101.60 ? 242  GLN B CD    1 
ATOM   5819 O  OE1   . GLN B 2 254 ? 18.150 58.837  -9.605  1.00 106.70 ? 242  GLN B OE1   1 
ATOM   5820 N  NE2   . GLN B 2 254 ? 17.062 59.792  -11.323 1.00 100.42 ? 242  GLN B NE2   1 
ATOM   5821 N  N     . PRO B 2 255 ? 13.705 58.664  -11.076 1.00 86.02  ? 243  PRO B N     1 
ATOM   5822 C  CA    . PRO B 2 255 ? 12.813 59.074  -12.164 1.00 80.61  ? 243  PRO B CA    1 
ATOM   5823 C  C     . PRO B 2 255 ? 13.592 59.583  -13.371 1.00 76.66  ? 243  PRO B C     1 
ATOM   5824 O  O     . PRO B 2 255 ? 14.807 59.781  -13.335 1.00 76.83  ? 243  PRO B O     1 
ATOM   5825 C  CB    . PRO B 2 255 ? 11.987 60.195  -11.529 1.00 82.77  ? 243  PRO B CB    1 
ATOM   5826 C  CG    . PRO B 2 255 ? 12.916 60.800  -10.532 1.00 86.54  ? 243  PRO B CG    1 
ATOM   5827 C  CD    . PRO B 2 255 ? 13.747 59.661  -9.992  1.00 88.89  ? 243  PRO B CD    1 
ATOM   5828 N  N     . ILE B 2 256 ? 12.855 59.790  -14.456 1.00 73.54  ? 244  ILE B N     1 
ATOM   5829 C  CA    . ILE B 2 256 ? 13.415 60.379  -15.666 1.00 70.24  ? 244  ILE B CA    1 
ATOM   5830 C  C     . ILE B 2 256 ? 13.399 61.895  -15.523 1.00 71.64  ? 244  ILE B C     1 
ATOM   5831 O  O     . ILE B 2 256 ? 12.376 62.485  -15.158 1.00 71.91  ? 244  ILE B O     1 
ATOM   5832 C  CB    . ILE B 2 256 ? 12.625 59.928  -16.904 1.00 64.44  ? 244  ILE B CB    1 
ATOM   5833 C  CG1   . ILE B 2 256 ? 12.488 58.404  -16.916 1.00 63.91  ? 244  ILE B CG1   1 
ATOM   5834 C  CG2   . ILE B 2 256 ? 13.299 60.415  -18.175 1.00 60.48  ? 244  ILE B CG2   1 
ATOM   5835 C  CD1   . ILE B 2 256 ? 11.513 57.889  -17.956 1.00 62.49  ? 244  ILE B CD1   1 
ATOM   5836 N  N     . VAL B 2 257 ? 14.533 62.529  -15.809 1.00 74.12  ? 245  VAL B N     1 
ATOM   5837 C  CA    . VAL B 2 257 ? 14.700 63.964  -15.615 1.00 82.27  ? 245  VAL B CA    1 
ATOM   5838 C  C     . VAL B 2 257 ? 15.173 64.588  -16.921 1.00 78.94  ? 245  VAL B C     1 
ATOM   5839 O  O     . VAL B 2 257 ? 15.951 63.981  -17.667 1.00 83.15  ? 245  VAL B O     1 
ATOM   5840 C  CB    . VAL B 2 257 ? 15.686 64.265  -14.462 1.00 89.25  ? 245  VAL B CB    1 
ATOM   5841 C  CG1   . VAL B 2 257 ? 17.049 63.638  -14.735 1.00 90.79  ? 245  VAL B CG1   1 
ATOM   5842 C  CG2   . VAL B 2 257 ? 15.809 65.767  -14.225 1.00 93.31  ? 245  VAL B CG2   1 
ATOM   5843 N  N     . LEU B 2 258 ? 14.679 65.814  -17.210 1.00 73.21  ? 246  LEU B N     1 
ATOM   5844 C  CA    . LEU B 2 258 ? 15.006 66.584  -18.399 1.00 66.32  ? 246  LEU B CA    1 
ATOM   5845 C  C     . LEU B 2 258 ? 16.035 67.663  -18.075 1.00 66.12  ? 246  LEU B C     1 
ATOM   5846 O  O     . LEU B 2 258 ? 16.046 68.207  -16.967 1.00 69.99  ? 246  LEU B O     1 
ATOM   5847 C  CB    . LEU B 2 258 ? 13.747 67.236  -18.981 1.00 61.21  ? 246  LEU B CB    1 
ATOM   5848 C  CG    . LEU B 2 258 ? 12.618 66.276  -19.363 1.00 57.31  ? 246  LEU B CG    1 
ATOM   5849 C  CD1   . LEU B 2 258 ? 11.407 67.041  -19.870 1.00 55.58  ? 246  LEU B CD1   1 
ATOM   5850 C  CD2   . LEU B 2 258 ? 13.090 65.261  -20.398 1.00 55.00  ? 246  LEU B CD2   1 
ATOM   5851 N  N     . PRO B 2 259 ? 16.912 67.994  -19.020 1.00 62.29  ? 247  PRO B N     1 
ATOM   5852 C  CA    . PRO B 2 259 ? 17.948 68.993  -18.741 1.00 61.76  ? 247  PRO B CA    1 
ATOM   5853 C  C     . PRO B 2 259 ? 17.356 70.380  -18.548 1.00 63.66  ? 247  PRO B C     1 
ATOM   5854 O  O     . PRO B 2 259 ? 16.306 70.720  -19.098 1.00 64.31  ? 247  PRO B O     1 
ATOM   5855 C  CB    . PRO B 2 259 ? 18.836 68.938  -19.989 1.00 60.46  ? 247  PRO B CB    1 
ATOM   5856 C  CG    . PRO B 2 259 ? 17.920 68.473  -21.071 1.00 57.64  ? 247  PRO B CG    1 
ATOM   5857 C  CD    . PRO B 2 259 ? 16.980 67.503  -20.408 1.00 59.58  ? 247  PRO B CD    1 
ATOM   5858 N  N     . GLU B 2 260 ? 18.048 71.183  -17.743 1.00 65.27  ? 248  GLU B N     1 
ATOM   5859 C  CA    . GLU B 2 260 ? 17.672 72.567  -17.485 1.00 66.87  ? 248  GLU B CA    1 
ATOM   5860 C  C     . GLU B 2 260 ? 18.771 73.469  -18.026 1.00 68.21  ? 248  GLU B C     1 
ATOM   5861 O  O     . GLU B 2 260 ? 19.904 73.433  -17.534 1.00 71.04  ? 248  GLU B O     1 
ATOM   5862 C  CB    . GLU B 2 260 ? 17.455 72.812  -15.990 1.00 68.97  ? 248  GLU B CB    1 
ATOM   5863 N  N     . LYS B 2 261 ? 18.441 74.270  -19.036 1.00 66.54  ? 249  LYS B N     1 
ATOM   5864 C  CA    . LYS B 2 261 ? 19.411 75.136  -19.688 1.00 67.40  ? 249  LYS B CA    1 
ATOM   5865 C  C     . LYS B 2 261 ? 18.864 76.552  -19.796 1.00 70.65  ? 249  LYS B C     1 
ATOM   5866 O  O     . LYS B 2 261 ? 17.653 76.783  -19.762 1.00 72.80  ? 249  LYS B O     1 
ATOM   5867 C  CB    . LYS B 2 261 ? 19.777 74.629  -21.092 1.00 64.23  ? 249  LYS B CB    1 
ATOM   5868 C  CG    . LYS B 2 261 ? 20.355 73.229  -21.137 1.00 62.96  ? 249  LYS B CG    1 
ATOM   5869 C  CD    . LYS B 2 261 ? 20.759 72.861  -22.556 1.00 60.74  ? 249  LYS B CD    1 
ATOM   5870 C  CE    . LYS B 2 261 ? 21.216 71.414  -22.647 1.00 61.22  ? 249  LYS B CE    1 
ATOM   5871 N  NZ    . LYS B 2 261 ? 22.379 71.144  -21.759 1.00 64.15  ? 249  LYS B NZ    1 
ATOM   5872 N  N     . ASP B 2 262 ? 19.787 77.505  -19.926 1.00 71.73  ? 250  ASP B N     1 
ATOM   5873 C  CA    . ASP B 2 262 ? 19.454 78.875  -20.285 1.00 73.93  ? 250  ASP B CA    1 
ATOM   5874 C  C     . ASP B 2 262 ? 19.635 79.145  -21.770 1.00 68.29  ? 250  ASP B C     1 
ATOM   5875 O  O     . ASP B 2 262 ? 19.234 80.213  -22.245 1.00 70.03  ? 250  ASP B O     1 
ATOM   5876 C  CB    . ASP B 2 262 ? 20.310 79.862  -19.484 1.00 82.05  ? 250  ASP B CB    1 
ATOM   5877 C  CG    . ASP B 2 262 ? 20.215 79.636  -17.992 1.00 91.48  ? 250  ASP B CG    1 
ATOM   5878 O  OD1   . ASP B 2 262 ? 19.476 78.718  -17.577 1.00 92.52  ? 250  ASP B OD1   1 
ATOM   5879 O  OD2   . ASP B 2 262 ? 20.879 80.375  -17.235 1.00 97.23  ? 250  ASP B OD2   1 
ATOM   5880 N  N     . SER B 2 263 ? 20.224 78.205  -22.505 1.00 63.05  ? 251  SER B N     1 
ATOM   5881 C  CA    . SER B 2 263 ? 20.495 78.367  -23.927 1.00 58.28  ? 251  SER B CA    1 
ATOM   5882 C  C     . SER B 2 263 ? 20.410 77.002  -24.590 1.00 54.45  ? 251  SER B C     1 
ATOM   5883 O  O     . SER B 2 263 ? 21.065 76.055  -24.146 1.00 54.18  ? 251  SER B O     1 
ATOM   5884 C  CB    . SER B 2 263 ? 21.876 78.992  -24.152 1.00 56.70  ? 251  SER B CB    1 
ATOM   5885 O  OG    . SER B 2 263 ? 22.160 79.116  -25.533 1.00 56.78  ? 251  SER B OG    1 
ATOM   5886 N  N     . TRP B 2 264 ? 19.611 76.905  -25.650 1.00 51.41  ? 252  TRP B N     1 
ATOM   5887 C  CA    . TRP B 2 264 ? 19.327 75.638  -26.311 1.00 46.01  ? 252  TRP B CA    1 
ATOM   5888 C  C     . TRP B 2 264 ? 19.772 75.694  -27.765 1.00 46.54  ? 252  TRP B C     1 
ATOM   5889 O  O     . TRP B 2 264 ? 19.376 76.601  -28.505 1.00 51.40  ? 252  TRP B O     1 
ATOM   5890 C  CB    . TRP B 2 264 ? 17.834 75.308  -26.237 1.00 44.44  ? 252  TRP B CB    1 
ATOM   5891 C  CG    . TRP B 2 264 ? 17.325 75.123  -24.844 1.00 48.58  ? 252  TRP B CG    1 
ATOM   5892 C  CD1   . TRP B 2 264 ? 16.957 76.103  -23.971 1.00 51.00  ? 252  TRP B CD1   1 
ATOM   5893 C  CD2   . TRP B 2 264 ? 17.119 73.879  -24.162 1.00 49.71  ? 252  TRP B CD2   1 
ATOM   5894 N  NE1   . TRP B 2 264 ? 16.537 75.549  -22.786 1.00 54.27  ? 252  TRP B NE1   1 
ATOM   5895 C  CE2   . TRP B 2 264 ? 16.627 74.185  -22.877 1.00 52.20  ? 252  TRP B CE2   1 
ATOM   5896 C  CE3   . TRP B 2 264 ? 17.303 72.538  -24.512 1.00 48.96  ? 252  TRP B CE3   1 
ATOM   5897 C  CZ2   . TRP B 2 264 ? 16.317 73.201  -21.943 1.00 51.94  ? 252  TRP B CZ2   1 
ATOM   5898 C  CZ3   . TRP B 2 264 ? 16.995 71.560  -23.582 1.00 50.07  ? 252  TRP B CZ3   1 
ATOM   5899 C  CH2   . TRP B 2 264 ? 16.507 71.898  -22.313 1.00 52.27  ? 252  TRP B CH2   1 
ATOM   5900 N  N     . THR B 2 265 ? 20.582 74.722  -28.174 1.00 42.60  ? 253  THR B N     1 
ATOM   5901 C  CA    . THR B 2 265 ? 20.951 74.592  -29.574 1.00 44.19  ? 253  THR B CA    1 
ATOM   5902 C  C     . THR B 2 265 ? 20.001 73.629  -30.285 1.00 41.13  ? 253  THR B C     1 
ATOM   5903 O  O     . THR B 2 265 ? 19.177 72.952  -29.666 1.00 40.57  ? 253  THR B O     1 
ATOM   5904 C  CB    . THR B 2 265 ? 22.396 74.109  -29.719 1.00 45.60  ? 253  THR B CB    1 
ATOM   5905 O  OG1   . THR B 2 265 ? 22.505 72.758  -29.252 1.00 46.91  ? 253  THR B OG1   1 
ATOM   5906 C  CG2   . THR B 2 265 ? 23.339 74.996  -28.922 1.00 42.69  ? 253  THR B CG2   1 
ATOM   5907 N  N     . VAL B 2 266 ? 20.122 73.584  -31.614 1.00 38.46  ? 254  VAL B N     1 
ATOM   5908 C  CA    . VAL B 2 266 ? 19.365 72.616  -32.402 1.00 38.17  ? 254  VAL B CA    1 
ATOM   5909 C  C     . VAL B 2 266 ? 19.663 71.199  -31.926 1.00 41.01  ? 254  VAL B C     1 
ATOM   5910 O  O     . VAL B 2 266 ? 18.770 70.345  -31.868 1.00 41.77  ? 254  VAL B O     1 
ATOM   5911 C  CB    . VAL B 2 266 ? 19.674 72.792  -33.901 1.00 37.74  ? 254  VAL B CB    1 
ATOM   5912 C  CG1   . VAL B 2 266 ? 19.042 71.676  -34.722 1.00 34.20  ? 254  VAL B CG1   1 
ATOM   5913 C  CG2   . VAL B 2 266 ? 19.188 74.153  -34.390 1.00 37.68  ? 254  VAL B CG2   1 
ATOM   5914 N  N     . ASN B 2 267 ? 20.917 70.934  -31.553 1.00 42.24  ? 255  ASN B N     1 
ATOM   5915 C  CA    . ASN B 2 267 ? 21.284 69.610  -31.060 1.00 42.15  ? 255  ASN B CA    1 
ATOM   5916 C  C     . ASN B 2 267 ? 20.604 69.309  -29.729 1.00 43.29  ? 255  ASN B C     1 
ATOM   5917 O  O     . ASN B 2 267 ? 20.063 68.213  -29.530 1.00 42.52  ? 255  ASN B O     1 
ATOM   5918 C  CB    . ASN B 2 267 ? 22.804 69.506  -30.927 1.00 41.29  ? 255  ASN B CB    1 
ATOM   5919 C  CG    . ASN B 2 267 ? 23.258 68.126  -30.494 1.00 43.69  ? 255  ASN B CG    1 
ATOM   5920 O  OD1   . ASN B 2 267 ? 23.229 67.179  -31.279 1.00 48.63  ? 255  ASN B OD1   1 
ATOM   5921 N  ND2   . ASN B 2 267 ? 23.685 68.007  -29.244 1.00 42.19  ? 255  ASN B ND2   1 
ATOM   5922 N  N     . ASP B 2 268 ? 20.638 70.269  -28.799 1.00 44.52  ? 256  ASP B N     1 
ATOM   5923 C  CA    . ASP B 2 268 ? 19.969 70.088  -27.514 1.00 44.11  ? 256  ASP B CA    1 
ATOM   5924 C  C     . ASP B 2 268 ? 18.490 69.778  -27.703 1.00 44.69  ? 256  ASP B C     1 
ATOM   5925 O  O     . ASP B 2 268 ? 17.951 68.869  -27.061 1.00 46.31  ? 256  ASP B O     1 
ATOM   5926 C  CB    . ASP B 2 268 ? 20.139 71.338  -26.648 1.00 48.21  ? 256  ASP B CB    1 
ATOM   5927 C  CG    . ASP B 2 268 ? 21.587 71.610  -26.280 1.00 56.49  ? 256  ASP B CG    1 
ATOM   5928 O  OD1   . ASP B 2 268 ? 22.397 70.658  -26.281 1.00 58.32  ? 256  ASP B OD1   1 
ATOM   5929 O  OD2   . ASP B 2 268 ? 21.911 72.781  -25.979 1.00 58.40  ? 256  ASP B OD2   1 
ATOM   5930 N  N     . ILE B 2 269 ? 17.821 70.513  -28.593 1.00 45.22  ? 257  ILE B N     1 
ATOM   5931 C  CA    . ILE B 2 269 ? 16.385 70.334  -28.768 1.00 42.97  ? 257  ILE B CA    1 
ATOM   5932 C  C     . ILE B 2 269 ? 16.087 69.019  -29.480 1.00 40.70  ? 257  ILE B C     1 
ATOM   5933 O  O     . ILE B 2 269 ? 15.101 68.346  -29.167 1.00 40.16  ? 257  ILE B O     1 
ATOM   5934 C  CB    . ILE B 2 269 ? 15.783 71.539  -29.513 1.00 43.29  ? 257  ILE B CB    1 
ATOM   5935 C  CG1   . ILE B 2 269 ? 16.055 72.826  -28.731 1.00 43.19  ? 257  ILE B CG1   1 
ATOM   5936 C  CG2   . ILE B 2 269 ? 14.287 71.350  -29.716 1.00 34.42  ? 257  ILE B CG2   1 
ATOM   5937 C  CD1   . ILE B 2 269 ? 15.456 74.064  -29.360 1.00 44.96  ? 257  ILE B CD1   1 
ATOM   5938 N  N     . GLN B 2 270 ? 16.929 68.625  -30.439 1.00 39.33  ? 258  GLN B N     1 
ATOM   5939 C  CA    . GLN B 2 270 ? 16.736 67.328  -31.084 1.00 38.20  ? 258  GLN B CA    1 
ATOM   5940 C  C     . GLN B 2 270 ? 16.883 66.188  -30.081 1.00 39.41  ? 258  GLN B C     1 
ATOM   5941 O  O     . GLN B 2 270 ? 16.072 65.252  -30.068 1.00 38.53  ? 258  GLN B O     1 
ATOM   5942 C  CB    . GLN B 2 270 ? 17.716 67.164  -32.247 1.00 36.35  ? 258  GLN B CB    1 
ATOM   5943 C  CG    . GLN B 2 270 ? 17.276 67.889  -33.522 1.00 38.75  ? 258  GLN B CG    1 
ATOM   5944 C  CD    . GLN B 2 270 ? 18.317 67.850  -34.626 1.00 38.49  ? 258  GLN B CD    1 
ATOM   5945 O  OE1   . GLN B 2 270 ? 19.405 67.306  -34.451 1.00 41.43  ? 258  GLN B OE1   1 
ATOM   5946 N  NE2   . GLN B 2 270 ? 17.985 68.433  -35.775 1.00 40.63  ? 258  GLN B NE2   1 
ATOM   5947 N  N     . LYS B 2 271 ? 17.897 66.263  -29.213 1.00 40.28  ? 259  LYS B N     1 
ATOM   5948 C  CA    . LYS B 2 271 ? 18.075 65.229  -28.196 1.00 42.99  ? 259  LYS B CA    1 
ATOM   5949 C  C     . LYS B 2 271 ? 16.908 65.213  -27.215 1.00 46.90  ? 259  LYS B C     1 
ATOM   5950 O  O     . LYS B 2 271 ? 16.410 64.140  -26.845 1.00 48.38  ? 259  LYS B O     1 
ATOM   5951 C  CB    . LYS B 2 271 ? 19.404 65.436  -27.468 1.00 40.94  ? 259  LYS B CB    1 
ATOM   5952 C  CG    . LYS B 2 271 ? 20.590 64.819  -28.199 1.00 47.98  ? 259  LYS B CG    1 
ATOM   5953 C  CD    . LYS B 2 271 ? 21.906 65.489  -27.839 1.00 55.66  ? 259  LYS B CD    1 
ATOM   5954 C  CE    . LYS B 2 271 ? 22.248 65.330  -26.367 1.00 60.93  ? 259  LYS B CE    1 
ATOM   5955 N  NZ    . LYS B 2 271 ? 23.564 65.956  -26.047 1.00 65.20  ? 259  LYS B NZ    1 
ATOM   5956 N  N     . LEU B 2 272 ? 16.449 66.395  -26.793 1.00 45.69  ? 260  LEU B N     1 
ATOM   5957 C  CA    . LEU B 2 272 ? 15.301 66.473  -25.896 1.00 44.59  ? 260  LEU B CA    1 
ATOM   5958 C  C     . LEU B 2 272 ? 14.050 65.888  -26.540 1.00 48.69  ? 260  LEU B C     1 
ATOM   5959 O  O     . LEU B 2 272 ? 13.284 65.173  -25.884 1.00 50.66  ? 260  LEU B O     1 
ATOM   5960 C  CB    . LEU B 2 272 ? 15.064 67.925  -25.488 1.00 44.24  ? 260  LEU B CB    1 
ATOM   5961 C  CG    . LEU B 2 272 ? 13.811 68.245  -24.674 1.00 44.72  ? 260  LEU B CG    1 
ATOM   5962 C  CD1   . LEU B 2 272 ? 13.842 67.534  -23.328 1.00 43.77  ? 260  LEU B CD1   1 
ATOM   5963 C  CD2   . LEU B 2 272 ? 13.679 69.750  -24.491 1.00 45.50  ? 260  LEU B CD2   1 
ATOM   5964 N  N     . VAL B 2 273 ? 13.826 66.177  -27.824 1.00 48.54  ? 261  VAL B N     1 
ATOM   5965 C  CA    . VAL B 2 273 ? 12.638 65.676  -28.507 1.00 49.07  ? 261  VAL B CA    1 
ATOM   5966 C  C     . VAL B 2 273 ? 12.701 64.162  -28.650 1.00 51.94  ? 261  VAL B C     1 
ATOM   5967 O  O     . VAL B 2 273 ? 11.692 63.473  -28.477 1.00 54.32  ? 261  VAL B O     1 
ATOM   5968 C  CB    . VAL B 2 273 ? 12.468 66.370  -29.870 1.00 46.44  ? 261  VAL B CB    1 
ATOM   5969 C  CG1   . VAL B 2 273 ? 11.465 65.615  -30.731 1.00 41.83  ? 261  VAL B CG1   1 
ATOM   5970 C  CG2   . VAL B 2 273 ? 12.015 67.808  -29.675 1.00 49.80  ? 261  VAL B CG2   1 
ATOM   5971 N  N     . GLY B 2 274 ? 13.878 63.617  -28.968 1.00 49.61  ? 262  GLY B N     1 
ATOM   5972 C  CA    . GLY B 2 274 ? 14.010 62.168  -29.012 1.00 49.18  ? 262  GLY B CA    1 
ATOM   5973 C  C     . GLY B 2 274 ? 13.736 61.519  -27.667 1.00 48.37  ? 262  GLY B C     1 
ATOM   5974 O  O     . GLY B 2 274 ? 13.009 60.520  -27.577 1.00 46.77  ? 262  GLY B O     1 
ATOM   5975 N  N     . LYS B 2 275 ? 14.298 62.093  -26.598 1.00 46.57  ? 263  LYS B N     1 
ATOM   5976 C  CA    . LYS B 2 275 ? 14.072 61.556  -25.260 1.00 46.95  ? 263  LYS B CA    1 
ATOM   5977 C  C     . LYS B 2 275 ? 12.598 61.624  -24.872 1.00 49.93  ? 263  LYS B C     1 
ATOM   5978 O  O     . LYS B 2 275 ? 12.059 60.679  -24.285 1.00 52.42  ? 263  LYS B O     1 
ATOM   5979 C  CB    . LYS B 2 275 ? 14.936 62.308  -24.249 1.00 46.39  ? 263  LYS B CB    1 
ATOM   5980 C  CG    . LYS B 2 275 ? 14.841 61.783  -22.828 1.00 47.78  ? 263  LYS B CG    1 
ATOM   5981 C  CD    . LYS B 2 275 ? 15.899 62.418  -21.944 1.00 46.26  ? 263  LYS B CD    1 
ATOM   5982 C  CE    . LYS B 2 275 ? 15.795 61.915  -20.516 1.00 49.15  ? 263  LYS B CE    1 
ATOM   5983 N  NZ    . LYS B 2 275 ? 16.906 62.433  -19.671 1.00 51.76  ? 263  LYS B NZ    1 
ATOM   5984 N  N     . LEU B 2 276 ? 11.922 62.726  -25.205 1.00 48.21  ? 264  LEU B N     1 
ATOM   5985 C  CA    . LEU B 2 276 ? 10.508 62.854  -24.862 1.00 47.66  ? 264  LEU B CA    1 
ATOM   5986 C  C     . LEU B 2 276 ? 9.644  61.930  -25.710 1.00 46.88  ? 264  LEU B C     1 
ATOM   5987 O  O     . LEU B 2 276 ? 8.637  61.399  -25.229 1.00 49.66  ? 264  LEU B O     1 
ATOM   5988 C  CB    . LEU B 2 276 ? 10.056 64.304  -25.020 1.00 47.88  ? 264  LEU B CB    1 
ATOM   5989 C  CG    . LEU B 2 276 ? 10.600 65.301  -23.998 1.00 47.85  ? 264  LEU B CG    1 
ATOM   5990 C  CD1   . LEU B 2 276 ? 10.243 66.720  -24.404 1.00 49.53  ? 264  LEU B CD1   1 
ATOM   5991 C  CD2   . LEU B 2 276 ? 10.066 64.986  -22.610 1.00 48.67  ? 264  LEU B CD2   1 
ATOM   5992 N  N     . ASN B 2 277 ? 10.015 61.728  -26.974 1.00 45.22  ? 265  ASN B N     1 
ATOM   5993 C  CA    . ASN B 2 277 ? 9.277  60.801  -27.821 1.00 48.25  ? 265  ASN B CA    1 
ATOM   5994 C  C     . ASN B 2 277 ? 9.389  59.379  -27.291 1.00 52.16  ? 265  ASN B C     1 
ATOM   5995 O  O     . ASN B 2 277 ? 8.425  58.607  -27.352 1.00 51.15  ? 265  ASN B O     1 
ATOM   5996 C  CB    . ASN B 2 277 ? 9.788  60.887  -29.257 1.00 46.10  ? 265  ASN B CB    1 
ATOM   5997 C  CG    . ASN B 2 277 ? 9.074  59.933  -30.186 1.00 48.39  ? 265  ASN B CG    1 
ATOM   5998 O  OD1   . ASN B 2 277 ? 7.908  60.135  -30.526 1.00 49.74  ? 265  ASN B OD1   1 
ATOM   5999 N  ND2   . ASN B 2 277 ? 9.773  58.886  -30.611 1.00 48.45  ? 265  ASN B ND2   1 
ATOM   6000 N  N     . TRP B 2 278 ? 10.558 59.016  -26.760 1.00 53.59  ? 266  TRP B N     1 
ATOM   6001 C  CA    . TRP B 2 278 ? 10.675 57.720  -26.097 1.00 54.25  ? 266  TRP B CA    1 
ATOM   6002 C  C     . TRP B 2 278 ? 9.839  57.677  -24.822 1.00 53.95  ? 266  TRP B C     1 
ATOM   6003 O  O     . TRP B 2 278 ? 9.103  56.712  -24.583 1.00 55.21  ? 266  TRP B O     1 
ATOM   6004 C  CB    . TRP B 2 278 ? 12.138 57.408  -25.787 1.00 57.91  ? 266  TRP B CB    1 
ATOM   6005 C  CG    . TRP B 2 278 ? 12.289 56.310  -24.783 1.00 64.91  ? 266  TRP B CG    1 
ATOM   6006 C  CD1   . TRP B 2 278 ? 12.225 54.965  -25.019 1.00 68.59  ? 266  TRP B CD1   1 
ATOM   6007 C  CD2   . TRP B 2 278 ? 12.521 56.460  -23.376 1.00 67.24  ? 266  TRP B CD2   1 
ATOM   6008 N  NE1   . TRP B 2 278 ? 12.407 54.270  -23.846 1.00 70.15  ? 266  TRP B NE1   1 
ATOM   6009 C  CE2   . TRP B 2 278 ? 12.591 55.164  -22.824 1.00 69.94  ? 266  TRP B CE2   1 
ATOM   6010 C  CE3   . TRP B 2 278 ? 12.680 57.563  -22.532 1.00 67.25  ? 266  TRP B CE3   1 
ATOM   6011 C  CZ2   . TRP B 2 278 ? 12.812 54.944  -21.466 1.00 71.63  ? 266  TRP B CZ2   1 
ATOM   6012 C  CZ3   . TRP B 2 278 ? 12.899 57.343  -21.184 1.00 69.33  ? 266  TRP B CZ3   1 
ATOM   6013 C  CH2   . TRP B 2 278 ? 12.964 56.043  -20.665 1.00 72.11  ? 266  TRP B CH2   1 
ATOM   6014 N  N     . ALA B 2 279 ? 9.935  58.721  -23.993 1.00 50.92  ? 267  ALA B N     1 
ATOM   6015 C  CA    . ALA B 2 279 ? 9.245  58.716  -22.707 1.00 50.99  ? 267  ALA B CA    1 
ATOM   6016 C  C     . ALA B 2 279 ? 7.730  58.693  -22.865 1.00 53.59  ? 267  ALA B C     1 
ATOM   6017 O  O     . ALA B 2 279 ? 7.026  58.201  -21.976 1.00 57.49  ? 267  ALA B O     1 
ATOM   6018 C  CB    . ALA B 2 279 ? 9.666  59.930  -21.879 1.00 49.84  ? 267  ALA B CB    1 
ATOM   6019 N  N     . SER B 2 280 ? 7.207  59.219  -23.975 1.00 52.62  ? 268  SER B N     1 
ATOM   6020 C  CA    . SER B 2 280 ? 5.762  59.228  -24.168 1.00 56.27  ? 268  SER B CA    1 
ATOM   6021 C  C     . SER B 2 280 ? 5.190  57.823  -24.299 1.00 58.44  ? 268  SER B C     1 
ATOM   6022 O  O     . SER B 2 280 ? 3.976  57.643  -24.152 1.00 61.00  ? 268  SER B O     1 
ATOM   6023 C  CB    . SER B 2 280 ? 5.395  60.060  -25.397 1.00 56.29  ? 268  SER B CB    1 
ATOM   6024 O  OG    . SER B 2 280 ? 5.919  59.481  -26.577 1.00 58.37  ? 268  SER B OG    1 
ATOM   6025 N  N     . GLN B 2 281 ? 6.033  56.826  -24.578 1.00 58.00  ? 269  GLN B N     1 
ATOM   6026 C  CA    . GLN B 2 281 ? 5.581  55.442  -24.564 1.00 60.63  ? 269  GLN B CA    1 
ATOM   6027 C  C     . GLN B 2 281 ? 5.258  54.963  -23.156 1.00 61.44  ? 269  GLN B C     1 
ATOM   6028 O  O     . GLN B 2 281 ? 4.486  54.011  -22.997 1.00 63.84  ? 269  GLN B O     1 
ATOM   6029 C  CB    . GLN B 2 281 ? 6.643  54.536  -25.185 1.00 62.00  ? 269  GLN B CB    1 
ATOM   6030 C  CG    . GLN B 2 281 ? 7.011  54.886  -26.614 1.00 64.11  ? 269  GLN B CG    1 
ATOM   6031 C  CD    . GLN B 2 281 ? 8.124  54.008  -27.148 1.00 67.20  ? 269  GLN B CD    1 
ATOM   6032 O  OE1   . GLN B 2 281 ? 9.282  54.145  -26.753 1.00 69.04  ? 269  GLN B OE1   1 
ATOM   6033 N  NE2   . GLN B 2 281 ? 7.778  53.090  -28.043 1.00 68.58  ? 269  GLN B NE2   1 
ATOM   6034 N  N     . ILE B 2 282 ? 5.831  55.599  -22.139 1.00 60.73  ? 270  ILE B N     1 
ATOM   6035 C  CA    . ILE B 2 282 ? 5.561  55.267  -20.749 1.00 60.82  ? 270  ILE B CA    1 
ATOM   6036 C  C     . ILE B 2 282 ? 4.539  56.216  -20.137 1.00 63.33  ? 270  ILE B C     1 
ATOM   6037 O  O     . ILE B 2 282 ? 3.618  55.779  -19.446 1.00 67.11  ? 270  ILE B O     1 
ATOM   6038 C  CB    . ILE B 2 282 ? 6.877  55.275  -19.943 1.00 61.12  ? 270  ILE B CB    1 
ATOM   6039 C  CG1   . ILE B 2 282 ? 7.902  54.344  -20.593 1.00 60.07  ? 270  ILE B CG1   1 
ATOM   6040 C  CG2   . ILE B 2 282 ? 6.623  54.887  -18.494 1.00 62.01  ? 270  ILE B CG2   1 
ATOM   6041 C  CD1   . ILE B 2 282 ? 9.280  54.425  -19.976 1.00 58.77  ? 270  ILE B CD1   1 
ATOM   6042 N  N     . TYR B 2 283 ? 4.690  57.516  -20.384 1.00 61.78  ? 271  TYR B N     1 
ATOM   6043 C  CA    . TYR B 2 283 ? 3.743  58.525  -19.920 1.00 61.99  ? 271  TYR B CA    1 
ATOM   6044 C  C     . TYR B 2 283 ? 3.046  59.137  -21.127 1.00 62.24  ? 271  TYR B C     1 
ATOM   6045 O  O     . TYR B 2 283 ? 3.642  59.966  -21.831 1.00 61.31  ? 271  TYR B O     1 
ATOM   6046 C  CB    . TYR B 2 283 ? 4.457  59.609  -19.107 1.00 61.62  ? 271  TYR B CB    1 
ATOM   6047 C  CG    . TYR B 2 283 ? 5.330  59.081  -17.993 1.00 61.05  ? 271  TYR B CG    1 
ATOM   6048 C  CD1   . TYR B 2 283 ? 6.668  58.781  -18.218 1.00 59.28  ? 271  TYR B CD1   1 
ATOM   6049 C  CD2   . TYR B 2 283 ? 4.822  58.890  -16.716 1.00 63.31  ? 271  TYR B CD2   1 
ATOM   6050 C  CE1   . TYR B 2 283 ? 7.474  58.303  -17.203 1.00 58.82  ? 271  TYR B CE1   1 
ATOM   6051 C  CE2   . TYR B 2 283 ? 5.620  58.411  -15.693 1.00 63.61  ? 271  TYR B CE2   1 
ATOM   6052 C  CZ    . TYR B 2 283 ? 6.945  58.119  -15.943 1.00 62.05  ? 271  TYR B CZ    1 
ATOM   6053 O  OH    . TYR B 2 283 ? 7.745  57.642  -14.931 1.00 64.41  ? 271  TYR B OH    1 
ATOM   6054 N  N     . PRO B 2 284 ? 1.795  58.769  -21.414 1.00 64.12  ? 272  PRO B N     1 
ATOM   6055 C  CA    . PRO B 2 284 ? 1.121  59.313  -22.605 1.00 65.32  ? 272  PRO B CA    1 
ATOM   6056 C  C     . PRO B 2 284 ? 0.882  60.814  -22.550 1.00 67.30  ? 272  PRO B C     1 
ATOM   6057 O  O     . PRO B 2 284 ? 0.522  61.398  -23.581 1.00 68.58  ? 272  PRO B O     1 
ATOM   6058 C  CB    . PRO B 2 284 ? -0.207 58.545  -22.644 1.00 68.67  ? 272  PRO B CB    1 
ATOM   6059 C  CG    . PRO B 2 284 ? 0.022  57.327  -21.800 1.00 68.31  ? 272  PRO B CG    1 
ATOM   6060 C  CD    . PRO B 2 284 ? 0.975  57.756  -20.730 1.00 66.42  ? 272  PRO B CD    1 
ATOM   6061 N  N     . GLY B 2 285 ? 1.065  61.455  -21.394 1.00 68.22  ? 273  GLY B N     1 
ATOM   6062 C  CA    . GLY B 2 285 ? 0.871  62.892  -21.307 1.00 70.20  ? 273  GLY B CA    1 
ATOM   6063 C  C     . GLY B 2 285 ? 1.952  63.707  -21.986 1.00 67.53  ? 273  GLY B C     1 
ATOM   6064 O  O     . GLY B 2 285 ? 1.742  64.896  -22.246 1.00 70.34  ? 273  GLY B O     1 
ATOM   6065 N  N     . ILE B 2 286 ? 3.103  63.096  -22.277 1.00 63.44  ? 274  ILE B N     1 
ATOM   6066 C  CA    . ILE B 2 286 ? 4.208  63.825  -22.888 1.00 62.01  ? 274  ILE B CA    1 
ATOM   6067 C  C     . ILE B 2 286 ? 3.798  64.322  -24.267 1.00 63.21  ? 274  ILE B C     1 
ATOM   6068 O  O     . ILE B 2 286 ? 3.267  63.565  -25.088 1.00 63.51  ? 274  ILE B O     1 
ATOM   6069 C  CB    . ILE B 2 286 ? 5.456  62.932  -22.961 1.00 60.28  ? 274  ILE B CB    1 
ATOM   6070 C  CG1   . ILE B 2 286 ? 5.869  62.467  -21.562 1.00 60.08  ? 274  ILE B CG1   1 
ATOM   6071 C  CG2   . ILE B 2 286 ? 6.604  63.666  -23.634 1.00 59.82  ? 274  ILE B CG2   1 
ATOM   6072 C  CD1   . ILE B 2 286 ? 6.290  63.591  -20.642 1.00 60.01  ? 274  ILE B CD1   1 
ATOM   6073 N  N     . LYS B 2 287 ? 4.043  65.607  -24.527 1.00 62.43  ? 275  LYS B N     1 
ATOM   6074 C  CA    . LYS B 2 287 ? 3.739  66.228  -25.807 1.00 63.62  ? 275  LYS B CA    1 
ATOM   6075 C  C     . LYS B 2 287 ? 5.003  66.867  -26.366 1.00 61.49  ? 275  LYS B C     1 
ATOM   6076 O  O     . LYS B 2 287 ? 5.848  67.362  -25.615 1.00 60.64  ? 275  LYS B O     1 
ATOM   6077 C  CB    . LYS B 2 287 ? 2.624  67.277  -25.676 1.00 67.43  ? 275  LYS B CB    1 
ATOM   6078 N  N     . VAL B 2 288 ? 5.126  66.855  -27.693 1.00 60.44  ? 276  VAL B N     1 
ATOM   6079 C  CA    . VAL B 2 288 ? 6.392  67.203  -28.332 1.00 57.40  ? 276  VAL B CA    1 
ATOM   6080 C  C     . VAL B 2 288 ? 6.187  68.196  -29.477 1.00 61.88  ? 276  VAL B C     1 
ATOM   6081 O  O     . VAL B 2 288 ? 7.159  68.739  -30.016 1.00 62.01  ? 276  VAL B O     1 
ATOM   6082 C  CB    . VAL B 2 288 ? 7.109  65.918  -28.801 1.00 50.73  ? 276  VAL B CB    1 
ATOM   6083 C  CG1   . VAL B 2 288 ? 7.042  65.740  -30.320 1.00 49.54  ? 276  VAL B CG1   1 
ATOM   6084 C  CG2   . VAL B 2 288 ? 8.542  65.886  -28.292 1.00 48.78  ? 276  VAL B CG2   1 
ATOM   6085 N  N     . ARG B 2 289 ? 4.925  68.466  -29.829 1.00 66.71  ? 277  ARG B N     1 
ATOM   6086 C  CA    . ARG B 2 289 ? 4.621  69.279  -31.008 1.00 71.94  ? 277  ARG B CA    1 
ATOM   6087 C  C     . ARG B 2 289 ? 5.299  70.646  -30.955 1.00 68.75  ? 277  ARG B C     1 
ATOM   6088 O  O     . ARG B 2 289 ? 5.962  71.059  -31.915 1.00 67.17  ? 277  ARG B O     1 
ATOM   6089 C  CB    . ARG B 2 289 ? 3.106  69.450  -31.153 1.00 81.09  ? 277  ARG B CB    1 
ATOM   6090 C  CG    . ARG B 2 289 ? 2.386  68.278  -31.805 1.00 88.11  ? 277  ARG B CG    1 
ATOM   6091 C  CD    . ARG B 2 289 ? 0.928  68.629  -32.077 1.00 96.14  ? 277  ARG B CD    1 
ATOM   6092 N  NE    . ARG B 2 289 ? 0.799  69.742  -33.015 1.00 101.40 ? 277  ARG B NE    1 
ATOM   6093 C  CZ    . ARG B 2 289 ? 0.354  69.624  -34.263 1.00 106.95 ? 277  ARG B CZ    1 
ATOM   6094 N  NH1   . ARG B 2 289 ? 0.274  70.694  -35.044 1.00 109.91 ? 277  ARG B NH1   1 
ATOM   6095 N  NH2   . ARG B 2 289 ? -0.021 68.439  -34.728 1.00 108.23 ? 277  ARG B NH2   1 
ATOM   6096 N  N     . GLN B 2 290 ? 5.134  71.371  -29.847 1.00 67.54  ? 278  GLN B N     1 
ATOM   6097 C  CA    . GLN B 2 290 ? 5.628  72.746  -29.796 1.00 67.38  ? 278  GLN B CA    1 
ATOM   6098 C  C     . GLN B 2 290 ? 7.152  72.797  -29.767 1.00 66.94  ? 278  GLN B C     1 
ATOM   6099 O  O     . GLN B 2 290 ? 7.757  73.696  -30.364 1.00 68.02  ? 278  GLN B O     1 
ATOM   6100 C  CB    . GLN B 2 290 ? 5.037  73.471  -28.589 1.00 66.62  ? 278  GLN B CB    1 
ATOM   6101 C  CG    . GLN B 2 290 ? 3.550  73.762  -28.723 1.00 69.96  ? 278  GLN B CG    1 
ATOM   6102 C  CD    . GLN B 2 290 ? 3.237  74.692  -29.883 1.00 70.53  ? 278  GLN B CD    1 
ATOM   6103 O  OE1   . GLN B 2 290 ? 3.971  75.646  -30.144 1.00 68.70  ? 278  GLN B OE1   1 
ATOM   6104 N  NE2   . GLN B 2 290 ? 2.146  74.413  -30.588 1.00 71.94  ? 278  GLN B NE2   1 
ATOM   6105 N  N     . LEU B 2 291 ? 7.794  71.850  -29.078 1.00 61.91  ? 279  LEU B N     1 
ATOM   6106 C  CA    . LEU B 2 291 ? 9.253  71.797  -29.102 1.00 57.53  ? 279  LEU B CA    1 
ATOM   6107 C  C     . LEU B 2 291 ? 9.766  71.431  -30.489 1.00 54.52  ? 279  LEU B C     1 
ATOM   6108 O  O     . LEU B 2 291 ? 10.791 71.958  -30.938 1.00 52.71  ? 279  LEU B O     1 
ATOM   6109 C  CB    . LEU B 2 291 ? 9.763  70.802  -28.060 1.00 56.64  ? 279  LEU B CB    1 
ATOM   6110 C  CG    . LEU B 2 291 ? 9.952  71.344  -26.643 1.00 57.21  ? 279  LEU B CG    1 
ATOM   6111 C  CD1   . LEU B 2 291 ? 10.191 70.201  -25.674 1.00 57.89  ? 279  LEU B CD1   1 
ATOM   6112 C  CD2   . LEU B 2 291 ? 11.108 72.333  -26.602 1.00 54.72  ? 279  LEU B CD2   1 
ATOM   6113 N  N     . SER B 2 292 ? 9.062  70.536  -31.184 1.00 54.74  ? 280  SER B N     1 
ATOM   6114 C  CA    . SER B 2 292 ? 9.451  70.161  -32.537 1.00 56.86  ? 280  SER B CA    1 
ATOM   6115 C  C     . SER B 2 292 ? 9.205  71.282  -33.537 1.00 57.94  ? 280  SER B C     1 
ATOM   6116 O  O     . SER B 2 292 ? 9.848  71.305  -34.592 1.00 58.95  ? 280  SER B O     1 
ATOM   6117 C  CB    . SER B 2 292 ? 8.697  68.900  -32.963 1.00 60.75  ? 280  SER B CB    1 
ATOM   6118 O  OG    . SER B 2 292 ? 9.206  68.389  -34.183 1.00 64.04  ? 280  SER B OG    1 
ATOM   6119 N  N     . LYS B 2 293 ? 8.287  72.204  -33.232 1.00 59.23  ? 281  LYS B N     1 
ATOM   6120 C  CA    . LYS B 2 293 ? 8.058  73.353  -34.105 1.00 60.34  ? 281  LYS B CA    1 
ATOM   6121 C  C     . LYS B 2 293 ? 9.333  74.162  -34.308 1.00 57.39  ? 281  LYS B C     1 
ATOM   6122 O  O     . LYS B 2 293 ? 9.592  74.662  -35.408 1.00 58.01  ? 281  LYS B O     1 
ATOM   6123 C  CB    . LYS B 2 293 ? 6.964  74.247  -33.523 1.00 63.73  ? 281  LYS B CB    1 
ATOM   6124 C  CG    . LYS B 2 293 ? 5.614  74.148  -34.205 1.00 68.82  ? 281  LYS B CG    1 
ATOM   6125 C  CD    . LYS B 2 293 ? 4.656  75.172  -33.615 1.00 74.67  ? 281  LYS B CD    1 
ATOM   6126 C  CE    . LYS B 2 293 ? 3.352  75.238  -34.390 1.00 82.57  ? 281  LYS B CE    1 
ATOM   6127 N  NZ    . LYS B 2 293 ? 2.503  76.380  -33.942 1.00 86.83  ? 281  LYS B NZ    1 
ATOM   6128 N  N     . LEU B 2 294 ? 10.140 74.307  -33.253 1.00 54.85  ? 282  LEU B N     1 
ATOM   6129 C  CA    . LEU B 2 294 ? 11.344 75.128  -33.302 1.00 54.64  ? 282  LEU B CA    1 
ATOM   6130 C  C     . LEU B 2 294 ? 12.425 74.556  -34.210 1.00 55.98  ? 282  LEU B C     1 
ATOM   6131 O  O     . LEU B 2 294 ? 13.456 75.212  -34.404 1.00 55.92  ? 282  LEU B O     1 
ATOM   6132 C  CB    . LEU B 2 294 ? 11.909 75.297  -31.893 1.00 51.59  ? 282  LEU B CB    1 
ATOM   6133 C  CG    . LEU B 2 294 ? 10.914 75.649  -30.789 1.00 51.95  ? 282  LEU B CG    1 
ATOM   6134 C  CD1   . LEU B 2 294 ? 11.516 75.326  -29.435 1.00 50.70  ? 282  LEU B CD1   1 
ATOM   6135 C  CD2   . LEU B 2 294 ? 10.515 77.115  -30.862 1.00 52.80  ? 282  LEU B CD2   1 
ATOM   6136 N  N     . LEU B 2 295 ? 12.224 73.362  -34.764 1.00 55.59  ? 283  LEU B N     1 
ATOM   6137 C  CA    . LEU B 2 295 ? 13.230 72.701  -35.582 1.00 52.93  ? 283  LEU B CA    1 
ATOM   6138 C  C     . LEU B 2 295 ? 12.843 72.625  -37.052 1.00 58.22  ? 283  LEU B C     1 
ATOM   6139 O  O     . LEU B 2 295 ? 13.471 71.876  -37.807 1.00 64.96  ? 283  LEU B O     1 
ATOM   6140 C  CB    . LEU B 2 295 ? 13.505 71.299  -35.040 1.00 49.23  ? 283  LEU B CB    1 
ATOM   6141 C  CG    . LEU B 2 295 ? 14.089 71.277  -33.629 1.00 45.63  ? 283  LEU B CG    1 
ATOM   6142 C  CD1   . LEU B 2 295 ? 14.309 69.852  -33.157 1.00 42.13  ? 283  LEU B CD1   1 
ATOM   6143 C  CD2   . LEU B 2 295 ? 15.384 72.073  -33.591 1.00 42.68  ? 283  LEU B CD2   1 
ATOM   6144 N  N     . ARG B 2 296 ? 11.824 73.368  -37.478 1.00 58.28  ? 284  ARG B N     1 
ATOM   6145 C  CA    . ARG B 2 296 ? 11.473 73.382  -38.890 1.00 60.49  ? 284  ARG B CA    1 
ATOM   6146 C  C     . ARG B 2 296 ? 12.620 73.958  -39.710 1.00 59.37  ? 284  ARG B C     1 
ATOM   6147 O  O     . ARG B 2 296 ? 13.288 74.908  -39.294 1.00 60.72  ? 284  ARG B O     1 
ATOM   6148 C  CB    . ARG B 2 296 ? 10.196 74.190  -39.121 1.00 65.53  ? 284  ARG B CB    1 
ATOM   6149 C  CG    . ARG B 2 296 ? 8.935  73.532  -38.582 1.00 69.49  ? 284  ARG B CG    1 
ATOM   6150 C  CD    . ARG B 2 296 ? 7.708  73.981  -39.362 1.00 78.01  ? 284  ARG B CD    1 
ATOM   6151 N  NE    . ARG B 2 296 ? 6.481  73.357  -38.873 1.00 84.21  ? 284  ARG B NE    1 
ATOM   6152 C  CZ    . ARG B 2 296 ? 5.555  73.986  -38.156 1.00 88.96  ? 284  ARG B CZ    1 
ATOM   6153 N  NH1   . ARG B 2 296 ? 5.710  75.266  -37.845 1.00 90.31  ? 284  ARG B NH1   1 
ATOM   6154 N  NH2   . ARG B 2 296 ? 4.471  73.337  -37.754 1.00 91.88  ? 284  ARG B NH2   1 
ATOM   6155 N  N     . GLY B 2 297 ? 12.850 73.371  -40.875 1.00 59.40  ? 285  GLY B N     1 
ATOM   6156 C  CA    . GLY B 2 297 ? 13.961 73.753  -41.722 1.00 57.59  ? 285  GLY B CA    1 
ATOM   6157 C  C     . GLY B 2 297 ? 15.142 72.817  -41.566 1.00 57.14  ? 285  GLY B C     1 
ATOM   6158 O  O     . GLY B 2 297 ? 15.084 71.784  -40.894 1.00 55.20  ? 285  GLY B O     1 
ATOM   6159 N  N     . THR B 2 298 ? 16.242 73.204  -42.205 1.00 62.21  ? 286  THR B N     1 
ATOM   6160 C  CA    . THR B 2 298 ? 17.487 72.440  -42.203 1.00 44.16  ? 286  THR B CA    1 
ATOM   6161 C  C     . THR B 2 298 ? 18.554 73.309  -41.546 1.00 44.74  ? 286  THR B C     1 
ATOM   6162 O  O     . THR B 2 298 ? 19.278 74.038  -42.228 1.00 52.64  ? 286  THR B O     1 
ATOM   6163 C  CB    . THR B 2 298 ? 17.888 72.045  -43.622 1.00 53.13  ? 286  THR B CB    1 
ATOM   6164 O  OG1   . THR B 2 298 ? 16.749 71.529  -44.321 1.00 49.02  ? 286  THR B OG1   1 
ATOM   6165 C  CG2   . THR B 2 298 ? 18.977 70.989  -43.587 1.00 50.72  ? 286  THR B CG2   1 
ATOM   6166 N  N     . LYS B 2 299 ? 18.657 73.226  -40.225 1.00 42.48  ? 287  LYS B N     1 
ATOM   6167 C  CA    . LYS B 2 299 ? 19.504 74.119  -39.448 1.00 41.28  ? 287  LYS B CA    1 
ATOM   6168 C  C     . LYS B 2 299 ? 20.796 73.434  -39.012 1.00 42.98  ? 287  LYS B C     1 
ATOM   6169 O  O     . LYS B 2 299 ? 20.913 72.205  -39.006 1.00 41.29  ? 287  LYS B O     1 
ATOM   6170 C  CB    . LYS B 2 299 ? 18.755 74.627  -38.214 1.00 40.41  ? 287  LYS B CB    1 
ATOM   6171 C  CG    . LYS B 2 299 ? 17.516 75.448  -38.521 1.00 41.55  ? 287  LYS B CG    1 
ATOM   6172 C  CD    . LYS B 2 299 ? 16.849 75.915  -37.235 1.00 46.31  ? 287  LYS B CD    1 
ATOM   6173 C  CE    . LYS B 2 299 ? 15.639 76.792  -37.521 1.00 49.99  ? 287  LYS B CE    1 
ATOM   6174 N  NZ    . LYS B 2 299 ? 15.997 78.003  -38.313 1.00 50.00  ? 287  LYS B NZ    1 
ATOM   6175 N  N     . ALA B 2 300 ? 21.772 74.258  -38.638 1.00 41.13  ? 288  ALA B N     1 
ATOM   6176 C  CA    . ALA B 2 300 ? 23.019 73.744  -38.095 1.00 41.02  ? 288  ALA B CA    1 
ATOM   6177 C  C     . ALA B 2 300 ? 22.817 73.280  -36.657 1.00 41.68  ? 288  ALA B C     1 
ATOM   6178 O  O     . ALA B 2 300 ? 22.021 73.846  -35.905 1.00 44.84  ? 288  ALA B O     1 
ATOM   6179 C  CB    . ALA B 2 300 ? 24.111 74.812  -38.155 1.00 38.32  ? 288  ALA B CB    1 
ATOM   6180 N  N     . LEU B 2 301 ? 23.559 72.237  -36.276 1.00 40.12  ? 289  LEU B N     1 
ATOM   6181 C  CA    . LEU B 2 301 ? 23.379 71.652  -34.951 1.00 35.25  ? 289  LEU B CA    1 
ATOM   6182 C  C     . LEU B 2 301 ? 23.748 72.626  -33.838 1.00 38.41  ? 289  LEU B C     1 
ATOM   6183 O  O     . LEU B 2 301 ? 23.191 72.543  -32.736 1.00 37.03  ? 289  LEU B O     1 
ATOM   6184 C  CB    . LEU B 2 301 ? 24.203 70.370  -34.823 1.00 35.70  ? 289  LEU B CB    1 
ATOM   6185 C  CG    . LEU B 2 301 ? 23.742 69.174  -35.656 1.00 36.07  ? 289  LEU B CG    1 
ATOM   6186 C  CD1   . LEU B 2 301 ? 24.457 67.922  -35.200 1.00 36.58  ? 289  LEU B CD1   1 
ATOM   6187 C  CD2   . LEU B 2 301 ? 22.237 68.996  -35.558 1.00 35.19  ? 289  LEU B CD2   1 
ATOM   6188 N  N     . THR B 2 302 ? 24.671 73.551  -34.095 1.00 36.74  ? 290  THR B N     1 
ATOM   6189 C  CA    . THR B 2 302 ? 25.130 74.485  -33.076 1.00 37.41  ? 290  THR B CA    1 
ATOM   6190 C  C     . THR B 2 302 ? 24.395 75.818  -33.118 1.00 42.50  ? 290  THR B C     1 
ATOM   6191 O  O     . THR B 2 302 ? 24.754 76.734  -32.370 1.00 46.99  ? 290  THR B O     1 
ATOM   6192 C  CB    . THR B 2 302 ? 26.635 74.714  -33.204 1.00 39.06  ? 290  THR B CB    1 
ATOM   6193 O  OG1   . THR B 2 302 ? 26.962 75.009  -34.568 1.00 43.12  ? 290  THR B OG1   1 
ATOM   6194 C  CG2   . THR B 2 302 ? 27.399 73.477  -32.751 1.00 38.37  ? 290  THR B CG2   1 
ATOM   6195 N  N     . GLU B 2 303 ? 23.376 75.949  -33.963 1.00 42.23  ? 291  GLU B N     1 
ATOM   6196 C  CA    . GLU B 2 303 ? 22.578 77.167  -33.988 1.00 44.08  ? 291  GLU B CA    1 
ATOM   6197 C  C     . GLU B 2 303 ? 21.751 77.281  -32.711 1.00 44.06  ? 291  GLU B C     1 
ATOM   6198 O  O     . GLU B 2 303 ? 21.121 76.311  -32.277 1.00 41.02  ? 291  GLU B O     1 
ATOM   6199 C  CB    . GLU B 2 303 ? 21.668 77.179  -35.215 1.00 45.16  ? 291  GLU B CB    1 
ATOM   6200 C  CG    . GLU B 2 303 ? 20.746 78.382  -35.295 1.00 49.43  ? 291  GLU B CG    1 
ATOM   6201 C  CD    . GLU B 2 303 ? 19.813 78.320  -36.488 1.00 56.79  ? 291  GLU B CD    1 
ATOM   6202 O  OE1   . GLU B 2 303 ? 18.613 78.630  -36.324 1.00 59.45  ? 291  GLU B OE1   1 
ATOM   6203 O  OE2   . GLU B 2 303 ? 20.279 77.953  -37.589 1.00 60.27  ? 291  GLU B OE2   1 
ATOM   6204 N  N     . VAL B 2 304 ? 21.753 78.469  -32.112 1.00 46.42  ? 292  VAL B N     1 
ATOM   6205 C  CA    . VAL B 2 304 ? 21.026 78.708  -30.871 1.00 47.26  ? 292  VAL B CA    1 
ATOM   6206 C  C     . VAL B 2 304 ? 19.567 79.001  -31.193 1.00 52.16  ? 292  VAL B C     1 
ATOM   6207 O  O     . VAL B 2 304 ? 19.261 79.884  -32.003 1.00 53.63  ? 292  VAL B O     1 
ATOM   6208 C  CB    . VAL B 2 304 ? 21.663 79.861  -30.081 1.00 47.08  ? 292  VAL B CB    1 
ATOM   6209 C  CG1   . VAL B 2 304 ? 20.801 80.228  -28.885 1.00 40.08  ? 292  VAL B CG1   1 
ATOM   6210 C  CG2   . VAL B 2 304 ? 23.062 79.481  -29.633 1.00 48.33  ? 292  VAL B CG2   1 
ATOM   6211 N  N     . ILE B 2 305 ? 18.666 78.265  -30.558 1.00 57.64  ? 293  ILE B N     1 
ATOM   6212 C  CA    . ILE B 2 305 ? 17.228 78.419  -30.748 1.00 59.88  ? 293  ILE B CA    1 
ATOM   6213 C  C     . ILE B 2 305 ? 16.638 78.971  -29.455 1.00 59.63  ? 293  ILE B C     1 
ATOM   6214 O  O     . ILE B 2 305 ? 16.797 78.350  -28.396 1.00 60.81  ? 293  ILE B O     1 
ATOM   6215 C  CB    . ILE B 2 305 ? 16.558 77.090  -31.130 1.00 64.43  ? 293  ILE B CB    1 
ATOM   6216 C  CG1   . ILE B 2 305 ? 17.137 76.558  -32.441 1.00 65.66  ? 293  ILE B CG1   1 
ATOM   6217 C  CG2   . ILE B 2 305 ? 15.051 77.269  -31.231 1.00 68.55  ? 293  ILE B CG2   1 
ATOM   6218 C  CD1   . ILE B 2 305 ? 16.945 77.490  -33.613 1.00 67.41  ? 293  ILE B CD1   1 
ATOM   6219 N  N     . PRO B 2 306 ? 15.967 80.120  -29.486 1.00 60.35  ? 294  PRO B N     1 
ATOM   6220 C  CA    . PRO B 2 306 ? 15.263 80.595  -28.291 1.00 58.92  ? 294  PRO B CA    1 
ATOM   6221 C  C     . PRO B 2 306 ? 13.919 79.900  -28.149 1.00 59.34  ? 294  PRO B C     1 
ATOM   6222 O  O     . PRO B 2 306 ? 13.169 79.751  -29.117 1.00 59.08  ? 294  PRO B O     1 
ATOM   6223 C  CB    . PRO B 2 306 ? 15.085 82.098  -28.554 1.00 60.16  ? 294  PRO B CB    1 
ATOM   6224 C  CG    . PRO B 2 306 ? 15.914 82.400  -29.785 1.00 59.06  ? 294  PRO B CG    1 
ATOM   6225 C  CD    . PRO B 2 306 ? 15.965 81.128  -30.556 1.00 58.94  ? 294  PRO B CD    1 
ATOM   6226 N  N     . LEU B 2 307 ? 13.620 79.466  -26.927 1.00 59.00  ? 295  LEU B N     1 
ATOM   6227 C  CA    . LEU B 2 307 ? 12.370 78.769  -26.664 1.00 58.82  ? 295  LEU B CA    1 
ATOM   6228 C  C     . LEU B 2 307 ? 11.218 79.763  -26.603 1.00 64.44  ? 295  LEU B C     1 
ATOM   6229 O  O     . LEU B 2 307 ? 11.275 80.752  -25.865 1.00 66.62  ? 295  LEU B O     1 
ATOM   6230 C  CB    . LEU B 2 307 ? 12.452 77.977  -25.358 1.00 57.77  ? 295  LEU B CB    1 
ATOM   6231 C  CG    . LEU B 2 307 ? 13.470 76.835  -25.269 1.00 55.02  ? 295  LEU B CG    1 
ATOM   6232 C  CD1   . LEU B 2 307 ? 13.151 75.917  -24.097 1.00 53.20  ? 295  LEU B CD1   1 
ATOM   6233 C  CD2   . LEU B 2 307 ? 13.531 76.048  -26.563 1.00 52.36  ? 295  LEU B CD2   1 
ATOM   6234 N  N     . THR B 2 308 ? 10.175 79.501  -27.386 1.00 66.52  ? 296  THR B N     1 
ATOM   6235 C  CA    . THR B 2 308 ? 8.966  80.303  -27.316 1.00 67.57  ? 296  THR B CA    1 
ATOM   6236 C  C     . THR B 2 308 ? 8.239  80.046  -25.997 1.00 70.57  ? 296  THR B C     1 
ATOM   6237 O  O     . THR B 2 308 ? 8.591  79.151  -25.222 1.00 69.10  ? 296  THR B O     1 
ATOM   6238 C  CB    . THR B 2 308 ? 8.045  79.992  -28.496 1.00 66.42  ? 296  THR B CB    1 
ATOM   6239 O  OG1   . THR B 2 308 ? 7.647  78.615  -28.443 1.00 68.97  ? 296  THR B OG1   1 
ATOM   6240 C  CG2   . THR B 2 308 ? 8.758  80.257  -29.813 1.00 62.33  ? 296  THR B CG2   1 
ATOM   6241 N  N     . GLU B 2 309 ? 7.210  80.857  -25.740 1.00 73.74  ? 297  GLU B N     1 
ATOM   6242 C  CA    . GLU B 2 309 ? 6.390  80.649  -24.551 1.00 75.46  ? 297  GLU B CA    1 
ATOM   6243 C  C     . GLU B 2 309 ? 5.672  79.307  -24.612 1.00 74.48  ? 297  GLU B C     1 
ATOM   6244 O  O     . GLU B 2 309 ? 5.544  78.614  -23.595 1.00 74.95  ? 297  GLU B O     1 
ATOM   6245 C  CB    . GLU B 2 309 ? 5.386  81.791  -24.399 1.00 79.80  ? 297  GLU B CB    1 
ATOM   6246 N  N     . GLU B 2 310 ? 5.204  78.922  -25.802 1.00 73.47  ? 298  GLU B N     1 
ATOM   6247 C  CA    . GLU B 2 310 ? 4.527  77.639  -25.961 1.00 72.81  ? 298  GLU B CA    1 
ATOM   6248 C  C     . GLU B 2 310 ? 5.469  76.481  -25.653 1.00 68.44  ? 298  GLU B C     1 
ATOM   6249 O  O     . GLU B 2 310 ? 5.112  75.554  -24.917 1.00 67.96  ? 298  GLU B O     1 
ATOM   6250 C  CB    . GLU B 2 310 ? 3.967  77.511  -27.380 1.00 76.36  ? 298  GLU B CB    1 
ATOM   6251 C  CG    . GLU B 2 310 ? 2.907  78.545  -27.745 1.00 84.03  ? 298  GLU B CG    1 
ATOM   6252 C  CD    . GLU B 2 310 ? 3.497  79.889  -28.129 1.00 87.61  ? 298  GLU B CD    1 
ATOM   6253 O  OE1   . GLU B 2 310 ? 4.721  79.958  -28.368 1.00 84.97  ? 298  GLU B OE1   1 
ATOM   6254 O  OE2   . GLU B 2 310 ? 2.735  80.877  -28.188 1.00 92.74  ? 298  GLU B OE2   1 
ATOM   6255 N  N     . ALA B 2 311 ? 6.682  76.519  -26.210 1.00 66.31  ? 299  ALA B N     1 
ATOM   6256 C  CA    . ALA B 2 311 ? 7.642  75.450  -25.960 1.00 64.54  ? 299  ALA B CA    1 
ATOM   6257 C  C     . ALA B 2 311 ? 8.063  75.416  -24.496 1.00 65.43  ? 299  ALA B C     1 
ATOM   6258 O  O     . ALA B 2 311 ? 8.247  74.337  -23.922 1.00 63.42  ? 299  ALA B O     1 
ATOM   6259 C  CB    . ALA B 2 311 ? 8.860  75.614  -26.868 1.00 60.76  ? 299  ALA B CB    1 
ATOM   6260 N  N     . GLU B 2 312 ? 8.209  76.588  -23.874 1.00 67.78  ? 300  GLU B N     1 
ATOM   6261 C  CA    . GLU B 2 312 ? 8.574  76.634  -22.462 1.00 71.11  ? 300  GLU B CA    1 
ATOM   6262 C  C     . GLU B 2 312 ? 7.481  76.018  -21.595 1.00 72.93  ? 300  GLU B C     1 
ATOM   6263 O  O     . GLU B 2 312 ? 7.768  75.226  -20.686 1.00 72.33  ? 300  GLU B O     1 
ATOM   6264 C  CB    . GLU B 2 312 ? 8.844  78.080  -22.046 1.00 77.12  ? 300  GLU B CB    1 
ATOM   6265 C  CG    . GLU B 2 312 ? 9.832  78.240  -20.903 1.00 81.73  ? 300  GLU B CG    1 
ATOM   6266 C  CD    . GLU B 2 312 ? 11.259 77.934  -21.316 1.00 82.11  ? 300  GLU B CD    1 
ATOM   6267 O  OE1   . GLU B 2 312 ? 11.854 76.991  -20.752 1.00 82.45  ? 300  GLU B OE1   1 
ATOM   6268 O  OE2   . GLU B 2 312 ? 11.784 78.634  -22.208 1.00 81.77  ? 300  GLU B OE2   1 
ATOM   6269 N  N     . LEU B 2 313 ? 6.220  76.364  -21.869 1.00 75.87  ? 301  LEU B N     1 
ATOM   6270 C  CA    . LEU B 2 313 ? 5.113  75.777  -21.122 1.00 78.48  ? 301  LEU B CA    1 
ATOM   6271 C  C     . LEU B 2 313 ? 5.031  74.274  -21.347 1.00 76.55  ? 301  LEU B C     1 
ATOM   6272 O  O     . LEU B 2 313 ? 4.778  73.512  -20.408 1.00 77.53  ? 301  LEU B O     1 
ATOM   6273 C  CB    . LEU B 2 313 ? 3.798  76.449  -21.513 1.00 81.94  ? 301  LEU B CB    1 
ATOM   6274 N  N     . GLU B 2 314 ? 5.242  73.827  -22.588 1.00 73.37  ? 302  GLU B N     1 
ATOM   6275 C  CA    . GLU B 2 314 ? 5.214  72.397  -22.876 1.00 68.71  ? 302  GLU B CA    1 
ATOM   6276 C  C     . GLU B 2 314 ? 6.318  71.663  -22.125 1.00 64.06  ? 302  GLU B C     1 
ATOM   6277 O  O     . GLU B 2 314 ? 6.098  70.567  -21.594 1.00 64.56  ? 302  GLU B O     1 
ATOM   6278 C  CB    . GLU B 2 314 ? 5.342  72.171  -24.381 1.00 69.75  ? 302  GLU B CB    1 
ATOM   6279 C  CG    . GLU B 2 314 ? 5.121  70.740  -24.827 1.00 73.29  ? 302  GLU B CG    1 
ATOM   6280 C  CD    . GLU B 2 314 ? 5.388  70.553  -26.306 1.00 75.44  ? 302  GLU B CD    1 
ATOM   6281 O  OE1   . GLU B 2 314 ? 6.506  70.887  -26.756 1.00 74.74  ? 302  GLU B OE1   1 
ATOM   6282 O  OE2   . GLU B 2 314 ? 4.477  70.086  -27.022 1.00 77.76  ? 302  GLU B OE2   1 
ATOM   6283 N  N     . LEU B 2 315 ? 7.510  72.259  -22.060 1.00 60.14  ? 303  LEU B N     1 
ATOM   6284 C  CA    . LEU B 2 315 ? 8.617  71.641  -21.338 1.00 56.88  ? 303  LEU B CA    1 
ATOM   6285 C  C     . LEU B 2 315 ? 8.337  71.581  -19.842 1.00 60.35  ? 303  LEU B C     1 
ATOM   6286 O  O     . LEU B 2 315 ? 8.657  70.583  -19.184 1.00 60.00  ? 303  LEU B O     1 
ATOM   6287 C  CB    . LEU B 2 315 ? 9.909  72.408  -21.617 1.00 54.42  ? 303  LEU B CB    1 
ATOM   6288 C  CG    . LEU B 2 315 ? 11.161 71.926  -20.888 1.00 53.42  ? 303  LEU B CG    1 
ATOM   6289 C  CD1   . LEU B 2 315 ? 11.412 70.456  -21.173 1.00 51.45  ? 303  LEU B CD1   1 
ATOM   6290 C  CD2   . LEU B 2 315 ? 12.360 72.765  -21.292 1.00 52.29  ? 303  LEU B CD2   1 
ATOM   6291 N  N     . ALA B 2 316 ? 7.735  72.635  -19.285 1.00 62.69  ? 304  ALA B N     1 
ATOM   6292 C  CA    . ALA B 2 316 ? 7.374  72.604  -17.871 1.00 67.14  ? 304  ALA B CA    1 
ATOM   6293 C  C     . ALA B 2 316 ? 6.315  71.539  -17.593 1.00 68.20  ? 304  ALA B C     1 
ATOM   6294 O  O     . ALA B 2 316 ? 6.404  70.807  -16.596 1.00 69.24  ? 304  ALA B O     1 
ATOM   6295 C  CB    . ALA B 2 316 ? 6.889  73.982  -17.425 1.00 70.34  ? 304  ALA B CB    1 
ATOM   6296 N  N     . GLU B 2 317 ? 5.310  71.436  -18.466 1.00 67.94  ? 305  GLU B N     1 
ATOM   6297 C  CA    . GLU B 2 317 ? 4.302  70.391  -18.318 1.00 71.90  ? 305  GLU B CA    1 
ATOM   6298 C  C     . GLU B 2 317 ? 4.935  69.008  -18.369 1.00 69.35  ? 305  GLU B C     1 
ATOM   6299 O  O     . GLU B 2 317 ? 4.578  68.127  -17.580 1.00 68.44  ? 305  GLU B O     1 
ATOM   6300 C  CB    . GLU B 2 317 ? 3.235  70.523  -19.403 1.00 78.98  ? 305  GLU B CB    1 
ATOM   6301 C  CG    . GLU B 2 317 ? 2.411  71.792  -19.331 1.00 89.48  ? 305  GLU B CG    1 
ATOM   6302 C  CD    . GLU B 2 317 ? 1.545  71.984  -20.560 1.00 97.33  ? 305  GLU B CD    1 
ATOM   6303 O  OE1   . GLU B 2 317 ? 0.862  71.019  -20.966 1.00 99.65  ? 305  GLU B OE1   1 
ATOM   6304 O  OE2   . GLU B 2 317 ? 1.557  73.096  -21.129 1.00 100.85 ? 305  GLU B OE2   1 
ATOM   6305 N  N     . ASN B 2 318 ? 5.874  68.798  -19.297 1.00 66.00  ? 306  ASN B N     1 
ATOM   6306 C  CA    . ASN B 2 318 ? 6.532  67.499  -19.400 1.00 63.81  ? 306  ASN B CA    1 
ATOM   6307 C  C     . ASN B 2 318 ? 7.367  67.199  -18.162 1.00 66.60  ? 306  ASN B C     1 
ATOM   6308 O  O     . ASN B 2 318 ? 7.418  66.050  -17.707 1.00 66.16  ? 306  ASN B O     1 
ATOM   6309 C  CB    . ASN B 2 318 ? 7.398  67.444  -20.657 1.00 60.31  ? 306  ASN B CB    1 
ATOM   6310 C  CG    . ASN B 2 318 ? 6.577  67.423  -21.928 1.00 60.15  ? 306  ASN B CG    1 
ATOM   6311 O  OD1   . ASN B 2 318 ? 5.438  66.954  -21.939 1.00 61.65  ? 306  ASN B OD1   1 
ATOM   6312 N  ND2   . ASN B 2 318 ? 7.153  67.930  -23.012 1.00 58.22  ? 306  ASN B ND2   1 
ATOM   6313 N  N     . ARG B 2 319 ? 8.041  68.212  -17.611 1.00 69.90  ? 307  ARG B N     1 
ATOM   6314 C  CA    . ARG B 2 319 ? 8.757  68.015  -16.354 1.00 73.14  ? 307  ARG B CA    1 
ATOM   6315 C  C     . ARG B 2 319 ? 7.803  67.588  -15.247 1.00 77.62  ? 307  ARG B C     1 
ATOM   6316 O  O     . ARG B 2 319 ? 8.126  66.707  -14.441 1.00 77.16  ? 307  ARG B O     1 
ATOM   6317 C  CB    . ARG B 2 319 ? 9.500  69.290  -15.952 1.00 75.10  ? 307  ARG B CB    1 
ATOM   6318 C  CG    . ARG B 2 319 ? 10.735 69.580  -16.783 1.00 75.83  ? 307  ARG B CG    1 
ATOM   6319 C  CD    . ARG B 2 319 ? 11.712 70.471  -16.031 1.00 77.46  ? 307  ARG B CD    1 
ATOM   6320 N  NE    . ARG B 2 319 ? 12.947 70.674  -16.782 1.00 75.93  ? 307  ARG B NE    1 
ATOM   6321 C  CZ    . ARG B 2 319 ? 13.179 71.722  -17.565 1.00 77.10  ? 307  ARG B CZ    1 
ATOM   6322 N  NH1   . ARG B 2 319 ? 12.260 72.669  -17.696 1.00 80.00  ? 307  ARG B NH1   1 
ATOM   6323 N  NH2   . ARG B 2 319 ? 14.331 71.826  -18.214 1.00 74.56  ? 307  ARG B NH2   1 
ATOM   6324 N  N     . GLU B 2 320 ? 6.620  68.202  -15.195 1.00 81.85  ? 308  GLU B N     1 
ATOM   6325 C  CA    . GLU B 2 320 ? 5.647  67.827  -14.173 1.00 85.34  ? 308  GLU B CA    1 
ATOM   6326 C  C     . GLU B 2 320 ? 5.128  66.407  -14.390 1.00 84.10  ? 308  GLU B C     1 
ATOM   6327 O  O     . GLU B 2 320 ? 4.940  65.656  -13.426 1.00 86.59  ? 308  GLU B O     1 
ATOM   6328 C  CB    . GLU B 2 320 ? 4.492  68.827  -14.158 1.00 90.48  ? 308  GLU B CB    1 
ATOM   6329 N  N     . ILE B 2 321 ? 4.906  66.019  -15.648 1.00 80.93  ? 309  ILE B N     1 
ATOM   6330 C  CA    . ILE B 2 321 ? 4.308  64.719  -15.946 1.00 78.39  ? 309  ILE B CA    1 
ATOM   6331 C  C     . ILE B 2 321 ? 5.249  63.586  -15.554 1.00 76.94  ? 309  ILE B C     1 
ATOM   6332 O  O     . ILE B 2 321 ? 4.808  62.530  -15.082 1.00 79.09  ? 309  ILE B O     1 
ATOM   6333 C  CB    . ILE B 2 321 ? 3.914  64.651  -17.433 1.00 76.20  ? 309  ILE B CB    1 
ATOM   6334 C  CG1   . ILE B 2 321 ? 2.726  65.574  -17.710 1.00 79.24  ? 309  ILE B CG1   1 
ATOM   6335 C  CG2   . ILE B 2 321 ? 3.587  63.223  -17.851 1.00 75.37  ? 309  ILE B CG2   1 
ATOM   6336 C  CD1   . ILE B 2 321 ? 2.405  65.737  -19.175 1.00 78.70  ? 309  ILE B CD1   1 
ATOM   6337 N  N     . LEU B 2 322 ? 6.556  63.787  -15.723 1.00 72.88  ? 310  LEU B N     1 
ATOM   6338 C  CA    . LEU B 2 322 ? 7.533  62.764  -15.367 1.00 68.46  ? 310  LEU B CA    1 
ATOM   6339 C  C     . LEU B 2 322 ? 7.648  62.541  -13.864 1.00 73.53  ? 310  LEU B C     1 
ATOM   6340 O  O     . LEU B 2 322 ? 8.429  61.678  -13.448 1.00 72.32  ? 310  LEU B O     1 
ATOM   6341 C  CB    . LEU B 2 322 ? 8.903  63.128  -15.940 1.00 61.71  ? 310  LEU B CB    1 
ATOM   6342 C  CG    . LEU B 2 322 ? 8.978  63.140  -17.465 1.00 55.62  ? 310  LEU B CG    1 
ATOM   6343 C  CD1   . LEU B 2 322 ? 10.380 63.490  -17.942 1.00 52.88  ? 310  LEU B CD1   1 
ATOM   6344 C  CD2   . LEU B 2 322 ? 8.537  61.795  -18.014 1.00 52.99  ? 310  LEU B CD2   1 
ATOM   6345 N  N     . LYS B 2 323 ? 6.907  63.287  -13.046 1.00 80.47  ? 311  LYS B N     1 
ATOM   6346 C  CA    . LYS B 2 323 ? 6.888  63.057  -11.608 1.00 88.66  ? 311  LYS B CA    1 
ATOM   6347 C  C     . LYS B 2 323 ? 5.796  62.083  -11.185 1.00 95.29  ? 311  LYS B C     1 
ATOM   6348 O  O     . LYS B 2 323 ? 5.966  61.365  -10.193 1.00 97.06  ? 311  LYS B O     1 
ATOM   6349 C  CB    . LYS B 2 323 ? 6.710  64.384  -10.864 1.00 90.67  ? 311  LYS B CB    1 
ATOM   6350 N  N     . GLU B 2 324 ? 4.684  62.042  -11.916 1.00 100.24 ? 312  GLU B N     1 
ATOM   6351 C  CA    . GLU B 2 324 ? 3.597  61.137  -11.585 1.00 101.24 ? 312  GLU B CA    1 
ATOM   6352 C  C     . GLU B 2 324 ? 4.017  59.686  -11.814 1.00 94.67  ? 312  GLU B C     1 
ATOM   6353 O  O     . GLU B 2 324 ? 4.829  59.398  -12.697 1.00 93.69  ? 312  GLU B O     1 
ATOM   6354 C  CB    . GLU B 2 324 ? 2.366  61.456  -12.427 1.00 108.86 ? 312  GLU B CB    1 
ATOM   6355 C  CG    . GLU B 2 324 ? 1.826  62.860  -12.230 1.00 118.85 ? 312  GLU B CG    1 
ATOM   6356 C  CD    . GLU B 2 324 ? 0.719  63.198  -13.208 1.00 124.59 ? 312  GLU B CD    1 
ATOM   6357 O  OE1   . GLU B 2 324 ? 0.711  62.626  -14.319 1.00 123.02 ? 312  GLU B OE1   1 
ATOM   6358 O  OE2   . GLU B 2 324 ? -0.144 64.034  -12.865 1.00 129.77 ? 312  GLU B OE2   1 
ATOM   6359 N  N     . PRO B 2 325 ? 3.479  58.753  -11.031 1.00 90.88  ? 313  PRO B N     1 
ATOM   6360 C  CA    . PRO B 2 325 ? 3.804  57.339  -11.247 1.00 86.33  ? 313  PRO B CA    1 
ATOM   6361 C  C     . PRO B 2 325 ? 3.103  56.786  -12.479 1.00 80.48  ? 313  PRO B C     1 
ATOM   6362 O  O     . PRO B 2 325 ? 2.046  57.269  -12.894 1.00 81.46  ? 313  PRO B O     1 
ATOM   6363 C  CB    . PRO B 2 325 ? 3.301  56.662  -9.968  1.00 89.26  ? 313  PRO B CB    1 
ATOM   6364 C  CG    . PRO B 2 325 ? 2.192  57.541  -9.504  1.00 92.14  ? 313  PRO B CG    1 
ATOM   6365 C  CD    . PRO B 2 325 ? 2.600  58.946  -9.864  1.00 92.58  ? 313  PRO B CD    1 
ATOM   6366 N  N     . VAL B 2 326 ? 3.717  55.755  -13.068 1.00 73.74  ? 314  VAL B N     1 
ATOM   6367 C  CA    . VAL B 2 326 ? 3.157  55.140  -14.265 1.00 70.96  ? 314  VAL B CA    1 
ATOM   6368 C  C     . VAL B 2 326 ? 1.805  54.518  -13.942 1.00 72.75  ? 314  VAL B C     1 
ATOM   6369 O  O     . VAL B 2 326 ? 1.617  53.890  -12.892 1.00 73.78  ? 314  VAL B O     1 
ATOM   6370 C  CB    . VAL B 2 326 ? 4.129  54.096  -14.839 1.00 68.01  ? 314  VAL B CB    1 
ATOM   6371 C  CG1   . VAL B 2 326 ? 3.639  53.597  -16.193 1.00 65.25  ? 314  VAL B CG1   1 
ATOM   6372 C  CG2   . VAL B 2 326 ? 5.531  54.681  -14.952 1.00 66.39  ? 314  VAL B CG2   1 
ATOM   6373 N  N     . HIS B 2 327 ? 0.852  54.695  -14.852 1.00 71.25  ? 315  HIS B N     1 
ATOM   6374 C  CA    . HIS B 2 327 ? -0.508 54.222  -14.649 1.00 71.51  ? 315  HIS B CA    1 
ATOM   6375 C  C     . HIS B 2 327 ? -0.669 52.799  -15.168 1.00 68.23  ? 315  HIS B C     1 
ATOM   6376 O  O     . HIS B 2 327 ? -0.078 52.424  -16.184 1.00 65.10  ? 315  HIS B O     1 
ATOM   6377 C  CB    . HIS B 2 327 ? -1.504 55.152  -15.346 1.00 74.22  ? 315  HIS B CB    1 
ATOM   6378 C  CG    . HIS B 2 327 ? -2.914 54.649  -15.332 1.00 79.95  ? 315  HIS B CG    1 
ATOM   6379 N  ND1   . HIS B 2 327 ? -3.551 54.189  -16.465 1.00 80.45  ? 315  HIS B ND1   1 
ATOM   6380 C  CD2   . HIS B 2 327 ? -3.808 54.530  -14.323 1.00 83.45  ? 315  HIS B CD2   1 
ATOM   6381 C  CE1   . HIS B 2 327 ? -4.778 53.811  -16.154 1.00 83.93  ? 315  HIS B CE1   1 
ATOM   6382 N  NE2   . HIS B 2 327 ? -4.960 54.008  -14.861 1.00 86.10  ? 315  HIS B NE2   1 
ATOM   6383 N  N     . GLY B 2 328 ? -1.469 52.008  -14.454 1.00 68.84  ? 316  GLY B N     1 
