data_6OY5
# 
_entry.id   6OY5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6OY5         
WWPDB D_1000241576 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6OY5 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shin, Y.'       1 ? 
'Murakami, K.S.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                2144 
_citation.page_last                 2155 
_citation.title                     
'Structural basis of reiterative transcription from the pyrG and pyrBI promoters by bacterial RNA polymerase.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkz1221 
_citation.pdbx_database_id_PubMed   31965171 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shin, Y.'       1 ? 
primary 'Hedglin, M.'    2 ? 
primary 'Murakami, K.S.' 3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   99.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6OY5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     186.106 
_cell.length_a_esd                 ? 
_cell.length_b                     102.417 
_cell.length_b_esd                 ? 
_cell.length_c                     297.237 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6OY5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                        35056.164  2 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                         125436.539 1 2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1 2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                        11533.316  1 2.7.7.6 ? ? ? 
5  polymer     nat 'RNA polymerase sigma factor SigA'                                                 48598.031  1 ?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(P*CP*CP*GP*CP*AP*TP*CP*AP*GP*AP*GP*CP*CP*CP*AP*AP*AP*AP*T)-3')
;
6659.336   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*CP*TP*CP*TP*GP*AP*TP*GP*CP*AP*G)-3')
;
8412.417   1 ?       ? ? ? 
8  polymer     syn 
;RNA (5'-D(*(GTP))-R(P*G)-3')
;
805.413    1 ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                    24.305     3 ?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                         65.409     2 ?       ? ? ? 
11 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                                        523.180    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  
;(DC)(DC)(DC)(DG)(DC)(DA)(DT)(DC)(DA)(DG)(DA)(DG)(DC)(DC)(DC)(DA)(DA)(DA)(DA)(DT)
(DA)(DC)
;
CCCGCATCAGAGCCCAAAATAC G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DG)(DC)(DT)(DC)(DT)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGGCTCTGATGCAGG H   ? 
8 polyribonucleotide      no yes '(GTP)G' GG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    LYS n 
5 3    LYS n 
5 4    SER n 
5 5    LYS n 
5 6    ARG n 
5 7    LYS n 
5 8    ASN n 
5 9    ALA n 
5 10   GLN n 
5 11   ALA n 
5 12   GLN n 
5 13   GLU n 
5 14   ALA n 
5 15   GLN n 
5 16   GLU n 
5 17   THR n 
5 18   GLU n 
5 19   VAL n 
5 20   LEU n 
5 21   VAL n 
5 22   GLN n 
5 23   GLU n 
5 24   GLU n 
5 25   ALA n 
5 26   GLU n 
5 27   GLU n 
5 28   LEU n 
5 29   PRO n 
5 30   GLU n 
5 31   PHE n 
5 32   PRO n 
5 33   GLU n 
5 34   GLY n 
5 35   GLU n 
5 36   PRO n 
5 37   ASP n 
5 38   PRO n 
5 39   ASP n 
5 40   LEU n 
5 41   GLU n 
5 42   ASP n 
5 43   PRO n 
5 44   ASP n 
5 45   LEU n 
5 46   THR n 
5 47   LEU n 
5 48   GLU n 
5 49   ASP n 
5 50   ASP n 
5 51   LEU n 
5 52   LEU n 
5 53   ASP n 
5 54   LEU n 
5 55   PRO n 
5 56   GLU n 
5 57   GLU n 
5 58   GLY n 
5 59   GLU n 