ATOM   6384 C  CA    . GLY B 2 328 ? -1.829 50.674  -14.893 1.00 66.79  ? 316  GLY B CA    1 
ATOM   6385 C  C     . GLY B 2 328 ? -0.689 49.677  -14.917 1.00 61.91  ? 316  GLY B C     1 
ATOM   6386 O  O     . GLY B 2 328 ? -0.482 48.988  -15.919 1.00 60.10  ? 316  GLY B O     1 
ATOM   6387 N  N     . VAL B 2 329 ? 0.056  49.585  -13.820 1.00 60.48  ? 317  VAL B N     1 
ATOM   6388 C  CA    . VAL B 2 329 ? 1.162  48.642  -13.693 1.00 59.17  ? 317  VAL B CA    1 
ATOM   6389 C  C     . VAL B 2 329 ? 0.802  47.701  -12.551 1.00 60.95  ? 317  VAL B C     1 
ATOM   6390 O  O     . VAL B 2 329 ? 0.907  48.067  -11.374 1.00 64.04  ? 317  VAL B O     1 
ATOM   6391 C  CB    . VAL B 2 329 ? 2.501  49.343  -13.444 1.00 59.90  ? 317  VAL B CB    1 
ATOM   6392 C  CG1   . VAL B 2 329 ? 3.649  48.365  -13.625 1.00 59.82  ? 317  VAL B CG1   1 
ATOM   6393 C  CG2   . VAL B 2 329 ? 2.660  50.528  -14.381 1.00 59.54  ? 317  VAL B CG2   1 
ATOM   6394 N  N     . TYR B 2 330 ? 0.373  46.487  -12.888 1.00 60.51  ? 318  TYR B N     1 
ATOM   6395 C  CA    . TYR B 2 330 ? -0.060 45.504  -11.905 1.00 60.13  ? 318  TYR B CA    1 
ATOM   6396 C  C     . TYR B 2 330 ? 0.846  44.285  -11.975 1.00 62.33  ? 318  TYR B C     1 
ATOM   6397 O  O     . TYR B 2 330 ? 1.088  43.744  -13.060 1.00 60.50  ? 318  TYR B O     1 
ATOM   6398 C  CB    . TYR B 2 330 ? -1.525 45.115  -12.131 1.00 67.89  ? 318  TYR B CB    1 
ATOM   6399 C  CG    . TYR B 2 330 ? -2.453 46.304  -12.037 1.00 71.12  ? 318  TYR B CG    1 
ATOM   6400 C  CD1   . TYR B 2 330 ? -2.993 46.692  -10.818 1.00 74.31  ? 318  TYR B CD1   1 
ATOM   6401 C  CD2   . TYR B 2 330 ? -2.763 47.058  -13.163 1.00 71.90  ? 318  TYR B CD2   1 
ATOM   6402 C  CE1   . TYR B 2 330 ? -3.827 47.789  -10.726 1.00 79.11  ? 318  TYR B CE1   1 
ATOM   6403 C  CE2   . TYR B 2 330 ? -3.596 48.156  -13.081 1.00 74.36  ? 318  TYR B CE2   1 
ATOM   6404 C  CZ    . TYR B 2 330 ? -4.125 48.517  -11.861 1.00 79.42  ? 318  TYR B CZ    1 
ATOM   6405 O  OH    . TYR B 2 330 ? -4.954 49.609  -11.780 1.00 83.38  ? 318  TYR B OH    1 
ATOM   6406 N  N     . TYR B 2 331 ? 1.348  43.862  -10.819 1.00 60.48  ? 319  TYR B N     1 
ATOM   6407 C  CA    . TYR B 2 331 ? 2.295  42.758  -10.765 1.00 63.43  ? 319  TYR B CA    1 
ATOM   6408 C  C     . TYR B 2 331 ? 1.600  41.439  -11.083 1.00 64.15  ? 319  TYR B C     1 
ATOM   6409 O  O     . TYR B 2 331 ? 0.580  41.096  -10.477 1.00 64.24  ? 319  TYR B O     1 
ATOM   6410 C  CB    . TYR B 2 331 ? 2.953  42.703  -9.387  1.00 66.75  ? 319  TYR B CB    1 
ATOM   6411 C  CG    . TYR B 2 331 ? 3.723  41.431  -9.114  1.00 70.04  ? 319  TYR B CG    1 
ATOM   6412 C  CD1   . TYR B 2 331 ? 4.877  41.127  -9.823  1.00 68.91  ? 319  TYR B CD1   1 
ATOM   6413 C  CD2   . TYR B 2 331 ? 3.300  40.539  -8.137  1.00 73.48  ? 319  TYR B CD2   1 
ATOM   6414 C  CE1   . TYR B 2 331 ? 5.583  39.965  -9.573  1.00 70.77  ? 319  TYR B CE1   1 
ATOM   6415 C  CE2   . TYR B 2 331 ? 3.997  39.377  -7.879  1.00 74.79  ? 319  TYR B CE2   1 
ATOM   6416 C  CZ    . TYR B 2 331 ? 5.137  39.094  -8.598  1.00 73.40  ? 319  TYR B CZ    1 
ATOM   6417 O  OH    . TYR B 2 331 ? 5.830  37.935  -8.339  1.00 74.61  ? 319  TYR B OH    1 
ATOM   6418 N  N     . ASP B 2 332 ? 2.157  40.702  -12.046 1.00 64.97  ? 320  ASP B N     1 
ATOM   6419 C  CA    . ASP B 2 332 ? 1.615  39.414  -12.449 1.00 67.93  ? 320  ASP B CA    1 
ATOM   6420 C  C     . ASP B 2 332 ? 2.449  38.310  -11.819 1.00 67.19  ? 320  ASP B C     1 
ATOM   6421 O  O     . ASP B 2 332 ? 3.609  38.121  -12.215 1.00 63.77  ? 320  ASP B O     1 
ATOM   6422 C  CB    . ASP B 2 332 ? 1.615  39.282  -13.973 1.00 68.99  ? 320  ASP B CB    1 
ATOM   6423 C  CG    . ASP B 2 332 ? 0.889  38.033  -14.462 1.00 74.69  ? 320  ASP B CG    1 
ATOM   6424 O  OD1   . ASP B 2 332 ? 0.578  37.143  -13.642 1.00 77.01  ? 320  ASP B OD1   1 
ATOM   6425 O  OD2   . ASP B 2 332 ? 0.623  37.946  -15.679 1.00 76.49  ? 320  ASP B OD2   1 
ATOM   6426 N  N     . PRO B 2 333 ? 1.917  37.559  -10.853 1.00 70.39  ? 321  PRO B N     1 
ATOM   6427 C  CA    . PRO B 2 333 ? 2.699  36.456  -10.273 1.00 74.27  ? 321  PRO B CA    1 
ATOM   6428 C  C     . PRO B 2 333 ? 3.000  35.342  -11.259 1.00 76.74  ? 321  PRO B C     1 
ATOM   6429 O  O     . PRO B 2 333 ? 3.948  34.579  -11.032 1.00 78.55  ? 321  PRO B O     1 
ATOM   6430 C  CB    . PRO B 2 333 ? 1.809  35.956  -9.125  1.00 76.62  ? 321  PRO B CB    1 
ATOM   6431 C  CG    . PRO B 2 333 ? 0.834  37.075  -8.867  1.00 75.99  ? 321  PRO B CG    1 
ATOM   6432 C  CD    . PRO B 2 333 ? 0.610  37.718  -10.196 1.00 72.67  ? 321  PRO B CD    1 
ATOM   6433 N  N     . SER B 2 334 ? 2.235  35.221  -12.345 1.00 76.92  ? 322  SER B N     1 
ATOM   6434 C  CA    . SER B 2 334 ? 2.451  34.136  -13.293 1.00 76.77  ? 322  SER B CA    1 
ATOM   6435 C  C     . SER B 2 334 ? 3.514  34.458  -14.333 1.00 75.66  ? 322  SER B C     1 
ATOM   6436 O  O     . SER B 2 334 ? 3.994  33.542  -15.010 1.00 77.81  ? 322  SER B O     1 
ATOM   6437 C  CB    . SER B 2 334 ? 1.142  33.781  -14.000 1.00 77.89  ? 322  SER B CB    1 
ATOM   6438 O  OG    . SER B 2 334 ? 0.796  34.770  -14.954 1.00 75.07  ? 322  SER B OG    1 
ATOM   6439 N  N     . LYS B 2 335 ? 3.888  35.723  -14.483 1.00 75.39  ? 323  LYS B N     1 
ATOM   6440 C  CA    . LYS B 2 335 ? 4.910  36.122  -15.438 1.00 75.81  ? 323  LYS B CA    1 
ATOM   6441 C  C     . LYS B 2 335 ? 6.227  36.396  -14.720 1.00 75.88  ? 323  LYS B C     1 
ATOM   6442 O  O     . LYS B 2 335 ? 6.290  36.515  -13.495 1.00 76.89  ? 323  LYS B O     1 
ATOM   6443 C  CB    . LYS B 2 335 ? 4.460  37.352  -16.234 1.00 75.46  ? 323  LYS B CB    1 
ATOM   6444 C  CG    . LYS B 2 335 ? 3.353  37.059  -17.238 1.00 78.51  ? 323  LYS B CG    1 
ATOM   6445 C  CD    . LYS B 2 335 ? 3.266  38.126  -18.322 1.00 79.89  ? 323  LYS B CD    1 
ATOM   6446 C  CE    . LYS B 2 335 ? 2.706  39.435  -17.790 1.00 82.03  ? 323  LYS B CE    1 
ATOM   6447 N  NZ    . LYS B 2 335 ? 2.583  40.461  -18.868 1.00 82.05  ? 323  LYS B NZ    1 
ATOM   6448 N  N     . ASP B 2 336 ? 7.290  36.490  -15.508 1.00 77.31  ? 324  ASP B N     1 
ATOM   6449 C  CA    . ASP B 2 336 ? 8.621  36.714  -14.971 1.00 79.88  ? 324  ASP B CA    1 
ATOM   6450 C  C     . ASP B 2 336 ? 8.888  38.199  -14.785 1.00 74.74  ? 324  ASP B C     1 
ATOM   6451 O  O     . ASP B 2 336 ? 8.331  39.047  -15.486 1.00 72.06  ? 324  ASP B O     1 
ATOM   6452 C  CB    . ASP B 2 336 ? 9.686  36.113  -15.890 1.00 85.87  ? 324  ASP B CB    1 
ATOM   6453 C  CG    . ASP B 2 336 ? 9.979  34.664  -15.569 1.00 92.63  ? 324  ASP B CG    1 
ATOM   6454 O  OD1   . ASP B 2 336 ? 9.371  34.131  -14.616 1.00 95.27  ? 324  ASP B OD1   1 
ATOM   6455 O  OD2   . ASP B 2 336 ? 10.821 34.060  -16.266 1.00 95.18  ? 324  ASP B OD2   1 
ATOM   6456 N  N     . LEU B 2 337 ? 9.747  38.502  -13.819 1.00 54.70  ? 325  LEU B N     1 
ATOM   6457 C  CA    . LEU B 2 337 ? 10.261 39.849  -13.629 1.00 52.71  ? 325  LEU B CA    1 
ATOM   6458 C  C     . LEU B 2 337 ? 11.472 40.038  -14.534 1.00 48.72  ? 325  LEU B C     1 
ATOM   6459 O  O     . LEU B 2 337 ? 12.439 39.275  -14.453 1.00 47.37  ? 325  LEU B O     1 
ATOM   6460 C  CB    . LEU B 2 337 ? 10.628 40.086  -12.166 1.00 53.97  ? 325  LEU B CB    1 
ATOM   6461 C  CG    . LEU B 2 337 ? 9.465  40.092  -11.173 1.00 57.01  ? 325  LEU B CG    1 
ATOM   6462 C  CD1   . LEU B 2 337 ? 9.966  39.919  -9.749  1.00 58.14  ? 325  LEU B CD1   1 
ATOM   6463 C  CD2   . LEU B 2 337 ? 8.674  41.378  -11.305 1.00 56.46  ? 325  LEU B CD2   1 
ATOM   6464 N  N     . ILE B 2 338 ? 11.403 41.031  -15.412 1.00 48.09  ? 326  ILE B N     1 
ATOM   6465 C  CA    . ILE B 2 338 ? 12.497 41.385  -16.308 1.00 48.71  ? 326  ILE B CA    1 
ATOM   6466 C  C     . ILE B 2 338 ? 13.238 42.571  -15.711 1.00 52.13  ? 326  ILE B C     1 
ATOM   6467 O  O     . ILE B 2 338 ? 12.630 43.609  -15.413 1.00 53.89  ? 326  ILE B O     1 
ATOM   6468 C  CB    . ILE B 2 338 ? 11.982 41.723  -17.717 1.00 47.45  ? 326  ILE B CB    1 
ATOM   6469 C  CG1   . ILE B 2 338 ? 11.038 40.632  -18.229 1.00 47.42  ? 326  ILE B CG1   1 
ATOM   6470 C  CG2   . ILE B 2 338 ? 13.150 41.929  -18.669 1.00 44.27  ? 326  ILE B CG2   1 
ATOM   6471 C  CD1   . ILE B 2 338 ? 11.724 39.333  -18.551 1.00 47.72  ? 326  ILE B CD1   1 
ATOM   6472 N  N     . ALA B 2 339 ? 14.548 42.425  -15.538 1.00 53.63  ? 327  ALA B N     1 
ATOM   6473 C  CA    . ALA B 2 339 ? 15.396 43.493  -15.026 1.00 49.19  ? 327  ALA B CA    1 
ATOM   6474 C  C     . ALA B 2 339 ? 16.414 43.865  -16.092 1.00 49.90  ? 327  ALA B C     1 
ATOM   6475 O  O     . ALA B 2 339 ? 17.247 43.036  -16.476 1.00 52.39  ? 327  ALA B O     1 
ATOM   6476 C  CB    . ALA B 2 339 ? 16.095 43.072  -13.732 1.00 46.02  ? 327  ALA B CB    1 
ATOM   6477 N  N     . GLU B 2 340 ? 16.343 45.104  -16.568 1.00 49.72  ? 328  GLU B N     1 
ATOM   6478 C  CA    . GLU B 2 340 ? 17.316 45.639  -17.509 1.00 50.56  ? 328  GLU B CA    1 
ATOM   6479 C  C     . GLU B 2 340 ? 18.284 46.562  -16.783 1.00 48.80  ? 328  GLU B C     1 
ATOM   6480 O  O     . GLU B 2 340 ? 17.875 47.377  -15.949 1.00 51.59  ? 328  GLU B O     1 
ATOM   6481 C  CB    . GLU B 2 340 ? 16.639 46.404  -18.647 1.00 57.29  ? 328  GLU B CB    1 
ATOM   6482 C  CG    . GLU B 2 340 ? 15.857 45.543  -19.616 1.00 61.97  ? 328  GLU B CG    1 
ATOM   6483 C  CD    . GLU B 2 340 ? 15.683 46.218  -20.960 1.00 67.52  ? 328  GLU B CD    1 
ATOM   6484 O  OE1   . GLU B 2 340 ? 16.619 46.923  -21.393 1.00 69.07  ? 328  GLU B OE1   1 
ATOM   6485 O  OE2   . GLU B 2 340 ? 14.611 46.049  -21.579 1.00 70.74  ? 328  GLU B OE2   1 
ATOM   6486 N  N     . ILE B 2 341 ? 19.566 46.430  -17.114 1.00 44.23  ? 329  ILE B N     1 
ATOM   6487 C  CA    . ILE B 2 341 ? 20.630 47.248  -16.549 1.00 42.24  ? 329  ILE B CA    1 
ATOM   6488 C  C     . ILE B 2 341 ? 21.334 47.982  -17.682 1.00 42.67  ? 329  ILE B C     1 
ATOM   6489 O  O     . ILE B 2 341 ? 21.572 47.411  -18.752 1.00 45.24  ? 329  ILE B O     1 
ATOM   6490 C  CB    . ILE B 2 341 ? 21.636 46.396  -15.746 1.00 38.41  ? 329  ILE B CB    1 
ATOM   6491 C  CG1   . ILE B 2 341 ? 20.919 45.610  -14.649 1.00 37.06  ? 329  ILE B CG1   1 
ATOM   6492 C  CG2   . ILE B 2 341 ? 22.728 47.269  -15.145 1.00 31.65  ? 329  ILE B CG2   1 
ATOM   6493 C  CD1   . ILE B 2 341 ? 21.861 44.830  -13.750 1.00 38.75  ? 329  ILE B CD1   1 
ATOM   6494 N  N     . GLN B 2 342 ? 21.658 49.249  -17.444 1.00 42.59  ? 330  GLN B N     1 
ATOM   6495 C  CA    . GLN B 2 342 ? 22.452 50.056  -18.360 1.00 44.73  ? 330  GLN B CA    1 
ATOM   6496 C  C     . GLN B 2 342 ? 23.654 50.617  -17.615 1.00 46.85  ? 330  GLN B C     1 
ATOM   6497 O  O     . GLN B 2 342 ? 23.510 51.158  -16.512 1.00 48.49  ? 330  GLN B O     1 
ATOM   6498 C  CB    . GLN B 2 342 ? 21.636 51.204  -18.963 1.00 44.89  ? 330  GLN B CB    1 
ATOM   6499 C  CG    . GLN B 2 342 ? 20.371 50.776  -19.682 1.00 44.46  ? 330  GLN B CG    1 
ATOM   6500 C  CD    . GLN B 2 342 ? 19.180 50.709  -18.757 1.00 46.38  ? 330  GLN B CD    1 
ATOM   6501 O  OE1   . GLN B 2 342 ? 19.148 51.375  -17.723 1.00 46.93  ? 330  GLN B OE1   1 
ATOM   6502 N  NE2   . GLN B 2 342 ? 18.191 49.901  -19.119 1.00 48.01  ? 330  GLN B NE2   1 
ATOM   6503 N  N     . LYS B 2 343 ? 24.833 50.472  -18.214 1.00 47.77  ? 331  LYS B N     1 
ATOM   6504 C  CA    . LYS B 2 343 ? 26.040 51.120  -17.719 1.00 49.09  ? 331  LYS B CA    1 
ATOM   6505 C  C     . LYS B 2 343 ? 26.070 52.563  -18.210 1.00 52.39  ? 331  LYS B C     1 
ATOM   6506 O  O     . LYS B 2 343 ? 26.082 52.806  -19.422 1.00 54.64  ? 331  LYS B O     1 
ATOM   6507 C  CB    . LYS B 2 343 ? 27.277 50.364  -18.198 1.00 48.47  ? 331  LYS B CB    1 
ATOM   6508 C  CG    . LYS B 2 343 ? 28.571 51.152  -18.094 1.00 49.74  ? 331  LYS B CG    1 
ATOM   6509 C  CD    . LYS B 2 343 ? 29.721 50.404  -18.747 1.00 47.81  ? 331  LYS B CD    1 
ATOM   6510 C  CE    . LYS B 2 343 ? 30.989 51.236  -18.739 1.00 51.45  ? 331  LYS B CE    1 
ATOM   6511 N  NZ    . LYS B 2 343 ? 32.102 50.554  -19.456 1.00 55.73  ? 331  LYS B NZ    1 
ATOM   6512 N  N     . GLN B 2 344 ? 26.073 53.520  -17.282 1.00 54.48  ? 332  GLN B N     1 
ATOM   6513 C  CA    . GLN B 2 344 ? 26.094 54.932  -17.635 1.00 58.83  ? 332  GLN B CA    1 
ATOM   6514 C  C     . GLN B 2 344 ? 27.491 55.533  -17.595 1.00 63.22  ? 332  GLN B C     1 
ATOM   6515 O  O     . GLN B 2 344 ? 27.658 56.699  -17.963 1.00 65.58  ? 332  GLN B O     1 
ATOM   6516 C  CB    . GLN B 2 344 ? 25.171 55.725  -16.703 1.00 58.20  ? 332  GLN B CB    1 
ATOM   6517 C  CG    . GLN B 2 344 ? 23.740 55.206  -16.638 1.00 56.74  ? 332  GLN B CG    1 
ATOM   6518 C  CD    . GLN B 2 344 ? 22.961 55.458  -17.917 1.00 56.50  ? 332  GLN B CD    1 
ATOM   6519 O  OE1   . GLN B 2 344 ? 23.459 56.088  -18.849 1.00 58.91  ? 332  GLN B OE1   1 
ATOM   6520 N  NE2   . GLN B 2 344 ? 21.727 54.965  -17.964 1.00 52.69  ? 332  GLN B NE2   1 
ATOM   6521 N  N     . GLY B 2 345 ? 28.490 54.773  -17.160 1.00 65.96  ? 333  GLY B N     1 
ATOM   6522 C  CA    . GLY B 2 345 ? 29.839 55.277  -17.033 1.00 69.51  ? 333  GLY B CA    1 
ATOM   6523 C  C     . GLY B 2 345 ? 30.100 55.900  -15.672 1.00 72.56  ? 333  GLY B C     1 
ATOM   6524 O  O     . GLY B 2 345 ? 29.186 56.224  -14.914 1.00 72.27  ? 333  GLY B O     1 
ATOM   6525 N  N     . GLN B 2 346 ? 31.389 56.062  -15.366 1.00 78.12  ? 334  GLN B N     1 
ATOM   6526 C  CA    . GLN B 2 346 ? 31.836 56.664  -14.108 1.00 81.84  ? 334  GLN B CA    1 
ATOM   6527 C  C     . GLN B 2 346 ? 31.221 55.957  -12.902 1.00 77.48  ? 334  GLN B C     1 
ATOM   6528 O  O     . GLN B 2 346 ? 30.848 56.585  -11.909 1.00 81.76  ? 334  GLN B O     1 
ATOM   6529 C  CB    . GLN B 2 346 ? 31.530 58.163  -14.076 1.00 94.05  ? 334  GLN B CB    1 
ATOM   6530 C  CG    . GLN B 2 346 ? 32.671 59.052  -14.559 1.00 106.80 ? 334  GLN B CG    1 
ATOM   6531 C  CD    . GLN B 2 346 ? 33.024 58.829  -16.019 1.00 110.98 ? 334  GLN B CD    1 
ATOM   6532 O  OE1   . GLN B 2 346 ? 34.196 58.844  -16.394 1.00 114.03 ? 334  GLN B OE1   1 
ATOM   6533 N  NE2   . GLN B 2 346 ? 32.008 58.630  -16.851 1.00 110.98 ? 334  GLN B NE2   1 
ATOM   6534 N  N     . GLY B 2 347 ? 31.111 54.633  -12.993 1.00 70.71  ? 335  GLY B N     1 
ATOM   6535 C  CA    . GLY B 2 347 ? 30.580 53.852  -11.894 1.00 65.13  ? 335  GLY B CA    1 
ATOM   6536 C  C     . GLY B 2 347 ? 29.089 53.968  -11.679 1.00 59.45  ? 335  GLY B C     1 
ATOM   6537 O  O     . GLY B 2 347 ? 28.598 53.596  -10.611 1.00 58.39  ? 335  GLY B O     1 
ATOM   6538 N  N     . GLN B 2 348 ? 28.350 54.466  -12.665 1.00 56.58  ? 336  GLN B N     1 
ATOM   6539 C  CA    . GLN B 2 348 ? 26.908 54.630  -12.560 1.00 54.77  ? 336  GLN B CA    1 
ATOM   6540 C  C     . GLN B 2 348 ? 26.192 53.533  -13.338 1.00 49.73  ? 336  GLN B C     1 
ATOM   6541 O  O     . GLN B 2 348 ? 26.610 53.159  -14.439 1.00 49.43  ? 336  GLN B O     1 
ATOM   6542 C  CB    . GLN B 2 348 ? 26.478 56.002  -13.083 1.00 60.38  ? 336  GLN B CB    1 
ATOM   6543 C  CG    . GLN B 2 348 ? 27.232 57.163  -12.460 1.00 69.06  ? 336  GLN B CG    1 
ATOM   6544 C  CD    . GLN B 2 348 ? 27.006 57.268  -10.966 1.00 73.77  ? 336  GLN B CD    1 
ATOM   6545 O  OE1   . GLN B 2 348 ? 25.874 57.429  -10.510 1.00 74.99  ? 336  GLN B OE1   1 
ATOM   6546 N  NE2   . GLN B 2 348 ? 28.085 57.172  -10.195 1.00 75.30  ? 336  GLN B NE2   1 
ATOM   6547 N  N     . TRP B 2 349 ? 25.100 53.029  -12.769 1.00 47.25  ? 337  TRP B N     1 
ATOM   6548 C  CA    . TRP B 2 349 ? 24.309 51.993  -13.417 1.00 47.16  ? 337  TRP B CA    1 
ATOM   6549 C  C     . TRP B 2 349 ? 22.838 52.290  -13.179 1.00 46.80  ? 337  TRP B C     1 
ATOM   6550 O  O     . TRP B 2 349 ? 22.441 52.583  -12.050 1.00 47.97  ? 337  TRP B O     1 
ATOM   6551 C  CB    . TRP B 2 349 ? 24.671 50.601  -12.875 1.00 43.90  ? 337  TRP B CB    1 
ATOM   6552 C  CG    . TRP B 2 349 ? 26.147 50.302  -12.906 1.00 44.90  ? 337  TRP B CG    1 
ATOM   6553 C  CD1   . TRP B 2 349 ? 27.097 50.770  -12.042 1.00 47.66  ? 337  TRP B CD1   1 
ATOM   6554 C  CD2   . TRP B 2 349 ? 26.836 49.465  -13.843 1.00 43.34  ? 337  TRP B CD2   1 
ATOM   6555 N  NE1   . TRP B 2 349 ? 28.333 50.283  -12.387 1.00 48.21  ? 337  TRP B NE1   1 
ATOM   6556 C  CE2   . TRP B 2 349 ? 28.201 49.476  -13.487 1.00 45.69  ? 337  TRP B CE2   1 
ATOM   6557 C  CE3   . TRP B 2 349 ? 26.434 48.707  -14.947 1.00 42.33  ? 337  TRP B CE3   1 
ATOM   6558 C  CZ2   . TRP B 2 349 ? 29.164 48.761  -14.197 1.00 44.50  ? 337  TRP B CZ2   1 
ATOM   6559 C  CZ3   . TRP B 2 349 ? 27.392 47.995  -15.650 1.00 41.67  ? 337  TRP B CZ3   1 
ATOM   6560 C  CH2   . TRP B 2 349 ? 28.740 48.030  -15.273 1.00 44.14  ? 337  TRP B CH2   1 
ATOM   6561 N  N     . THR B 2 350 ? 22.036 52.232  -14.233 1.00 42.72  ? 338  THR B N     1 
ATOM   6562 C  CA    . THR B 2 350 ? 20.594 52.377  -14.109 1.00 42.16  ? 338  THR B CA    1 
ATOM   6563 C  C     . THR B 2 350 ? 19.929 51.023  -14.314 1.00 44.32  ? 338  THR B C     1 
ATOM   6564 O  O     . THR B 2 350 ? 20.473 50.146  -14.990 1.00 45.84  ? 338  THR B O     1 
ATOM   6565 C  CB    . THR B 2 350 ? 20.049 53.389  -15.117 1.00 42.14  ? 338  THR B CB    1 
ATOM   6566 O  OG1   . THR B 2 350 ? 20.517 53.054  -16.428 1.00 43.15  ? 338  THR B OG1   1 
ATOM   6567 C  CG2   . THR B 2 350 ? 20.511 54.797  -14.763 1.00 46.54  ? 338  THR B CG2   1 
ATOM   6568 N  N     . TYR B 2 351 ? 18.752 50.845  -13.720 1.00 42.44  ? 339  TYR B N     1 
ATOM   6569 C  CA    . TYR B 2 351 ? 18.056 49.577  -13.873 1.00 43.70  ? 339  TYR B CA    1 
ATOM   6570 C  C     . TYR B 2 351 ? 16.554 49.800  -13.822 1.00 45.07  ? 339  TYR B C     1 
ATOM   6571 O  O     . TYR B 2 351 ? 16.064 50.708  -13.145 1.00 47.61  ? 339  TYR B O     1 
ATOM   6572 C  CB    . TYR B 2 351 ? 18.486 48.553  -12.809 1.00 42.38  ? 339  TYR B CB    1 
ATOM   6573 C  CG    . TYR B 2 351 ? 18.043 48.851  -11.389 1.00 45.12  ? 339  TYR B CG    1 
ATOM   6574 C  CD1   . TYR B 2 351 ? 16.812 48.410  -10.915 1.00 48.35  ? 339  TYR B CD1   1 
ATOM   6575 C  CD2   . TYR B 2 351 ? 18.868 49.547  -10.513 1.00 46.67  ? 339  TYR B CD2   1 
ATOM   6576 C  CE1   . TYR B 2 351 ? 16.404 48.671  -9.620  1.00 51.06  ? 339  TYR B CE1   1 
ATOM   6577 C  CE2   . TYR B 2 351 ? 18.471 49.811  -9.212  1.00 50.68  ? 339  TYR B CE2   1 
ATOM   6578 C  CZ    . TYR B 2 351 ? 17.236 49.370  -8.771  1.00 53.89  ? 339  TYR B CZ    1 
ATOM   6579 O  OH    . TYR B 2 351 ? 16.831 49.626  -7.478  1.00 55.68  ? 339  TYR B OH    1 
ATOM   6580 N  N     . GLN B 2 352 ? 15.835 48.953  -14.553 1.00 45.12  ? 340  GLN B N     1 
ATOM   6581 C  CA    . GLN B 2 352 ? 14.379 48.949  -14.555 1.00 44.13  ? 340  GLN B CA    1 
ATOM   6582 C  C     . GLN B 2 352 ? 13.875 47.524  -14.387 1.00 47.85  ? 340  GLN B C     1 
ATOM   6583 O  O     . GLN B 2 352 ? 14.412 46.589  -14.989 1.00 50.61  ? 340  GLN B O     1 
ATOM   6584 C  CB    . GLN B 2 352 ? 13.801 49.547  -15.848 1.00 42.64  ? 340  GLN B CB    1 
ATOM   6585 C  CG    . GLN B 2 352 ? 14.354 50.912  -16.223 1.00 44.61  ? 340  GLN B CG    1 
ATOM   6586 C  CD    . GLN B 2 352 ? 15.660 50.816  -16.982 1.00 45.27  ? 340  GLN B CD    1 
ATOM   6587 O  OE1   . GLN B 2 352 ? 15.768 50.080  -17.962 1.00 47.61  ? 340  GLN B OE1   1 
ATOM   6588 N  NE2   . GLN B 2 352 ? 16.665 51.552  -16.525 1.00 44.86  ? 340  GLN B NE2   1 
ATOM   6589 N  N     . ILE B 2 353 ? 12.838 47.369  -13.570 1.00 48.16  ? 341  ILE B N     1 
ATOM   6590 C  CA    . ILE B 2 353 ? 12.159 46.098  -13.353 1.00 47.34  ? 341  ILE B CA    1 
ATOM   6591 C  C     . ILE B 2 353 ? 10.743 46.245  -13.885 1.00 47.77  ? 341  ILE B C     1 
ATOM   6592 O  O     . ILE B 2 353 ? 9.992  47.120  -13.428 1.00 48.21  ? 341  ILE B O     1 
ATOM   6593 C  CB    . ILE B 2 353 ? 12.143 45.698  -11.869 1.00 49.47  ? 341  ILE B CB    1 
ATOM   6594 C  CG1   . ILE B 2 353 ? 13.566 45.618  -11.317 1.00 50.50  ? 341  ILE B CG1   1 
ATOM   6595 C  CG2   . ILE B 2 353 ? 11.417 44.374  -11.682 1.00 51.26  ? 341  ILE B CG2   1 
ATOM   6596 C  CD1   . ILE B 2 353 ? 13.622 45.324  -9.836  1.00 52.78  ? 341  ILE B CD1   1 
ATOM   6597 N  N     . TYR B 2 354 ? 10.384 45.393  -14.844 1.00 46.23  ? 342  TYR B N     1 
ATOM   6598 C  CA    . TYR B 2 354 ? 9.073  45.425  -15.477 1.00 48.21  ? 342  TYR B CA    1 
ATOM   6599 C  C     . TYR B 2 354 ? 8.675  44.005  -15.857 1.00 49.15  ? 342  TYR B C     1 
ATOM   6600 O  O     . TYR B 2 354 ? 9.495  43.089  -15.854 1.00 47.85  ? 342  TYR B O     1 
ATOM   6601 C  CB    . TYR B 2 354 ? 9.073  46.321  -16.718 1.00 46.48  ? 342  TYR B CB    1 
ATOM   6602 C  CG    . TYR B 2 354 ? 10.017 45.842  -17.801 1.00 46.46  ? 342  TYR B CG    1 
ATOM   6603 C  CD1   . TYR B 2 354 ? 11.359 46.199  -17.788 1.00 45.29  ? 342  TYR B CD1   1 
ATOM   6604 C  CD2   . TYR B 2 354 ? 9.567  45.031  -18.835 1.00 48.11  ? 342  TYR B CD2   1 
ATOM   6605 C  CE1   . TYR B 2 354 ? 12.225 45.764  -18.773 1.00 45.86  ? 342  TYR B CE1   1 
ATOM   6606 C  CE2   . TYR B 2 354 ? 10.427 44.589  -19.823 1.00 47.26  ? 342  TYR B CE2   1 
ATOM   6607 C  CZ    . TYR B 2 354 ? 11.754 44.959  -19.788 1.00 48.19  ? 342  TYR B CZ    1 
ATOM   6608 O  OH    . TYR B 2 354 ? 12.613 44.521  -20.773 1.00 51.15  ? 342  TYR B OH    1 
ATOM   6609 N  N     . GLN B 2 355 ? 7.402  43.832  -16.200 1.00 50.12  ? 343  GLN B N     1 
ATOM   6610 C  CA    . GLN B 2 355 ? 6.922  42.571  -16.749 1.00 52.69  ? 343  GLN B CA    1 
ATOM   6611 C  C     . GLN B 2 355 ? 6.395  42.693  -18.169 1.00 57.71  ? 343  GLN B C     1 
ATOM   6612 O  O     . GLN B 2 355 ? 6.402  41.702  -18.902 1.00 59.75  ? 343  GLN B O     1 
ATOM   6613 C  CB    . GLN B 2 355 ? 5.822  41.974  -15.855 1.00 52.32  ? 343  GLN B CB    1 
ATOM   6614 C  CG    . GLN B 2 355 ? 6.320  41.488  -14.505 1.00 49.28  ? 343  GLN B CG    1 
ATOM   6615 C  CD    . GLN B 2 355 ? 5.225  40.847  -13.676 1.00 53.37  ? 343  GLN B CD    1 
ATOM   6616 O  OE1   . GLN B 2 355 ? 4.137  41.404  -13.525 1.00 57.69  ? 343  GLN B OE1   1 
ATOM   6617 N  NE2   . GLN B 2 355 ? 5.506  39.665  -13.137 1.00 49.93  ? 343  GLN B NE2   1 
ATOM   6618 N  N     . GLU B 2 356 ? 5.946  43.872  -18.571 1.00 60.87  ? 344  GLU B N     1 
ATOM   6619 C  CA    . GLU B 2 356 ? 5.496  44.178  -19.918 1.00 63.63  ? 344  GLU B CA    1 
ATOM   6620 C  C     . GLU B 2 356 ? 6.231  45.423  -20.389 1.00 66.22  ? 344  GLU B C     1 
ATOM   6621 O  O     . GLU B 2 356 ? 6.712  46.211  -19.569 1.00 65.57  ? 344  GLU B O     1 
ATOM   6622 C  CB    . GLU B 2 356 ? 3.977  44.405  -19.955 1.00 66.80  ? 344  GLU B CB    1 
ATOM   6623 N  N     . PRO B 2 357 ? 6.351  45.623  -21.702 1.00 67.64  ? 345  PRO B N     1 
ATOM   6624 C  CA    . PRO B 2 357 ? 7.112  46.779  -22.199 1.00 65.30  ? 345  PRO B CA    1 
ATOM   6625 C  C     . PRO B 2 357 ? 6.510  48.098  -21.733 1.00 61.27  ? 345  PRO B C     1 
ATOM   6626 O  O     . PRO B 2 357 ? 5.298  48.316  -21.821 1.00 59.76  ? 345  PRO B O     1 
ATOM   6627 C  CB    . PRO B 2 357 ? 7.036  46.628  -23.723 1.00 69.38  ? 345  PRO B CB    1 
ATOM   6628 C  CG    . PRO B 2 357 ? 5.855  45.743  -23.963 1.00 72.35  ? 345  PRO B CG    1 
ATOM   6629 C  CD    . PRO B 2 357 ? 5.839  44.795  -22.807 1.00 70.67  ? 345  PRO B CD    1 
ATOM   6630 N  N     . PHE B 2 358 ? 7.377  48.971  -21.218 1.00 58.90  ? 346  PHE B N     1 
ATOM   6631 C  CA    . PHE B 2 358 ? 7.086  50.321  -20.740 1.00 58.83  ? 346  PHE B CA    1 
ATOM   6632 C  C     . PHE B 2 358 ? 6.228  50.338  -19.481 1.00 59.01  ? 346  PHE B C     1 
ATOM   6633 O  O     . PHE B 2 358 ? 5.909  51.426  -18.984 1.00 59.47  ? 346  PHE B O     1 
ATOM   6634 C  CB    . PHE B 2 358 ? 6.416  51.185  -21.818 1.00 61.77  ? 346  PHE B CB    1 
ATOM   6635 C  CG    . PHE B 2 358 ? 7.061  51.063  -23.168 1.00 63.10  ? 346  PHE B CG    1 
ATOM   6636 C  CD1   . PHE B 2 358 ? 8.394  51.401  -23.346 1.00 61.84  ? 346  PHE B CD1   1 
ATOM   6637 C  CD2   . PHE B 2 358 ? 6.339  50.603  -24.258 1.00 65.32  ? 346  PHE B CD2   1 
ATOM   6638 C  CE1   . PHE B 2 358 ? 8.994  51.285  -24.584 1.00 62.86  ? 346  PHE B CE1   1 
ATOM   6639 C  CE2   . PHE B 2 358 ? 6.933  50.485  -25.499 1.00 66.75  ? 346  PHE B CE2   1 
ATOM   6640 C  CZ    . PHE B 2 358 ? 8.262  50.826  -25.662 1.00 65.93  ? 346  PHE B CZ    1 
ATOM   6641 N  N     . LYS B 2 359 ? 5.836  49.182  -18.953 1.00 58.62  ? 347  LYS B N     1 
ATOM   6642 C  CA    . LYS B 2 359 ? 5.085  49.115  -17.702 1.00 60.39  ? 347  LYS B CA    1 
ATOM   6643 C  C     . LYS B 2 359 ? 6.039  48.760  -16.563 1.00 59.78  ? 347  LYS B C     1 
ATOM   6644 O  O     . LYS B 2 359 ? 6.003  47.673  -15.981 1.00 61.24  ? 347  LYS B O     1 
ATOM   6645 C  CB    . LYS B 2 359 ? 3.938  48.116  -17.825 1.00 62.54  ? 347  LYS B CB    1 
ATOM   6646 N  N     . ASN B 2 360 ? 6.913  49.716  -16.260 1.00 59.12  ? 348  ASN B N     1 
ATOM   6647 C  CA    . ASN B 2 360 ? 7.942  49.505  -15.250 1.00 56.08  ? 348  ASN B CA    1 
ATOM   6648 C  C     . ASN B 2 360 ? 7.319  49.352  -13.870 1.00 55.54  ? 348  ASN B C     1 
ATOM   6649 O  O     . ASN B 2 360 ? 6.511  50.182  -13.442 1.00 59.38  ? 348  ASN B O     1 
ATOM   6650 C  CB    . ASN B 2 360 ? 8.936  50.665  -15.247 1.00 54.70  ? 348  ASN B CB    1 
ATOM   6651 C  CG    . ASN B 2 360 ? 9.793  50.703  -16.493 1.00 54.62  ? 348  ASN B CG    1 
ATOM   6652 O  OD1   . ASN B 2 360 ? 10.128 49.663  -17.061 1.00 53.95  ? 348  ASN B OD1   1 
ATOM   6653 N  ND2   . ASN B 2 360 ? 10.156 51.906  -16.926 1.00 56.12  ? 348  ASN B ND2   1 
ATOM   6654 N  N     . LEU B 2 361 ? 7.694  48.280  -13.177 1.00 54.64  ? 349  LEU B N     1 
ATOM   6655 C  CA    . LEU B 2 361 ? 7.344  48.149  -11.771 1.00 54.91  ? 349  LEU B CA    1 
ATOM   6656 C  C     . LEU B 2 361 ? 8.266  48.978  -10.890 1.00 54.60  ? 349  LEU B C     1 
ATOM   6657 O  O     . LEU B 2 361 ? 7.837  49.470  -9.840  1.00 55.06  ? 349  LEU B O     1 
ATOM   6658 C  CB    . LEU B 2 361 ? 7.393  46.680  -11.350 1.00 51.78  ? 349  LEU B CB    1 
ATOM   6659 C  CG    . LEU B 2 361 ? 6.266  45.782  -11.860 1.00 51.44  ? 349  LEU B CG    1 
ATOM   6660 C  CD1   . LEU B 2 361 ? 6.635  44.328  -11.674 1.00 49.12  ? 349  LEU B CD1   1 
ATOM   6661 C  CD2   . LEU B 2 361 ? 4.972  46.096  -11.130 1.00 55.90  ? 349  LEU B CD2   1 
ATOM   6662 N  N     . LYS B 2 362 ? 9.521  49.149  -11.301 1.00 53.95  ? 350  LYS B N     1 
ATOM   6663 C  CA    . LYS B 2 362 ? 10.470 49.919  -10.506 1.00 55.10  ? 350  LYS B CA    1 
ATOM   6664 C  C     . LYS B 2 362 ? 11.580 50.432  -11.412 1.00 53.20  ? 350  LYS B C     1 
ATOM   6665 O  O     . LYS B 2 362 ? 11.915 49.804  -12.417 1.00 52.30  ? 350  LYS B O     1 
ATOM   6666 C  CB    . LYS B 2 362 ? 11.049 49.073  -9.363  1.00 58.03  ? 350  LYS B CB    1 
ATOM   6667 C  CG    . LYS B 2 362 ? 11.568 49.865  -8.163  1.00 63.37  ? 350  LYS B CG    1 
ATOM   6668 C  CD    . LYS B 2 362 ? 13.041 50.230  -8.307  1.00 63.87  ? 350  LYS B CD    1 
ATOM   6669 C  CE    . LYS B 2 362 ? 13.586 50.881  -7.042  1.00 67.75  ? 350  LYS B CE    1 
ATOM   6670 N  NZ    . LYS B 2 362 ? 13.603 49.935  -5.889  1.00 70.89  ? 350  LYS B NZ    1 
ATOM   6671 N  N     . THR B 2 363 ? 12.129 51.592  -11.057 1.00 52.54  ? 351  THR B N     1 
ATOM   6672 C  CA    . THR B 2 363 ? 13.326 52.130  -11.692 1.00 52.42  ? 351  THR B CA    1 
ATOM   6673 C  C     . THR B 2 363 ? 14.282 52.596  -10.604 1.00 57.56  ? 351  THR B C     1 
ATOM   6674 O  O     . THR B 2 363 ? 13.854 53.168  -9.598  1.00 63.01  ? 351  THR B O     1 
ATOM   6675 C  CB    . THR B 2 363 ? 13.012 53.305  -12.634 1.00 52.69  ? 351  THR B CB    1 
ATOM   6676 O  OG1   . THR B 2 363 ? 12.660 54.457  -11.862 1.00 56.13  ? 351  THR B OG1   1 
ATOM   6677 C  CG2   . THR B 2 363 ? 11.868 52.963  -13.576 1.00 51.78  ? 351  THR B CG2   1 
ATOM   6678 N  N     . GLY B 2 364 ? 15.574 52.354  -10.803 1.00 54.91  ? 352  GLY B N     1 
ATOM   6679 C  CA    . GLY B 2 364 ? 16.539 52.738  -9.791  1.00 56.13  ? 352  GLY B CA    1 
ATOM   6680 C  C     . GLY B 2 364 ? 17.931 52.853  -10.366 1.00 55.09  ? 352  GLY B C     1 
ATOM   6681 O  O     . GLY B 2 364 ? 18.148 52.706  -11.570 1.00 55.46  ? 352  GLY B O     1 
ATOM   6682 N  N     . LYS B 2 365 ? 18.887 53.107  -9.475  1.00 57.94  ? 353  LYS B N     1 
ATOM   6683 C  CA    . LYS B 2 365 ? 20.281 53.234  -9.868  1.00 62.89  ? 353  LYS B CA    1 
ATOM   6684 C  C     . LYS B 2 365 ? 21.183 52.629  -8.801  1.00 66.85  ? 353  LYS B C     1 
ATOM   6685 O  O     . LYS B 2 365 ? 20.802 52.476  -7.638  1.00 71.24  ? 353  LYS B O     1 
ATOM   6686 C  CB    . LYS B 2 365 ? 20.674 54.699  -10.109 1.00 67.58  ? 353  LYS B CB    1 
ATOM   6687 C  CG    . LYS B 2 365 ? 20.755 55.534  -8.843  1.00 75.03  ? 353  LYS B CG    1 
ATOM   6688 C  CD    . LYS B 2 365 ? 21.566 56.800  -9.068  1.00 81.69  ? 353  LYS B CD    1 
ATOM   6689 C  CE    . LYS B 2 365 ? 21.685 57.620  -7.793  1.00 88.22  ? 353  LYS B CE    1 
ATOM   6690 N  NZ    . LYS B 2 365 ? 20.361 58.104  -7.313  1.00 91.65  ? 353  LYS B NZ    1 
ATOM   6691 N  N     . TYR B 2 366 ? 22.392 52.281  -9.233  1.00 67.57  ? 354  TYR B N     1 
ATOM   6692 C  CA    . TYR B 2 366 ? 23.481 51.837  -8.372  1.00 71.79  ? 354  TYR B CA    1 
ATOM   6693 C  C     . TYR B 2 366 ? 24.701 52.669  -8.735  1.00 72.76  ? 354  TYR B C     1 
ATOM   6694 O  O     . TYR B 2 366 ? 25.161 52.630  -9.882  1.00 73.45  ? 354  TYR B O     1 
ATOM   6695 C  CB    . TYR B 2 366 ? 23.750 50.337  -8.552  1.00 70.20  ? 354  TYR B CB    1 
ATOM   6696 C  CG    . TYR B 2 366 ? 24.918 49.802  -7.752  1.00 71.77  ? 354  TYR B CG    1 
ATOM   6697 C  CD1   . TYR B 2 366 ? 24.840 49.676  -6.369  1.00 73.95  ? 354  TYR B CD1   1 
ATOM   6698 C  CD2   . TYR B 2 366 ? 26.093 49.408  -8.381  1.00 69.87  ? 354  TYR B CD2   1 
ATOM   6699 C  CE1   . TYR B 2 366 ? 25.906 49.184  -5.634  1.00 75.08  ? 354  TYR B CE1   1 
ATOM   6700 C  CE2   . TYR B 2 366 ? 27.163 48.915  -7.655  1.00 71.86  ? 354  TYR B CE2   1 
ATOM   6701 C  CZ    . TYR B 2 366 ? 27.065 48.805  -6.282  1.00 74.96  ? 354  TYR B CZ    1 
ATOM   6702 O  OH    . TYR B 2 366 ? 28.129 48.315  -5.557  1.00 76.31  ? 354  TYR B OH    1 
ATOM   6703 N  N     . ALA B 2 367 ? 25.213 53.433  -7.773  1.00 75.28  ? 355  ALA B N     1 
ATOM   6704 C  CA    . ALA B 2 367 ? 26.215 54.468  -8.034  1.00 79.53  ? 355  ALA B CA    1 
ATOM   6705 C  C     . ALA B 2 367 ? 27.476 54.198  -7.217  1.00 84.31  ? 355  ALA B C     1 
ATOM   6706 O  O     . ALA B 2 367 ? 27.583 54.623  -6.064  1.00 90.03  ? 355  ALA B O     1 
ATOM   6707 C  CB    . ALA B 2 367 ? 25.645 55.851  -7.725  1.00 82.71  ? 355  ALA B CB    1 
ATOM   6708 N  N     . ARG B 2 368 ? 28.435 53.503  -7.824  1.00 81.80  ? 356  ARG B N     1 
ATOM   6709 C  CA    . ARG B 2 368 ? 29.746 53.327  -7.222  1.00 81.37  ? 356  ARG B CA    1 
ATOM   6710 C  C     . ARG B 2 368 ? 30.625 54.541  -7.528  1.00 82.87  ? 356  ARG B C     1 
ATOM   6711 O  O     . ARG B 2 368 ? 30.215 55.483  -8.213  1.00 83.01  ? 356  ARG B O     1 
ATOM   6712 C  CB    . ARG B 2 368 ? 30.388 52.033  -7.716  1.00 76.84  ? 356  ARG B CB    1 
ATOM   6713 N  N     . MET B 2 369 ? 31.851 54.524  -7.016  1.00 83.99  ? 357  MET B N     1 
ATOM   6714 C  CA    . MET B 2 369 ? 32.763 55.649  -7.200  1.00 88.10  ? 357  MET B CA    1 
ATOM   6715 C  C     . MET B 2 369 ? 34.014 55.240  -7.970  1.00 89.60  ? 357  MET B C     1 
ATOM   6716 O  O     . MET B 2 369 ? 34.800 56.090  -8.390  1.00 92.93  ? 357  MET B O     1 
ATOM   6717 C  CB    . MET B 2 369 ? 33.154 56.249  -5.847  1.00 91.68  ? 357  MET B CB    1 
ATOM   6718 N  N     . HIS B 2 373 ? 40.119 53.284  -11.325 1.00 112.31 ? 361  HIS B N     1 
ATOM   6719 C  CA    . HIS B 2 373 ? 40.680 51.962  -11.071 1.00 110.94 ? 361  HIS B CA    1 
ATOM   6720 C  C     . HIS B 2 373 ? 39.589 50.965  -10.686 1.00 106.15 ? 361  HIS B C     1 
ATOM   6721 O  O     . HIS B 2 373 ? 39.791 50.112  -9.821  1.00 108.25 ? 361  HIS B O     1 
ATOM   6722 C  CB    . HIS B 2 373 ? 41.739 52.035  -9.968  1.00 114.78 ? 361  HIS B CB    1 
ATOM   6723 N  N     . THR B 2 374 ? 38.435 51.073  -11.341 1.00 96.71  ? 362  THR B N     1 
ATOM   6724 C  CA    . THR B 2 374 ? 37.268 50.282  -10.988 1.00 87.78  ? 362  THR B CA    1 
ATOM   6725 C  C     . THR B 2 374 ? 37.209 48.996  -11.815 1.00 79.01  ? 362  THR B C     1 
ATOM   6726 O  O     . THR B 2 374 ? 38.036 48.748  -12.695 1.00 79.65  ? 362  THR B O     1 
ATOM   6727 C  CB    . THR B 2 374 ? 35.996 51.108  -11.171 1.00 87.82  ? 362  THR B CB    1 
ATOM   6728 O  OG1   . THR B 2 374 ? 35.948 51.623  -12.507 1.00 87.19  ? 362  THR B OG1   1 
ATOM   6729 C  CG2   . THR B 2 374 ? 35.967 52.270  -10.185 1.00 91.01  ? 362  THR B CG2   1 
ATOM   6730 N  N     . ASN B 2 375 ? 36.207 48.167  -11.524 1.00 70.43  ? 363  ASN B N     1 
ATOM   6731 C  CA    . ASN B 2 375 ? 36.014 46.876  -12.181 1.00 64.59  ? 363  ASN B CA    1 
ATOM   6732 C  C     . ASN B 2 375 ? 34.555 46.789  -12.612 1.00 60.02  ? 363  ASN B C     1 
ATOM   6733 O  O     . ASN B 2 375 ? 33.661 46.695  -11.765 1.00 58.97  ? 363  ASN B O     1 
ATOM   6734 C  CB    . ASN B 2 375 ? 36.387 45.724  -11.242 1.00 62.78  ? 363  ASN B CB    1 
ATOM   6735 C  CG    . ASN B 2 375 ? 36.337 44.358  -11.920 1.00 60.99  ? 363  ASN B CG    1 
ATOM   6736 O  OD1   . ASN B 2 375 ? 35.614 44.148  -12.895 1.00 56.52  ? 363  ASN B OD1   1 
ATOM   6737 N  ND2   . ASN B 2 375 ? 37.106 43.415  -11.387 1.00 62.23  ? 363  ASN B ND2   1 
ATOM   6738 N  N     . ASP B 2 376 ? 34.320 46.810  -13.927 1.00 57.41  ? 364  ASP B N     1 
ATOM   6739 C  CA    . ASP B 2 376 ? 32.952 46.822  -14.437 1.00 55.60  ? 364  ASP B CA    1 
ATOM   6740 C  C     . ASP B 2 376 ? 32.214 45.533  -14.099 1.00 54.95  ? 364  ASP B C     1 
ATOM   6741 O  O     . ASP B 2 376 ? 31.038 45.567  -13.721 1.00 52.97  ? 364  ASP B O     1 
ATOM   6742 C  CB    . ASP B 2 376 ? 32.954 47.050  -15.949 1.00 57.25  ? 364  ASP B CB    1 
ATOM   6743 C  CG    . ASP B 2 376 ? 32.856 48.514  -16.317 1.00 57.83  ? 364  ASP B CG    1 
ATOM   6744 O  OD1   . ASP B 2 376 ? 32.789 49.358  -15.398 1.00 59.06  ? 364  ASP B OD1   1 
ATOM   6745 O  OD2   . ASP B 2 376 ? 32.839 48.818  -17.528 1.00 57.60  ? 364  ASP B OD2   1 
ATOM   6746 N  N     . VAL B 2 377 ? 32.880 44.385  -14.241 1.00 55.22  ? 365  VAL B N     1 
ATOM   6747 C  CA    . VAL B 2 377 ? 32.216 43.108  -13.996 1.00 51.70  ? 365  VAL B CA    1 
ATOM   6748 C  C     . VAL B 2 377 ? 31.825 42.979  -12.530 1.00 50.12  ? 365  VAL B C     1 
ATOM   6749 O  O     . VAL B 2 377 ? 30.711 42.550  -12.206 1.00 49.58  ? 365  VAL B O     1 
ATOM   6750 C  CB    . VAL B 2 377 ? 33.117 41.945  -14.444 1.00 54.20  ? 365  VAL B CB    1 
ATOM   6751 C  CG1   . VAL B 2 377 ? 32.407 40.619  -14.232 1.00 53.62  ? 365  VAL B CG1   1 
ATOM   6752 C  CG2   . VAL B 2 377 ? 33.518 42.120  -15.900 1.00 57.42  ? 365  VAL B CG2   1 
ATOM   6753 N  N     . LYS B 2 378 ? 32.733 43.342  -11.624 1.00 50.70  ? 366  LYS B N     1 
ATOM   6754 C  CA    . LYS B 2 378 ? 32.437 43.275  -10.197 1.00 49.34  ? 366  LYS B CA    1 
ATOM   6755 C  C     . LYS B 2 378 ? 31.272 44.189  -9.833  1.00 50.16  ? 366  LYS B C     1 
ATOM   6756 O  O     . LYS B 2 378 ? 30.350 43.783  -9.113  1.00 51.86  ? 366  LYS B O     1 
ATOM   6757 C  CB    . LYS B 2 378 ? 33.691 43.635  -9.399  1.00 50.79  ? 366  LYS B CB    1 
ATOM   6758 C  CG    . LYS B 2 378 ? 33.485 43.805  -7.907  1.00 50.62  ? 366  LYS B CG    1 
ATOM   6759 C  CD    . LYS B 2 378 ? 34.826 44.000  -7.213  1.00 54.47  ? 366  LYS B CD    1 
ATOM   6760 C  CE    . LYS B 2 378 ? 34.650 44.452  -5.778  1.00 57.99  ? 366  LYS B CE    1 
ATOM   6761 N  NZ    . LYS B 2 378 ? 33.947 45.763  -5.716  1.00 60.25  ? 366  LYS B NZ    1 
ATOM   6762 N  N     . GLN B 2 379 ? 31.300 45.432  -10.321 1.00 50.14  ? 367  GLN B N     1 
ATOM   6763 C  CA    . GLN B 2 379 ? 30.199 46.352  -10.055 1.00 49.39  ? 367  GLN B CA    1 
ATOM   6764 C  C     . GLN B 2 379 ? 28.890 45.820  -10.621 1.00 44.69  ? 367  GLN B C     1 
ATOM   6765 O  O     . GLN B 2 379 ? 27.831 45.980  -10.005 1.00 44.55  ? 367  GLN B O     1 
ATOM   6766 C  CB    . GLN B 2 379 ? 30.502 47.734  -10.634 1.00 51.60  ? 367  GLN B CB    1 
ATOM   6767 C  CG    . GLN B 2 379 ? 31.579 48.504  -9.899  1.00 55.29  ? 367  GLN B CG    1 
ATOM   6768 C  CD    . GLN B 2 379 ? 31.772 49.899  -10.461 1.00 58.69  ? 367  GLN B CD    1 
ATOM   6769 O  OE1   . GLN B 2 379 ? 31.128 50.281  -11.440 1.00 58.07  ? 367  GLN B OE1   1 
ATOM   6770 N  NE2   . GLN B 2 379 ? 32.661 50.670  -9.843  1.00 61.36  ? 367  GLN B NE2   1 
ATOM   6771 N  N     . LEU B 2 380 ? 28.942 45.174  -11.788 1.00 41.54  ? 368  LEU B N     1 
ATOM   6772 C  CA    . LEU B 2 380 ? 27.718 44.650  -12.384 1.00 42.31  ? 368  LEU B CA    1 
ATOM   6773 C  C     . LEU B 2 380 ? 27.154 43.496  -11.566 1.00 43.52  ? 368  LEU B C     1 
ATOM   6774 O  O     . LEU B 2 380 ? 25.937 43.409  -11.374 1.00 43.91  ? 368  LEU B O     1 
ATOM   6775 C  CB    . LEU B 2 380 ? 27.966 44.214  -13.826 1.00 46.34  ? 368  LEU B CB    1 
ATOM   6776 C  CG    . LEU B 2 380 ? 26.711 43.728  -14.558 1.00 46.25  ? 368  LEU B CG    1 
ATOM   6777 C  CD1   . LEU B 2 380 ? 25.606 44.775  -14.482 1.00 44.99  ? 368  LEU B CD1   1 
ATOM   6778 C  CD2   . LEU B 2 380 ? 27.025 43.382  -16.005 1.00 44.68  ? 368  LEU B CD2   1 
ATOM   6779 N  N     . THR B 2 381 ? 28.018 42.602  -11.071 1.00 44.32  ? 369  THR B N     1 
ATOM   6780 C  CA    . THR B 2 381 ? 27.525 41.514  -10.225 1.00 45.88  ? 369  THR B CA    1 
ATOM   6781 C  C     . THR B 2 381 ? 26.947 42.058  -8.926  1.00 47.65  ? 369  THR B C     1 
ATOM   6782 O  O     . THR B 2 381 ? 25.921 41.563  -8.438  1.00 48.86  ? 369  THR B O     1 
ATOM   6783 C  CB    . THR B 2 381 ? 28.629 40.497  -9.919  1.00 48.93  ? 369  THR B CB    1 
ATOM   6784 O  OG1   . THR B 2 381 ? 29.599 41.083  -9.043  1.00 60.14  ? 369  THR B OG1   1 
ATOM   6785 C  CG2   . THR B 2 381 ? 29.314 40.032  -11.185 1.00 42.58  ? 369  THR B CG2   1 
ATOM   6786 N  N     . GLU B 2 382 ? 27.589 43.081  -8.353  1.00 49.06  ? 370  GLU B N     1 
ATOM   6787 C  CA    . GLU B 2 382 ? 27.055 43.695  -7.142  1.00 52.87  ? 370  GLU B CA    1 
ATOM   6788 C  C     . GLU B 2 382 ? 25.698 44.339  -7.403  1.00 52.12  ? 370  GLU B C     1 
ATOM   6789 O  O     . GLU B 2 382 ? 24.776 44.216  -6.587  1.00 55.08  ? 370  GLU B O     1 
ATOM   6790 C  CB    . GLU B 2 382 ? 28.048 44.720  -6.595  1.00 57.66  ? 370  GLU B CB    1 
ATOM   6791 C  CG    . GLU B 2 382 ? 29.343 44.103  -6.090  1.00 62.86  ? 370  GLU B CG    1 
ATOM   6792 C  CD    . GLU B 2 382 ? 30.399 45.140  -5.756  1.00 68.70  ? 370  GLU B CD    1 
ATOM   6793 O  OE1   . GLU B 2 382 ? 30.179 46.335  -6.050  1.00 69.87  ? 370  GLU B OE1   1 
ATOM   6794 O  OE2   . GLU B 2 382 ? 31.451 44.757  -5.199  1.00 70.67  ? 370  GLU B OE2   1 
ATOM   6795 N  N     . ALA B 2 383 ? 25.551 45.019  -8.543  1.00 49.52  ? 371  ALA B N     1 
ATOM   6796 C  CA    . ALA B 2 383 ? 24.266 45.619  -8.886  1.00 48.55  ? 371  ALA B CA    1 
ATOM   6797 C  C     . ALA B 2 383 ? 23.200 44.552  -9.099  1.00 46.43  ? 371  ALA B C     1 
ATOM   6798 O  O     . ALA B 2 383 ? 22.043 44.733  -8.702  1.00 42.36  ? 371  ALA B O     1 
ATOM   6799 C  CB    . ALA B 2 383 ? 24.409 46.491  -10.134 1.00 46.79  ? 371  ALA B CB    1 
ATOM   6800 N  N     . VAL B 2 384 ? 23.574 43.432  -9.729  1.00 44.62  ? 372  VAL B N     1 
ATOM   6801 C  CA    . VAL B 2 384 ? 22.639 42.325  -9.917  1.00 45.95  ? 372  VAL B CA    1 
ATOM   6802 C  C     . VAL B 2 384 ? 22.172 41.787  -8.572  1.00 46.53  ? 372  VAL B C     1 
ATOM   6803 O  O     . VAL B 2 384 ? 20.979 41.527  -8.371  1.00 48.39  ? 372  VAL B O     1 
ATOM   6804 C  CB    . VAL B 2 384 ? 23.281 41.217  -10.775 1.00 46.14  ? 372  VAL B CB    1 
ATOM   6805 C  CG1   . VAL B 2 384 ? 22.469 39.934  -10.677 1.00 45.35  ? 372  VAL B CG1   1 
ATOM   6806 C  CG2   . VAL B 2 384 ? 23.397 41.660  -12.228 1.00 41.16  ? 372  VAL B CG2   1 
ATOM   6807 N  N     . GLN B 2 385 ? 23.100 41.621  -7.627  1.00 48.63  ? 373  GLN B N     1 
ATOM   6808 C  CA    . GLN B 2 385 ? 22.719 41.106  -6.314  1.00 51.46  ? 373  GLN B CA    1 
ATOM   6809 C  C     . GLN B 2 385 ? 21.836 42.097  -5.562  1.00 55.65  ? 373  GLN B C     1 
ATOM   6810 O  O     . GLN B 2 385 ? 20.880 41.695  -4.888  1.00 59.50  ? 373  GLN B O     1 
ATOM   6811 C  CB    . GLN B 2 385 ? 23.966 40.759  -5.501  1.00 51.68  ? 373  GLN B CB    1 
ATOM   6812 C  CG    . GLN B 2 385 ? 24.796 39.637  -6.107  1.00 51.59  ? 373  GLN B CG    1 
ATOM   6813 C  CD    . GLN B 2 385 ? 26.058 39.339  -5.318  1.00 53.21  ? 373  GLN B CD    1 
ATOM   6814 O  OE1   . GLN B 2 385 ? 25.997 38.889  -4.173  1.00 55.60  ? 373  GLN B OE1   1 
ATOM   6815 N  NE2   . GLN B 2 385 ? 27.211 39.590  -5.929  1.00 51.33  ? 373  GLN B NE2   1 
ATOM   6816 N  N     . LYS B 2 386 ? 22.129 43.395  -5.673  1.00 54.99  ? 374  LYS B N     1 
ATOM   6817 C  CA    . LYS B 2 386 ? 21.284 44.400  -5.031  1.00 56.62  ? 374  LYS B CA    1 
ATOM   6818 C  C     . LYS B 2 386 ? 19.872 44.386  -5.608  1.00 52.33  ? 374  LYS B C     1 
ATOM   6819 O  O     . LYS B 2 386 ? 18.880 44.405  -4.865  1.00 52.62  ? 374  LYS B O     1 
ATOM   6820 C  CB    . LYS B 2 386 ? 21.909 45.788  -5.181  1.00 61.35  ? 374  LYS B CB    1 
ATOM   6821 C  CG    . LYS B 2 386 ? 20.899 46.925  -5.071  1.00 66.35  ? 374  LYS B CG    1 
ATOM   6822 C  CD    . LYS B 2 386 ? 21.537 48.281  -5.326  1.00 70.72  ? 374  LYS B CD    1 
ATOM   6823 C  CE    . LYS B 2 386 ? 20.486 49.380  -5.343  1.00 73.94  ? 374  LYS B CE    1 
ATOM   6824 N  NZ    . LYS B 2 386 ? 21.090 50.737  -5.258  1.00 76.34  ? 374  LYS B NZ    1 
ATOM   6825 N  N     . ILE B 2 387 ? 19.764 44.368  -6.941  1.00 47.99  ? 375  ILE B N     1 
ATOM   6826 C  CA    . ILE B 2 387 ? 18.456 44.344  -7.590  1.00 48.51  ? 375  ILE B CA    1 
ATOM   6827 C  C     . ILE B 2 387 ? 17.691 43.089  -7.200  1.00 52.26  ? 375  ILE B C     1 
ATOM   6828 O  O     . ILE B 2 387 ? 16.481 43.135  -6.942  1.00 55.89  ? 375  ILE B O     1 
ATOM   6829 C  CB    . ILE B 2 387 ? 18.617 44.451  -9.117  1.00 46.96  ? 375  ILE B CB    1 
ATOM   6830 C  CG1   . ILE B 2 387 ? 19.206 45.809  -9.497  1.00 49.45  ? 375  ILE B CG1   1 
ATOM   6831 C  CG2   . ILE B 2 387 ? 17.283 44.234  -9.811  1.00 46.48  ? 375  ILE B CG2   1 
ATOM   6832 C  CD1   . ILE B 2 387 ? 19.765 45.847  -10.892 1.00 48.31  ? 375  ILE B CD1   1 
ATOM   6833 N  N     . THR B 2 388 ? 18.382 41.949  -7.141  1.00 50.37  ? 376  THR B N     1 
ATOM   6834 C  CA    . THR B 2 388 ? 17.715 40.708  -6.772  1.00 50.35  ? 376  THR B CA    1 
ATOM   6835 C  C     . THR B 2 388 ? 17.238 40.750  -5.327  1.00 53.97  ? 376  THR B C     1 
ATOM   6836 O  O     . THR B 2 388 ? 16.142 40.271  -5.020  1.00 56.50  ? 376  THR B O     1 
ATOM   6837 C  CB    . THR B 2 388 ? 18.650 39.521  -6.995  1.00 50.66  ? 376  THR B CB    1 
ATOM   6838 O  OG1   . THR B 2 388 ? 19.160 39.563  -8.333  1.00 49.22  ? 376  THR B OG1   1 
ATOM   6839 C  CG2   . THR B 2 388 ? 17.902 38.216  -6.789  1.00 51.42  ? 376  THR B CG2   1 
ATOM   6840 N  N     . THR B 2 389 ? 18.045 41.317  -4.427  1.00 55.54  ? 377  THR B N     1 
ATOM   6841 C  CA    . THR B 2 389 ? 17.620 41.447  -3.037  1.00 56.80  ? 377  THR B CA    1 
ATOM   6842 C  C     . THR B 2 389 ? 16.377 42.319  -2.926  1.00 59.64  ? 377  THR B C     1 
ATOM   6843 O  O     . THR B 2 389 ? 15.428 41.976  -2.208  1.00 64.98  ? 377  THR B O     1 
ATOM   6844 C  CB    . THR B 2 389 ? 18.757 42.022  -2.193  1.00 55.88  ? 377  THR B CB    1 
ATOM   6845 O  OG1   . THR B 2 389 ? 19.903 41.167  -2.292  1.00 56.65  ? 377  THR B OG1   1 
ATOM   6846 C  CG2   . THR B 2 389 ? 18.340 42.132  -0.739  1.00 57.69  ? 377  THR B CG2   1 
ATOM   6847 N  N     . GLU B 2 390 ? 16.362 43.449  -3.638  1.00 59.94  ? 378  GLU B N     1 
ATOM   6848 C  CA    . GLU B 2 390 ? 15.173 44.298  -3.646  1.00 61.88  ? 378  GLU B CA    1 
ATOM   6849 C  C     . GLU B 2 390 ? 13.961 43.548  -4.187  1.00 58.52  ? 378  GLU B C     1 
ATOM   6850 O  O     . GLU B 2 390 ? 12.863 43.642  -3.628  1.00 59.60  ? 378  GLU B O     1 
ATOM   6851 C  CB    . GLU B 2 390 ? 15.430 45.560  -4.470  1.00 65.06  ? 378  GLU B CB    1 
ATOM   6852 C  CG    . GLU B 2 390 ? 16.432 46.520  -3.854  1.00 72.96  ? 378  GLU B CG    1 
ATOM   6853 C  CD    . GLU B 2 390 ? 16.686 47.736  -4.726  1.00 78.64  ? 378  GLU B CD    1 
ATOM   6854 O  OE1   . GLU B 2 390 ? 16.122 47.805  -5.840  1.00 77.96  ? 378  GLU B OE1   1 
ATOM   6855 O  OE2   . GLU B 2 390 ? 17.452 48.624  -4.296  1.00 82.65  ? 378  GLU B OE2   1 
ATOM   6856 N  N     . SER B 2 391 ? 14.143 42.796  -5.275  1.00 55.87  ? 379  SER B N     1 
ATOM   6857 C  CA    . SER B 2 391 ? 13.027 42.079  -5.882  1.00 57.63  ? 379  SER B CA    1 
ATOM   6858 C  C     . SER B 2 391 ? 12.493 40.994  -4.953  1.00 60.73  ? 379  SER B C     1 
ATOM   6859 O  O     . SER B 2 391 ? 11.280 40.768  -4.886  1.00 64.12  ? 379  SER B O     1 
ATOM   6860 C  CB    . SER B 2 391 ? 13.461 41.484  -7.221  1.00 59.02  ? 379  SER B CB    1 
ATOM   6861 O  OG    . SER B 2 391 ? 12.410 40.753  -7.826  1.00 62.52  ? 379  SER B OG    1 
ATOM   6862 N  N     . ILE B 2 392 ? 13.384 40.316  -4.228  1.00 59.45  ? 380  ILE B N     1 
ATOM   6863 C  CA    . ILE B 2 392 ? 12.954 39.315  -3.258  1.00 58.23  ? 380  ILE B CA    1 
ATOM   6864 C  C     . ILE B 2 392 ? 12.184 39.973  -2.121  1.00 63.42  ? 380  ILE B C     1 
ATOM   6865 O  O     . ILE B 2 392 ? 11.147 39.464  -1.677  1.00 67.82  ? 380  ILE B O     1 
ATOM   6866 C  CB    . ILE B 2 392 ? 14.165 38.523  -2.732  1.00 56.04  ? 380  ILE B CB    1 
ATOM   6867 C  CG1   . ILE B 2 392 ? 14.790 37.685  -3.849  1.00 52.41  ? 380  ILE B CG1   1 
ATOM   6868 C  CG2   . ILE B 2 392 ? 13.762 37.637  -1.561  1.00 57.40  ? 380  ILE B CG2   1 
ATOM   6869 C  CD1   . ILE B 2 392 ? 16.130 37.086  -3.478  1.00 50.75  ? 380  ILE B CD1   1 
ATOM   6870 N  N     . VAL B 2 393 ? 12.675 41.112  -1.628  1.00 62.90  ? 381  VAL B N     1 
ATOM   6871 C  CA    . VAL B 2 393 ? 12.002 41.781  -0.520  1.00 65.22  ? 381  VAL B CA    1 
ATOM   6872 C  C     . VAL B 2 393 ? 10.624 42.278  -0.945  1.00 64.97  ? 381  VAL B C     1 
ATOM   6873 O  O     . VAL B 2 393 ? 9.658  42.199  -0.177  1.00 70.07  ? 381  VAL B O     1 
ATOM   6874 C  CB    . VAL B 2 393 ? 12.882 42.920  0.025   1.00 67.92  ? 381  VAL B CB    1 
ATOM   6875 C  CG1   . VAL B 2 393 ? 12.081 43.834  0.939   1.00 71.70  ? 381  VAL B CG1   1 
ATOM   6876 C  CG2   . VAL B 2 393 ? 14.078 42.347  0.771   1.00 68.98  ? 381  VAL B CG2   1 
ATOM   6877 N  N     . ILE B 2 394 ? 10.497 42.769  -2.178  1.00 61.32  ? 382  ILE B N     1 
ATOM   6878 C  CA    . ILE B 2 394 ? 9.238  43.382  -2.593  1.00 62.84  ? 382  ILE B CA    1 
ATOM   6879 C  C     . ILE B 2 394 ? 8.232  42.327  -3.045  1.00 64.83  ? 382  ILE B C     1 
ATOM   6880 O  O     . ILE B 2 394 ? 7.099  42.286  -2.554  1.00 68.83  ? 382  ILE B O     1 
ATOM   6881 C  CB    . ILE B 2 394 ? 9.483  44.433  -3.691  1.00 57.41  ? 382  ILE B CB    1 
ATOM   6882 C  CG1   . ILE B 2 394 ? 10.418 45.530  -3.182  1.00 56.20  ? 382  ILE B CG1   1 
ATOM   6883 C  CG2   . ILE B 2 394 ? 8.165  45.048  -4.132  1.00 56.52  ? 382  ILE B CG2   1 
ATOM   6884 C  CD1   . ILE B 2 394 ? 10.935 46.442  -4.277  1.00 53.10  ? 382  ILE B CD1   1 
ATOM   6885 N  N     . TRP B 2 395 ? 8.618  41.464  -3.986  1.00 63.97  ? 383  TRP B N     1 
ATOM   6886 C  CA    . TRP B 2 395 ? 7.686  40.535  -4.613  1.00 65.24  ? 383  TRP B CA    1 
ATOM   6887 C  C     . TRP B 2 395 ? 7.948  39.075  -4.268  1.00 69.83  ? 383  TRP B C     1 
ATOM   6888 O  O     . TRP B 2 395 ? 7.181  38.207  -4.698  1.00 73.14  ? 383  TRP B O     1 
ATOM   6889 C  CB    . TRP B 2 395 ? 7.713  40.710  -6.136  1.00 60.51  ? 383  TRP B CB    1 
ATOM   6890 C  CG    . TRP B 2 395 ? 7.371  42.096  -6.575  1.00 60.82  ? 383  TRP B CG    1 
ATOM   6891 C  CD1   . TRP B 2 395 ? 6.145  42.692  -6.526  1.00 62.38  ? 383  TRP B CD1   1 
ATOM   6892 C  CD2   . TRP B 2 395 ? 8.266  43.066  -7.133  1.00 57.71  ? 383  TRP B CD2   1 
ATOM   6893 N  NE1   . TRP B 2 395 ? 6.220  43.972  -7.015  1.00 61.86  ? 383  TRP B NE1   1 
ATOM   6894 C  CE2   . TRP B 2 395 ? 7.511  44.227  -7.396  1.00 58.71  ? 383  TRP B CE2   1 
ATOM   6895 C  CE3   . TRP B 2 395 ? 9.632  43.066  -7.434  1.00 54.64  ? 383  TRP B CE3   1 
ATOM   6896 C  CZ2   . TRP B 2 395 ? 8.076  45.377  -7.944  1.00 56.08  ? 383  TRP B CZ2   1 
ATOM   6897 C  CZ3   . TRP B 2 395 ? 10.191 44.208  -7.981  1.00 54.49  ? 383  TRP B CZ3   1 
ATOM   6898 C  CH2   . TRP B 2 395 ? 9.413  45.348  -8.230  1.00 54.68  ? 383  TRP B CH2   1 
ATOM   6899 N  N     . GLY B 2 396 ? 9.000  38.776  -3.511  1.00 70.15  ? 384  GLY B N     1 
ATOM   6900 C  CA    . GLY B 2 396 ? 9.280  37.398  -3.153  1.00 71.87  ? 384  GLY B CA    1 
ATOM   6901 C  C     . GLY B 2 396 ? 9.698  36.524  -4.313  1.00 67.36  ? 384  GLY B C     1 
ATOM   6902 O  O     . GLY B 2 396 ? 9.502  35.306  -4.267  1.00 67.56  ? 384  GLY B O     1 
ATOM   6903 N  N     . LYS B 2 397 ? 10.270 37.115  -5.357  1.00 64.51  ? 385  LYS B N     1 
ATOM   6904 C  CA    . LYS B 2 397 ? 10.698 36.370  -6.530  1.00 65.03  ? 385  LYS B CA    1 
ATOM   6905 C  C     . LYS B 2 397 ? 11.897 37.080  -7.139  1.00 62.07  ? 385  LYS B C     1 
ATOM   6906 O  O     . LYS B 2 397 ? 12.047 38.298  -7.002  1.00 60.99  ? 385  LYS B O     1 
ATOM   6907 C  CB    . LYS B 2 397 ? 9.556  36.242  -7.547  1.00 67.47  ? 385  LYS B CB    1 
ATOM   6908 C  CG    . LYS B 2 397 ? 9.849  35.332  -8.726  1.00 68.94  ? 385  LYS B CG    1 
ATOM   6909 C  CD    . LYS B 2 397 ? 8.591  35.065  -9.535  1.00 73.35  ? 385  LYS B CD    1 
ATOM   6910 C  CE    . LYS B 2 397 ? 8.014  36.349  -10.109 1.00 73.73  ? 385  LYS B CE    1 
ATOM   6911 N  NZ    . LYS B 2 397 ? 6.703  36.114  -10.777 1.00 75.81  ? 385  LYS B NZ    1 
ATOM   6912 N  N     . THR B 2 398 ? 12.775 36.294  -7.813  1.00 58.70  ? 386  THR B N     1 
ATOM   6913 C  CA    . THR B 2 398 ? 13.930 36.925  -8.430  1.00 51.96  ? 386  THR B CA    1 
ATOM   6914 C  C     . THR B 2 398 ? 13.658 37.211  -9.902  1.00 49.33  ? 386  THR B C     1 
ATOM   6915 O  O     . THR B 2 398 ? 12.924 36.469  -10.562 1.00 50.36  ? 386  THR B O     1 
ATOM   6916 C  CB    . THR B 2 398 ? 15.175 36.039  -8.308  1.00 51.17  ? 386  THR B CB    1 
ATOM   6917 O  OG1   . THR B 2 398 ? 15.026 34.877  -9.133  1.00 52.17  ? 386  THR B OG1   1 
ATOM   6918 C  CG2   . THR B 2 398 ? 15.376 35.606  -6.866  1.00 52.85  ? 386  THR B CG2   1 
ATOM   6919 N  N     . PRO B 2 399 ? 14.221 38.289  -10.439 1.00 46.58  ? 387  PRO B N     1 
ATOM   6920 C  CA    . PRO B 2 399 ? 13.992 38.631  -11.843 1.00 43.34  ? 387  PRO B CA    1 
ATOM   6921 C  C     . PRO B 2 399 ? 14.967 37.938  -12.787 1.00 44.39  ? 387  PRO B C     1 
ATOM   6922 O  O     . PRO B 2 399 ? 16.033 37.460  -12.395 1.00 49.64  ? 387  PRO B O     1 
ATOM   6923 C  CB    . PRO B 2 399 ? 14.214 40.150  -11.861 1.00 38.62  ? 387  PRO B CB    1 
ATOM   6924 C  CG    . PRO B 2 399 ? 15.241 40.367  -10.813 1.00 39.05  ? 387  PRO B CG    1 
ATOM   6925 C  CD    . PRO B 2 399 ? 14.964 39.346  -9.729  1.00 43.68  ? 387  PRO B CD    1 
ATOM   6926 N  N     . LYS B 2 400 ? 14.567 37.888  -14.057 1.00 42.49  ? 388  LYS B N     1 
ATOM   6927 C  CA    . LYS B 2 400 ? 15.456 37.491  -15.140 1.00 43.83  ? 388  LYS B CA    1 
ATOM   6928 C  C     . LYS B 2 400 ? 16.171 38.731  -15.665 1.00 45.21  ? 388  LYS B C     1 
ATOM   6929 O  O     . LYS B 2 400 ? 15.528 39.727  -16.013 1.00 45.45  ? 388  LYS B O     1 
ATOM   6930 C  CB    . LYS B 2 400 ? 14.678 36.803  -16.263 1.00 41.12  ? 388  LYS B CB    1 
ATOM   6931 N  N     . PHE B 2 401 ? 17.497 38.672  -15.709 1.00 44.40  ? 389  PHE B N     1 
ATOM   6932 C  CA    . PHE B 2 401 ? 18.317 39.835  -16.018 1.00 44.23  ? 389  PHE B CA    1 
ATOM   6933 C  C     . PHE B 2 401 ? 18.712 39.861  -17.488 1.00 47.78  ? 389  PHE B C     1 
ATOM   6934 O  O     . PHE B 2 401 ? 19.088 38.836  -18.065 1.00 50.06  ? 389  PHE B O     1 
ATOM   6935 C  CB    . PHE B 2 401 ? 19.578 39.854  -15.153 1.00 42.87  ? 389  PHE B CB    1 
ATOM   6936 C  CG    . PHE B 2 401 ? 19.338 40.295  -13.740 1.00 44.50  ? 389  PHE B CG    1 
ATOM   6937 C  CD1   . PHE B 2 401 ? 19.408 41.638  -13.398 1.00 43.66  ? 389  PHE B CD1   1 
ATOM   6938 C  CD2   . PHE B 2 401 ? 19.048 39.370  -12.751 1.00 44.83  ? 389  PHE B CD2   1 
ATOM   6939 C  CE1   . PHE B 2 401 ? 19.189 42.051  -12.095 1.00 42.11  ? 389  PHE B CE1   1 
ATOM   6940 C  CE2   . PHE B 2 401 ? 18.829 39.775  -11.447 1.00 45.20  ? 389  PHE B CE2   1 
ATOM   6941 C  CZ    . PHE B 2 401 ? 18.901 41.119  -11.119 1.00 44.34  ? 389  PHE B CZ    1 
ATOM   6942 N  N     . LYS B 2 402 ? 18.628 41.045  -18.086 1.00 49.07  ? 390  LYS B N     1 
ATOM   6943 C  CA    . LYS B 2 402 ? 19.214 41.317  -19.396 1.00 49.81  ? 390  LYS B CA    1 
ATOM   6944 C  C     . LYS B 2 402 ? 20.519 42.064  -19.139 1.00 48.87  ? 390  LYS B C     1 
ATOM   6945 O  O     . LYS B 2 402 ? 20.514 43.265  -18.858 1.00 50.65  ? 390  LYS B O     1 
ATOM   6946 C  CB    . LYS B 2 402 ? 18.254 42.115  -20.270 1.00 50.98  ? 390  LYS B CB    1 
ATOM   6947 C  CG    . LYS B 2 402 ? 16.977 41.369  -20.609 1.00 53.55  ? 390  LYS B CG    1 
ATOM   6948 C  CD    . LYS B 2 402 ? 16.140 42.125  -21.623 1.00 55.98  ? 390  LYS B CD    1 
ATOM   6949 C  CE    . LYS B 2 402 ? 14.920 41.317  -22.027 1.00 58.85  ? 390  LYS B CE    1 
ATOM   6950 N  NZ    . LYS B 2 402 ? 14.116 42.012  -23.067 1.00 62.50  ? 390  LYS B NZ    1 
ATOM   6951 N  N     . LEU B 2 403 ? 21.644 41.342  -19.224 1.00 47.13  ? 391  LEU B N     1 
ATOM   6952 C  CA    . LEU B 2 403 ? 22.925 41.880  -18.773 1.00 45.26  ? 391  LEU B CA    1 
ATOM   6953 C  C     . LEU B 2 403 ? 23.670 42.535  -19.929 1.00 47.55  ? 391  LEU B C     1 
ATOM   6954 O  O     . LEU B 2 403 ? 23.879 41.893  -20.966 1.00 51.54  ? 391  LEU B O     1 
ATOM   6955 C  CB    . LEU B 2 403 ? 23.787 40.783  -18.166 1.00 42.45  ? 391  LEU B CB    1 
ATOM   6956 C  CG    . LEU B 2 403 ? 23.206 40.093  -16.932 1.00 41.31  ? 391  LEU B CG    1 
ATOM   6957 C  CD1   . LEU B 2 403 ? 24.142 39.008  -16.430 1.00 42.42  ? 391  LEU B CD1   1 
ATOM   6958 C  CD2   . LEU B 2 403 ? 22.920 41.109  -15.838 1.00 39.44  ? 391  LEU B CD2   1 
ATOM   6959 N  N     . PRO B 2 404 ? 24.091 43.793  -19.783 1.00 47.17  ? 392  PRO B N     1 
ATOM   6960 C  CA    . PRO B 2 404 ? 24.864 44.483  -20.837 1.00 48.58  ? 392  PRO B CA    1 
ATOM   6961 C  C     . PRO B 2 404 ? 26.346 44.134  -20.777 1.00 53.54  ? 392  PRO B C     1 
ATOM   6962 O  O     . PRO B 2 404 ? 27.210 44.937  -20.404 1.00 56.59  ? 392  PRO B O     1 
ATOM   6963 C  CB    . PRO B 2 404 ? 24.591 45.956  -20.524 1.00 46.55  ? 392  PRO B CB    1 
ATOM   6964 C  CG    . PRO B 2 404 ? 24.484 45.979  -19.033 1.00 45.39  ? 392  PRO B CG    1 
ATOM   6965 C  CD    . PRO B 2 404 ? 23.807 44.681  -18.642 1.00 46.22  ? 392  PRO B CD    1 
ATOM   6966 N  N     . ILE B 2 405 ? 26.667 42.899  -21.158 1.00 54.14  ? 393  ILE B N     1 
ATOM   6967 C  CA    . ILE B 2 405 ? 28.032 42.397  -21.064 1.00 53.90  ? 393  ILE B CA    1 
ATOM   6968 C  C     . ILE B 2 405 ? 28.151 41.201  -21.993 1.00 56.36  ? 393  ILE B C     1 
ATOM   6969 O  O     . ILE B 2 405 ? 27.168 40.503  -22.256 1.00 58.19  ? 393  ILE B O     1 
ATOM   6970 C  CB    . ILE B 2 405 ? 28.390 42.037  -19.599 1.00 52.06  ? 393  ILE B CB    1 
ATOM   6971 C  CG1   . ILE B 2 405 ? 29.834 41.540  -19.488 1.00 53.40  ? 393  ILE B CG1   1 
ATOM   6972 C  CG2   . ILE B 2 405 ? 27.409 41.011  -19.046 1.00 49.11  ? 393  ILE B CG2   1 
ATOM   6973 C  CD1   . ILE B 2 405 ? 30.281 41.274  -18.069 1.00 52.27  ? 393  ILE B CD1   1 
ATOM   6974 N  N     . GLN B 2 406 ? 29.357 40.979  -22.511 1.00 59.02  ? 394  GLN B N     1 
ATOM   6975 C  CA    . GLN B 2 406 ? 29.611 39.794  -23.318 1.00 59.96  ? 394  GLN B CA    1 
ATOM   6976 C  C     . GLN B 2 406 ? 29.453 38.541  -22.466 1.00 58.04  ? 394  GLN B C     1 
ATOM   6977 O  O     . GLN B 2 406 ? 29.840 38.513  -21.294 1.00 55.49  ? 394  GLN B O     1 
ATOM   6978 C  CB    . GLN B 2 406 ? 31.014 39.850  -23.926 1.00 64.87  ? 394  GLN B CB    1 
ATOM   6979 C  CG    . GLN B 2 406 ? 31.282 38.768  -24.965 1.00 72.39  ? 394  GLN B CG    1 
ATOM   6980 C  CD    . GLN B 2 406 ? 32.707 38.796  -25.491 1.00 79.58  ? 394  GLN B CD    1 
ATOM   6981 O  OE1   . GLN B 2 406 ? 33.667 38.703  -24.725 1.00 80.69  ? 394  GLN B OE1   1 
ATOM   6982 N  NE2   . GLN B 2 406 ? 32.849 38.927  -26.806 1.00 83.50  ? 394  GLN B NE2   1 
ATOM   6983 N  N     . LYS B 2 407 ? 28.868 37.503  -23.067 1.00 61.91  ? 395  LYS B N     1 
ATOM   6984 C  CA    . LYS B 2 407 ? 28.617 36.256  -22.349 1.00 62.10  ? 395  LYS B CA    1 
ATOM   6985 C  C     . LYS B 2 407 ? 29.897 35.698  -21.734 1.00 62.17  ? 395  LYS B C     1 
ATOM   6986 O  O     . LYS B 2 407 ? 29.915 35.309  -20.560 1.00 57.63  ? 395  LYS B O     1 
ATOM   6987 C  CB    . LYS B 2 407 ? 27.982 35.239  -23.300 1.00 66.19  ? 395  LYS B CB    1 
ATOM   6988 C  CG    . LYS B 2 407 ? 27.740 33.868  -22.699 1.00 68.35  ? 395  LYS B CG    1 
ATOM   6989 C  CD    . LYS B 2 407 ? 27.242 32.900  -23.759 1.00 74.92  ? 395  LYS B CD    1 
ATOM   6990 C  CE    . LYS B 2 407 ? 26.745 31.605  -23.141 1.00 78.49  ? 395  LYS B CE    1 
ATOM   6991 N  NZ    . LYS B 2 407 ? 27.814 30.887  -22.399 1.00 81.52  ? 395  LYS B NZ    1 
ATOM   6992 N  N     . GLU B 2 408 ? 30.985 35.669  -22.508 1.00 68.78  ? 396  GLU B N     1 
ATOM   6993 C  CA    . GLU B 2 408 ? 32.208 35.029  -22.032 1.00 73.66  ? 396  GLU B CA    1 
ATOM   6994 C  C     . GLU B 2 408 ? 32.834 35.802  -20.876 1.00 71.71  ? 396  GLU B C     1 
ATOM   6995 O  O     . GLU B 2 408 ? 33.305 35.196  -19.910 1.00 70.79  ? 396  GLU B O     1 
ATOM   6996 C  CB    . GLU B 2 408 ? 33.214 34.870  -23.174 1.00 81.84  ? 396  GLU B CB    1 
ATOM   6997 C  CG    . GLU B 2 408 ? 32.738 35.347  -24.537 1.00 88.15  ? 396  GLU B CG    1 
ATOM   6998 C  CD    . GLU B 2 408 ? 31.679 34.448  -25.146 1.00 92.51  ? 396  GLU B CD    1 
ATOM   6999 O  OE1   . GLU B 2 408 ? 30.514 34.887  -25.235 1.00 92.70  ? 396  GLU B OE1   1 
ATOM   7000 O  OE2   . GLU B 2 408 ? 32.010 33.308  -25.531 1.00 96.53  ? 396  GLU B OE2   1 
ATOM   7001 N  N     . THR B 2 409 ? 32.850 37.135  -20.955 1.00 70.68  ? 397  THR B N     1 
ATOM   7002 C  CA    . THR B 2 409 ? 33.381 37.943  -19.857 1.00 70.82  ? 397  THR B CA    1 
ATOM   7003 C  C     . THR B 2 409 ? 32.653 37.640  -18.553 1.00 66.68  ? 397  THR B C     1 
ATOM   7004 O  O     . THR B 2 409 ? 33.276 37.371  -17.511 1.00 67.27  ? 397  THR B O     1 
ATOM   7005 C  CB    . THR B 2 409 ? 33.248 39.430  -20.195 1.00 72.63  ? 397  THR B CB    1 
ATOM   7006 O  OG1   . THR B 2 409 ? 33.788 39.687  -21.497 1.00 76.70  ? 397  THR B OG1   1 
ATOM   7007 C  CG2   . THR B 2 409 ? 33.971 40.283  -19.163 1.00 71.20  ? 397  THR B CG2   1 
ATOM   7008 N  N     . TRP B 2 410 ? 31.322 37.691  -18.599 1.00 61.35  ? 398  TRP B N     1 
ATOM   7009 C  CA    . TRP B 2 410 ? 30.517 37.443  -17.413 1.00 57.15  ? 398  TRP B CA    1 
ATOM   7010 C  C     . TRP B 2 410 ? 30.755 36.040  -16.877 1.00 59.91  ? 398  TRP B C     1 
ATOM   7011 O  O     . TRP B 2 410 ? 31.039 35.856  -15.691 1.00 60.72  ? 398  TRP B O     1 
ATOM   7012 C  CB    . TRP B 2 410 ? 29.041 37.658  -17.741 1.00 52.28  ? 398  TRP B CB    1 
ATOM   7013 C  CG    . TRP B 2 410 ? 28.126 37.339  -16.617 1.00 49.03  ? 398  TRP B CG    1 
ATOM   7014 C  CD1   . TRP B 2 410 ? 27.482 36.159  -16.395 1.00 48.12  ? 398  TRP B CD1   1 
ATOM   7015 C  CD2   . TRP B 2 410 ? 27.740 38.214  -15.554 1.00 47.67  ? 398  TRP B CD2   1 
ATOM   7016 N  NE1   . TRP B 2 410 ? 26.719 36.244  -15.257 1.00 46.42  ? 398  TRP B NE1   1 
ATOM   7017 C  CE2   . TRP B 2 410 ? 26.860 37.497  -14.721 1.00 46.81  ? 398  TRP B CE2   1 
ATOM   7018 C  CE3   . TRP B 2 410 ? 28.053 39.537  -15.226 1.00 47.46  ? 398  TRP B CE3   1 
ATOM   7019 C  CZ2   . TRP B 2 410 ? 26.288 38.056  -13.580 1.00 46.46  ? 398  TRP B CZ2   1 
ATOM   7020 C  CZ3   . TRP B 2 410 ? 27.484 40.092  -14.094 1.00 46.00  ? 398  TRP B CZ3   1 
ATOM   7021 C  CH2   . TRP B 2 410 ? 26.612 39.352  -13.284 1.00 45.76  ? 398  TRP B CH2   1 
ATOM   7022 N  N     . GLU B 2 411 ? 30.656 35.028  -17.740 1.00 62.10  ? 399  GLU B N     1 
ATOM   7023 C  CA    . GLU B 2 411 ? 30.818 33.665  -17.252 1.00 65.92  ? 399  GLU B CA    1 
ATOM   7024 C  C     . GLU B 2 411 ? 32.246 33.378  -16.807 1.00 65.17  ? 399  GLU B C     1 
ATOM   7025 O  O     . GLU B 2 411 ? 32.466 32.432  -16.044 1.00 65.00  ? 399  GLU B O     1 
ATOM   7026 C  CB    . GLU B 2 411 ? 30.368 32.669  -18.320 1.00 72.73  ? 399  GLU B CB    1 
ATOM   7027 C  CG    . GLU B 2 411 ? 28.947 32.926  -18.805 1.00 76.80  ? 399  GLU B CG    1 
ATOM   7028 C  CD    . GLU B 2 411 ? 28.248 31.675  -19.288 1.00 84.68  ? 399  GLU B CD    1 
ATOM   7029 O  OE1   . GLU B 2 411 ? 27.144 31.381  -18.779 1.00 86.06  ? 399  GLU B OE1   1 
ATOM   7030 O  OE2   . GLU B 2 411 ? 28.800 30.986  -20.171 1.00 89.25  ? 399  GLU B OE2   1 
ATOM   7031 N  N     . THR B 2 412 ? 33.215 34.187  -17.240 1.00 65.98  ? 400  THR B N     1 
ATOM   7032 C  CA    . THR B 2 412 ? 34.587 34.023  -16.780 1.00 70.38  ? 400  THR B CA    1 
ATOM   7033 C  C     . THR B 2 412 ? 34.791 34.621  -15.393 1.00 67.86  ? 400  THR B C     1 
ATOM   7034 O  O     . THR B 2 412 ? 35.516 34.047  -14.572 1.00 69.66  ? 400  THR B O     1 
ATOM   7035 C  CB    . THR B 2 412 ? 35.556 34.659  -17.784 1.00 76.37  ? 400  THR B CB    1 
ATOM   7036 O  OG1   . THR B 2 412 ? 35.500 33.948  -19.027 1.00 80.75  ? 400  THR B OG1   1 
ATOM   7037 C  CG2   . THR B 2 412 ? 36.988 34.633  -17.261 1.00 78.31  ? 400  THR B CG2   1 
ATOM   7038 N  N     . TRP B 2 413 ? 34.163 35.765  -15.099 1.00 63.64  ? 401  TRP B N     1 
ATOM   7039 C  CA    . TRP B 2 413 ? 34.513 36.479  -13.874 1.00 59.97  ? 401  TRP B CA    1 
ATOM   7040 C  C     . TRP B 2 413 ? 33.398 36.674  -12.850 1.00 57.64  ? 401  TRP B C     1 
ATOM   7041 O  O     . TRP B 2 413 ? 33.670 37.241  -11.785 1.00 58.45  ? 401  TRP B O     1 
ATOM   7042 C  CB    . TRP B 2 413 ? 35.106 37.852  -14.219 1.00 58.24  ? 401  TRP B CB    1 
ATOM   7043 C  CG    . TRP B 2 413 ? 36.525 37.766  -14.663 1.00 61.96  ? 401  TRP B CG    1 
ATOM   7044 C  CD1   . TRP B 2 413 ? 37.591 37.360  -13.916 1.00 65.45  ? 401  TRP B CD1   1 
ATOM   7045 C  CD2   . TRP B 2 413 ? 37.041 38.091  -15.957 1.00 65.20  ? 401  TRP B CD2   1 
ATOM   7046 N  NE1   . TRP B 2 413 ? 38.742 37.410  -14.665 1.00 68.69  ? 401  TRP B NE1   1 
ATOM   7047 C  CE2   . TRP B 2 413 ? 38.431 37.856  -15.923 1.00 70.03  ? 401  TRP B CE2   1 
ATOM   7048 C  CE3   . TRP B 2 413 ? 36.465 38.557  -17.141 1.00 67.06  ? 401  TRP B CE3   1 
ATOM   7049 C  CZ2   . TRP B 2 413 ? 39.252 38.071  -17.028 1.00 74.13  ? 401  TRP B CZ2   1 
ATOM   7050 C  CZ3   . TRP B 2 413 ? 37.283 38.773  -18.238 1.00 71.08  ? 401  TRP B CZ3   1 
ATOM   7051 C  CH2   . TRP B 2 413 ? 38.661 38.529  -18.173 1.00 74.02  ? 401  TRP B CH2   1 
ATOM   7052 N  N     . TRP B 2 414 ? 32.170 36.214  -13.100 1.00 56.63  ? 402  TRP B N     1 
ATOM   7053 C  CA    . TRP B 2 414 ? 31.082 36.582  -12.196 1.00 57.29  ? 402  TRP B CA    1 
ATOM   7054 C  C     . TRP B 2 414 ? 31.119 35.821  -10.875 1.00 59.49  ? 402  TRP B C     1 
ATOM   7055 O  O     . TRP B 2 414 ? 30.702 36.368  -9.847  1.00 58.38  ? 402  TRP B O     1 
ATOM   7056 C  CB    . TRP B 2 414 ? 29.725 36.390  -12.883 1.00 56.43  ? 402  TRP B CB    1 
ATOM   7057 C  CG    . TRP B 2 414 ? 29.236 34.969  -12.976 1.00 58.07  ? 402  TRP B CG    1 
ATOM   7058 C  CD1   . TRP B 2 414 ? 29.419 34.105  -14.015 1.00 59.55  ? 402  TRP B CD1   1 
ATOM   7059 C  CD2   . TRP B 2 414 ? 28.455 34.262  -12.002 1.00 58.03  ? 402  TRP B CD2   1 
ATOM   7060 N  NE1   . TRP B 2 414 ? 28.814 32.901  -13.747 1.00 61.77  ? 402  TRP B NE1   1 
ATOM   7061 C  CE2   . TRP B 2 414 ? 28.214 32.971  -12.518 1.00 60.18  ? 402  TRP B CE2   1 
ATOM   7062 C  CE3   . TRP B 2 414 ? 27.943 34.590  -10.743 1.00 54.83  ? 402  TRP B CE3   1 
ATOM   7063 C  CZ2   . TRP B 2 414 ? 27.484 32.010  -11.819 1.00 57.67  ? 402  TRP B CZ2   1 
ATOM   7064 C  CZ3   . TRP B 2 414 ? 27.219 33.634  -10.050 1.00 54.90  ? 402  TRP B CZ3   1 
ATOM   7065 C  CH2   . TRP B 2 414 ? 26.997 32.361  -10.590 1.00 56.12  ? 402  TRP B CH2   1 
ATOM   7066 N  N     . THR B 2 415 ? 31.611 34.578  -10.868 1.00 58.97  ? 403  THR B N     1 
ATOM   7067 C  CA    . THR B 2 415 ? 31.667 33.809  -9.628  1.00 57.46  ? 403  THR B CA    1 
ATOM   7068 C  C     . THR B 2 415 ? 32.703 34.341  -8.646  1.00 61.15  ? 403  THR B C     1 
ATOM   7069 O  O     . THR B 2 415 ? 32.672 33.953  -7.473  1.00 64.49  ? 403  THR B O     1 
ATOM   7070 C  CB    . THR B 2 415 ? 31.959 32.331  -9.914  1.00 55.46  ? 403  THR B CB    1 
ATOM   7071 O  OG1   . THR B 2 415 ? 33.115 32.215  -10.753 1.00 54.13  ? 403  THR B OG1   1 
ATOM   7072 C  CG2   . THR B 2 415 ? 30.771 31.666  -10.590 1.00 52.68  ? 403  THR B CG2   1 
ATOM   7073 N  N     . GLU B 2 416 ? 33.611 35.209  -9.089  1.00 61.27  ? 404  GLU B N     1 
ATOM   7074 C  CA    . GLU B 2 416 ? 34.608 35.790  -8.200  1.00 63.71  ? 404  GLU B CA    1 
ATOM   7075 C  C     . GLU B 2 416 ? 34.047 36.902  -7.323  1.00 60.23  ? 404  GLU B C     1 
ATOM   7076 O  O     . GLU B 2 416 ? 34.746 37.364  -6.416  1.00 61.63  ? 404  GLU B O     1 
ATOM   7077 C  CB    . GLU B 2 416 ? 35.788 36.328  -9.015  1.00 68.30  ? 404  GLU B CB    1 
ATOM   7078 C  CG    . GLU B 2 416 ? 36.529 35.262  -9.807  1.00 74.88  ? 404  GLU B CG    1 
ATOM   7079 C  CD    . GLU B 2 416 ? 37.329 34.325  -8.919  1.00 81.07  ? 404  GLU B CD    1 
ATOM   7080 O  OE1   . GLU B 2 416 ? 37.965 34.811  -7.960  1.00 83.67  ? 404  GLU B OE1   1 
ATOM   7081 O  OE2   . GLU B 2 416 ? 37.320 33.103  -9.179  1.00 82.81  ? 404  GLU B OE2   1 
ATOM   7082 N  N     . TYR B 2 417 ? 32.811 37.343  -7.566  1.00 57.82  ? 405  TYR B N     1 
ATOM   7083 C  CA    . TYR B 2 417 ? 32.222 38.428  -6.794  1.00 57.66  ? 405  TYR B CA    1 
ATOM   7084 C  C     . TYR B 2 417 ? 30.838 38.084  -6.253  1.00 58.44  ? 405  TYR B C     1 
ATOM   7085 O  O     . TYR B 2 417 ? 30.189 38.951  -5.657  1.00 61.63  ? 405  TYR B O     1 
ATOM   7086 C  CB    . TYR B 2 417 ? 32.156 39.707  -7.640  1.00 54.00  ? 405  TYR B CB    1 
ATOM   7087 C  CG    . TYR B 2 417 ? 33.436 39.978  -8.401  1.00 53.27  ? 405  TYR B CG    1 
ATOM   7088 C  CD1   . TYR B 2 417 ? 34.598 40.345  -7.732  1.00 54.27  ? 405  TYR B CD1   1 
ATOM   7089 C  CD2   . TYR B 2 417 ? 33.487 39.855  -9.783  1.00 51.72  ? 405  TYR B CD2   1 
ATOM   7090 C  CE1   . TYR B 2 417 ? 35.773 40.583  -8.419  1.00 54.82  ? 405  TYR B CE1   1 
ATOM   7091 C  CE2   . TYR B 2 417 ? 34.660 40.093  -10.479 1.00 52.59  ? 405  TYR B CE2   1 
ATOM   7092 C  CZ    . TYR B 2 417 ? 35.798 40.457  -9.791  1.00 55.11  ? 405  TYR B CZ    1 
ATOM   7093 O  OH    . TYR B 2 417 ? 36.967 40.696  -10.475 1.00 59.80  ? 405  TYR B OH    1 
ATOM   7094 N  N     . TRP B 2 418 ? 30.374 36.851  -6.433  1.00 57.05  ? 406  TRP B N     1 
ATOM   7095 C  CA    . TRP B 2 418 ? 29.065 36.454  -5.933  1.00 55.57  ? 406  TRP B CA    1 
ATOM   7096 C  C     . TRP B 2 418 ? 29.136 36.139  -4.444  1.00 57.54  ? 406  TRP B C     1 
ATOM   7097 O  O     . TRP B 2 418 ? 30.077 35.492  -3.975  1.00 60.77  ? 406  TRP B O     1 
ATOM   7098 C  CB    . TRP B 2 418 ? 28.545 35.241  -6.704  1.00 54.37  ? 406  TRP B CB    1 
ATOM   7099 C  CG    . TRP B 2 418 ? 27.061 35.097  -6.644  1.00 53.44  ? 406  TRP B CG    1 
ATOM   7100 C  CD1   . TRP B 2 418 ? 26.348 34.250  -5.846  1.00 54.84  ? 406  TRP B CD1   1 
ATOM   7101 C  CD2   . TRP B 2 418 ? 26.101 35.830  -7.411  1.00 50.87  ? 406  TRP B CD2   1 
ATOM   7102 N  NE1   . TRP B 2 418 ? 25.003 34.408  -6.073  1.00 53.79  ? 406  TRP B NE1   1 
ATOM   7103 C  CE2   . TRP B 2 418 ? 24.825 35.373  -7.029  1.00 50.78  ? 406  TRP B CE2   1 
ATOM   7104 C  CE3   . TRP B 2 418 ? 26.197 36.830  -8.384  1.00 49.05  ? 406  TRP B CE3   1 
ATOM   7105 C  CZ2   . TRP B 2 418 ? 23.654 35.881  -7.586  1.00 48.78  ? 406  TRP B CZ2   1 
ATOM   7106 C  CZ3   . TRP B 2 418 ? 25.035 37.332  -8.937  1.00 47.50  ? 406  TRP B CZ3   1 
ATOM   7107 C  CH2   . TRP B 2 418 ? 23.780 36.857  -8.536  1.00 48.53  ? 406  TRP B CH2   1 
ATOM   7108 N  N     . GLN B 2 419 ? 28.129 36.602  -3.697  1.00 56.24  ? 407  GLN B N     1 
ATOM   7109 C  CA    . GLN B 2 419 ? 28.088 36.408  -2.252  1.00 59.19  ? 407  GLN B CA    1 
ATOM   7110 C  C     . GLN B 2 419 ? 26.722 35.951  -1.752  1.00 56.55  ? 407  GLN B C     1 
ATOM   7111 O  O     . GLN B 2 419 ? 26.519 35.870  -0.536  1.00 59.84  ? 407  GLN B O     1 
ATOM   7112 C  CB    . GLN B 2 419 ? 28.498 37.695  -1.525  1.00 64.14  ? 407  GLN B CB    1 
ATOM   7113 C  CG    . GLN B 2 419 ? 29.979 38.028  -1.635  1.00 68.57  ? 407  GLN B CG    1 
ATOM   7114 C  CD    . GLN B 2 419 ? 30.860 37.016  -0.923  1.00 74.39  ? 407  GLN B CD    1 
ATOM   7115 O  OE1   . GLN B 2 419 ? 30.481 36.463  0.109   1.00 78.47  ? 407  GLN B OE1   1 
ATOM   7116 N  NE2   . GLN B 2 419 ? 32.042 36.767  -1.476  1.00 74.57  ? 407  GLN B NE2   1 
ATOM   7117 N  N     . ALA B 2 420 ? 25.789 35.647  -2.647  1.00 51.93  ? 408  ALA B N     1 
ATOM   7118 C  CA    . ALA B 2 420 ? 24.446 35.232  -2.273  1.00 49.64  ? 408  ALA B CA    1 
ATOM   7119 C  C     . ALA B 2 420 ? 24.276 33.730  -2.473  1.00 52.22  ? 408  ALA B C     1 
ATOM   7120 O  O     . ALA B 2 420 ? 25.014 33.090  -3.225  1.00 50.84  ? 408  ALA B O     1 
ATOM   7121 C  CB    . ALA B 2 420 ? 23.400 35.996  -3.090  1.00 43.68  ? 408  ALA B CB    1 
ATOM   7122 N  N     . THR B 2 421 ? 23.281 33.170  -1.783  1.00 53.39  ? 409  THR B N     1 
ATOM   7123 C  CA    . THR B 2 421 ? 23.002 31.743  -1.863  1.00 55.62  ? 409  THR B CA    1 
ATOM   7124 C  C     . THR B 2 421 ? 22.077 31.376  -3.016  1.00 55.14  ? 409  THR B C     1 
ATOM   7125 O  O     . THR B 2 421 ? 21.895 30.183  -3.287  1.00 58.31  ? 409  THR B O     1 
ATOM   7126 C  CB    . THR B 2 421 ? 22.391 31.244  -0.550  1.00 60.79  ? 409  THR B CB    1 
ATOM   7127 O  OG1   . THR B 2 421 ? 21.083 31.804  -0.385  1.00 61.54  ? 409  THR B OG1   1 
ATOM   7128 C  CG2   . THR B 2 421 ? 23.264 31.652  0.627   1.00 57.71  ? 409  THR B CG2   1 
ATOM   7129 N  N     . TRP B 2 422 ? 21.488 32.357  -3.690  1.00 52.61  ? 410  TRP B N     1 
ATOM   7130 C  CA    . TRP B 2 422 ? 20.655 32.128  -4.860  1.00 50.22  ? 410  TRP B CA    1 
ATOM   7131 C  C     . TRP B 2 422 ? 21.354 32.644  -6.112  1.00 47.34  ? 410  TRP B C     1 
ATOM   7132 O  O     . TRP B 2 422 ? 22.320 33.408  -6.044  1.00 44.27  ? 410  TRP B O     1 
ATOM   7133 C  CB    . TRP B 2 422 ? 19.285 32.803  -4.706  1.00 51.12  ? 410  TRP B CB    1 
ATOM   7134 C  CG    . TRP B 2 422 ? 19.310 34.077  -3.902  1.00 52.11  ? 410  TRP B CG    1 
ATOM   7135 C  CD1   . TRP B 2 422 ? 18.817 34.258  -2.643  1.00 55.81  ? 410  TRP B CD1   1 
ATOM   7136 C  CD2   . TRP B 2 422 ? 19.858 35.342  -4.301  1.00 47.26  ? 410  TRP B CD2   1 
ATOM   7137 N  NE1   . TRP B 2 422 ? 19.020 35.553  -2.233  1.00 52.13  ? 410  TRP B NE1   1 
ATOM   7138 C  CE2   . TRP B 2 422 ? 19.658 36.239  -3.232  1.00 45.96  ? 410  TRP B CE2   1 
ATOM   7139 C  CE3   . TRP B 2 422 ? 20.496 35.803  -5.457  1.00 45.38  ? 410  TRP B CE3   1 
ATOM   7140 C  CZ2   . TRP B 2 422 ? 20.074 37.567  -3.283  1.00 42.22  ? 410  TRP B CZ2   1 
ATOM   7141 C  CZ3   . TRP B 2 422 ? 20.911 37.121  -5.504  1.00 42.61  ? 410  TRP B CZ3   1 
ATOM   7142 C  CH2   . TRP B 2 422 ? 20.695 37.989  -4.425  1.00 41.17  ? 410  TRP B CH2   1 
ATOM   7143 N  N     . ILE B 2 423 ? 20.864 32.196  -7.265  1.00 47.57  ? 411  ILE B N     1 
ATOM   7144 C  CA    . ILE B 2 423 ? 21.350 32.671  -8.559  1.00 43.02  ? 411  ILE B CA    1 
ATOM   7145 C  C     . ILE B 2 423 ? 20.152 32.950  -9.458  1.00 44.02  ? 411  ILE B C     1 
ATOM   7146 O  O     . ILE B 2 423 ? 19.333 32.049  -9.690  1.00 46.72  ? 411  ILE B O     1 
ATOM   7147 C  CB    . ILE B 2 423 ? 22.294 31.659  -9.227  1.00 42.00  ? 411  ILE B CB    1 
ATOM   7148 C  CG1   . ILE B 2 423 ? 23.360 31.162  -8.248  1.00 40.89  ? 411  ILE B CG1   1 
ATOM   7149 C  CG2   . ILE B 2 423 ? 22.954 32.289  -10.441 1.00 37.35  ? 411  ILE B CG2   1 
ATOM   7150 C  CD1   . ILE B 2 423 ? 24.178 30.004  -8.782  1.00 42.50  ? 411  ILE B CD1   1 
ATOM   7151 N  N     . PRO B 2 424 ? 20.005 34.162  -9.982  1.00 43.65  ? 412  PRO B N     1 
ATOM   7152 C  CA    . PRO B 2 424 ? 18.884 34.450  -10.878 1.00 42.82  ? 412  PRO B CA    1 
ATOM   7153 C  C     . PRO B 2 424 ? 19.192 34.053  -12.314 1.00 45.41  ? 412  PRO B C     1 
ATOM   7154 O  O     . PRO B 2 424 ? 20.348 33.925  -12.722 1.00 48.42  ? 412  PRO B O     1 
ATOM   7155 C  CB    . PRO B 2 424 ? 18.723 35.968  -10.755 1.00 42.65  ? 412  PRO B CB    1 
ATOM   7156 C  CG    . PRO B 2 424 ? 20.118 36.448  -10.512 1.00 42.64  ? 412  PRO B CG    1 
ATOM   7157 C  CD    . PRO B 2 424 ? 20.806 35.366  -9.698  1.00 42.44  ? 412  PRO B CD    1 
ATOM   7158 N  N     . GLU B 2 425 ? 18.121 33.845  -13.077 1.00 46.96  ? 413  GLU B N     1 
ATOM   7159 C  CA    . GLU B 2 425 ? 18.256 33.667  -14.515 1.00 47.72  ? 413  GLU B CA    1 
ATOM   7160 C  C     . GLU B 2 425 ? 18.781 34.952  -15.145 1.00 47.05  ? 413  GLU B C     1 
ATOM   7161 O  O     . GLU B 2 425 ? 18.540 36.055  -14.645 1.00 46.09  ? 413  GLU B O     1 
ATOM   7162 C  CB    . GLU B 2 425 ? 16.910 33.299  -15.140 1.00 51.78  ? 413  GLU B CB    1 
ATOM   7163 C  CG    . GLU B 2 425 ? 16.123 32.249  -14.379 1.00 61.89  ? 413  GLU B CG    1 
ATOM   7164 C  CD    . GLU B 2 425 ? 16.611 30.842  -14.646 1.00 72.63  ? 413  GLU B CD    1 
ATOM   7165 O  OE1   . GLU B 2 425 ? 17.395 30.655  -15.601 1.00 75.80  ? 413  GLU B OE1   1 
ATOM   7166 O  OE2   . GLU B 2 425 ? 16.207 29.923  -13.902 1.00 78.59  ? 413  GLU B OE2   1 
ATOM   7167 N  N     . TRP B 2 426 ? 19.507 34.809  -16.251 1.00 46.07  ? 414  TRP B N     1 
ATOM   7168 C  CA    . TRP B 2 426 ? 19.984 35.989  -16.958 1.00 46.18  ? 414  TRP B CA    1 
ATOM   7169 C  C     . TRP B 2 426 ? 20.226 35.658  -18.421 1.00 52.04  ? 414  TRP B C     1 
ATOM   7170 O  O     . TRP B 2 426 ? 20.360 34.494  -18.807 1.00 54.81  ? 414  TRP B O     1 
ATOM   7171 C  CB    . TRP B 2 426 ? 21.260 36.559  -16.326 1.00 43.48  ? 414  TRP B CB    1 
ATOM   7172 C  CG    . TRP B 2 426 ? 22.374 35.572  -16.143 1.00 41.61  ? 414  TRP B CG    1 
ATOM   7173 C  CD1   . TRP B 2 426 ? 22.930 34.765  -17.097 1.00 42.32  ? 414  TRP B CD1   1 
ATOM   7174 C  CD2   . TRP B 2 426 ? 23.094 35.313  -14.931 1.00 38.76  ? 414  TRP B CD2   1 
ATOM   7175 N  NE1   . TRP B 2 426 ? 23.937 34.008  -16.548 1.00 43.50  ? 414  TRP B NE1   1 
ATOM   7176 C  CE2   . TRP B 2 426 ? 24.060 34.327  -15.221 1.00 42.44  ? 414  TRP B CE2   1 
ATOM   7177 C  CE3   . TRP B 2 426 ? 23.010 35.814  -13.628 1.00 36.12  ? 414  TRP B CE3   1 
ATOM   7178 C  CZ2   . TRP B 2 426 ? 24.934 33.832  -14.254 1.00 43.51  ? 414  TRP B CZ2   1 
ATOM   7179 C  CZ3   . TRP B 2 426 ? 23.881 35.323  -12.671 1.00 37.25  ? 414  TRP B CZ3   1 
ATOM   7180 C  CH2   . TRP B 2 426 ? 24.830 34.344  -12.989 1.00 42.32  ? 414  TRP B CH2   1 
ATOM   7181 N  N     . GLU B 2 427 ? 20.272 36.714  -19.227 1.00 53.97  ? 415  GLU B N     1 
ATOM   7182 C  CA    . GLU B 2 427 ? 20.664 36.642  -20.624 1.00 53.80  ? 415  GLU B CA    1 
ATOM   7183 C  C     . GLU B 2 427 ? 21.510 37.869  -20.930 1.00 53.37  ? 415  GLU B C     1 
ATOM   7184 O  O     . GLU B 2 427 ? 21.576 38.815  -20.141 1.00 52.99  ? 415  GLU B O     1 
ATOM   7185 C  CB    . GLU B 2 427 ? 19.448 36.555  -21.552 1.00 57.13  ? 415  GLU B CB    1 
ATOM   7186 C  CG    . GLU B 2 427 ? 18.327 37.509  -21.193 1.00 61.63  ? 415  GLU B CG    1 
ATOM   7187 C  CD    . GLU B 2 427 ? 17.250 37.566  -22.259 1.00 68.89  ? 415  GLU B CD    1 
ATOM   7188 O  OE1   . GLU B 2 427 ? 17.602 37.574  -23.458 1.00 72.36  ? 415  GLU B OE1   1 
ATOM   7189 O  OE2   . GLU B 2 427 ? 16.054 37.598  -21.898 1.00 70.20  ? 415  GLU B OE2   1 
ATOM   7190 N  N     . PHE B 2 428 ? 22.165 37.851  -22.085 1.00 55.30  ? 416  PHE B N     1 
ATOM   7191 C  CA    . PHE B 2 428 ? 23.134 38.877  -22.443 1.00 55.97  ? 416  PHE B CA    1 
ATOM   7192 C  C     . PHE B 2 428 ? 22.639 39.682  -23.636 1.00 62.38  ? 416  PHE B C     1 
ATOM   7193 O  O     . PHE B 2 428 ? 22.046 39.131  -24.570 1.00 65.01  ? 416  PHE B O     1 
ATOM   7194 C  CB    . PHE B 2 428 ? 24.492 38.242  -22.731 1.00 54.76  ? 416  PHE B CB    1 
ATOM   7195 C  CG    . PHE B 2 428 ? 24.982 37.374  -21.612 1.00 54.93  ? 416  PHE B CG    1 
ATOM   7196 C  CD1   . PHE B 2 428 ? 25.588 37.935  -20.499 1.00 51.72  ? 416  PHE B CD1   1 
ATOM   7197 C  CD2   . PHE B 2 428 ? 24.808 35.999  -21.655 1.00 56.12  ? 416  PHE B CD2   1 
ATOM   7198 C  CE1   . PHE B 2 428 ? 26.027 37.141  -19.460 1.00 50.82  ? 416  PHE B CE1   1 
ATOM   7199 C  CE2   . PHE B 2 428 ? 25.245 35.199  -20.618 1.00 54.76  ? 416  PHE B CE2   1 
ATOM   7200 C  CZ    . PHE B 2 428 ? 25.856 35.770  -19.520 1.00 53.82  ? 416  PHE B CZ    1 
ATOM   7201 N  N     . VAL B 2 429 ? 22.882 40.990  -23.594 1.00 66.47  ? 417  VAL B N     1 
ATOM   7202 C  CA    . VAL B 2 429 ? 22.299 41.935  -24.536 1.00 73.53  ? 417  VAL B CA    1 
ATOM   7203 C  C     . VAL B 2 429 ? 23.402 42.763  -25.178 1.00 83.21  ? 417  VAL B C     1 
ATOM   7204 O  O     . VAL B 2 429 ? 24.357 43.173  -24.510 1.00 83.46  ? 417  VAL B O     1 
ATOM   7205 C  CB    . VAL B 2 429 ? 21.270 42.853  -23.842 1.00 68.04  ? 417  VAL B CB    1 
ATOM   7206 C  CG1   . VAL B 2 429 ? 20.729 43.887  -24.813 1.00 71.13  ? 417  VAL B CG1   1 
ATOM   7207 C  CG2   . VAL B 2 429 ? 20.139 42.031  -23.270 1.00 65.26  ? 417  VAL B CG2   1 
ATOM   7208 N  N     . ASN B 2 430 ? 23.269 42.998  -26.483 1.00 94.56  ? 418  ASN B N     1 
ATOM   7209 C  CA    . ASN B 2 430 ? 24.080 43.987  -27.193 1.00 102.15 ? 418  ASN B CA    1 
ATOM   7210 C  C     . ASN B 2 430 ? 23.335 45.324  -27.187 1.00 104.99 ? 418  ASN B C     1 
ATOM   7211 O  O     . ASN B 2 430 ? 22.861 45.828  -28.208 1.00 106.80 ? 418  ASN B O     1 
ATOM   7212 C  CB    . ASN B 2 430 ? 24.383 43.505  -28.605 1.00 109.51 ? 418  ASN B CB    1 
ATOM   7213 C  CG    . ASN B 2 430 ? 23.181 42.855  -29.266 1.00 114.82 ? 418  ASN B CG    1 
ATOM   7214 O  OD1   . ASN B 2 430 ? 22.065 43.367  -29.196 1.00 116.06 ? 418  ASN B OD1   1 
ATOM   7215 N  ND2   . ASN B 2 430 ? 23.402 41.709  -29.894 1.00 118.75 ? 418  ASN B ND2   1 
ATOM   7216 N  N     . THR B 2 431 ? 23.249 45.898  -25.984 1.00 105.28 ? 419  THR B N     1 
ATOM   7217 C  CA    . THR B 2 431 ? 22.417 47.045  -25.629 1.00 106.95 ? 419  THR B CA    1 
ATOM   7218 C  C     . THR B 2 431 ? 22.508 48.201  -26.621 1.00 111.85 ? 419  THR B C     1 
ATOM   7219 O  O     . THR B 2 431 ? 23.561 48.425  -27.233 1.00 114.05 ? 419  THR B O     1 
ATOM   7220 C  CB    . THR B 2 431 ? 22.793 47.547  -24.233 1.00 103.86 ? 419  THR B CB    1 
ATOM   7221 N  N     . PRO B 2 432 ? 21.421 48.944  -26.809 1.00 113.85 ? 420  PRO B N     1 
ATOM   7222 C  CA    . PRO B 2 432 ? 21.465 50.133  -27.658 1.00 118.74 ? 420  PRO B CA    1 
ATOM   7223 C  C     . PRO B 2 432 ? 21.840 51.361  -26.849 1.00 119.45 ? 420  PRO B C     1 
ATOM   7224 O  O     . PRO B 2 432 ? 21.393 51.525  -25.702 1.00 117.71 ? 420  PRO B O     1 
ATOM   7225 C  CB    . PRO B 2 432 ? 20.030 50.230  -28.190 1.00 119.53 ? 420  PRO B CB    1 
ATOM   7226 C  CG    . PRO B 2 432 ? 19.204 49.676  -27.067 1.00 115.34 ? 420  PRO B CG    1 
ATOM   7227 C  CD    . PRO B 2 432 ? 20.047 48.613  -26.391 1.00 111.69 ? 420  PRO B CD    1 
ATOM   7228 N  N     . PRO B 2 433 ? 22.676 52.241  -27.405 1.00 122.26 ? 421  PRO B N     1 
ATOM   7229 C  CA    . PRO B 2 433 ? 23.051 53.459  -26.670 1.00 120.29 ? 421  PRO B CA    1 
ATOM   7230 C  C     . PRO B 2 433 ? 21.897 54.419  -26.459 1.00 118.05 ? 421  PRO B C     1 
ATOM   7231 O  O     . PRO B 2 433 ? 21.988 55.274  -25.569 1.00 122.29 ? 421  PRO B O     1 
ATOM   7232 C  CB    . PRO B 2 433 ? 24.137 54.086  -27.554 1.00 125.85 ? 421  PRO B CB    1 
ATOM   7233 C  CG    . PRO B 2 433 ? 23.922 53.490  -28.921 1.00 129.80 ? 421  PRO B CG    1 
ATOM   7234 C  CD    . PRO B 2 433 ? 23.384 52.113  -28.689 1.00 126.38 ? 421  PRO B CD    1 
ATOM   7235 N  N     . LEU B 2 434 ? 20.827 54.304  -27.251 1.00 108.24 ? 422  LEU B N     1 
ATOM   7236 C  CA    . LEU B 2 434 ? 19.670 55.181  -27.103 1.00 98.24  ? 422  LEU B CA    1 
ATOM   7237 C  C     . LEU B 2 434 ? 19.029 55.026  -25.728 1.00 94.25  ? 422  LEU B C     1 
ATOM   7238 O  O     . LEU B 2 434 ? 18.850 56.010  -24.999 1.00 97.48  ? 422  LEU B O     1 
ATOM   7239 C  CB    . LEU B 2 434 ? 18.653 54.891  -28.211 1.00 89.56  ? 422  LEU B CB    1 
ATOM   7240 C  CG    . LEU B 2 434 ? 18.535 55.938  -29.323 1.00 86.26  ? 422  LEU B CG    1 
ATOM   7241 C  CD1   . LEU B 2 434 ? 19.910 56.408  -29.781 1.00 84.72  ? 422  LEU B CD1   1 
ATOM   7242 C  CD2   . LEU B 2 434 ? 17.732 55.395  -30.497 1.00 87.27  ? 422  LEU B CD2   1 
ATOM   7243 N  N     . VAL B 2 435 ? 18.673 53.793  -25.355 1.00 88.79  ? 423  VAL B N     1 
ATOM   7244 C  CA    . VAL B 2 435 ? 18.076 53.558  -24.043 1.00 85.46  ? 423  VAL B CA    1 
ATOM   7245 C  C     . VAL B 2 435 ? 19.055 53.922  -22.938 1.00 84.13  ? 423  VAL B C     1 
ATOM   7246 O  O     . VAL B 2 435 ? 18.648 54.352  -21.851 1.00 82.99  ? 423  VAL B O     1 
ATOM   7247 C  CB    . VAL B 2 435 ? 17.599 52.098  -23.924 1.00 84.55  ? 423  VAL B CB    1 
ATOM   7248 C  CG1   . VAL B 2 435 ? 16.789 51.899  -22.649 1.00 81.78  ? 423  VAL B CG1   1 
ATOM   7249 C  CG2   . VAL B 2 435 ? 16.782 51.712  -25.145 1.00 88.07  ? 423  VAL B CG2   1 
ATOM   7250 N  N     . LYS B 2 436 ? 20.356 53.763  -23.192 1.00 85.35  ? 424  LYS B N     1 
ATOM   7251 C  CA    . LYS B 2 436 ? 21.353 54.251  -22.248 1.00 85.08  ? 424  LYS B CA    1 
ATOM   7252 C  C     . LYS B 2 436 ? 21.229 55.759  -22.057 1.00 84.68  ? 424  LYS B C     1 
ATOM   7253 O  O     . LYS B 2 436 ? 21.331 56.259  -20.933 1.00 83.54  ? 424  LYS B O     1 
ATOM   7254 C  CB    . LYS B 2 436 ? 22.755 53.876  -22.727 1.00 87.75  ? 424  LYS B CB    1 
ATOM   7255 C  CG    . LYS B 2 436 ? 23.860 54.145  -21.717 1.00 88.99  ? 424  LYS B CG    1 
ATOM   7256 C  CD    . LYS B 2 436 ? 25.234 54.053  -22.366 1.00 92.08  ? 424  LYS B CD    1 
ATOM   7257 C  CE    . LYS B 2 436 ? 25.471 55.211  -23.325 1.00 96.40  ? 424  LYS B CE    1 
ATOM   7258 N  NZ    . LYS B 2 436 ? 25.433 56.527  -22.625 1.00 98.07  ? 424  LYS B NZ    1 
ATOM   7259 N  N     . LEU B 2 437 ? 20.985 56.502  -23.139 1.00 85.86  ? 425  LEU B N     1 
ATOM   7260 C  CA    . LEU B 2 437 ? 20.813 57.941  -22.984 1.00 86.80  ? 425  LEU B CA    1 
ATOM   7261 C  C     . LEU B 2 437 ? 19.478 58.280  -22.334 1.00 82.02  ? 425  LEU B C     1 
ATOM   7262 O  O     . LEU B 2 437 ? 19.346 59.342  -21.715 1.00 82.43  ? 425  LEU B O     1 
ATOM   7263 C  CB    . LEU B 2 437 ? 20.931 58.657  -24.328 1.00 94.87  ? 425  LEU B CB    1 
ATOM   7264 C  CG    . LEU B 2 437 ? 22.284 58.588  -25.026 1.00 101.77 ? 425  LEU B CG    1 
ATOM   7265 C  CD1   . LEU B 2 437 ? 22.227 59.458  -26.265 1.00 108.80 ? 425  LEU B CD1   1 
ATOM   7266 C  CD2   . LEU B 2 437 ? 23.409 59.030  -24.102 1.00 102.94 ? 425  LEU B CD2   1 
ATOM   7267 N  N     . TRP B 2 438 ? 18.481 57.400  -22.456 1.00 77.94  ? 426  TRP B N     1 
ATOM   7268 C  CA    . TRP B 2 438 ? 17.149 57.746  -21.966 1.00 75.09  ? 426  TRP B CA    1 
ATOM   7269 C  C     . TRP B 2 438 ? 17.109 57.837  -20.445 1.00 74.27  ? 426  TRP B C     1 
ATOM   7270 O  O     . TRP B 2 438 ? 16.404 58.688  -19.889 1.00 73.40  ? 426  TRP B O     1 
ATOM   7271 C  CB    . TRP B 2 438 ? 16.107 56.739  -22.455 1.00 71.37  ? 426  TRP B CB    1 
ATOM   7272 C  CG    . TRP B 2 438 ? 15.914 56.621  -23.961 1.00 71.22  ? 426  TRP B CG    1 
ATOM   7273 C  CD1   . TRP B 2 438 ? 15.430 55.529  -24.624 1.00 70.15  ? 426  TRP B CD1   1 
ATOM   7274 C  CD2   . TRP B 2 438 ? 16.177 57.613  -24.975 1.00 71.80  ? 426  TRP B CD2   1 
ATOM   7275 N  NE1   . TRP B 2 438 ? 15.378 55.771  -25.973 1.00 72.89  ? 426  TRP B NE1   1 
ATOM   7276 C  CE2   . TRP B 2 438 ? 15.832 57.040  -26.217 1.00 73.69  ? 426  TRP B CE2   1 
ATOM   7277 C  CE3   . TRP B 2 438 ? 16.672 58.922  -24.955 1.00 71.73  ? 426  TRP B CE3   1 
ATOM   7278 C  CZ2   . TRP B 2 438 ? 15.967 57.726  -27.419 1.00 75.04  ? 426  TRP B CZ2   1 
ATOM   7279 C  CZ3   . TRP B 2 438 ? 16.807 59.599  -26.151 1.00 77.27  ? 426  TRP B CZ3   1 
ATOM   7280 C  CH2   . TRP B 2 438 ? 16.453 59.001  -27.365 1.00 78.94  ? 426  TRP B CH2   1 
ATOM   7281 N  N     . TYR B 2 439 ? 17.847 56.969  -19.753 1.00 76.00  ? 427  TYR B N     1 
ATOM   7282 C  CA    . TYR B 2 439 ? 17.823 56.903  -18.298 1.00 77.22  ? 427  TYR B CA    1 
ATOM   7283 C  C     . TYR B 2 439 ? 19.007 57.617  -17.653 1.00 88.33  ? 427  TYR B C     1 
ATOM   7284 O  O     . TYR B 2 439 ? 19.290 57.387  -16.473 1.00 86.19  ? 427  TYR B O     1 
ATOM   7285 C  CB    . TYR B 2 439 ? 17.773 55.445  -17.834 1.00 68.24  ? 427  TYR B CB    1 
ATOM   7286 C  CG    . TYR B 2 439 ? 16.457 54.752  -18.109 1.00 62.82  ? 427  TYR B CG    1 
ATOM   7287 C  CD1   . TYR B 2 439 ? 15.349 54.986  -17.307 1.00 61.43  ? 427  TYR B CD1   1 
ATOM   7288 C  CD2   . TYR B 2 439 ? 16.326 53.857  -19.165 1.00 61.05  ? 427  TYR B CD2   1 
ATOM   7289 C  CE1   . TYR B 2 439 ? 14.144 54.358  -17.550 1.00 61.35  ? 427  TYR B CE1   1 
ATOM   7290 C  CE2   . TYR B 2 439 ? 15.123 53.221  -19.416 1.00 59.62  ? 427  TYR B CE2   1 
ATOM   7291 C  CZ    . TYR B 2 439 ? 14.035 53.476  -18.605 1.00 61.46  ? 427  TYR B CZ    1 
ATOM   7292 O  OH    . TYR B 2 439 ? 12.832 52.851  -18.844 1.00 63.39  ? 427  TYR B OH    1 
ATOM   7293 N  N     . GLN B 2 440 ? 19.698 58.477  -18.396 1.00 104.37 ? 428  GLN B N     1 
ATOM   7294 C  CA    . GLN B 2 440 ? 20.842 59.184  -17.841 1.00 113.13 ? 428  GLN B CA    1 
ATOM   7295 C  C     . GLN B 2 440 ? 20.400 60.198  -16.790 1.00 116.68 ? 428  GLN B C     1 
ATOM   7296 O  O     . GLN B 2 440 ? 19.246 60.635  -16.749 1.00 118.48 ? 428  GLN B O     1 
ATOM   7297 C  CB    . GLN B 2 440 ? 21.633 59.884  -18.945 1.00 123.02 ? 428  GLN B CB    1 
ATOM   7298 C  CG    . GLN B 2 440 ? 22.538 58.954  -19.727 1.00 129.81 ? 428  GLN B CG    1 
ATOM   7299 C  CD    . GLN B 2 440 ? 23.503 59.695  -20.626 1.00 138.37 ? 428  GLN B CD    1 
ATOM   7300 O  OE1   . GLN B 2 440 ? 23.248 60.830  -21.029 1.00 143.18 ? 428  GLN B OE1   1 
ATOM   7301 N  NE2   . GLN B 2 440 ? 24.625 59.057  -20.942 1.00 139.36 ? 428  GLN B NE2   1 
ATOM   7302 N  N     . LEU B 2 441 ? 21.344 60.571  -15.932 1.00 111.92 ? 429  LEU B N     1 
ATOM   7303 C  CA    . LEU B 2 441 ? 21.053 61.440  -14.798 1.00 108.72 ? 429  LEU B CA    1 
ATOM   7304 C  C     . LEU B 2 441 ? 21.893 62.712  -14.841 1.00 110.25 ? 429  LEU B C     1 
ATOM   7305 O  O     . LEU B 2 441 ? 21.664 63.589  -15.673 1.00 112.01 ? 429  LEU B O     1 
ATOM   7306 C  CB    . LEU B 2 441 ? 21.297 60.691  -13.485 1.00 103.57 ? 429  LEU B CB    1 
ATOM   7307 C  CG    . LEU B 2 441 ? 20.772 59.254  -13.448 1.00 97.96  ? 429  LEU B CG    1 
ATOM   7308 C  CD1   . LEU B 2 441 ? 21.104 58.588  -12.127 1.00 96.52  ? 429  LEU B CD1   1 
ATOM   7309 C  CD2   . LEU B 2 441 ? 19.274 59.223  -13.707 1.00 97.36  ? 429  LEU B CD2   1 
ATOM   7310 O  "O5'" . DG  C 3 4   ? 3.931  38.014  -36.221 1.00 75.87  ? 805  DG  P "O5'" 1 
ATOM   7311 C  "C5'" . DG  C 3 4   ? 3.009  37.116  -36.842 1.00 85.84  ? 805  DG  P "C5'" 1 
ATOM   7312 C  "C4'" . DG  C 3 4   ? 2.522  37.664  -38.177 1.00 87.84  ? 805  DG  P "C4'" 1 
ATOM   7313 O  "O4'" . DG  C 3 4   ? 1.979  38.988  -37.985 1.00 87.12  ? 805  DG  P "O4'" 1 
ATOM   7314 C  "C3'" . DG  C 3 4   ? 3.588  37.759  -39.263 1.00 86.15  ? 805  DG  P "C3'" 1 
ATOM   7315 O  "O3'" . DG  C 3 4   ? 3.348  36.778  -40.261 1.00 90.40  ? 805  DG  P "O3'" 1 
ATOM   7316 C  "C2'" . DG  C 3 4   ? 3.472  39.175  -39.840 1.00 83.71  ? 805  DG  P "C2'" 1 
ATOM   7317 C  "C1'" . DG  C 3 4   ? 2.558  39.918  -38.873 1.00 83.78  ? 805  DG  P "C1'" 1 
ATOM   7318 N  N9    . DG  C 3 4   ? 3.209  40.965  -38.084 1.00 79.46  ? 805  DG  P N9    1 
ATOM   7319 C  C8    . DG  C 3 4   ? 3.215  41.071  -36.714 1.00 78.94  ? 805  DG  P C8    1 
ATOM   7320 N  N7    . DG  C 3 4   ? 3.845  42.121  -36.273 1.00 74.69  ? 805  DG  P N7    1 
ATOM   7321 C  C5    . DG  C 3 4   ? 4.281  42.765  -37.422 1.00 74.32  ? 805  DG  P C5    1 
ATOM   7322 C  C6    . DG  C 3 4   ? 5.023  43.960  -37.564 1.00 71.31  ? 805  DG  P C6    1 
ATOM   7323 O  O6    . DG  C 3 4   ? 5.450  44.704  -36.670 1.00 68.46  ? 805  DG  P O6    1 
ATOM   7324 N  N1    . DG  C 3 4   ? 5.260  44.267  -38.901 1.00 71.42  ? 805  DG  P N1    1 
ATOM   7325 C  C2    . DG  C 3 4   ? 4.832  43.512  -39.970 1.00 75.86  ? 805  DG  P C2    1 
ATOM   7326 N  N2    . DG  C 3 4   ? 5.155  43.968  -41.190 1.00 71.73  ? 805  DG  P N2    1 
ATOM   7327 N  N3    . DG  C 3 4   ? 4.132  42.385  -39.851 1.00 74.52  ? 805  DG  P N3    1 
ATOM   7328 C  C4    . DG  C 3 4   ? 3.895  42.072  -38.550 1.00 75.84  ? 805  DG  P C4    1 
ATOM   7329 P  P     . DT  C 3 5   ? 4.580  36.127  -41.058 1.00 88.26  ? 806  DT  P P     1 
ATOM   7330 O  OP1   . DT  C 3 5   ? 4.031  35.144  -42.019 1.00 92.75  ? 806  DT  P OP1   1 
ATOM   7331 O  OP2   . DT  C 3 5   ? 5.586  35.707  -40.057 1.00 85.57  ? 806  DT  P OP2   1 
ATOM   7332 O  "O5'" . DT  C 3 5   ? 5.205  37.352  -41.870 1.00 83.25  ? 806  DT  P "O5'" 1 
ATOM   7333 C  "C5'" . DT  C 3 5   ? 4.526  37.886  -42.998 1.00 85.78  ? 806  DT  P "C5'" 1 
ATOM   7334 C  "C4'" . DT  C 3 5   ? 5.462  38.743  -43.833 1.00 83.47  ? 806  DT  P "C4'" 1 
ATOM   7335 O  "O4'" . DT  C 3 5   ? 5.793  39.957  -43.108 1.00 79.58  ? 806  DT  P "O4'" 1 
ATOM   7336 C  "C3'" . DT  C 3 5   ? 6.791  38.089  -44.180 1.00 81.80  ? 806  DT  P "C3'" 1 
ATOM   7337 O  "O3'" . DT  C 3 5   ? 7.220  38.521  -45.459 1.00 84.28  ? 806  DT  P "O3'" 1 
ATOM   7338 C  "C2'" . DT  C 3 5   ? 7.718  38.591  -43.075 1.00 76.81  ? 806  DT  P "C2'" 1 
ATOM   7339 C  "C1'" . DT  C 3 5   ? 7.177  39.992  -42.813 1.00 75.28  ? 806  DT  P "C1'" 1 
ATOM   7340 N  N1    . DT  C 3 5   ? 7.337  40.446  -41.394 1.00 67.93  ? 806  DT  P N1    1 
ATOM   7341 C  C2    . DT  C 3 5   ? 7.918  41.667  -41.138 1.00 65.07  ? 806  DT  P C2    1 
ATOM   7342 O  O2    . DT  C 3 5   ? 8.324  42.410  -42.012 1.00 64.74  ? 806  DT  P O2    1 
ATOM   7343 N  N3    . DT  C 3 5   ? 8.008  41.989  -39.809 1.00 63.10  ? 806  DT  P N3    1 
ATOM   7344 C  C4    . DT  C 3 5   ? 7.585  41.233  -38.734 1.00 63.77  ? 806  DT  P C4    1 
ATOM   7345 O  O4    . DT  C 3 5   ? 7.708  41.608  -37.573 1.00 62.16  ? 806  DT  P O4    1 
ATOM   7346 C  C5    . DT  C 3 5   ? 6.985  39.970  -39.068 1.00 66.78  ? 806  DT  P C5    1 
ATOM   7347 C  C7    . DT  C 3 5   ? 6.496  39.070  -37.974 1.00 68.01  ? 806  DT  P C7    1 
ATOM   7348 C  C6    . DT  C 3 5   ? 6.888  39.637  -40.367 1.00 68.69  ? 806  DT  P C6    1 
ATOM   7349 P  P     . DC  C 3 6   ? 8.472  37.811  -46.171 1.00 84.14  ? 807  DC  P P     1 
ATOM   7350 O  OP1   . DC  C 3 6   ? 8.182  37.757  -47.621 1.00 87.71  ? 807  DC  P OP1   1 
ATOM   7351 O  OP2   . DC  C 3 6   ? 8.776  36.568  -45.428 1.00 83.60  ? 807  DC  P OP2   1 
ATOM   7352 O  "O5'" . DC  C 3 6   ? 9.675  38.833  -45.926 1.00 77.38  ? 807  DC  P "O5'" 1 
ATOM   7353 C  "C5'" . DC  C 3 6   ? 9.563  40.170  -46.380 1.00 76.23  ? 807  DC  P "C5'" 1 
ATOM   7354 C  "C4'" . DC  C 3 6   ? 10.785 40.976  -45.987 1.00 70.89  ? 807  DC  P "C4'" 1 
ATOM   7355 O  "O4'" . DC  C 3 6   ? 10.690 41.360  -44.592 1.00 68.82  ? 807  DC  P "O4'" 1 
ATOM   7356 C  "C3'" . DC  C 3 6   ? 12.117 40.247  -46.145 1.00 68.94  ? 807  DC  P "C3'" 1 
ATOM   7357 O  "O3'" . DC  C 3 6   ? 13.068 41.123  -46.734 1.00 69.66  ? 807  DC  P "O3'" 1 
ATOM   7358 C  "C2'" . DC  C 3 6   ? 12.493 39.876  -44.708 1.00 65.11  ? 807  DC  P "C2'" 1 
ATOM   7359 C  "C1'" . DC  C 3 6   ? 11.886 41.026  -43.922 1.00 65.83  ? 807  DC  P "C1'" 1 
ATOM   7360 N  N1    . DC  C 3 6   ? 11.538 40.677  -42.516 1.00 65.82  ? 807  DC  P N1    1 
ATOM   7361 C  C2    . DC  C 3 6   ? 11.891 41.546  -41.477 1.00 62.97  ? 807  DC  P C2    1 
ATOM   7362 O  O2    . DC  C 3 6   ? 12.504 42.583  -41.748 1.00 61.54  ? 807  DC  P O2    1 
ATOM   7363 N  N3    . DC  C 3 6   ? 11.553 41.218  -40.203 1.00 62.54  ? 807  DC  P N3    1 
ATOM   7364 C  C4    . DC  C 3 6   ? 10.889 40.085  -39.959 1.00 64.88  ? 807  DC  P C4    1 
ATOM   7365 N  N4    . DC  C 3 6   ? 10.574 39.800  -38.691 1.00 64.29  ? 807  DC  P N4    1 
ATOM   7366 C  C5    . DC  C 3 6   ? 10.518 39.193  -41.007 1.00 66.33  ? 807  DC  P C5    1 
ATOM   7367 C  C6    . DC  C 3 6   ? 10.859 39.525  -42.256 1.00 66.24  ? 807  DC  P C6    1 
ATOM   7368 P  P     . DC  C 3 7   ? 14.521 40.591  -47.167 1.00 68.37  ? 808  DC  P P     1 
ATOM   7369 O  OP1   . DC  C 3 7   ? 14.817 41.172  -48.495 1.00 72.06  ? 808  DC  P OP1   1 
ATOM   7370 O  OP2   . DC  C 3 7   ? 14.574 39.123  -46.976 1.00 67.67  ? 808  DC  P OP2   1 
ATOM   7371 O  "O5'" . DC  C 3 7   ? 15.491 41.258  -46.088 1.00 60.68  ? 808  DC  P "O5'" 1 
ATOM   7372 C  "C5'" . DC  C 3 7   ? 15.295 42.612  -45.722 1.00 60.20  ? 808  DC  P "C5'" 1 
ATOM   7373 C  "C4'" . DC  C 3 7   ? 16.110 42.963  -44.493 1.00 57.26  ? 808  DC  P "C4'" 1 
ATOM   7374 O  "O4'" . DC  C 3 7   ? 15.424 42.513  -43.302 1.00 57.79  ? 808  DC  P "O4'" 1 
ATOM   7375 C  "C3'" . DC  C 3 7   ? 17.511 42.351  -44.447 1.00 55.09  ? 808  DC  P "C3'" 1 
ATOM   7376 O  "O3'" . DC  C 3 7   ? 18.464 43.383  -44.234 1.00 53.66  ? 808  DC  P "O3'" 1 
ATOM   7377 C  "C2'" . DC  C 3 7   ? 17.451 41.364  -43.269 1.00 51.72  ? 808  DC  P "C2'" 1 
ATOM   7378 C  "C1'" . DC  C 3 7   ? 16.357 41.969  -42.404 1.00 53.68  ? 808  DC  P "C1'" 1 
ATOM   7379 N  N1    . DC  C 3 7   ? 15.637 40.983  -41.540 1.00 57.86  ? 808  DC  P N1    1 
ATOM   7380 C  C2    . DC  C 3 7   ? 15.556 41.203  -40.160 1.00 58.73  ? 808  DC  P C2    1 
ATOM   7381 O  O2    . DC  C 3 7   ? 16.106 42.203  -39.682 1.00 59.64  ? 808  DC  P O2    1 
ATOM   7382 N  N3    . DC  C 3 7   ? 14.887 40.308  -39.388 1.00 58.39  ? 808  DC  P N3    1 
ATOM   7383 C  C4    . DC  C 3 7   ? 14.311 39.240  -39.952 1.00 59.65  ? 808  DC  P C4    1 
ATOM   7384 N  N4    . DC  C 3 7   ? 13.660 38.383  -39.158 1.00 59.82  ? 808  DC  P N4    1 
ATOM   7385 C  C5    . DC  C 3 7   ? 14.376 39.005  -41.358 1.00 59.50  ? 808  DC  P C5    1 
ATOM   7386 C  C6    . DC  C 3 7   ? 15.040 39.894  -42.106 1.00 59.72  ? 808  DC  P C6    1 
ATOM   7387 P  P     . DC  C 3 8   ? 20.028 43.112  -44.464 1.00 57.39  ? 809  DC  P P     1 
ATOM   7388 O  OP1   . DC  C 3 8   ? 20.605 44.337  -45.060 1.00 58.10  ? 809  DC  P OP1   1 
ATOM   7389 O  OP2   . DC  C 3 8   ? 20.182 41.810  -45.151 1.00 59.34  ? 809  DC  P OP2   1 
ATOM   7390 O  "O5'" . DC  C 3 8   ? 20.593 42.966  -42.984 1.00 51.96  ? 809  DC  P "O5'" 1 
ATOM   7391 C  "C5'" . DC  C 3 8   ? 20.294 43.962  -42.032 1.00 53.03  ? 809  DC  P "C5'" 1 
ATOM   7392 C  "C4'" . DC  C 3 8   ? 20.617 43.485  -40.633 1.00 54.40  ? 809  DC  P "C4'" 1 
ATOM   7393 O  "O4'" . DC  C 3 8   ? 19.584 42.590  -40.165 1.00 55.98  ? 809  DC  P "O4'" 1 
ATOM   7394 C  "C3'" . DC  C 3 8   ? 21.939 42.723  -40.495 1.00 53.49  ? 809  DC  P "C3'" 1 
ATOM   7395 O  "O3'" . DC  C 3 8   ? 22.784 43.420  -39.599 1.00 55.58  ? 809  DC  P "O3'" 1 
ATOM   7396 C  "C2'" . DC  C 3 8   ? 21.525 41.348  -39.942 1.00 53.90  ? 809  DC  P "C2'" 1 
ATOM   7397 C  "C1'" . DC  C 3 8   ? 20.175 41.651  -39.314 1.00 57.00  ? 809  DC  P "C1'" 1 
ATOM   7398 N  N1    . DC  C 3 8   ? 19.265 40.474  -39.207 1.00 61.10  ? 809  DC  P N1    1 
ATOM   7399 C  C2    . DC  C 3 8   ? 18.767 40.104  -37.955 1.00 64.03  ? 809  DC  P C2    1 
ATOM   7400 O  O2    . DC  C 3 8   ? 19.105 40.756  -36.962 1.00 65.29  ? 809  DC  P O2    1 
ATOM   7401 N  N3    . DC  C 3 8   ? 17.933 39.037  -37.867 1.00 66.44  ? 809  DC  P N3    1 
ATOM   7402 C  C4    . DC  C 3 8   ? 17.596 38.362  -38.968 1.00 66.41  ? 809  DC  P C4    1 
ATOM   7403 N  N4    . DC  C 3 8   ? 16.771 37.317  -38.836 1.00 68.60  ? 809  DC  P N4    1 
ATOM   7404 C  C5    . DC  C 3 8   ? 18.091 38.728  -40.255 1.00 63.77  ? 809  DC  P C5    1 
ATOM   7405 C  C6    . DC  C 3 8   ? 18.910 39.783  -40.327 1.00 62.57  ? 809  DC  P C6    1 
ATOM   7406 P  P     . DT  C 3 9   ? 24.346 43.068  -39.495 1.00 54.73  ? 810  DT  P P     1 
ATOM   7407 O  OP1   . DT  C 3 9   ? 25.095 44.344  -39.446 1.00 54.36  ? 810  DT  P OP1   1 
ATOM   7408 O  OP2   . DT  C 3 9   ? 24.663 42.071  -40.538 1.00 55.99  ? 810  DT  P OP2   1 
ATOM   7409 O  "O5'" . DT  C 3 9   ? 24.464 42.374  -38.063 1.00 57.30  ? 810  DT  P "O5'" 1 
ATOM   7410 C  "C5'" . DT  C 3 9   ? 23.836 42.982  -36.945 1.00 61.28  ? 810  DT  P "C5'" 1 
ATOM   7411 C  "C4'" . DT  C 3 9   ? 23.597 41.972  -35.842 1.00 62.72  ? 810  DT  P "C4'" 1 
ATOM   7412 O  "O4'" . DT  C 3 9   ? 22.500 41.097  -36.203 1.00 63.16  ? 810  DT  P "O4'" 1 
ATOM   7413 C  "C3'" . DT  C 3 9   ? 24.790 41.059  -35.541 1.00 64.50  ? 810  DT  P "C3'" 1 
ATOM   7414 O  "O3'" . DT  C 3 9   ? 25.150 41.173  -34.180 1.00 69.64  ? 810  DT  P "O3'" 1 
ATOM   7415 C  "C2'" . DT  C 3 9   ? 24.276 39.654  -35.870 1.00 63.05  ? 810  DT  P "C2'" 1 
ATOM   7416 C  "C1'" . DT  C 3 9   ? 22.779 39.823  -35.693 1.00 64.54  ? 810  DT  P "C1'" 1 
ATOM   7417 N  N1    . DT  C 3 9   ? 21.972 38.805  -36.427 1.00 64.59  ? 810  DT  P N1    1 
ATOM   7418 C  C2    . DT  C 3 9   ? 21.130 37.988  -35.716 1.00 66.96  ? 810  DT  P C2    1 
ATOM   7419 O  O2    . DT  C 3 9   ? 20.994 38.059  -34.508 1.00 70.19  ? 810  DT  P O2    1 
ATOM   7420 N  N3    . DT  C 3 9   ? 20.438 37.082  -36.470 1.00 68.14  ? 810  DT  P N3    1 
ATOM   7421 C  C4    . DT  C 3 9   ? 20.508 36.908  -37.839 1.00 68.78  ? 810  DT  P C4    1 
ATOM   7422 O  O4    . DT  C 3 9   ? 19.842 36.059  -38.426 1.00 70.69  ? 810  DT  P O4    1 
ATOM   7423 C  C5    . DT  C 3 9   ? 21.416 37.794  -38.528 1.00 66.36  ? 810  DT  P C5    1 
ATOM   7424 C  C7    . DT  C 3 9   ? 21.579 37.700  -40.016 1.00 65.66  ? 810  DT  P C7    1 
ATOM   7425 C  C6    . DT  C 3 9   ? 22.100 38.688  -37.796 1.00 64.30  ? 810  DT  P C6    1 
ATOM   7426 P  P     . DG  C 3 10  ? 26.604 40.697  -33.695 1.00 72.99  ? 811  DG  P P     1 
ATOM   7427 O  OP1   . DG  C 3 10  ? 27.247 41.849  -33.022 1.00 74.86  ? 811  DG  P OP1   1 
ATOM   7428 O  OP2   . DG  C 3 10  ? 27.263 40.047  -34.849 1.00 72.14  ? 811  DG  P OP2   1 
ATOM   7429 O  "O5'" . DG  C 3 10  ? 26.290 39.559  -32.617 1.00 72.29  ? 811  DG  P "O5'" 1 
ATOM   7430 C  "C5'" . DG  C 3 10  ? 25.373 39.819  -31.565 1.00 73.05  ? 811  DG  P "C5'" 1 
ATOM   7431 C  "C4'" . DG  C 3 10  ? 24.818 38.526  -30.999 1.00 72.23  ? 811  DG  P "C4'" 1 
ATOM   7432 O  "O4'" . DG  C 3 10  ? 23.883 37.941  -31.945 1.00 71.91  ? 811  DG  P "O4'" 1 
ATOM   7433 C  "C3'" . DG  C 3 10  ? 25.869 37.450  -30.707 1.00 71.20  ? 811  DG  P "C3'" 1 
ATOM   7434 O  "O3'" . DG  C 3 10  ? 25.664 36.900  -29.411 1.00 71.45  ? 811  DG  P "O3'" 1 
ATOM   7435 C  "C2'" . DG  C 3 10  ? 25.630 36.413  -31.801 1.00 70.74  ? 811  DG  P "C2'" 1 
ATOM   7436 C  "C1'" . DG  C 3 10  ? 24.140 36.564  -32.055 1.00 71.81  ? 811  DG  P "C1'" 1 
ATOM   7437 N  N9    . DG  C 3 10  ? 23.730 36.111  -33.384 1.00 70.68  ? 811  DG  P N9    1 
ATOM   7438 C  C8    . DG  C 3 10  ? 24.182 36.577  -34.593 1.00 69.21  ? 811  DG  P C8    1 
ATOM   7439 N  N7    . DG  C 3 10  ? 23.640 35.979  -35.618 1.00 67.70  ? 811  DG  P N7    1 
ATOM   7440 C  C5    . DG  C 3 10  ? 22.775 35.053  -35.052 1.00 69.65  ? 811  DG  P C5    1 
ATOM   7441 C  C6    . DG  C 3 10  ? 21.914 34.114  -35.669 1.00 70.13  ? 811  DG  P C6    1 
ATOM   7442 O  O6    . DG  C 3 10  ? 21.740 33.912  -36.879 1.00 68.69  ? 811  DG  P O6    1 
ATOM   7443 N  N1    . DG  C 3 10  ? 21.211 33.364  -34.729 1.00 72.90  ? 811  DG  P N1    1 
ATOM   7444 C  C2    . DG  C 3 10  ? 21.325 33.506  -33.365 1.00 74.59  ? 811  DG  P C2    1 
ATOM   7445 N  N2    . DG  C 3 10  ? 20.571 32.695  -32.611 1.00 75.98  ? 811  DG  P N2    1 
ATOM   7446 N  N3    . DG  C 3 10  ? 22.129 34.382  -32.776 1.00 74.62  ? 811  DG  P N3    1 
ATOM   7447 C  C4    . DG  C 3 10  ? 22.821 35.119  -33.677 1.00 71.52  ? 811  DG  P C4    1 
ATOM   7448 P  P     . DT  C 3 11  ? 26.795 35.985  -28.726 1.00 73.69  ? 812  DT  P P     1 
ATOM   7449 O  OP1   . DT  C 3 11  ? 26.991 36.483  -27.346 1.00 78.59  ? 812  DT  P OP1   1 
ATOM   7450 O  OP2   . DT  C 3 11  ? 27.950 35.896  -29.647 1.00 69.74  ? 812  DT  P OP2   1 
ATOM   7451 O  "O5'" . DT  C 3 11  ? 26.116 34.542  -28.656 1.00 75.49  ? 812  DT  P "O5'" 1 
ATOM   7452 C  "C5'" . DT  C 3 11  ? 24.721 34.419  -28.883 1.00 77.96  ? 812  DT  P "C5'" 1 
ATOM   7453 C  "C4'" . DT  C 3 11  ? 24.213 33.067  -28.429 1.00 79.48  ? 812  DT  P "C4'" 1 
ATOM   7454 O  "O4'" . DT  C 3 11  ? 23.479 32.450  -29.513 1.00 78.43  ? 812  DT  P "O4'" 1 
ATOM   7455 C  "C3'" . DT  C 3 11  ? 25.295 32.072  -28.038 1.00 81.18  ? 812  DT  P "C3'" 1 
ATOM   7456 O  "O3'" . DT  C 3 11  ? 24.811 31.188  -27.029 1.00 86.33  ? 812  DT  P "O3'" 1 
ATOM   7457 C  "C2'" . DT  C 3 11  ? 25.571 31.343  -29.347 1.00 78.89  ? 812  DT  P "C2'" 1 
ATOM   7458 C  "C1'" . DT  C 3 11  ? 24.214 31.368  -30.049 1.00 77.71  ? 812  DT  P "C1'" 1 
ATOM   7459 N  N1    . DT  C 3 11  ? 24.324 31.552  -31.530 1.00 73.16  ? 812  DT  P N1    1 
ATOM   7460 C  C2    . DT  C 3 11  ? 23.554 30.777  -32.366 1.00 73.35  ? 812  DT  P C2    1 
ATOM   7461 O  O2    . DT  C 3 11  ? 22.763 29.943  -31.964 1.00 77.65  ? 812  DT  P O2    1 
ATOM   7462 N  N3    . DT  C 3 11  ? 23.741 31.019  -33.702 1.00 68.78  ? 812  DT  P N3    1 
ATOM   7463 C  C4    . DT  C 3 11  ? 24.605 31.934  -34.274 1.00 65.29  ? 812  DT  P C4    1 
ATOM   7464 O  O4    . DT  C 3 11  ? 24.704 32.078  -35.490 1.00 61.99  ? 812  DT  P O4    1 
ATOM   7465 C  C5    . DT  C 3 11  ? 25.386 32.708  -33.345 1.00 65.08  ? 812  DT  P C5    1 
ATOM   7466 C  C7    . DT  C 3 11  ? 26.359 33.728  -33.855 1.00 63.64  ? 812  DT  P C7    1 
ATOM   7467 C  C6    . DT  C 3 11  ? 25.213 32.483  -32.032 1.00 68.30  ? 812  DT  P C6    1 
ATOM   7468 P  P     . DT  C 3 12  ? 25.680 29.915  -26.563 1.00 79.72  ? 813  DT  P P     1 
ATOM   7469 O  OP1   . DT  C 3 12  ? 25.310 29.614  -25.163 1.00 81.94  ? 813  DT  P OP1   1 
ATOM   7470 O  OP2   . DT  C 3 12  ? 27.102 30.139  -26.913 1.00 78.04  ? 813  DT  P OP2   1 
ATOM   7471 O  "O5'" . DT  C 3 12  ? 25.122 28.732  -27.475 1.00 77.71  ? 813  DT  P "O5'" 1 
ATOM   7472 C  "C5'" . DT  C 3 12  ? 23.723 28.507  -27.546 1.00 77.27  ? 813  DT  P "C5'" 1 
ATOM   7473 C  "C4'" . DT  C 3 12  ? 23.418 27.246  -28.326 1.00 78.27  ? 813  DT  P "C4'" 1 
ATOM   7474 O  "O4'" . DT  C 3 12  ? 23.505 27.519  -29.750 1.00 75.34  ? 813  DT  P "O4'" 1 
ATOM   7475 C  "C3'" . DT  C 3 12  ? 24.368 26.082  -28.062 1.00 82.19  ? 813  DT  P "C3'" 1 
ATOM   7476 O  "O3'" . DT  C 3 12  ? 23.641 24.867  -28.096 1.00 85.06  ? 813  DT  P "O3'" 1 
ATOM   7477 C  "C2'" . DT  C 3 12  ? 25.350 26.185  -29.227 1.00 80.54  ? 813  DT  P "C2'" 1 
ATOM   7478 C  "C1'" . DT  C 3 12  ? 24.427 26.634  -30.346 1.00 76.23  ? 813  DT  P "C1'" 1 
ATOM   7479 N  N1    . DT  C 3 12  ? 25.116 27.352  -31.457 1.00 72.36  ? 813  DT  P N1    1 
ATOM   7480 C  C2    . DT  C 3 12  ? 24.792 27.035  -32.752 1.00 72.22  ? 813  DT  P C2    1 
ATOM   7481 O  O2    . DT  C 3 12  ? 23.972 26.184  -33.044 1.00 75.13  ? 813  DT  P O2    1 
ATOM   7482 N  N3    . DT  C 3 12  ? 25.466 27.751  -33.704 1.00 70.53  ? 813  DT  P N3    1 
ATOM   7483 C  C4    . DT  C 3 12  ? 26.413 28.735  -33.495 1.00 68.68  ? 813  DT  P C4    1 
ATOM   7484 O  O4    . DT  C 3 12  ? 26.965 29.323  -34.421 1.00 66.66  ? 813  DT  P O4    1 
ATOM   7485 C  C5    . DT  C 3 12  ? 26.708 29.024  -32.113 1.00 68.52  ? 813  DT  P C5    1 
ATOM   7486 C  C7    . DT  C 3 12  ? 27.724 30.071  -31.767 1.00 66.23  ? 813  DT  P C7    1 
ATOM   7487 C  C6    . DT  C 3 12  ? 26.051 28.327  -31.168 1.00 70.99  ? 813  DT  P C6    1 
ATOM   7488 P  P     . DC  C 3 13  ? 24.256 23.522  -27.469 1.00 91.07  ? 814  DC  P P     1 
ATOM   7489 O  OP1   . DC  C 3 13  ? 23.450 23.174  -26.278 1.00 94.28  ? 814  DC  P OP1   1 
ATOM   7490 O  OP2   . DC  C 3 13  ? 25.721 23.689  -27.338 1.00 93.46  ? 814  DC  P OP2   1 
ATOM   7491 O  "O5'" . DC  C 3 13  ? 23.989 22.439  -28.610 1.00 88.57  ? 814  DC  P "O5'" 1 
ATOM   7492 C  "C5'" . DC  C 3 13  ? 22.957 22.664  -29.562 1.00 83.81  ? 814  DC  P "C5'" 1 
ATOM   7493 C  "C4'" . DC  C 3 13  ? 23.303 22.022  -30.891 1.00 82.90  ? 814  DC  P "C4'" 1 
ATOM   7494 O  "O4'" . DC  C 3 13  ? 23.925 22.999  -31.770 1.00 79.10  ? 814  DC  P "O4'" 1 
ATOM   7495 C  "C3'" . DC  C 3 13  ? 24.277 20.847  -30.804 1.00 86.59  ? 814  DC  P "C3'" 1 
ATOM   7496 O  "O3'" . DC  C 3 13  ? 23.826 19.802  -31.641 1.00 89.35  ? 814  DC  P "O3'" 1 
ATOM   7497 C  "C2'" . DC  C 3 13  ? 25.591 21.444  -31.309 1.00 85.02  ? 814  DC  P "C2'" 1 
ATOM   7498 C  "C1'" . DC  C 3 13  ? 25.082 22.433  -32.343 1.00 80.34  ? 814  DC  P "C1'" 1 
ATOM   7499 N  N1    . DC  C 3 13  ? 26.041 23.534  -32.659 1.00 74.99  ? 814  DC  P N1    1 
ATOM   7500 C  C2    . DC  C 3 13  ? 26.300 23.866  -33.994 1.00 74.43  ? 814  DC  P C2    1 
ATOM   7501 O  O2    . DC  C 3 13  ? 25.733 23.230  -34.890 1.00 76.86  ? 814  DC  P O2    1 
ATOM   7502 N  N3    . DC  C 3 13  ? 27.171 24.872  -34.263 1.00 71.82  ? 814  DC  P N3    1 
ATOM   7503 C  C4    . DC  C 3 13  ? 27.761 25.529  -33.263 1.00 70.42  ? 814  DC  P C4    1 
ATOM   7504 N  N4    . DC  C 3 13  ? 28.611 26.514  -33.572 1.00 67.34  ? 814  DC  P N4    1 
ATOM   7505 C  C5    . DC  C 3 13  ? 27.507 25.205  -31.899 1.00 71.81  ? 814  DC  P C5    1 
ATOM   7506 C  C6    . DC  C 3 13  ? 26.651 24.210  -31.647 1.00 73.43  ? 814  DC  P C6    1 
ATOM   7507 P  P     . DG  C 3 14  ? 24.292 18.290  -31.379 1.00 95.62  ? 815  DG  P P     1 
ATOM   7508 O  OP1   . DG  C 3 14  ? 23.107 17.525  -30.931 1.00 97.83  ? 815  DG  P OP1   1 
ATOM   7509 O  OP2   . DG  C 3 14  ? 25.504 18.322  -30.531 1.00 96.93  ? 815  DG  P OP2   1 
ATOM   7510 O  "O5'" . DG  C 3 14  ? 24.713 17.784  -32.834 1.00 97.94  ? 815  DG  P "O5'" 1 
ATOM   7511 C  "C5'" . DG  C 3 14  ? 23.915 18.131  -33.962 1.00 95.16  ? 815  DG  P "C5'" 1 
ATOM   7512 C  "C4'" . DG  C 3 14  ? 24.758 18.176  -35.222 1.00 95.63  ? 815  DG  P "C4'" 1 
ATOM   7513 O  "O4'" . DG  C 3 14  ? 25.453 19.448  -35.297 1.00 90.71  ? 815  DG  P "O4'" 1 
ATOM   7514 C  "C3'" . DG  C 3 14  ? 25.834 17.089  -35.311 1.00 100.65 ? 815  DG  P "C3'" 1 
ATOM   7515 O  "O3'" . DG  C 3 14  ? 25.816 16.483  -36.592 1.00 105.21 ? 815  DG  P "O3'" 1 
ATOM   7516 C  "C2'" . DG  C 3 14  ? 27.135 17.850  -35.071 1.00 99.01  ? 815  DG  P "C2'" 1 
ATOM   7517 C  "C1'" . DG  C 3 14  ? 26.801 19.224  -35.627 1.00 93.18  ? 815  DG  P "C1'" 1 
ATOM   7518 N  N9    . DG  C 3 14  ? 27.614 20.285  -35.042 1.00 89.99  ? 815  DG  P N9    1 
ATOM   7519 C  C8    . DG  C 3 14  ? 27.781 20.557  -33.706 1.00 88.38  ? 815  DG  P C8    1 
ATOM   7520 N  N7    . DG  C 3 14  ? 28.580 21.560  -33.476 1.00 85.19  ? 815  DG  P N7    1 
ATOM   7521 C  C5    . DG  C 3 14  ? 28.976 21.976  -34.740 1.00 84.54  ? 815  DG  P C5    1 
ATOM   7522 C  C6    . DG  C 3 14  ? 29.841 23.027  -35.123 1.00 81.41  ? 815  DG  P C6    1 
ATOM   7523 O  O6    . DG  C 3 14  ? 30.450 23.822  -34.395 1.00 77.99  ? 815  DG  P O6    1 
ATOM   7524 N  N1    . DG  C 3 14  ? 29.972 23.107  -36.507 1.00 82.22  ? 815  DG  P N1    1 
ATOM   7525 C  C2    . DG  C 3 14  ? 29.342 22.280  -37.406 1.00 85.12  ? 815  DG  P C2    1 
ATOM   7526 N  N2    . DG  C 3 14  ? 29.592 22.506  -38.703 1.00 86.62  ? 815  DG  P N2    1 
ATOM   7527 N  N3    . DG  C 3 14  ? 28.529 21.291  -37.060 1.00 87.33  ? 815  DG  P N3    1 
ATOM   7528 C  C4    . DG  C 3 14  ? 28.390 21.201  -35.715 1.00 87.17  ? 815  DG  P C4    1 
ATOM   7529 P  P     . DG  C 3 15  ? 26.552 15.074  -36.823 1.00 114.88 ? 816  DG  P P     1 
ATOM   7530 O  OP1   . DG  C 3 15  ? 25.590 14.186  -37.513 1.00 119.61 ? 816  DG  P OP1   1 
ATOM   7531 O  OP2   . DG  C 3 15  ? 27.141 14.654  -35.532 1.00 116.69 ? 816  DG  P OP2   1 
ATOM   7532 O  "O5'" . DG  C 3 15  ? 27.754 15.423  -37.821 1.00 118.36 ? 816  DG  P "O5'" 1 
ATOM   7533 C  "C5'" . DG  C 3 15  ? 27.504 15.534  -39.217 1.00 123.35 ? 816  DG  P "C5'" 1 
ATOM   7534 C  "C4'" . DG  C 3 15  ? 28.630 16.273  -39.916 1.00 126.58 ? 816  DG  P "C4'" 1 
ATOM   7535 O  "O4'" . DG  C 3 15  ? 28.718 17.616  -39.402 1.00 115.23 ? 816  DG  P "O4'" 1 
ATOM   7536 C  "C3'" . DG  C 3 15  ? 30.014 15.693  -39.700 1.00 139.58 ? 816  DG  P "C3'" 1 
ATOM   7537 O  "O3'" . DG  C 3 15  ? 30.260 14.664  -40.642 1.00 163.37 ? 816  DG  P "O3'" 1 
ATOM   7538 C  "C2'" . DG  C 3 15  ? 30.915 16.896  -39.957 1.00 129.00 ? 816  DG  P "C2'" 1 
ATOM   7539 C  "C1'" . DG  C 3 15  ? 30.051 18.080  -39.521 1.00 114.60 ? 816  DG  P "C1'" 1 
ATOM   7540 N  N9    . DG  C 3 15  ? 30.449 18.681  -38.249 1.00 105.62 ? 816  DG  P N9    1 
ATOM   7541 C  C8    . DG  C 3 15  ? 29.963 18.372  -37.002 1.00 103.78 ? 816  DG  P C8    1 
ATOM   7542 N  N7    . DG  C 3 15  ? 30.491 19.086  -36.047 1.00 100.15 ? 816  DG  P N7    1 
ATOM   7543 C  C5    . DG  C 3 15  ? 31.379 19.930  -36.703 1.00 98.33  ? 816  DG  P C5    1 
ATOM   7544 C  C6    . DG  C 3 15  ? 32.235 20.934  -36.187 1.00 91.69  ? 816  DG  P C6    1 
ATOM   7545 O  O6    . DG  C 3 15  ? 32.384 21.284  -35.007 1.00 87.82  ? 816  DG  P O6    1 
ATOM   7546 N  N1    . DG  C 3 15  ? 32.969 21.556  -37.196 1.00 90.35  ? 816  DG  P N1    1 
ATOM   7547 C  C2    . DG  C 3 15  ? 32.885 21.247  -38.534 1.00 95.57  ? 816  DG  P C2    1 
ATOM   7548 N  N2    . DG  C 3 15  ? 33.673 21.952  -39.360 1.00 96.82  ? 816  DG  P N2    1 
ATOM   7549 N  N3    . DG  C 3 15  ? 32.085 20.309  -39.030 1.00 99.86  ? 816  DG  P N3    1 
ATOM   7550 C  C4    . DG  C 3 15  ? 31.363 19.695  -38.061 1.00 101.04 ? 816  DG  P C4    1 
HETATM 7551 P  P     . G47 C 3 16  ? 31.495 13.658  -40.432 1.00 63.98  ? 817  G47 P P     1 
HETATM 7552 O  O1P   . G47 C 3 16  ? 31.588 13.317  -38.963 1.00 65.56  ? 817  G47 P O1P   1 
HETATM 7553 O  O2P   . G47 C 3 16  ? 31.356 12.554  -41.456 1.00 68.47  ? 817  G47 P O2P   1 
HETATM 7554 O  "O5'" . G47 C 3 16  ? 32.792 14.529  -40.819 1.00 61.57  ? 817  G47 P "O5'" 1 
HETATM 7555 C  "C5'" . G47 C 3 16  ? 33.140 14.728  -42.184 1.00 60.60  ? 817  G47 P "C5'" 1 
HETATM 7556 C  "C4'" . G47 C 3 16  ? 34.296 15.715  -42.289 1.00 59.16  ? 817  G47 P "C4'" 1 
HETATM 7557 O  "O4'" . G47 C 3 16  ? 33.939 16.981  -41.719 1.00 62.26  ? 817  G47 P "O4'" 1 
HETATM 7558 C  "C3'" . G47 C 3 16  ? 35.524 15.268  -41.515 1.00 53.99  ? 817  G47 P "C3'" 1 
HETATM 7559 O  "O3'" . G47 C 3 16  ? 36.402 14.413  -42.253 1.00 46.05  ? 817  G47 P "O3'" 1 
HETATM 7560 C  "C2'" . G47 C 3 16  ? 36.212 16.573  -41.179 1.00 57.06  ? 817  G47 P "C2'" 1 
HETATM 7561 C  "C1'" . G47 C 3 16  ? 35.068 17.562  -41.048 1.00 61.10  ? 817  G47 P "C1'" 1 
HETATM 7562 N  N9    . G47 C 3 16  ? 34.779 17.797  -39.606 1.00 61.70  ? 817  G47 P N9    1 
HETATM 7563 C  C8    . G47 C 3 16  ? 33.886 17.133  -38.853 1.00 62.24  ? 817  G47 P C8    1 
HETATM 7564 N  N7    . G47 C 3 16  ? 33.861 17.589  -37.574 1.00 62.56  ? 817  G47 P N7    1 
HETATM 7565 C  C5    . G47 C 3 16  ? 34.773 18.573  -37.490 1.00 62.94  ? 817  G47 P C5    1 
HETATM 7566 C  C6    . G47 C 3 16  ? 35.270 19.485  -36.432 1.00 61.63  ? 817  G47 P C6    1 
HETATM 7567 O  O6    . G47 C 3 16  ? 34.809 19.435  -35.270 1.00 58.29  ? 817  G47 P O6    1 
HETATM 7568 N  N1    . G47 C 3 16  ? 36.226 20.365  -36.761 1.00 62.93  ? 817  G47 P N1    1 
HETATM 7569 C  C2    . G47 C 3 16  ? 36.742 20.438  -38.004 1.00 63.54  ? 817  G47 P C2    1 
HETATM 7570 N  N2    . G47 C 3 16  ? 37.706 21.353  -38.253 1.00 64.67  ? 817  G47 P N2    1 
HETATM 7571 N  N3    . G47 C 3 16  ? 36.330 19.631  -39.014 1.00 63.92  ? 817  G47 P N3    1 
HETATM 7572 C  C4    . G47 C 3 16  ? 35.371 18.702  -38.827 1.00 62.44  ? 817  G47 P C4    1 
HETATM 7573 C  C6A   . G47 C 3 16  ? 38.590 21.244  -39.403 1.00 64.37  ? 817  G47 P C6A   1 
HETATM 7574 C  C7A   . G47 C 3 16  ? 37.930 21.628  -40.723 1.00 64.51  ? 817  G47 P C7A   1 
HETATM 7575 S  SG    . G47 C 3 16  ? 39.187 21.929  -41.989 1.00 69.70  ? 817  G47 P SG    1 
ATOM   7576 P  P     . DC  C 3 17  ? 37.385 13.411  -41.467 1.00 99.86  ? 818  DC  P P     1 
ATOM   7577 O  OP1   . DC  C 3 17  ? 37.921 12.443  -42.449 1.00 101.51 ? 818  DC  P OP1   1 
ATOM   7578 O  OP2   . DC  C 3 17  ? 36.660 12.931  -40.270 1.00 97.66  ? 818  DC  P OP2   1 
ATOM   7579 O  "O5'" . DC  C 3 17  ? 38.578 14.349  -40.963 1.00 86.80  ? 818  DC  P "O5'" 1 
ATOM   7580 C  "C5'" . DC  C 3 17  ? 39.464 14.936  -41.906 1.00 82.17  ? 818  DC  P "C5'" 1 
ATOM   7581 C  "C4'" . DC  C 3 17  ? 40.267 16.061  -41.275 1.00 75.49  ? 818  DC  P "C4'" 1 
ATOM   7582 O  "O4'" . DC  C 3 17  ? 39.366 17.056  -40.720 1.00 74.18  ? 818  DC  P "O4'" 1 
ATOM   7583 C  "C3'" . DC  C 3 17  ? 41.140 15.660  -40.101 1.00 70.60  ? 818  DC  P "C3'" 1 
ATOM   7584 O  "O3'" . DC  C 3 17  ? 42.374 15.105  -40.551 1.00 67.60  ? 818  DC  P "O3'" 1 
ATOM   7585 C  "C2'" . DC  C 3 17  ? 41.344 17.007  -39.420 1.00 66.82  ? 818  DC  P "C2'" 1 
ATOM   7586 C  "C1'" . DC  C 3 17  ? 39.950 17.623  -39.553 1.00 69.30  ? 818  DC  P "C1'" 1 
ATOM   7587 N  N1    . DC  C 3 17  ? 39.070 17.333  -38.379 1.00 71.40  ? 818  DC  P N1    1 
ATOM   7588 C  C2    . DC  C 3 17  ? 39.290 18.002  -37.169 1.00 69.34  ? 818  DC  P C2    1 
ATOM   7589 O  O2    . DC  C 3 17  ? 40.205 18.832  -37.100 1.00 68.14  ? 818  DC  P O2    1 
ATOM   7590 N  N3    . DC  C 3 17  ? 38.492 17.716  -36.108 1.00 68.14  ? 818  DC  P N3    1 
ATOM   7591 C  C4    . DC  C 3 17  ? 37.518 16.812  -36.229 1.00 68.97  ? 818  DC  P C4    1 
ATOM   7592 N  N4    . DC  C 3 17  ? 36.755 16.562  -35.161 1.00 69.33  ? 818  DC  P N4    1 
ATOM   7593 C  C5    . DC  C 3 17  ? 37.283 16.121  -37.451 1.00 72.07  ? 818  DC  P C5    1 
ATOM   7594 C  C6    . DC  C 3 17  ? 38.079 16.405  -38.485 1.00 73.57  ? 818  DC  P C6    1 
ATOM   7595 P  P     . DG  C 3 18  ? 43.194 14.100  -39.599 1.00 65.49  ? 819  DG  P P     1 
ATOM   7596 O  OP1   . DG  C 3 18  ? 44.350 13.576  -40.361 1.00 65.17  ? 819  DG  P OP1   1 
ATOM   7597 O  OP2   . DG  C 3 18  ? 42.223 13.154  -39.003 1.00 64.90  ? 819  DG  P OP2   1 
ATOM   7598 O  "O5'" . DG  C 3 18  ? 43.740 15.040  -38.425 1.00 59.32  ? 819  DG  P "O5'" 1 
ATOM   7599 C  "C5'" . DG  C 3 18  ? 44.723 16.031  -38.701 1.00 56.97  ? 819  DG  P "C5'" 1 
ATOM   7600 C  "C4'" . DG  C 3 18  ? 45.069 16.808  -37.443 1.00 55.61  ? 819  DG  P "C4'" 1 
ATOM   7601 O  "O4'" . DG  C 3 18  ? 43.895 17.504  -36.976 1.00 58.59  ? 819  DG  P "O4'" 1 
ATOM   7602 C  "C3'" . DG  C 3 18  ? 45.513 15.949  -36.274 1.00 51.17  ? 819  DG  P "C3'" 1 
ATOM   7603 O  "O3'" . DG  C 3 18  ? 46.908 15.778  -36.312 1.00 49.74  ? 819  DG  P "O3'" 1 
ATOM   7604 C  "C2'" . DG  C 3 18  ? 45.099 16.772  -35.062 1.00 50.13  ? 819  DG  P "C2'" 1 
ATOM   7605 C  "C1'" . DG  C 3 18  ? 43.863 17.505  -35.561 1.00 56.10  ? 819  DG  P "C1'" 1 
ATOM   7606 N  N9    . DG  C 3 18  ? 42.599 16.923  -35.122 1.00 60.71  ? 819  DG  P N9    1 
ATOM   7607 C  C8    . DG  C 3 18  ? 41.687 16.242  -35.892 1.00 63.11  ? 819  DG  P C8    1 
ATOM   7608 N  N7    . DG  C 3 18  ? 40.632 15.860  -35.228 1.00 65.08  ? 819  DG  P N7    1 
ATOM   7609 C  C5    . DG  C 3 18  ? 40.856 16.322  -33.937 1.00 62.86  ? 819  DG  P C5    1 
ATOM   7610 C  C6    . DG  C 3 18  ? 40.057 16.207  -32.774 1.00 63.29  ? 819  DG  P C6    1 
ATOM   7611 O  O6    . DG  C 3 18  ? 38.955 15.654  -32.652 1.00 65.36  ? 819  DG  P O6    1 
ATOM   7612 N  N1    . DG  C 3 18  ? 40.659 16.815  -31.674 1.00 62.84  ? 819  DG  P N1    1 
ATOM   7613 C  C2    . DG  C 3 18  ? 41.877 17.456  -31.698 1.00 60.57  ? 819  DG  P C2    1 
ATOM   7614 N  N2    . DG  C 3 18  ? 42.300 17.988  -30.542 1.00 59.51  ? 819  DG  P N2    1 
ATOM   7615 N  N3    . DG  C 3 18  ? 42.631 17.570  -32.780 1.00 59.40  ? 819  DG  P N3    1 
ATOM   7616 C  C4    . DG  C 3 18  ? 42.061 16.981  -33.858 1.00 60.76  ? 819  DG  P C4    1 
ATOM   7617 P  P     . DC  C 3 19  ? 47.559 14.450  -35.696 1.00 51.17  ? 820  DC  P P     1 
ATOM   7618 O  OP1   . DC  C 3 19  ? 49.005 14.482  -36.007 1.00 52.05  ? 820  DC  P OP1   1 
ATOM   7619 O  OP2   . DC  C 3 19  ? 46.717 13.315  -36.131 1.00 52.19  ? 820  DC  P OP2   1 
ATOM   7620 O  "O5'" . DC  C 3 19  ? 47.358 14.617  -34.120 1.00 47.12  ? 820  DC  P "O5'" 1 
ATOM   7621 C  "C5'" . DC  C 3 19  ? 48.053 15.640  -33.418 1.00 44.26  ? 820  DC  P "C5'" 1 
ATOM   7622 C  "C4'" . DC  C 3 19  ? 47.655 15.651  -31.955 1.00 43.44  ? 820  DC  P "C4'" 1 
ATOM   7623 O  "O4'" . DC  C 3 19  ? 46.304 16.146  -31.823 1.00 44.35  ? 820  DC  P "O4'" 1 
ATOM   7624 C  "C3'" . DC  C 3 19  ? 47.615 14.289  -31.286 1.00 43.48  ? 820  DC  P "C3'" 1 
ATOM   7625 O  "O3'" . DC  C 3 19  ? 48.905 13.919  -30.850 1.00 43.38  ? 820  DC  P "O3'" 1 
ATOM   7626 C  "C2'" . DC  C 3 19  ? 46.693 14.552  -30.105 1.00 44.48  ? 820  DC  P "C2'" 1 
ATOM   7627 C  "C1'" . DC  C 3 19  ? 45.692 15.537  -30.693 1.00 46.13  ? 820  DC  P "C1'" 1 
ATOM   7628 N  N1    . DC  C 3 19  ? 44.418 14.906  -31.113 1.00 48.40  ? 820  DC  P N1    1 
ATOM   7629 C  C2    . DC  C 3 19  ? 43.424 14.682  -30.160 1.00 49.12  ? 820  DC  P C2    1 
ATOM   7630 O  O2    . DC  C 3 19  ? 43.641 15.013  -28.987 1.00 49.14  ? 820  DC  P O2    1 
ATOM   7631 N  N3    . DC  C 3 19  ? 42.257 14.115  -30.550 1.00 48.66  ? 820  DC  P N3    1 
ATOM   7632 C  C4    . DC  C 3 19  ? 42.075 13.776  -31.828 1.00 48.77  ? 820  DC  P C4    1 
ATOM   7633 N  N4    . DC  C 3 19  ? 40.908 13.221  -32.171 1.00 49.27  ? 820  DC  P N4    1 
ATOM   7634 C  C5    . DC  C 3 19  ? 43.082 13.994  -32.815 1.00 48.67  ? 820  DC  P C5    1 
ATOM   7635 C  C6    . DC  C 3 19  ? 44.226 14.556  -32.417 1.00 48.55  ? 820  DC  P C6    1 
ATOM   7636 P  P     . DC  C 3 20  ? 49.222 12.388  -30.499 1.00 48.73  ? 821  DC  P P     1 
ATOM   7637 O  OP1   . DC  C 3 20  ? 50.642 12.310  -30.090 1.00 49.13  ? 821  DC  P OP1   1 
ATOM   7638 O  OP2   . DC  C 3 20  ? 48.733 11.579  -31.636 1.00 50.49  ? 821  DC  P OP2   1 
ATOM   7639 O  "O5'" . DC  C 3 20  ? 48.293 12.068  -29.235 1.00 43.19  ? 821  DC  P "O5'" 1 
ATOM   7640 C  "C5'" . DC  C 3 20  ? 48.596 12.632  -27.963 1.00 46.11  ? 821  DC  P "C5'" 1 
ATOM   7641 C  "C4'" . DC  C 3 20  ? 47.616 12.148  -26.908 1.00 51.36  ? 821  DC  P "C4'" 1 
ATOM   7642 O  "O4'" . DC  C 3 20  ? 46.287 12.627  -27.217 1.00 41.02  ? 821  DC  P "O4'" 1 
ATOM   7643 C  "C3'" . DC  C 3 20  ? 47.462 10.642  -26.821 1.00 53.53  ? 821  DC  P "C3'" 1 
ATOM   7644 O  "O3'" . DC  C 3 20  ? 48.485 10.094  -26.000 1.00 64.31  ? 821  DC  P "O3'" 1 
ATOM   7645 C  "C2'" . DC  C 3 20  ? 46.088 10.500  -26.172 1.00 48.86  ? 821  DC  P "C2'" 1 
ATOM   7646 C  "C1'" . DC  C 3 20  ? 45.326 11.699  -26.733 1.00 47.69  ? 821  DC  P "C1'" 1 
ATOM   7647 N  N1    . DC  C 3 20  ? 44.387 11.353  -27.841 1.00 48.63  ? 821  DC  P N1    1 
ATOM   7648 C  C2    . DC  C 3 20  ? 43.063 11.015  -27.542 1.00 50.89  ? 821  DC  P C2    1 
ATOM   7649 O  O2    . DC  C 3 20  ? 42.701 11.000  -26.359 1.00 55.00  ? 821  DC  P O2    1 
ATOM   7650 N  N3    . DC  C 3 20  ? 42.217 10.713  -28.559 1.00 48.82  ? 821  DC  P N3    1 
ATOM   7651 C  C4    . DC  C 3 20  ? 42.654 10.741  -29.820 1.00 47.70  ? 821  DC  P C4    1 
ATOM   7652 N  N4    . DC  C 3 20  ? 41.787 10.439  -30.792 1.00 49.76  ? 821  DC  P N4    1 
ATOM   7653 C  C5    . DC  C 3 20  ? 44.000 11.084  -30.143 1.00 43.85  ? 821  DC  P C5    1 
ATOM   7654 C  C6    . DC  C 3 20  ? 44.823 11.380  -29.133 1.00 46.40  ? 821  DC  P C6    1 
HETATM 7655 P  P     . DDG C 3 21  ? 48.824 8.627   -26.401 1.00 44.88  ? 822  DDG P P     1 
HETATM 7656 O  OP1   . DDG C 3 21  ? 49.994 8.568   -25.450 1.00 44.50  ? 822  DDG P OP1   1 
HETATM 7657 O  OP2   . DDG C 3 21  ? 48.957 8.136   -27.823 1.00 47.19  ? 822  DDG P OP2   1 
HETATM 7658 O  "O5'" . DDG C 3 21  ? 47.551 7.913   -25.717 1.00 38.20  ? 822  DDG P "O5'" 1 
HETATM 7659 C  "C5'" . DDG C 3 21  ? 47.552 7.590   -24.330 1.00 41.37  ? 822  DDG P "C5'" 1 
HETATM 7660 C  "C4'" . DDG C 3 21  ? 46.138 7.216   -23.906 1.00 42.92  ? 822  DDG P "C4'" 1 
HETATM 7661 O  "O4'" . DDG C 3 21  ? 45.181 7.936   -24.687 1.00 43.48  ? 822  DDG P "O4'" 1 
HETATM 7662 C  "C3'" . DDG C 3 21  ? 45.895 5.742   -24.184 1.00 45.60  ? 822  DDG P "C3'" 1 
HETATM 7663 C  "C2'" . DDG C 3 21  ? 44.473 5.673   -24.710 1.00 46.52  ? 822  DDG P "C2'" 1 
HETATM 7664 C  "C1'" . DDG C 3 21  ? 44.064 7.107   -25.020 1.00 45.62  ? 822  DDG P "C1'" 1 
HETATM 7665 N  N9    . DDG C 3 21  ? 43.729 7.173   -26.467 1.00 44.24  ? 822  DDG P N9    1 
HETATM 7666 C  C8    . DDG C 3 21  ? 44.598 7.404   -27.469 1.00 45.49  ? 822  DDG P C8    1 
HETATM 7667 N  N7    . DDG C 3 21  ? 43.977 7.386   -28.678 1.00 45.12  ? 822  DDG P N7    1 
HETATM 7668 C  C5    . DDG C 3 21  ? 42.675 7.133   -28.457 1.00 44.68  ? 822  DDG P C5    1 
HETATM 7669 C  C6    . DDG C 3 21  ? 41.461 6.978   -29.293 1.00 46.08  ? 822  DDG P C6    1 
HETATM 7670 O  O6    . DDG C 3 21  ? 41.512 7.084   -30.539 1.00 48.17  ? 822  DDG P O6    1 
HETATM 7671 N  N1    . DDG C 3 21  ? 40.303 6.720   -28.673 1.00 46.08  ? 822  DDG P N1    1 
HETATM 7672 C  C2    . DDG C 3 21  ? 40.213 6.600   -27.335 1.00 45.87  ? 822  DDG P C2    1 
HETATM 7673 N  N2    . DDG C 3 21  ? 39.001 6.338   -26.790 1.00 45.28  ? 822  DDG P N2    1 
HETATM 7674 N  N3    . DDG C 3 21  ? 41.283 6.729   -26.508 1.00 45.11  ? 822  DDG P N3    1 
HETATM 7675 C  C4    . DDG C 3 21  ? 42.517 6.992   -27.001 1.00 44.38  ? 822  DDG P C4    1 
ATOM   7676 P  P     . DG  D 4 3   ? 44.445 0.828   -44.469 1.00 101.73 ? 703  DG  T P     1 
ATOM   7677 O  "O5'" . DG  D 4 3   ? 42.987 1.362   -44.859 1.00 100.92 ? 703  DG  T "O5'" 1 
ATOM   7678 C  "C5'" . DG  D 4 3   ? 42.690 2.756   -44.789 1.00 99.09  ? 703  DG  T "C5'" 1 
ATOM   7679 C  "C4'" . DG  D 4 3   ? 41.282 2.974   -44.265 1.00 96.79  ? 703  DG  T "C4'" 1 
ATOM   7680 O  "O4'" . DG  D 4 3   ? 40.359 2.227   -45.083 1.00 99.14  ? 703  DG  T "O4'" 1 
ATOM   7681 C  "C3'" . DG  D 4 3   ? 41.061 2.492   -42.840 1.00 92.04  ? 703  DG  T "C3'" 1 
ATOM   7682 O  "O3'" . DG  D 4 3   ? 41.256 3.577   -41.869 1.00 83.98  ? 703  DG  T "O3'" 1 
ATOM   7683 C  "C2'" . DG  D 4 3   ? 39.635 1.934   -42.830 1.00 95.73  ? 703  DG  T "C2'" 1 
ATOM   7684 C  "C1'" . DG  D 4 3   ? 39.294 1.722   -44.305 1.00 99.45  ? 703  DG  T "C1'" 1 
ATOM   7685 N  N9    . DG  D 4 3   ? 39.093 0.323   -44.670 1.00 103.79 ? 703  DG  T N9    1 
ATOM   7686 C  C8    . DG  D 4 3   ? 40.034 -0.678  -44.654 1.00 104.66 ? 703  DG  T C8    1 
ATOM   7687 N  N7    . DG  D 4 3   ? 39.572 -1.832  -45.050 1.00 104.57 ? 703  DG  T N7    1 
ATOM   7688 C  C5    . DG  D 4 3   ? 38.240 -1.580  -45.354 1.00 105.01 ? 703  DG  T C5    1 
ATOM   7689 C  C6    . DG  D 4 3   ? 37.234 -2.452  -45.833 1.00 106.65 ? 703  DG  T C6    1 
ATOM   7690 O  O6    . DG  D 4 3   ? 37.324 -3.660  -46.091 1.00 107.09 ? 703  DG  T O6    1 
ATOM   7691 N  N1    . DG  D 4 3   ? 36.020 -1.791  -46.009 1.00 106.94 ? 703  DG  T N1    1 
ATOM   7692 C  C2    . DG  D 4 3   ? 35.807 -0.456  -45.755 1.00 106.25 ? 703  DG  T C2    1 
ATOM   7693 N  N2    . DG  D 4 3   ? 34.568 0.001   -45.986 1.00 106.51 ? 703  DG  T N2    1 
ATOM   7694 N  N3    . DG  D 4 3   ? 36.741 0.372   -45.305 1.00 105.34 ? 703  DG  T N3    1 
ATOM   7695 C  C4    . DG  D 4 3   ? 37.930 -0.256  -45.128 1.00 104.99 ? 703  DG  T C4    1 
ATOM   7696 P  P     . DG  D 4 4   ? 40.461 4.986   -41.932 1.00 159.92 ? 704  DG  T P     1 
ATOM   7697 O  OP1   . DG  D 4 4   ? 40.694 5.685   -43.215 1.00 168.35 ? 704  DG  T OP1   1 
ATOM   7698 O  OP2   . DG  D 4 4   ? 40.820 5.693   -40.684 1.00 154.87 ? 704  DG  T OP2   1 
ATOM   7699 O  "O5'" . DG  D 4 4   ? 38.915 4.601   -41.799 1.00 145.30 ? 704  DG  T "O5'" 1 
ATOM   7700 C  "C5'" . DG  D 4 4   ? 38.374 4.243   -40.531 1.00 126.10 ? 704  DG  T "C5'" 1 
ATOM   7701 C  "C4'" . DG  D 4 4   ? 36.947 3.743   -40.676 1.00 113.39 ? 704  DG  T "C4'" 1 
ATOM   7702 O  "O4'" . DG  D 4 4   ? 36.942 2.474   -41.380 1.00 111.35 ? 704  DG  T "O4'" 1 
ATOM   7703 C  "C3'" . DG  D 4 4   ? 36.217 3.506   -39.362 1.00 101.28 ? 704  DG  T "C3'" 1 
ATOM   7704 O  "O3'" . DG  D 4 4   ? 34.871 3.922   -39.476 1.00 97.80  ? 704  DG  T "O3'" 1 
ATOM   7705 C  "C2'" . DG  D 4 4   ? 36.331 1.998   -39.151 1.00 98.84  ? 704  DG  T "C2'" 1 
ATOM   7706 C  "C1'" . DG  D 4 4   ? 36.364 1.464   -40.578 1.00 102.93 ? 704  DG  T "C1'" 1 
ATOM   7707 N  N9    . DG  D 4 4   ? 37.170 0.252   -40.714 1.00 98.38  ? 704  DG  T N9    1 
ATOM   7708 C  C8    . DG  D 4 4   ? 38.476 0.084   -40.320 1.00 96.24  ? 704  DG  T C8    1 
ATOM   7709 N  N7    . DG  D 4 4   ? 38.945 -1.107  -40.564 1.00 98.14  ? 704  DG  T N7    1 
ATOM   7710 C  C5    . DG  D 4 4   ? 37.881 -1.777  -41.155 1.00 100.27 ? 704  DG  T C5    1 
ATOM   7711 C  C6    . DG  D 4 4   ? 37.794 -3.108  -41.632 1.00 101.34 ? 704  DG  T C6    1 
ATOM   7712 O  O6    . DG  D 4 4   ? 38.672 -3.984  -41.628 1.00 101.82 ? 704  DG  T O6    1 
ATOM   7713 N  N1    . DG  D 4 4   ? 36.534 -3.385  -42.157 1.00 101.77 ? 704  DG  T N1    1 
ATOM   7714 C  C2    . DG  D 4 4   ? 35.491 -2.491  -42.213 1.00 100.51 ? 704  DG  T C2    1 
ATOM   7715 N  N2    . DG  D 4 4   ? 34.351 -2.942  -42.757 1.00 102.35 ? 704  DG  T N2    1 
ATOM   7716 N  N3    . DG  D 4 4   ? 35.558 -1.241  -41.768 1.00 98.92  ? 704  DG  T N3    1 
ATOM   7717 C  C4    . DG  D 4 4   ? 36.779 -0.955  -41.253 1.00 99.07  ? 704  DG  T C4    1 
ATOM   7718 P  P     . DG  D 4 5   ? 34.286 4.999   -38.441 1.00 90.76  ? 705  DG  T P     1 
ATOM   7719 O  OP1   . DG  D 4 5   ? 33.011 5.517   -38.987 1.00 92.66  ? 705  DG  T OP1   1 
ATOM   7720 O  OP2   . DG  D 4 5   ? 35.386 5.930   -38.103 1.00 89.29  ? 705  DG  T OP2   1 
ATOM   7721 O  "O5'" . DG  D 4 5   ? 33.956 4.132   -37.144 1.00 82.33  ? 705  DG  T "O5'" 1 
ATOM   7722 C  "C5'" . DG  D 4 5   ? 32.988 3.105   -37.206 1.00 79.84  ? 705  DG  T "C5'" 1 
ATOM   7723 C  "C4'" . DG  D 4 5   ? 32.755 2.523   -35.829 1.00 74.86  ? 705  DG  T "C4'" 1 
ATOM   7724 O  "O4'" . DG  D 4 5   ? 33.768 1.519   -35.548 1.00 74.32  ? 705  DG  T "O4'" 1 
ATOM   7725 C  "C3'" . DG  D 4 5   ? 32.884 3.518   -34.688 1.00 69.23  ? 705  DG  T "C3'" 1 
ATOM   7726 O  "O3'" . DG  D 4 5   ? 31.660 4.204   -34.480 1.00 66.82  ? 705  DG  T "O3'" 1 
ATOM   7727 C  "C2'" . DG  D 4 5   ? 33.220 2.591   -33.532 1.00 67.04  ? 705  DG  T "C2'" 1 
ATOM   7728 C  "C1'" . DG  D 4 5   ? 34.217 1.667   -34.208 1.00 69.47  ? 705  DG  T "C1'" 1 
ATOM   7729 N  N9    . DG  D 4 5   ? 35.567 2.219   -34.226 1.00 68.32  ? 705  DG  T N9    1 
ATOM   7730 C  C8    . DG  D 4 5   ? 36.274 2.650   -35.322 1.00 71.02  ? 705  DG  T C8    1 
ATOM   7731 N  N7    . DG  D 4 5   ? 37.461 3.106   -35.027 1.00 70.62  ? 705  DG  T N7    1 
ATOM   7732 C  C5    . DG  D 4 5   ? 37.540 2.979   -33.645 1.00 67.06  ? 705  DG  T C5    1 
ATOM   7733 C  C6    . DG  D 4 5   ? 38.594 3.303   -32.758 1.00 65.50  ? 705  DG  T C6    1 
ATOM   7734 O  O6    . DG  D 4 5   ? 39.701 3.793   -33.024 1.00 67.13  ? 705  DG  T O6    1 
ATOM   7735 N  N1    . DG  D 4 5   ? 38.264 3.011   -31.437 1.00 62.62  ? 705  DG  T N1    1 
ATOM   7736 C  C2    . DG  D 4 5   ? 37.069 2.468   -31.027 1.00 63.45  ? 705  DG  T C2    1 
ATOM   7737 N  N2    . DG  D 4 5   ? 36.933 2.254   -29.710 1.00 62.44  ? 705  DG  T N2    1 
ATOM   7738 N  N3    . DG  D 4 5   ? 36.077 2.155   -31.849 1.00 65.48  ? 705  DG  T N3    1 
ATOM   7739 C  C4    . DG  D 4 5   ? 36.382 2.435   -33.139 1.00 66.06  ? 705  DG  T C4    1 
ATOM   7740 P  P     . DC  D 4 6   ? 31.673 5.684   -33.855 1.00 60.89  ? 706  DC  T P     1 
ATOM   7741 O  OP1   . DC  D 4 6   ? 30.271 6.139   -33.746 1.00 63.42  ? 706  DC  T OP1   1 
ATOM   7742 O  OP2   . DC  D 4 6   ? 32.650 6.489   -34.620 1.00 62.46  ? 706  DC  T OP2   1 
ATOM   7743 O  "O5'" . DC  D 4 6   ? 32.258 5.471   -32.383 1.00 56.63  ? 706  DC  T "O5'" 1 
ATOM   7744 C  "C5'" . DC  D 4 6   ? 31.519 4.726   -31.425 1.00 53.41  ? 706  DC  T "C5'" 1 
ATOM   7745 C  "C4'" . DC  D 4 6   ? 32.202 4.758   -30.072 1.00 51.01  ? 706  DC  T "C4'" 1 
ATOM   7746 O  "O4'" . DC  D 4 6   ? 33.519 4.165   -30.165 1.00 50.72  ? 706  DC  T "O4'" 1 
ATOM   7747 C  "C3'" . DC  D 4 6   ? 32.466 6.142   -29.524 1.00 50.48  ? 706  DC  T "C3'" 1 
ATOM   7748 O  "O3'" . DC  D 4 6   ? 31.295 6.661   -28.927 1.00 51.95  ? 706  DC  T "O3'" 1 
ATOM   7749 C  "C2'" . DC  D 4 6   ? 33.550 5.853   -28.495 1.00 48.04  ? 706  DC  T "C2'" 1 
ATOM   7750 C  "C1'" . DC  D 4 6   ? 34.382 4.794   -29.225 1.00 49.63  ? 706  DC  T "C1'" 1 
ATOM   7751 N  N1    . DC  D 4 6   ? 35.554 5.361   -29.953 1.00 51.47  ? 706  DC  T N1    1 
ATOM   7752 C  C2    . DC  D 4 6   ? 36.707 5.712   -29.241 1.00 50.58  ? 706  DC  T C2    1 
ATOM   7753 O  O2    . DC  D 4 6   ? 36.734 5.544   -28.018 1.00 53.68  ? 706  DC  T O2    1 
ATOM   7754 N  N3    . DC  D 4 6   ? 37.766 6.225   -29.916 1.00 49.43  ? 706  DC  T N3    1 
ATOM   7755 C  C4    . DC  D 4 6   ? 37.697 6.392   -31.237 1.00 52.94  ? 706  DC  T C4    1 
ATOM   7756 N  N4    . DC  D 4 6   ? 38.764 6.902   -31.857 1.00 48.17  ? 706  DC  T N4    1 
ATOM   7757 C  C5    . DC  D 4 6   ? 36.531 6.042   -31.981 1.00 54.33  ? 706  DC  T C5    1 
ATOM   7758 C  C6    . DC  D 4 6   ? 35.493 5.536   -31.305 1.00 52.98  ? 706  DC  T C6    1 
ATOM   7759 P  P     . DG  D 4 7   ? 30.927 8.211   -29.121 1.00 51.08  ? 707  DG  T P     1 
ATOM   7760 O  OP1   . DG  D 4 7   ? 29.493 8.384   -28.800 1.00 51.18  ? 707  DG  T OP1   1 
ATOM   7761 O  OP2   . DG  D 4 7   ? 31.446 8.619   -30.444 1.00 56.64  ? 707  DG  T OP2   1 
ATOM   7762 O  "O5'" . DG  D 4 7   ? 31.791 8.944   -27.997 1.00 44.27  ? 707  DG  T "O5'" 1 
ATOM   7763 C  "C5'" . DG  D 4 7   ? 31.452 8.774   -26.629 1.00 42.91  ? 707  DG  T "C5'" 1 
ATOM   7764 C  "C4'" . DG  D 4 7   ? 32.584 9.226   -25.730 1.00 46.11  ? 707  DG  T "C4'" 1 
ATOM   7765 O  "O4'" . DG  D 4 7   ? 33.753 8.410   -25.978 1.00 45.27  ? 707  DG  T "O4'" 1 
ATOM   7766 C  "C3'" . DG  D 4 7   ? 33.066 10.649  -25.953 1.00 44.47  ? 707  DG  T "C3'" 1 
ATOM   7767 O  "O3'" . DG  D 4 7   ? 32.230 11.577  -25.253 1.00 46.24  ? 707  DG  T "O3'" 1 
ATOM   7768 C  "C2'" . DG  D 4 7   ? 34.463 10.585  -25.350 1.00 42.13  ? 707  DG  T "C2'" 1 
ATOM   7769 C  "C1'" . DG  D 4 7   ? 34.923 9.186   -25.767 1.00 43.94  ? 707  DG  T "C1'" 1 
ATOM   7770 N  N9    . DG  D 4 7   ? 35.717 9.182   -26.991 1.00 46.04  ? 707  DG  T N9    1 
ATOM   7771 C  C8    . DG  D 4 7   ? 35.277 8.901   -28.261 1.00 48.97  ? 707  DG  T C8    1 
ATOM   7772 N  N7    . DG  D 4 7   ? 36.214 8.984   -29.165 1.00 50.42  ? 707  DG  T N7    1 
ATOM   7773 C  C5    . DG  D 4 7   ? 37.347 9.345   -28.449 1.00 49.19  ? 707  DG  T C5    1 
ATOM   7774 C  C6    . DG  D 4 7   ? 38.669 9.581   -28.893 1.00 53.21  ? 707  DG  T C6    1 
ATOM   7775 O  O6    . DG  D 4 7   ? 39.114 9.515   -30.046 1.00 54.84  ? 707  DG  T O6    1 
ATOM   7776 N  N1    . DG  D 4 7   ? 39.514 9.925   -27.840 1.00 54.94  ? 707  DG  T N1    1 
ATOM   7777 C  C2    . DG  D 4 7   ? 39.130 10.029  -26.525 1.00 50.07  ? 707  DG  T C2    1 
ATOM   7778 N  N2    . DG  D 4 7   ? 40.082 10.374  -25.649 1.00 51.97  ? 707  DG  T N2    1 
ATOM   7779 N  N3    . DG  D 4 7   ? 37.894 9.810   -26.095 1.00 46.30  ? 707  DG  T N3    1 
ATOM   7780 C  C4    . DG  D 4 7   ? 37.058 9.473   -27.109 1.00 47.19  ? 707  DG  T C4    1 
ATOM   7781 P  P     . DG  D 4 8   ? 32.252 13.142  -25.632 1.00 56.12  ? 708  DG  T P     1 
ATOM   7782 O  OP1   . DG  D 4 8   ? 31.169 13.798  -24.867 1.00 53.14  ? 708  DG  T OP1   1 
ATOM   7783 O  OP2   . DG  D 4 8   ? 32.284 13.252  -27.105 1.00 58.05  ? 708  DG  T OP2   1 
ATOM   7784 O  "O5'" . DG  D 4 8   ? 33.655 13.663  -25.069 1.00 47.90  ? 708  DG  T "O5'" 1 
ATOM   7785 C  "C5'" . DG  D 4 8   ? 33.893 13.670  -23.668 1.00 47.31  ? 708  DG  T "C5'" 1 
ATOM   7786 C  "C4'" . DG  D 4 8   ? 35.310 14.114  -23.359 1.00 45.88  ? 708  DG  T "C4'" 1 
ATOM   7787 O  "O4'" . DG  D 4 8   ? 36.245 13.118  -23.834 1.00 48.24  ? 708  DG  T "O4'" 1 
ATOM   7788 C  "C3'" . DG  D 4 8   ? 35.742 15.409  -24.028 1.00 43.84  ? 708  DG  T "C3'" 1 
ATOM   7789 O  "O3'" . DG  D 4 8   ? 35.364 16.511  -23.228 1.00 43.88  ? 708  DG  T "O3'" 1 
ATOM   7790 C  "C2'" . DG  D 4 8   ? 37.254 15.248  -24.068 1.00 43.10  ? 708  DG  T "C2'" 1 
ATOM   7791 C  "C1'" . DG  D 4 8   ? 37.394 13.755  -24.364 1.00 47.17  ? 708  DG  T "C1'" 1 
ATOM   7792 N  N9    . DG  D 4 8   ? 37.474 13.448  -25.785 1.00 51.59  ? 708  DG  T N9    1 
ATOM   7793 C  C8    . DG  D 4 8   ? 36.466 12.977  -26.590 1.00 55.37  ? 708  DG  T C8    1 
ATOM   7794 N  N7    . DG  D 4 8   ? 36.832 12.792  -27.826 1.00 55.71  ? 708  DG  T N7    1 
ATOM   7795 C  C5    . DG  D 4 8   ? 38.168 13.165  -27.842 1.00 54.09  ? 708  DG  T C5    1 
ATOM   7796 C  C6    . DG  D 4 8   ? 39.097 13.178  -28.905 1.00 55.18  ? 708  DG  T C6    1 
ATOM   7797 O  O6    . DG  D 4 8   ? 38.916 12.850  -30.084 1.00 56.92  ? 708  DG  T O6    1 
ATOM   7798 N  N1    . DG  D 4 8   ? 40.347 13.624  -28.489 1.00 56.50  ? 708  DG  T N1    1 
ATOM   7799 C  C2    . DG  D 4 8   ? 40.657 14.013  -27.206 1.00 58.48  ? 708  DG  T C2    1 
ATOM   7800 N  N2    . DG  D 4 8   ? 41.914 14.416  -26.990 1.00 62.31  ? 708  DG  T N2    1 
ATOM   7801 N  N3    . DG  D 4 8   ? 39.796 14.004  -26.203 1.00 53.93  ? 708  DG  T N3    1 
ATOM   7802 C  C4    . DG  D 4 8   ? 38.576 13.571  -26.592 1.00 53.21  ? 708  DG  T C4    1 
ATOM   7803 P  P     . DC  D 4 9   ? 34.713 17.814  -23.902 1.00 46.17  ? 709  DC  T P     1 
ATOM   7804 O  OP1   . DC  D 4 9   ? 33.991 18.535  -22.832 1.00 49.62  ? 709  DC  T OP1   1 
ATOM   7805 O  OP2   . DC  D 4 9   ? 33.997 17.392  -25.124 1.00 43.34  ? 709  DC  T OP2   1 
ATOM   7806 O  "O5'" . DC  D 4 9   ? 35.975 18.684  -24.351 1.00 41.84  ? 709  DC  T "O5'" 1 
ATOM   7807 C  "C5'" . DC  D 4 9   ? 36.962 19.040  -23.396 1.00 38.43  ? 709  DC  T "C5'" 1 
ATOM   7808 C  "C4'" . DC  D 4 9   ? 38.298 19.285  -24.070 1.00 39.43  ? 709  DC  T "C4'" 1 
ATOM   7809 O  "O4'" . DC  D 4 9   ? 38.775 18.057  -24.671 1.00 38.94  ? 709  DC  T "O4'" 1 
ATOM   7810 C  "C3'" . DC  D 4 9   ? 38.266 20.264  -25.223 1.00 43.37  ? 709  DC  T "C3'" 1 
ATOM   7811 O  "O3'" . DC  D 4 9   ? 38.315 21.593  -24.742 1.00 45.04  ? 709  DC  T "O3'" 1 
ATOM   7812 C  "C2'" . DC  D 4 9   ? 39.541 19.885  -25.966 1.00 44.61  ? 709  DC  T "C2'" 1 
ATOM   7813 C  "C1'" . DC  D 4 9   ? 39.534 18.362  -25.830 1.00 42.67  ? 709  DC  T "C1'" 1 
ATOM   7814 N  N1    . DC  D 4 9   ? 38.920 17.675  -27.002 1.00 50.91  ? 709  DC  T N1    1 
ATOM   7815 C  C2    . DC  D 4 9   ? 39.680 17.480  -28.160 1.00 55.07  ? 709  DC  T C2    1 
ATOM   7816 O  O2    . DC  D 4 9   ? 40.851 17.874  -28.181 1.00 57.48  ? 709  DC  T O2    1 
ATOM   7817 N  N3    . DC  D 4 9   ? 39.110 16.863  -29.224 1.00 57.74  ? 709  DC  T N3    1 
ATOM   7818 C  C4    . DC  D 4 9   ? 37.840 16.453  -29.156 1.00 56.91  ? 709  DC  T C4    1 
ATOM   7819 N  N4    . DC  D 4 9   ? 37.317 15.847  -30.228 1.00 56.58  ? 709  DC  T N4    1 
ATOM   7820 C  C5    . DC  D 4 9   ? 37.050 16.645  -27.984 1.00 54.35  ? 709  DC  T C5    1 
ATOM   7821 C  C6    . DC  D 4 9   ? 37.624 17.255  -26.943 1.00 51.60  ? 709  DC  T C6    1 
ATOM   7822 P  P     . DG  D 4 10  ? 37.660 22.782  -25.603 1.00 50.58  ? 710  DG  T P     1 
ATOM   7823 O  OP1   . DG  D 4 10  ? 37.722 24.022  -24.798 1.00 46.18  ? 710  DG  T OP1   1 
ATOM   7824 O  OP2   . DG  D 4 10  ? 36.356 22.303  -26.111 1.00 42.30  ? 710  DG  T OP2   1 
ATOM   7825 O  "O5'" . DG  D 4 10  ? 38.655 22.942  -26.839 1.00 49.66  ? 710  DG  T "O5'" 1 
ATOM   7826 C  "C5'" . DG  D 4 10  ? 40.012 23.303  -26.614 1.00 47.32  ? 710  DG  T "C5'" 1 
ATOM   7827 C  "C4'" . DG  D 4 10  ? 40.798 23.228  -27.906 1.00 47.22  ? 710  DG  T "C4'" 1 
ATOM   7828 O  "O4'" . DG  D 4 10  ? 40.808 21.866  -28.374 1.00 47.57  ? 710  DG  T "O4'" 1 
ATOM   7829 C  "C3'" . DG  D 4 10  ? 40.207 24.034  -29.046 1.00 51.36  ? 710  DG  T "C3'" 1 
ATOM   7830 O  "O3'" . DG  D 4 10  ? 40.725 25.346  -29.010 1.00 55.74  ? 710  DG  T "O3'" 1 
ATOM   7831 C  "C2'" . DG  D 4 10  ? 40.685 23.281  -30.286 1.00 52.92  ? 710  DG  T "C2'" 1 
ATOM   7832 C  "C1'" . DG  D 4 10  ? 40.824 21.842  -29.788 1.00 50.21  ? 710  DG  T "C1'" 1 
ATOM   7833 N  N9    . DG  D 4 10  ? 39.776 20.935  -30.250 1.00 51.97  ? 710  DG  T N9    1 
ATOM   7834 C  C8    . DG  D 4 10  ? 38.793 20.347  -29.490 1.00 53.27  ? 710  DG  T C8    1 
ATOM   7835 N  N7    . DG  D 4 10  ? 38.008 19.559  -30.174 1.00 54.05  ? 710  DG  T N7    1 
ATOM   7836 C  C5    . DG  D 4 10  ? 38.509 19.622  -31.467 1.00 54.11  ? 710  DG  T C5    1 
ATOM   7837 C  C6    . DG  D 4 10  ? 38.069 18.978  -32.646 1.00 53.58  ? 710  DG  T C6    1 
ATOM   7838 O  O6    . DG  D 4 10  ? 37.116 18.201  -32.785 1.00 54.36  ? 710  DG  T O6    1 
ATOM   7839 N  N1    . DG  D 4 10  ? 38.856 19.319  -33.742 1.00 55.75  ? 710  DG  T N1    1 
ATOM   7840 C  C2    . DG  D 4 10  ? 39.934 20.171  -33.703 1.00 57.40  ? 710  DG  T C2    1 
ATOM   7841 N  N2    . DG  D 4 10  ? 40.572 20.383  -34.861 1.00 58.95  ? 710  DG  T N2    1 
ATOM   7842 N  N3    . DG  D 4 10  ? 40.355 20.782  -32.605 1.00 57.23  ? 710  DG  T N3    1 
ATOM   7843 C  C4    . DG  D 4 10  ? 39.599 20.461  -31.529 1.00 54.79  ? 710  DG  T C4    1 
ATOM   7844 P  P     . DC  D 4 11  ? 39.880 26.569  -29.613 1.00 61.54  ? 711  DC  T P     1 
ATOM   7845 O  OP1   . DC  D 4 11  ? 40.601 27.815  -29.272 1.00 63.08  ? 711  DC  T OP1   1 
ATOM   7846 O  OP2   . DC  D 4 11  ? 38.467 26.396  -29.211 1.00 64.12  ? 711  DC  T OP2   1 
ATOM   7847 O  "O5'" . DC  D 4 11  ? 39.966 26.346  -31.188 1.00 60.67  ? 711  DC  T "O5'" 1 
ATOM   7848 C  "C5'" . DC  D 4 11  ? 41.220 26.411  -31.853 1.00 58.61  ? 711  DC  T "C5'" 1 
ATOM   7849 C  "C4'" . DC  D 4 11  ? 41.031 26.134  -33.327 1.00 59.19  ? 711  DC  T "C4'" 1 
ATOM   7850 O  "O4'" . DC  D 4 11  ? 40.623 24.764  -33.488 1.00 59.73  ? 711  DC  T "O4'" 1 
ATOM   7851 C  "C3'" . DC  D 4 11  ? 39.949 26.980  -33.974 1.00 59.10  ? 711  DC  T "C3'" 1 
ATOM   7852 O  "O3'" . DC  D 4 11  ? 40.547 28.053  -34.685 1.00 64.19  ? 711  DC  T "O3'" 1 
ATOM   7853 C  "C2'" . DC  D 4 11  ? 39.210 26.030  -34.919 1.00 59.14  ? 711  DC  T "C2'" 1 
ATOM   7854 C  "C1'" . DC  D 4 11  ? 39.704 24.639  -34.546 1.00 58.25  ? 711  DC  T "C1'" 1 
ATOM   7855 N  N1    . DC  D 4 11  ? 38.627 23.705  -34.112 1.00 57.10  ? 711  DC  T N1    1 
ATOM   7856 C  C2    . DC  D 4 11  ? 37.971 22.915  -35.059 1.00 58.60  ? 711  DC  T C2    1 
ATOM   7857 O  O2    . DC  D 4 11  ? 38.280 23.024  -36.250 1.00 62.04  ? 711  DC  T O2    1 
ATOM   7858 N  N3    . DC  D 4 11  ? 37.009 22.056  -34.643 1.00 58.49  ? 711  DC  T N3    1 
ATOM   7859 C  C4    . DC  D 4 11  ? 36.705 21.970  -33.347 1.00 55.55  ? 711  DC  T C4    1 
ATOM   7860 N  N4    . DC  D 4 11  ? 35.747 21.111  -32.984 1.00 53.54  ? 711  DC  T N4    1 
ATOM   7861 C  C5    . DC  D 4 11  ? 37.367 22.764  -32.367 1.00 55.83  ? 711  DC  T C5    1 
ATOM   7862 C  C6    . DC  D 4 11  ? 38.313 23.607  -32.790 1.00 56.03  ? 711  DC  T C6    1 
ATOM   7863 P  P     . DC  D 4 12  ? 39.681 29.346  -35.080 1.00 74.36  ? 712  DC  T P     1 
ATOM   7864 O  OP1   . DC  D 4 12  ? 40.633 30.401  -35.489 1.00 75.86  ? 712  DC  T OP1   1 
ATOM   7865 O  OP2   . DC  D 4 12  ? 38.714 29.595  -33.987 1.00 73.51  ? 712  DC  T OP2   1 
ATOM   7866 O  "O5'" . DC  D 4 12  ? 38.837 28.873  -36.352 1.00 72.44  ? 712  DC  T "O5'" 1 
ATOM   7867 C  "C5'" . DC  D 4 12  ? 39.497 28.336  -37.489 1.00 74.30  ? 712  DC  T "C5'" 1 
ATOM   7868 C  "C4'" . DC  D 4 12  ? 38.484 27.781  -38.472 1.00 75.99  ? 712  DC  T "C4'" 1 
ATOM   7869 O  "O4'" . DC  D 4 12  ? 37.890 26.570  -37.935 1.00 76.95  ? 712  DC  T "O4'" 1 
ATOM   7870 C  "C3'" . DC  D 4 12  ? 37.329 28.728  -38.787 1.00 75.91  ? 712  DC  T "C3'" 1 
ATOM   7871 O  "O3'" . DC  D 4 12  ? 37.209 28.895  -40.185 1.00 81.30  ? 712  DC  T "O3'" 1 
ATOM   7872 C  "C2'" . DC  D 4 12  ? 36.099 28.040  -38.186 1.00 74.48  ? 712  DC  T "C2'" 1 
ATOM   7873 C  "C1'" . DC  D 4 12  ? 36.504 26.576  -38.184 1.00 74.46  ? 712  DC  T "C1'" 1 
ATOM   7874 N  N1    . DC  D 4 12  ? 35.831 25.775  -37.109 1.00 69.64  ? 712  DC  T N1    1 
ATOM   7875 C  C2    . DC  D 4 12  ? 35.003 24.692  -37.444 1.00 69.30  ? 712  DC  T C2    1 
ATOM   7876 O  O2    . DC  D 4 12  ? 34.833 24.405  -38.634 1.00 72.42  ? 712  DC  T O2    1 
ATOM   7877 N  N3    . DC  D 4 12  ? 34.409 23.987  -36.445 1.00 67.47  ? 712  DC  T N3    1 
ATOM   7878 C  C4    . DC  D 4 12  ? 34.617 24.329  -35.173 1.00 65.85  ? 712  DC  T C4    1 
ATOM   7879 N  N4    . DC  D 4 12  ? 34.014 23.613  -34.219 1.00 66.59  ? 712  DC  T N4    1 
ATOM   7880 C  C5    . DC  D 4 12  ? 35.454 25.425  -34.819 1.00 66.53  ? 712  DC  T C5    1 
ATOM   7881 C  C6    . DC  D 4 12  ? 36.028 26.114  -35.808 1.00 65.77  ? 712  DC  T C6    1 
ATOM   7882 P  P     . DC  D 4 13  ? 36.263 30.046  -40.781 1.00 84.79  ? 713  DC  T P     1 
ATOM   7883 O  OP1   . DC  D 4 13  ? 36.978 30.676  -41.914 1.00 85.54  ? 713  DC  T OP1   1 
ATOM   7884 O  OP2   . DC  D 4 13  ? 35.790 30.877  -39.651 1.00 82.91  ? 713  DC  T OP2   1 
ATOM   7885 O  "O5'" . DC  D 4 13  ? 35.005 29.240  -41.342 1.00 85.49  ? 713  DC  T "O5'" 1 
ATOM   7886 C  "C5'" . DC  D 4 13  ? 35.206 28.059  -42.109 1.00 86.17  ? 713  DC  T "C5'" 1 
ATOM   7887 C  "C4'" . DC  D 4 13  ? 33.880 27.396  -42.410 1.00 86.46  ? 713  DC  T "C4'" 1 
ATOM   7888 O  "O4'" . DC  D 4 13  ? 33.503 26.534  -41.303 1.00 85.93  ? 713  DC  T "O4'" 1 
ATOM   7889 C  "C3'" . DC  D 4 13  ? 32.725 28.370  -42.617 1.00 86.75  ? 713  DC  T "C3'" 1 
ATOM   7890 O  "O3'" . DC  D 4 13  ? 31.971 27.993  -43.750 1.00 89.89  ? 713  DC  T "O3'" 1 
ATOM   7891 C  "C2'" . DC  D 4 13  ? 31.913 28.254  -41.327 1.00 85.07  ? 713  DC  T "C2'" 1 
ATOM   7892 C  "C1'" . DC  D 4 13  ? 32.184 26.822  -40.894 1.00 84.64  ? 713  DC  T "C1'" 1 
ATOM   7893 N  N1    . DC  D 4 13  ? 32.106 26.640  -39.418 1.00 80.72  ? 713  DC  T N1    1 
ATOM   7894 C  C2    . DC  D 4 13  ? 31.334 25.605  -38.876 1.00 80.71  ? 713  DC  T C2    1 
ATOM   7895 O  O2    . DC  D 4 13  ? 30.724 24.846  -39.637 1.00 82.33  ? 713  DC  T O2    1 
ATOM   7896 N  N3    . DC  D 4 13  ? 31.280 25.468  -37.524 1.00 79.10  ? 713  DC  T N3    1 
ATOM   7897 C  C4    . DC  D 4 13  ? 31.955 26.313  -36.739 1.00 77.04  ? 713  DC  T C4    1 
ATOM   7898 N  N4    . DC  D 4 13  ? 31.877 26.145  -35.414 1.00 76.39  ? 713  DC  T N4    1 
ATOM   7899 C  C5    . DC  D 4 13  ? 32.741 27.370  -37.278 1.00 76.25  ? 713  DC  T C5    1 
ATOM   7900 C  C6    . DC  D 4 13  ? 32.784 27.497  -38.606 1.00 78.03  ? 713  DC  T C6    1 
ATOM   7901 P  P     . DG  D 4 14  ? 30.863 28.987  -44.352 1.00 90.10  ? 714  DG  T P     1 
ATOM   7902 O  OP1   . DG  D 4 14  ? 31.182 29.186  -45.782 1.00 94.45  ? 714  DG  T OP1   1 
ATOM   7903 O  OP2   . DG  D 4 14  ? 30.730 30.158  -43.457 1.00 87.31  ? 714  DG  T OP2   1 
ATOM   7904 O  "O5'" . DG  D 4 14  ? 29.520 28.138  -44.248 1.00 89.77  ? 714  DG  T "O5'" 1 
ATOM   7905 C  "C5'" . DG  D 4 14  ? 29.503 26.802  -44.720 1.00 91.03  ? 714  DG  T "C5'" 1 
ATOM   7906 C  "C4'" . DG  D 4 14  ? 28.280 26.073  -44.210 1.00 89.44  ? 714  DG  T "C4'" 1 
ATOM   7907 O  "O4'" . DG  D 4 14  ? 28.442 25.789  -42.797 1.00 85.65  ? 714  DG  T "O4'" 1 
ATOM   7908 C  "C3'" . DG  D 4 14  ? 26.972 26.846  -44.351 1.00 88.26  ? 714  DG  T "C3'" 1 
ATOM   7909 O  "O3'" . DG  D 4 14  ? 25.945 25.972  -44.784 1.00 93.80  ? 714  DG  T "O3'" 1 
ATOM   7910 C  "C2'" . DG  D 4 14  ? 26.719 27.375  -42.940 1.00 83.69  ? 714  DG  T "C2'" 1 
ATOM   7911 C  "C1'" . DG  D 4 14  ? 27.343 26.294  -42.072 1.00 83.10  ? 714  DG  T "C1'" 1 
ATOM   7912 N  N9    . DG  D 4 14  ? 27.834 26.797  -40.793 1.00 76.82  ? 714  DG  T N9    1 
ATOM   7913 C  C8    . DG  D 4 14  ? 28.685 27.856  -40.595 1.00 72.24  ? 714  DG  T C8    1 
ATOM   7914 N  N7    . DG  D 4 14  ? 28.956 28.079  -39.339 1.00 70.60  ? 714  DG  T N7    1 
ATOM   7915 C  C5    . DG  D 4 14  ? 28.238 27.104  -38.658 1.00 72.70  ? 714  DG  T C5    1 
ATOM   7916 C  C6    . DG  D 4 14  ? 28.140 26.847  -37.271 1.00 71.48  ? 714  DG  T C6    1 
ATOM   7917 O  O6    . DG  D 4 14  ? 28.688 27.451  -36.338 1.00 70.65  ? 714  DG  T O6    1 
ATOM   7918 N  N1    . DG  D 4 14  ? 27.304 25.765  -37.005 1.00 74.91  ? 714  DG  T N1    1 
ATOM   7919 C  C2    . DG  D 4 14  ? 26.647 25.024  -37.960 1.00 78.47  ? 714  DG  T C2    1 
ATOM   7920 N  N2    . DG  D 4 14  ? 25.882 24.016  -37.518 1.00 82.90  ? 714  DG  T N2    1 
ATOM   7921 N  N3    . DG  D 4 14  ? 26.731 25.255  -39.264 1.00 78.98  ? 714  DG  T N3    1 
ATOM   7922 C  C4    . DG  D 4 14  ? 27.541 26.307  -39.539 1.00 76.50  ? 714  DG  T C4    1 
ATOM   7923 P  P     . DA  D 4 15  ? 24.472 26.529  -45.101 1.00 96.90  ? 715  DA  T P     1 
ATOM   7924 O  OP1   . DA  D 4 15  ? 24.049 25.942  -46.391 1.00 103.58 ? 715  DA  T OP1   1 
ATOM   7925 O  OP2   . DA  D 4 15  ? 24.456 28.000  -44.936 1.00 92.71  ? 715  DA  T OP2   1 
ATOM   7926 O  "O5'" . DA  D 4 15  ? 23.585 25.886  -43.942 1.00 96.44  ? 715  DA  T "O5'" 1 
ATOM   7927 C  "C5'" . DA  D 4 15  ? 23.679 24.491  -43.678 1.00 97.05  ? 715  DA  T "C5'" 1 
ATOM   7928 C  "C4'" . DA  D 4 15  ? 22.752 24.089  -42.547 1.00 96.45  ? 715  DA  T "C4'" 1 
ATOM   7929 O  "O4'" . DA  D 4 15  ? 23.355 24.438  -41.274 1.00 90.62  ? 715  DA  T "O4'" 1 
ATOM   7930 C  "C3'" . DA  D 4 15  ? 21.385 24.760  -42.568 1.00 97.96  ? 715  DA  T "C3'" 1 
ATOM   7931 O  "O3'" . DA  D 4 15  ? 20.393 23.850  -42.124 1.00 104.09 ? 715  DA  T "O3'" 1 
ATOM   7932 C  "C2'" . DA  D 4 15  ? 21.555 25.931  -41.603 1.00 90.74  ? 715  DA  T "C2'" 1 
ATOM   7933 C  "C1'" . DA  D 4 15  ? 22.550 25.377  -40.589 1.00 87.55  ? 715  DA  T "C1'" 1 
ATOM   7934 N  N9    . DA  D 4 15  ? 23.428 26.398  -40.021 1.00 78.74  ? 715  DA  T N9    1 
ATOM   7935 C  C8    . DA  D 4 15  ? 24.191 27.300  -40.708 1.00 73.39  ? 715  DA  T C8    1 
ATOM   7936 N  N7    . DA  D 4 15  ? 24.889 28.100  -39.938 1.00 68.62  ? 715  DA  T N7    1 
ATOM   7937 C  C5    . DA  D 4 15  ? 24.562 27.695  -38.655 1.00 69.82  ? 715  DA  T C5    1 
ATOM   7938 C  C6    . DA  D 4 15  ? 24.970 28.147  -37.384 1.00 64.10  ? 715  DA  T C6    1 
ATOM   7939 N  N6    . DA  D 4 15  ? 25.833 29.152  -37.201 1.00 59.30  ? 715  DA  T N6    1 
ATOM   7940 N  N1    . DA  D 4 15  ? 24.453 27.523  -36.304 1.00 66.52  ? 715  DA  T N1    1 
ATOM   7941 C  C2    . DA  D 4 15  ? 23.590 26.518  -36.492 1.00 73.38  ? 715  DA  T C2    1 
ATOM   7942 N  N3    . DA  D 4 15  ? 23.133 26.005  -37.633 1.00 77.08  ? 715  DA  T N3    1 
ATOM   7943 C  C4    . DA  D 4 15  ? 23.664 26.645  -38.688 1.00 75.72  ? 715  DA  T C4    1 
ATOM   7944 P  P     . DA  D 4 16  ? 18.841 24.146  -42.411 1.00 109.47 ? 716  DA  T P     1 
ATOM   7945 O  OP1   . DA  D 4 16  ? 18.245 22.896  -42.934 1.00 116.58 ? 716  DA  T OP1   1 
ATOM   7946 O  OP2   . DA  D 4 16  ? 18.750 25.397  -43.198 1.00 106.84 ? 716  DA  T OP2   1 
ATOM   7947 O  "O5'" . DA  D 4 16  ? 18.242 24.442  -40.960 1.00 107.07 ? 716  DA  T "O5'" 1 
ATOM   7948 C  "C5'" . DA  D 4 16  ? 18.402 23.483  -39.925 1.00 105.68 ? 716  DA  T "C5'" 1 
ATOM   7949 C  "C4'" . DA  D 4 16  ? 18.276 24.133  -38.561 1.00 100.36 ? 716  DA  T "C4'" 1 
ATOM   7950 O  "O4'" . DA  D 4 16  ? 19.398 25.013  -38.334 1.00 92.06  ? 716  DA  T "O4'" 1 
ATOM   7951 C  "C3'" . DA  D 4 16  ? 17.018 24.981  -38.360 1.00 100.05 ? 716  DA  T "C3'" 1 
ATOM   7952 O  "O3'" . DA  D 4 16  ? 16.253 24.447  -37.293 1.00 105.74 ? 716  DA  T "O3'" 1 
ATOM   7953 C  "C2'" . DA  D 4 16  ? 17.548 26.390  -38.038 1.00 91.24  ? 716  DA  T "C2'" 1 
ATOM   7954 C  "C1'" . DA  D 4 16  ? 18.967 26.109  -37.573 1.00 86.68  ? 716  DA  T "C1'" 1 
ATOM   7955 N  N9    . DA  D 4 16  ? 19.899 27.209  -37.804 1.00 79.46  ? 716  DA  T N9    1 
ATOM   7956 C  C8    . DA  D 4 16  ? 20.328 27.682  -39.012 1.00 76.54  ? 716  DA  T C8    1 
ATOM   7957 N  N7    . DA  D 4 16  ? 21.185 28.671  -38.921 1.00 70.68  ? 716  DA  T N7    1 
ATOM   7958 C  C5    . DA  D 4 16  ? 21.334 28.855  -37.557 1.00 70.58  ? 716  DA  T C5    1 
ATOM   7959 C  C6    . DA  D 4 16  ? 22.108 29.756  -36.801 1.00 67.41  ? 716  DA  T C6    1 
ATOM   7960 N  N6    . DA  D 4 16  ? 22.908 30.676  -37.349 1.00 60.68  ? 716  DA  T N6    1 
ATOM   7961 N  N1    . DA  D 4 16  ? 22.027 29.674  -35.457 1.00 67.80  ? 716  DA  T N1    1 
ATOM   7962 C  C2    . DA  D 4 16  ? 21.224 28.752  -34.914 1.00 70.75  ? 716  DA  T C2    1 
ATOM   7963 N  N3    . DA  D 4 16  ? 20.450 27.854  -35.519 1.00 75.02  ? 716  DA  T N3    1 
ATOM   7964 C  C4    . DA  D 4 16  ? 20.552 27.959  -36.853 1.00 74.85  ? 716  DA  T C4    1 
ATOM   7965 P  P     . DC  D 4 17  ? 14.775 24.999  -37.000 1.00 111.46 ? 717  DC  T P     1 
ATOM   7966 O  OP1   . DC  D 4 17  ? 13.992 23.889  -36.412 1.00 118.16 ? 717  DC  T OP1   1 
ATOM   7967 O  OP2   . DC  D 4 17  ? 14.293 25.681  -38.221 1.00 110.97 ? 717  DC  T OP2   1 
ATOM   7968 O  "O5'" . DC  D 4 17  ? 15.011 26.111  -35.880 1.00 108.34 ? 717  DC  T "O5'" 1 
ATOM   7969 C  "C5'" . DC  D 4 17  ? 15.754 25.785  -34.716 1.00 107.81 ? 717  DC  T "C5'" 1 
ATOM   7970 C  "C4'" . DC  D 4 17  ? 15.978 27.015  -33.864 1.00 102.99 ? 717  DC  T "C4'" 1 
ATOM   7971 O  "O4'" . DC  D 4 17  ? 17.077 27.784  -34.402 1.00 96.66  ? 717  DC  T "O4'" 1 
ATOM   7972 C  "C3'" . DC  D 4 17  ? 14.782 27.969  -33.781 1.00 103.90 ? 717  DC  T "C3'" 1 
ATOM   7973 O  "O3'" . DC  D 4 17  ? 14.410 28.150  -32.420 1.00 107.16 ? 717  DC  T "O3'" 1 
ATOM   7974 C  "C2'" . DC  D 4 17  ? 15.292 29.269  -34.417 1.00 97.28  ? 717  DC  T "C2'" 1 
ATOM   7975 C  "C1'" . DC  D 4 17  ? 16.794 29.146  -34.240 1.00 93.11  ? 717  DC  T "C1'" 1 
ATOM   7976 N  N1    . DC  D 4 17  ? 17.575 29.914  -35.246 1.00 87.53  ? 717  DC  T N1    1 
ATOM   7977 C  C2    . DC  D 4 17  ? 18.469 30.898  -34.816 1.00 82.62  ? 717  DC  T C2    1 
ATOM   7978 O  O2    . DC  D 4 17  ? 18.586 31.108  -33.603 1.00 83.30  ? 717  DC  T O2    1 
ATOM   7979 N  N3    . DC  D 4 17  ? 19.173 31.595  -35.743 1.00 77.44  ? 717  DC  T N3    1 
ATOM   7980 C  C4    . DC  D 4 17  ? 19.008 31.333  -37.041 1.00 77.58  ? 717  DC  T C4    1 
ATOM   7981 N  N4    . DC  D 4 17  ? 19.724 32.043  -37.920 1.00 74.10  ? 717  DC  T N4    1 
ATOM   7982 C  C5    . DC  D 4 17  ? 18.100 30.332  -37.497 1.00 82.80  ? 717  DC  T C5    1 
ATOM   7983 C  C6    . DC  D 4 17  ? 17.411 29.654  -36.574 1.00 87.22  ? 717  DC  T C6    1 
ATOM   7984 P  P     . DA  D 4 18  ? 13.227 29.159  -32.012 1.00 108.90 ? 718  DA  T P     1 
ATOM   7985 O  OP1   . DA  D 4 18  ? 12.477 28.520  -30.907 1.00 113.59 ? 718  DA  T OP1   1 
ATOM   7986 O  OP2   . DA  D 4 18  ? 12.499 29.589  -33.227 1.00 109.25 ? 718  DA  T OP2   1 
ATOM   7987 O  "O5'" . DA  D 4 18  ? 14.010 30.420  -31.424 1.00 100.19 ? 718  DA  T "O5'" 1 
ATOM   7988 C  "C5'" . DA  D 4 18  ? 15.098 30.213  -30.530 1.00 96.16  ? 718  DA  T "C5'" 1 
ATOM   7989 C  "C4'" . DA  D 4 18  ? 15.522 31.512  -29.869 1.00 90.23  ? 718  DA  T "C4'" 1 
ATOM   7990 O  "O4'" . DA  D 4 18  ? 16.496 32.190  -30.700 1.00 83.35  ? 718  DA  T "O4'" 1 
ATOM   7991 C  "C3'" . DA  D 4 18  ? 14.403 32.513  -29.627 1.00 90.33  ? 718  DA  T "C3'" 1 
ATOM   7992 O  "O3'" . DA  D 4 18  ? 14.648 33.229  -28.424 1.00 90.34  ? 718  DA  T "O3'" 1 
ATOM   7993 C  "C2'" . DA  D 4 18  ? 14.474 33.419  -30.856 1.00 84.91  ? 718  DA  T "C2'" 1 
ATOM   7994 C  "C1'" . DA  D 4 18  ? 15.960 33.396  -31.208 1.00 80.04  ? 718  DA  T "C1'" 1 
ATOM   7995 N  N9    . DA  D 4 18  ? 16.219 33.430  -32.646 1.00 77.92  ? 718  DA  T N9    1 
ATOM   7996 C  C8    . DA  D 4 18  ? 15.712 32.587  -33.594 1.00 80.22  ? 718  DA  T C8    1 
ATOM   7997 N  N7    . DA  D 4 18  ? 16.124 32.849  -34.812 1.00 77.83  ? 718  DA  T N7    1 
ATOM   7998 C  C5    . DA  D 4 18  ? 16.966 33.936  -34.651 1.00 73.10  ? 718  DA  T C5    1 
ATOM   7999 C  C6    . DA  D 4 18  ? 17.727 34.693  -35.565 1.00 67.91  ? 718  DA  T C6    1 
ATOM   8000 N  N6    . DA  D 4 18  ? 17.756 34.451  -36.881 1.00 67.08  ? 718  DA  T N6    1 
ATOM   8001 N  N1    . DA  D 4 18  ? 18.458 35.711  -35.073 1.00 66.43  ? 718  DA  T N1    1 
ATOM   8002 C  C2    . DA  D 4 18  ? 18.429 35.951  -33.757 1.00 68.08  ? 718  DA  T C2    1 
ATOM   8003 N  N3    . DA  D 4 18  ? 17.756 35.312  -32.803 1.00 70.36  ? 718  DA  T N3    1 
ATOM   8004 C  C4    . DA  D 4 18  ? 17.038 34.305  -33.321 1.00 73.58  ? 718  DA  T C4    1 
ATOM   8005 P  P     . DG  D 4 19  ? 13.536 34.226  -27.830 1.00 93.69  ? 719  DG  T P     1 
ATOM   8006 O  OP1   . DG  D 4 19  ? 13.548 34.093  -26.357 1.00 97.54  ? 719  DG  T OP1   1 
ATOM   8007 O  OP2   . DG  D 4 19  ? 12.276 34.022  -28.579 1.00 96.75  ? 719  DG  T OP2   1 
ATOM   8008 O  "O5'" . DG  D 4 19  ? 14.096 35.670  -28.201 1.00 86.21  ? 719  DG  T "O5'" 1 
ATOM   8009 C  "C5'" . DG  D 4 19  ? 15.373 36.065  -27.735 1.00 82.30  ? 719  DG  T "C5'" 1 
ATOM   8010 C  "C4'" . DG  D 4 19  ? 15.698 37.462  -28.211 1.00 78.20  ? 719  DG  T "C4'" 1 
ATOM   8011 O  "O4'" . DG  D 4 19  ? 16.161 37.406  -29.584 1.00 73.64  ? 719  DG  T "O4'" 1 
ATOM   8012 C  "C3'" . DG  D 4 19  ? 14.517 38.430  -28.190 1.00 80.31  ? 719  DG  T "C3'" 1 
ATOM   8013 O  "O3'" . DG  D 4 19  ? 14.929 39.680  -27.669 1.00 81.53  ? 719  DG  T "O3'" 1 
ATOM   8014 C  "C2'" . DG  D 4 19  ? 14.105 38.529  -29.659 1.00 77.81  ? 719  DG  T "C2'" 1 
ATOM   8015 C  "C1'" . DG  D 4 19  ? 15.427 38.311  -30.377 1.00 73.54  ? 719  DG  T "C1'" 1 
ATOM   8016 N  N9    . DG  D 4 19  ? 15.277 37.727  -31.706 1.00 71.13  ? 719  DG  T N9    1 
ATOM   8017 C  C8    . DG  D 4 19  ? 14.564 36.602  -32.039 1.00 73.08  ? 719  DG  T C8    1 
ATOM   8018 N  N7    . DG  D 4 19  ? 14.616 36.311  -33.309 1.00 73.05  ? 719  DG  T N7    1 
ATOM   8019 C  C5    . DG  D 4 19  ? 15.416 37.308  -33.853 1.00 68.90  ? 719  DG  T C5    1 
ATOM   8020 C  C6    . DG  D 4 19  ? 15.830 37.517  -35.190 1.00 65.09  ? 719  DG  T C6    1 
ATOM   8021 O  O6    . DG  D 4 19  ? 15.561 36.841  -36.192 1.00 66.42  ? 719  DG  T O6    1 
ATOM   8022 N  N1    . DG  D 4 19  ? 16.639 38.641  -35.306 1.00 62.12  ? 719  DG  T N1    1 
ATOM   8023 C  C2    . DG  D 4 19  ? 17.001 39.462  -34.263 1.00 62.11  ? 719  DG  T C2    1 
ATOM   8024 N  N2    . DG  D 4 19  ? 17.782 40.507  -34.566 1.00 61.29  ? 719  DG  T N2    1 
ATOM   8025 N  N3    . DG  D 4 19  ? 16.620 39.276  -33.008 1.00 62.32  ? 719  DG  T N3    1 
ATOM   8026 C  C4    . DG  D 4 19  ? 15.832 38.185  -32.878 1.00 66.98  ? 719  DG  T C4    1 
ATOM   8027 P  P     . DG  D 4 20  ? 13.844 40.809  -27.309 1.00 85.95  ? 720  DG  T P     1 
ATOM   8028 O  OP1   . DG  D 4 20  ? 14.168 41.324  -25.961 1.00 88.55  ? 720  DG  T OP1   1 
ATOM   8029 O  OP2   . DG  D 4 20  ? 12.492 40.273  -27.587 1.00 89.49  ? 720  DG  T OP2   1 
ATOM   8030 O  "O5'" . DG  D 4 20  ? 14.146 41.957  -28.371 1.00 77.98  ? 720  DG  T "O5'" 1 
ATOM   8031 C  "C5'" . DG  D 4 20  ? 15.476 42.410  -28.547 1.00 73.85  ? 720  DG  T "C5'" 1 
ATOM   8032 C  "C4'" . DG  D 4 20  ? 15.584 43.287  -29.777 1.00 70.32  ? 720  DG  T "C4'" 1 
ATOM   8033 O  "O4'" . DG  D 4 20  ? 15.612 42.459  -30.969 1.00 69.13  ? 720  DG  T "O4'" 1 
ATOM   8034 C  "C3'" . DG  D 4 20  ? 14.432 44.273  -29.969 1.00 71.53  ? 720  DG  T "C3'" 1 
ATOM   8035 O  "O3'" . DG  D 4 20  ? 14.950 45.520  -30.366 1.00 73.44  ? 720  DG  T "O3'" 1 
ATOM   8036 C  "C2'" . DG  D 4 20  ? 13.606 43.631  -31.083 1.00 70.71  ? 720  DG  T "C2'" 1 
ATOM   8037 C  "C1'" . DG  D 4 20  ? 14.697 42.972  -31.907 1.00 68.97  ? 720  DG  T "C1'" 1 
ATOM   8038 N  N9    . DG  D 4 20  ? 14.224 41.876  -32.747 1.00 68.52  ? 720  DG  T N9    1 
ATOM   8039 C  C8    . DG  D 4 20  ? 13.513 40.770  -32.351 1.00 71.28  ? 720  DG  T C8    1 
ATOM   8040 N  N7    . DG  D 4 20  ? 13.232 39.955  -33.330 1.00 73.68  ? 720  DG  T N7    1 
ATOM   8041 C  C5    . DG  D 4 20  ? 13.796 40.559  -34.448 1.00 69.65  ? 720  DG  T C5    1 
ATOM   8042 C  C6    . DG  D 4 20  ? 13.818 40.141  -35.802 1.00 68.41  ? 720  DG  T C6    1 
ATOM   8043 O  O6    . DG  D 4 20  ? 13.326 39.117  -36.299 1.00 69.24  ? 720  DG  T O6    1 
ATOM   8044 N  N1    . DG  D 4 20  ? 14.498 41.050  -36.610 1.00 66.56  ? 720  DG  T N1    1 
ATOM   8045 C  C2    . DG  D 4 20  ? 15.084 42.213  -36.165 1.00 64.79  ? 720  DG  T C2    1 
ATOM   8046 N  N2    . DG  D 4 20  ? 15.694 42.971  -37.085 1.00 62.55  ? 720  DG  T N2    1 
ATOM   8047 N  N3    . DG  D 4 20  ? 15.068 42.613  -34.902 1.00 65.35  ? 720  DG  T N3    1 
ATOM   8048 C  C4    . DG  D 4 20  ? 14.411 41.741  -34.103 1.00 67.26  ? 720  DG  T C4    1 
ATOM   8049 P  P     . DG  D 4 21  ? 14.094 46.862  -30.166 1.00 75.12  ? 721  DG  T P     1 
ATOM   8050 O  OP1   . DG  D 4 21  ? 14.803 47.679  -29.157 1.00 76.79  ? 721  DG  T OP1   1 
ATOM   8051 O  OP2   . DG  D 4 21  ? 12.676 46.493  -29.954 1.00 79.18  ? 721  DG  T OP2   1 
ATOM   8052 O  "O5'" . DG  D 4 21  ? 14.201 47.579  -31.585 1.00 71.05  ? 721  DG  T "O5'" 1 
ATOM   8053 C  "C5'" . DG  D 4 21  ? 15.465 47.707  -32.213 1.00 69.79  ? 721  DG  T "C5'" 1 
ATOM   8054 C  "C4'" . DG  D 4 21  ? 15.298 48.010  -33.688 1.00 70.78  ? 721  DG  T "C4'" 1 
ATOM   8055 O  "O4'" . DG  D 4 21  ? 15.019 46.780  -34.407 1.00 70.41  ? 721  DG  T "O4'" 1 
ATOM   8056 C  "C3'" . DG  D 4 21  ? 14.154 48.967  -34.023 1.00 71.62  ? 721  DG  T "C3'" 1 
ATOM   8057 O  "O3'" . DG  D 4 21  ? 14.554 49.850  -35.054 1.00 71.21  ? 721  DG  T "O3'" 1 
ATOM   8058 C  "C2'" . DG  D 4 21  ? 13.045 48.028  -34.491 1.00 73.49  ? 721  DG  T "C2'" 1 
ATOM   8059 C  "C1'" . DG  D 4 21  ? 13.848 46.936  -35.177 1.00 71.17  ? 721  DG  T "C1'" 1 
ATOM   8060 N  N9    . DG  D 4 21  ? 13.161 45.650  -35.230 1.00 71.16  ? 721  DG  T N9    1 
ATOM   8061 C  C8    . DG  D 4 21  ? 12.635 44.951  -34.172 1.00 72.21  ? 721  DG  T C8    1 
ATOM   8062 N  N7    . DG  D 4 21  ? 12.082 43.823  -34.519 1.00 74.45  ? 721  DG  T N7    1 
ATOM   8063 C  C5    . DG  D 4 21  ? 12.255 43.769  -35.896 1.00 73.64  ? 721  DG  T C5    1 
ATOM   8064 C  C6    . DG  D 4 21  ? 11.862 42.777  -36.825 1.00 73.86  ? 721  DG  T C6    1 
ATOM   8065 O  O6    . DG  D 4 21  ? 11.262 41.717  -36.604 1.00 75.55  ? 721  DG  T O6    1 
ATOM   8066 N  N1    . DG  D 4 21  ? 12.233 43.113  -38.126 1.00 72.91  ? 721  DG  T N1    1 
ATOM   8067 C  C2    . DG  D 4 21  ? 12.901 44.262  -38.483 1.00 71.20  ? 721  DG  T C2    1 
ATOM   8068 N  N2    . DG  D 4 21  ? 13.176 44.420  -39.786 1.00 70.92  ? 721  DG  T N2    1 
ATOM   8069 N  N3    . DG  D 4 21  ? 13.274 45.199  -37.619 1.00 71.23  ? 721  DG  T N3    1 
ATOM   8070 C  C4    . DG  D 4 21  ? 12.919 44.886  -36.349 1.00 72.17  ? 721  DG  T C4    1 
ATOM   8071 P  P     . DA  D 4 22  ? 13.736 51.205  -35.323 1.00 92.00  ? 722  DA  T P     1 
ATOM   8072 O  OP1   . DA  D 4 22  ? 14.693 52.329  -35.222 1.00 98.81  ? 722  DA  T OP1   1 
ATOM   8073 O  OP2   . DA  D 4 22  ? 12.523 51.183  -34.475 1.00 92.11  ? 722  DA  T OP2   1 
ATOM   8074 O  "O5'" . DA  D 4 22  ? 13.261 51.067  -36.840 1.00 84.54  ? 722  DA  T "O5'" 1 
ATOM   8075 C  "C5'" . DA  D 4 22  ? 14.200 50.728  -37.846 1.00 82.84  ? 722  DA  T "C5'" 1 
ATOM   8076 C  "C4'" . DA  D 4 22  ? 13.494 50.375  -39.141 1.00 81.80  ? 722  DA  T "C4'" 1 
ATOM   8077 O  "O4'" . DA  D 4 22  ? 13.003 49.010  -39.075 1.00 78.79  ? 722  DA  T "O4'" 1 
ATOM   8078 C  "C3'" . DA  D 4 22  ? 12.286 51.246  -39.474 1.00 81.11  ? 722  DA  T "C3'" 1 
ATOM   8079 O  "O3'" . DA  D 4 22  ? 12.255 51.510  -40.867 1.00 82.31  ? 722  DA  T "O3'" 1 
ATOM   8080 C  "C2'" . DA  D 4 22  ? 11.103 50.384  -39.036 1.00 77.89  ? 722  DA  T "C2'" 1 
ATOM   8081 C  "C1'" . DA  D 4 22  ? 11.615 48.984  -39.335 1.00 78.30  ? 722  DA  T "C1'" 1 
ATOM   8082 N  N9    . DA  D 4 22  ? 11.014 47.953  -38.494 1.00 79.64  ? 722  DA  T N9    1 
ATOM   8083 C  C8    . DA  D 4 22  ? 10.884 47.975  -37.134 1.00 80.14  ? 722  DA  T C8    1 
ATOM   8084 N  N7    . DA  D 4 22  ? 10.309 46.905  -36.640 1.00 78.83  ? 722  DA  T N7    1 
ATOM   8085 C  C5    . DA  D 4 22  ? 10.046 46.125  -37.754 1.00 78.25  ? 722  DA  T C5    1 
ATOM   8086 C  C6    . DA  D 4 22  ? 9.445  44.862  -37.906 1.00 78.23  ? 722  DA  T C6    1 
ATOM   8087 N  N6    . DA  D 4 22  ? 8.984  44.141  -36.880 1.00 76.43  ? 722  DA  T N6    1 
ATOM   8088 N  N1    . DA  D 4 22  ? 9.337  44.367  -39.157 1.00 79.50  ? 722  DA  T N1    1 
ATOM   8089 C  C2    . DA  D 4 22  ? 9.800  45.093  -40.181 1.00 80.00  ? 722  DA  T C2    1 
ATOM   8090 N  N3    . DA  D 4 22  ? 10.384 46.290  -40.162 1.00 80.08  ? 722  DA  T N3    1 
ATOM   8091 C  C4    . DA  D 4 22  ? 10.477 46.755  -38.905 1.00 79.12  ? 722  DA  T C4    1 
ATOM   8092 P  P     . DC  D 4 23  ? 11.245 52.607  -41.464 1.00 83.39  ? 723  DC  T P     1 
ATOM   8093 O  OP1   . DC  D 4 23  ? 11.999 53.410  -42.452 1.00 86.71  ? 723  DC  T OP1   1 
ATOM   8094 O  OP2   . DC  D 4 23  ? 10.570 53.276  -40.329 1.00 83.42  ? 723  DC  T OP2   1 
ATOM   8095 O  "O5'" . DC  D 4 23  ? 10.153 51.733  -42.236 1.00 81.65  ? 723  DC  T "O5'" 1 
ATOM   8096 C  "C5'" . DC  D 4 23  ? 10.564 50.851  -43.270 1.00 82.54  ? 723  DC  T "C5'" 1 
ATOM   8097 C  "C4'" . DC  D 4 23  ? 9.467  49.856  -43.598 1.00 81.69  ? 723  DC  T "C4'" 1 
ATOM   8098 O  "O4'" . DC  D 4 23  ? 9.277  48.956  -42.482 1.00 80.16  ? 723  DC  T "O4'" 1 
ATOM   8099 C  "C3'" . DC  D 4 23  ? 8.098  50.476  -43.893 1.00 81.68  ? 723  DC  T "C3'" 1 
ATOM   8100 O  "O3'" . DC  D 4 23  ? 7.675  50.104  -45.194 1.00 85.57  ? 723  DC  T "O3'" 1 
ATOM   8101 C  "C2'" . DC  D 4 23  ? 7.175  49.898  -42.812 1.00 80.05  ? 723  DC  T "C2'" 1 
ATOM   8102 C  "C1'" . DC  D 4 23  ? 7.915  48.641  -42.377 1.00 79.40  ? 723  DC  T "C1'" 1 
ATOM   8103 N  N1    . DC  D 4 23  ? 7.637  48.253  -40.965 1.00 78.64  ? 723  DC  T N1    1 
ATOM   8104 C  C2    . DC  D 4 23  ? 7.037  47.016  -40.682 1.00 78.47  ? 723  DC  T C2    1 
ATOM   8105 O  O2    . DC  D 4 23  ? 6.747  46.255  -41.615 1.00 79.53  ? 723  DC  T O2    1 
ATOM   8106 N  N3    . DC  D 4 23  ? 6.795  46.689  -39.386 1.00 77.37  ? 723  DC  T N3    1 
ATOM   8107 C  C4    . DC  D 4 23  ? 7.124  47.540  -38.410 1.00 76.59  ? 723  DC  T C4    1 
ATOM   8108 N  N4    . DC  D 4 23  ? 6.869  47.182  -37.149 1.00 75.74  ? 723  DC  T N4    1 
ATOM   8109 C  C5    . DC  D 4 23  ? 7.733  48.799  -38.684 1.00 77.65  ? 723  DC  T C5    1 
ATOM   8110 C  C6    . DC  D 4 23  ? 7.968  49.110  -39.960 1.00 78.49  ? 723  DC  T C6    1 
ATOM   8111 P  P     . DT  D 4 24  ? 6.755  51.095  -46.061 1.00 89.94  ? 724  DT  T P     1 
ATOM   8112 O  OP1   . DT  D 4 24  ? 7.481  51.410  -47.312 1.00 92.57  ? 724  DT  T OP1   1 
ATOM   8113 O  OP2   . DT  D 4 24  ? 6.310  52.190  -45.172 1.00 88.83  ? 724  DT  T OP2   1 
ATOM   8114 O  "O5'" . DT  D 4 24  ? 5.475  50.207  -46.413 1.00 91.64  ? 724  DT  T "O5'" 1 
ATOM   8115 C  "C5'" . DT  D 4 24  ? 5.546  48.787  -46.324 1.00 93.21  ? 724  DT  T "C5'" 1 
ATOM   8116 C  "C4'" . DT  D 4 24  ? 4.158  48.175  -46.381 1.00 94.69  ? 724  DT  T "C4'" 1 
ATOM   8117 O  "O4'" . DT  D 4 24  ? 3.587  48.127  -45.046 1.00 94.46  ? 724  DT  T "O4'" 1 
ATOM   8118 C  "C3'" . DT  D 4 24  ? 3.155  48.939  -47.240 1.00 96.71  ? 724  DT  T "C3'" 1 
ATOM   8119 O  "O3'" . DT  D 4 24  ? 2.327  48.026  -47.939 1.00 98.26  ? 724  DT  T "O3'" 1 
ATOM   8120 C  "C2'" . DT  D 4 24  ? 2.362  49.743  -46.212 1.00 96.63  ? 724  DT  T "C2'" 1 
ATOM   8121 C  "C1'" . DT  D 4 24  ? 2.333  48.779  -45.039 1.00 95.38  ? 724  DT  T "C1'" 1 
ATOM   8122 N  N1    . DT  D 4 24  ? 2.160  49.437  -43.710 1.00 95.17  ? 724  DT  T N1    1 
ATOM   8123 C  C2    . DT  D 4 24  ? 1.119  49.050  -42.900 1.00 96.52  ? 724  DT  T C2    1 
ATOM   8124 O  O2    . DT  D 4 24  ? 0.307  48.199  -43.217 1.00 97.50  ? 724  DT  T O2    1 
ATOM   8125 N  N3    . DT  D 4 24  ? 1.057  49.702  -41.696 1.00 96.93  ? 724  DT  T N3    1 
ATOM   8126 C  C4    . DT  D 4 24  ? 1.917  50.679  -41.229 1.00 96.45  ? 724  DT  T C4    1 
ATOM   8127 O  O4    . DT  D 4 24  ? 1.777  51.207  -40.129 1.00 96.87  ? 724  DT  T O4    1 
ATOM   8128 C  C5    . DT  D 4 24  ? 2.991  51.035  -42.126 1.00 95.87  ? 724  DT  T C5    1 
ATOM   8129 C  C7    . DT  D 4 24  ? 3.987  52.084  -41.729 1.00 96.76  ? 724  DT  T C7    1 
ATOM   8130 C  C6    . DT  D 4 24  ? 3.062  50.402  -43.308 1.00 95.37  ? 724  DT  T C6    1 
ATOM   8131 P  P     . DG  D 4 25  ? 1.524  48.504  -49.244 1.00 101.24 ? 725  DG  T P     1 
ATOM   8132 O  OP1   . DG  D 4 25  ? 1.271  47.302  -50.070 1.00 104.09 ? 725  DG  T OP1   1 
ATOM   8133 O  OP2   . DG  D 4 25  ? 2.250  49.658  -49.822 1.00 101.17 ? 725  DG  T OP2   1 
ATOM   8134 O  "O5'" . DG  D 4 25  ? 0.133  49.041  -48.661 1.00 100.04 ? 725  DG  T "O5'" 1 
ATOM   8135 C  "C5'" . DG  D 4 25  ? -0.768 48.139  -48.029 1.00 99.43  ? 725  DG  T "C5'" 1 
ATOM   8136 C  "C4'" . DG  D 4 25  ? -1.739 48.886  -47.133 1.00 99.39  ? 725  DG  T "C4'" 1 
ATOM   8137 O  "O4'" . DG  D 4 25  ? -1.012 49.520  -46.065 1.00 98.34  ? 725  DG  T "O4'" 1 
ATOM   8138 C  "C3'" . DG  D 4 25  ? -2.520 50.009  -47.822 1.00 100.24 ? 725  DG  T "C3'" 1 
ATOM   8139 O  "O3'" . DG  D 4 25  ? -3.861 49.593  -48.074 1.00 100.43 ? 725  DG  T "O3'" 1 
ATOM   8140 C  "C2'" . DG  D 4 25  ? -2.468 51.189  -46.830 1.00 99.47  ? 725  DG  T "C2'" 1 
ATOM   8141 C  "C1'" . DG  D 4 25  ? -1.769 50.603  -45.602 1.00 98.98  ? 725  DG  T "C1'" 1 
ATOM   8142 N  N9    . DG  D 4 25  ? -0.876 51.549  -44.934 1.00 98.93  ? 725  DG  T N9    1 
ATOM   8143 C  C8    . DG  D 4 25  ? 0.224  52.173  -45.474 1.00 99.00  ? 725  DG  T C8    1 
ATOM   8144 N  N7    . DG  D 4 25  ? 0.832  52.971  -44.641 1.00 98.64  ? 725  DG  T N7    1 
ATOM   8145 C  C5    . DG  D 4 25  ? 0.085  52.877  -43.474 1.00 98.73  ? 725  DG  T C5    1 
ATOM   8146 C  C6    . DG  D 4 25  ? 0.261  53.519  -42.223 1.00 98.45  ? 725  DG  T C6    1 
ATOM   8147 O  O6    . DG  D 4 25  ? 1.142  54.323  -41.890 1.00 97.30  ? 725  DG  T O6    1 
ATOM   8148 N  N1    . DG  D 4 25  ? -0.721 53.143  -41.309 1.00 99.94  ? 725  DG  T N1    1 
ATOM   8149 C  C2    . DG  D 4 25  ? -1.742 52.261  -41.570 1.00 100.65 ? 725  DG  T C2    1 
ATOM   8150 N  N2    . DG  D 4 25  ? -2.594 52.023  -40.562 1.00 101.83 ? 725  DG  T N2    1 
ATOM   8151 N  N3    . DG  D 4 25  ? -1.919 51.654  -42.737 1.00 100.55 ? 725  DG  T N3    1 
ATOM   8152 C  C4    . DG  D 4 25  ? -0.971 52.007  -43.638 1.00 98.99  ? 725  DG  T C4    1 
HETATM 8153 O  OAC   . 1RY E 5 .   ? 47.124 -3.399  -23.820 1.00 110.37 ? 601  1RY A OAC   1 
HETATM 8154 P  PAZ   . 1RY E 5 .   ? 48.163 -2.564  -24.491 1.00 111.11 ? 601  1RY A PAZ   1 
HETATM 8155 O  OAF   . 1RY E 5 .   ? 49.487 -2.539  -23.721 1.00 114.49 ? 601  1RY A OAF   1 
HETATM 8156 O  OAG   . 1RY E 5 .   ? 48.445 -3.005  -25.930 1.00 111.75 ? 601  1RY A OAG   1 
HETATM 8157 O  OAQ   . 1RY E 5 .   ? 47.701 -1.043  -24.607 1.00 112.85 ? 601  1RY A OAQ   1 
HETATM 8158 P  PBB   . 1RY E 5 .   ? 46.716 -0.277  -25.596 1.00 104.14 ? 601  1RY A PBB   1 
HETATM 8159 O  OAI   . 1RY E 5 .   ? 46.448 1.109   -25.150 1.00 102.07 ? 601  1RY A OAI   1 
HETATM 8160 O  OAE   . 1RY E 5 .   ? 47.291 -0.403  -27.009 1.00 104.62 ? 601  1RY A OAE   1 
HETATM 8161 O  OAR   . 1RY E 5 .   ? 45.423 -1.204  -25.526 1.00 92.78  ? 601  1RY A OAR   1 
HETATM 8162 P  PBA   . 1RY E 5 .   ? 44.439 -1.587  -24.335 1.00 83.54  ? 601  1RY A PBA   1 
HETATM 8163 O  OAH   . 1RY E 5 .   ? 43.784 -2.921  -24.703 1.00 84.56  ? 601  1RY A OAH   1 
HETATM 8164 O  OAD   . 1RY E 5 .   ? 45.126 -1.544  -23.028 1.00 79.89  ? 601  1RY A OAD   1 
HETATM 8165 O  OAO   . 1RY E 5 .   ? 43.297 -0.479  -24.387 1.00 81.88  ? 601  1RY A OAO   1 
HETATM 8166 C  CAL   . 1RY E 5 .   ? 43.420 0.930   -24.095 1.00 76.45  ? 601  1RY A CAL   1 
HETATM 8167 C  CAW   . 1RY E 5 .   ? 42.051 1.542   -24.247 1.00 69.63  ? 601  1RY A CAW   1 
HETATM 8168 O  OAP   . 1RY E 5 .   ? 41.547 1.267   -25.560 1.00 65.34  ? 601  1RY A OAP   1 
HETATM 8169 S  SAS   . 1RY E 5 .   ? 42.043 3.341   -24.066 1.00 67.80  ? 601  1RY A SAS   1 
HETATM 8170 C  CAM   . 1RY E 5 .   ? 40.505 3.382   -25.021 1.00 65.33  ? 601  1RY A CAM   1 
HETATM 8171 C  CAX   . 1RY E 5 .   ? 40.621 2.239   -26.020 1.00 62.79  ? 601  1RY A CAX   1 
HETATM 8172 N  NAY   . 1RY E 5 .   ? 41.064 2.693   -27.350 1.00 57.67  ? 601  1RY A NAY   1 
HETATM 8173 C  CAK   . 1RY E 5 .   ? 42.375 3.029   -27.579 1.00 56.12  ? 601  1RY A CAK   1 
HETATM 8174 C  CAU   . 1RY E 5 .   ? 42.750 3.433   -28.785 1.00 55.71  ? 601  1RY A CAU   1 
HETATM 8175 F  FAJ   . 1RY E 5 .   ? 44.023 3.792   -29.044 1.00 56.36  ? 601  1RY A FAJ   1 
HETATM 8176 C  CAV   . 1RY E 5 .   ? 40.117 2.772   -28.376 1.00 55.33  ? 601  1RY A CAV   1 
HETATM 8177 O  OAB   . 1RY E 5 .   ? 38.946 2.477   -28.132 1.00 55.72  ? 601  1RY A OAB   1 
HETATM 8178 N  NAN   . 1RY E 5 .   ? 40.522 3.182   -29.609 1.00 53.83  ? 601  1RY A NAN   1 
HETATM 8179 C  CAT   . 1RY E 5 .   ? 41.797 3.509   -29.839 1.00 54.56  ? 601  1RY A CAT   1 
HETATM 8180 N  NAA   . 1RY E 5 .   ? 42.163 3.900   -31.066 1.00 53.30  ? 601  1RY A NAA   1 
HETATM 8181 MG MG    . MG  F 6 .   ? 47.180 0.060   -22.337 1.00 43.01  ? 602  MG  A MG    1 
HETATM 8182 MG MG    . MG  G 6 .   ? 15.277 56.431  -42.100 1.00 39.94  ? 603  MG  A MG    1 
HETATM 8183 S  S     . SO4 H 7 .   ? 27.660 76.556  -40.344 1.00 59.43  ? 604  SO4 A S     1 
HETATM 8184 O  O1    . SO4 H 7 .   ? 27.739 75.388  -41.219 1.00 58.94  ? 604  SO4 A O1    1 
HETATM 8185 O  O2    . SO4 H 7 .   ? 28.037 77.745  -41.103 1.00 64.14  ? 604  SO4 A O2    1 
HETATM 8186 O  O3    . SO4 H 7 .   ? 26.298 76.708  -39.845 1.00 58.66  ? 604  SO4 A O3    1 
HETATM 8187 O  O4    . SO4 H 7 .   ? 28.569 76.395  -39.212 1.00 59.28  ? 604  SO4 A O4    1 
HETATM 8188 S  S     . SO4 I 7 .   ? 33.141 17.589  -32.590 1.00 136.25 ? 901  SO4 P S     1 
HETATM 8189 O  O1    . SO4 I 7 .   ? 31.775 18.104  -32.566 1.00 136.07 ? 901  SO4 P O1    1 
HETATM 8190 O  O2    . SO4 I 7 .   ? 33.454 17.109  -33.933 1.00 136.14 ? 901  SO4 P O2    1 
HETATM 8191 O  O3    . SO4 I 7 .   ? 33.265 16.492  -31.634 1.00 136.10 ? 901  SO4 P O3    1 
HETATM 8192 O  O4    . SO4 I 7 .   ? 34.071 18.654  -32.225 1.00 136.15 ? 901  SO4 P O4    1 
HETATM 8193 S  S     . SO4 J 7 .   ? 36.712 11.048  -32.838 1.00 111.72 ? 801  SO4 T S     1 
HETATM 8194 O  O1    . SO4 J 7 .   ? 36.399 11.703  -34.105 1.00 111.29 ? 801  SO4 T O1    1 
HETATM 8195 O  O2    . SO4 J 7 .   ? 38.076 10.530  -32.885 1.00 111.28 ? 801  SO4 T O2    1 
HETATM 8196 O  O3    . SO4 J 7 .   ? 35.779 9.947   -32.612 1.00 111.69 ? 801  SO4 T O3    1 
HETATM 8197 O  O4    . SO4 J 7 .   ? 36.591 12.013  -31.749 1.00 111.42 ? 801  SO4 T O4    1 
HETATM 8198 O  O     . HOH K 8 .   ? 40.964 8.241   -7.452  1.00 34.27  ? 701  HOH A O     1 
HETATM 8199 O  O     . HOH K 8 .   ? 29.622 -10.183 -36.215 1.00 51.21  ? 702  HOH A O     1 
HETATM 8200 O  O     . HOH K 8 .   ? 29.139 61.764  -32.095 1.00 47.28  ? 703  HOH A O     1 
HETATM 8201 O  O     . HOH K 8 .   ? 32.732 72.803  -32.001 1.00 41.07  ? 704  HOH A O     1 
HETATM 8202 O  O     . HOH K 8 .   ? 31.349 4.247   -11.998 1.00 45.20  ? 705  HOH A O     1 
HETATM 8203 O  O     . HOH K 8 .   ? 47.874 17.713  -23.746 1.00 32.48  ? 706  HOH A O     1 
HETATM 8204 O  O     . HOH K 8 .   ? 41.199 9.831   -17.401 1.00 36.60  ? 707  HOH A O     1 
HETATM 8205 O  O     . HOH K 8 .   ? 30.748 -1.853  -15.532 1.00 47.17  ? 708  HOH A O     1 
HETATM 8206 O  O     . HOH K 8 .   ? 57.628 23.203  -9.956  1.00 54.91  ? 709  HOH A O     1 
HETATM 8207 O  O     . HOH K 8 .   ? 54.448 16.572  -11.870 1.00 38.91  ? 710  HOH A O     1 
HETATM 8208 O  O     . HOH K 8 .   ? 31.906 71.011  -42.939 1.00 48.06  ? 711  HOH A O     1 
HETATM 8209 O  O     . HOH K 8 .   ? 50.226 19.514  -11.604 1.00 27.38  ? 712  HOH A O     1 
HETATM 8210 O  O     . HOH K 8 .   ? 48.461 10.279  -18.004 1.00 31.01  ? 713  HOH A O     1 
HETATM 8211 O  O     . HOH K 8 .   ? 52.494 9.869   -26.125 1.00 45.59  ? 714  HOH A O     1 
HETATM 8212 O  O     . HOH K 8 .   ? 46.719 11.716  -8.072  1.00 43.63  ? 715  HOH A O     1 
HETATM 8213 O  O     . HOH K 8 .   ? 11.742 62.944  -37.884 1.00 43.73  ? 716  HOH A O     1 
HETATM 8214 O  O     . HOH K 8 .   ? 38.973 20.977  -18.655 1.00 35.83  ? 717  HOH A O     1 
HETATM 8215 O  O     . HOH K 8 .   ? 37.037 3.619   -4.249  1.00 43.87  ? 718  HOH A O     1 
HETATM 8216 O  O     . HOH K 8 .   ? 48.718 27.811  -8.368  1.00 52.08  ? 719  HOH A O     1 
HETATM 8217 O  O     . HOH K 8 .   ? 44.338 20.629  -18.563 1.00 26.72  ? 720  HOH A O     1 
HETATM 8218 O  O     . HOH K 8 .   ? 53.008 -0.691  -17.426 1.00 39.02  ? 721  HOH A O     1 
HETATM 8219 O  O     . HOH K 8 .   ? 63.184 9.644   -0.368  1.00 36.65  ? 722  HOH A O     1 
HETATM 8220 O  O     . HOH K 8 .   ? 48.851 23.105  -12.631 1.00 47.05  ? 723  HOH A O     1 
HETATM 8221 O  O     . HOH K 8 .   ? 41.413 20.487  -21.783 1.00 33.69  ? 724  HOH A O     1 
HETATM 8222 O  O     . HOH K 8 .   ? 32.689 -1.174  -13.511 1.00 40.96  ? 725  HOH A O     1 
HETATM 8223 O  O     . HOH K 8 .   ? 18.163 62.529  -40.712 1.00 35.63  ? 726  HOH A O     1 
HETATM 8224 O  O     . HOH K 8 .   ? 42.261 -5.303  -28.887 1.00 55.86  ? 727  HOH A O     1 
HETATM 8225 O  O     . HOH K 8 .   ? 48.318 24.434  -10.163 1.00 40.87  ? 728  HOH A O     1 
HETATM 8226 O  O     . HOH K 8 .   ? 33.049 47.529  -33.003 1.00 51.22  ? 729  HOH A O     1 
HETATM 8227 O  O     . HOH K 8 .   ? 38.018 70.271  -44.590 1.00 48.06  ? 730  HOH A O     1 
HETATM 8228 O  O     . HOH K 8 .   ? 33.100 2.105   -11.496 1.00 33.85  ? 731  HOH A O     1 
HETATM 8229 O  O     . HOH K 8 .   ? 8.542  57.954  -45.564 1.00 50.24  ? 732  HOH A O     1 
HETATM 8230 O  O     . HOH K 8 .   ? 32.972 16.384  -20.499 1.00 48.86  ? 733  HOH A O     1 
HETATM 8231 O  O     . HOH K 8 .   ? 52.415 18.062  -10.751 1.00 45.20  ? 734  HOH A O     1 
HETATM 8232 O  O     . HOH K 8 .   ? 47.519 15.835  -25.592 1.00 52.13  ? 735  HOH A O     1 
HETATM 8233 O  O     . HOH K 8 .   ? 43.610 22.090  -20.577 1.00 32.26  ? 736  HOH A O     1 
HETATM 8234 O  O     . HOH K 8 .   ? 35.804 5.832   -4.836  1.00 46.81  ? 737  HOH A O     1 
HETATM 8235 O  O     . HOH L 8 .   ? 19.734 38.774  -25.528 1.00 48.66  ? 501  HOH B O     1 
HETATM 8236 O  O     . HOH L 8 .   ? 39.168 15.722  -16.669 1.00 32.19  ? 502  HOH B O     1 
HETATM 8237 O  O     . HOH L 8 .   ? 46.293 18.829  -10.380 1.00 44.77  ? 503  HOH B O     1 
HETATM 8238 O  O     . HOH L 8 .   ? 20.290 22.449  -12.155 1.00 37.07  ? 504  HOH B O     1 
HETATM 8239 O  O     . HOH L 8 .   ? 3.407  65.247  -29.578 1.00 42.89  ? 505  HOH B O     1 
HETATM 8240 O  O     . HOH L 8 .   ? 42.445 19.165  -8.169  1.00 41.96  ? 506  HOH B O     1 
HETATM 8241 O  O     . HOH L 8 .   ? 47.358 15.838  -6.316  1.00 57.80  ? 507  HOH B O     1 
HETATM 8242 O  O     . HOH M 8 .   ? 45.164 15.858  -26.913 1.00 36.31  ? 1001 HOH P O     1 
HETATM 8243 O  O     . HOH N 8 .   ? 29.944 13.470  -28.509 1.00 49.66  ? 901  HOH T O     1 
HETATM 8244 O  O     . HOH N 8 .   ? 31.171 16.786  -24.210 1.00 59.54  ? 902  HOH T O     1 
HETATM 8245 O  O     . HOH N 8 .   ? 39.245 22.430  -21.079 1.00 38.70  ? 903  HOH T O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . PRO A 2   ? 1.0541 1.0067 1.1795 0.1078  -0.0643 -0.0459 1   PRO A N     
2    C CA    . PRO A 2   ? 1.0823 0.9810 1.1697 0.0933  -0.0660 -0.0338 1   PRO A CA    
3    C C     . PRO A 2   ? 0.9959 0.9039 1.0817 0.0611  -0.0588 -0.0306 1   PRO A C     
4    O O     . PRO A 2   ? 0.9487 0.8930 1.0545 0.0506  -0.0513 -0.0391 1   PRO A O     
5    C CB    . PRO A 2   ? 1.1212 1.0074 1.1941 0.1072  -0.0809 -0.0199 1   PRO A CB    
6    C CG    . PRO A 2   ? 1.1056 1.0517 1.2127 0.1173  -0.0901 -0.0253 1   PRO A CG    
7    C CD    . PRO A 2   ? 1.0668 1.0477 1.2094 0.1264  -0.0803 -0.0416 1   PRO A CD    
8    N N     . ILE A 3   ? 0.9089 0.7833 0.9714 0.0467  -0.0597 -0.0176 2   ILE A N     
9    C CA    . ILE A 3   ? 0.8059 0.6889 0.8705 0.0189  -0.0529 -0.0132 2   ILE A CA    
10   C C     . ILE A 3   ? 0.7571 0.6514 0.8167 0.0153  -0.0554 -0.0011 2   ILE A C     
11   O O     . ILE A 3   ? 0.7917 0.6578 0.8283 0.0259  -0.0609 0.0097  2   ILE A O     
12   C CB    . ILE A 3   ? 0.7948 0.6339 0.8431 0.0021  -0.0490 -0.0095 2   ILE A CB    
13   C CG1   . ILE A 3   ? 0.7957 0.6216 0.8428 0.0037  -0.0480 -0.0246 2   ILE A CG1   
14   C CG2   . ILE A 3   ? 0.7714 0.6252 0.8292 -0.0238 -0.0430 -0.0028 2   ILE A CG2   
15   C CD1   . ILE A 3   ? 0.8099 0.5951 0.8440 -0.0163 -0.0480 -0.0246 2   ILE A CD1   
16   N N     . SER A 4   ? 0.6818 0.6122 0.7574 0.0015  -0.0508 -0.0029 3   SER A N     
17   C CA    . SER A 4   ? 0.6699 0.6099 0.7373 -0.0015 -0.0521 0.0056  3   SER A CA    
18   C C     . SER A 4   ? 0.6817 0.5841 0.7240 -0.0115 -0.0450 0.0209  3   SER A C     
19   O O     . SER A 4   ? 0.6413 0.5328 0.6899 -0.0283 -0.0357 0.0233  3   SER A O     
20   C CB    . SER A 4   ? 0.6225 0.6005 0.7097 -0.0154 -0.0459 0.0000  3   SER A CB    
21   O OG    . SER A 4   ? 0.6005 0.5838 0.6758 -0.0172 -0.0470 0.0057  3   SER A OG    
22   N N     . PRO A 5   ? 0.7315 0.6134 0.7453 -0.0021 -0.0488 0.0316  4   PRO A N     
23   C CA    . PRO A 5   ? 0.7868 0.6322 0.7745 -0.0128 -0.0363 0.0477  4   PRO A CA    
24   C C     . PRO A 5   ? 0.7541 0.6201 0.7469 -0.0281 -0.0236 0.0508  4   PRO A C     
25   O O     . PRO A 5   ? 0.7936 0.6355 0.7631 -0.0341 -0.0107 0.0641  4   PRO A O     
26   C CB    . PRO A 5   ? 0.7248 0.5368 0.6715 0.0075  -0.0462 0.0577  4   PRO A CB    
27   C CG    . PRO A 5   ? 0.7278 0.5771 0.6850 0.0236  -0.0646 0.0461  4   PRO A CG    
28   C CD    . PRO A 5   ? 0.7226 0.6112 0.7248 0.0200  -0.0656 0.0298  4   PRO A CD    
29   N N     . ILE A 6   ? 0.7212 0.6288 0.7424 -0.0333 -0.0250 0.0389  5   ILE A N     
30   C CA    . ILE A 6   ? 0.6945 0.6200 0.7221 -0.0455 -0.0127 0.0406  5   ILE A CA    
31   C C     . ILE A 6   ? 0.7040 0.6237 0.7481 -0.0625 0.0030  0.0481  5   ILE A C     
32   O O     . ILE A 6   ? 0.7079 0.6207 0.7675 -0.0688 0.0007  0.0465  5   ILE A O     
33   C CB    . ILE A 6   ? 0.6522 0.6172 0.7047 -0.0468 -0.0177 0.0268  5   ILE A CB    
34   C CG1   . ILE A 6   ? 0.6891 0.6650 0.7391 -0.0544 -0.0066 0.0281  5   ILE A CG1   
35   C CG2   . ILE A 6   ? 0.6031 0.5825 0.6844 -0.0538 -0.0175 0.0197  5   ILE A CG2   
36   C CD1   . ILE A 6   ? 0.6517 0.6586 0.7237 -0.0583 -0.0084 0.0164  5   ILE A CD1   
37   N N     . GLU A 7   ? 0.7114 0.6342 0.7533 -0.0699 0.0188  0.0556  6   GLU A N     
38   C CA    . GLU A 7   ? 0.7084 0.6357 0.7762 -0.0859 0.0341  0.0627  6   GLU A CA    
39   C C     . GLU A 7   ? 0.6312 0.5924 0.7375 -0.0930 0.0277  0.0526  6   GLU A C     
40   O O     . GLU A 7   ? 0.6294 0.6115 0.7389 -0.0870 0.0204  0.0430  6   GLU A O     
41   C CB    . GLU A 7   ? 0.7879 0.7133 0.8457 -0.0884 0.0553  0.0726  6   GLU A CB    
42   C CG    . GLU A 7   ? 0.9661 0.8531 0.9732 -0.0794 0.0618  0.0827  6   GLU A CG    
43   C CD    . GLU A 7   ? 1.0993 0.9795 1.0900 -0.0811 0.0871  0.0921  6   GLU A CD    
44   O OE1   . GLU A 7   ? 1.1119 1.0212 1.1298 -0.0848 0.0965  0.0880  6   GLU A OE1   
45   O OE2   . GLU A 7   ? 1.1725 1.0150 1.1197 -0.0770 0.0988  0.1041  6   GLU A OE2   
46   N N     . THR A 8   ? 0.5940 0.5585 0.7281 -0.1066 0.0297  0.0549  7   THR A N     
47   C CA    . THR A 8   ? 0.5653 0.5575 0.7302 -0.1125 0.0204  0.0462  7   THR A CA    
48   C C     . THR A 8   ? 0.5929 0.6140 0.7796 -0.1141 0.0307  0.0495  7   THR A C     
49   O O     . THR A 8   ? 0.6143 0.6347 0.8018 -0.1152 0.0486  0.0592  7   THR A O     
50   C CB    . THR A 8   ? 0.5678 0.5528 0.7540 -0.1271 0.0140  0.0455  7   THR A CB    
51   O OG1   . THR A 8   ? 0.5813 0.5586 0.7817 -0.1398 0.0298  0.0581  7   THR A OG1   
52   C CG2   . THR A 8   ? 0.5904 0.5443 0.7532 -0.1226 0.0019  0.0386  7   THR A CG2   
53   N N     . VAL A 9   ? 0.5528 0.5960 0.7539 -0.1125 0.0208  0.0416  8   VAL A N     
54   C CA    . VAL A 9   ? 0.5122 0.5810 0.7354 -0.1113 0.0275  0.0445  8   VAL A CA    
55   C C     . VAL A 9   ? 0.5361 0.6239 0.7998 -0.1227 0.0222  0.0472  8   VAL A C     
56   O O     . VAL A 9   ? 0.5432 0.6313 0.8115 -0.1276 0.0039  0.0397  8   VAL A O     
57   C CB    . VAL A 9   ? 0.5117 0.5891 0.7241 -0.1026 0.0197  0.0362  8   VAL A CB    
58   C CG1   . VAL A 9   ? 0.4879 0.5858 0.7208 -0.0990 0.0255  0.0403  8   VAL A CG1   
59   C CG2   . VAL A 9   ? 0.5334 0.5972 0.7142 -0.0946 0.0234  0.0321  8   VAL A CG2   
60   N N     . PRO A 10  ? 0.5601 0.6645 0.8543 -0.1271 0.0372  0.0568  9   PRO A N     
61   C CA    . PRO A 10  ? 0.5741 0.7031 0.9169 -0.1402 0.0304  0.0589  9   PRO A CA    
62   C C     . PRO A 10  ? 0.5826 0.7401 0.9465 -0.1336 0.0140  0.0544  9   PRO A C     
63   O O     . PRO A 10  ? 0.5757 0.7480 0.9448 -0.1209 0.0231  0.0582  9   PRO A O     
64   C CB    . PRO A 10  ? 0.5279 0.6685 0.8978 -0.1445 0.0573  0.0714  9   PRO A CB    
65   C CG    . PRO A 10  ? 0.5446 0.6752 0.8815 -0.1277 0.0748  0.0740  9   PRO A CG    
66   C CD    . PRO A 10  ? 0.5599 0.6614 0.8456 -0.1205 0.0622  0.0654  9   PRO A CD    
67   N N     . VAL A 11  ? 0.5838 0.7434 0.9539 -0.1410 -0.0108 0.0463  10  VAL A N     
68   C CA    . VAL A 11  ? 0.6007 0.7823 0.9843 -0.1347 -0.0309 0.0425  10  VAL A CA    
69   C C     . VAL A 11  ? 0.6218 0.8321 1.0583 -0.1494 -0.0465 0.0425  10  VAL A C     
70   O O     . VAL A 11  ? 0.6799 0.8857 1.1361 -0.1676 -0.0438 0.0427  10  VAL A O     
71   C CB    . VAL A 11  ? 0.6391 0.7970 0.9771 -0.1292 -0.0489 0.0315  10  VAL A CB    
72   C CG1   . VAL A 11  ? 0.6470 0.7867 0.9451 -0.1158 -0.0341 0.0314  10  VAL A CG1   
73   C CG2   . VAL A 11  ? 0.6556 0.7885 0.9787 -0.1423 -0.0596 0.0228  10  VAL A CG2   
74   N N     . LYS A 12  ? 0.6032 0.8422 1.0632 -0.1416 -0.0641 0.0424  11  LYS A N     
75   C CA    . LYS A 12  ? 0.5858 0.8602 1.1027 -0.1543 -0.0845 0.0412  11  LYS A CA    
76   C C     . LYS A 12  ? 0.5800 0.8633 1.0867 -0.1436 -0.1175 0.0352  11  LYS A C     
77   O O     . LYS A 12  ? 0.5895 0.8591 1.0567 -0.1239 -0.1166 0.0367  11  LYS A O     
78   C CB    . LYS A 12  ? 0.5500 0.8684 1.1329 -0.1539 -0.0647 0.0530  11  LYS A CB    
79   N N     . LEU A 13  ? 0.5661 0.8689 1.1057 -0.1578 -0.1472 0.0282  12  LEU A N     
80   C CA    . LEU A 13  ? 0.5676 0.8811 1.0989 -0.1470 -0.1826 0.0233  12  LEU A CA    
81   C C     . LEU A 13  ? 0.5371 0.8971 1.1172 -0.1284 -0.1827 0.0350  12  LEU A C     
82   O O     . LEU A 13  ? 0.5194 0.9123 1.1551 -0.1293 -0.1587 0.0445  12  LEU A O     
83   C CB    . LEU A 13  ? 0.5840 0.9041 1.1355 -0.1686 -0.2185 0.0104  12  LEU A CB    
84   C CG    . LEU A 13  ? 0.5953 0.8627 1.0896 -0.1830 -0.2261 -0.0041 12  LEU A CG    
85   C CD1   . LEU A 13  ? 0.6152 0.8892 1.1312 -0.2046 -0.2649 -0.0183 12  LEU A CD1   
86   C CD2   . LEU A 13  ? 0.6105 0.8355 1.0225 -0.1629 -0.2269 -0.0080 12  LEU A CD2   
87   N N     . LYS A 14  ? 0.5545 0.9139 1.1096 -0.1095 -0.2085 0.0348  13  LYS A N     
88   C CA    . LYS A 14  ? 0.5835 0.9869 1.1867 -0.0892 -0.2160 0.0452  13  LYS A CA    
89   C C     . LYS A 14  ? 0.6254 1.0884 1.3188 -0.1050 -0.2364 0.0433  13  LYS A C     
90   O O     . LYS A 14  ? 0.6568 1.1192 1.3575 -0.1286 -0.2622 0.0311  13  LYS A O     
91   C CB    . LYS A 14  ? 0.5890 0.9733 1.1406 -0.0661 -0.2443 0.0458  13  LYS A CB    
92   N N     . PRO A 15  ? 0.6145 1.1296 1.3802 -0.0932 -0.2240 0.0544  14  PRO A N     
93   C CA    . PRO A 15  ? 0.6062 1.1860 1.4713 -0.1109 -0.2370 0.0532  14  PRO A CA    
94   C C     . PRO A 15  ? 0.6209 1.2217 1.5012 -0.1174 -0.2942 0.0422  14  PRO A C     
95   O O     . PRO A 15  ? 0.6384 1.2277 1.4775 -0.0939 -0.3244 0.0423  14  PRO A O     
96   C CB    . PRO A 15  ? 0.6010 1.2297 1.5289 -0.0858 -0.2148 0.0677  14  PRO A CB    
97   C CG    . PRO A 15  ? 0.5946 1.1740 1.4554 -0.0666 -0.1751 0.0754  14  PRO A CG    
98   C CD    . PRO A 15  ? 0.6072 1.1230 1.3692 -0.0644 -0.1929 0.0678  14  PRO A CD    
99   N N     . GLY A 16  ? 0.6372 1.2618 1.5674 -0.1499 -0.3075 0.0320  15  GLY A N     
100  C CA    . GLY A 16  ? 0.6989 1.3366 1.6294 -0.1574 -0.3549 0.0177  15  GLY A CA    
101  C C     . GLY A 16  ? 0.7630 1.3433 1.6089 -0.1625 -0.3917 0.0042  15  GLY A C     
102  O O     . GLY A 16  ? 0.8004 1.3856 1.6297 -0.1584 -0.4353 -0.0057 15  GLY A O     
103  N N     . MET A 17  ? 0.7661 1.2864 1.5449 -0.1687 -0.3701 0.0024  16  MET A N     
104  C CA    . MET A 17  ? 0.8188 1.2751 1.5010 -0.1699 -0.3930 -0.0115 16  MET A CA    
105  C C     . MET A 17  ? 0.8173 1.2310 1.4755 -0.1997 -0.3756 -0.0227 16  MET A C     
106  O O     . MET A 17  ? 0.7506 1.1700 1.4435 -0.2125 -0.3373 -0.0157 16  MET A O     
107  C CB    . MET A 17  ? 0.8287 1.2395 1.4240 -0.1381 -0.3764 -0.0031 16  MET A CB    
108  C CG    . MET A 17  ? 0.8356 1.2759 1.4430 -0.1055 -0.3906 0.0099  16  MET A CG    
109  S SD    . MET A 17  ? 0.8706 1.2452 1.3646 -0.0739 -0.3774 0.0173  16  MET A SD    
110  C CE    . MET A 17  ? 0.8646 1.2803 1.3955 -0.0375 -0.3900 0.0353  16  MET A CE    
111  N N     . ASP A 18  ? 0.9164 1.2828 1.5097 -0.2088 -0.4039 -0.0400 17  ASP A N     
112  C CA    . ASP A 18  ? 0.9726 1.2902 1.5343 -0.2341 -0.3931 -0.0530 17  ASP A CA    
113  C C     . ASP A 18  ? 0.9923 1.2401 1.4459 -0.2180 -0.3840 -0.0591 17  ASP A C     
114  O O     . ASP A 18  ? 1.0081 1.2456 1.4135 -0.1904 -0.3831 -0.0525 17  ASP A O     
115  C CB    . ASP A 18  ? 1.0568 1.3786 1.6417 -0.2623 -0.4296 -0.0716 17  ASP A CB    
116  C CG    . ASP A 18  ? 1.0929 1.4692 1.7688 -0.2811 -0.4120 -0.0662 17  ASP A CG    
117  O OD1   . ASP A 18  ? 1.0669 1.4544 1.7800 -0.2856 -0.3706 -0.0525 17  ASP A OD1   
118  O OD2   . ASP A 18  ? 1.1543 1.5611 1.8620 -0.2916 -0.4390 -0.0759 17  ASP A OD2   
119  N N     . GLY A 19  ? 0.9954 1.1941 1.4128 -0.2353 -0.3754 -0.0716 18  GLY A N     
120  C CA    . GLY A 19  ? 0.9834 1.1197 1.3090 -0.2212 -0.3604 -0.0778 18  GLY A CA    
121  C C     . GLY A 19  ? 0.9939 1.0951 1.2473 -0.2128 -0.3961 -0.0934 18  GLY A C     
122  O O     . GLY A 19  ? 1.0165 1.1326 1.2855 -0.2236 -0.4391 -0.1040 18  GLY A O     
123  N N     . PRO A 20  ? 0.9579 1.0112 1.1295 -0.1937 -0.3786 -0.0955 19  PRO A N     
124  C CA    . PRO A 20  ? 0.9999 1.0137 1.0907 -0.1823 -0.4064 -0.1086 19  PRO A CA    
125  C C     . PRO A 20  ? 1.0698 1.0380 1.1254 -0.2020 -0.4297 -0.1332 19  PRO A C     
126  O O     . PRO A 20  ? 1.0671 1.0156 1.1374 -0.2188 -0.4125 -0.1398 19  PRO A O     
127  C CB    . PRO A 20  ? 0.9786 0.9586 1.0038 -0.1584 -0.3695 -0.1015 19  PRO A CB    
128  C CG    . PRO A 20  ? 0.9331 0.9139 0.9903 -0.1654 -0.3301 -0.0963 19  PRO A CG    
129  C CD    . PRO A 20  ? 0.8914 0.9254 1.0414 -0.1819 -0.3321 -0.0864 19  PRO A CD    
130  N N     . LYS A 21  ? 1.1236 1.0695 1.1263 -0.1989 -0.4700 -0.1472 20  LYS A N     
131  C CA    . LYS A 21  ? 1.1670 1.0621 1.1235 -0.2163 -0.4972 -0.1737 20  LYS A CA    
132  C C     . LYS A 21  ? 1.2357 1.0722 1.0787 -0.1953 -0.5074 -0.1851 20  LYS A C     
133  O O     . LYS A 21  ? 1.3110 1.1226 1.1099 -0.2007 -0.5516 -0.2031 20  LYS A O     
134  C CB    . LYS A 21  ? 1.1789 1.1088 1.1966 -0.2430 -0.5468 -0.1843 20  LYS A CB    
135  C CG    . LYS A 21  ? 1.0483 1.0393 1.1808 -0.2637 -0.5301 -0.1714 20  LYS A CG    
136  C CD    . LYS A 21  ? 1.0882 1.0985 1.2671 -0.2898 -0.5490 -0.1840 20  LYS A CD    
137  C CE    . LYS A 21  ? 1.0603 1.1339 1.3503 -0.3087 -0.5287 -0.1696 20  LYS A CE    
138  N NZ    . LYS A 21  ? 1.0157 1.1631 1.3679 -0.2934 -0.5355 -0.1509 20  LYS A NZ    
139  N N     . VAL A 22  ? 1.2215 1.0345 1.0146 -0.1715 -0.4658 -0.1750 21  VAL A N     
140  C CA    . VAL A 22  ? 1.2826 1.0387 0.9665 -0.1504 -0.4648 -0.1831 21  VAL A CA    
141  C C     . VAL A 22  ? 1.3798 1.0696 1.0028 -0.1561 -0.4541 -0.2066 21  VAL A C     
142  O O     . VAL A 22  ? 1.3666 1.0525 1.0250 -0.1663 -0.4276 -0.2090 21  VAL A O     
143  C CB    . VAL A 22  ? 1.1934 0.9560 0.8565 -0.1244 -0.4225 -0.1615 21  VAL A CB    
144  N N     . LYS A 23  ? 1.5174 1.1506 1.0431 -0.1474 -0.4745 -0.2241 22  LYS A N     
145  C CA    . LYS A 23  ? 1.6029 1.1656 1.0599 -0.1502 -0.4673 -0.2494 22  LYS A CA    
146  C C     . LYS A 23  ? 1.6375 1.1641 1.0306 -0.1240 -0.4150 -0.2453 22  LYS A C     
147  O O     . LYS A 23  ? 1.6694 1.2050 1.0328 -0.1037 -0.3976 -0.2291 22  LYS A O     
148  C CB    . LYS A 23  ? 1.7218 1.2377 1.1026 -0.1555 -0.5177 -0.2735 22  LYS A CB    
149  N N     . GLN A 24  ? 1.5991 1.0844 0.9737 -0.1248 -0.3893 -0.2601 23  GLN A N     
150  C CA    . GLN A 24  ? 1.5757 1.0331 0.9029 -0.1004 -0.3377 -0.2579 23  GLN A CA    
151  C C     . GLN A 24  ? 1.7634 1.1621 0.9736 -0.0819 -0.3391 -0.2699 23  GLN A C     
152  O O     . GLN A 24  ? 1.9157 1.2636 1.0615 -0.0883 -0.3742 -0.2930 23  GLN A O     
153  C CB    . GLN A 24  ? 1.5068 0.9341 0.8456 -0.1032 -0.3135 -0.2715 23  GLN A CB    
154  C CG    . GLN A 24  ? 1.4884 0.8929 0.7887 -0.0769 -0.2605 -0.2707 23  GLN A CG    
155  C CD    . GLN A 24  ? 1.4064 0.8724 0.7668 -0.0667 -0.2253 -0.2434 23  GLN A CD    
156  O OE1   . GLN A 24  ? 1.4053 0.8697 0.7284 -0.0476 -0.1949 -0.2358 23  GLN A OE1   
157  N NE2   . GLN A 24  ? 1.3261 0.8439 0.7780 -0.0806 -0.2282 -0.2288 23  GLN A NE2   
158  N N     . TRP A 25  ? 1.7955 1.1985 0.9757 -0.0599 -0.3004 -0.2545 24  TRP A N     
159  C CA    . TRP A 25  ? 1.9462 1.2914 1.0120 -0.0399 -0.2893 -0.2622 24  TRP A CA    
160  C C     . TRP A 25  ? 1.9670 1.2644 0.9865 -0.0253 -0.2442 -0.2780 24  TRP A C     
161  O O     . TRP A 25  ? 1.8980 1.2194 0.9822 -0.0255 -0.2140 -0.2754 24  TRP A O     
162  C CB    . TRP A 25  ? 1.9981 1.3710 1.0565 -0.0255 -0.2686 -0.2355 24  TRP A CB    
163  C CG    . TRP A 25  ? 1.9506 1.3825 1.0968 -0.0238 -0.2267 -0.2132 24  TRP A CG    
164  C CD1   . TRP A 25  ? 1.9227 1.3686 1.1175 -0.0228 -0.1891 -0.2156 24  TRP A CD1   
165  C CD2   . TRP A 25  ? 1.9226 1.4047 1.1153 -0.0223 -0.2208 -0.1860 24  TRP A CD2   
166  N NE1   . TRP A 25  ? 1.8508 1.3537 1.1184 -0.0222 -0.1624 -0.1926 24  TRP A NE1   
167  C CE2   . TRP A 25  ? 1.8474 1.3713 1.1143 -0.0226 -0.1798 -0.1747 24  TRP A CE2   
168  C CE3   . TRP A 25  ? 1.9543 1.4472 1.1312 -0.0192 -0.2475 -0.1704 24  TRP A CE3   
169  C CZ2   . TRP A 25  ? 1.7764 1.3491 1.0987 -0.0223 -0.1642 -0.1502 24  TRP A CZ2   
170  C CZ3   . TRP A 25  ? 1.8876 1.4279 1.1209 -0.0169 -0.2296 -0.1448 24  TRP A CZ3   
171  C CH2   . TRP A 25  ? 1.7939 1.3721 1.0978 -0.0196 -0.1880 -0.1359 24  TRP A CH2   
172  N N     . PRO A 26  ? 2.0584 1.2861 0.9638 -0.0105 -0.2388 -0.2949 25  PRO A N     
173  C CA    . PRO A 26  ? 2.0822 1.2620 0.9426 0.0059  -0.1948 -0.3121 25  PRO A CA    
174  C C     . PRO A 26  ? 1.9981 1.2146 0.8959 0.0230  -0.1324 -0.2931 25  PRO A C     
175  O O     . PRO A 26  ? 1.9393 1.1834 0.8365 0.0286  -0.1161 -0.2712 25  PRO A O     
176  C CB    . PRO A 26  ? 2.2224 1.3307 0.9586 0.0183  -0.2022 -0.3280 25  PRO A CB    
177  C CG    . PRO A 26  ? 2.2430 1.3696 0.9571 0.0163  -0.2316 -0.3096 25  PRO A CG    
178  C CD    . PRO A 26  ? 2.1550 1.3402 0.9630 -0.0066 -0.2745 -0.3004 25  PRO A CD    
179  N N     . LEU A 27  ? 2.0007 1.2163 0.9324 0.0310  -0.0986 -0.3018 26  LEU A N     
180  C CA    . LEU A 27  ? 1.9482 1.2033 0.9266 0.0464  -0.0418 -0.2871 26  LEU A CA    
181  C C     . LEU A 27  ? 2.0288 1.2328 0.9474 0.0703  0.0014  -0.3066 26  LEU A C     
182  O O     . LEU A 27  ? 2.0949 1.2362 0.9558 0.0737  -0.0127 -0.3323 26  LEU A O     
183  C CB    . LEU A 27  ? 1.7945 1.1152 0.8938 0.0361  -0.0407 -0.2744 26  LEU A CB    
184  N N     . THR A 28  ? 2.0179 1.2496 0.9531 0.0867  0.0556  -0.2947 27  THR A N     
185  C CA    . THR A 28  ? 2.0978 1.2931 0.9897 0.1123  0.1048  -0.3105 27  THR A CA    
186  C C     . THR A 28  ? 2.0815 1.2833 1.0343 0.1192  0.1096  -0.3230 27  THR A C     
187  O O     . THR A 28  ? 1.9747 1.2330 1.0255 0.1079  0.0963  -0.3101 27  THR A O     
188  C CB    . THR A 28  ? 2.1070 1.3428 1.0196 0.1244  0.1618  -0.2924 27  THR A CB    
189  O OG1   . THR A 28  ? 2.1760 1.3939 1.0206 0.1191  0.1587  -0.2799 27  THR A OG1   
190  C CG2   . THR A 28  ? 2.2128 1.4194 1.0908 0.1523  0.2176  -0.3082 27  THR A CG2   
191  N N     . GLU A 29  ? 2.1940 1.3321 1.0823 0.1397  0.1292  -0.3479 28  GLU A N     
192  C CA    . GLU A 29  ? 2.1950 1.3267 1.1288 0.1513  0.1358  -0.3608 28  GLU A CA    
193  C C     . GLU A 29  ? 2.0917 1.3034 1.1358 0.1618  0.1704  -0.3425 28  GLU A C     
194  O O     . GLU A 29  ? 2.0460 1.2787 1.1598 0.1613  0.1582  -0.3412 28  GLU A O     
195  C CB    . GLU A 29  ? 2.2987 1.3576 1.1506 0.1759  0.1607  -0.3864 28  GLU A CB    
196  N N     . GLU A 30  ? 2.0551 1.3099 1.1147 0.1707  0.2128  -0.3283 29  GLU A N     
197  C CA    . GLU A 30  ? 1.9446 1.2822 1.1140 0.1765  0.2404  -0.3108 29  GLU A CA    
198  C C     . GLU A 30  ? 1.8320 1.2277 1.0832 0.1501  0.2019  -0.2902 29  GLU A C     
199  O O     . GLU A 30  ? 1.8089 1.2479 1.1441 0.1522  0.1979  -0.2838 29  GLU A O     
200  C CB    . GLU A 30  ? 1.9748 1.3439 1.1413 0.1855  0.2923  -0.3003 29  GLU A CB    
201  C CG    . GLU A 30  ? 1.9093 1.3707 1.1916 0.1837  0.3144  -0.2806 29  GLU A CG    
202  C CD    . GLU A 30  ? 1.9464 1.4369 1.2269 0.1863  0.3649  -0.2696 29  GLU A CD    
203  O OE1   . GLU A 30  ? 1.9439 1.4754 1.2790 0.2043  0.4095  -0.2709 29  GLU A OE1   
204  O OE2   . GLU A 30  ? 1.9755 1.4474 1.2010 0.1705  0.3602  -0.2592 29  GLU A OE2   
205  N N     . LYS A 31  ? 1.7897 1.1852 1.0144 0.1272  0.1734  -0.2792 30  LYS A N     
206  C CA    . LYS A 31  ? 1.6421 1.0863 0.9370 0.1030  0.1366  -0.2611 30  LYS A CA    
207  C C     . LYS A 31  ? 1.6122 1.0356 0.9276 0.0948  0.0982  -0.2706 30  LYS A C     
208  O O     . LYS A 31  ? 1.3566 0.8255 0.7514 0.0851  0.0844  -0.2580 30  LYS A O     
209  C CB    . LYS A 31  ? 1.5984 1.0383 0.8532 0.0842  0.1124  -0.2498 30  LYS A CB    
210  N N     . ILE A 32  ? 1.6663 1.0166 0.9070 0.0979  0.0821  -0.2931 31  ILE A N     
211  C CA    . ILE A 32  ? 1.6425 0.9641 0.8979 0.0877  0.0479  -0.3033 31  ILE A CA    
212  C C     . ILE A 32  ? 1.5965 0.9344 0.9121 0.1060  0.0697  -0.3033 31  ILE A C     
213  O O     . ILE A 32  ? 1.5299 0.8859 0.9038 0.0947  0.0483  -0.2953 31  ILE A O     
214  C CB    . ILE A 32  ? 1.7578 0.9912 0.9142 0.0871  0.0278  -0.3304 31  ILE A CB    
215  C CG1   . ILE A 32  ? 1.6804 0.9016 0.7816 0.0682  -0.0036 -0.3290 31  ILE A CG1   
216  C CG2   . ILE A 32  ? 1.6628 0.8601 0.8350 0.0756  -0.0027 -0.3423 31  ILE A CG2   
217  C CD1   . ILE A 32  ? 1.8054 0.9393 0.7990 0.0685  -0.0244 -0.3569 31  ILE A CD1   
218  N N     . LYS A 33  ? 1.6432 0.9750 0.9455 0.1360  0.1133  -0.3115 32  LYS A N     
219  C CA    . LYS A 33  ? 1.5990 0.9494 0.9602 0.1583  0.1333  -0.3112 32  LYS A CA    
220  C C     . LYS A 33  ? 1.5164 0.9537 0.9781 0.1519  0.1347  -0.2862 32  LYS A C     
221  O O     . LYS A 33  ? 1.5010 0.9528 1.0172 0.1543  0.1227  -0.2800 32  LYS A O     
222  C CB    . LYS A 33  ? 1.6484 0.9814 0.9793 0.1934  0.1818  -0.3254 32  LYS A CB    
223  N N     . ALA A 34  ? 1.4227 0.9130 0.9046 0.1438  0.1494  -0.2716 33  ALA A N     
224  C CA    . ALA A 34  ? 1.3208 0.8887 0.8915 0.1341  0.1472  -0.2494 33  ALA A CA    
225  C C     . ALA A 34  ? 1.2768 0.8485 0.8748 0.1091  0.1039  -0.2391 33  ALA A C     
226  O O     . ALA A 34  ? 1.2268 0.8329 0.8889 0.1095  0.0963  -0.2283 33  ALA A O     
227  C CB    . ALA A 34  ? 1.2952 0.9055 0.8707 0.1248  0.1671  -0.2368 33  ALA A CB    
228  N N     . LEU A 35  ? 1.2987 0.8345 0.8475 0.0880  0.0751  -0.2426 34  LEU A N     
229  C CA    . LEU A 35  ? 1.2371 0.7803 0.8153 0.0625  0.0366  -0.2328 34  LEU A CA    
230  C C     . LEU A 35  ? 1.2745 0.7832 0.8647 0.0652  0.0227  -0.2399 34  LEU A C     
231  O O     . LEU A 35  ? 1.1483 0.6829 0.7918 0.0536  0.0074  -0.2262 34  LEU A O     
232  C CB    . LEU A 35  ? 1.2609 0.7756 0.7866 0.0414  0.0080  -0.2371 34  LEU A CB    
233  C CG    . LEU A 35  ? 1.2363 0.7859 0.7555 0.0343  0.0130  -0.2239 34  LEU A CG    
234  C CD1   . LEU A 35  ? 1.2864 0.7975 0.7410 0.0202  -0.0173 -0.2313 34  LEU A CD1   
235  C CD2   . LEU A 35  ? 1.1235 0.7392 0.7199 0.0213  0.0079  -0.2008 34  LEU A CD2   
236  N N     . VAL A 36  ? 1.3598 0.8049 0.8968 0.0812  0.0296  -0.2610 35  VAL A N     
237  C CA    . VAL A 36  ? 1.3759 0.7784 0.9187 0.0834  0.0166  -0.2673 35  VAL A CA    
238  C C     . VAL A 36  ? 1.3133 0.7520 0.9174 0.1059  0.0357  -0.2557 35  VAL A C     
239  O O     . VAL A 36  ? 1.2849 0.7202 0.9226 0.0999  0.0204  -0.2464 35  VAL A O     
240  C CB    . VAL A 36  ? 1.5193 0.8355 0.9837 0.0946  0.0176  -0.2945 35  VAL A CB    
241  C CG1   . VAL A 36  ? 1.6209 0.9004 1.0236 0.0701  -0.0093 -0.3067 35  VAL A CG1   
242  C CG2   . VAL A 36  ? 1.5612 0.8685 0.9999 0.1313  0.0584  -0.3062 35  VAL A CG2   
243  N N     . GLU A 37  ? 1.3093 0.7847 0.9305 0.1318  0.0688  -0.2553 36  GLU A N     
244  C CA    . GLU A 37  ? 1.2091 0.7292 0.8960 0.1530  0.0821  -0.2439 36  GLU A CA    
245  C C     . GLU A 37  ? 1.2347 0.8138 0.9828 0.1320  0.0642  -0.2207 36  GLU A C     
246  O O     . GLU A 37  ? 1.2282 0.8105 1.0106 0.1349  0.0520  -0.2107 36  GLU A O     
247  C CB    . GLU A 37  ? 1.2099 0.7689 0.9131 0.1804  0.1206  -0.2480 36  GLU A CB    
248  N N     . ILE A 38  ? 1.1493 0.7697 0.9057 0.1117  0.0629  -0.2119 37  ILE A N     
249  C CA    . ILE A 38  ? 1.0463 0.7187 0.8545 0.0918  0.0478  -0.1915 37  ILE A CA    
250  C C     . ILE A 38  ? 1.0304 0.6725 0.8379 0.0719  0.0179  -0.1858 37  ILE A C     
251  O O     . ILE A 38  ? 1.0162 0.6821 0.8658 0.0687  0.0094  -0.1712 37  ILE A O     
252  C CB    . ILE A 38  ? 1.0205 0.7269 0.8248 0.0737  0.0509  -0.1851 37  ILE A CB    
253  C CG1   . ILE A 38  ? 1.0210 0.7665 0.8405 0.0903  0.0846  -0.1862 37  ILE A CG1   
254  C CG2   . ILE A 38  ? 0.8946 0.6412 0.7414 0.0512  0.0321  -0.1662 37  ILE A CG2   
255  C CD1   . ILE A 38  ? 1.0141 0.7788 0.8166 0.0747  0.0920  -0.1804 37  ILE A CD1   
256  N N     . CYS A 39  ? 1.0838 0.6715 0.8422 0.0576  0.0019  -0.1977 38  CYS A N     
257  C CA    . CYS A 39  ? 1.1076 0.6715 0.8710 0.0328  -0.0253 -0.1922 38  CYS A CA    
258  C C     . CYS A 39  ? 1.1621 0.6840 0.9285 0.0437  -0.0272 -0.1929 38  CYS A C     
259  O O     . CYS A 39  ? 1.1600 0.6842 0.9541 0.0289  -0.0401 -0.1791 38  CYS A O     
260  C CB    . CYS A 39  ? 1.1661 0.6891 0.8810 0.0120  -0.0451 -0.2061 38  CYS A CB    
261  S SG    . CYS A 39  ? 1.1435 0.7172 0.8679 -0.0100 -0.0570 -0.1959 38  CYS A SG    
262  N N     . THR A 40  ? 1.2003 0.6800 0.9362 0.0706  -0.0127 -0.2080 39  THR A N     
263  C CA    . THR A 40  ? 1.2203 0.6602 0.9601 0.0867  -0.0125 -0.2061 39  THR A CA    
264  C C     . THR A 40  ? 1.1634 0.6580 0.9599 0.0999  -0.0073 -0.1854 39  THR A C     
265  O O     . THR A 40  ? 1.1955 0.6746 1.0065 0.0945  -0.0183 -0.1721 39  THR A O     
266  C CB    . THR A 40  ? 1.3170 0.7056 1.0158 0.1190  0.0052  -0.2264 39  THR A CB    
267  O OG1   . THR A 40  ? 1.3012 0.7389 1.0140 0.1433  0.0306  -0.2295 39  THR A OG1   
268  C CG2   . THR A 40  ? 1.3287 0.6467 0.9612 0.1042  -0.0048 -0.2486 39  THR A CG2   
269  N N     . GLU A 41  ? 1.0901 0.6480 0.9174 0.1154  0.0092  -0.1822 40  GLU A N     
270  C CA    . GLU A 41  ? 1.0063 0.6193 0.8873 0.1266  0.0105  -0.1647 40  GLU A CA    
271  C C     . GLU A 41  ? 0.9732 0.6090 0.8765 0.0970  -0.0073 -0.1463 40  GLU A C     
272  O O     . GLU A 41  ? 0.9435 0.5798 0.8659 0.1010  -0.0153 -0.1321 40  GLU A O     
273  C CB    . GLU A 41  ? 0.9885 0.6676 0.9015 0.1411  0.0305  -0.1665 40  GLU A CB    
274  N N     . MET A 42  ? 0.9570 0.6092 0.8553 0.0690  -0.0133 -0.1460 41  MET A N     
275  C CA    . MET A 42  ? 0.9226 0.6014 0.8456 0.0430  -0.0266 -0.1291 41  MET A CA    
276  C C     . MET A 42  ? 0.9538 0.5827 0.8640 0.0260  -0.0413 -0.1240 41  MET A C     
277  O O     . MET A 42  ? 0.8826 0.5249 0.8155 0.0153  -0.0469 -0.1072 41  MET A O     
278  C CB    . MET A 42  ? 0.9143 0.6229 0.8362 0.0214  -0.0291 -0.1302 41  MET A CB    
279  C CG    . MET A 42  ? 0.9412 0.7014 0.8796 0.0321  -0.0125 -0.1306 41  MET A CG    
280  S SD    . MET A 42  ? 0.9899 0.7722 0.9167 0.0092  -0.0161 -0.1299 41  MET A SD    
281  C CE    . MET A 42  ? 0.8987 0.7118 0.8637 -0.0134 -0.0310 -0.1100 41  MET A CE    
282  N N     . GLU A 43  ? 1.0378 0.6063 0.9099 0.0221  -0.0464 -0.1387 42  GLU A N     
283  C CA    . GLU A 43  ? 1.1023 0.6192 0.9638 0.0026  -0.0589 -0.1350 42  GLU A CA    
284  C C     . GLU A 43  ? 1.0389 0.5254 0.9012 0.0228  -0.0540 -0.1244 42  GLU A C     
285  O O     . GLU A 43  ? 1.0454 0.5118 0.9144 0.0071  -0.0595 -0.1100 42  GLU A O     
286  C CB    . GLU A 43  ? 1.1708 0.6273 0.9887 -0.0081 -0.0674 -0.1562 42  GLU A CB    
287  C CG    . GLU A 43  ? 1.2078 0.6288 1.0252 -0.0436 -0.0846 -0.1543 42  GLU A CG    
288  C CD    . GLU A 43  ? 1.2889 0.6451 1.0932 -0.0407 -0.0827 -0.1496 42  GLU A CD    
289  O OE1   . GLU A 43  ? 1.3209 0.6476 1.1053 -0.0078 -0.0712 -0.1528 42  GLU A OE1   
290  O OE2   . GLU A 43  ? 1.3070 0.6413 1.1220 -0.0708 -0.0917 -0.1421 42  GLU A OE2   
291  N N     . LYS A 44  ? 1.1139 0.5965 0.9695 0.0589  -0.0427 -0.1306 43  LYS A N     
292  C CA    . LYS A 44  ? 1.1610 0.6199 1.0187 0.0834  -0.0408 -0.1188 43  LYS A CA    
293  C C     . LYS A 44  ? 1.1080 0.6163 1.0003 0.0794  -0.0443 -0.0963 43  LYS A C     
294  O O     . LYS A 44  ? 1.1416 0.6183 1.0273 0.0795  -0.0486 -0.0807 43  LYS A O     
295  C CB    . LYS A 44  ? 1.1901 0.6505 1.0452 0.1257  -0.0287 -0.1297 43  LYS A CB    
296  C CG    . LYS A 44  ? 1.2608 0.6467 1.0703 0.1386  -0.0236 -0.1496 43  LYS A CG    
297  C CD    . LYS A 44  ? 1.2999 0.6800 1.1117 0.1863  -0.0111 -0.1549 43  LYS A CD    
298  C CE    . LYS A 44  ? 1.4326 0.7271 1.1931 0.2013  -0.0048 -0.1745 43  LYS A CE    
299  N NZ    . LYS A 44  ? 1.4896 0.7705 1.2536 0.2515  0.0069  -0.1773 43  LYS A NZ    
300  N N     . GLU A 45  ? 1.0399 0.6203 0.9638 0.0757  -0.0417 -0.0942 44  GLU A N     
301  C CA    . GLU A 45  ? 0.9808 0.6078 0.9337 0.0728  -0.0450 -0.0758 44  GLU A CA    
302  C C     . GLU A 45  ? 0.9626 0.5915 0.9198 0.0375  -0.0502 -0.0637 44  GLU A C     
303  O O     . GLU A 45  ? 0.9625 0.6222 0.9367 0.0337  -0.0514 -0.0485 44  GLU A O     
304  C CB    . GLU A 45  ? 0.9519 0.6515 0.9374 0.0820  -0.0390 -0.0798 44  GLU A CB    
305  C CG    . GLU A 45  ? 1.0015 0.7115 0.9931 0.1146  -0.0295 -0.0931 44  GLU A CG    
306  C CD    . GLU A 45  ? 0.9888 0.7694 1.0148 0.1165  -0.0202 -0.0979 44  GLU A CD    
307  O OE1   . GLU A 45  ? 0.9742 0.8015 1.0321 0.1207  -0.0247 -0.0884 44  GLU A OE1   
308  O OE2   . GLU A 45  ? 1.0010 0.7869 1.0186 0.1125  -0.0084 -0.1111 44  GLU A OE2   
309  N N     . GLY A 46  ? 0.9730 0.5715 0.9164 0.0122  -0.0535 -0.0709 45  GLY A N     
310  C CA    . GLY A 46  ? 0.9587 0.5656 0.9155 -0.0209 -0.0575 -0.0601 45  GLY A CA    
311  C C     . GLY A 46  ? 0.8846 0.5543 0.8682 -0.0348 -0.0578 -0.0597 45  GLY A C     
312  O O     . GLY A 46  ? 0.8563 0.5452 0.8589 -0.0558 -0.0584 -0.0476 45  GLY A O     
313  N N     . LYS A 47  ? 0.8573 0.5572 0.8421 -0.0228 -0.0551 -0.0719 46  LYS A N     
314  C CA    . LYS A 47  ? 0.8257 0.5772 0.8302 -0.0353 -0.0549 -0.0709 46  LYS A CA    
315  C C     . LYS A 47  ? 0.8782 0.6190 0.8741 -0.0579 -0.0648 -0.0798 46  LYS A C     
316  O O     . LYS A 47  ? 0.8671 0.6422 0.8822 -0.0739 -0.0686 -0.0741 46  LYS A O     
317  C CB    . LYS A 47  ? 0.7602 0.5472 0.7693 -0.0149 -0.0454 -0.0782 46  LYS A CB    
318  C CG    . LYS A 47  ? 0.7232 0.5364 0.7519 0.0038  -0.0403 -0.0692 46  LYS A CG    
319  C CD    . LYS A 47  ? 0.7178 0.5580 0.7548 0.0262  -0.0301 -0.0794 46  LYS A CD    
320  C CE    . LYS A 47  ? 0.6761 0.5453 0.7378 0.0442  -0.0305 -0.0717 46  LYS A CE    
321  N NZ    . LYS A 47  ? 0.7065 0.6054 0.7862 0.0668  -0.0203 -0.0823 46  LYS A NZ    
322  N N     . ILE A 48  ? 0.9206 0.6131 0.8869 -0.0583 -0.0707 -0.0944 47  ILE A N     
323  C CA    . ILE A 48  ? 0.9340 0.6087 0.8896 -0.0818 -0.0859 -0.1042 47  ILE A CA    
324  C C     . ILE A 48  ? 0.9808 0.5973 0.9244 -0.0946 -0.0931 -0.1072 47  ILE A C     
325  O O     . ILE A 48  ? 0.9996 0.5768 0.9260 -0.0781 -0.0854 -0.1074 47  ILE A O     
326  C CB    . ILE A 48  ? 0.9628 0.6289 0.8837 -0.0731 -0.0883 -0.1230 47  ILE A CB    
327  C CG1   . ILE A 48  ? 0.9916 0.6123 0.8773 -0.0488 -0.0782 -0.1368 47  ILE A CG1   
328  C CG2   . ILE A 48  ? 0.9206 0.6404 0.8529 -0.0648 -0.0795 -0.1181 47  ILE A CG2   
329  C CD1   . ILE A 48  ? 1.0050 0.6128 0.8501 -0.0380 -0.0751 -0.1553 47  ILE A CD1   
330  N N     . SER A 49  ? 0.9883 0.5992 0.9430 -0.1243 -0.1084 -0.1094 48  SER A N     
331  C CA    . SER A 49  ? 1.0538 0.6118 1.0043 -0.1443 -0.1152 -0.1114 48  SER A CA    
332  C C     . SER A 49  ? 1.0135 0.5420 0.9429 -0.1634 -0.1366 -0.1328 48  SER A C     
333  O O     . SER A 49  ? 0.9912 0.5572 0.9335 -0.1757 -0.1512 -0.1369 48  SER A O     
334  C CB    . SER A 49  ? 0.9361 0.5174 0.9312 -0.1680 -0.1119 -0.0914 48  SER A CB    
335  O OG    . SER A 49  ? 0.9079 0.5013 0.9104 -0.1503 -0.0936 -0.0728 48  SER A OG    
336  N N     . LYS A 50  ? 1.1158 0.5738 1.0094 -0.1647 -0.1401 -0.1467 49  LYS A N     
337  C CA    . LYS A 50  ? 1.1469 0.5677 1.0160 -0.1859 -0.1633 -0.1691 49  LYS A CA    
338  C C     . LYS A 50  ? 1.1376 0.5824 1.0546 -0.2262 -0.1808 -0.1637 49  LYS A C     
339  O O     . LYS A 50  ? 1.1226 0.5733 1.0775 -0.2414 -0.1706 -0.1459 49  LYS A O     
340  C CB    . LYS A 50  ? 1.2341 0.5670 1.0556 -0.1804 -0.1614 -0.1845 49  LYS A CB    
341  C CG    . LYS A 50  ? 1.3565 0.6646 1.1325 -0.1387 -0.1442 -0.1932 49  LYS A CG    
342  C CD    . LYS A 50  ? 1.4186 0.6345 1.1471 -0.1319 -0.1422 -0.2088 49  LYS A CD    
343  C CE    . LYS A 50  ? 1.4241 0.6179 1.1089 -0.0887 -0.1249 -0.2207 49  LYS A CE    
344  N NZ    . LYS A 50  ? 1.5363 0.6352 1.1708 -0.0786 -0.1221 -0.2375 49  LYS A NZ    
345  N N     . ILE A 51  ? 1.1504 0.6102 1.0656 -0.2428 -0.2071 -0.1789 50  ILE A N     
346  C CA    . ILE A 51  ? 1.1804 0.6716 1.1486 -0.2806 -0.2279 -0.1764 50  ILE A CA    
347  C C     . ILE A 51  ? 1.2559 0.6922 1.1979 -0.3063 -0.2568 -0.2025 50  ILE A C     
348  O O     . ILE A 51  ? 1.2918 0.6636 1.1687 -0.2924 -0.2591 -0.2223 50  ILE A O     
349  C CB    . ILE A 51  ? 1.0981 0.6680 1.0995 -0.2785 -0.2388 -0.1690 50  ILE A CB    
350  C CG1   . ILE A 51  ? 1.1069 0.6673 1.0528 -0.2621 -0.2569 -0.1884 50  ILE A CG1   
351  C CG2   . ILE A 51  ? 1.0149 0.6343 1.0426 -0.2567 -0.2104 -0.1445 50  ILE A CG2   
352  C CD1   . ILE A 51  ? 1.0533 0.6816 1.0209 -0.2552 -0.2664 -0.1798 50  ILE A CD1   
353  N N     . GLY A 52  ? 1.2550 0.7169 1.2488 -0.3438 -0.2791 -0.2037 51  GLY A N     
354  C CA    . GLY A 52  ? 1.3497 0.7721 1.3283 -0.3704 -0.3070 -0.2281 51  GLY A CA    
355  C C     . GLY A 52  ? 1.3611 0.8508 1.3774 -0.3854 -0.3366 -0.2340 51  GLY A C     
356  O O     . GLY A 52  ? 1.3019 0.8456 1.3309 -0.3724 -0.3460 -0.2262 51  GLY A O     
357  N N     . PRO A 53  ? 1.4380 0.9242 1.4726 -0.4126 -0.3526 -0.2482 52  PRO A N     
358  C CA    . PRO A 53  ? 1.4462 0.9972 1.5190 -0.4266 -0.3838 -0.2545 52  PRO A CA    
359  C C     . PRO A 53  ? 1.3803 1.0179 1.5466 -0.4401 -0.3769 -0.2313 52  PRO A C     
360  O O     . PRO A 53  ? 1.3620 1.0618 1.5625 -0.4435 -0.4016 -0.2326 52  PRO A O     
361  C CB    . PRO A 53  ? 1.5372 1.0519 1.6033 -0.4537 -0.3996 -0.2774 52  PRO A CB    
362  C CG    . PRO A 53  ? 1.5608 1.0178 1.6271 -0.4644 -0.3685 -0.2722 52  PRO A CG    
363  C CD    . PRO A 53  ? 1.5337 0.9536 1.5526 -0.4310 -0.3442 -0.2602 52  PRO A CD    
364  N N     . GLU A 54  ? 1.3493 0.9910 1.5549 -0.4458 -0.3434 -0.2098 53  GLU A N     
365  C CA    . GLU A 54  ? 1.3103 1.0322 1.5985 -0.4538 -0.3307 -0.1866 53  GLU A CA    
366  C C     . GLU A 54  ? 1.2600 1.0318 1.5512 -0.4257 -0.3352 -0.1741 53  GLU A C     
367  O O     . GLU A 54  ? 1.2096 1.0538 1.5672 -0.4280 -0.3295 -0.1575 53  GLU A O     
368  C CB    . GLU A 54  ? 1.2979 1.0019 1.6135 -0.4640 -0.2907 -0.1660 53  GLU A CB    
369  C CG    . GLU A 54  ? 1.2619 0.9286 1.5351 -0.4364 -0.2685 -0.1518 53  GLU A CG    
370  C CD    . GLU A 54  ? 1.3223 0.8965 1.5131 -0.4240 -0.2699 -0.1680 53  GLU A CD    
371  O OE1   . GLU A 54  ? 1.3818 0.9159 1.5486 -0.4383 -0.2843 -0.1894 53  GLU A OE1   
372  O OE2   . GLU A 54  ? 1.2954 0.8403 1.4452 -0.3966 -0.2537 -0.1597 53  GLU A OE2   
373  N N     . ASN A 55  ? 1.2620 0.9953 1.4821 -0.3992 -0.3428 -0.1820 54  ASN A N     
374  C CA    . ASN A 55  ? 1.2033 0.9761 1.4181 -0.3738 -0.3480 -0.1725 54  ASN A CA    
375  C C     . ASN A 55  ? 1.2415 1.0277 1.4259 -0.3665 -0.3853 -0.1894 54  ASN A C     
376  O O     . ASN A 55  ? 1.3129 1.0408 1.4191 -0.3565 -0.3984 -0.2093 54  ASN A O     
377  C CB    . ASN A 55  ? 1.1765 0.9114 1.3266 -0.3388 -0.3158 -0.1671 54  ASN A CB    
378  C CG    . ASN A 55  ? 1.1160 0.9032 1.2702 -0.3090 -0.3003 -0.1498 54  ASN A CG    
379  O OD1   . ASN A 55  ? 1.1120 0.9410 1.2769 -0.3042 -0.3218 -0.1501 54  ASN A OD1   
380  N ND2   . ASN A 55  ? 1.0846 0.8671 1.2290 -0.2887 -0.2641 -0.1347 54  ASN A ND2   
381  N N     . PRO A 56  ? 1.1881 1.0460 1.4266 -0.3688 -0.4024 -0.1822 55  PRO A N     
382  C CA    . PRO A 56  ? 1.2095 1.0782 1.4166 -0.3608 -0.4409 -0.1966 55  PRO A CA    
383  C C     . PRO A 56  ? 1.1717 1.0420 1.3286 -0.3297 -0.4490 -0.1922 55  PRO A C     
384  O O     . PRO A 56  ? 1.2075 1.0810 1.3283 -0.3198 -0.4800 -0.2021 55  PRO A O     
385  C CB    . PRO A 56  ? 1.1835 1.1311 1.4801 -0.3765 -0.4533 -0.1883 55  PRO A CB    
386  C CG    . PRO A 56  ? 1.1058 1.0967 1.4681 -0.3753 -0.4182 -0.1628 55  PRO A CG    
387  C CD    . PRO A 56  ? 1.1056 1.0359 1.4366 -0.3782 -0.3860 -0.1603 55  PRO A CD    
388  N N     . TYR A 57  ? 1.0888 0.9599 1.2370 -0.3088 -0.4123 -0.1754 56  TYR A N     
389  C CA    . TYR A 57  ? 1.0519 0.9360 1.1593 -0.2750 -0.4024 -0.1653 56  TYR A CA    
390  C C     . TYR A 57  ? 1.1060 0.9241 1.1175 -0.2539 -0.3874 -0.1771 56  TYR A C     
391  O O     . TYR A 57  ? 1.1551 0.9204 1.1371 -0.2608 -0.3769 -0.1895 56  TYR A O     
392  C CB    . TYR A 57  ? 0.9394 0.8710 1.0971 -0.2622 -0.3650 -0.1389 56  TYR A CB    
393  C CG    . TYR A 57  ? 0.8920 0.8862 1.1470 -0.2817 -0.3690 -0.1263 56  TYR A CG    
394  C CD1   . TYR A 57  ? 0.8871 0.9322 1.1843 -0.2848 -0.4029 -0.1254 56  TYR A CD1   
395  C CD2   . TYR A 57  ? 0.8548 0.8574 1.1590 -0.2953 -0.3379 -0.1145 56  TYR A CD2   
396  C CE1   . TYR A 57  ? 0.8428 0.9506 1.2361 -0.3012 -0.4035 -0.1140 56  TYR A CE1   
397  C CE2   . TYR A 57  ? 0.8118 0.8714 1.2046 -0.3129 -0.3361 -0.1024 56  TYR A CE2   
398  C CZ    . TYR A 57  ? 0.8073 0.9220 1.2481 -0.3159 -0.3679 -0.1026 56  TYR A CZ    
399  O OH    . TYR A 57  ? 0.7925 0.9682 1.3224 -0.3291 -0.3590 -0.0905 56  TYR A OH    
400  N N     . ASN A 58  ? 1.0875 0.9080 1.0507 -0.2273 -0.3846 -0.1724 57  ASN A N     
401  C CA    . ASN A 58  ? 1.0941 0.8615 0.9728 -0.2046 -0.3630 -0.1803 57  ASN A CA    
402  C C     . ASN A 58  ? 1.0662 0.8530 0.9157 -0.1784 -0.3522 -0.1667 57  ASN A C     
403  O O     . ASN A 58  ? 1.0610 0.8858 0.9325 -0.1768 -0.3747 -0.1578 57  ASN A O     
404  C CB    . ASN A 58  ? 1.1650 0.8683 0.9700 -0.2101 -0.3896 -0.2080 57  ASN A CB    
405  C CG    . ASN A 58  ? 1.1803 0.8264 0.9061 -0.1877 -0.3594 -0.2172 57  ASN A CG    
406  O OD1   . ASN A 58  ? 1.1688 0.7924 0.9008 -0.1864 -0.3314 -0.2184 57  ASN A OD1   
407  N ND2   . ASN A 58  ? 1.2270 0.8491 0.8779 -0.1684 -0.3635 -0.2229 57  ASN A ND2   
408  N N     . THR A 59  ? 1.0516 0.8116 0.8536 -0.1577 -0.3169 -0.1650 58  THR A N     
409  C CA    . THR A 59  ? 1.0667 0.8348 0.8338 -0.1345 -0.2998 -0.1530 58  THR A CA    
410  C C     . THR A 59  ? 1.1216 0.8376 0.8135 -0.1178 -0.2734 -0.1644 58  THR A C     
411  O O     . THR A 59  ? 1.1095 0.8048 0.8056 -0.1186 -0.2530 -0.1719 58  THR A O     
412  C CB    . THR A 59  ? 0.9638 0.7823 0.7914 -0.1287 -0.2714 -0.1296 58  THR A CB    
413  O OG1   . THR A 59  ? 0.9095 0.7616 0.8142 -0.1473 -0.2756 -0.1238 58  THR A OG1   
414  C CG2   . THR A 59  ? 0.9473 0.7938 0.7734 -0.1174 -0.2804 -0.1147 58  THR A CG2   
415  N N     . PRO A 60  ? 1.1822 0.8751 0.8049 -0.1012 -0.2716 -0.1653 59  PRO A N     
416  C CA    . PRO A 60  ? 1.2440 0.8860 0.7932 -0.0853 -0.2444 -0.1777 59  PRO A CA    
417  C C     . PRO A 60  ? 1.2231 0.8837 0.7989 -0.0732 -0.1964 -0.1666 59  PRO A C     
418  O O     . PRO A 60  ? 1.1816 0.8885 0.8101 -0.0727 -0.1829 -0.1472 59  PRO A O     
419  C CB    . PRO A 60  ? 1.2869 0.9040 0.7584 -0.0720 -0.2545 -0.1770 59  PRO A CB    
420  C CG    . PRO A 60  ? 1.2753 0.9209 0.7739 -0.0829 -0.3005 -0.1709 59  PRO A CG    
421  C CD    . PRO A 60  ? 1.1838 0.8899 0.7863 -0.0956 -0.2965 -0.1562 59  PRO A CD    
422  N N     . VAL A 61  ? 1.2585 0.8818 0.7973 -0.0625 -0.1715 -0.1803 60  VAL A N     
423  C CA    . VAL A 61  ? 1.2128 0.8533 0.7757 -0.0493 -0.1278 -0.1732 60  VAL A CA    
424  C C     . VAL A 61  ? 1.2578 0.8613 0.7482 -0.0299 -0.0989 -0.1819 60  VAL A C     
425  O O     . VAL A 61  ? 1.3521 0.9047 0.7675 -0.0260 -0.1111 -0.1977 60  VAL A O     
426  C CB    . VAL A 61  ? 1.2056 0.8451 0.8117 -0.0520 -0.1202 -0.1793 60  VAL A CB    
427  C CG1   . VAL A 61  ? 1.1523 0.8344 0.8347 -0.0694 -0.1362 -0.1656 60  VAL A CG1   
428  C CG2   . VAL A 61  ? 1.3014 0.8808 0.8576 -0.0538 -0.1358 -0.2032 60  VAL A CG2   
429  N N     . PHE A 62  ? 1.2096 0.8394 0.7235 -0.0186 -0.0595 -0.1719 61  PHE A N     
430  C CA    . PHE A 62  ? 1.2316 0.8356 0.6921 -0.0004 -0.0224 -0.1784 61  PHE A CA    
431  C C     . PHE A 62  ? 1.1451 0.7926 0.6670 0.0073  0.0156  -0.1697 61  PHE A C     
432  O O     . PHE A 62  ? 1.0583 0.7450 0.6516 0.0002  0.0095  -0.1617 61  PHE A O     
433  C CB    . PHE A 62  ? 1.2715 0.8577 0.6685 0.0027  -0.0206 -0.1709 61  PHE A CB    
434  C CG    . PHE A 62  ? 1.2259 0.8574 0.6661 -0.0046 -0.0192 -0.1473 61  PHE A CG    
435  C CD1   . PHE A 62  ? 1.1966 0.8509 0.6705 -0.0178 -0.0570 -0.1379 61  PHE A CD1   
436  C CD2   . PHE A 62  ? 1.2217 0.8715 0.6692 0.0017  0.0213  -0.1353 61  PHE A CD2   
437  C CE1   . PHE A 62  ? 1.1503 0.8408 0.6601 -0.0218 -0.0541 -0.1172 61  PHE A CE1   
438  C CE2   . PHE A 62  ? 1.1738 0.8571 0.6560 -0.0055 0.0228  -0.1149 61  PHE A CE2   
439  C CZ    . PHE A 62  ? 1.1399 0.8414 0.6507 -0.0158 -0.0148 -0.1060 61  PHE A CZ    
440  N N     . ALA A 63  ? 1.1907 0.8318 0.6849 0.0217  0.0551  -0.1715 62  ALA A N     
441  C CA    . ALA A 63  ? 1.1764 0.8623 0.7325 0.0289  0.0902  -0.1655 62  ALA A CA    
442  C C     . ALA A 63  ? 1.2418 0.9307 0.7712 0.0355  0.1303  -0.1594 62  ALA A C     
443  O O     . ALA A 63  ? 1.3521 0.9948 0.8017 0.0420  0.1394  -0.1652 62  ALA A O     
444  C CB    . ALA A 63  ? 1.1867 0.8631 0.7584 0.0442  0.1017  -0.1812 62  ALA A CB    
445  N N     . ILE A 64  ? 1.3493 0.8817 0.8009 -0.1158 0.0426  -0.0289 63  ILE A N     
446  C CA    . ILE A 64  ? 1.3797 0.9426 0.8599 -0.1219 0.0630  0.0261  63  ILE A CA    
447  C C     . ILE A 64  ? 1.3461 0.9328 0.8931 -0.1135 0.0981  0.0251  63  ILE A C     
448  O O     . ILE A 64  ? 1.2944 0.8712 0.8700 -0.0993 0.0985  -0.0142 63  ILE A O     
449  C CB    . ILE A 64  ? 1.3893 0.9452 0.9322 -0.1362 0.0249  0.0674  63  ILE A CB    
450  C CG1   . ILE A 64  ? 1.3276 0.8681 0.9679 -0.1334 -0.0046 0.0453  63  ILE A CG1   
451  C CG2   . ILE A 64  ? 1.4380 0.9805 0.9143 -0.1379 -0.0103 0.0715  63  ILE A CG2   
452  C CD1   . ILE A 64  ? 1.3296 0.8511 1.0318 -0.1424 -0.0459 0.0753  63  ILE A CD1   
453  N N     . LYS A 65  ? 1.3757 1.0009 0.9501 -0.1198 0.1302  0.0732  64  LYS A N     
454  C CA    . LYS A 65  ? 1.3436 1.0089 0.9975 -0.1142 0.1620  0.0781  64  LYS A CA    
455  C C     . LYS A 65  ? 1.2878 0.9535 1.0689 -0.1286 0.1243  0.0828  64  LYS A C     
456  O O     . LYS A 65  ? 1.3019 0.9569 1.1304 -0.1514 0.1003  0.1212  64  LYS A O     
457  C CB    . LYS A 65  ? 1.3934 1.1104 1.0395 -0.1161 0.2141  0.1322  64  LYS A CB    
458  N N     . LYS A 66  ? 1.2263 0.9015 1.0589 -0.1108 0.1174  0.0420  65  LYS A N     
459  C CA    . LYS A 66  ? 1.1724 0.8550 1.1215 -0.1169 0.0777  0.0348  65  LYS A CA    
460  C C     . LYS A 66  ? 1.2398 0.9738 1.2955 -0.1419 0.0947  0.0774  65  LYS A C     
461  O O     . LYS A 66  ? 1.2455 1.0195 1.2852 -0.1478 0.1455  0.1150  65  LYS A O     
462  C CB    . LYS A 66  ? 1.0893 0.7811 1.0568 -0.0818 0.0688  -0.0179 65  LYS A CB    
463  C CG    . LYS A 66  ? 1.0623 0.7036 0.9671 -0.0607 0.0422  -0.0540 65  LYS A CG    
464  C CD    . LYS A 66  ? 1.0041 0.6593 0.9369 -0.0198 0.0348  -0.0947 65  LYS A CD    
465  N N     . LYS A 67  ? 1.3119 1.0465 1.4825 -0.1555 0.0510  0.0703  66  LYS A N     
466  C CA    . LYS A 67  ? 1.4203 1.2054 1.7215 -0.1855 0.0609  0.1044  66  LYS A CA    
467  C C     . LYS A 67  ? 1.5107 1.3768 1.8480 -0.1679 0.1007  0.0929  66  LYS A C     
468  O O     . LYS A 67  ? 1.5337 1.4605 1.9495 -0.1909 0.1365  0.1367  66  LYS A O     
469  C CB    . LYS A 67  ? 1.3802 1.1431 1.7992 -0.2004 -0.0036 0.0810  66  LYS A CB    
470  N N     . ASP A 68  ? 1.5922 1.4634 1.8772 -0.1248 0.0985  0.0395  67  ASP A N     
471  C CA    . ASP A 68  ? 1.6095 1.5528 1.9092 -0.0969 0.1393  0.0283  67  ASP A CA    
472  C C     . ASP A 68  ? 1.6925 1.6506 1.9025 -0.0925 0.2080  0.0654  67  ASP A C     
473  O O     . ASP A 68  ? 1.7722 1.6846 1.8975 -0.1072 0.2197  0.0932  67  ASP A O     
474  C CB    . ASP A 68  ? 1.5754 1.5066 1.8261 -0.0450 0.1241  -0.0307 67  ASP A CB    
475  N N     . SER A 69  ? 1.7117 1.7397 1.9373 -0.0654 0.2520  0.0630  68  SER A N     
476  C CA    . SER A 69  ? 1.7141 1.7747 1.8754 -0.0574 0.3202  0.1016  68  SER A CA    
477  C C     . SER A 69  ? 1.6853 1.6686 1.6771 -0.0358 0.3361  0.0830  68  SER A C     
478  O O     . SER A 69  ? 1.7429 1.7014 1.6665 -0.0530 0.3494  0.1163  68  SER A O     
479  C CB    . SER A 69  ? 1.7326 1.8835 1.9407 -0.0221 0.3620  0.0953  68  SER A CB    
480  N N     . THR A 70  ? 1.5883 1.5329 1.5135 0.0030  0.3335  0.0297  69  THR A N     
481  C CA    . THR A 70  ? 1.5580 1.4336 1.3364 0.0232  0.3528  0.0050  69  THR A CA    
482  C C     . THR A 70  ? 1.4451 1.2379 1.1803 0.0262  0.3089  -0.0396 69  THR A C     
483  O O     . THR A 70  ? 1.4852 1.2190 1.1183 0.0438  0.3223  -0.0706 69  THR A O     
484  C CB    . THR A 70  ? 1.5862 1.4849 1.3115 0.0714  0.4096  -0.0119 69  THR A CB    
485  N N     . LYS A 71  ? 1.3054 1.0934 1.1190 0.0109  0.2577  -0.0448 70  LYS A N     
486  C CA    . LYS A 71  ? 1.2343 0.9558 1.0133 0.0174  0.2204  -0.0792 70  LYS A CA    
487  C C     . LYS A 71  ? 1.2338 0.9055 0.9552 -0.0155 0.1953  -0.0687 70  LYS A C     
488  O O     . LYS A 71  ? 1.2423 0.9316 0.9878 -0.0457 0.1856  -0.0307 70  LYS A O     
489  C CB    . LYS A 71  ? 1.1697 0.9119 1.0452 0.0253  0.1753  -0.0920 70  LYS A CB    
490  N N     . TRP A 72  ? 1.2236 0.8359 0.8741 -0.0085 0.1861  -0.0994 71  TRP A N     
491  C CA    . TRP A 72  ? 1.2414 0.8143 0.8394 -0.0352 0.1571  -0.0969 71  TRP A CA    
492  C C     . TRP A 72  ? 1.1897 0.7392 0.8291 -0.0364 0.1096  -0.1089 71  TRP A C     
493  O O     . TRP A 72  ? 1.1930 0.7287 0.8471 -0.0102 0.1104  -0.1344 71  TRP A O     
494  C CB    . TRP A 72  ? 1.3245 0.8542 0.8187 -0.0308 0.1783  -0.1266 71  TRP A CB    
495  C CG    . TRP A 72  ? 1.4307 0.9802 0.8571 -0.0285 0.2161  -0.1147 71  TRP A CG    
496  C CD1   . TRP A 72  ? 1.4564 1.0248 0.8620 -0.0004 0.2659  -0.1205 71  TRP A CD1   
497  C CD2   . TRP A 72  ? 1.5046 1.0624 0.8675 -0.0462 0.2090  -0.0932 71  TRP A CD2   
498  N NE1   . TRP A 72  ? 1.5432 1.1322 0.8750 0.0011  0.2920  -0.1047 71  TRP A NE1   
499  C CE2   . TRP A 72  ? 1.5717 1.1552 0.8734 -0.0259 0.2576  -0.0871 71  TRP A CE2   
500  C CE3   . TRP A 72  ? 1.5085 1.0593 0.8565 -0.0706 0.1673  -0.0766 71  TRP A CE3   
501  C CZ2   . TRP A 72  ? 1.6592 1.2629 0.8801 -0.0271 0.2664  -0.0642 71  TRP A CZ2   
502  C CZ3   . TRP A 72  ? 1.5918 1.1616 0.8621 -0.0729 0.1741  -0.0531 71  TRP A CZ3   
503  C CH2   . TRP A 72  ? 1.6680 1.2646 0.8730 -0.0504 0.2236  -0.0468 71  TRP A CH2   
504  N N     . ARG A 73  ? 1.1662 0.7127 0.8210 -0.0605 0.0717  -0.0868 72  ARG A N     
505  C CA    . ARG A 73  ? 1.1306 0.6559 0.8108 -0.0584 0.0268  -0.0968 72  ARG A CA    
506  C C     . ARG A 73  ? 1.1656 0.6608 0.7755 -0.0712 0.0166  -0.1087 72  ARG A C     
507  O O     . ARG A 73  ? 1.2012 0.6972 0.7561 -0.0908 0.0187  -0.0949 72  ARG A O     
508  C CB    . ARG A 73  ? 1.0831 0.6184 0.8270 -0.0724 -0.0114 -0.0684 72  ARG A CB    
509  C CG    . ARG A 73  ? 1.0383 0.5527 0.7998 -0.0638 -0.0582 -0.0780 72  ARG A CG    
510  C CD    . ARG A 73  ? 0.9515 0.4630 0.7778 -0.0729 -0.0965 -0.0549 72  ARG A CD    
511  N NE    . ARG A 73  ? 0.9172 0.4452 0.8250 -0.0546 -0.1102 -0.0728 72  ARG A NE    
512  C CZ    . ARG A 73  ? 0.9840 0.5349 0.9582 -0.0701 -0.1027 -0.0585 72  ARG A CZ    
513  N NH1   . ARG A 73  ? 1.0441 0.6027 1.0098 -0.1020 -0.0745 -0.0173 72  ARG A NH1   
514  N NH2   . ARG A 73  ? 0.9542 0.5267 1.0060 -0.0518 -0.1238 -0.0847 72  ARG A NH2   
515  N N     . LYS A 74  ? 1.1507 0.6262 0.7655 -0.0581 0.0062  -0.1332 73  LYS A N     
516  C CA    . LYS A 74  ? 1.1709 0.6251 0.7422 -0.0734 -0.0062 -0.1488 73  LYS A CA    
517  C C     . LYS A 74  ? 1.1380 0.6033 0.7360 -0.0796 -0.0538 -0.1327 73  LYS A C     
518  O O     . LYS A 74  ? 1.0967 0.5690 0.7487 -0.0580 -0.0724 -0.1287 73  LYS A O     
519  C CB    . LYS A 74  ? 1.1648 0.5930 0.7403 -0.0573 0.0164  -0.1765 73  LYS A CB    
520  C CG    . LYS A 74  ? 1.2020 0.6121 0.7609 -0.0780 0.0023  -0.1940 73  LYS A CG    
521  C CD    . LYS A 74  ? 1.2137 0.5925 0.7929 -0.0624 0.0327  -0.2112 73  LYS A CD    
522  C CE    . LYS A 74  ? 1.2444 0.6030 0.8208 -0.0926 0.0236  -0.2317 73  LYS A CE    
523  N NZ    . LYS A 74  ? 1.2166 0.6132 0.8325 -0.1015 -0.0178 -0.2155 73  LYS A NZ    
524  N N     . LEU A 75  ? 1.1907 0.6608 0.7456 -0.1025 -0.0745 -0.1253 74  LEU A N     
525  C CA    . LEU A 75  ? 1.1944 0.6785 0.7674 -0.1048 -0.1190 -0.1052 74  LEU A CA    
526  C C     . LEU A 75  ? 1.2336 0.7267 0.7796 -0.1195 -0.1385 -0.1241 74  LEU A C     
527  O O     . LEU A 75  ? 1.3060 0.7922 0.8029 -0.1367 -0.1244 -0.1497 74  LEU A O     
528  C CB    . LEU A 75  ? 1.2563 0.7485 0.8107 -0.1142 -0.1307 -0.0667 74  LEU A CB    
529  C CG    . LEU A 75  ? 1.2547 0.7433 0.8588 -0.1093 -0.1221 -0.0382 74  LEU A CG    
530  C CD1   . LEU A 75  ? 1.2764 0.7699 0.8763 -0.1095 -0.0764 -0.0467 74  LEU A CD1   
531  C CD2   . LEU A 75  ? 1.2968 0.7877 0.8864 -0.1206 -0.1351 0.0087  74  LEU A CD2   
532  N N     . VAL A 76  ? 1.1802 0.6917 0.7626 -0.1113 -0.1734 -0.1141 75  VAL A N     
533  C CA    . VAL A 76  ? 1.1968 0.7338 0.7737 -0.1258 -0.1987 -0.1273 75  VAL A CA    
534  C C     . VAL A 76  ? 1.1748 0.7398 0.7448 -0.1203 -0.2415 -0.0974 75  VAL A C     
535  O O     . VAL A 76  ? 1.1382 0.6997 0.7452 -0.0964 -0.2569 -0.0725 75  VAL A O     
536  C CB    . VAL A 76  ? 1.1882 0.7334 0.8261 -0.1150 -0.1937 -0.1396 75  VAL A CB    
537  C CG1   . VAL A 76  ? 1.1988 0.7769 0.8459 -0.1399 -0.2154 -0.1560 75  VAL A CG1   
538  C CG2   . VAL A 76  ? 1.1860 0.6965 0.8339 -0.1082 -0.1471 -0.1576 75  VAL A CG2   
539  N N     . ASP A 77  ? 1.2063 0.7975 0.7263 -0.1379 -0.2627 -0.1024 76  ASP A N     
540  C CA    . ASP A 77  ? 1.1911 0.8150 0.6979 -0.1273 -0.3040 -0.0719 76  ASP A CA    
541  C C     . ASP A 77  ? 1.1455 0.8096 0.7107 -0.1193 -0.3331 -0.0780 76  ASP A C     
542  O O     . ASP A 77  ? 1.1610 0.8713 0.7240 -0.1352 -0.3569 -0.0978 76  ASP A O     
543  C CB    . ASP A 77  ? 1.2414 0.8900 0.6661 -0.1402 -0.3172 -0.0758 76  ASP A CB    
544  C CG    . ASP A 77  ? 1.2864 0.9677 0.6874 -0.1208 -0.3557 -0.0349 76  ASP A CG    
545  O OD1   . ASP A 77  ? 1.2336 0.9055 0.6828 -0.0988 -0.3689 -0.0023 76  ASP A OD1   
546  O OD2   . ASP A 77  ? 1.3503 1.0658 0.6802 -0.1223 -0.3737 -0.0367 76  ASP A OD2   
547  N N     . PHE A 78  ? 1.0857 0.7381 0.7074 -0.0914 -0.3322 -0.0621 77  PHE A N     
548  C CA    . PHE A 78  ? 1.0618 0.7552 0.7432 -0.0734 -0.3499 -0.0624 77  PHE A CA    
549  C C     . PHE A 78  ? 1.0327 0.7595 0.7164 -0.0472 -0.3928 -0.0321 77  PHE A C     
550  O O     . PHE A 78  ? 0.9997 0.7523 0.7330 -0.0159 -0.4052 -0.0235 77  PHE A O     
551  C CB    . PHE A 78  ? 0.9575 0.6263 0.6876 -0.0444 -0.3256 -0.0640 77  PHE A CB    
552  C CG    . PHE A 78  ? 1.0034 0.6710 0.7600 -0.0584 -0.2885 -0.0890 77  PHE A CG    
553  C CD1   . PHE A 78  ? 1.0516 0.7565 0.8299 -0.0883 -0.2892 -0.1052 77  PHE A CD1   
554  C CD2   . PHE A 78  ? 0.9675 0.5966 0.7329 -0.0410 -0.2538 -0.0956 77  PHE A CD2   
555  C CE1   . PHE A 78  ? 0.9409 0.6327 0.7516 -0.1027 -0.2513 -0.1231 77  PHE A CE1   
556  C CE2   . PHE A 78  ? 0.9817 0.6036 0.7688 -0.0480 -0.2155 -0.1113 77  PHE A CE2   
557  C CZ    . PHE A 78  ? 1.0218 0.6690 0.8328 -0.0800 -0.2120 -0.1229 77  PHE A CZ    
558  N N     . ARG A 79  ? 1.0918 0.8206 0.7190 -0.0526 -0.4132 -0.0128 78  ARG A N     
559  C CA    . ARG A 79  ? 1.1651 0.9168 0.7892 -0.0209 -0.4515 0.0225  78  ARG A CA    
560  C C     . ARG A 79  ? 1.1571 0.9888 0.8248 -0.0106 -0.4801 0.0146  78  ARG A C     
561  O O     . ARG A 79  ? 1.1786 1.0274 0.8776 0.0299  -0.5018 0.0373  78  ARG A O     
562  C CB    . ARG A 79  ? 1.1991 0.9494 0.7475 -0.0267 -0.4635 0.0482  78  ARG A CB    
563  C CG    . ARG A 79  ? 1.2238 0.9006 0.7499 -0.0222 -0.4406 0.0814  78  ARG A CG    
564  C CD    . ARG A 79  ? 1.3122 0.9941 0.7600 -0.0230 -0.4436 0.1170  78  ARG A CD    
565  N NE    . ARG A 79  ? 1.3402 1.0416 0.7294 -0.0525 -0.4228 0.0878  78  ARG A NE    
566  C CZ    . ARG A 79  ? 1.4688 1.1787 0.7762 -0.0510 -0.4154 0.1121  78  ARG A CZ    
567  N NH1   . ARG A 79  ? 1.5375 1.2373 0.8172 -0.0240 -0.4237 0.1739  78  ARG A NH1   
568  N NH2   . ARG A 79  ? 1.4925 1.2188 0.7430 -0.0716 -0.3977 0.0762  78  ARG A NH2   
569  N N     . GLU A 80  ? 1.1259 1.0081 0.8034 -0.0462 -0.4806 -0.0188 79  GLU A N     
570  C CA    . GLU A 80  ? 1.0973 1.0672 0.8361 -0.0439 -0.5060 -0.0258 79  GLU A CA    
571  C C     . GLU A 80  ? 1.0554 1.0307 0.8723 -0.0200 -0.4837 -0.0213 79  GLU A C     
572  O O     . GLU A 80  ? 1.0529 1.0768 0.9096 0.0194  -0.5033 0.0011  79  GLU A O     
573  C CB    . GLU A 80  ? 1.1255 1.1406 0.8702 -0.0950 -0.5125 -0.0688 79  GLU A CB    
574  C CG    . GLU A 80  ? 1.1437 1.2656 0.9594 -0.1004 -0.5474 -0.0757 79  GLU A CG    
575  C CD    . GLU A 80  ? 1.2238 1.4062 1.0091 -0.0646 -0.5967 -0.0467 79  GLU A CD    
576  O OE1   . GLU A 80  ? 1.2934 1.4437 0.9886 -0.0532 -0.6076 -0.0332 79  GLU A OE1   
577  O OE2   . GLU A 80  ? 1.2298 1.4954 1.0828 -0.0435 -0.6199 -0.0325 79  GLU A OE2   
578  N N     . LEU A 81  ? 0.7780 0.6771 0.9356 -0.1666 -0.3334 -0.0918 80  LEU A N     
579  C CA    . LEU A 81  ? 0.7319 0.6405 0.9449 -0.1539 -0.3097 -0.0739 80  LEU A CA    
580  C C     . LEU A 81  ? 0.7162 0.6392 0.9194 -0.1486 -0.2905 -0.0531 80  LEU A C     
581  O O     . LEU A 81  ? 0.7060 0.6375 0.9581 -0.1427 -0.2811 -0.0322 80  LEU A O     
582  C CB    . LEU A 81  ? 0.7070 0.6149 0.9239 -0.1451 -0.2881 -0.0898 80  LEU A CB    
583  C CG    . LEU A 81  ? 0.6563 0.5747 0.9207 -0.1333 -0.2624 -0.0707 80  LEU A CG    
584  C CD1   . LEU A 81  ? 0.6313 0.5500 0.9669 -0.1338 -0.2734 -0.0523 80  LEU A CD1   
585  C CD2   . LEU A 81  ? 0.6374 0.5539 0.9024 -0.1264 -0.2449 -0.0856 80  LEU A CD2   
586  N N     . ASN A 82  ? 0.7269 0.6532 0.8688 -0.1509 -0.2838 -0.0591 81  ASN A N     
587  C CA    . ASN A 82  ? 0.7028 0.6416 0.8368 -0.1465 -0.2693 -0.0405 81  ASN A CA    
588  C C     . ASN A 82  ? 0.7583 0.6991 0.9250 -0.1526 -0.2899 -0.0197 81  ASN A C     
589  O O     . ASN A 82  ? 0.7660 0.7172 0.9662 -0.1458 -0.2769 -0.0019 81  ASN A O     
590  C CB    . ASN A 82  ? 0.6851 0.6265 0.7502 -0.1497 -0.2623 -0.0500 81  ASN A CB    
591  C CG    . ASN A 82  ? 0.7095 0.6518 0.7515 -0.1415 -0.2368 -0.0679 81  ASN A CG    
592  O OD1   . ASN A 82  ? 0.7187 0.6637 0.7952 -0.1310 -0.2186 -0.0653 81  ASN A OD1   
593  N ND2   . ASN A 82  ? 0.7110 0.6516 0.6956 -0.1469 -0.2355 -0.0851 81  ASN A ND2   
594  N N     . LYS A 83  ? 0.8038 0.7344 0.9626 -0.1658 -0.3229 -0.0224 82  LYS A N     
595  C CA    . LYS A 83  ? 0.8067 0.7374 1.0082 -0.1722 -0.3464 -0.0017 82  LYS A CA    
596  C C     . LYS A 83  ? 0.8171 0.7508 1.0981 -0.1645 -0.3401 0.0096  82  LYS A C     
597  O O     . LYS A 83  ? 0.7994 0.7419 1.1261 -0.1616 -0.3370 0.0290  82  LYS A O     
598  C CB    . LYS A 83  ? 0.8406 0.7578 1.0192 -0.1889 -0.3862 -0.0073 82  LYS A CB    
599  C CG    . LYS A 83  ? 0.8620 0.7794 0.9676 -0.2002 -0.3973 -0.0093 82  LYS A CG    
600  C CD    . LYS A 83  ? 0.9048 0.8091 0.9868 -0.2181 -0.4384 -0.0134 82  LYS A CD    
601  N N     . ARG A 84  ? 0.8563 0.7836 1.1579 -0.1614 -0.3372 -0.0021 83  ARG A N     
602  C CA    . ARG A 84  ? 0.8375 0.7680 1.2161 -0.1560 -0.3329 0.0102  83  ARG A CA    
603  C C     . ARG A 84  ? 0.7784 0.7245 1.1801 -0.1424 -0.2945 0.0205  83  ARG A C     
604  O O     . ARG A 84  ? 0.7489 0.7020 1.2141 -0.1383 -0.2867 0.0350  83  ARG A O     
605  C CB    . ARG A 84  ? 0.9004 0.8185 1.2977 -0.1583 -0.3456 -0.0045 83  ARG A CB    
606  C CG    . ARG A 84  ? 0.9801 0.8815 1.3404 -0.1714 -0.3809 -0.0227 83  ARG A CG    
607  C CD    . ARG A 84  ? 1.0300 0.9249 1.4244 -0.1822 -0.4163 -0.0092 83  ARG A CD    
608  N NE    . ARG A 84  ? 1.1186 0.9968 1.4738 -0.1892 -0.4414 -0.0263 83  ARG A NE    
609  C CZ    . ARG A 84  ? 1.1605 1.0277 1.5438 -0.1871 -0.4511 -0.0364 83  ARG A CZ    
610  N NH1   . ARG A 84  ? 1.2191 1.0724 1.5629 -0.1943 -0.4735 -0.0539 83  ARG A NH1   
611  N NH2   . ARG A 84  ? 1.1268 0.9980 1.5781 -0.1780 -0.4376 -0.0285 83  ARG A NH2   
612  N N     . THR A 85  ? 0.7569 0.7089 1.1093 -0.1360 -0.2708 0.0138  84  THR A N     
613  C CA    . THR A 85  ? 0.7221 0.6870 1.0877 -0.1241 -0.2362 0.0208  84  THR A CA    
614  C C     . THR A 85  ? 0.6951 0.6739 1.0755 -0.1195 -0.2222 0.0364  84  THR A C     
615  O O     . THR A 85  ? 0.6964 0.6750 1.0580 -0.1242 -0.2349 0.0389  84  THR A O     
616  C CB    . THR A 85  ? 0.7133 0.6766 1.0231 -0.1194 -0.2192 0.0053  84  THR A CB    
617  O OG1   . THR A 85  ? 0.7263 0.6767 1.0275 -0.1236 -0.2323 -0.0124 84  THR A OG1   
618  C CG2   . THR A 85  ? 0.6755 0.6503 0.9976 -0.1084 -0.1870 0.0132  84  THR A CG2   
619  N N     . GLN A 86  ? 0.6739 0.6652 1.0897 -0.1109 -0.1960 0.0470  85  GLN A N     
620  C CA    . GLN A 86  ? 0.6456 0.6516 1.0788 -0.1050 -0.1777 0.0581  85  GLN A CA    
621  C C     . GLN A 86  ? 0.6633 0.6714 1.0404 -0.1020 -0.1696 0.0515  85  GLN A C     
622  O O     . GLN A 86  ? 0.6697 0.6710 0.9948 -0.1022 -0.1692 0.0397  85  GLN A O     
623  C CB    . GLN A 86  ? 0.5851 0.6047 1.0487 -0.0967 -0.1468 0.0667  85  GLN A CB    
624  C CG    . GLN A 86  ? 0.5432 0.5635 0.9610 -0.0907 -0.1264 0.0596  85  GLN A CG    
625  C CD    . GLN A 86  ? 0.5088 0.5447 0.9451 -0.0835 -0.0952 0.0701  85  GLN A CD    
626  O OE1   . GLN A 86  ? 0.5049 0.5437 0.9724 -0.0838 -0.0883 0.0785  85  GLN A OE1   
627  N NE2   . GLN A 86  ? 0.4592 0.5054 0.8758 -0.0775 -0.0768 0.0700  85  GLN A NE2   
628  N N     . ASP A 87  ? 0.6542 0.6726 1.0477 -0.0989 -0.1623 0.0590  86  ASP A N     
629  C CA    . ASP A 87  ? 0.6385 0.6604 0.9886 -0.0952 -0.1538 0.0547  86  ASP A CA    
630  C C     . ASP A 87  ? 0.6442 0.6750 0.9767 -0.0847 -0.1216 0.0517  86  ASP A C     
631  O O     . ASP A 87  ? 0.6358 0.6753 0.9997 -0.0798 -0.1029 0.0570  86  ASP A O     
632  C CB    . ASP A 87  ? 0.6266 0.6552 1.0069 -0.0961 -0.1611 0.0631  86  ASP A CB    
633  C CG    . ASP A 87  ? 0.6878 0.7066 1.0720 -0.1082 -0.1968 0.0678  86  ASP A CG    
634  O OD1   . ASP A 87  ? 0.7075 0.7148 1.0462 -0.1155 -0.2133 0.0609  86  ASP A OD1   
635  O OD2   . ASP A 87  ? 0.7115 0.7342 1.1446 -0.1109 -0.2087 0.0781  86  ASP A OD2   
636  N N     . PHE A 88  ? 0.6336 0.6628 0.9154 -0.0820 -0.1161 0.0442  87  PHE A N     
637  C CA    . PHE A 88  ? 0.5792 0.6152 0.8389 -0.0728 -0.0897 0.0412  87  PHE A CA    
638  C C     . PHE A 88  ? 0.5916 0.6340 0.8392 -0.0687 -0.0846 0.0404  87  PHE A C     
639  O O     . PHE A 88  ? 0.5986 0.6383 0.8452 -0.0737 -0.1028 0.0421  87  PHE A O     
640  C CB    . PHE A 88  ? 0.5370 0.5644 0.7518 -0.0725 -0.0872 0.0319  87  PHE A CB    
641  C CG    . PHE A 88  ? 0.5225 0.5421 0.7507 -0.0766 -0.0945 0.0302  87  PHE A CG    
642  C CD1   . PHE A 88  ? 0.5316 0.5404 0.7567 -0.0853 -0.1188 0.0244  87  PHE A CD1   
643  C CD2   . PHE A 88  ? 0.4950 0.5182 0.7389 -0.0725 -0.0784 0.0345  87  PHE A CD2   
644  C CE1   . PHE A 88  ? 0.5369 0.5377 0.7780 -0.0887 -0.1269 0.0203  87  PHE A CE1   
645  C CE2   . PHE A 88  ? 0.5051 0.5210 0.7680 -0.0763 -0.0867 0.0336  87  PHE A CE2   
646  C CZ    . PHE A 88  ? 0.5146 0.5190 0.7779 -0.0839 -0.1109 0.0251  87  PHE A CZ    
647  N N     . TRP A 89  ? 0.5980 0.6489 0.8374 -0.0601 -0.0611 0.0386  88  TRP A N     
648  C CA    . TRP A 89  ? 0.5320 0.5870 0.7533 -0.0551 -0.0558 0.0348  88  TRP A CA    
649  C C     . TRP A 89  ? 0.5111 0.5597 0.6808 -0.0529 -0.0511 0.0282  88  TRP A C     
650  O O     . TRP A 89  ? 0.5169 0.5665 0.6733 -0.0486 -0.0353 0.0266  88  TRP A O     
651  C CB    . TRP A 89  ? 0.5033 0.5717 0.7497 -0.0472 -0.0340 0.0343  88  TRP A CB    
652  C CG    . TRP A 89  ? 0.4711 0.5428 0.7085 -0.0426 -0.0332 0.0291  88  TRP A CG    
653  C CD1   . TRP A 89  ? 0.4539 0.5262 0.6567 -0.0363 -0.0212 0.0223  88  TRP A CD1   
654  C CD2   . TRP A 89  ? 0.4373 0.5110 0.7044 -0.0447 -0.0480 0.0312  88  TRP A CD2   
655  N NE1   . TRP A 89  ? 0.4306 0.5055 0.6408 -0.0337 -0.0267 0.0191  88  TRP A NE1   
656  C CE2   . TRP A 89  ? 0.4370 0.5130 0.6874 -0.0389 -0.0431 0.0249  88  TRP A CE2   
657  C CE3   . TRP A 89  ? 0.4297 0.5029 0.7395 -0.0513 -0.0669 0.0388  88  TRP A CE3   
658  C CZ2   . TRP A 89  ? 0.3882 0.4667 0.6657 -0.0394 -0.0559 0.0263  88  TRP A CZ2   
659  C CZ3   . TRP A 89  ? 0.3965 0.4721 0.7322 -0.0523 -0.0802 0.0412  88  TRP A CZ3   
660  C CH2   . TRP A 89  ? 0.3950 0.4735 0.7156 -0.0463 -0.0743 0.0351  88  TRP A CH2   
661  N N     . GLU A 90  ? 0.5291 0.5717 0.6721 -0.0568 -0.0652 0.0257  89  GLU A N     
662  C CA    . GLU A 90  ? 0.5627 0.6000 0.6616 -0.0550 -0.0606 0.0192  89  GLU A CA    
663  C C     . GLU A 90  ? 0.5809 0.6240 0.6710 -0.0457 -0.0432 0.0169  89  GLU A C     
664  O O     . GLU A 90  ? 0.6233 0.6736 0.7318 -0.0421 -0.0407 0.0181  89  GLU A O     
665  C CB    . GLU A 90  ? 0.5572 0.5896 0.6314 -0.0619 -0.0775 0.0186  89  GLU A CB    
666  C CG    . GLU A 90  ? 0.6006 0.6277 0.6812 -0.0727 -0.0986 0.0212  89  GLU A CG    
667  C CD    . GLU A 90  ? 0.6797 0.6988 0.7498 -0.0757 -0.0992 0.0135  89  GLU A CD    
668  O OE1   . GLU A 90  ? 0.6881 0.7048 0.7385 -0.0709 -0.0855 0.0061  89  GLU A OE1   
669  O OE2   . GLU A 90  ? 0.7050 0.7196 0.7902 -0.0832 -0.1151 0.0147  89  GLU A OE2   
670  N N     . VAL A 91  ? 0.5568 0.5964 0.6214 -0.0422 -0.0324 0.0129  90  VAL A N     
671  C CA    . VAL A 91  ? 0.5275 0.5710 0.5796 -0.0343 -0.0184 0.0107  90  VAL A CA    
672  C C     . VAL A 91  ? 0.4897 0.5287 0.5131 -0.0329 -0.0220 0.0065  90  VAL A C     
673  O O     . VAL A 91  ? 0.4571 0.4984 0.4718 -0.0266 -0.0142 0.0042  90  VAL A O     
674  C CB    . VAL A 91  ? 0.5249 0.5684 0.5719 -0.0315 -0.0046 0.0123  90  VAL A CB    
675  C CG1   . VAL A 91  ? 0.4781 0.5297 0.5560 -0.0321 0.0032  0.0183  90  VAL A CG1   
676  C CG2   . VAL A 91  ? 0.5538 0.5877 0.5868 -0.0352 -0.0097 0.0105  90  VAL A CG2   
677  N N     . GLN A 92  ? 0.4746 0.5078 0.4830 -0.0390 -0.0334 0.0052  91  GLN A N     
678  C CA    . GLN A 92  ? 0.4967 0.5277 0.4811 -0.0388 -0.0358 0.0028  91  GLN A CA    
679  C C     . GLN A 92  ? 0.5533 0.5898 0.5497 -0.0397 -0.0450 0.0080  91  GLN A C     
680  O O     . GLN A 92  ? 0.6131 0.6501 0.6152 -0.0475 -0.0588 0.0129  91  GLN A O     
681  C CB    . GLN A 92  ? 0.4869 0.5119 0.4497 -0.0457 -0.0416 -0.0016 91  GLN A CB    
682  C CG    . GLN A 92  ? 0.4850 0.5082 0.4239 -0.0443 -0.0373 -0.0053 91  GLN A CG    
683  C CD    . GLN A 92  ? 0.5441 0.5647 0.4815 -0.0361 -0.0249 -0.0083 91  GLN A CD    
684  O OE1   . GLN A 92  ? 0.5661 0.5829 0.5086 -0.0349 -0.0197 -0.0107 91  GLN A OE1   
685  N NE2   . GLN A 92  ? 0.5276 0.5497 0.4603 -0.0311 -0.0221 -0.0068 91  GLN A NE2   
686  N N     . LEU A 93  ? 0.5274 0.5676 0.5295 -0.0324 -0.0391 0.0071  92  LEU A N     
687  C CA    . LEU A 93  ? 0.5129 0.5587 0.5364 -0.0321 -0.0478 0.0112  92  LEU A CA    
688  C C     . LEU A 93  ? 0.5184 0.5634 0.5274 -0.0351 -0.0565 0.0155  92  LEU A C     
689  O O     . LEU A 93  ? 0.5103 0.5596 0.5397 -0.0362 -0.0666 0.0215  92  LEU A O     
690  C CB    . LEU A 93  ? 0.4549 0.5056 0.4960 -0.0226 -0.0372 0.0054  92  LEU A CB    
691  C CG    . LEU A 93  ? 0.4418 0.4959 0.4938 -0.0194 -0.0239 0.0017  92  LEU A CG    
692  C CD1   . LEU A 93  ? 0.4429 0.5040 0.5109 -0.0112 -0.0133 -0.0059 92  LEU A CD1   
693  C CD2   . LEU A 93  ? 0.4178 0.4739 0.4946 -0.0258 -0.0304 0.0072  92  LEU A CD2   
694  N N     . GLY A 94  ? 0.5299 0.5702 0.5087 -0.0368 -0.0525 0.0133  93  GLY A N     
695  C CA    . GLY A 94  ? 0.5546 0.5959 0.5202 -0.0399 -0.0575 0.0181  93  GLY A CA    
696  C C     . GLY A 94  ? 0.5660 0.6027 0.5047 -0.0387 -0.0471 0.0119  93  GLY A C     
697  O O     . GLY A 94  ? 0.5846 0.6164 0.5165 -0.0359 -0.0382 0.0044  93  GLY A O     
698  N N     . ILE A 95  ? 0.5506 0.5893 0.4785 -0.0413 -0.0486 0.0161  94  ILE A N     
699  C CA    . ILE A 95  ? 0.5192 0.5551 0.4263 -0.0414 -0.0386 0.0105  94  ILE A CA    
700  C C     . ILE A 95  ? 0.5239 0.5587 0.4402 -0.0327 -0.0340 0.0105  94  ILE A C     
701  O O     . ILE A 95  ? 0.5375 0.5765 0.4671 -0.0319 -0.0411 0.0183  94  ILE A O     
702  C CB    . ILE A 95  ? 0.5127 0.5533 0.3989 -0.0524 -0.0416 0.0151  94  ILE A CB    
703  C CG1   . ILE A 95  ? 0.5198 0.5612 0.3970 -0.0623 -0.0516 0.0166  94  ILE A CG1   
704  C CG2   . ILE A 95  ? 0.5331 0.5717 0.4016 -0.0523 -0.0279 0.0056  94  ILE A CG2   
705  C CD1   . ILE A 95  ? 0.4539 0.4884 0.3316 -0.0603 -0.0476 0.0052  94  ILE A CD1   
706  N N     . PRO A 96  ? 0.4893 0.5180 0.4021 -0.0266 -0.0243 0.0028  95  PRO A N     
707  C CA    . PRO A 96  ? 0.4337 0.4601 0.3550 -0.0192 -0.0226 0.0031  95  PRO A CA    
708  C C     . PRO A 96  ? 0.4648 0.4951 0.3842 -0.0226 -0.0218 0.0084  95  PRO A C     
709  O O     . PRO A 96  ? 0.4775 0.5110 0.3822 -0.0300 -0.0168 0.0077  95  PRO A O     
710  C CB    . PRO A 96  ? 0.4488 0.4673 0.3663 -0.0146 -0.0145 -0.0044 95  PRO A CB    
711  C CG    . PRO A 96  ? 0.4510 0.4687 0.3580 -0.0208 -0.0099 -0.0093 95  PRO A CG    
712  C CD    . PRO A 96  ? 0.4776 0.5007 0.3826 -0.0268 -0.0170 -0.0056 95  PRO A CD    
713  N N     . HIS A 97  ? 0.4786 0.5094 0.4137 -0.0175 -0.0264 0.0131  96  HIS A N     
714  C CA    . HIS A 97  ? 0.4387 0.4746 0.3781 -0.0207 -0.0259 0.0209  96  HIS A CA    
715  C C     . HIS A 97  ? 0.4237 0.4538 0.3756 -0.0131 -0.0226 0.0181  96  HIS A C     
716  O O     . HIS A 97  ? 0.4169 0.4406 0.3790 -0.0051 -0.0281 0.0144  96  HIS A O     
717  C CB    . HIS A 97  ? 0.4218 0.4649 0.3774 -0.0234 -0.0384 0.0331  96  HIS A CB    
718  C CG    . HIS A 97  ? 0.4047 0.4562 0.3610 -0.0306 -0.0378 0.0455  96  HIS A CG    
719  N ND1   . HIS A 97  ? 0.4002 0.4520 0.3742 -0.0266 -0.0366 0.0499  96  HIS A ND1   
720  C CD2   . HIS A 97  ? 0.4210 0.4819 0.3617 -0.0425 -0.0381 0.0554  96  HIS A CD2   
721  C CE1   . HIS A 97  ? 0.4122 0.4743 0.3834 -0.0355 -0.0343 0.0627  96  HIS A CE1   
722  N NE2   . HIS A 97  ? 0.4542 0.5221 0.4023 -0.0458 -0.0351 0.0664  96  HIS A NE2   
723  N N     . PRO A 98  ? 0.3971 0.4294 0.3489 -0.0157 -0.0137 0.0194  97  PRO A N     
724  C CA    . PRO A 98  ? 0.4417 0.4676 0.4107 -0.0087 -0.0118 0.0173  97  PRO A CA    
725  C C     . PRO A 98  ? 0.4573 0.4821 0.4495 -0.0033 -0.0239 0.0243  97  PRO A C     
726  O O     . PRO A 98  ? 0.4320 0.4482 0.4375 0.0038  -0.0278 0.0210  97  PRO A O     
727  C CB    . PRO A 98  ? 0.4020 0.4339 0.3702 -0.0142 0.0021  0.0177  97  PRO A CB    
728  C CG    . PRO A 98  ? 0.4141 0.4579 0.3647 -0.0245 0.0037  0.0248  97  PRO A CG    
729  C CD    . PRO A 98  ? 0.4124 0.4538 0.3485 -0.0257 -0.0047 0.0222  97  PRO A CD    
730  N N     . ALA A 99  ? 0.4552 0.4880 0.4552 -0.0067 -0.0320 0.0340  98  ALA A N     
731  C CA    . ALA A 99  ? 0.4798 0.5112 0.5074 -0.0011 -0.0453 0.0390  98  ALA A CA    
732  C C     . ALA A 99  ? 0.4672 0.4898 0.4967 0.0073  -0.0540 0.0280  98  ALA A C     
733  O O     . ALA A 99  ? 0.4856 0.5038 0.5360 0.0137  -0.0648 0.0265  98  ALA A O     
734  C CB    . ALA A 99  ? 0.5194 0.5617 0.5600 -0.0077 -0.0535 0.0532  98  ALA A CB    
735  N N     . GLY A 100 ? 0.4385 0.4589 0.4467 0.0070  -0.0493 0.0198  99  GLY A N     
736  C CA    . GLY A 100 ? 0.4207 0.4347 0.4252 0.0138  -0.0533 0.0091  99  GLY A CA    
737  C C     . GLY A 100 ? 0.4655 0.4695 0.4579 0.0180  -0.0500 0.0025  99  GLY A C     
738  O O     . GLY A 100 ? 0.4470 0.4460 0.4318 0.0228  -0.0533 -0.0055 99  GLY A O     
739  N N     . LEU A 101 ? 0.4096 0.4109 0.4008 0.0158  -0.0436 0.0057  100 LEU A N     
740  C CA    . LEU A 101 ? 0.4314 0.4225 0.4190 0.0192  -0.0437 0.0021  100 LEU A CA    
741  C C     . LEU A 101 ? 0.4889 0.4730 0.4937 0.0250  -0.0562 0.0023  100 LEU A C     
742  O O     . LEU A 101 ? 0.4935 0.4811 0.5196 0.0259  -0.0617 0.0070  100 LEU A O     
743  C CB    . LEU A 101 ? 0.4141 0.4048 0.4041 0.0153  -0.0331 0.0039  100 LEU A CB    
744  C CG    . LEU A 101 ? 0.4232 0.4194 0.3971 0.0091  -0.0216 0.0014  100 LEU A CG    
745  C CD1   . LEU A 101 ? 0.3872 0.3846 0.3684 0.0055  -0.0104 0.0001  100 LEU A CD1   
746  C CD2   . LEU A 101 ? 0.4189 0.4101 0.3777 0.0099  -0.0217 -0.0030 100 LEU A CD2   
747  N N     . LYS A 102 ? 0.5110 0.4851 0.5070 0.0284  -0.0622 -0.0017 101 LYS A N     
748  C CA    . LYS A 102 ? 0.5326 0.4975 0.5415 0.0333  -0.0767 -0.0025 101 LYS A CA    
749  C C     . LYS A 102 ? 0.5741 0.5307 0.5958 0.0325  -0.0777 0.0029  101 LYS A C     
750  O O     . LYS A 102 ? 0.6160 0.5726 0.6323 0.0290  -0.0679 0.0046  101 LYS A O     
751  C CB    . LYS A 102 ? 0.5397 0.4993 0.5269 0.0365  -0.0852 -0.0113 101 LYS A CB    
752  C CG    . LYS A 102 ? 0.5719 0.5403 0.5532 0.0379  -0.0826 -0.0189 101 LYS A CG    
753  C CD    . LYS A 102 ? 0.6124 0.5780 0.5689 0.0404  -0.0857 -0.0300 101 LYS A CD    
754  C CE    . LYS A 102 ? 0.6176 0.5931 0.5764 0.0420  -0.0809 -0.0392 101 LYS A CE    
755  N NZ    . LYS A 102 ? 0.6504 0.6259 0.5842 0.0441  -0.0795 -0.0521 101 LYS A NZ    
756  N N     . LYS A 103 ? 0.5563 0.5057 0.6007 0.0360  -0.0909 0.0052  102 LYS A N     
757  C CA    . LYS A 103 ? 0.5768 0.5179 0.6427 0.0356  -0.0937 0.0110  102 LYS A CA    
758  C C     . LYS A 103 ? 0.5933 0.5244 0.6401 0.0341  -0.0993 0.0109  102 LYS A C     
759  O O     . LYS A 103 ? 0.6055 0.5303 0.6299 0.0355  -0.1118 0.0074  102 LYS A O     
760  C CB    . LYS A 103 ? 0.5626 0.4971 0.6593 0.0397  -0.1098 0.0141  102 LYS A CB    
761  N N     . LYS A 104 ? 0.5516 0.4821 0.6078 0.0308  -0.0899 0.0145  103 LYS A N     
762  C CA    . LYS A 104 ? 0.5674 0.4887 0.6137 0.0281  -0.0961 0.0180  103 LYS A CA    
763  C C     . LYS A 104 ? 0.5685 0.4805 0.6536 0.0279  -0.1034 0.0247  103 LYS A C     
764  O O     . LYS A 104 ? 0.5424 0.4591 0.6598 0.0283  -0.0923 0.0243  103 LYS A O     
765  C CB    . LYS A 104 ? 0.5554 0.4834 0.5853 0.0240  -0.0805 0.0163  103 LYS A CB    
766  C CG    . LYS A 104 ? 0.5688 0.5046 0.5629 0.0236  -0.0754 0.0113  103 LYS A CG    
767  C CD    . LYS A 104 ? 0.6095 0.5392 0.5772 0.0242  -0.0891 0.0119  103 LYS A CD    
768  C CE    . LYS A 104 ? 0.6307 0.5694 0.5714 0.0255  -0.0830 0.0040  103 LYS A CE    
769  N NZ    . LYS A 104 ? 0.6646 0.5994 0.5755 0.0254  -0.0927 0.0020  103 LYS A NZ    
770  N N     . LYS A 105 ? 0.5718 0.4710 0.6542 0.0265  -0.1220 0.0313  104 LYS A N     
771  C CA    . LYS A 105 ? 0.5455 0.4346 0.6699 0.0255  -0.1315 0.0391  104 LYS A CA    
772  C C     . LYS A 105 ? 0.5241 0.4173 0.6715 0.0226  -0.1149 0.0386  104 LYS A C     
773  O O     . LYS A 105 ? 0.5316 0.4244 0.7245 0.0236  -0.1092 0.0385  104 LYS A O     
774  C CB    . LYS A 105 ? 0.5800 0.4544 0.6925 0.0226  -0.1575 0.0485  104 LYS A CB    
775  N N     . SER A 106 ? 0.5193 0.4171 0.6388 0.0193  -0.1062 0.0371  105 SER A N     
776  C CA    . SER A 106 ? 0.4854 0.3855 0.6280 0.0164  -0.0933 0.0351  105 SER A CA    
777  C C     . SER A 106 ? 0.4801 0.3924 0.5937 0.0150  -0.0742 0.0263  105 SER A C     
778  O O     . SER A 106 ? 0.4961 0.4117 0.5698 0.0143  -0.0758 0.0269  105 SER A O     
779  C CB    . SER A 106 ? 0.4768 0.3656 0.6297 0.0118  -0.1094 0.0471  105 SER A CB    
780  O OG    . SER A 106 ? 0.4888 0.3653 0.6744 0.0122  -0.1291 0.0563  105 SER A OG    
781  N N     . VAL A 107 ? 0.4526 0.3716 0.5880 0.0145  -0.0562 0.0171  106 VAL A N     
782  C CA    . VAL A 107 ? 0.4153 0.3457 0.5269 0.0127  -0.0389 0.0074  106 VAL A CA    
783  C C     . VAL A 107 ? 0.4860 0.4163 0.6215 0.0098  -0.0290 0.0005  106 VAL A C     
784  O O     . VAL A 107 ? 0.4883 0.4152 0.6660 0.0104  -0.0260 -0.0029 106 VAL A O     
785  C CB    . VAL A 107 ? 0.5000 0.4415 0.6067 0.0143  -0.0256 0.0001  106 VAL A CB    
786  C CG1   . VAL A 107 ? 0.4899 0.4421 0.5749 0.0109  -0.0095 -0.0095 106 VAL A CG1   
787  C CG2   . VAL A 107 ? 0.4051 0.3470 0.4915 0.0172  -0.0364 0.0059  106 VAL A CG2   
788  N N     . THR A 108 ? 0.4178 0.3520 0.5309 0.0068  -0.0242 -0.0023 107 THR A N     
789  C CA    . THR A 108 ? 0.4199 0.3548 0.5534 0.0040  -0.0148 -0.0117 107 THR A CA    
790  C C     . THR A 108 ? 0.4856 0.4307 0.5877 0.0018  -0.0023 -0.0217 107 THR A C     
791  O O     . THR A 108 ? 0.4989 0.4478 0.5663 0.0015  -0.0057 -0.0162 107 THR A O     
792  C CB    . THR A 108 ? 0.4272 0.3531 0.5751 0.0012  -0.0281 -0.0007 107 THR A CB    
793  O OG1   . THR A 108 ? 0.4319 0.3475 0.6120 0.0020  -0.0425 0.0099  107 THR A OG1   
794  C CG2   . THR A 108 ? 0.4293 0.3558 0.6026 -0.0015 -0.0197 -0.0116 107 THR A CG2   
795  N N     . VAL A 109 ? 0.4901 0.4397 0.6055 0.0000  0.0118  -0.0374 108 VAL A N     
796  C CA    . VAL A 109 ? 0.4941 0.4515 0.5825 -0.0035 0.0207  -0.0472 108 VAL A CA    
797  C C     . VAL A 109 ? 0.5239 0.4774 0.6367 -0.0060 0.0229  -0.0572 108 VAL A C     
798  O O     . VAL A 109 ? 0.5635 0.5147 0.7127 -0.0054 0.0295  -0.0686 108 VAL A O     
799  C CB    . VAL A 109 ? 0.5019 0.4701 0.5746 -0.0050 0.0353  -0.0585 108 VAL A CB    
800  C CG1   . VAL A 109 ? 0.4695 0.4441 0.5151 -0.0100 0.0413  -0.0685 108 VAL A CG1   
801  C CG2   . VAL A 109 ? 0.4195 0.3915 0.4733 -0.0028 0.0309  -0.0469 108 VAL A CG2   
802  N N     . LEU A 110 ? 0.5405 0.4936 0.6385 -0.0087 0.0173  -0.0533 109 LEU A N     
803  C CA    . LEU A 110 ? 0.5343 0.4837 0.6580 -0.0113 0.0176  -0.0624 109 LEU A CA    
804  C C     . LEU A 110 ? 0.5405 0.4953 0.6369 -0.0151 0.0199  -0.0688 109 LEU A C     
805  O O     . LEU A 110 ? 0.5439 0.5045 0.6043 -0.0157 0.0193  -0.0625 109 LEU A O     
806  C CB    . LEU A 110 ? 0.5837 0.5240 0.7363 -0.0115 0.0033  -0.0460 109 LEU A CB    
807  C CG    . LEU A 110 ? 0.6237 0.5617 0.7568 -0.0110 -0.0093 -0.0224 109 LEU A CG    
808  C CD1   . LEU A 110 ? 0.6786 0.6228 0.7743 -0.0130 -0.0095 -0.0160 109 LEU A CD1   
809  C CD2   . LEU A 110 ? 0.6140 0.5429 0.7819 -0.0129 -0.0231 -0.0071 109 LEU A CD2   
810  N N     . ASP A 111 ? 0.5461 0.4983 0.6649 -0.0176 0.0215  -0.0822 110 ASP A N     
811  C CA    . ASP A 111 ? 0.6171 0.5731 0.7161 -0.0218 0.0231  -0.0927 110 ASP A CA    
812  C C     . ASP A 111 ? 0.5661 0.5157 0.6976 -0.0237 0.0146  -0.0919 110 ASP A C     
813  O O     . ASP A 111 ? 0.5711 0.5144 0.7460 -0.0227 0.0135  -0.0980 110 ASP A O     
814  C CB    . ASP A 111 ? 0.7544 0.7156 0.8427 -0.0240 0.0365  -0.1178 110 ASP A CB    
815  C CG    . ASP A 111 ? 0.8921 0.8566 0.9545 -0.0295 0.0355  -0.1286 110 ASP A CG    
816  O OD1   . ASP A 111 ? 0.9653 0.9247 1.0496 -0.0314 0.0300  -0.1367 110 ASP A OD1   
817  O OD2   . ASP A 111 ? 0.9686 0.9406 0.9915 -0.0326 0.0384  -0.1281 110 ASP A OD2   
818  N N     . VAL A 112 ? 0.5393 0.4907 0.6553 -0.0265 0.0081  -0.0834 111 VAL A N     
819  C CA    . VAL A 112 ? 0.4630 0.4095 0.6111 -0.0290 -0.0007 -0.0797 111 VAL A CA    
820  C C     . VAL A 112 ? 0.6173 0.5616 0.7813 -0.0316 0.0020  -0.1066 111 VAL A C     
821  O O     . VAL A 112 ? 0.6006 0.5493 0.7327 -0.0341 0.0070  -0.1216 111 VAL A O     
822  C CB    . VAL A 112 ? 0.6252 0.5759 0.7543 -0.0313 -0.0070 -0.0609 111 VAL A CB    
823  C CG1   . VAL A 112 ? 0.6750 0.6218 0.8397 -0.0347 -0.0156 -0.0570 111 VAL A CG1   
824  C CG2   . VAL A 112 ? 0.6104 0.5633 0.7249 -0.0290 -0.0089 -0.0371 111 VAL A CG2   
825  N N     . GLY A 113 ? 0.5845 0.5216 0.7986 -0.0315 -0.0026 -0.1130 112 GLY A N     
826  C CA    . GLY A 113 ? 0.5633 0.4973 0.7976 -0.0336 -0.0009 -0.1418 112 GLY A CA    
827  C C     . GLY A 113 ? 0.5882 0.5209 0.8263 -0.0378 -0.0118 -0.1388 112 GLY A C     
828  O O     . GLY A 113 ? 0.6149 0.5460 0.8742 -0.0387 -0.0221 -0.1152 112 GLY A O     
829  N N     . ASP A 114 ? 0.6112 0.5450 0.8282 -0.0411 -0.0099 -0.1627 113 ASP A N     
830  C CA    . ASP A 114 ? 0.6397 0.5718 0.8577 -0.0456 -0.0214 -0.1630 113 ASP A CA    
831  C C     . ASP A 114 ? 0.6031 0.5398 0.8049 -0.0464 -0.0277 -0.1307 113 ASP A C     
832  O O     . ASP A 114 ? 0.6206 0.5553 0.8539 -0.0476 -0.0372 -0.1138 113 ASP A O     
833  C CB    . ASP A 114 ? 0.7391 0.6625 1.0180 -0.0462 -0.0310 -0.1732 113 ASP A CB    
834  C CG    . ASP A 114 ? 0.8598 0.7793 1.1478 -0.0471 -0.0262 -0.2135 113 ASP A CG    
835  O OD1   . ASP A 114 ? 0.8972 0.8218 1.1418 -0.0478 -0.0135 -0.2318 113 ASP A OD1   
836  O OD2   . ASP A 114 ? 0.9211 0.8331 1.2602 -0.0477 -0.0348 -0.2273 113 ASP A OD2   
837  N N     . ALA A 115 ? 0.5665 0.5104 0.7207 -0.0458 -0.0212 -0.1227 114 ALA A N     
838  C CA    . ALA A 115 ? 0.5355 0.4851 0.6743 -0.0452 -0.0234 -0.0945 114 ALA A CA    
839  C C     . ALA A 115 ? 0.5459 0.4961 0.6943 -0.0493 -0.0334 -0.0866 114 ALA A C     
840  O O     . ALA A 115 ? 0.4806 0.4318 0.6548 -0.0494 -0.0375 -0.0658 114 ALA A O     
841  C CB    . ALA A 115 ? 0.5443 0.5009 0.6352 -0.0441 -0.0160 -0.0925 114 ALA A CB    
842  N N     . TYR A 116 ? 0.5023 0.4527 0.6302 -0.0535 -0.0378 -0.1016 115 TYR A N     
843  C CA    . TYR A 116 ? 0.5049 0.4553 0.6455 -0.0577 -0.0491 -0.0947 115 TYR A CA    
844  C C     . TYR A 116 ? 0.5540 0.4981 0.7480 -0.0586 -0.0573 -0.0935 115 TYR A C     
845  O O     . TYR A 116 ? 0.5812 0.5278 0.7997 -0.0598 -0.0624 -0.0729 115 TYR A O     
846  C CB    . TYR A 116 ? 0.5249 0.4740 0.6377 -0.0633 -0.0560 -0.1140 115 TYR A CB    
847  C CG    . TYR A 116 ? 0.6002 0.5568 0.6694 -0.0648 -0.0542 -0.1062 115 TYR A CG    
848  C CD1   . TYR A 116 ? 0.5760 0.5394 0.6294 -0.0600 -0.0441 -0.0897 115 TYR A CD1   
849  C CD2   . TYR A 116 ? 0.6261 0.5824 0.6724 -0.0717 -0.0648 -0.1149 115 TYR A CD2   
850  C CE1   . TYR A 116 ? 0.5776 0.5476 0.5983 -0.0614 -0.0438 -0.0829 115 TYR A CE1   
851  C CE2   . TYR A 116 ? 0.6423 0.6053 0.6549 -0.0740 -0.0656 -0.1056 115 TYR A CE2   
852  C CZ    . TYR A 116 ? 0.6285 0.5984 0.6308 -0.0685 -0.0547 -0.0898 115 TYR A CZ    
853  O OH    . TYR A 116 ? 0.6338 0.6103 0.6093 -0.0707 -0.0569 -0.0808 115 TYR A OH    
854  N N     . PHE A 117 ? 0.5520 0.4885 0.7683 -0.0581 -0.0582 -0.1151 116 PHE A N     
855  C CA    . PHE A 117 ? 0.5847 0.5141 0.8576 -0.0594 -0.0686 -0.1177 116 PHE A CA    
856  C C     . PHE A 117 ? 0.5763 0.5070 0.8875 -0.0573 -0.0683 -0.0900 116 PHE A C     
857  O O     . PHE A 117 ? 0.5140 0.4390 0.8790 -0.0587 -0.0776 -0.0886 116 PHE A O     
858  C CB    . PHE A 117 ? 0.6266 0.5478 0.9144 -0.0592 -0.0687 -0.1527 116 PHE A CB    
859  C CG    . PHE A 117 ? 0.6540 0.5742 0.9016 -0.0633 -0.0702 -0.1809 116 PHE A CG    
860  C CD1   . PHE A 117 ? 0.6705 0.5934 0.8907 -0.0681 -0.0790 -0.1734 116 PHE A CD1   
861  C CD2   . PHE A 117 ? 0.6840 0.6011 0.9216 -0.0632 -0.0629 -0.2147 116 PHE A CD2   
862  C CE1   . PHE A 117 ? 0.7015 0.6231 0.8820 -0.0736 -0.0832 -0.1966 116 PHE A CE1   
863  C CE2   . PHE A 117 ? 0.7305 0.6477 0.9246 -0.0687 -0.0641 -0.2397 116 PHE A CE2   
864  C CZ    . PHE A 117 ? 0.7357 0.6547 0.8997 -0.0743 -0.0757 -0.2296 116 PHE A CZ    
865  N N     . SER A 118 ? 0.5039 0.4418 0.7896 -0.0548 -0.0592 -0.0679 117 SER A N     
866  C CA    . SER A 118 ? 0.5148 0.4552 0.8267 -0.0546 -0.0596 -0.0386 117 SER A CA    
867  C C     . SER A 118 ? 0.5420 0.4922 0.8435 -0.0568 -0.0581 -0.0108 117 SER A C     
868  O O     . SER A 118 ? 0.5679 0.5217 0.8913 -0.0587 -0.0588 0.0153  117 SER A O     
869  C CB    . SER A 118 ? 0.5286 0.4695 0.8222 -0.0506 -0.0513 -0.0342 117 SER A CB    
870  O OG    . SER A 118 ? 0.5731 0.5061 0.8852 -0.0484 -0.0508 -0.0589 117 SER A OG    
871  N N     . VAL A 119 ? 0.4759 0.4309 0.7466 -0.0574 -0.0559 -0.0154 118 VAL A N     
872  C CA    . VAL A 119 ? 0.5191 0.4845 0.7823 -0.0589 -0.0520 0.0074  118 VAL A CA    
873  C C     . VAL A 119 ? 0.5704 0.5349 0.8705 -0.0634 -0.0624 0.0087  118 VAL A C     
874  O O     . VAL A 119 ? 0.6069 0.5654 0.9040 -0.0649 -0.0708 -0.0129 118 VAL A O     
875  C CB    . VAL A 119 ? 0.5083 0.4799 0.7221 -0.0565 -0.0441 0.0031  118 VAL A CB    
876  C CG1   . VAL A 119 ? 0.4975 0.4803 0.7116 -0.0579 -0.0394 0.0227  118 VAL A CG1   
877  C CG2   . VAL A 119 ? 0.4577 0.4303 0.6404 -0.0520 -0.0351 0.0037  118 VAL A CG2   
878  N N     . PRO A 120 ? 0.5688 0.5392 0.9031 -0.0665 -0.0628 0.0337  119 PRO A N     
879  C CA    . PRO A 120 ? 0.5378 0.5066 0.9167 -0.0709 -0.0741 0.0358  119 PRO A CA    
880  C C     . PRO A 120 ? 0.5535 0.5276 0.9175 -0.0720 -0.0742 0.0339  119 PRO A C     
881  O O     . PRO A 120 ? 0.5446 0.5276 0.8730 -0.0698 -0.0628 0.0403  119 PRO A O     
882  C CB    . PRO A 120 ? 0.5255 0.5022 0.9418 -0.0742 -0.0713 0.0682  119 PRO A CB    
883  C CG    . PRO A 120 ? 0.5447 0.5316 0.9196 -0.0721 -0.0552 0.0846  119 PRO A CG    
884  C CD    . PRO A 120 ? 0.5430 0.5226 0.8762 -0.0669 -0.0531 0.0621  119 PRO A CD    
885  N N     . LEU A 121 ? 0.5656 0.5335 0.9618 -0.0756 -0.0890 0.0247  120 LEU A N     
886  C CA    . LEU A 121 ? 0.5741 0.5448 0.9674 -0.0779 -0.0943 0.0232  120 LEU A CA    
887  C C     . LEU A 121 ? 0.5786 0.5581 1.0214 -0.0813 -0.0943 0.0488  120 LEU A C     
888  O O     . LEU A 121 ? 0.6153 0.5944 1.1019 -0.0834 -0.0972 0.0619  120 LEU A O     
889  C CB    . LEU A 121 ? 0.5959 0.5533 0.9885 -0.0807 -0.1132 -0.0053 120 LEU A CB    
890  C CG    . LEU A 121 ? 0.5944 0.5516 0.9831 -0.0846 -0.1246 -0.0089 120 LEU A CG    
891  C CD1   . LEU A 121 ? 0.5007 0.4654 0.8391 -0.0826 -0.1145 -0.0075 120 LEU A CD1   
892  C CD2   . LEU A 121 ? 0.5314 0.4741 0.9209 -0.0890 -0.1458 -0.0370 120 LEU A CD2   
893  N N     . ASP A 122 ? 0.5559 0.5440 0.9951 -0.0821 -0.0905 0.0569  121 ASP A N     
894  C CA    . ASP A 122 ? 0.5873 0.5852 1.0760 -0.0855 -0.0888 0.0799  121 ASP A CA    
895  C C     . ASP A 122 ? 0.6528 0.6401 1.1961 -0.0900 -0.1101 0.0756  121 ASP A C     
896  O O     . ASP A 122 ? 0.6819 0.6561 1.2220 -0.0917 -0.1291 0.0523  121 ASP A O     
897  C CB    . ASP A 122 ? 0.5951 0.6012 1.0767 -0.0855 -0.0851 0.0826  121 ASP A CB    
898  C CG    . ASP A 122 ? 0.6252 0.6459 1.1552 -0.0880 -0.0754 0.1084  121 ASP A CG    
899  O OD1   . ASP A 122 ? 0.6616 0.6914 1.2108 -0.0890 -0.0630 0.1289  121 ASP A OD1   
900  O OD2   . ASP A 122 ? 0.6512 0.6751 1.2019 -0.0896 -0.0805 0.1093  121 ASP A OD2   
901  N N     . GLU A 123 ? 0.6619 0.6550 1.2552 -0.0927 -0.1076 0.0984  122 GLU A N     
902  C CA    . GLU A 123 ? 0.7377 0.7202 1.3900 -0.0967 -0.1288 0.0951  122 GLU A CA    
903  C C     . GLU A 123 ? 0.7731 0.7511 1.4516 -0.1000 -0.1455 0.0877  122 GLU A C     
904  O O     . GLU A 123 ? 0.7994 0.7614 1.4886 -0.1019 -0.1686 0.0638  122 GLU A O     
905  C CB    . GLU A 123 ? 0.7596 0.7522 1.4645 -0.1001 -0.1223 0.1272  122 GLU A CB    
906  C CG    . GLU A 123 ? 0.7928 0.7891 1.4741 -0.0985 -0.1092 0.1376  122 GLU A CG    
907  C CD    . GLU A 123 ? 0.8373 0.8377 1.5772 -0.1036 -0.1125 0.1650  122 GLU A CD    
908  O OE1   . GLU A 123 ? 0.8631 0.8692 1.6591 -0.1083 -0.1175 0.1832  122 GLU A OE1   
909  O OE2   . GLU A 123 ? 0.8532 0.8510 1.5866 -0.1033 -0.1111 0.1697  122 GLU A OE2   
910  N N     . ASP A 124 ? 0.7812 0.7733 1.4701 -0.1009 -0.1346 0.1068  123 ASP A N     
911  C CA    . ASP A 124 ? 0.8006 0.7891 1.5211 -0.1044 -0.1515 0.1034  123 ASP A CA    
912  C C     . ASP A 124 ? 0.7589 0.7320 1.4365 -0.1047 -0.1705 0.0722  123 ASP A C     
913  O O     . ASP A 124 ? 0.8254 0.7877 1.5292 -0.1092 -0.1950 0.0618  123 ASP A O     
914  C CB    . ASP A 124 ? 0.8948 0.9022 1.6267 -0.1042 -0.1325 0.1258  123 ASP A CB    
915  C CG    . ASP A 124 ? 0.9936 1.0186 1.7687 -0.1057 -0.1127 0.1582  123 ASP A CG    
916  O OD1   . ASP A 124 ? 1.0343 1.0569 1.8279 -0.1072 -0.1145 0.1662  123 ASP A OD1   
917  O OD2   . ASP A 124 ? 1.0181 1.0604 1.8104 -0.1060 -0.0951 0.1761  123 ASP A OD2   
918  N N     . PHE A 125 ? 0.6830 0.6551 1.2946 -0.1008 -0.1605 0.0580  124 PHE A N     
919  C CA    . PHE A 125 ? 0.6348 0.5952 1.1988 -0.1022 -0.1754 0.0314  124 PHE A CA    
920  C C     . PHE A 125 ? 0.6389 0.5824 1.1908 -0.1036 -0.1918 0.0031  124 PHE A C     
921  O O     . PHE A 125 ? 0.6579 0.5903 1.1807 -0.1074 -0.2097 -0.0197 124 PHE A O     
922  C CB    . PHE A 125 ? 0.5819 0.5503 1.0841 -0.0976 -0.1564 0.0300  124 PHE A CB    
923  C CG    . PHE A 125 ? 0.5941 0.5585 1.0610 -0.1005 -0.1685 0.0180  124 PHE A CG    
924  C CD1   . PHE A 125 ? 0.5927 0.5633 1.0858 -0.1031 -0.1738 0.0313  124 PHE A CD1   
925  C CD2   . PHE A 125 ? 0.6150 0.5705 1.0252 -0.1012 -0.1743 -0.0051 124 PHE A CD2   
926  C CE1   . PHE A 125 ? 0.5908 0.5576 1.0555 -0.1069 -0.1877 0.0232  124 PHE A CE1   
927  C CE2   . PHE A 125 ? 0.6000 0.5530 0.9771 -0.1055 -0.1867 -0.0125 124 PHE A CE2   
928  C CZ    . PHE A 125 ? 0.5838 0.5418 0.9886 -0.1085 -0.1948 0.0024  124 PHE A CZ    
929  N N     . ARG A 126 ? 0.5377 0.4793 1.1128 -0.1013 -0.1866 0.0040  125 ARG A N     
930  C CA    . ARG A 126 ? 0.6199 0.5469 1.1828 -0.1013 -0.1975 -0.0259 125 ARG A CA    
931  C C     . ARG A 126 ? 0.6838 0.5958 1.2647 -0.1072 -0.2264 -0.0487 125 ARG A C     
932  O O     . ARG A 126 ? 0.7322 0.6331 1.2757 -0.1087 -0.2359 -0.0804 125 ARG A O     
933  C CB    . ARG A 126 ? 0.6003 0.5277 1.2039 -0.0987 -0.1909 -0.0171 125 ARG A CB    
934  C CG    . ARG A 126 ? 0.5900 0.5306 1.1698 -0.0940 -0.1650 0.0041  125 ARG A CG    
935  C CD    . ARG A 126 ? 0.5551 0.4956 1.1766 -0.0930 -0.1618 0.0160  125 ARG A CD    
936  N NE    . ARG A 126 ? 0.5097 0.4626 1.1049 -0.0899 -0.1396 0.0378  125 ARG A NE    
937  C CZ    . ARG A 126 ? 0.5888 0.5436 1.2087 -0.0896 -0.1348 0.0532  125 ARG A CZ    
938  N NH1   . ARG A 126 ? 0.5992 0.5449 1.2763 -0.0918 -0.1501 0.0493  125 ARG A NH1   
939  N NH2   . ARG A 126 ? 0.5858 0.5513 1.1749 -0.0877 -0.1165 0.0725  125 ARG A NH2   
940  N N     . LYS A 127 ? 1.0065 0.5567 1.1026 -0.0631 -0.2954 -0.2200 126 LYS A N     
941  C CA    . LYS A 127 ? 1.0065 0.5908 1.1092 -0.1014 -0.3048 -0.2242 126 LYS A CA    
942  C C     . LYS A 127 ? 0.9586 0.5954 1.0940 -0.1006 -0.3504 -0.2003 126 LYS A C     
943  O O     . LYS A 127 ? 0.9707 0.6149 1.0692 -0.1231 -0.3585 -0.1975 126 LYS A O     
944  C CB    . LYS A 127 ? 1.0294 0.6621 1.1937 -0.1223 -0.2979 -0.2426 126 LYS A CB    
945  C CG    . LYS A 127 ? 1.0851 0.6750 1.2163 -0.1374 -0.2490 -0.2655 126 LYS A CG    
946  C CD    . LYS A 127 ? 1.0827 0.7334 1.2795 -0.1661 -0.2460 -0.2818 126 LYS A CD    
947  C CE    . LYS A 127 ? 1.0333 0.7472 1.3188 -0.1400 -0.2706 -0.2746 126 LYS A CE    
948  N NZ    . LYS A 127 ? 1.0194 0.6980 1.3004 -0.1026 -0.2492 -0.2781 126 LYS A NZ    
949  N N     . TYR A 128 ? 0.8842 0.5574 1.0890 -0.0739 -0.3784 -0.1828 127 TYR A N     
950  C CA    . TYR A 128 ? 0.8643 0.5974 1.1165 -0.0717 -0.4198 -0.1542 127 TYR A CA    
951  C C     . TYR A 128 ? 0.8411 0.5490 1.0489 -0.0581 -0.4338 -0.1287 127 TYR A C     
952  O O     . TYR A 128 ? 0.8296 0.5866 1.0643 -0.0580 -0.4651 -0.1007 127 TYR A O     
953  C CB    . TYR A 128 ? 0.8176 0.5934 1.1685 -0.0471 -0.4398 -0.1428 127 TYR A CB    
954  C CG    . TYR A 128 ? 0.8233 0.6263 1.2207 -0.0556 -0.4234 -0.1672 127 TYR A CG    
955  C CD1   . TYR A 128 ? 0.8392 0.6815 1.2337 -0.0913 -0.4170 -0.1815 127 TYR A CD1   
956  C CD2   . TYR A 128 ? 0.8073 0.5989 1.2508 -0.0294 -0.4129 -0.1788 127 TYR A CD2   
957  C CE1   . TYR A 128 ? 0.8317 0.7039 1.2723 -0.1002 -0.4004 -0.2018 127 TYR A CE1   
958  C CE2   . TYR A 128 ? 0.8148 0.6347 1.3001 -0.0352 -0.3953 -0.2000 127 TYR A CE2   
959  C CZ    . TYR A 128 ? 0.8626 0.7235 1.3478 -0.0704 -0.3889 -0.2092 127 TYR A CZ    
960  O OH    . TYR A 128 ? 0.8885 0.7829 1.4196 -0.0772 -0.3702 -0.2282 127 TYR A OH    
961  N N     . THR A 129 ? 0.8537 0.4933 0.9957 -0.0452 -0.4107 -0.1343 128 THR A N     
962  C CA    . THR A 129 ? 0.9108 0.5291 1.0123 -0.0307 -0.4214 -0.1094 128 THR A CA    
963  C C     . THR A 129 ? 0.9517 0.5491 0.9701 -0.0519 -0.4087 -0.1123 128 THR A C     
964  O O     . THR A 129 ? 0.9920 0.5536 0.9554 -0.0385 -0.4027 -0.0990 128 THR A O     
965  C CB    . THR A 129 ? 0.8447 0.4115 0.9244 -0.0022 -0.4058 -0.1117 128 THR A CB    
966  O OG1   . THR A 129 ? 1.0022 0.5172 1.0167 -0.0068 -0.3655 -0.1366 128 THR A OG1   
967  C CG2   . THR A 129 ? 0.8129 0.3999 0.9751 0.0175  -0.4185 -0.1151 128 THR A CG2   
968  N N     . ALA A 130 ? 0.9430 0.5648 0.9539 -0.0851 -0.4041 -0.1315 129 ALA A N     
969  C CA    . ALA A 130 ? 0.9656 0.5608 0.8969 -0.1092 -0.3869 -0.1449 129 ALA A CA    
970  C C     . ALA A 130 ? 1.0464 0.6755 0.9592 -0.1050 -0.4147 -0.1171 129 ALA A C     
971  O O     . ALA A 130 ? 1.0191 0.7204 0.9908 -0.1013 -0.4515 -0.0921 129 ALA A O     
972  C CB    . ALA A 130 ? 0.9960 0.6189 0.9349 -0.1508 -0.3784 -0.1766 129 ALA A CB    
973  N N     . PHE A 131 ? 1.0793 0.6574 0.9100 -0.1032 -0.3946 -0.1188 130 PHE A N     
974  C CA    . PHE A 131 ? 1.0873 0.6952 0.8871 -0.1006 -0.4145 -0.0959 130 PHE A CA    
975  C C     . PHE A 131 ? 1.1571 0.7126 0.8627 -0.1187 -0.3823 -0.1223 130 PHE A C     
976  O O     . PHE A 131 ? 1.1992 0.6869 0.8669 -0.1285 -0.3432 -0.1519 130 PHE A O     
977  C CB    . PHE A 131 ? 1.0226 0.6257 0.8357 -0.0626 -0.4286 -0.0552 130 PHE A CB    
978  C CG    . PHE A 131 ? 1.0326 0.5568 0.7901 -0.0408 -0.3955 -0.0584 130 PHE A CG    
979  C CD1   . PHE A 131 ? 0.9668 0.4563 0.7473 -0.0257 -0.3803 -0.0678 130 PHE A CD1   
980  C CD2   . PHE A 131 ? 1.0548 0.5464 0.7368 -0.0327 -0.3793 -0.0507 130 PHE A CD2   
981  C CE1   . PHE A 131 ? 0.9804 0.4097 0.7096 -0.0031 -0.3513 -0.0673 130 PHE A CE1   
982  C CE2   . PHE A 131 ? 1.0593 0.4863 0.6930 -0.0088 -0.3487 -0.0491 130 PHE A CE2   
983  C CZ    . PHE A 131 ? 1.0126 0.4114 0.6701 0.0061  -0.3357 -0.0562 130 PHE A CZ    
984  N N     . THR A 132 ? 1.1870 0.7740 0.8556 -0.1220 -0.3968 -0.1104 131 THR A N     
985  C CA    . THR A 132 ? 1.2564 0.7975 0.8352 -0.1380 -0.3675 -0.1371 131 THR A CA    
986  C C     . THR A 132 ? 1.2690 0.8065 0.8030 -0.1093 -0.3714 -0.1046 131 THR A C     
987  O O     . THR A 132 ? 1.2312 0.8421 0.7951 -0.0996 -0.4077 -0.0705 131 THR A O     
988  C CB    . THR A 132 ? 1.2992 0.8959 0.8690 -0.1817 -0.3792 -0.1697 131 THR A CB    
989  O OG1   . THR A 132 ? 1.2860 0.9837 0.8889 -0.1770 -0.4249 -0.1377 131 THR A OG1   
990  C CG2   . THR A 132 ? 1.3039 0.9141 0.9243 -0.2126 -0.3759 -0.2006 131 THR A CG2   
991  N N     . ILE A 133 ? 1.3372 0.7925 0.8021 -0.0941 -0.3321 -0.1119 132 ILE A N     
992  C CA    . ILE A 133 ? 1.3915 0.8397 0.8040 -0.0685 -0.3282 -0.0861 132 ILE A CA    
993  C C     . ILE A 133 ? 1.4654 0.9069 0.8049 -0.0940 -0.3121 -0.1195 132 ILE A C     
994  O O     . ILE A 133 ? 1.5147 0.8854 0.8083 -0.1134 -0.2725 -0.1618 132 ILE A O     
995  C CB    . ILE A 133 ? 1.4266 0.7972 0.8059 -0.0335 -0.2941 -0.0728 132 ILE A CB    
996  C CG1   . ILE A 133 ? 1.3868 0.7699 0.8368 -0.0115 -0.3112 -0.0474 132 ILE A CG1   
997  C CG2   . ILE A 133 ? 1.4351 0.8059 0.7638 -0.0068 -0.2895 -0.0450 132 ILE A CG2   
998  C CD1   . ILE A 133 ? 1.3546 0.8115 0.8643 0.0045  -0.3552 -0.0040 132 ILE A CD1   
999  N N     . PRO A 134 ? 1.4799 0.9928 0.8071 -0.0951 -0.3394 -0.1032 133 PRO A N     
1000 C CA    . PRO A 134 ? 1.5685 1.0891 0.8252 -0.1202 -0.3282 -0.1389 133 PRO A CA    
1001 C C     . PRO A 134 ? 1.6656 1.0891 0.8348 -0.1066 -0.2769 -0.1584 133 PRO A C     
1002 O O     . PRO A 134 ? 1.7625 1.1782 0.8681 -0.1272 -0.2607 -0.1954 133 PRO A O     
1003 C CB    . PRO A 134 ? 1.5350 1.1579 0.8025 -0.1082 -0.3691 -0.0986 133 PRO A CB    
1004 C CG    . PRO A 134 ? 1.4535 1.1323 0.8171 -0.0929 -0.4069 -0.0524 133 PRO A CG    
1005 C CD    . PRO A 134 ? 1.4169 1.0133 0.8022 -0.0731 -0.3832 -0.0487 133 PRO A CD    
1006 N N     . ILE A 143 ? 1.6120 0.8323 0.8779 -0.1738 -0.1821 -0.2580 142 ILE A N     
1007 C CA    . ILE A 143 ? 1.5848 0.7706 0.8936 -0.1566 -0.1580 -0.2447 142 ILE A CA    
1008 C C     . ILE A 143 ? 1.4914 0.7369 0.8700 -0.1553 -0.2078 -0.2266 142 ILE A C     
1009 O O     . ILE A 143 ? 1.4459 0.7518 0.8527 -0.1314 -0.2462 -0.1902 142 ILE A O     
1010 C CB    . ILE A 143 ? 1.5895 0.7055 0.8553 -0.1085 -0.1261 -0.2137 142 ILE A CB    
1011 C CG1   . ILE A 143 ? 1.6698 0.7348 0.8667 -0.1040 -0.0841 -0.2248 142 ILE A CG1   
1012 C CG2   . ILE A 143 ? 1.5569 0.6502 0.8624 -0.0940 -0.0914 -0.2037 142 ILE A CG2   
1013 C CD1   . ILE A 143 ? 1.6801 0.6867 0.8357 -0.0545 -0.0518 -0.1905 142 ILE A CD1   
1014 N N     . ARG A 144 ? 1.4706 0.7134 0.9916 -0.2695 -0.3683 -0.0771 143 ARG A N     
1015 C CA    . ARG A 144 ? 1.4079 0.7056 0.9882 -0.2719 -0.3757 -0.0667 143 ARG A CA    
1016 C C     . ARG A 144 ? 1.3663 0.7025 0.9959 -0.2666 -0.3519 -0.0636 143 ARG A C     
1017 O O     . ARG A 144 ? 1.3822 0.7131 1.0238 -0.2687 -0.3402 -0.0647 143 ARG A O     
1018 C CB    . ARG A 144 ? 1.3890 0.7094 1.0158 -0.2889 -0.4070 -0.0558 143 ARG A CB    
1019 C CG    . ARG A 144 ? 1.4400 0.7144 1.0241 -0.2988 -0.4309 -0.0588 143 ARG A CG    
1020 C CD    . ARG A 144 ? 1.4490 0.7401 1.0605 -0.3104 -0.4648 -0.0484 143 ARG A CD    
1021 N NE    . ARG A 144 ? 1.4007 0.7501 1.0992 -0.3189 -0.4714 -0.0353 143 ARG A NE    
1022 C CZ    . ARG A 144 ? 1.3799 0.7756 1.1239 -0.3152 -0.4717 -0.0265 143 ARG A CZ    
1023 N NH1   . ARG A 144 ? 1.3427 0.7890 1.1658 -0.3224 -0.4753 -0.0140 143 ARG A NH1   
1024 N NH2   . ARG A 144 ? 1.3920 0.7826 1.1024 -0.3037 -0.4670 -0.0297 143 ARG A NH2   
1025 N N     . TYR A 145 ? 1.3196 0.6925 0.9763 -0.2599 -0.3451 -0.0593 144 TYR A N     
1026 C CA    . TYR A 145 ? 1.2712 0.6800 0.9726 -0.2545 -0.3236 -0.0554 144 TYR A CA    
1027 C C     . TYR A 145 ? 1.2267 0.6905 0.9917 -0.2590 -0.3332 -0.0429 144 TYR A C     
1028 O O     . TYR A 145 ? 1.2539 0.7276 1.0258 -0.2642 -0.3550 -0.0380 144 TYR A O     
1029 C CB    . TYR A 145 ? 1.2714 0.6647 0.9341 -0.2370 -0.2970 -0.0646 144 TYR A CB    
1030 C CG    . TYR A 145 ? 1.3140 0.6568 0.9191 -0.2286 -0.2805 -0.0761 144 TYR A CG    
1031 C CD1   . TYR A 145 ? 1.3012 0.6388 0.9171 -0.2256 -0.2621 -0.0772 144 TYR A CD1   
1032 C CD2   . TYR A 145 ? 1.3654 0.6650 0.9052 -0.2224 -0.2815 -0.0849 144 TYR A CD2   
1033 C CE1   . TYR A 145 ? 1.3453 0.6384 0.9116 -0.2163 -0.2458 -0.0869 144 TYR A CE1   
1034 C CE2   . TYR A 145 ? 1.4092 0.6639 0.8988 -0.2133 -0.2638 -0.0945 144 TYR A CE2   
1035 C CZ    . TYR A 145 ? 1.4108 0.6636 0.9155 -0.2100 -0.2461 -0.0956 144 TYR A CZ    
1036 O OH    . TYR A 145 ? 1.4746 0.6840 0.9325 -0.1997 -0.2277 -0.1042 144 TYR A OH    
1037 N N     . GLN A 146 ? 1.1677 0.6657 0.9788 -0.2563 -0.3156 -0.0370 145 GLN A N     
1038 C CA    . GLN A 146 ? 1.1023 0.6517 0.9694 -0.2561 -0.3162 -0.0261 145 GLN A CA    
1039 C C     . GLN A 146 ? 1.0436 0.6147 0.9163 -0.2379 -0.2833 -0.0264 145 GLN A C     
1040 O O     . GLN A 146 ? 1.0480 0.6019 0.9004 -0.2295 -0.2625 -0.0316 145 GLN A O     
1041 C CB    . GLN A 146 ? 1.0743 0.6621 1.0128 -0.2683 -0.3245 -0.0117 145 GLN A CB    
1042 C CG    . GLN A 146 ? 1.0320 0.6323 1.0038 -0.2687 -0.3028 -0.0069 145 GLN A CG    
1043 C CD    . GLN A 146 ? 1.0062 0.6463 1.0504 -0.2793 -0.3069 0.0083  145 GLN A CD    
1044 O OE1   . GLN A 146 ? 1.0060 0.6594 1.0740 -0.2877 -0.3282 0.0143  145 GLN A OE1   
1045 N NE2   . GLN A 146 ? 0.9749 0.6326 1.0540 -0.2781 -0.2855 0.0154  145 GLN A NE2   
1046 N N     . TYR A 147 ? 0.9662 0.5793 0.8678 -0.2288 -0.2766 -0.0197 146 TYR A N     
1047 C CA    . TYR A 147 ? 0.9013 0.5408 0.8085 -0.2086 -0.2452 -0.0191 146 TYR A CA    
1048 C C     . TYR A 147 ? 0.8443 0.5221 0.8078 -0.2074 -0.2291 -0.0079 146 TYR A C     
1049 O O     . TYR A 147 ? 0.8351 0.5426 0.8497 -0.2173 -0.2391 0.0033  146 TYR A O     
1050 C CB    . TYR A 147 ? 0.9060 0.5685 0.8136 -0.1993 -0.2450 -0.0177 146 TYR A CB    
1051 C CG    . TYR A 147 ? 0.9377 0.5652 0.7823 -0.1900 -0.2419 -0.0297 146 TYR A CG    
1052 C CD1   . TYR A 147 ? 0.9989 0.5891 0.8024 -0.1996 -0.2667 -0.0356 146 TYR A CD1   
1053 C CD2   . TYR A 147 ? 0.9138 0.5439 0.7398 -0.1716 -0.2142 -0.0346 146 TYR A CD2   
1054 C CE1   . TYR A 147 ? 1.0318 0.5864 0.7745 -0.1905 -0.2609 -0.0461 146 TYR A CE1   
1055 C CE2   . TYR A 147 ? 0.9597 0.5583 0.7317 -0.1627 -0.2084 -0.0445 146 TYR A CE2   
1056 C CZ    . TYR A 147 ? 1.0094 0.5693 0.7385 -0.1719 -0.2304 -0.0502 146 TYR A CZ    
1057 O OH    . TYR A 147 ? 1.0327 0.5577 0.7049 -0.1625 -0.2220 -0.0597 146 TYR A OH    
1058 N N     . ASN A 148 ? 0.8063 0.4817 0.7601 -0.1949 -0.2038 -0.0105 147 ASN A N     
1059 C CA    . ASN A 148 ? 0.7548 0.4646 0.7515 -0.1890 -0.1839 -0.0006 147 ASN A CA    
1060 C C     . ASN A 148 ? 0.7859 0.5249 0.7871 -0.1712 -0.1647 0.0006  147 ASN A C     
1061 O O     . ASN A 148 ? 0.8123 0.5792 0.8450 -0.1650 -0.1482 0.0087  147 ASN A O     
1062 C CB    . ASN A 148 ? 0.7489 0.4363 0.7329 -0.1870 -0.1699 -0.0028 147 ASN A CB    
1063 C CG    . ASN A 148 ? 0.7949 0.4472 0.7684 -0.2045 -0.1880 -0.0054 147 ASN A CG    
1064 O OD1   . ASN A 148 ? 0.7995 0.4529 0.7911 -0.2206 -0.2114 -0.0020 147 ASN A OD1   
1065 N ND2   . ASN A 148 ? 0.8017 0.4216 0.7464 -0.2014 -0.1784 -0.0112 147 ASN A ND2   
1066 N N     . VAL A 149 ? 0.7564 0.4867 0.7246 -0.1631 -0.1662 -0.0073 148 VAL A N     
1067 C CA    . VAL A 149 ? 0.7095 0.4631 0.6778 -0.1469 -0.1496 -0.0075 148 VAL A CA    
1068 C C     . VAL A 149 ? 0.7245 0.4874 0.6907 -0.1486 -0.1634 -0.0075 148 VAL A C     
1069 O O     . VAL A 149 ? 0.7927 0.5436 0.7567 -0.1617 -0.1862 -0.0071 148 VAL A O     
1070 C CB    . VAL A 149 ? 0.7095 0.4414 0.6385 -0.1328 -0.1329 -0.0170 148 VAL A CB    
1071 C CG1   . VAL A 149 ? 0.7021 0.4265 0.6356 -0.1300 -0.1198 -0.0156 148 VAL A CG1   
1072 C CG2   . VAL A 149 ? 0.7138 0.4043 0.5944 -0.1357 -0.1433 -0.0277 148 VAL A CG2   
1073 N N     . LEU A 150 ? 0.6615 0.4446 0.6281 -0.1355 -0.1505 -0.0076 149 LEU A N     
1074 C CA    . LEU A 150 ? 0.6694 0.4620 0.6337 -0.1353 -0.1612 -0.0069 149 LEU A CA    
1075 C C     . LEU A 150 ? 0.7136 0.4672 0.6254 -0.1364 -0.1712 -0.0172 149 LEU A C     
1076 O O     . LEU A 150 ? 0.7499 0.4834 0.6279 -0.1263 -0.1564 -0.0254 149 LEU A O     
1077 C CB    . LEU A 150 ? 0.6271 0.4487 0.6039 -0.1210 -0.1434 -0.0046 149 LEU A CB    
1078 C CG    . LEU A 150 ? 0.5434 0.4008 0.5663 -0.1182 -0.1320 0.0055  149 LEU A CG    
1079 C CD1   . LEU A 150 ? 0.5954 0.4741 0.6214 -0.1043 -0.1161 0.0058  149 LEU A CD1   
1080 C CD2   . LEU A 150 ? 0.5403 0.4166 0.6027 -0.1299 -0.1473 0.0156  149 LEU A CD2   
1081 N N     . PRO A 151 ? 0.7439 0.4838 0.6464 -0.1479 -0.1956 -0.0168 150 PRO A N     
1082 C CA    . PRO A 151 ? 0.7956 0.4942 0.6415 -0.1483 -0.2046 -0.0264 150 PRO A CA    
1083 C C     . PRO A 151 ? 0.7581 0.4660 0.5915 -0.1388 -0.2003 -0.0267 150 PRO A C     
1084 O O     . PRO A 151 ? 0.6983 0.4441 0.5692 -0.1351 -0.1975 -0.0187 150 PRO A O     
1085 C CB    . PRO A 151 ? 0.8567 0.5365 0.7009 -0.1667 -0.2364 -0.0246 150 PRO A CB    
1086 C CG    . PRO A 151 ? 0.8312 0.5567 0.7394 -0.1725 -0.2444 -0.0114 150 PRO A CG    
1087 C CD    . PRO A 151 ? 0.7590 0.5175 0.7027 -0.1621 -0.2171 -0.0070 150 PRO A CD    
1088 N N     . GLN A 152 ? 0.8077 0.4773 0.5858 -0.1346 -0.1985 -0.0358 151 GLN A N     
1089 C CA    . GLN A 152 ? 0.8555 0.5257 0.6135 -0.1256 -0.1929 -0.0369 151 GLN A CA    
1090 C C     . GLN A 152 ? 0.9157 0.5630 0.6485 -0.1362 -0.2212 -0.0361 151 GLN A C     
1091 O O     . GLN A 152 ? 0.9837 0.5840 0.6675 -0.1428 -0.2335 -0.0433 151 GLN A O     
1092 C CB    . GLN A 152 ? 0.8927 0.5358 0.6077 -0.1129 -0.1692 -0.0462 151 GLN A CB    
1093 C CG    . GLN A 152 ? 0.8933 0.5549 0.6317 -0.1031 -0.1448 -0.0470 151 GLN A CG    
1094 C CD    . GLN A 152 ? 0.9485 0.5974 0.6606 -0.0883 -0.1198 -0.0531 151 GLN A CD    
1095 O OE1   . GLN A 152 ? 0.9479 0.5894 0.6382 -0.0834 -0.1159 -0.0544 151 GLN A OE1   
1096 N NE2   . GLN A 152 ? 1.0096 0.6559 0.7256 -0.0811 -0.1024 -0.0562 151 GLN A NE2   
1097 N N     . GLY A 153 ? 0.8637 0.5419 0.6281 -0.1375 -0.2320 -0.0273 152 GLY A N     
1098 C CA    . GLY A 153 ? 0.8906 0.5531 0.6408 -0.1479 -0.2625 -0.0241 152 GLY A CA    
1099 C C     . GLY A 153 ? 0.8627 0.5670 0.6769 -0.1564 -0.2801 -0.0116 152 GLY A C     
1100 O O     . GLY A 153 ? 0.8882 0.5948 0.7078 -0.1623 -0.3038 -0.0055 152 GLY A O     
1101 N N     . TRP A 154 ? 0.8074 0.5438 0.6706 -0.1565 -0.2679 -0.0070 153 TRP A N     
1102 C CA    . TRP A 154 ? 0.7488 0.5284 0.6784 -0.1620 -0.2768 0.0058  153 TRP A CA    
1103 C C     . TRP A 154 ? 0.6763 0.4930 0.6337 -0.1491 -0.2599 0.0119  153 TRP A C     
1104 O O     . TRP A 154 ? 0.6586 0.4785 0.6010 -0.1362 -0.2343 0.0069  153 TRP A O     
1105 C CB    . TRP A 154 ? 0.7378 0.5326 0.7038 -0.1664 -0.2671 0.0084  153 TRP A CB    
1106 C CG    . TRP A 154 ? 0.7183 0.5526 0.7526 -0.1735 -0.2754 0.0221  153 TRP A CG    
1107 C CD1   . TRP A 154 ? 0.7051 0.5487 0.7677 -0.1846 -0.3035 0.0309  153 TRP A CD1   
1108 C CD2   . TRP A 154 ? 0.6946 0.5634 0.7780 -0.1696 -0.2544 0.0292  153 TRP A CD2   
1109 N NE1   . TRP A 154 ? 0.6831 0.5669 0.8138 -0.1875 -0.2995 0.0435  153 TRP A NE1   
1110 C CE2   . TRP A 154 ? 0.6718 0.5699 0.8136 -0.1783 -0.2685 0.0425  153 TRP A CE2   
1111 C CE3   . TRP A 154 ? 0.6853 0.5611 0.7681 -0.1593 -0.2253 0.0262  153 TRP A CE3   
1112 C CZ2   . TRP A 154 ? 0.6436 0.5760 0.8406 -0.1766 -0.2515 0.0526  153 TRP A CZ2   
1113 C CZ3   . TRP A 154 ? 0.6505 0.5583 0.7837 -0.1581 -0.2109 0.0358  153 TRP A CZ3   
1114 C CH2   . TRP A 154 ? 0.6410 0.5759 0.8296 -0.1665 -0.2225 0.0488  153 TRP A CH2   
1115 N N     . LYS A 155 ? 0.6494 0.4937 0.6489 -0.1528 -0.2748 0.0232  154 LYS A N     
1116 C CA    . LYS A 155 ? 0.6565 0.5321 0.6796 -0.1409 -0.2608 0.0292  154 LYS A CA    
1117 C C     . LYS A 155 ? 0.6188 0.5300 0.6856 -0.1332 -0.2344 0.0337  154 LYS A C     
1118 O O     . LYS A 155 ? 0.5981 0.5268 0.6700 -0.1211 -0.2158 0.0346  154 LYS A O     
1119 C CB    . LYS A 155 ? 0.6531 0.5447 0.7067 -0.1463 -0.2855 0.0403  154 LYS A CB    
1120 C CG    . LYS A 155 ? 0.5904 0.5210 0.7162 -0.1516 -0.2887 0.0535  154 LYS A CG    
1121 C CD    . LYS A 155 ? 0.5983 0.5437 0.7558 -0.1564 -0.3148 0.0651  154 LYS A CD    
1122 C CE    . LYS A 155 ? 0.6175 0.6047 0.8528 -0.1597 -0.3134 0.0794  154 LYS A CE    
1123 N NZ    . LYS A 155 ? 0.6294 0.6289 0.9011 -0.1675 -0.3446 0.0916  154 LYS A NZ    
1124 N N     . GLY A 156 ? 0.6463 0.5656 0.7417 -0.1400 -0.2324 0.0366  155 GLY A N     
1125 C CA    . GLY A 156 ? 0.5638 0.5110 0.6941 -0.1327 -0.2071 0.0410  155 GLY A CA    
1126 C C     . GLY A 156 ? 0.5537 0.4881 0.6534 -0.1240 -0.1839 0.0314  155 GLY A C     
1127 O O     . GLY A 156 ? 0.5490 0.5024 0.6706 -0.1173 -0.1634 0.0344  155 GLY A O     
1128 N N     . SER A 157 ? 0.5938 0.4947 0.6422 -0.1234 -0.1863 0.0203  156 SER A N     
1129 C CA    . SER A 157 ? 0.5982 0.4869 0.6219 -0.1153 -0.1655 0.0120  156 SER A CA    
1130 C C     . SER A 157 ? 0.5715 0.4756 0.5926 -0.1008 -0.1445 0.0105  156 SER A C     
1131 O O     . SER A 157 ? 0.5775 0.4914 0.6080 -0.0941 -0.1264 0.0101  156 SER A O     
1132 C CB    . SER A 157 ? 0.6387 0.4855 0.6108 -0.1186 -0.1728 0.0013  156 SER A CB    
1133 O OG    . SER A 157 ? 0.6805 0.5106 0.6544 -0.1320 -0.1892 0.0016  156 SER A OG    
1134 N N     . PRO A 158 ? 0.5640 0.4686 0.5712 -0.0957 -0.1462 0.0095  157 PRO A N     
1135 C CA    . PRO A 158 ? 0.5525 0.4708 0.5587 -0.0829 -0.1261 0.0079  157 PRO A CA    
1136 C C     . PRO A 158 ? 0.5483 0.4981 0.5949 -0.0784 -0.1140 0.0154  157 PRO A C     
1137 O O     . PRO A 158 ? 0.4308 0.3855 0.4766 -0.0706 -0.0968 0.0128  157 PRO A O     
1138 C CB    . PRO A 158 ? 0.5626 0.4763 0.5524 -0.0809 -0.1337 0.0080  157 PRO A CB    
1139 C CG    . PRO A 158 ? 0.5329 0.4161 0.4923 -0.0902 -0.1535 0.0046  157 PRO A CG    
1140 C CD    . PRO A 158 ? 0.6014 0.4887 0.5862 -0.1011 -0.1660 0.0090  157 PRO A CD    
1141 N N     . ALA A 159 ? 0.5288 0.4983 0.6103 -0.0830 -0.1224 0.0250  158 ALA A N     
1142 C CA    . ALA A 159 ? 0.4753 0.4715 0.5924 -0.0776 -0.1082 0.0325  158 ALA A CA    
1143 C C     . ALA A 159 ? 0.4688 0.4654 0.5966 -0.0790 -0.0978 0.0334  158 ALA A C     
1144 O O     . ALA A 159 ? 0.4368 0.4420 0.5693 -0.0710 -0.0802 0.0340  158 ALA A O     
1145 C CB    . ALA A 159 ? 0.4061 0.4226 0.5612 -0.0817 -0.1185 0.0436  158 ALA A CB    
1146 N N     . ILE A 160 ? 0.4633 0.4482 0.5929 -0.0894 -0.1091 0.0337  159 ILE A N     
1147 C CA    . ILE A 160 ? 0.4703 0.4530 0.6086 -0.0910 -0.0992 0.0350  159 ILE A CA    
1148 C C     . ILE A 160 ? 0.5054 0.4734 0.6114 -0.0824 -0.0857 0.0261  159 ILE A C     
1149 O O     . ILE A 160 ? 0.5543 0.5275 0.6662 -0.0767 -0.0705 0.0279  159 ILE A O     
1150 C CB    . ILE A 160 ? 0.4751 0.4450 0.6199 -0.1049 -0.1154 0.0365  159 ILE A CB    
1151 C CG1   . ILE A 160 ? 0.4540 0.4451 0.6448 -0.1132 -0.1262 0.0483  159 ILE A CG1   
1152 C CG2   . ILE A 160 ? 0.4713 0.4308 0.6131 -0.1060 -0.1047 0.0355  159 ILE A CG2   
1153 C CD1   . ILE A 160 ? 0.4934 0.4736 0.6961 -0.1286 -0.1450 0.0508  159 ILE A CD1   
1154 N N     . PHE A 161 ? 0.4756 0.4241 0.5469 -0.0807 -0.0906 0.0169  160 PHE A N     
1155 C CA    . PHE A 161 ? 0.4803 0.4170 0.5267 -0.0719 -0.0778 0.0094  160 PHE A CA    
1156 C C     . PHE A 161 ? 0.4488 0.4027 0.5012 -0.0609 -0.0639 0.0103  160 PHE A C     
1157 O O     . PHE A 161 ? 0.4923 0.4459 0.5417 -0.0544 -0.0523 0.0091  160 PHE A O     
1158 C CB    . PHE A 161 ? 0.5135 0.4256 0.5237 -0.0714 -0.0830 0.0002  160 PHE A CB    
1159 C CG    . PHE A 161 ? 0.5274 0.4289 0.5181 -0.0620 -0.0694 -0.0064 160 PHE A CG    
1160 C CD1   . PHE A 161 ? 0.5534 0.4372 0.5337 -0.0629 -0.0670 -0.0094 160 PHE A CD1   
1161 C CD2   . PHE A 161 ? 0.5246 0.4346 0.5109 -0.0522 -0.0593 -0.0089 160 PHE A CD2   
1162 C CE1   . PHE A 161 ? 0.5290 0.4046 0.4960 -0.0535 -0.0552 -0.0143 160 PHE A CE1   
1163 C CE2   . PHE A 161 ? 0.4971 0.3998 0.4720 -0.0437 -0.0481 -0.0138 160 PHE A CE2   
1164 C CZ    . PHE A 161 ? 0.5242 0.4104 0.4902 -0.0439 -0.0462 -0.0163 160 PHE A CZ    
1165 N N     . GLN A 162 ? 0.4425 0.4090 0.5014 -0.0588 -0.0658 0.0123  161 GLN A N     
1166 C CA    . GLN A 162 ? 0.4226 0.4022 0.4848 -0.0491 -0.0536 0.0125  161 GLN A CA    
1167 C C     . GLN A 162 ? 0.4360 0.4289 0.5199 -0.0466 -0.0434 0.0192  161 GLN A C     
1168 O O     . GLN A 162 ? 0.4688 0.4618 0.5460 -0.0392 -0.0326 0.0174  161 GLN A O     
1169 C CB    . GLN A 162 ? 0.3843 0.3724 0.4488 -0.0478 -0.0581 0.0139  161 GLN A CB    
1170 C CG    . GLN A 162 ? 0.4075 0.3788 0.4433 -0.0476 -0.0633 0.0068  161 GLN A CG    
1171 C CD    . GLN A 162 ? 0.4500 0.4229 0.4857 -0.0508 -0.0745 0.0097  161 GLN A CD    
1172 O OE1   . GLN A 162 ? 0.4922 0.4813 0.5533 -0.0528 -0.0791 0.0174  161 GLN A OE1   
1173 N NE2   . GLN A 162 ? 0.4492 0.4037 0.4558 -0.0506 -0.0784 0.0041  161 GLN A NE2   
1174 N N     . SER A 163 ? 0.4230 0.4254 0.5325 -0.0528 -0.0467 0.0273  162 SER A N     
1175 C CA    . SER A 163 ? 0.4041 0.4158 0.5327 -0.0502 -0.0341 0.0345  162 SER A CA    
1176 C C     . SER A 163 ? 0.4394 0.4375 0.5557 -0.0496 -0.0276 0.0325  162 SER A C     
1177 O O     . SER A 163 ? 0.4896 0.4869 0.6014 -0.0428 -0.0149 0.0339  162 SER A O     
1178 C CB    . SER A 163 ? 0.4327 0.4580 0.5964 -0.0574 -0.0382 0.0446  162 SER A CB    
1179 O OG    . SER A 163 ? 0.4981 0.5316 0.6804 -0.0537 -0.0223 0.0524  162 SER A OG    
1180 N N     . SER A 164 ? 0.4523 0.4366 0.5602 -0.0565 -0.0365 0.0294  163 SER A N     
1181 C CA    . SER A 164 ? 0.4689 0.4385 0.5644 -0.0556 -0.0307 0.0277  163 SER A CA    
1182 C C     . SER A 164 ? 0.4505 0.4125 0.5216 -0.0454 -0.0246 0.0208  163 SER A C     
1183 O O     . SER A 164 ? 0.4788 0.4351 0.5435 -0.0403 -0.0159 0.0221  163 SER A O     
1184 C CB    . SER A 164 ? 0.4879 0.4414 0.5767 -0.0649 -0.0421 0.0248  163 SER A CB    
1185 O OG    . SER A 164 ? 0.4567 0.4175 0.5717 -0.0756 -0.0502 0.0318  163 SER A OG    
1186 N N     . MET A 165 ? 0.4480 0.4091 0.5059 -0.0425 -0.0292 0.0141  164 MET A N     
1187 C CA    . MET A 165 ? 0.4702 0.4272 0.5118 -0.0333 -0.0241 0.0084  164 MET A CA    
1188 C C     . MET A 165 ? 0.4822 0.4498 0.5288 -0.0265 -0.0157 0.0116  164 MET A C     
1189 O O     . MET A 165 ? 0.5122 0.4738 0.5487 -0.0202 -0.0113 0.0101  164 MET A O     
1190 C CB    . MET A 165 ? 0.4972 0.4524 0.5278 -0.0321 -0.0286 0.0020  164 MET A CB    
1191 C CG    . MET A 165 ? 0.5527 0.5048 0.5719 -0.0235 -0.0234 -0.0034 164 MET A CG    
1192 S SD    . MET A 165 ? 0.6440 0.5786 0.6520 -0.0201 -0.0211 -0.0064 164 MET A SD    
1193 C CE    . MET A 165 ? 0.5901 0.5207 0.5889 -0.0127 -0.0177 -0.0133 164 MET A CE    
1194 N N     . THR A 166 ? 0.4906 0.4717 0.5515 -0.0275 -0.0141 0.0161  165 THR A N     
1195 C CA    . THR A 166 ? 0.4199 0.4068 0.4820 -0.0211 -0.0051 0.0190  165 THR A CA    
1196 C C     . THR A 166 ? 0.4173 0.3963 0.4777 -0.0197 0.0033  0.0241  165 THR A C     
1197 O O     . THR A 166 ? 0.4444 0.4159 0.4902 -0.0132 0.0085  0.0232  165 THR A O     
1198 C CB    . THR A 166 ? 0.3786 0.3799 0.4578 -0.0221 -0.0037 0.0236  165 THR A CB    
1199 O OG1   . THR A 166 ? 0.3679 0.3734 0.4440 -0.0226 -0.0112 0.0190  165 THR A OG1   
1200 C CG2   . THR A 166 ? 0.3445 0.3475 0.4216 -0.0152 0.0072  0.0263  165 THR A CG2   
1201 N N     . LYS A 167 ? 0.4199 0.3986 0.4940 -0.0262 0.0043  0.0298  166 LYS A N     
1202 C CA    . LYS A 167 ? 0.4582 0.4270 0.5297 -0.0252 0.0140  0.0355  166 LYS A CA    
1203 C C     . LYS A 167 ? 0.4730 0.4246 0.5211 -0.0214 0.0121  0.0309  166 LYS A C     
1204 O O     . LYS A 167 ? 0.4919 0.4322 0.5255 -0.0159 0.0194  0.0332  166 LYS A O     
1205 C CB    . LYS A 167 ? 0.5149 0.4868 0.6093 -0.0343 0.0146  0.0426  166 LYS A CB    
1206 C CG    . LYS A 167 ? 0.5875 0.5773 0.7113 -0.0372 0.0179  0.0499  166 LYS A CG    
1207 C CD    . LYS A 167 ? 0.6202 0.6133 0.7714 -0.0462 0.0198  0.0588  166 LYS A CD    
1208 C CE    . LYS A 167 ? 0.6366 0.6506 0.8239 -0.0504 0.0180  0.0660  166 LYS A CE    
1209 N NZ    . LYS A 167 ? 0.6315 0.6536 0.8249 -0.0415 0.0334  0.0709  166 LYS A NZ    
1210 N N     . ILE A 168 ? 0.4707 0.4182 0.5135 -0.0236 0.0025  0.0247  167 ILE A N     
1211 C CA    . ILE A 168 ? 0.4865 0.4187 0.5112 -0.0192 0.0006  0.0209  167 ILE A CA    
1212 C C     . ILE A 168 ? 0.5005 0.4325 0.5123 -0.0101 0.0007  0.0174  167 ILE A C     
1213 O O     . ILE A 168 ? 0.4923 0.4122 0.4902 -0.0047 0.0020  0.0184  167 ILE A O     
1214 C CB    . ILE A 168 ? 0.4594 0.3857 0.4816 -0.0229 -0.0076 0.0150  167 ILE A CB    
1215 C CG1   . ILE A 168 ? 0.4600 0.3800 0.4908 -0.0326 -0.0096 0.0186  167 ILE A CG1   
1216 C CG2   . ILE A 168 ? 0.4680 0.3816 0.4749 -0.0159 -0.0089 0.0107  167 ILE A CG2   
1217 C CD1   . ILE A 168 ? 0.4649 0.3742 0.4886 -0.0372 -0.0181 0.0125  167 ILE A CD1   
1218 N N     . LEU A 169 ? 0.4888 0.4331 0.5051 -0.0086 -0.0018 0.0137  168 LEU A N     
1219 C CA    . LEU A 169 ? 0.4908 0.4353 0.4980 -0.0014 -0.0035 0.0103  168 LEU A CA    
1220 C C     . LEU A 169 ? 0.5012 0.4421 0.4999 0.0022  0.0023  0.0143  168 LEU A C     
1221 O O     . LEU A 169 ? 0.5141 0.4491 0.5007 0.0078  -0.0009 0.0121  168 LEU A O     
1222 C CB    . LEU A 169 ? 0.4756 0.4326 0.4901 -0.0015 -0.0069 0.0053  168 LEU A CB    
1223 C CG    . LEU A 169 ? 0.4788 0.4343 0.4944 -0.0025 -0.0112 0.0001  168 LEU A CG    
1224 C CD1   . LEU A 169 ? 0.4464 0.4121 0.4670 -0.0028 -0.0122 -0.0035 168 LEU A CD1   
1225 C CD2   . LEU A 169 ? 0.3761 0.3228 0.3858 0.0034  -0.0134 -0.0023 168 LEU A CD2   
1226 N N     . GLU A 170 ? 0.5093 0.4519 0.5141 -0.0007 0.0108  0.0203  169 GLU A N     
1227 C CA    . GLU A 170 ? 0.5595 0.4955 0.5535 0.0036  0.0195  0.0242  169 GLU A CA    
1228 C C     . GLU A 170 ? 0.6102 0.5250 0.5781 0.0092  0.0195  0.0249  169 GLU A C     
1229 O O     . GLU A 170 ? 0.6649 0.5719 0.6161 0.0141  0.0185  0.0230  169 GLU A O     
1230 C CB    . GLU A 170 ? 0.6215 0.5620 0.6306 -0.0002 0.0312  0.0321  169 GLU A CB    
1231 C CG    . GLU A 170 ? 0.7310 0.6662 0.7326 0.0046  0.0437  0.0364  169 GLU A CG    
1232 C CD    . GLU A 170 ? 0.8967 0.8077 0.8725 0.0091  0.0530  0.0405  169 GLU A CD    
1233 O OE1   . GLU A 170 ? 0.9642 0.8628 0.9218 0.0147  0.0620  0.0419  169 GLU A OE1   
1234 O OE2   . GLU A 170 ? 0.9582 0.8596 0.9289 0.0073  0.0516  0.0424  169 GLU A OE2   
1235 N N     . PRO A 171 ? 0.5635 0.4658 0.5244 0.0087  0.0197  0.0276  170 PRO A N     
1236 C CA    . PRO A 171 ? 0.6347 0.5145 0.5676 0.0147  0.0179  0.0288  170 PRO A CA    
1237 C C     . PRO A 171 ? 0.5975 0.4766 0.5228 0.0192  0.0036  0.0225  170 PRO A C     
1238 O O     . PRO A 171 ? 0.6643 0.5279 0.5666 0.0242  -0.0003 0.0224  170 PRO A O     
1239 C CB    . PRO A 171 ? 0.4765 0.3455 0.4083 0.0125  0.0199  0.0329  170 PRO A CB    
1240 C CG    . PRO A 171 ? 0.4836 0.3661 0.4401 0.0048  0.0276  0.0362  170 PRO A CG    
1241 C CD    . PRO A 171 ? 0.5304 0.4350 0.5060 0.0024  0.0219  0.0308  170 PRO A CD    
1242 N N     . PHE A 172 ? 0.5236 0.4176 0.4675 0.0175  -0.0044 0.0175  171 PHE A N     
1243 C CA    . PHE A 172 ? 0.5168 0.4133 0.4611 0.0217  -0.0165 0.0125  171 PHE A CA    
1244 C C     . PHE A 172 ? 0.5383 0.4414 0.4817 0.0224  -0.0185 0.0095  171 PHE A C     
1245 O O     . PHE A 172 ? 0.5800 0.4762 0.5138 0.0261  -0.0282 0.0076  171 PHE A O     
1246 C CB    . PHE A 172 ? 0.4743 0.3836 0.4390 0.0203  -0.0203 0.0085  171 PHE A CB    
1247 C CG    . PHE A 172 ? 0.4837 0.3965 0.4550 0.0251  -0.0307 0.0048  171 PHE A CG    
1248 C CD1   . PHE A 172 ? 0.4402 0.3670 0.4237 0.0248  -0.0336 0.0008  171 PHE A CD1   
1249 C CD2   . PHE A 172 ? 0.4964 0.3987 0.4645 0.0299  -0.0374 0.0062  171 PHE A CD2   
1250 C CE1   . PHE A 172 ? 0.4338 0.3655 0.4292 0.0287  -0.0425 -0.0015 171 PHE A CE1   
1251 C CE2   . PHE A 172 ? 0.5023 0.4101 0.4829 0.0346  -0.0472 0.0041  171 PHE A CE2   
1252 C CZ    . PHE A 172 ? 0.4404 0.3637 0.4362 0.0337  -0.0495 0.0003  171 PHE A CZ    
1253 N N     . ARG A 173 ? 0.4905 0.4060 0.4446 0.0187  -0.0107 0.0093  172 ARG A N     
1254 C CA    . ARG A 173 ? 0.4922 0.4117 0.4442 0.0195  -0.0112 0.0068  172 ARG A CA    
1255 C C     . ARG A 173 ? 0.5343 0.4328 0.4586 0.0231  -0.0083 0.0094  172 ARG A C     
1256 O O     . ARG A 173 ? 0.5465 0.4382 0.4591 0.0252  -0.0152 0.0062  172 ARG A O     
1257 C CB    . ARG A 173 ? 0.4421 0.3779 0.4112 0.0156  -0.0033 0.0071  172 ARG A CB    
1258 C CG    . ARG A 173 ? 0.3762 0.3288 0.3657 0.0124  -0.0074 0.0034  172 ARG A CG    
1259 C CD    . ARG A 173 ? 0.4006 0.3662 0.4022 0.0095  -0.0025 0.0037  172 ARG A CD    
1260 N NE    . ARG A 173 ? 0.3946 0.3717 0.4092 0.0070  -0.0064 -0.0001 172 ARG A NE    
1261 C CZ    . ARG A 173 ? 0.3911 0.3742 0.4148 0.0027  -0.0056 0.0008  172 ARG A CZ    
1262 N NH1   . ARG A 173 ? 0.3969 0.3790 0.4239 -0.0004 -0.0021 0.0057  172 ARG A NH1   
1263 N NH2   . ARG A 173 ? 0.3352 0.3235 0.3640 0.0012  -0.0083 -0.0029 172 ARG A NH2   
1264 N N     . LYS A 174 ? 0.5737 0.4594 0.4859 0.0235  0.0024  0.0151  173 LYS A N     
1265 C CA    . LYS A 174 ? 0.6421 0.5016 0.5214 0.0278  0.0074  0.0180  173 LYS A CA    
1266 C C     . LYS A 174 ? 0.6939 0.5347 0.5499 0.0315  -0.0079 0.0159  173 LYS A C     
1267 O O     . LYS A 174 ? 0.7605 0.5858 0.5941 0.0340  -0.0144 0.0134  173 LYS A O     
1268 C CB    . LYS A 174 ? 0.7138 0.5624 0.5866 0.0276  0.0233  0.0257  173 LYS A CB    
1269 C CG    . LYS A 174 ? 0.7626 0.6231 0.6529 0.0255  0.0398  0.0297  173 LYS A CG    
1270 C CD    . LYS A 174 ? 0.8046 0.6500 0.6732 0.0301  0.0485  0.0297  173 LYS A CD    
1271 C CE    . LYS A 174 ? 0.8204 0.6780 0.7103 0.0293  0.0664  0.0352  173 LYS A CE    
1272 N NZ    . LYS A 174 ? 0.8029 0.6923 0.7305 0.0243  0.0600  0.0328  173 LYS A NZ    
1273 N N     . GLN A 175 ? 0.6864 0.5272 0.5477 0.0318  -0.0151 0.0170  174 GLN A N     
1274 C CA    . GLN A 175 ? 0.7283 0.5520 0.5710 0.0359  -0.0311 0.0164  174 GLN A CA    
1275 C C     . GLN A 175 ? 0.6737 0.5100 0.5310 0.0359  -0.0477 0.0105  174 GLN A C     
1276 O O     . GLN A 175 ? 0.6758 0.4963 0.5157 0.0388  -0.0630 0.0099  174 GLN A O     
1277 C CB    . GLN A 175 ? 0.7667 0.5885 0.6154 0.0370  -0.0335 0.0196  174 GLN A CB    
1278 C CG    . GLN A 175 ? 0.8528 0.6544 0.6814 0.0422  -0.0498 0.0210  174 GLN A CG    
1279 C CD    . GLN A 175 ? 0.9077 0.7064 0.7427 0.0438  -0.0505 0.0246  174 GLN A CD    
1280 O OE1   . GLN A 175 ? 0.9382 0.7377 0.7775 0.0411  -0.0364 0.0277  174 GLN A OE1   
1281 N NE2   . GLN A 175 ? 0.9183 0.7137 0.7564 0.0483  -0.0675 0.0245  174 GLN A NE2   
1282 N N     . ASN A 176 ? 0.5600 0.4229 0.4487 0.0324  -0.0454 0.0068  175 ASN A N     
1283 C CA    . ASN A 176 ? 0.5680 0.4451 0.4762 0.0319  -0.0583 0.0020  175 ASN A CA    
1284 C C     . ASN A 176 ? 0.6173 0.5076 0.5356 0.0284  -0.0515 -0.0014 175 ASN A C     
1285 O O     . ASN A 176 ? 0.6381 0.5501 0.5831 0.0257  -0.0472 -0.0034 175 ASN A O     
1286 C CB    . ASN A 176 ? 0.5391 0.4341 0.4773 0.0322  -0.0620 0.0011  175 ASN A CB    
1287 C CG    . ASN A 176 ? 0.5714 0.4531 0.5012 0.0364  -0.0681 0.0049  175 ASN A CG    
1288 O OD1   . ASN A 176 ? 0.6316 0.5084 0.5631 0.0399  -0.0833 0.0053  175 ASN A OD1   
1289 N ND2   . ASN A 176 ? 0.5304 0.4060 0.4528 0.0359  -0.0570 0.0082  175 ASN A ND2   
1290 N N     . PRO A 177 ? 0.6186 0.4933 0.5132 0.0287  -0.0500 -0.0019 176 PRO A N     
1291 C CA    . PRO A 177 ? 0.6147 0.4999 0.5177 0.0260  -0.0424 -0.0045 176 PRO A CA    
1292 C C     . PRO A 177 ? 0.6369 0.5377 0.5624 0.0236  -0.0528 -0.0091 176 PRO A C     
1293 O O     . PRO A 177 ? 0.6537 0.5683 0.5936 0.0211  -0.0458 -0.0109 176 PRO A O     
1294 C CB    . PRO A 177 ? 0.6102 0.4682 0.4770 0.0282  -0.0385 -0.0038 176 PRO A CB    
1295 C CG    . PRO A 177 ? 0.6383 0.4722 0.4787 0.0309  -0.0529 -0.0033 176 PRO A CG    
1296 C CD    . PRO A 177 ? 0.6069 0.4500 0.4623 0.0319  -0.0551 -0.0002 176 PRO A CD    
1297 N N     . ASP A 178 ? 0.6668 0.5659 0.5977 0.0242  -0.0692 -0.0104 177 ASP A N     
1298 C CA    . ASP A 178 ? 0.7014 0.6147 0.6569 0.0215  -0.0789 -0.0139 177 ASP A CA    
1299 C C     . ASP A 178 ? 0.6299 0.5665 0.6211 0.0216  -0.0781 -0.0137 177 ASP A C     
1300 O O     . ASP A 178 ? 0.6364 0.5854 0.6525 0.0200  -0.0855 -0.0154 177 ASP A O     
1301 C CB    . ASP A 178 ? 0.8285 0.7248 0.7707 0.0215  -0.0989 -0.0150 177 ASP A CB    
1302 C CG    . ASP A 178 ? 0.9741 0.8428 0.8767 0.0212  -0.0991 -0.0165 177 ASP A CG    
1303 O OD1   . ASP A 178 ? 0.9930 0.8644 0.8945 0.0192  -0.0885 -0.0186 177 ASP A OD1   
1304 O OD2   . ASP A 178 ? 1.0467 0.8887 0.9171 0.0236  -0.1091 -0.0153 177 ASP A OD2   
1305 N N     . ILE A 179 ? 0.5895 0.5307 0.5835 0.0232  -0.0684 -0.0115 178 ILE A N     
1306 C CA    . ILE A 179 ? 0.5271 0.4864 0.5487 0.0233  -0.0629 -0.0120 178 ILE A CA    
1307 C C     . ILE A 179 ? 0.4973 0.4657 0.5212 0.0201  -0.0488 -0.0129 178 ILE A C     
1308 O O     . ILE A 179 ? 0.5337 0.4960 0.5425 0.0195  -0.0411 -0.0110 178 ILE A O     
1309 C CB    . ILE A 179 ? 0.5228 0.4772 0.5432 0.0269  -0.0630 -0.0093 178 ILE A CB    
1310 C CG1   . ILE A 179 ? 0.4780 0.4192 0.4900 0.0306  -0.0785 -0.0071 178 ILE A CG1   
1311 C CG2   . ILE A 179 ? 0.4866 0.4555 0.5329 0.0279  -0.0572 -0.0103 178 ILE A CG2   
1312 C CD1   . ILE A 179 ? 0.4305 0.3832 0.4724 0.0329  -0.0894 -0.0072 178 ILE A CD1   
1313 N N     . VAL A 180 ? 0.4278 0.4101 0.4713 0.0182  -0.0454 -0.0152 179 VAL A N     
1314 C CA    . VAL A 180 ? 0.4075 0.3965 0.4511 0.0153  -0.0344 -0.0157 179 VAL A CA    
1315 C C     . VAL A 180 ? 0.3874 0.3815 0.4386 0.0153  -0.0274 -0.0156 179 VAL A C     
1316 O O     . VAL A 180 ? 0.4123 0.4110 0.4784 0.0172  -0.0273 -0.0167 179 VAL A O     
1317 C CB    . VAL A 180 ? 0.4148 0.4115 0.4696 0.0130  -0.0338 -0.0178 179 VAL A CB    
1318 C CG1   . VAL A 180 ? 0.4524 0.4575 0.5308 0.0137  -0.0380 -0.0190 179 VAL A CG1   
1319 C CG2   . VAL A 180 ? 0.3832 0.3862 0.4388 0.0107  -0.0233 -0.0177 179 VAL A CG2   
1320 N N     . ILE A 181 ? 0.3700 0.3619 0.4113 0.0133  -0.0215 -0.0141 180 ILE A N     
1321 C CA    . ILE A 181 ? 0.3538 0.3456 0.3965 0.0121  -0.0169 -0.0143 180 ILE A CA    
1322 C C     . ILE A 181 ? 0.3979 0.3944 0.4395 0.0083  -0.0119 -0.0142 180 ILE A C     
1323 O O     . ILE A 181 ? 0.4222 0.4185 0.4583 0.0060  -0.0108 -0.0115 180 ILE A O     
1324 C CB    . ILE A 181 ? 0.3728 0.3555 0.4058 0.0121  -0.0175 -0.0118 180 ILE A CB    
1325 C CG1   . ILE A 181 ? 0.4175 0.3929 0.4468 0.0163  -0.0239 -0.0107 180 ILE A CG1   
1326 C CG2   . ILE A 181 ? 0.3629 0.3420 0.3965 0.0110  -0.0146 -0.0131 180 ILE A CG2   
1327 C CD1   . ILE A 181 ? 0.4014 0.3656 0.4206 0.0168  -0.0237 -0.0079 180 ILE A CD1   
1328 N N     . TYR A 182 ? 0.3846 0.3845 0.4321 0.0081  -0.0084 -0.0166 181 TYR A N     
1329 C CA    . TYR A 182 ? 0.3886 0.3889 0.4312 0.0047  -0.0050 -0.0163 181 TYR A CA    
1330 C C     . TYR A 182 ? 0.4062 0.3979 0.4400 0.0026  -0.0050 -0.0166 181 TYR A C     
1331 O O     . TYR A 182 ? 0.4371 0.4220 0.4693 0.0046  -0.0023 -0.0191 181 TYR A O     
1332 C CB    . TYR A 182 ? 0.3721 0.3750 0.4198 0.0054  -0.0002 -0.0183 181 TYR A CB    
1333 C CG    . TYR A 182 ? 0.3849 0.3943 0.4372 0.0048  -0.0004 -0.0174 181 TYR A CG    
1334 C CD1   . TYR A 182 ? 0.3826 0.3953 0.4428 0.0064  -0.0040 -0.0179 181 TYR A CD1   
1335 C CD2   . TYR A 182 ? 0.4162 0.4261 0.4632 0.0026  0.0018  -0.0160 181 TYR A CD2   
1336 C CE1   . TYR A 182 ? 0.4495 0.4646 0.5112 0.0055  -0.0044 -0.0177 181 TYR A CE1   
1337 C CE2   . TYR A 182 ? 0.4447 0.4584 0.4951 0.0025  0.0023  -0.0151 181 TYR A CE2   
1338 C CZ    . TYR A 182 ? 0.4882 0.5040 0.5454 0.0038  -0.0003 -0.0163 181 TYR A CZ    
1339 O OH    . TYR A 182 ? 0.5099 0.5262 0.5679 0.0033  0.0001  -0.0160 181 TYR A OH    
1340 N N     . GLN A 183 ? 0.4127 0.4041 0.4423 -0.0013 -0.0079 -0.0137 182 GLN A N     
1341 C CA    . GLN A 183 ? 0.4508 0.4334 0.4733 -0.0050 -0.0107 -0.0133 182 GLN A CA    
1342 C C     . GLN A 183 ? 0.4720 0.4516 0.4878 -0.0096 -0.0135 -0.0128 182 GLN A C     
1343 O O     . GLN A 183 ? 0.4851 0.4713 0.5064 -0.0130 -0.0174 -0.0086 182 GLN A O     
1344 C CB    . GLN A 183 ? 0.4615 0.4459 0.4883 -0.0066 -0.0128 -0.0091 182 GLN A CB    
1345 C CG    . GLN A 183 ? 0.4578 0.4366 0.4830 -0.0127 -0.0169 -0.0067 182 GLN A CG    
1346 C CD    . GLN A 183 ? 0.4999 0.4855 0.5356 -0.0147 -0.0163 -0.0004 182 GLN A CD    
1347 O OE1   . GLN A 183 ? 0.4964 0.4856 0.5343 -0.0106 -0.0118 0.0014  182 GLN A OE1   
1348 N NE2   . GLN A 183 ? 0.4909 0.4768 0.5330 -0.0212 -0.0207 0.0033  182 GLN A NE2   
1349 N N     . TYR A 184 ? 0.5059 0.4743 0.5092 -0.0093 -0.0114 -0.0166 183 TYR A N     
1350 C CA    . TYR A 184 ? 0.5433 0.5016 0.5325 -0.0141 -0.0163 -0.0166 183 TYR A CA    
1351 C C     . TYR A 184 ? 0.6475 0.5894 0.6242 -0.0175 -0.0202 -0.0187 183 TYR A C     
1352 O O     . TYR A 184 ? 0.8224 0.7601 0.8003 -0.0143 -0.0158 -0.0209 183 TYR A O     
1353 C CB    . TYR A 184 ? 0.4966 0.4474 0.4737 -0.0116 -0.0102 -0.0192 183 TYR A CB    
1354 C CG    . TYR A 184 ? 0.4360 0.3785 0.3982 -0.0159 -0.0167 -0.0176 183 TYR A CG    
1355 C CD1   . TYR A 184 ? 0.4450 0.3638 0.3805 -0.0187 -0.0195 -0.0205 183 TYR A CD1   
1356 C CD2   . TYR A 184 ? 0.4042 0.3596 0.3767 -0.0169 -0.0207 -0.0130 183 TYR A CD2   
1357 C CE1   . TYR A 184 ? 0.4810 0.3890 0.3993 -0.0227 -0.0280 -0.0187 183 TYR A CE1   
1358 C CE2   . TYR A 184 ? 0.4361 0.3834 0.3955 -0.0203 -0.0285 -0.0107 183 TYR A CE2   
1359 C CZ    . TYR A 184 ? 0.4589 0.3823 0.3906 -0.0235 -0.0331 -0.0135 183 TYR A CZ    
1360 O OH    . TYR A 184 ? 0.4812 0.3933 0.3962 -0.0271 -0.0434 -0.0109 183 TYR A OH    
1361 N N     . MET A 185 ? 0.6053 0.5359 0.5692 -0.0240 -0.0292 -0.0181 184 MET A N     
1362 C CA    . MET A 185 ? 0.6406 0.5641 0.6042 -0.0305 -0.0380 -0.0169 184 MET A CA    
1363 C C     . MET A 185 ? 0.6423 0.5593 0.6061 -0.0277 -0.0325 -0.0194 184 MET A C     
1364 O O     . MET A 185 ? 0.6603 0.5880 0.6407 -0.0283 -0.0328 -0.0157 184 MET A O     
1365 C CB    . MET A 185 ? 0.7083 0.6092 0.6472 -0.0369 -0.0479 -0.0192 184 MET A CB    
1366 C CG    . MET A 185 ? 0.7941 0.6905 0.7377 -0.0463 -0.0616 -0.0163 184 MET A CG    
1367 S SD    . MET A 185 ? 0.8807 0.7827 0.8297 -0.0540 -0.0787 -0.0104 184 MET A SD    
1368 C CE    . MET A 185 ? 0.8842 0.7720 0.8034 -0.0485 -0.0737 -0.0146 184 MET A CE    
1369 N N     . ASP A 186 ? 0.6452 0.5447 0.5916 -0.0235 -0.0256 -0.0249 185 ASP A N     
1370 C CA    . ASP A 186 ? 0.6753 0.5694 0.6242 -0.0189 -0.0194 -0.0267 185 ASP A CA    
1371 C C     . ASP A 186 ? 0.6525 0.5515 0.6074 -0.0093 -0.0076 -0.0288 185 ASP A C     
1372 O O     . ASP A 186 ? 0.6233 0.5215 0.5853 -0.0042 -0.0034 -0.0291 185 ASP A O     
1373 C CB    . ASP A 186 ? 0.7283 0.5944 0.6545 -0.0223 -0.0217 -0.0307 185 ASP A CB    
1374 C CG    . ASP A 186 ? 0.8126 0.6559 0.7112 -0.0204 -0.0166 -0.0361 185 ASP A CG    
1375 O OD1   . ASP A 186 ? 0.8132 0.6628 0.7103 -0.0182 -0.0131 -0.0359 185 ASP A OD1   
1376 O OD2   . ASP A 186 ? 0.8538 0.6699 0.7297 -0.0209 -0.0151 -0.0405 185 ASP A OD2   
1377 N N     . ASP A 187 ? 0.6182 0.5218 0.5721 -0.0068 -0.0026 -0.0297 186 ASP A N     
1378 C CA    . ASP A 187 ? 0.6401 0.5528 0.6074 0.0012  0.0077  -0.0304 186 ASP A CA    
1379 C C     . ASP A 187 ? 0.5499 0.4861 0.5410 0.0027  0.0044  -0.0267 186 ASP A C     
1380 O O     . ASP A 187 ? 0.5248 0.4721 0.5202 -0.0012 -0.0011 -0.0238 186 ASP A O     
1381 C CB    . ASP A 187 ? 0.7663 0.6738 0.7235 0.0024  0.0150  -0.0319 186 ASP A CB    
1382 C CG    . ASP A 187 ? 0.9047 0.8156 0.8749 0.0103  0.0284  -0.0329 186 ASP A CG    
1383 O OD1   . ASP A 187 ? 0.9052 0.8365 0.9001 0.0128  0.0282  -0.0306 186 ASP A OD1   
1384 O OD2   . ASP A 187 ? 1.0084 0.9000 0.9642 0.0141  0.0392  -0.0358 186 ASP A OD2   
1385 N N     . LEU A 188 ? 0.4916 0.4333 0.4970 0.0087  0.0075  -0.0265 187 LEU A N     
1386 C CA    . LEU A 188 ? 0.4634 0.4218 0.4862 0.0105  0.0034  -0.0236 187 LEU A CA    
1387 C C     . LEU A 188 ? 0.4873 0.4542 0.5269 0.0161  0.0086  -0.0242 187 LEU A C     
1388 O O     . LEU A 188 ? 0.5139 0.4760 0.5604 0.0214  0.0142  -0.0252 187 LEU A O     
1389 C CB    . LEU A 188 ? 0.4485 0.4044 0.4730 0.0117  -0.0017 -0.0216 187 LEU A CB    
1390 C CG    . LEU A 188 ? 0.4716 0.4192 0.4845 0.0059  -0.0060 -0.0199 187 LEU A CG    
1391 C CD1   . LEU A 188 ? 0.4353 0.3786 0.4497 0.0085  -0.0087 -0.0175 187 LEU A CD1   
1392 C CD2   . LEU A 188 ? 0.4714 0.4287 0.4855 0.0005  -0.0096 -0.0170 187 LEU A CD2   
1393 N N     . TYR A 189 ? 0.4339 0.4131 0.4821 0.0148  0.0072  -0.0232 188 TYR A N     
1394 C CA    . TYR A 189 ? 0.4064 0.3964 0.4754 0.0184  0.0084  -0.0228 188 TYR A CA    
1395 C C     . TYR A 189 ? 0.3892 0.3857 0.4650 0.0190  -0.0021 -0.0208 188 TYR A C     
1396 O O     . TYR A 189 ? 0.3896 0.3864 0.4551 0.0157  -0.0069 -0.0196 188 TYR A O     
1397 C CB    . TYR A 189 ? 0.4367 0.4325 0.5079 0.0159  0.0128  -0.0230 188 TYR A CB    
1398 C CG    . TYR A 189 ? 0.4037 0.4119 0.4967 0.0169  0.0110  -0.0221 188 TYR A CG    
1399 C CD1   . TYR A 189 ? 0.4531 0.4671 0.5476 0.0149  0.0011  -0.0211 188 TYR A CD1   
1400 C CD2   . TYR A 189 ? 0.4222 0.4344 0.5337 0.0194  0.0197  -0.0221 188 TYR A CD2   
1401 C CE1   . TYR A 189 ? 0.5012 0.5234 0.6132 0.0146  -0.0028 -0.0208 188 TYR A CE1   
1402 C CE2   . TYR A 189 ? 0.4692 0.4930 0.6039 0.0188  0.0165  -0.0209 188 TYR A CE2   
1403 C CZ    . TYR A 189 ? 0.4976 0.5258 0.6315 0.0160  0.0039  -0.0206 188 TYR A CZ    
1404 O OH    . TYR A 189 ? 0.5095 0.5462 0.6641 0.0144  -0.0015 -0.0199 188 TYR A OH    
1405 N N     . VAL A 190 ? 0.3351 0.3349 0.4274 0.0235  -0.0055 -0.0199 189 VAL A N     
1406 C CA    . VAL A 190 ? 0.3357 0.3363 0.4294 0.0246  -0.0173 -0.0179 189 VAL A CA    
1407 C C     . VAL A 190 ? 0.3611 0.3718 0.4781 0.0261  -0.0229 -0.0173 189 VAL A C     
1408 O O     . VAL A 190 ? 0.3730 0.3889 0.5124 0.0301  -0.0203 -0.0166 189 VAL A O     
1409 C CB    . VAL A 190 ? 0.3457 0.3372 0.4354 0.0286  -0.0205 -0.0164 189 VAL A CB    
1410 C CG1   . VAL A 190 ? 0.3515 0.3393 0.4353 0.0296  -0.0330 -0.0139 189 VAL A CG1   
1411 C CG2   . VAL A 190 ? 0.3509 0.3318 0.4210 0.0261  -0.0148 -0.0171 189 VAL A CG2   
1412 N N     . GLY A 191 ? 0.3542 0.3668 0.4670 0.0229  -0.0305 -0.0174 190 GLY A N     
1413 C CA    . GLY A 191 ? 0.3364 0.3567 0.4698 0.0224  -0.0386 -0.0170 190 GLY A CA    
1414 C C     . GLY A 191 ? 0.3910 0.4035 0.5145 0.0226  -0.0549 -0.0159 190 GLY A C     
1415 O O     . GLY A 191 ? 0.4410 0.4419 0.5371 0.0216  -0.0567 -0.0159 190 GLY A O     
1416 N N     . SER A 192 ? 0.3842 0.4017 0.5303 0.0239  -0.0667 -0.0145 191 SER A N     
1417 C CA    . SER A 192 ? 0.3901 0.3968 0.5247 0.0239  -0.0852 -0.0134 191 SER A CA    
1418 C C     . SER A 192 ? 0.4033 0.4182 0.5654 0.0214  -0.0987 -0.0129 191 SER A C     
1419 O O     . SER A 192 ? 0.4168 0.4482 0.6142 0.0211  -0.0929 -0.0120 191 SER A O     
1420 C CB    . SER A 192 ? 0.4109 0.4097 0.5405 0.0297  -0.0918 -0.0103 191 SER A CB    
1421 O OG    . SER A 192 ? 0.3718 0.3827 0.5380 0.0336  -0.0967 -0.0076 191 SER A OG    
1422 N N     . ASP A 193 ? 0.4320 0.4330 0.5768 0.0192  -0.1169 -0.0131 192 ASP A N     
1423 C CA    . ASP A 193 ? 0.4952 0.4999 0.6631 0.0157  -0.1355 -0.0124 192 ASP A CA    
1424 C C     . ASP A 193 ? 0.4841 0.4869 0.6657 0.0198  -0.1549 -0.0082 192 ASP A C     
1425 O O     . ASP A 193 ? 0.5110 0.5084 0.6989 0.0166  -0.1773 -0.0074 192 ASP A O     
1426 C CB    . ASP A 193 ? 0.5572 0.5436 0.6939 0.0100  -0.1452 -0.0159 192 ASP A CB    
1427 C CG    . ASP A 193 ? 0.6329 0.6207 0.7573 0.0068  -0.1268 -0.0193 192 ASP A CG    
1428 O OD1   . ASP A 193 ? 0.6297 0.6362 0.7827 0.0057  -0.1136 -0.0192 192 ASP A OD1   
1429 O OD2   . ASP A 193 ? 0.6694 0.6383 0.7551 0.0061  -0.1248 -0.0215 192 ASP A OD2   
1430 N N     . LEU A 194 ? 0.4672 0.4724 0.6524 0.0267  -0.1482 -0.0053 193 LEU A N     
1431 C CA    . LEU A 194 ? 0.4624 0.4660 0.6622 0.0321  -0.1651 -0.0004 193 LEU A CA    
1432 C C     . LEU A 194 ? 0.4455 0.4746 0.7038 0.0349  -0.1626 0.0035  193 LEU A C     
1433 O O     . LEU A 194 ? 0.3834 0.4282 0.6635 0.0344  -0.1422 0.0022  193 LEU A O     
1434 C CB    . LEU A 194 ? 0.4427 0.4329 0.6147 0.0385  -0.1581 0.0012  193 LEU A CB    
1435 C CG    . LEU A 194 ? 0.4696 0.4372 0.5881 0.0364  -0.1524 -0.0018 193 LEU A CG    
1436 C CD1   . LEU A 194 ? 0.4380 0.3970 0.5381 0.0416  -0.1408 0.0001  193 LEU A CD1   
1437 C CD2   . LEU A 194 ? 0.5223 0.4664 0.6093 0.0342  -0.1742 -0.0016 193 LEU A CD2   
1438 N N     . GLU A 195 ? 0.5636 0.5955 0.8473 0.0382  -0.1834 0.0088  194 GLU A N     
1439 C CA    . GLU A 195 ? 0.5435 0.5991 0.8850 0.0434  -0.1784 0.0140  194 GLU A CA    
1440 C C     . GLU A 195 ? 0.4817 0.5375 0.8193 0.0519  -0.1556 0.0146  194 GLU A C     
1441 O O     . GLU A 195 ? 0.4805 0.5179 0.7744 0.0537  -0.1507 0.0124  194 GLU A O     
1442 C CB    . GLU A 195 ? 0.6736 0.7319 1.0448 0.0459  -0.2077 0.0206  194 GLU A CB    
1443 C CG    . GLU A 195 ? 0.7848 0.8707 1.2241 0.0441  -0.2121 0.0253  194 GLU A CG    
1444 C CD    . GLU A 195 ? 0.8698 0.9570 1.3122 0.0323  -0.2246 0.0222  194 GLU A CD    
1445 O OE1   . GLU A 195 ? 0.9179 0.9876 1.3361 0.0273  -0.2531 0.0214  194 GLU A OE1   
1446 O OE2   . GLU A 195 ? 0.8760 0.9787 1.3419 0.0281  -0.2058 0.0204  194 GLU A OE2   
1447 N N     . ILE A 196 ? 0.4524 0.5276 0.8367 0.0570  -0.1407 0.0179  195 ILE A N     
1448 C CA    . ILE A 196 ? 0.4362 0.5093 0.8138 0.0636  -0.1145 0.0168  195 ILE A CA    
1449 C C     . ILE A 196 ? 0.4362 0.4926 0.7896 0.0709  -0.1198 0.0188  195 ILE A C     
1450 O O     . ILE A 196 ? 0.3894 0.4329 0.7106 0.0726  -0.1036 0.0155  195 ILE A O     
1451 C CB    . ILE A 196 ? 0.4309 0.5244 0.8630 0.0689  -0.0969 0.0206  195 ILE A CB    
1452 C CG1   . ILE A 196 ? 0.4699 0.5554 0.8860 0.0747  -0.0679 0.0179  195 ILE A CG1   
1453 C CG2   . ILE A 196 ? 0.4169 0.5229 0.8986 0.0760  -0.1127 0.0291  195 ILE A CG2   
1454 C CD1   . ILE A 196 ? 0.4766 0.5504 0.8467 0.0677  -0.0544 0.0105  195 ILE A CD1   
1455 N N     . GLY A 197 ? 0.4058 0.4604 0.7727 0.0748  -0.1436 0.0246  196 GLY A N     
1456 C CA    . GLY A 197 ? 0.4767 0.5136 0.8200 0.0821  -0.1487 0.0273  196 GLY A CA    
1457 C C     . GLY A 197 ? 0.5236 0.5357 0.8047 0.0774  -0.1513 0.0230  196 GLY A C     
1458 O O     . GLY A 197 ? 0.5976 0.5960 0.8511 0.0803  -0.1378 0.0216  196 GLY A O     
1459 N N     . GLN A 198 ? 0.5012 0.5058 0.7599 0.0699  -0.1681 0.0211  197 GLN A N     
1460 C CA    . GLN A 198 ? 0.5400 0.5211 0.7414 0.0656  -0.1672 0.0174  197 GLN A CA    
1461 C C     . GLN A 198 ? 0.5452 0.5286 0.7302 0.0618  -0.1409 0.0116  197 GLN A C     
1462 O O     . GLN A 198 ? 0.5758 0.5430 0.7238 0.0614  -0.1323 0.0102  197 GLN A O     
1463 C CB    . GLN A 198 ? 0.5934 0.5646 0.7748 0.0587  -0.1873 0.0158  197 GLN A CB    
1464 C CG    . GLN A 198 ? 0.6777 0.6182 0.8100 0.0597  -0.2026 0.0176  197 GLN A CG    
1465 C CD    . GLN A 198 ? 0.7407 0.6657 0.8439 0.0527  -0.2185 0.0147  197 GLN A CD    
1466 O OE1   . GLN A 198 ? 0.7684 0.6970 0.8915 0.0502  -0.2409 0.0161  197 GLN A OE1   
1467 N NE2   . GLN A 198 ? 0.7353 0.6418 0.7921 0.0493  -0.2069 0.0108  197 GLN A NE2   
1468 N N     . HIS A 199 ? 0.5018 0.5046 0.7150 0.0589  -0.1284 0.0089  198 HIS A N     
1469 C CA    . HIS A 199 ? 0.4917 0.4956 0.6899 0.0556  -0.1054 0.0041  198 HIS A CA    
1470 C C     . HIS A 199 ? 0.4876 0.4854 0.6806 0.0613  -0.0904 0.0045  198 HIS A C     
1471 O O     . HIS A 199 ? 0.5012 0.4878 0.6632 0.0586  -0.0798 0.0017  198 HIS A O     
1472 C CB    . HIS A 199 ? 0.3776 0.4008 0.6062 0.0523  -0.0952 0.0020  198 HIS A CB    
1473 C CG    . HIS A 199 ? 0.3651 0.3882 0.5794 0.0497  -0.0729 -0.0023 198 HIS A CG    
1474 N ND1   . HIS A 199 ? 0.3609 0.3776 0.5445 0.0431  -0.0693 -0.0061 198 HIS A ND1   
1475 C CD2   . HIS A 199 ? 0.3594 0.3859 0.5845 0.0531  -0.0538 -0.0032 198 HIS A CD2   
1476 C CE1   . HIS A 199 ? 0.3864 0.4038 0.5640 0.0421  -0.0512 -0.0088 198 HIS A CE1   
1477 N NE2   . HIS A 199 ? 0.3528 0.3744 0.5523 0.0478  -0.0416 -0.0075 198 HIS A NE2   
1478 N N     . ARG A 200 ? 0.4993 0.5034 0.7237 0.0691  -0.0893 0.0083  199 ARG A N     
1479 C CA    . ARG A 200 ? 0.5254 0.5197 0.7426 0.0749  -0.0749 0.0084  199 ARG A CA    
1480 C C     . ARG A 200 ? 0.5255 0.4988 0.7075 0.0759  -0.0830 0.0101  199 ARG A C     
1481 O O     . ARG A 200 ? 0.5296 0.4900 0.6886 0.0756  -0.0708 0.0081  199 ARG A O     
1482 C CB    . ARG A 200 ? 0.5641 0.5684 0.8239 0.0845  -0.0711 0.0128  199 ARG A CB    
1483 C CG    . ARG A 200 ? 0.6278 0.6512 0.9239 0.0843  -0.0580 0.0120  199 ARG A CG    
1484 C CD    . ARG A 200 ? 0.7270 0.7545 1.0573 0.0949  -0.0439 0.0156  199 ARG A CD    
1485 N NE    . ARG A 200 ? 0.7808 0.8300 1.1598 0.0965  -0.0377 0.0185  199 ARG A NE    
1486 C CZ    . ARG A 200 ? 0.8248 0.8902 1.2518 0.1016  -0.0503 0.0257  199 ARG A CZ    
1487 N NH1   . ARG A 200 ? 0.8403 0.9009 1.2693 0.1063  -0.0712 0.0306  199 ARG A NH1   
1488 N NH2   . ARG A 200 ? 0.8278 0.9138 1.3020 0.1020  -0.0425 0.0287  199 ARG A NH2   
1489 N N     . THR A 201 ? 0.5618 0.5290 0.7375 0.0768  -0.1039 0.0140  200 THR A N     
1490 C CA    . THR A 201 ? 0.5913 0.5355 0.7286 0.0772  -0.1104 0.0160  200 THR A CA    
1491 C C     . THR A 201 ? 0.5706 0.5055 0.6710 0.0691  -0.1001 0.0117  200 THR A C     
1492 O O     . THR A 201 ? 0.5380 0.4582 0.6144 0.0687  -0.0916 0.0119  200 THR A O     
1493 C CB    . THR A 201 ? 0.6628 0.5989 0.7948 0.0791  -0.1355 0.0208  200 THR A CB    
1494 O OG1   . THR A 201 ? 0.6339 0.5713 0.7925 0.0884  -0.1451 0.0268  200 THR A OG1   
1495 C CG2   . THR A 201 ? 0.7703 0.6805 0.8526 0.0764  -0.1399 0.0216  200 THR A CG2   
1496 N N     . LYS A 202 ? 0.5103 0.4540 0.6088 0.0625  -0.1005 0.0082  201 LYS A N     
1497 C CA    . LYS A 202 ? 0.4899 0.4275 0.5595 0.0555  -0.0900 0.0049  201 LYS A CA    
1498 C C     . LYS A 202 ? 0.5131 0.4553 0.5858 0.0536  -0.0713 0.0018  201 LYS A C     
1499 O O     . LYS A 202 ? 0.5806 0.5133 0.6303 0.0496  -0.0632 0.0012  201 LYS A O     
1500 C CB    . LYS A 202 ? 0.4978 0.4435 0.5671 0.0499  -0.0940 0.0020  201 LYS A CB    
1501 C CG    . LYS A 202 ? 0.5704 0.5006 0.6159 0.0493  -0.1104 0.0039  201 LYS A CG    
1502 C CD    . LYS A 202 ? 0.5797 0.4881 0.5853 0.0484  -0.1047 0.0055  201 LYS A CD    
1503 C CE    . LYS A 202 ? 0.6232 0.5090 0.5989 0.0498  -0.1206 0.0082  201 LYS A CE    
1504 N NZ    . LYS A 202 ? 0.6893 0.5522 0.6263 0.0495  -0.1116 0.0107  201 LYS A NZ    
1505 N N     . ILE A 203 ? 0.4444 0.3996 0.5451 0.0563  -0.0641 0.0002  202 ILE A N     
1506 C CA    . ILE A 203 ? 0.4337 0.3880 0.5321 0.0547  -0.0474 -0.0032 202 ILE A CA    
1507 C C     . ILE A 203 ? 0.4509 0.3880 0.5346 0.0577  -0.0440 -0.0016 202 ILE A C     
1508 O O     . ILE A 203 ? 0.4177 0.3461 0.4834 0.0530  -0.0351 -0.0038 202 ILE A O     
1509 C CB    . ILE A 203 ? 0.4750 0.4425 0.6032 0.0581  -0.0386 -0.0048 202 ILE A CB    
1510 C CG1   . ILE A 203 ? 0.5060 0.4887 0.6455 0.0532  -0.0391 -0.0067 202 ILE A CG1   
1511 C CG2   . ILE A 203 ? 0.4743 0.4332 0.5935 0.0580  -0.0221 -0.0081 202 ILE A CG2   
1512 C CD1   . ILE A 203 ? 0.4779 0.4584 0.5937 0.0454  -0.0331 -0.0101 202 ILE A CD1   
1513 N N     . GLU A 204 ? 0.4296 0.3609 0.5218 0.0652  -0.0520 0.0027  203 GLU A N     
1514 C CA    . GLU A 204 ? 0.4974 0.4098 0.5741 0.0682  -0.0493 0.0048  203 GLU A CA    
1515 C C     . GLU A 204 ? 0.5226 0.4212 0.5675 0.0623  -0.0520 0.0063  203 GLU A C     
1516 O O     . GLU A 204 ? 0.5403 0.4256 0.5691 0.0594  -0.0443 0.0059  203 GLU A O     
1517 C CB    . GLU A 204 ? 0.5505 0.4594 0.6436 0.0783  -0.0588 0.0101  203 GLU A CB    
1518 C CG    . GLU A 204 ? 0.6429 0.5595 0.7668 0.0858  -0.0495 0.0095  203 GLU A CG    
1519 C CD    . GLU A 204 ? 0.7073 0.6121 0.8183 0.0843  -0.0313 0.0049  203 GLU A CD    
1520 O OE1   . GLU A 204 ? 0.7282 0.6140 0.8137 0.0820  -0.0296 0.0049  203 GLU A OE1   
1521 O OE2   . GLU A 204 ? 0.7079 0.6205 0.8328 0.0849  -0.0189 0.0012  203 GLU A OE2   
1522 N N     . GLU A 205 ? 0.5388 0.4386 0.5742 0.0603  -0.0623 0.0082  204 GLU A N     
1523 C CA    . GLU A 205 ? 0.5626 0.4489 0.5682 0.0551  -0.0612 0.0101  204 GLU A CA    
1524 C C     . GLU A 205 ? 0.6006 0.4921 0.6013 0.0468  -0.0483 0.0065  204 GLU A C     
1525 O O     . GLU A 205 ? 0.5659 0.4457 0.5512 0.0429  -0.0420 0.0082  204 GLU A O     
1526 C CB    . GLU A 205 ? 0.6478 0.5324 0.6418 0.0547  -0.0726 0.0118  204 GLU A CB    
1527 C CG    . GLU A 205 ? 0.7243 0.5909 0.6853 0.0513  -0.0698 0.0148  204 GLU A CG    
1528 C CD    . GLU A 205 ? 0.7803 0.6421 0.7255 0.0508  -0.0790 0.0152  204 GLU A CD    
1529 O OE1   . GLU A 205 ? 0.7725 0.6328 0.7034 0.0460  -0.0708 0.0143  204 GLU A OE1   
1530 O OE2   . GLU A 205 ? 0.7938 0.6523 0.7414 0.0554  -0.0950 0.0164  204 GLU A OE2   
1531 N N     . LEU A 206 ? 0.5955 0.5039 0.6105 0.0439  -0.0449 0.0022  205 LEU A N     
1532 C CA    . LEU A 206 ? 0.5549 0.4683 0.5662 0.0363  -0.0352 -0.0007 205 LEU A CA    
1533 C C     . LEU A 206 ? 0.5415 0.4469 0.5519 0.0348  -0.0276 -0.0025 205 LEU A C     
1534 O O     . LEU A 206 ? 0.5558 0.4563 0.5563 0.0281  -0.0229 -0.0024 205 LEU A O     
1535 C CB    . LEU A 206 ? 0.4869 0.4177 0.5125 0.0345  -0.0338 -0.0046 205 LEU A CB    
1536 C CG    . LEU A 206 ? 0.4647 0.4011 0.4880 0.0276  -0.0256 -0.0074 205 LEU A CG    
1537 C CD1   . LEU A 206 ? 0.3928 0.3266 0.4026 0.0222  -0.0245 -0.0046 205 LEU A CD1   
1538 C CD2   . LEU A 206 ? 0.4747 0.4256 0.5115 0.0271  -0.0237 -0.0107 205 LEU A CD2   
1539 N N     . ARG A 207 ? 0.5329 0.4357 0.5542 0.0410  -0.0264 -0.0038 206 ARG A N     
1540 C CA    . ARG A 207 ? 0.5405 0.4304 0.5563 0.0402  -0.0189 -0.0061 206 ARG A CA    
1541 C C     . ARG A 207 ? 0.5981 0.4699 0.5981 0.0386  -0.0200 -0.0025 206 ARG A C     
1542 O O     . ARG A 207 ? 0.6282 0.4894 0.6176 0.0322  -0.0155 -0.0040 206 ARG A O     
1543 C CB    . ARG A 207 ? 0.5260 0.4150 0.5570 0.0489  -0.0149 -0.0078 206 ARG A CB    
1544 C CG    . ARG A 207 ? 0.4852 0.3896 0.5320 0.0497  -0.0099 -0.0112 206 ARG A CG    
1545 C CD    . ARG A 207 ? 0.4576 0.3595 0.5212 0.0588  -0.0020 -0.0121 206 ARG A CD    
1546 N NE    . ARG A 207 ? 0.4997 0.3803 0.5469 0.0591  0.0079  -0.0153 206 ARG A NE    
1547 C CZ    . ARG A 207 ? 0.5595 0.4245 0.6060 0.0659  0.0102  -0.0137 206 ARG A CZ    
1548 N NH1   . ARG A 207 ? 0.5245 0.3943 0.5872 0.0733  0.0023  -0.0082 206 ARG A NH1   
1549 N NH2   . ARG A 207 ? 0.5939 0.4362 0.6219 0.0653  0.0194  -0.0175 206 ARG A NH2   
1550 N N     . GLN A 208 ? 0.6089 0.4751 0.6061 0.0440  -0.0267 0.0025  207 GLN A N     
1551 C CA    . GLN A 208 ? 0.6198 0.4669 0.6002 0.0426  -0.0267 0.0069  207 GLN A CA    
1552 C C     . GLN A 208 ? 0.6306 0.4778 0.5994 0.0331  -0.0237 0.0088  207 GLN A C     
1553 O O     . GLN A 208 ? 0.6287 0.4628 0.5883 0.0277  -0.0194 0.0109  207 GLN A O     
1554 C CB    . GLN A 208 ? 0.6694 0.5082 0.6460 0.0509  -0.0355 0.0125  207 GLN A CB    
1555 C CG    . GLN A 208 ? 0.7727 0.6111 0.7657 0.0612  -0.0388 0.0125  207 GLN A CG    
1556 C CD    . GLN A 208 ? 0.8727 0.6966 0.8645 0.0624  -0.0300 0.0105  207 GLN A CD    
1557 O OE1   . GLN A 208 ? 0.8614 0.6656 0.8375 0.0613  -0.0285 0.0135  207 GLN A OE1   
1558 N NE2   . GLN A 208 ? 0.9342 0.7651 0.9407 0.0646  -0.0231 0.0054  207 GLN A NE2   
1559 N N     . HIS A 209 ? 0.6009 0.4624 0.5720 0.0310  -0.0252 0.0086  208 HIS A N     
1560 C CA    . HIS A 209 ? 0.5483 0.4122 0.5132 0.0230  -0.0204 0.0109  208 HIS A CA    
1561 C C     . HIS A 209 ? 0.5527 0.4204 0.5243 0.0146  -0.0155 0.0079  208 HIS A C     
1562 O O     . HIS A 209 ? 0.5701 0.4313 0.5385 0.0077  -0.0117 0.0111  208 HIS A O     
1563 C CB    . HIS A 209 ? 0.5240 0.4014 0.4905 0.0235  -0.0223 0.0105  208 HIS A CB    
1564 C CG    . HIS A 209 ? 0.5752 0.4572 0.5397 0.0166  -0.0155 0.0130  208 HIS A CG    
1565 N ND1   . HIS A 209 ? 0.5876 0.4585 0.5380 0.0163  -0.0110 0.0189  208 HIS A ND1   
1566 C CD2   . HIS A 209 ? 0.5652 0.4609 0.5410 0.0103  -0.0120 0.0110  208 HIS A CD2   
1567 C CE1   . HIS A 209 ? 0.5669 0.4465 0.5239 0.0104  -0.0037 0.0208  208 HIS A CE1   
1568 N NE2   . HIS A 209 ? 0.5726 0.4680 0.5458 0.0066  -0.0055 0.0161  208 HIS A NE2   
1569 N N     . LEU A 210 ? 0.5498 0.4265 0.5302 0.0149  -0.0160 0.0020  209 LEU A N     
1570 C CA    . LEU A 210 ? 0.4936 0.3697 0.4751 0.0070  -0.0138 -0.0012 209 LEU A CA    
1571 C C     . LEU A 210 ? 0.5148 0.3707 0.4881 0.0045  -0.0127 -0.0014 209 LEU A C     
1572 O O     . LEU A 210 ? 0.5255 0.3759 0.4970 -0.0048 -0.0129 -0.0006 209 LEU A O     
1573 C CB    . LEU A 210 ? 0.4917 0.3764 0.4788 0.0089  -0.0132 -0.0072 209 LEU A CB    
1574 C CG    . LEU A 210 ? 0.4902 0.3941 0.4858 0.0094  -0.0140 -0.0076 209 LEU A CG    
1575 C CD1   . LEU A 210 ? 0.4792 0.3882 0.4798 0.0123  -0.0116 -0.0129 209 LEU A CD1   
1576 C CD2   . LEU A 210 ? 0.4505 0.3621 0.4474 0.0010  -0.0141 -0.0053 209 LEU A CD2   
1577 N N     . LEU A 211 ? 0.5590 0.4029 0.5287 0.0125  -0.0124 -0.0019 210 LEU A N     
1578 C CA    . LEU A 211 ? 0.5647 0.3862 0.5247 0.0112  -0.0107 -0.0023 210 LEU A CA    
1579 C C     . LEU A 211 ? 0.5636 0.3755 0.5181 0.0052  -0.0106 0.0040  210 LEU A C     
1580 O O     . LEU A 211 ? 0.5254 0.3231 0.4748 -0.0027 -0.0100 0.0038  210 LEU A O     
1581 C CB    . LEU A 211 ? 0.5739 0.3859 0.5341 0.0229  -0.0097 -0.0028 210 LEU A CB    
1582 C CG    . LEU A 211 ? 0.5919 0.3780 0.5414 0.0240  -0.0068 -0.0037 210 LEU A CG    
1583 C CD1   . LEU A 211 ? 0.5467 0.3219 0.4880 0.0189  -0.0032 -0.0109 210 LEU A CD1   
1584 C CD2   . LEU A 211 ? 0.6066 0.3872 0.5614 0.0374  -0.0064 -0.0019 210 LEU A CD2   
1585 N N     . ARG A 212 ? 0.5501 0.3676 0.5045 0.0083  -0.0108 0.0099  211 ARG A N     
1586 C CA    . ARG A 212 ? 0.5911 0.4002 0.5406 0.0025  -0.0075 0.0168  211 ARG A CA    
1587 C C     . ARG A 212 ? 0.6033 0.4208 0.5627 -0.0097 -0.0057 0.0173  211 ARG A C     
1588 O O     . ARG A 212 ? 0.5965 0.4035 0.5565 -0.0174 -0.0029 0.0217  211 ARG A O     
1589 C CB    . ARG A 212 ? 0.6161 0.4287 0.5596 0.0083  -0.0068 0.0223  211 ARG A CB    
1590 C CG    . ARG A 212 ? 0.6567 0.4593 0.5931 0.0036  0.0002  0.0304  211 ARG A CG    
1591 C CD    . ARG A 212 ? 0.7061 0.5256 0.6533 -0.0029 0.0053  0.0324  211 ARG A CD    
1592 N NE    . ARG A 212 ? 0.7875 0.5975 0.7310 -0.0068 0.0153  0.0411  211 ARG A NE    
1593 C CZ    . ARG A 212 ? 0.8309 0.6355 0.7844 -0.0161 0.0203  0.0451  211 ARG A CZ    
1594 N NH1   . ARG A 212 ? 0.8537 0.6589 0.8174 -0.0228 0.0142  0.0404  211 ARG A NH1   
1595 N NH2   . ARG A 212 ? 0.8555 0.6521 0.8079 -0.0190 0.0317  0.0541  211 ARG A NH2   
1596 N N     . TRP A 213 ? 0.6047 0.4407 0.5735 -0.0120 -0.0079 0.0134  212 TRP A N     
1597 C CA    . TRP A 213 ? 0.5866 0.4319 0.5672 -0.0230 -0.0089 0.0141  212 TRP A CA    
1598 C C     . TRP A 213 ? 0.6029 0.4408 0.5808 -0.0286 -0.0148 0.0074  212 TRP A C     
1599 O O     . TRP A 213 ? 0.6352 0.4830 0.6210 -0.0358 -0.0191 0.0060  212 TRP A O     
1600 C CB    . TRP A 213 ? 0.5678 0.4353 0.5586 -0.0221 -0.0080 0.0149  212 TRP A CB    
1601 C CG    . TRP A 213 ? 0.5665 0.4370 0.5574 -0.0192 -0.0011 0.0221  212 TRP A CG    
1602 C CD1   . TRP A 213 ? 0.5664 0.4395 0.5485 -0.0102 0.0004  0.0223  212 TRP A CD1   
1603 C CD2   . TRP A 213 ? 0.5597 0.4276 0.5579 -0.0251 0.0061  0.0302  212 TRP A CD2   
1604 N NE1   . TRP A 213 ? 0.5909 0.4600 0.5691 -0.0098 0.0084  0.0296  212 TRP A NE1   
1605 C CE2   . TRP A 213 ? 0.5493 0.4161 0.5387 -0.0184 0.0135  0.0349  212 TRP A CE2   
1606 C CE3   . TRP A 213 ? 0.5379 0.4034 0.5501 -0.0358 0.0069  0.0344  212 TRP A CE3   
1607 C CZ2   . TRP A 213 ? 0.5096 0.3718 0.5020 -0.0210 0.0248  0.0438  212 TRP A CZ2   
1608 C CZ3   . TRP A 213 ? 0.5398 0.4045 0.5611 -0.0391 0.0172  0.0437  212 TRP A CZ3   
1609 C CH2   . TRP A 213 ? 0.5416 0.4043 0.5524 -0.0312 0.0275  0.0485  212 TRP A CH2   
1610 N N     . GLY A 214 ? 0.5680 0.3864 0.5327 -0.0248 -0.0150 0.0033  213 GLY A N     
1611 C CA    . GLY A 214 ? 0.5692 0.3719 0.5243 -0.0304 -0.0192 -0.0030 213 GLY A CA    
1612 C C     . GLY A 214 ? 0.5713 0.3787 0.5210 -0.0272 -0.0206 -0.0101 213 GLY A C     
1613 O O     . GLY A 214 ? 0.6115 0.4036 0.5488 -0.0329 -0.0245 -0.0154 213 GLY A O     
1614 N N     . LEU A 215 ? 0.5403 0.3656 0.4967 -0.0186 -0.0174 -0.0105 214 LEU A N     
1615 C CA    . LEU A 215 ? 0.5057 0.3363 0.4587 -0.0155 -0.0167 -0.0162 214 LEU A CA    
1616 C C     . LEU A 215 ? 0.5432 0.3679 0.4934 -0.0033 -0.0101 -0.0193 214 LEU A C     
1617 O O     . LEU A 215 ? 0.5813 0.4183 0.5426 0.0046  -0.0085 -0.0162 214 LEU A O     
1618 C CB    . LEU A 215 ? 0.4840 0.3401 0.4504 -0.0160 -0.0179 -0.0139 214 LEU A CB    
1619 C CG    . LEU A 215 ? 0.5098 0.3749 0.4844 -0.0269 -0.0236 -0.0101 214 LEU A CG    
1620 C CD1   . LEU A 215 ? 0.4624 0.3512 0.4499 -0.0251 -0.0228 -0.0077 214 LEU A CD1   
1621 C CD2   . LEU A 215 ? 0.4984 0.3495 0.4616 -0.0355 -0.0305 -0.0143 214 LEU A CD2   
1622 N N     . THR A 216 ? 0.5644 0.3686 0.4996 -0.0016 -0.0065 -0.0250 215 THR A N     
1623 C CA    . THR A 216 ? 0.5821 0.3808 0.5184 0.0106  0.0019  -0.0274 215 THR A CA    
1624 C C     . THR A 216 ? 0.6276 0.4428 0.5724 0.0152  0.0064  -0.0295 215 THR A C     
1625 O O     . THR A 216 ? 0.6610 0.4819 0.6008 0.0087  0.0039  -0.0314 215 THR A O     
1626 C CB    . THR A 216 ? 0.6113 0.3779 0.5262 0.0116  0.0072  -0.0327 215 THR A CB    
1627 O OG1   . THR A 216 ? 0.6192 0.3746 0.5154 0.0049  0.0066  -0.0382 215 THR A OG1   
1628 C CG2   . THR A 216 ? 0.5755 0.3235 0.4815 0.0059  0.0026  -0.0307 215 THR A CG2   
1629 N N     . THR A 217 ? 0.6001 0.4229 0.5598 0.0264  0.0124  -0.0286 216 THR A N     
1630 C CA    . THR A 217 ? 0.5518 0.3889 0.5234 0.0315  0.0186  -0.0301 216 THR A CA    
1631 C C     . THR A 217 ? 0.5468 0.3699 0.5202 0.0421  0.0310  -0.0323 216 THR A C     
1632 O O     . THR A 217 ? 0.5349 0.3671 0.5302 0.0516  0.0328  -0.0288 216 THR A O     
1633 C CB    . THR A 217 ? 0.5150 0.3795 0.5106 0.0342  0.0130  -0.0255 216 THR A CB    
1634 O OG1   . THR A 217 ? 0.5239 0.3881 0.5281 0.0395  0.0083  -0.0211 216 THR A OG1   
1635 C CG2   . THR A 217 ? 0.4484 0.3256 0.4409 0.0247  0.0051  -0.0240 216 THR A CG2   
1636 N N     . PRO A 218 ? 0.5357 0.3348 0.4858 0.0412  0.0397  -0.0376 217 PRO A N     
1637 C CA    . PRO A 218 ? 0.6197 0.4004 0.5684 0.0522  0.0547  -0.0397 217 PRO A CA    
1638 C C     . PRO A 218 ? 0.6254 0.4251 0.6016 0.0615  0.0653  -0.0377 217 PRO A C     
1639 O O     . PRO A 218 ? 0.5965 0.4125 0.5787 0.0580  0.0651  -0.0377 217 PRO A O     
1640 C CB    . PRO A 218 ? 0.5935 0.3408 0.5032 0.0470  0.0605  -0.0465 217 PRO A CB    
1641 C CG    . PRO A 218 ? 0.5985 0.3561 0.4986 0.0353  0.0501  -0.0473 217 PRO A CG    
1642 C CD    . PRO A 218 ? 0.5482 0.3335 0.4706 0.0303  0.0358  -0.0418 217 PRO A CD    
1643 N N     . ASP A 219 ? 0.6277 0.4249 0.6230 0.0737  0.0748  -0.0353 218 ASP A N     
1644 C CA    . ASP A 219 ? 0.6028 0.4211 0.6338 0.0830  0.0839  -0.0317 218 ASP A CA    
1645 C C     . ASP A 219 ? 0.6490 0.4586 0.6698 0.0840  0.1013  -0.0353 218 ASP A C     
1646 O O     . ASP A 219 ? 0.6271 0.4588 0.6750 0.0864  0.1060  -0.0325 218 ASP A O     
1647 C CB    . ASP A 219 ? 0.6211 0.4363 0.6762 0.0963  0.0908  -0.0276 218 ASP A CB    
1648 C CG    . ASP A 219 ? 0.6418 0.4860 0.7449 0.1047  0.0937  -0.0216 218 ASP A CG    
1649 O OD1   . ASP A 219 ? 0.6649 0.5352 0.7895 0.1012  0.0769  -0.0176 218 ASP A OD1   
1650 O OD2   . ASP A 219 ? 0.6036 0.4432 0.7231 0.1148  0.1130  -0.0207 218 ASP A OD2   
1651 N N     . LYS A 220 ? 0.6837 0.4588 0.6638 0.0819  0.1106  -0.0413 219 LYS A N     
1652 C CA    . LYS A 220 ? 0.6800 0.4397 0.6422 0.0835  0.1283  -0.0447 219 LYS A CA    
1653 C C     . LYS A 220 ? 0.7118 0.4911 0.6747 0.0746  0.1211  -0.0444 219 LYS A C     
1654 O O     . LYS A 220 ? 0.7670 0.5447 0.7303 0.0776  0.1362  -0.0446 219 LYS A O     
1655 C CB    . LYS A 220 ? 0.6548 0.3686 0.5642 0.0808  0.1349  -0.0518 219 LYS A CB    
1656 N N     . LYS A 221 ? 0.7023 0.4988 0.6657 0.0643  0.1000  -0.0435 220 LYS A N     
1657 C CA    . LYS A 221 ? 0.7007 0.5174 0.6681 0.0567  0.0924  -0.0425 220 LYS A CA    
1658 C C     . LYS A 221 ? 0.6479 0.5011 0.6544 0.0564  0.0804  -0.0371 220 LYS A C     
1659 O O     . LYS A 221 ? 0.6164 0.4854 0.6238 0.0486  0.0690  -0.0362 220 LYS A O     
1660 C CB    . LYS A 221 ? 0.7571 0.5603 0.6894 0.0446  0.0788  -0.0458 220 LYS A CB    
1661 C CG    . LYS A 221 ? 0.8845 0.6490 0.7724 0.0430  0.0875  -0.0515 220 LYS A CG    
1662 C CD    . LYS A 221 ? 0.9557 0.7124 0.8157 0.0302  0.0711  -0.0535 220 LYS A CD    
1663 C CE    . LYS A 221 ? 1.0348 0.7492 0.8459 0.0279  0.0767  -0.0593 220 LYS A CE    
1664 N NZ    . LYS A 221 ? 1.0713 0.7801 0.8592 0.0153  0.0580  -0.0601 220 LYS A NZ    
1665 N N     . HIS A 222 ? 0.6420 0.5067 0.6798 0.0650  0.0821  -0.0334 221 HIS A N     
1666 C CA    . HIS A 222 ? 0.5667 0.4616 0.6391 0.0653  0.0694  -0.0283 221 HIS A CA    
1667 C C     . HIS A 222 ? 0.5337 0.4460 0.6399 0.0711  0.0800  -0.0254 221 HIS A C     
1668 O O     . HIS A 222 ? 0.5256 0.4387 0.6567 0.0809  0.0906  -0.0227 221 HIS A O     
1669 C CB    . HIS A 222 ? 0.5454 0.4403 0.6296 0.0705  0.0610  -0.0252 221 HIS A CB    
1670 C CG    . HIS A 222 ? 0.5581 0.4780 0.6695 0.0703  0.0451  -0.0202 221 HIS A CG    
1671 N ND1   . HIS A 222 ? 0.5738 0.4934 0.6921 0.0739  0.0340  -0.0166 221 HIS A ND1   
1672 C CD2   . HIS A 222 ? 0.5586 0.5006 0.6884 0.0669  0.0380  -0.0184 221 HIS A CD2   
1673 C CE1   . HIS A 222 ? 0.5563 0.4954 0.6935 0.0727  0.0200  -0.0129 221 HIS A CE1   
1674 N NE2   . HIS A 222 ? 0.5421 0.4951 0.6871 0.0683  0.0221  -0.0142 221 HIS A NE2   
1675 N N     . GLN A 223 ? 0.5191 0.4451 0.6283 0.0650  0.0778  -0.0255 222 GLN A N     
1676 C CA    . GLN A 223 ? 0.5348 0.4772 0.6766 0.0685  0.0878  -0.0225 222 GLN A CA    
1677 C C     . GLN A 223 ? 0.5443 0.5138 0.7249 0.0691  0.0723  -0.0176 222 GLN A C     
1678 O O     . GLN A 223 ? 0.5455 0.5238 0.7194 0.0623  0.0547  -0.0177 222 GLN A O     
1679 C CB    . GLN A 223 ? 0.5214 0.4629 0.6465 0.0616  0.0927  -0.0245 222 GLN A CB    
1680 C CG    . GLN A 223 ? 0.4564 0.3682 0.5355 0.0592  0.1021  -0.0295 222 GLN A CG    
1681 C CD    . GLN A 223 ? 0.5080 0.4182 0.5712 0.0532  0.1062  -0.0305 222 GLN A CD    
1682 O OE1   . GLN A 223 ? 0.4925 0.4111 0.5756 0.0558  0.1186  -0.0280 222 GLN A OE1   
1683 N NE2   . GLN A 223 ? 0.4812 0.3809 0.5106 0.0453  0.0955  -0.0333 222 GLN A NE2   
1684 N N     . LYS A 224 ? 0.5802 0.5613 0.8014 0.0772  0.0788  -0.0131 223 LYS A N     
1685 C CA    . LYS A 224 ? 0.5550 0.5589 0.8141 0.0783  0.0615  -0.0080 223 LYS A CA    
1686 C C     . LYS A 224 ? 0.5473 0.5728 0.8499 0.0785  0.0655  -0.0039 223 LYS A C     
1687 O O     . LYS A 224 ? 0.5357 0.5798 0.8703 0.0779  0.0483  0.0002  223 LYS A O     
1688 C CB    . LYS A 224 ? 0.5570 0.5576 0.8329 0.0879  0.0588  -0.0044 223 LYS A CB    
1689 C CG    . LYS A 224 ? 0.6009 0.5785 0.8364 0.0878  0.0559  -0.0079 223 LYS A CG    
1690 C CD    . LYS A 224 ? 0.6331 0.6041 0.8849 0.0987  0.0576  -0.0042 223 LYS A CD    
1691 C CE    . LYS A 224 ? 0.6777 0.6215 0.8880 0.0985  0.0595  -0.0081 223 LYS A CE    
1692 N NZ    . LYS A 224 ? 0.7764 0.7108 1.0012 0.1100  0.0636  -0.0045 223 LYS A NZ    
1693 N N     . GLU A 225 ? 0.6202 0.6420 0.9241 0.0789  0.0870  -0.0046 224 GLU A N     
1694 C CA    . GLU A 225 ? 0.6735 0.7150 1.0211 0.0787  0.0938  -0.0001 224 GLU A CA    
1695 C C     . GLU A 225 ? 0.6564 0.6902 0.9820 0.0731  0.1088  -0.0029 224 GLU A C     
1696 O O     . GLU A 225 ? 0.6629 0.6729 0.9467 0.0736  0.1225  -0.0073 224 GLU A O     
1697 C CB    . GLU A 225 ? 0.7609 0.8077 1.1524 0.0901  0.1117  0.0057  224 GLU A CB    
1698 C CG    . GLU A 225 ? 0.8591 0.9234 1.2929 0.0952  0.0935  0.0116  224 GLU A CG    
1699 C CD    . GLU A 225 ? 0.9851 1.0606 1.4743 0.1062  0.1110  0.0191  224 GLU A CD    
1700 O OE1   . GLU A 225 ? 1.0378 1.1141 1.5462 0.1152  0.1064  0.0229  224 GLU A OE1   
1701 O OE2   . GLU A 225 ? 1.0281 1.1113 1.5429 0.1061  0.1303  0.0218  224 GLU A OE2   
1702 N N     . PRO A 226 ? 0.6462 0.6975 0.9978 0.0674  0.1056  -0.0004 225 PRO A N     
1703 C CA    . PRO A 226 ? 0.6123 0.6557 0.9443 0.0623  0.1202  -0.0022 225 PRO A CA    
1704 C C     . PRO A 226 ? 0.6047 0.6376 0.9464 0.0697  0.1516  0.0004  225 PRO A C     
1705 O O     . PRO A 226 ? 0.5799 0.6212 0.9621 0.0780  0.1617  0.0053  225 PRO A O     
1706 C CB    . PRO A 226 ? 0.5825 0.6485 0.9467 0.0546  0.1064  0.0006  225 PRO A CB    
1707 C CG    . PRO A 226 ? 0.5790 0.6654 0.9940 0.0583  0.0939  0.0058  225 PRO A CG    
1708 C CD    . PRO A 226 ? 0.6097 0.6866 1.0070 0.0645  0.0859  0.0041  225 PRO A CD    
1709 N N     . PRO A 227 ? 0.6162 0.6289 0.9210 0.0675  0.1684  -0.0023 226 PRO A N     
1710 C CA    . PRO A 227 ? 0.5764 0.5792 0.8363 0.0586  0.1574  -0.0070 226 PRO A CA    
1711 C C     . PRO A 227 ? 0.5793 0.5628 0.7908 0.0578  0.1466  -0.0128 226 PRO A C     
1712 O O     . PRO A 227 ? 0.6332 0.5950 0.8226 0.0638  0.1592  -0.0148 226 PRO A O     
1713 C CB    . PRO A 227 ? 0.5896 0.5749 0.8312 0.0588  0.1824  -0.0063 226 PRO A CB    
1714 C CG    . PRO A 227 ? 0.6280 0.5994 0.8778 0.0695  0.2084  -0.0042 226 PRO A CG    
1715 C CD    . PRO A 227 ? 0.6035 0.6005 0.9097 0.0746  0.2013  0.0002  226 PRO A CD    
1716 N N     . PHE A 228 ? 0.5081 0.4984 0.7043 0.0503  0.1240  -0.0152 227 PHE A N     
1717 C CA    . PHE A 228 ? 0.5126 0.4874 0.6682 0.0481  0.1129  -0.0197 227 PHE A CA    
1718 C C     . PHE A 228 ? 0.5505 0.5029 0.6611 0.0441  0.1195  -0.0227 227 PHE A C     
1719 O O     . PHE A 228 ? 0.5694 0.5259 0.6767 0.0393  0.1193  -0.0218 227 PHE A O     
1720 C CB    . PHE A 228 ? 0.4646 0.4551 0.6243 0.0425  0.0881  -0.0200 227 PHE A CB    
1721 C CG    . PHE A 228 ? 0.4654 0.4739 0.6627 0.0459  0.0776  -0.0170 227 PHE A CG    
1722 C CD1   . PHE A 228 ? 0.4598 0.4627 0.6551 0.0508  0.0729  -0.0173 227 PHE A CD1   
1723 C CD2   . PHE A 228 ? 0.4521 0.4812 0.6858 0.0440  0.0711  -0.0137 227 PHE A CD2   
1724 C CE1   . PHE A 228 ? 0.4274 0.4450 0.6555 0.0545  0.0615  -0.0138 227 PHE A CE1   
1725 C CE2   . PHE A 228 ? 0.4248 0.4686 0.6918 0.0467  0.0582  -0.0106 227 PHE A CE2   
1726 C CZ    . PHE A 228 ? 0.4168 0.4548 0.6805 0.0524  0.0533  -0.0104 227 PHE A CZ    
1727 N N     . LEU A 229 ? 0.5777 0.5045 0.6527 0.0461  0.1244  -0.0262 228 LEU A N     
1728 C CA    . LEU A 229 ? 0.6031 0.5055 0.6313 0.0417  0.1257  -0.0291 228 LEU A CA    
1729 C C     . LEU A 229 ? 0.6100 0.5177 0.6227 0.0340  0.1025  -0.0307 228 LEU A C     
1730 O O     . LEU A 229 ? 0.6012 0.5072 0.6100 0.0337  0.0924  -0.0323 228 LEU A O     
1731 C CB    . LEU A 229 ? 0.6513 0.5198 0.6457 0.0467  0.1405  -0.0324 228 LEU A CB    
1732 C CG    . LEU A 229 ? 0.7128 0.5621 0.7004 0.0532  0.1682  -0.0312 228 LEU A CG    
1733 C CD1   . LEU A 229 ? 0.6915 0.5677 0.7324 0.0575  0.1801  -0.0257 228 LEU A CD1   
1734 C CD2   . LEU A 229 ? 0.7277 0.5458 0.6906 0.0604  0.1828  -0.0345 228 LEU A CD2   
1735 N N     . TRP A 230 ? 0.5845 0.4984 0.5901 0.0281  0.0952  -0.0296 229 TRP A N     
1736 C CA    . TRP A 230 ? 0.5393 0.4629 0.5395 0.0216  0.0750  -0.0296 229 TRP A CA    
1737 C C     . TRP A 230 ? 0.5512 0.4678 0.5286 0.0165  0.0712  -0.0288 229 TRP A C     
1738 O O     . TRP A 230 ? 0.5243 0.4484 0.5114 0.0162  0.0768  -0.0265 229 TRP A O     
1739 C CB    . TRP A 230 ? 0.5164 0.4677 0.5519 0.0213  0.0655  -0.0273 229 TRP A CB    
1740 C CG    . TRP A 230 ? 0.4910 0.4513 0.5219 0.0158  0.0487  -0.0267 229 TRP A CG    
1741 C CD1   . TRP A 230 ? 0.4697 0.4276 0.4922 0.0140  0.0382  -0.0273 229 TRP A CD1   
1742 C CD2   . TRP A 230 ? 0.4812 0.4531 0.5169 0.0120  0.0424  -0.0247 229 TRP A CD2   
1743 N NE1   . TRP A 230 ? 0.4336 0.4018 0.4568 0.0096  0.0271  -0.0254 229 TRP A NE1   
1744 C CE2   . TRP A 230 ? 0.4544 0.4308 0.4849 0.0087  0.0294  -0.0240 229 TRP A CE2   
1745 C CE3   . TRP A 230 ? 0.4745 0.4523 0.5186 0.0113  0.0477  -0.0231 229 TRP A CE3   
1746 C CZ2   . TRP A 230 ? 0.4460 0.4319 0.4791 0.0056  0.0225  -0.0218 229 TRP A CZ2   
1747 C CZ3   . TRP A 230 ? 0.4454 0.4319 0.4905 0.0077  0.0393  -0.0214 229 TRP A CZ3   
1748 C CH2   . TRP A 230 ? 0.4417 0.4320 0.4812 0.0054  0.0273  -0.0208 229 TRP A CH2   
1749 N N     . MET A 231 ? 0.5719 0.4740 0.5205 0.0121  0.0607  -0.0301 230 MET A N     
1750 C CA    . MET A 231 ? 0.5559 0.4524 0.4846 0.0070  0.0524  -0.0284 230 MET A CA    
1751 C C     . MET A 231 ? 0.6486 0.5268 0.5565 0.0087  0.0658  -0.0278 230 MET A C     
1752 O O     . MET A 231 ? 0.6899 0.5701 0.5926 0.0063  0.0624  -0.0249 230 MET A O     
1753 C CB    . MET A 231 ? 0.5011 0.4236 0.4540 0.0042  0.0420  -0.0250 230 MET A CB    
1754 C CG    . MET A 231 ? 0.4630 0.3996 0.4305 0.0023  0.0296  -0.0248 230 MET A CG    
1755 S SD    . MET A 231 ? 0.5404 0.4637 0.4849 -0.0038 0.0152  -0.0247 230 MET A SD    
1756 C CE    . MET A 231 ? 0.5159 0.4462 0.4586 -0.0076 0.0064  -0.0200 230 MET A CE    
1757 N N     . GLY A 232 ? 0.6389 0.4968 0.5332 0.0136  0.0823  -0.0301 231 GLY A N     
1758 C CA    . GLY A 232 ? 0.6507 0.4880 0.5237 0.0162  0.0989  -0.0291 231 GLY A CA    
1759 C C     . GLY A 232 ? 0.6339 0.4891 0.5403 0.0196  0.1141  -0.0259 231 GLY A C     
1760 O O     . GLY A 232 ? 0.6465 0.4870 0.5384 0.0210  0.1282  -0.0238 231 GLY A O     
1761 N N     . TYR A 233 ? 0.6090 0.4937 0.5588 0.0206  0.1110  -0.0251 232 TYR A N     
1762 C CA    . TYR A 233 ? 0.5757 0.4793 0.5629 0.0227  0.1222  -0.0219 232 TYR A CA    
1763 C C     . TYR A 233 ? 0.6159 0.5281 0.6337 0.0286  0.1324  -0.0221 232 TYR A C     
1764 O O     . TYR A 233 ? 0.6505 0.5589 0.6642 0.0308  0.1274  -0.0248 232 TYR A O     
1765 C CB    . TYR A 233 ? 0.5266 0.4575 0.5403 0.0180  0.1063  -0.0202 232 TYR A CB    
1766 C CG    . TYR A 233 ? 0.5562 0.4830 0.5463 0.0129  0.0936  -0.0194 232 TYR A CG    
1767 C CD1   . TYR A 233 ? 0.5475 0.4682 0.5289 0.0114  0.0999  -0.0164 232 TYR A CD1   
1768 C CD2   . TYR A 233 ? 0.5121 0.4417 0.4916 0.0099  0.0759  -0.0207 232 TYR A CD2   
1769 C CE1   . TYR A 233 ? 0.5478 0.4653 0.5103 0.0078  0.0878  -0.0148 232 TYR A CE1   
1770 C CE2   . TYR A 233 ? 0.5152 0.4432 0.4791 0.0060  0.0645  -0.0188 232 TYR A CE2   
1771 C CZ    . TYR A 233 ? 0.5370 0.4591 0.4925 0.0053  0.0700  -0.0159 232 TYR A CZ    
1772 O OH    . TYR A 233 ? 0.5097 0.4305 0.4520 0.0023  0.0581  -0.0132 232 TYR A OH    
1773 N N     . GLU A 234 ? 0.6120 0.5362 0.6631 0.0310  0.1464  -0.0187 233 GLU A N     
1774 C CA    . GLU A 234 ? 0.5820 0.5220 0.6755 0.0363  0.1534  -0.0170 233 GLU A CA    
1775 C C     . GLU A 234 ? 0.5587 0.5298 0.6943 0.0321  0.1390  -0.0146 233 GLU A C     
1776 O O     . GLU A 234 ? 0.5970 0.5755 0.7472 0.0287  0.1434  -0.0118 233 GLU A O     
1777 C CB    . GLU A 234 ? 0.5616 0.4896 0.6639 0.0426  0.1822  -0.0140 233 GLU A CB    
1778 N N     . LEU A 235 ? 0.5197 0.5055 0.6711 0.0320  0.1216  -0.0158 234 LEU A N     
1779 C CA    . LEU A 235 ? 0.5026 0.5125 0.6859 0.0280  0.1046  -0.0144 234 LEU A CA    
1780 C C     . LEU A 235 ? 0.5452 0.5718 0.7775 0.0320  0.1088  -0.0107 234 LEU A C     
1781 O O     . LEU A 235 ? 0.5418 0.5680 0.7835 0.0380  0.1099  -0.0106 234 LEU A O     
1782 C CB    . LEU A 235 ? 0.4695 0.4825 0.6383 0.0257  0.0832  -0.0171 234 LEU A CB    
1783 C CG    . LEU A 235 ? 0.4677 0.4670 0.5945 0.0220  0.0768  -0.0198 234 LEU A CG    
1784 C CD1   . LEU A 235 ? 0.4381 0.4432 0.5599 0.0203  0.0582  -0.0211 234 LEU A CD1   
1785 C CD2   . LEU A 235 ? 0.4724 0.4712 0.5902 0.0172  0.0777  -0.0188 234 LEU A CD2   
1786 N N     . HIS A 236 ? 0.5570 0.5977 0.8218 0.0286  0.1103  -0.0074 235 HIS A N     
1787 C CA    . HIS A 236 ? 0.5115 0.5724 0.8303 0.0303  0.1088  -0.0030 235 HIS A CA    
1788 C C     . HIS A 236 ? 0.4721 0.5484 0.8062 0.0242  0.0818  -0.0035 235 HIS A C     
1789 O O     . HIS A 236 ? 0.4317 0.5024 0.7351 0.0192  0.0688  -0.0070 235 HIS A O     
1790 C CB    . HIS A 236 ? 0.5263 0.5909 0.8735 0.0297  0.1298  0.0018  235 HIS A CB    
1791 C CG    . HIS A 236 ? 0.5760 0.6206 0.9040 0.0364  0.1587  0.0026  235 HIS A CG    
1792 N ND1   . HIS A 236 ? 0.5980 0.6193 0.8776 0.0350  0.1695  0.0001  235 HIS A ND1   
1793 C CD2   . HIS A 236 ? 0.5881 0.6296 0.9361 0.0451  0.1791  0.0058  235 HIS A CD2   
1794 C CE1   . HIS A 236 ? 0.6079 0.6101 0.8744 0.0420  0.1950  0.0012  235 HIS A CE1   
1795 N NE2   . HIS A 236 ? 0.6172 0.6310 0.9248 0.0486  0.2027  0.0046  235 HIS A NE2   
1796 N N     . PRO A 237 ? 0.4921 0.5862 0.8726 0.0249  0.0720  0.0002  236 PRO A N     
1797 C CA    . PRO A 237 ? 0.4979 0.6012 0.8862 0.0189  0.0444  -0.0008 236 PRO A CA    
1798 C C     . PRO A 237 ? 0.5074 0.6094 0.8867 0.0100  0.0389  -0.0023 236 PRO A C     
1799 O O     . PRO A 237 ? 0.5343 0.6301 0.8857 0.0060  0.0220  -0.0060 236 PRO A O     
1800 C CB    . PRO A 237 ? 0.4997 0.6217 0.9451 0.0209  0.0374  0.0048  236 PRO A CB    
1801 C CG    . PRO A 237 ? 0.5032 0.6236 0.9594 0.0309  0.0572  0.0074  236 PRO A CG    
1802 C CD    . PRO A 237 ? 0.5124 0.6164 0.9359 0.0322  0.0832  0.0053  236 PRO A CD    
1803 N N     . ASP A 238 ? 0.5082 0.6143 0.9096 0.0071  0.0542  0.0008  237 ASP A N     
1804 C CA    . ASP A 238 ? 0.5480 0.6524 0.9445 -0.0014 0.0495  -0.0001 237 ASP A CA    
1805 C C     . ASP A 238 ? 0.5877 0.6772 0.9504 -0.0018 0.0689  -0.0011 237 ASP A C     
1806 O O     . ASP A 238 ? 0.6321 0.7164 0.9808 -0.0079 0.0644  -0.0024 237 ASP A O     
1807 C CB    . ASP A 238 ? 0.5194 0.6400 0.9715 -0.0067 0.0479  0.0049  237 ASP A CB    
1808 N N     . LYS A 239 ? 0.5655 0.6454 0.9122 0.0047  0.0894  -0.0005 238 LYS A N     
1809 C CA    . LYS A 239 ? 0.5392 0.6017 0.8514 0.0048  0.1070  -0.0008 238 LYS A CA    
1810 C C     . LYS A 239 ? 0.5461 0.5923 0.8150 0.0105  0.1113  -0.0040 238 LYS A C     
1811 O O     . LYS A 239 ? 0.4933 0.5417 0.7635 0.0150  0.1055  -0.0055 238 LYS A O     
1812 C CB    . LYS A 239 ? 0.4972 0.5590 0.8346 0.0059  0.1327  0.0047  238 LYS A CB    
1813 N N     . TRP A 240 ? 0.5532 0.5814 0.7830 0.0099  0.1200  -0.0050 239 TRP A N     
1814 C CA    . TRP A 240 ? 0.5536 0.5629 0.7412 0.0141  0.1244  -0.0077 239 TRP A CA    
1815 C C     . TRP A 240 ? 0.6079 0.5957 0.7679 0.0151  0.1444  -0.0058 239 TRP A C     
1816 O O     . TRP A 240 ? 0.6258 0.6125 0.7868 0.0110  0.1482  -0.0034 239 TRP A O     
1817 C CB    . TRP A 240 ? 0.5197 0.5272 0.6783 0.0114  0.1039  -0.0113 239 TRP A CB    
1818 C CG    . TRP A 240 ? 0.5016 0.5060 0.6438 0.0064  0.0981  -0.0109 239 TRP A CG    
1819 C CD1   . TRP A 240 ? 0.4649 0.4811 0.6224 0.0018  0.0855  -0.0108 239 TRP A CD1   
1820 C CD2   . TRP A 240 ? 0.4645 0.4506 0.5703 0.0060  0.1039  -0.0102 239 TRP A CD2   
1821 N NE1   . TRP A 240 ? 0.4160 0.4234 0.5510 -0.0009 0.0850  -0.0100 239 TRP A NE1   
1822 C CE2   . TRP A 240 ? 0.4467 0.4367 0.5512 0.0017  0.0953  -0.0092 239 TRP A CE2   
1823 C CE3   . TRP A 240 ? 0.4755 0.4397 0.5476 0.0089  0.1147  -0.0102 239 TRP A CE3   
1824 C CZ2   . TRP A 240 ? 0.4619 0.4374 0.5365 0.0007  0.0970  -0.0075 239 TRP A CZ2   
1825 C CZ3   . TRP A 240 ? 0.5058 0.4543 0.5456 0.0072  0.1145  -0.0088 239 TRP A CZ3   
1826 C CH2   . TRP A 240 ? 0.4951 0.4506 0.5383 0.0034  0.1057  -0.0071 239 TRP A CH2   
1827 N N     . THR A 241 ? 0.6287 0.5966 0.7619 0.0205  0.1573  -0.0069 240 THR A N     
1828 C CA    . THR A 241 ? 0.6931 0.6338 0.7903 0.0220  0.1758  -0.0055 240 THR A CA    
1829 C C     . THR A 241 ? 0.7532 0.6706 0.7985 0.0229  0.1681  -0.0095 240 THR A C     
1830 O O     . THR A 241 ? 0.7667 0.6891 0.8089 0.0233  0.1537  -0.0130 240 THR A O     
1831 C CB    . THR A 241 ? 0.7292 0.6602 0.8404 0.0282  0.2045  -0.0023 240 THR A CB    
1832 O OG1   . THR A 241 ? 0.7690 0.6924 0.8740 0.0345  0.2081  -0.0051 240 THR A OG1   
1833 C CG2   . THR A 241 ? 0.7026 0.6600 0.8744 0.0268  0.2106  0.0025  240 THR A CG2   
1834 N N     . VAL A 242 ? 0.7646 0.6551 0.7689 0.0228  0.1771  -0.0085 241 VAL A N     
1835 C CA    . VAL A 242 ? 0.7830 0.6465 0.7354 0.0231  0.1701  -0.0117 241 VAL A CA    
1836 C C     . VAL A 242 ? 0.8301 0.6651 0.7593 0.0296  0.1919  -0.0129 241 VAL A C     
1837 O O     . VAL A 242 ? 0.8526 0.6773 0.7868 0.0333  0.2168  -0.0095 241 VAL A O     
1838 C CB    . VAL A 242 ? 0.8047 0.6519 0.7218 0.0193  0.1642  -0.0095 241 VAL A CB    
1839 C CG1   . VAL A 242 ? 0.8501 0.6655 0.7129 0.0193  0.1567  -0.0122 241 VAL A CG1   
1840 C CG2   . VAL A 242 ? 0.7930 0.6662 0.7312 0.0140  0.1431  -0.0086 241 VAL A CG2   
1841 N N     . GLN A 243 ? 0.8397 0.6607 0.7442 0.0310  0.1841  -0.0175 242 GLN A N     
1842 C CA    . GLN A 243 ? 0.9084 0.6960 0.7824 0.0374  0.2044  -0.0195 242 GLN A CA    
1843 C C     . GLN A 243 ? 0.9736 0.7231 0.7974 0.0380  0.2185  -0.0178 242 GLN A C     
1844 O O     . GLN A 243 ? 0.9813 0.7244 0.7794 0.0325  0.2030  -0.0168 242 GLN A O     
1845 C CB    . GLN A 243 ? 0.8963 0.6711 0.7451 0.0370  0.1896  -0.0251 242 GLN A CB    
1846 C CG    . GLN A 243 ? 0.8546 0.6621 0.7492 0.0376  0.1785  -0.0262 242 GLN A CG    
1847 C CD    . GLN A 243 ? 0.8882 0.6845 0.7595 0.0358  0.1621  -0.0312 242 GLN A CD    
1848 O OE1   . GLN A 243 ? 0.9479 0.7077 0.7713 0.0363  0.1651  -0.0346 242 GLN A OE1   
1849 N NE2   . GLN A 243 ? 0.8393 0.6646 0.7424 0.0333  0.1445  -0.0315 242 GLN A NE2   
1850 N N     . PRO A 244 ? 1.0313 0.7535 0.8393 0.0451  0.2482  -0.0167 243 PRO A N     
1851 C CA    . PRO A 244 ? 1.0851 0.7744 0.8537 0.0462  0.2664  -0.0132 243 PRO A CA    
1852 C C     . PRO A 244 ? 1.1246 0.7777 0.8253 0.0420  0.2490  -0.0158 243 PRO A C     
1853 O O     . PRO A 244 ? 1.1430 0.7783 0.8119 0.0409  0.2343  -0.0212 243 PRO A O     
1854 C CB    . PRO A 244 ? 1.1279 0.7905 0.8884 0.0559  0.3021  -0.0125 243 PRO A CB    
1855 C CG    . PRO A 244 ? 1.1215 0.7877 0.8906 0.0593  0.2965  -0.0178 243 PRO A CG    
1856 C CD    . PRO A 244 ? 1.0576 0.7732 0.8784 0.0532  0.2678  -0.0184 243 PRO A CD    
1857 N N     . ILE A 245 ? 1.1227 0.7640 0.8020 0.0394  0.2501  -0.0113 244 ILE A N     
1858 C CA    . ILE A 245 ? 1.1432 0.7502 0.7601 0.0355  0.2325  -0.0120 244 ILE A CA    
1859 C C     . ILE A 245 ? 1.2137 0.7661 0.7711 0.0410  0.2592  -0.0104 244 ILE A C     
1860 O O     . ILE A 245 ? 1.2337 0.7827 0.8002 0.0442  0.2844  -0.0048 244 ILE A O     
1861 C CB    . ILE A 245 ? 1.0937 0.7241 0.7262 0.0293  0.2125  -0.0074 244 ILE A CB    
1862 C CG1   . ILE A 245 ? 1.0187 0.6941 0.6970 0.0242  0.1847  -0.0096 244 ILE A CG1   
1863 C CG2   . ILE A 245 ? 1.1443 0.7349 0.7120 0.0268  0.1992  -0.0059 244 ILE A CG2   
1864 C CD1   . ILE A 245 ? 0.9501 0.6631 0.6742 0.0209  0.1781  -0.0051 244 ILE A CD1   
1865 N N     . VAL A 246 ? 1.2514 0.7587 0.7462 0.0418  0.2540  -0.0154 245 VAL A N     
1866 C CA    . VAL A 246 ? 1.3058 0.7522 0.7315 0.0472  0.2779  -0.0149 245 VAL A CA    
1867 C C     . VAL A 246 ? 1.3748 0.7895 0.7409 0.0416  0.2537  -0.0134 245 VAL A C     
1868 O O     . VAL A 246 ? 1.4116 0.8098 0.7429 0.0365  0.2247  -0.0179 245 VAL A O     
1869 C CB    . VAL A 246 ? 1.2925 0.7030 0.6829 0.0525  0.2899  -0.0218 245 VAL A CB    
1870 C CG1   . VAL A 246 ? 1.3596 0.7091 0.6879 0.0607  0.3254  -0.0205 245 VAL A CG1   
1871 C CG2   . VAL A 246 ? 1.1960 0.6482 0.6546 0.0565  0.3006  -0.0237 245 VAL A CG2   
1872 N N     . LEU A 247 ? 1.4111 0.8172 0.7671 0.0423  0.2646  -0.0063 246 LEU A N     
1873 C CA    . LEU A 247 ? 1.4875 0.8615 0.7863 0.0380  0.2424  -0.0035 246 LEU A CA    
1874 C C     . LEU A 247 ? 1.6356 0.9346 0.8435 0.0423  0.2568  -0.0054 246 LEU A C     
1875 O O     . LEU A 247 ? 1.6821 0.9569 0.8793 0.0500  0.2942  -0.0042 246 LEU A O     
1876 C CB    . LEU A 247 ? 1.4534 0.8455 0.7752 0.0371  0.2474  0.0052  246 LEU A CB    
1877 N N     . PRO A 248 ? 1.7221 0.9845 0.8684 0.0374  0.2261  -0.0077 247 PRO A N     
1878 C CA    . PRO A 248 ? 1.8299 1.0259 0.9035 0.0402  0.2311  -0.0091 247 PRO A CA    
1879 C C     . PRO A 248 ? 1.9018 1.0717 0.9589 0.0456  0.2561  -0.0013 247 PRO A C     
1880 O O     . PRO A 248 ? 1.9057 1.0964 0.9823 0.0447  0.2575  0.0054  247 PRO A O     
1881 C CB    . PRO A 248 ? 1.8365 1.0117 0.8652 0.0317  0.1852  -0.0109 247 PRO A CB    
1882 C CG    . PRO A 248 ? 1.7567 0.9874 0.8384 0.0252  0.1596  -0.0134 247 PRO A CG    
1883 C CD    . PRO A 248 ? 1.6830 0.9729 0.8455 0.0282  0.1799  -0.0084 247 PRO A CD    
1884 N N     . GLU A 249 ? 1.9852 1.1068 1.0049 0.0513  0.2765  -0.0020 248 GLU A N     
1885 C CA    . GLU A 249 ? 2.0329 1.1234 1.0345 0.0574  0.3048  0.0047  248 GLU A CA    
1886 C C     . GLU A 249 ? 2.1358 1.1552 1.0571 0.0583  0.2960  0.0037  248 GLU A C     
1887 O O     . GLU A 249 ? 2.2329 1.2113 1.1289 0.0653  0.3248  0.0053  248 GLU A O     
1888 C CB    . GLU A 249 ? 2.0333 1.1378 1.0807 0.0654  0.3485  0.0069  248 GLU A CB    
1889 N N     . LYS A 250 ? 2.1289 1.1322 1.0103 0.0510  0.2551  0.0014  249 LYS A N     
1890 C CA    . LYS A 250 ? 2.1589 1.0947 0.9642 0.0505  0.2414  0.0000  249 LYS A CA    
1891 C C     . LYS A 250 ? 2.1503 1.0547 0.9226 0.0534  0.2479  0.0068  249 LYS A C     
1892 O O     . LYS A 250 ? 2.0971 1.0347 0.9052 0.0542  0.2565  0.0126  249 LYS A O     
1893 C CB    . LYS A 250 ? 2.1323 1.0649 0.9139 0.0407  0.1925  -0.0046 249 LYS A CB    
1894 N N     . ASP A 251 ? 2.2235 1.0605 0.9250 0.0549  0.2438  0.0059  250 ASP A N     
1895 C CA    . ASP A 251 ? 2.3067 1.1049 0.9654 0.0571  0.2443  0.0113  250 ASP A CA    
1896 C C     . ASP A 251 ? 2.3468 1.1292 0.9676 0.0491  0.1957  0.0112  250 ASP A C     
1897 O O     . ASP A 251 ? 2.3560 1.1305 0.9626 0.0494  0.1882  0.0167  250 ASP A O     
1898 C CB    . ASP A 251 ? 2.4278 1.1560 1.0295 0.0651  0.2742  0.0114  250 ASP A CB    
1899 C CG    . ASP A 251 ? 2.4423 1.1843 1.0846 0.0740  0.3248  0.0143  250 ASP A CG    
1900 O OD1   . ASP A 251 ? 2.3751 1.1759 1.0850 0.0744  0.3382  0.0178  250 ASP A OD1   
1901 O OD2   . ASP A 251 ? 2.5142 1.2077 1.1222 0.0805  0.3509  0.0136  250 ASP A OD2   
1902 N N     . SER A 252 ? 2.3951 1.1731 1.0019 0.0419  0.1625  0.0055  251 SER A N     
1903 C CA    . SER A 252 ? 2.4240 1.1999 1.0120 0.0329  0.1124  0.0060  251 SER A CA    
1904 C C     . SER A 252 ? 2.2886 1.1350 0.9411 0.0260  0.0883  0.0055  251 SER A C     
1905 O O     . SER A 252 ? 2.2729 1.1498 0.9617 0.0256  0.0987  0.0008  251 SER A O     
1906 C CB    . SER A 252 ? 2.5311 1.2487 1.0574 0.0285  0.0890  0.0007  251 SER A CB    
1907 O OG    . SER A 252 ? 2.5689 1.2889 1.0856 0.0189  0.0387  0.0017  251 SER A OG    
1908 N N     . TRP A 253 ? 2.1851 1.0564 0.8522 0.0209  0.0565  0.0108  252 TRP A N     
1909 C CA    . TRP A 253 ? 2.0352 0.9732 0.7648 0.0153  0.0351  0.0124  252 TRP A CA    
1910 C C     . TRP A 253 ? 1.9943 0.9326 0.7161 0.0055  -0.0177 0.0131  252 TRP A C     
1911 O O     . TRP A 253 ? 2.0322 0.9483 0.7269 0.0041  -0.0398 0.0184  252 TRP A O     
1912 C CB    . TRP A 253 ? 1.9691 0.9473 0.7391 0.0191  0.0495  0.0206  252 TRP A CB    
1913 C CG    . TRP A 253 ? 1.9161 0.9138 0.7181 0.0264  0.0977  0.0202  252 TRP A CG    
1914 C CD1   . TRP A 253 ? 1.9325 0.9066 0.7210 0.0342  0.1352  0.0234  252 TRP A CD1   
1915 C CD2   . TRP A 253 ? 1.8424 0.8880 0.6990 0.0264  0.1132  0.0166  252 TRP A CD2   
1916 N NE1   . TRP A 253 ? 1.8786 0.8856 0.7150 0.0387  0.1722  0.0227  252 TRP A NE1   
1917 C CE2   . TRP A 253 ? 1.8245 0.8752 0.7021 0.0341  0.1594  0.0183  252 TRP A CE2   
1918 C CE3   . TRP A 253 ? 1.7738 0.8584 0.6654 0.0205  0.0921  0.0123  252 TRP A CE3   
1919 C CZ2   . TRP A 253 ? 1.7608 0.8548 0.6940 0.0361  0.1840  0.0159  252 TRP A CZ2   
1920 C CZ3   . TRP A 253 ? 1.7009 0.8256 0.6419 0.0229  0.1175  0.0093  252 TRP A CZ3   
1921 C CH2   . TRP A 253 ? 1.6971 0.8268 0.6593 0.0306  0.1626  0.0111  252 TRP A CH2   
1922 N N     . THR A 254 ? 1.9183 0.8829 0.6673 -0.0013 -0.0377 0.0081  253 THR A N     
1923 C CA    . THR A 254 ? 1.8840 0.8612 0.6433 -0.0114 -0.0875 0.0096  253 THR A CA    
1924 C C     . THR A 254 ? 1.8081 0.8557 0.6374 -0.0144 -0.1019 0.0144  253 THR A C     
1925 O O     . THR A 254 ? 1.7679 0.8518 0.6339 -0.0094 -0.0738 0.0150  253 THR A O     
1926 C CB    . THR A 254 ? 1.8748 0.8294 0.6159 -0.0180 -0.1024 0.0014  253 THR A CB    
1927 O OG1   . THR A 254 ? 1.8031 0.8034 0.5934 -0.0193 -0.0930 -0.0033 253 THR A OG1   
1928 C CG2   . THR A 254 ? 1.9536 0.8416 0.6305 -0.0125 -0.0757 -0.0037 253 THR A CG2   
1929 N N     . VAL A 255 ? 1.8009 0.8668 0.6502 -0.0228 -0.1463 0.0184  254 VAL A N     
1930 C CA    . VAL A 255 ? 1.7282 0.8585 0.6443 -0.0255 -0.1632 0.0245  254 VAL A CA    
1931 C C     . VAL A 255 ? 1.6965 0.8638 0.6520 -0.0269 -0.1499 0.0180  254 VAL A C     
1932 O O     . VAL A 255 ? 1.6582 0.8713 0.6591 -0.0239 -0.1376 0.0215  254 VAL A O     
1933 C CB    . VAL A 255 ? 1.7174 0.8587 0.6515 -0.0343 -0.2133 0.0302  254 VAL A CB    
1934 C CG1   . VAL A 255 ? 1.6257 0.8333 0.6338 -0.0382 -0.2314 0.0350  254 VAL A CG1   
1935 C CG2   . VAL A 255 ? 1.7447 0.8644 0.6549 -0.0312 -0.2250 0.0389  254 VAL A CG2   
1936 N N     . ASN A 256 ? 1.7466 0.8921 0.6837 -0.0312 -0.1518 0.0088  255 ASN A N     
1937 C CA    . ASN A 256 ? 1.7141 0.8909 0.6855 -0.0323 -0.1386 0.0018  255 ASN A CA    
1938 C C     . ASN A 256 ? 1.6808 0.8634 0.6551 -0.0222 -0.0901 -0.0008 255 ASN A C     
1939 O O     . ASN A 256 ? 1.6187 0.8523 0.6513 -0.0207 -0.0769 -0.0017 255 ASN A O     
1940 C CB    . ASN A 256 ? 1.7902 0.9353 0.7357 -0.0383 -0.1486 -0.0070 255 ASN A CB    
1941 C CG    . ASN A 256 ? 1.7632 0.9437 0.7494 -0.0414 -0.1447 -0.0138 255 ASN A CG    
1942 O OD1   . ASN A 256 ? 1.7323 0.9476 0.7599 -0.0500 -0.1754 -0.0123 255 ASN A OD1   
1943 N ND2   . ASN A 256 ? 1.7731 0.9452 0.7508 -0.0343 -0.1062 -0.0209 255 ASN A ND2   
1944 N N     . ASP A 257 ? 1.7282 0.8664 0.6570 -0.0150 -0.0615 -0.0015 256 ASP A N     
1945 C CA    . ASP A 257 ? 1.7002 0.8453 0.6387 -0.0053 -0.0142 -0.0023 256 ASP A CA    
1946 C C     . ASP A 257 ? 1.6210 0.8097 0.6006 -0.0025 -0.0075 0.0063  256 ASP A C     
1947 O O     . ASP A 257 ? 1.5442 0.7772 0.5830 0.0015  0.0195  0.0053  256 ASP A O     
1948 C CB    . ASP A 257 ? 1.7926 0.8807 0.6770 0.0016  0.0125  -0.0026 256 ASP A CB    
1949 C CG    . ASP A 257 ? 1.8565 0.8968 0.6970 0.0000  0.0106  -0.0103 256 ASP A CG    
1950 O OD1   . ASP A 257 ? 1.8385 0.8945 0.6982 -0.0036 0.0052  -0.0168 256 ASP A OD1   
1951 O OD2   . ASP A 257 ? 1.9313 0.9161 0.7165 0.0025  0.0150  -0.0095 256 ASP A OD2   
1952 N N     . ILE A 258 ? 1.6115 0.7994 0.5855 -0.0045 -0.0325 0.0151  257 ILE A N     
1953 C CA    . ILE A 258 ? 1.5394 0.7740 0.5675 -0.0018 -0.0277 0.0238  257 ILE A CA    
1954 C C     . ILE A 258 ? 1.4562 0.7637 0.5752 -0.0058 -0.0404 0.0227  257 ILE A C     
1955 O O     . ILE A 258 ? 1.3335 0.6877 0.5138 -0.0023 -0.0196 0.0242  257 ILE A O     
1956 C CB    . ILE A 258 ? 1.5782 0.7902 0.5728 -0.0025 -0.0544 0.0341  257 ILE A CB    
1957 C CG1   . ILE A 258 ? 1.6800 0.8353 0.6167 0.0024  -0.0357 0.0334  257 ILE A CG1   
1958 C CG2   . ILE A 258 ? 1.4891 0.7545 0.5509 0.0002  -0.0515 0.0427  257 ILE A CG2   
1959 C CD1   . ILE A 258 ? 1.6885 0.8422 0.6289 0.0107  0.0118  0.0351  257 ILE A CD1   
1960 N N     . CYS A 259 ? 1.5379 0.8541 0.6659 -0.0135 -0.0748 0.0202  258 CYS A N     
1961 C CA    . CYS A 259 ? 1.5318 0.9132 0.7423 -0.0171 -0.0850 0.0192  258 CYS A CA    
1962 C C     . CYS A 259 ? 1.3913 0.7967 0.6364 -0.0139 -0.0526 0.0112  258 CYS A C     
1963 O O     . CYS A 259 ? 1.3210 0.7800 0.6344 -0.0122 -0.0425 0.0123  258 CYS A O     
1964 C CB    . CYS A 259 ? 1.7062 1.0872 0.9166 -0.0266 -0.1255 0.0182  258 CYS A CB    
1965 S SG    . CYS A 259 ? 1.8585 1.2404 1.0686 -0.0310 -0.1699 0.0304  258 CYS A SG    
1966 N N     . LYS A 260 ? 1.3706 0.7345 0.5677 -0.0125 -0.0362 0.0033  259 LYS A N     
1967 C CA    . LYS A 260 ? 1.3245 0.7088 0.5541 -0.0084 -0.0052 -0.0035 259 LYS A CA    
1968 C C     . LYS A 260 ? 1.3160 0.7219 0.5768 -0.0008 0.0295  0.0001  259 LYS A C     
1969 O O     . LYS A 260 ? 1.2562 0.7102 0.5812 0.0008  0.0428  -0.0012 259 LYS A O     
1970 C CB    . LYS A 260 ? 1.3564 0.6854 0.5228 -0.0070 0.0077  -0.0118 259 LYS A CB    
1971 N N     . LEU A 261 ? 1.3737 0.7430 0.5891 0.0035  0.0434  0.0050  260 LEU A N     
1972 C CA    . LEU A 261 ? 1.3600 0.7461 0.6035 0.0097  0.0766  0.0091  260 LEU A CA    
1973 C C     . LEU A 261 ? 1.2800 0.7241 0.5930 0.0080  0.0658  0.0147  260 LEU A C     
1974 O O     . LEU A 261 ? 1.2518 0.7336 0.6193 0.0105  0.0868  0.0146  260 LEU A O     
1975 C CB    . LEU A 261 ? 1.4606 0.7911 0.6362 0.0140  0.0918  0.0141  260 LEU A CB    
1976 C CG    . LEU A 261 ? 1.4425 0.7845 0.6415 0.0194  0.1236  0.0204  260 LEU A CG    
1977 C CD1   . LEU A 261 ? 1.4263 0.7772 0.6518 0.0246  0.1632  0.0162  260 LEU A CD1   
1978 C CD2   . LEU A 261 ? 1.5147 0.8003 0.6421 0.0223  0.1291  0.0270  260 LEU A CD2   
1979 N N     . VAL A 262 ? 1.2585 0.7090 0.5708 0.0038  0.0328  0.0199  261 VAL A N     
1980 C CA    . VAL A 262 ? 1.1850 0.6864 0.5595 0.0030  0.0232  0.0255  261 VAL A CA    
1981 C C     . VAL A 262 ? 1.0983 0.6514 0.5383 0.0005  0.0193  0.0205  261 VAL A C     
1982 O O     . VAL A 262 ? 1.0446 0.6388 0.5394 0.0019  0.0295  0.0219  261 VAL A O     
1983 C CB    . VAL A 262 ? 1.1841 0.6784 0.5430 0.0002  -0.0110 0.0331  261 VAL A CB    
1984 C CG1   . VAL A 262 ? 1.1087 0.6575 0.5357 -0.0004 -0.0226 0.0380  261 VAL A CG1   
1985 C CG2   . VAL A 262 ? 1.2410 0.6887 0.5416 0.0039  -0.0042 0.0396  261 VAL A CG2   
1986 N N     . GLY A 263 ? 1.0814 0.6304 0.5141 -0.0036 0.0044  0.0147  262 GLY A N     
1987 C CA    . GLY A 263 ? 1.0104 0.6038 0.5002 -0.0057 0.0027  0.0101  262 GLY A CA    
1988 C C     . GLY A 263 ? 0.9708 0.5789 0.4871 -0.0010 0.0352  0.0056  262 GLY A C     
1989 O O     . GLY A 263 ? 0.9296 0.5814 0.5029 -0.0007 0.0394  0.0053  262 GLY A O     
1990 N N     . LYS A 264 ? 1.0033 0.5734 0.4783 0.0029  0.0586  0.0025  263 LYS A N     
1991 C CA    . LYS A 264 ? 0.9656 0.5493 0.4692 0.0079  0.0906  -0.0003 263 LYS A CA    
1992 C C     . LYS A 264 ? 0.9534 0.5639 0.4955 0.0100  0.1048  0.0054  263 LYS A C     
1993 O O     . LYS A 264 ? 0.8982 0.5453 0.4936 0.0111  0.1164  0.0041  263 LYS A O     
1994 C CB    . LYS A 264 ? 1.0332 0.5673 0.4832 0.0126  0.1151  -0.0034 263 LYS A CB    
1995 C CG    . LYS A 264 ? 1.0914 0.6031 0.5137 0.0113  0.1080  -0.0109 263 LYS A CG    
1996 C CD    . LYS A 264 ? 1.1797 0.6395 0.5478 0.0175  0.1365  -0.0140 263 LYS A CD    
1997 C CE    . LYS A 264 ? 1.2044 0.6442 0.5512 0.0170  0.1328  -0.0222 263 LYS A CE    
1998 N NZ    . LYS A 264 ? 1.1302 0.6166 0.5424 0.0180  0.1382  -0.0253 263 LYS A NZ    
1999 N N     . LEU A 265 ? 0.9631 0.5544 0.4783 0.0105  0.1029  0.0118  264 LEU A N     
2000 C CA    . LEU A 265 ? 0.9518 0.5654 0.5013 0.0119  0.1160  0.0172  264 LEU A CA    
2001 C C     . LEU A 265 ? 0.9242 0.5871 0.5311 0.0088  0.0975  0.0182  264 LEU A C     
2002 O O     . LEU A 265 ? 0.8879 0.5808 0.5408 0.0093  0.1098  0.0187  264 LEU A O     
2003 C CB    . LEU A 265 ? 0.9903 0.5684 0.4938 0.0134  0.1174  0.0243  264 LEU A CB    
2004 C CG    . LEU A 265 ? 1.0142 0.5424 0.4635 0.0177  0.1449  0.0248  264 LEU A CG    
2005 C CD1   . LEU A 265 ? 1.0389 0.5277 0.4349 0.0188  0.1407  0.0322  264 LEU A CD1   
2006 C CD2   . LEU A 265 ? 0.9784 0.5218 0.4651 0.0209  0.1802  0.0249  264 LEU A CD2   
2007 N N     . ASN A 266 ? 0.9130 0.5831 0.5177 0.0055  0.0682  0.0187  265 ASN A N     
2008 C CA    . ASN A 266 ? 0.8622 0.5765 0.5193 0.0034  0.0528  0.0196  265 ASN A CA    
2009 C C     . ASN A 266 ? 0.8156 0.5604 0.5152 0.0029  0.0605  0.0134  265 ASN A C     
2010 O O     . ASN A 266 ? 0.8174 0.5951 0.5618 0.0029  0.0633  0.0137  265 ASN A O     
2011 C CB    . ASN A 266 ? 0.9224 0.6374 0.5710 0.0001  0.0217  0.0221  265 ASN A CB    
2012 C CG    . ASN A 266 ? 1.0205 0.7101 0.6343 0.0008  0.0098  0.0297  265 ASN A CG    
2013 O OD1   . ASN A 266 ? 1.0355 0.7246 0.6526 0.0036  0.0202  0.0347  265 ASN A OD1   
2014 N ND2   . ASN A 266 ? 1.0695 0.7368 0.6498 -0.0021 -0.0134 0.0309  265 ASN A ND2   
2015 N N     . TRP A 267 ? 0.8218 0.5536 0.5055 0.0027  0.0633  0.0077  266 TRP A N     
2016 C CA    . TRP A 267 ? 0.7573 0.5145 0.4785 0.0031  0.0715  0.0023  266 TRP A CA    
2017 C C     . TRP A 267 ? 0.7459 0.5133 0.4930 0.0064  0.0973  0.0025  266 TRP A C     
2018 O O     . TRP A 267 ? 0.7088 0.5081 0.5011 0.0062  0.0997  0.0007  266 TRP A O     
2019 C CB    . TRP A 267 ? 0.7669 0.5019 0.4605 0.0030  0.0712  -0.0033 266 TRP A CB    
2020 C CG    . TRP A 267 ? 0.7463 0.5016 0.4731 0.0047  0.0815  -0.0083 266 TRP A CG    
2021 C CD1   . TRP A 267 ? 0.7766 0.5183 0.4985 0.0091  0.1045  -0.0114 266 TRP A CD1   
2022 C CD2   . TRP A 267 ? 0.6991 0.4901 0.4686 0.0026  0.0696  -0.0100 266 TRP A CD2   
2023 N NE1   . TRP A 267 ? 0.7326 0.5009 0.4934 0.0100  0.1056  -0.0148 266 TRP A NE1   
2024 C CE2   . TRP A 267 ? 0.6973 0.4946 0.4852 0.0058  0.0842  -0.0142 266 TRP A CE2   
2025 C CE3   . TRP A 267 ? 0.6655 0.4822 0.4591 -0.0010 0.0491  -0.0079 266 TRP A CE3   
2026 C CZ2   . TRP A 267 ? 0.6560 0.4828 0.4818 0.0051  0.0772  -0.0164 266 TRP A CZ2   
2027 C CZ3   . TRP A 267 ? 0.6327 0.4774 0.4626 -0.0016 0.0446  -0.0103 266 TRP A CZ3   
2028 C CH2   . TRP A 267 ? 0.6538 0.5026 0.4977 0.0012  0.0577  -0.0145 266 TRP A CH2   
2029 N N     . ALA A 268 ? 0.7850 0.5244 0.5041 0.0091  0.1165  0.0052  267 ALA A N     
2030 C CA    . ALA A 268 ? 0.7517 0.5000 0.4985 0.0116  0.1422  0.0064  267 ALA A CA    
2031 C C     . ALA A 268 ? 0.7153 0.4905 0.4988 0.0094  0.1392  0.0104  267 ALA A C     
2032 O O     . ALA A 268 ? 0.6664 0.4639 0.4915 0.0093  0.1512  0.0102  267 ALA A O     
2033 C CB    . ALA A 268 ? 0.7627 0.4704 0.4673 0.0153  0.1659  0.0090  267 ALA A CB    
2034 N N     . SER A 269 ? 0.7260 0.4980 0.4949 0.0078  0.1228  0.0143  268 SER A N     
2035 C CA    . SER A 269 ? 0.7299 0.5202 0.5264 0.0064  0.1221  0.0184  268 SER A CA    
2036 C C     . SER A 269 ? 0.6913 0.5204 0.5385 0.0043  0.1138  0.0153  268 SER A C     
2037 O O     . SER A 269 ? 0.6695 0.5128 0.5417 0.0030  0.1155  0.0175  268 SER A O     
2038 C CB    . SER A 269 ? 0.7699 0.5484 0.5408 0.0062  0.1048  0.0236  268 SER A CB    
2039 O OG    . SER A 269 ? 0.8076 0.5988 0.5817 0.0049  0.0808  0.0219  268 SER A OG    
2040 N N     . GLN A 270 ? 0.6433 0.4867 0.5032 0.0040  0.1050  0.0102  269 GLN A N     
2041 C CA    . GLN A 270 ? 0.5498 0.4257 0.4523 0.0024  0.0974  0.0075  269 GLN A CA    
2042 C C     . GLN A 270 ? 0.5449 0.4335 0.4811 0.0019  0.1132  0.0064  269 GLN A C     
2043 O O     . GLN A 270 ? 0.5145 0.4255 0.4833 -0.0001 0.1073  0.0053  269 GLN A O     
2044 C CB    . GLN A 270 ? 0.5206 0.4055 0.4259 0.0022  0.0852  0.0030  269 GLN A CB    
2045 C CG    . GLN A 270 ? 0.5118 0.3875 0.4123 0.0042  0.0975  -0.0007 269 GLN A CG    
2046 C CD    . GLN A 270 ? 0.5388 0.4220 0.4416 0.0038  0.0851  -0.0049 269 GLN A CD    
2047 O OE1   . GLN A 270 ? 0.5163 0.4233 0.4470 0.0026  0.0751  -0.0062 269 GLN A OE1   
2048 N NE2   . GLN A 270 ? 0.5401 0.4000 0.4105 0.0047  0.0859  -0.0068 269 GLN A NE2   
2049 N N     . ILE A 271 ? 0.5755 0.4493 0.5052 0.0037  0.1332  0.0070  270 ILE A N     
2050 C CA    . ILE A 271 ? 0.5871 0.4742 0.5546 0.0030  0.1487  0.0074  270 ILE A CA    
2051 C C     . ILE A 271 ? 0.6330 0.5007 0.5912 0.0036  0.1714  0.0124  270 ILE A C     
2052 O O     . ILE A 271 ? 0.6568 0.5368 0.6504 0.0013  0.1823  0.0145  270 ILE A O     
2053 C CB    . ILE A 271 ? 0.5781 0.4745 0.5644 0.0055  0.1535  0.0036  270 ILE A CB    
2054 C CG1   . ILE A 271 ? 0.5125 0.4300 0.5488 0.0040  0.1630  0.0046  270 ILE A CG1   
2055 C CG2   . ILE A 271 ? 0.5228 0.3907 0.4742 0.0100  0.1690  0.0034  270 ILE A CG2   
2056 C CD1   . ILE A 271 ? 0.4726 0.4130 0.5386 -0.0009 0.1471  0.0041  270 ILE A CD1   
2057 N N     . TYR A 272 ? 0.6952 0.5311 0.6064 0.0062  0.1786  0.0149  271 TYR A N     
2058 C CA    . TYR A 272 ? 0.7608 0.5738 0.6573 0.0071  0.2013  0.0204  271 TYR A CA    
2059 C C     . TYR A 272 ? 0.7764 0.5842 0.6614 0.0045  0.1931  0.0248  271 TYR A C     
2060 O O     . TYR A 272 ? 0.8308 0.6259 0.6813 0.0054  0.1768  0.0254  271 TYR A O     
2061 C CB    . TYR A 272 ? 0.8492 0.6242 0.6940 0.0117  0.2146  0.0209  271 TYR A CB    
2062 C CG    . TYR A 272 ? 0.8847 0.6577 0.7385 0.0156  0.2311  0.0178  271 TYR A CG    
2063 C CD1   . TYR A 272 ? 0.8795 0.6584 0.7294 0.0170  0.2172  0.0119  271 TYR A CD1   
2064 C CD2   . TYR A 272 ? 0.9158 0.6800 0.7833 0.0184  0.2618  0.0215  271 TYR A CD2   
2065 C CE1   . TYR A 272 ? 0.8780 0.6533 0.7357 0.0214  0.2328  0.0093  271 TYR A CE1   
2066 C CE2   . TYR A 272 ? 0.9404 0.7025 0.8187 0.0232  0.2786  0.0194  271 TYR A CE2   
2067 C CZ    . TYR A 272 ? 0.9286 0.6958 0.8009 0.0250  0.2636  0.0131  271 TYR A CZ    
2068 O OH    . TYR A 272 ? 0.9768 0.7404 0.8596 0.0306  0.2808  0.0112  271 TYR A OH    
2069 N N     . PRO A 273 ? 0.7362 0.5530 0.6502 0.0014  0.2030  0.0284  272 PRO A N     
2070 C CA    . PRO A 273 ? 0.7444 0.5541 0.6469 -0.0005 0.1962  0.0328  272 PRO A CA    
2071 C C     . PRO A 273 ? 0.7870 0.5583 0.6418 0.0023  0.2105  0.0390  272 PRO A C     
2072 O O     . PRO A 273 ? 0.8354 0.5864 0.6759 0.0045  0.2337  0.0410  272 PRO A O     
2073 C CB    . PRO A 273 ? 0.7088 0.5393 0.6603 -0.0056 0.2031  0.0339  272 PRO A CB    
2074 C CG    . PRO A 273 ? 0.7253 0.5607 0.7028 -0.0055 0.2240  0.0337  272 PRO A CG    
2075 C CD    . PRO A 273 ? 0.7213 0.5573 0.6850 -0.0011 0.2184  0.0287  272 PRO A CD    
2076 N N     . GLY A 274 ? 0.7779 0.5377 0.6069 0.0027  0.1967  0.0425  273 GLY A N     
2077 C CA    . GLY A 274 ? 0.8336 0.5559 0.6162 0.0052  0.2069  0.0494  273 GLY A CA    
2078 C C     . GLY A 274 ? 0.8961 0.5876 0.6215 0.0093  0.1989  0.0496  273 GLY A C     
2079 O O     . GLY A 274 ? 0.9867 0.6414 0.6665 0.0118  0.2075  0.0555  273 GLY A O     
2080 N N     . ILE A 275 ? 0.8662 0.5689 0.5907 0.0098  0.1820  0.0436  274 ILE A N     
2081 C CA    . ILE A 275 ? 0.9066 0.5785 0.5767 0.0124  0.1717  0.0433  274 ILE A CA    
2082 C C     . ILE A 275 ? 0.9269 0.5844 0.5677 0.0131  0.1507  0.0492  274 ILE A C     
2083 O O     . ILE A 275 ? 0.9147 0.5981 0.5851 0.0119  0.1341  0.0505  274 ILE A O     
2084 C CB    . ILE A 275 ? 0.9084 0.5985 0.5902 0.0116  0.1563  0.0358  274 ILE A CB    
2085 C CG1   . ILE A 275 ? 0.9091 0.6099 0.6172 0.0122  0.1775  0.0309  274 ILE A CG1   
2086 C CG2   . ILE A 275 ? 0.9282 0.5860 0.5545 0.0129  0.1411  0.0352  274 ILE A CG2   
2087 C CD1   . ILE A 275 ? 0.9545 0.6158 0.6213 0.0160  0.2025  0.0317  274 ILE A CD1   
2088 N N     . LYS A 276 ? 0.9574 0.5712 0.5384 0.0156  0.1516  0.0531  275 LYS A N     
2089 C CA    . LYS A 276 ? 0.9898 0.5850 0.5379 0.0168  0.1300  0.0597  275 LYS A CA    
2090 C C     . LYS A 276 ? 1.0691 0.6302 0.5610 0.0176  0.1141  0.0585  275 LYS A C     
2091 O O     . LYS A 276 ? 1.1484 0.6766 0.6012 0.0190  0.1310  0.0560  275 LYS A O     
2092 C CB    . LYS A 276 ? 1.0223 0.5904 0.5473 0.0190  0.1464  0.0681  275 LYS A CB    
2093 C CG    . LYS A 276 ? 0.9386 0.5360 0.5160 0.0173  0.1594  0.0699  275 LYS A CG    
2094 C CD    . LYS A 276 ? 0.9538 0.5199 0.5054 0.0189  0.1793  0.0783  275 LYS A CD    
2095 N N     . VAL A 277 ? 1.0663 0.6342 0.5551 0.0166  0.0817  0.0605  276 VAL A N     
2096 C CA    . VAL A 277 ? 1.1191 0.6574 0.5595 0.0156  0.0604  0.0594  276 VAL A CA    
2097 C C     . VAL A 277 ? 1.1857 0.7038 0.5953 0.0165  0.0333  0.0681  276 VAL A C     
2098 O O     . VAL A 277 ? 1.2306 0.7235 0.6006 0.0148  0.0104  0.0681  276 VAL A O     
2099 C CB    . VAL A 277 ? 1.0442 0.6131 0.5163 0.0118  0.0435  0.0519  276 VAL A CB    
2100 C CG1   . VAL A 277 ? 1.0042 0.5884 0.5016 0.0116  0.0686  0.0437  276 VAL A CG1   
2101 C CG2   . VAL A 277 ? 0.9816 0.5958 0.5087 0.0106  0.0226  0.0546  276 VAL A CG2   
2102 N N     . ARG A 278 ? 1.1970 0.7238 0.6232 0.0191  0.0341  0.0759  277 ARG A N     
2103 C CA    . ARG A 278 ? 1.2305 0.7457 0.6389 0.0207  0.0056  0.0851  277 ARG A CA    
2104 C C     . ARG A 278 ? 1.3178 0.7726 0.6465 0.0220  -0.0002 0.0894  277 ARG A C     
2105 O O     . ARG A 278 ? 1.3571 0.7956 0.6588 0.0207  -0.0320 0.0926  277 ARG A O     
2106 C CB    . ARG A 278 ? 1.2286 0.7619 0.6693 0.0242  0.0119  0.0925  277 ARG A CB    
2107 N N     . GLN A 279 ? 1.3662 0.8672 0.6350 0.0306  0.0430  0.1023  278 GLN A N     
2108 C CA    . GLN A 279 ? 1.4519 0.8871 0.6221 0.0345  0.0436  0.1071  278 GLN A CA    
2109 C C     . GLN A 279 ? 1.4997 0.9060 0.6187 0.0347  0.0364  0.0923  278 GLN A C     
2110 O O     . GLN A 279 ? 1.5885 0.9466 0.6330 0.0365  0.0147  0.0917  278 GLN A O     
2111 C CB    . GLN A 279 ? 1.4805 0.8874 0.6221 0.0376  0.0899  0.1184  278 GLN A CB    
2112 C CG    . GLN A 279 ? 1.4731 0.8859 0.6345 0.0383  0.0907  0.1358  278 GLN A CG    
2113 C CD    . GLN A 279 ? 1.5040 0.8888 0.6186 0.0399  0.0494  0.1441  278 GLN A CD    
2114 O OE1   . GLN A 279 ? 1.5845 0.9289 0.6381 0.0419  0.0410  0.1413  278 GLN A OE1   
2115 N NE2   . GLN A 279 ? 1.4376 0.8615 0.6129 0.0380  0.0213  0.1480  278 GLN A NE2   
2116 N N     . LEU A 280 ? 1.4272 0.8632 0.5897 0.0326  0.0526  0.0795  279 LEU A N     
2117 C CA    . LEU A 280 ? 1.4222 0.8343 0.5442 0.0325  0.0439  0.0643  279 LEU A CA    
2118 C C     . LEU A 280 ? 1.4095 0.8386 0.5493 0.0291  -0.0077 0.0573  279 LEU A C     
2119 O O     . LEU A 280 ? 1.4566 0.8468 0.5371 0.0292  -0.0313 0.0492  279 LEU A O     
2120 C CB    . LEU A 280 ? 1.3379 0.7768 0.5058 0.0316  0.0777  0.0542  279 LEU A CB    
2121 C CG    . LEU A 280 ? 1.3131 0.7291 0.4624 0.0354  0.1311  0.0597  279 LEU A CG    
2122 C CD1   . LEU A 280 ? 1.2538 0.7152 0.4822 0.0335  0.1587  0.0538  279 LEU A CD1   
2123 C CD2   . LEU A 280 ? 1.3846 0.7329 0.4374 0.0399  0.1450  0.0543  279 LEU A CD2   
2124 N N     . SER A 281 ? 1.3404 0.8251 0.5618 0.0260  -0.0253 0.0603  280 SER A N     
2125 C CA    . SER A 281 ? 1.3307 0.8340 0.5788 0.0231  -0.0713 0.0556  280 SER A CA    
2126 C C     . SER A 281 ? 1.4028 0.8680 0.5984 0.0245  -0.1078 0.0643  280 SER A C     
2127 O O     . SER A 281 ? 1.4251 0.8793 0.6087 0.0226  -0.1470 0.0586  280 SER A O     
2128 C CB    . SER A 281 ? 1.2413 0.8097 0.5868 0.0204  -0.0757 0.0575  280 SER A CB    
2129 O OG    . SER A 281 ? 1.2139 0.8163 0.6073 0.0184  -0.0508 0.0486  280 SER A OG    
2130 N N     . LYS A 282 ? 1.4475 0.8917 0.6142 0.0276  -0.0972 0.0788  281 LYS A N     
2131 C CA    . LYS A 282 ? 1.4997 0.9047 0.6142 0.0293  -0.1325 0.0891  281 LYS A CA    
2132 C C     . LYS A 282 ? 1.5718 0.9271 0.6175 0.0294  -0.1441 0.0791  281 LYS A C     
2133 O O     . LYS A 282 ? 1.6049 0.9422 0.6360 0.0286  -0.1810 0.0809  281 LYS A O     
2134 C CB    . LYS A 282 ? 1.5351 0.9271 0.6345 0.0327  -0.1122 0.1062  281 LYS A CB    
2135 N N     . LEU A 283 ? 1.6207 0.9544 0.6300 0.0303  -0.1127 0.0682  282 LEU A N     
2136 C CA    . LEU A 283 ? 1.6931 0.9783 0.6394 0.0306  -0.1204 0.0571  282 LEU A CA    
2137 C C     . LEU A 283 ? 1.6969 0.9871 0.6577 0.0264  -0.1647 0.0451  282 LEU A C     
2138 O O     . LEU A 283 ? 1.7533 1.0015 0.6635 0.0261  -0.1777 0.0360  282 LEU A O     
2139 C CB    . LEU A 283 ? 1.7029 0.9681 0.6179 0.0332  -0.0722 0.0485  282 LEU A CB    
2140 C CG    . LEU A 283 ? 1.7734 1.0009 0.6398 0.0381  -0.0319 0.0560  282 LEU A CG    
2141 C CD1   . LEU A 283 ? 1.7488 0.9993 0.6466 0.0393  -0.0169 0.0737  282 LEU A CD1   
2142 C CD2   . LEU A 283 ? 1.7867 1.0043 0.6432 0.0405  0.0158  0.0469  282 LEU A CD2   
2143 N N     . LEU A 284 ? 1.6550 0.9937 0.6847 0.0232  -0.1880 0.0452  283 LEU A N     
2144 C CA    . LEU A 284 ? 1.6658 1.0159 0.7230 0.0188  -0.2250 0.0337  283 LEU A CA    
2145 C C     . LEU A 284 ? 1.7183 1.0831 0.8159 0.0163  -0.2734 0.0411  283 LEU A C     
2146 O O     . LEU A 284 ? 1.6870 1.0770 0.8345 0.0124  -0.3033 0.0351  283 LEU A O     
2147 C CB    . LEU A 284 ? 1.5485 0.9429 0.6592 0.0168  -0.2127 0.0266  283 LEU A CB    
2148 C CG    . LEU A 284 ? 1.5391 0.9252 0.6249 0.0190  -0.1626 0.0191  283 LEU A CG    
2149 C CD1   . LEU A 284 ? 1.4362 0.8908 0.6191 0.0175  -0.1356 0.0197  283 LEU A CD1   
2150 C CD2   . LEU A 284 ? 1.5999 0.9567 0.6502 0.0176  -0.1659 0.0018  283 LEU A CD2   
2151 N N     . ARG A 285 ? 1.7958 1.1459 0.8774 0.0185  -0.2803 0.0543  284 ARG A N     
2152 C CA    . ARG A 285 ? 1.8066 1.1693 0.9294 0.0166  -0.3240 0.0621  284 ARG A CA    
2153 C C     . ARG A 285 ? 1.8530 1.1749 0.9398 0.0138  -0.3586 0.0543  284 ARG A C     
2154 O O     . ARG A 285 ? 1.9036 1.1726 0.9126 0.0156  -0.3511 0.0523  284 ARG A O     
2155 C CB    . ARG A 285 ? 1.8558 1.2148 0.9732 0.0200  -0.3191 0.0791  284 ARG A CB    
2156 C CG    . ARG A 285 ? 1.8231 1.2126 0.9659 0.0231  -0.2822 0.0880  284 ARG A CG    
2157 C CD    . ARG A 285 ? 1.7603 1.2069 0.9878 0.0216  -0.2899 0.0884  284 ARG A CD    
2158 N NE    . ARG A 285 ? 1.7450 1.2175 0.9982 0.0245  -0.2574 0.0981  284 ARG A NE    
2159 C CZ    . ARG A 285 ? 1.7224 1.2186 1.0220 0.0263  -0.2621 0.1111  284 ARG A CZ    
2160 N NH1   . ARG A 285 ? 1.7480 1.2409 1.0650 0.0265  -0.3013 0.1185  284 ARG A NH1   
2161 N NH2   . ARG A 285 ? 1.6651 1.1923 1.0042 0.0275  -0.2252 0.1149  284 ARG A NH2   
2162 N N     . GLY A 286 ? 1.8409 1.1859 0.9853 0.0095  -0.3954 0.0504  285 GLY A N     
2163 C CA    . GLY A 286 ? 1.9199 1.2297 1.0436 0.0061  -0.4342 0.0451  285 GLY A CA    
2164 C C     . GLY A 286 ? 1.9969 1.2604 1.0524 0.0054  -0.4285 0.0302  285 GLY A C     
2165 O O     . GLY A 286 ? 2.0765 1.3025 1.1046 0.0030  -0.4610 0.0262  285 GLY A O     
2166 N N     . THR A 287 ? 1.9860 1.2490 1.0140 0.0076  -0.3885 0.0221  286 THR A N     
2167 C CA    . THR A 287 ? 2.0491 1.2685 1.0156 0.0076  -0.3802 0.0075  286 THR A CA    
2168 C C     . THR A 287 ? 2.0243 1.2554 1.0330 0.0023  -0.4140 -0.0031 286 THR A C     
2169 O O     . THR A 287 ? 1.9542 1.2384 1.0438 -0.0007 -0.4227 -0.0029 286 THR A O     
2170 C CB    . THR A 287 ? 2.0433 1.2672 0.9873 0.0109  -0.3283 0.0015  286 THR A CB    
2171 O OG1   . THR A 287 ? 1.9552 1.2393 0.9749 0.0091  -0.3197 0.0009  286 THR A OG1   
2172 C CG2   . THR A 287 ? 2.0754 1.2798 0.9733 0.0162  -0.2927 0.0122  286 THR A CG2   
2173 N N     . LYS A 288 ? 2.0851 1.2644 1.0389 0.0012  -0.4326 -0.0120 287 LYS A N     
2174 C CA    . LYS A 288 ? 2.0608 1.2449 1.0536 -0.0041 -0.4701 -0.0203 287 LYS A CA    
2175 C C     . LYS A 288 ? 2.0035 1.2130 1.0233 -0.0054 -0.4505 -0.0335 287 LYS A C     
2176 O O     . LYS A 288 ? 1.9257 1.1863 1.0284 -0.0091 -0.4620 -0.0339 287 LYS A O     
2177 C CB    . LYS A 288 ? 2.1753 1.2917 1.0967 -0.0047 -0.4978 -0.0253 287 LYS A CB    
2178 N N     . ALA A 289 ? 2.0132 1.1869 0.9657 -0.0024 -0.4194 -0.0441 288 ALA A N     
2179 C CA    . ALA A 289 ? 1.9356 1.1242 0.9052 -0.0037 -0.4023 -0.0581 288 ALA A CA    
2180 C C     . ALA A 289 ? 1.8602 1.0502 0.7985 0.0011  -0.3471 -0.0607 288 ALA A C     
2181 O O     . ALA A 289 ? 1.8711 1.0481 0.7729 0.0055  -0.3223 -0.0514 288 ALA A O     
2182 C CB    . ALA A 289 ? 2.0075 1.1472 0.9320 -0.0053 -0.4222 -0.0711 288 ALA A CB    
2183 N N     . LEU A 290 ? 1.7837 0.9889 0.7397 0.0003  -0.3274 -0.0731 289 LEU A N     
2184 C CA    . LEU A 290 ? 1.7463 0.9588 0.6876 0.0045  -0.2745 -0.0759 289 LEU A CA    
2185 C C     . LEU A 290 ? 1.8428 0.9950 0.6948 0.0102  -0.2427 -0.0791 289 LEU A C     
2186 O O     . LEU A 290 ? 1.8576 1.0074 0.6889 0.0150  -0.2002 -0.0732 289 LEU A O     
2187 C CB    . LEU A 290 ? 1.6935 0.9371 0.6814 0.0017  -0.2646 -0.0889 289 LEU A CB    
2188 C CG    . LEU A 290 ? 1.6100 0.9151 0.6902 -0.0038 -0.2897 -0.0862 289 LEU A CG    
2189 C CD1   . LEU A 290 ? 1.5780 0.9029 0.6948 -0.0068 -0.2818 -0.1007 289 LEU A CD1   
2190 C CD2   . LEU A 290 ? 1.5552 0.9005 0.6694 -0.0022 -0.2723 -0.0731 289 LEU A CD2   
2191 N N     . THR A 291 ? 1.9074 1.0094 0.7075 0.0098  -0.2616 -0.0878 290 THR A N     
2192 C CA    . THR A 291 ? 1.9883 1.0294 0.7021 0.0154  -0.2307 -0.0919 290 THR A CA    
2193 C C     . THR A 291 ? 2.0188 1.0251 0.6781 0.0192  -0.2270 -0.0786 290 THR A C     
2194 O O     . THR A 291 ? 2.0936 1.0466 0.6793 0.0242  -0.1999 -0.0802 290 THR A O     
2195 C CB    . THR A 291 ? 2.0604 1.0553 0.7321 0.0139  -0.2543 -0.1056 290 THR A CB    
2196 O OG1   . THR A 291 ? 2.0822 1.0662 0.7577 0.0095  -0.3100 -0.1016 290 THR A OG1   
2197 C CG2   . THR A 291 ? 2.0061 1.0304 0.7261 0.0109  -0.2503 -0.1198 290 THR A CG2   
2198 N N     . GLU A 292 ? 1.9628 0.9964 0.6567 0.0171  -0.2521 -0.0653 291 GLU A N     
2199 C CA    . GLU A 292 ? 2.0130 1.0139 0.6579 0.0203  -0.2513 -0.0525 291 GLU A CA    
2200 C C     . GLU A 292 ? 2.0164 1.0168 0.6415 0.0263  -0.1939 -0.0460 291 GLU A C     
2201 O O     . GLU A 292 ? 1.9408 0.9928 0.6235 0.0263  -0.1715 -0.0408 291 GLU A O     
2202 C CB    . GLU A 292 ? 1.9759 1.0125 0.6740 0.0167  -0.2900 -0.0398 291 GLU A CB    
2203 N N     . VAL A 293 ? 2.1236 1.0642 0.6686 0.0313  -0.1698 -0.0458 292 VAL A N     
2204 C CA    . VAL A 293 ? 2.1186 1.0542 0.6461 0.0372  -0.1144 -0.0382 292 VAL A CA    
2205 C C     . VAL A 293 ? 2.1168 1.0729 0.6630 0.0375  -0.1186 -0.0208 292 VAL A C     
2206 O O     . VAL A 293 ? 2.1672 1.0992 0.6853 0.0364  -0.1539 -0.0141 292 VAL A O     
2207 C CB    . VAL A 293 ? 2.1648 1.0274 0.6016 0.0427  -0.0878 -0.0424 292 VAL A CB    
2208 C CG1   . VAL A 293 ? 2.1587 1.0059 0.5697 0.0484  -0.0444 -0.0291 292 VAL A CG1   
2209 C CG2   . VAL A 293 ? 2.1558 1.0109 0.5897 0.0442  -0.0592 -0.0573 292 VAL A CG2   
2210 N N     . ILE A 294 ? 2.0524 1.0528 0.6479 0.0391  -0.0831 -0.0132 293 ILE A N     
2211 C CA    . ILE A 294 ? 2.0214 1.0447 0.6399 0.0397  -0.0824 0.0037  293 ILE A CA    
2212 C C     . ILE A 294 ? 2.0696 1.0771 0.6656 0.0456  -0.0259 0.0117  293 ILE A C     
2213 O O     . ILE A 294 ? 2.0163 1.0539 0.6527 0.0469  0.0139  0.0105  293 ILE A O     
2214 C CB    . ILE A 294 ? 1.8822 0.9765 0.5892 0.0355  -0.0965 0.0077  293 ILE A CB    
2215 N N     . PRO A 295 ? 2.1668 1.1273 0.7023 0.0492  -0.0203 0.0204  294 PRO A N     
2216 C CA    . PRO A 295