5 60   GLY n 
5 61   LEU n 
5 62   ASP n 
5 63   LEU n 
5 64   GLU n 
5 65   GLU n 
5 66   GLU n 
5 67   GLU n 
5 68   GLU n 
5 69   ASP n 
5 70   LEU n 
5 71   PRO n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ILE n 
5 76   SER n 
5 77   THR n 
5 78   SER n 
5 79   ASP n 
5 80   PRO n 
5 81   VAL n 
5 82   ARG n 
5 83   GLN n 
5 84   TYR n 
5 85   LEU n 
5 86   HIS n 
5 87   GLU n 
5 88   ILE n 
5 89   GLY n 
5 90   GLN n 
5 91   VAL n 
5 92   PRO n 
5 93   LEU n 
5 94   LEU n 
5 95   THR n 
5 96   LEU n 
5 97   GLU n 
5 98   GLU n 
5 99   GLU n 
5 100  VAL n 
5 101  GLU n 
5 102  LEU n 
5 103  ALA n 
5 104  ARG n 
5 105  LYS n 
5 106  VAL n 
5 107  GLU n 
5 108  GLU n 
5 109  GLY n 
5 110  MET n 
5 111  GLU n 
5 112  ALA n 
5 113  ILE n 
5 114  LYS n 
5 115  LYS n 
5 116  LEU n 
5 117  SER n 
5 118  GLU n 
5 119  ILE n 
5 120  THR n 
5 121  GLY n 
5 122  LEU n 
5 123  ASP n 
5 124  PRO n 
5 125  ASP n 
5 126  LEU n 
5 127  ILE n 
5 128  ARG n 
5 129  GLU n 
5 130  VAL n 
5 131  VAL n 
5 132  ARG n 
5 133  ALA n 
5 134  LYS n 
5 135  ILE n 
5 136  LEU n 
5 137  GLY n 
5 138  SER n 
5 139  ALA n 
5 140  ARG n 
5 141  VAL n 
5 142  ARG n 
5 143  HIS n 
5 144  ILE n 
5 145  PRO n 
5 146  GLY n 
5 147  LEU n 
5 148  LYS n 
5 149  GLU n 
5 150  THR n 
5 151  LEU n 
5 152  ASP n 
5 153  PRO n 
5 154  LYS n 
5 155  THR n 
5 156  VAL n 
5 157  GLU n 
5 158  GLU n 
5 159  ILE n 
5 160  ASP n 
5 161  GLN n 
5 162  LYS n 
5 163  LEU n 
5 164  LYS n 
5 165  SER n 
5 166  LEU n 
5 167  PRO n 
5 168  LYS n 
5 169  GLU n 
5 170  HIS n 
5 171  LYS n 
5 172  ARG n 
5 173  TYR n 
5 174  LEU n 
5 175  HIS n 
5 176  ILE n 
5 177  ALA n 
5 178  ARG n 
5 179  GLU n 
5 180  GLY n 
5 181  GLU n 
5 182  ALA n 
5 183  ALA n 
5 184  ARG n 
5 185  GLN n 
5 186  HIS n 
5 187  LEU n 
5 188  ILE n 
5 189  GLU n 
5 190  ALA n 
5 191  ASN n 
5 192  LEU n 
5 193  ARG n 
5 194  LEU n 
5 195  VAL n 
5 196  VAL n 
5 197  SER n 
5 198  ILE n 
5 199  ALA n 
5 200  LYS n 
5 201  LYS n 
5 202  TYR n 
5 203  THR n 
5 204  GLY n 
5 205  ARG n 
5 206  GLY n 
5 207  LEU n 
5 208  SER n 
5 209  PHE n 
5 210  LEU n 
5 211  ASP n 
5 212  LEU n 
5 213  ILE n 
5 214  GLN n 
5 215  GLU n 
5 216  GLY n 
5 217  ASN n 
5 218  GLN n 
5 219  GLY n 
5 220  LEU n 
5 221  ILE n 
5 222  ARG n 
5 223  ALA n 
5 224  VAL n 
5 225  GLU n 
5 226  LYS n 
5 227  PHE n 
5 228  GLU n 
5 229  TYR n 
5 230  LYS n 
5 231  ARG n 
5 232  ARG n 
5 233  PHE n 
5 234  LYS n 
5 235  PHE n 
5 236  SER n 
5 237  THR n 
5 238  TYR n 
5 239  ALA n 
5 240  THR n 
5 241  TRP n 
5 242  TRP n 
5 243  ILE n 
5 244  ARG n 
5 245  GLN n 
5 246  ALA n 
5 247  ILE n 
5 248  ASN n 
5 249  ARG n 
5 250  ALA n 
5 251  ILE n 
5 252  ALA n 
5 253  ASP n 
5 254  GLN n 
5 255  ALA n 
5 256  ARG n 
5 257  THR n 
5 258  ILE n 
5 259  ARG n 
5 260  ILE n 
5 261  PRO n 
5 262  VAL n 
5 263  HIS n 
5 264  MET n 
5 265  VAL n 
5 266  GLU n 
5 267  THR n 
5 268  ILE n 
5 269  ASN n 
5 270  LYS n 
5 271  LEU n 
5 272  SER n 
5 273  ARG n 
5 274  THR n 
5 275  ALA n 
5 276  ARG n 
5 277  GLN n 
5 278  LEU n 
5 279  GLN n 
5 280  GLN n 
5 281  GLU n 
5 282  LEU n 
5 283  GLY n 
5 284  ARG n 
5 285  GLU n 
5 286  PRO n 
5 287  THR n 
5 288  TYR n 
5 289  GLU n 
5 290  GLU n 
5 291  ILE n 
5 292  ALA n 
5 293  GLU n 
5 294  ALA n 
5 295  MET n 
5 296  GLY n 
5 297  PRO n 
5 298  GLY n 
5 299  TRP n 
5 300  ASP n 
5 301  ALA n 
5 302  LYS n 
5 303  ARG n 
5 304  VAL n 
5 305  GLU n 
5 306  GLU n 
5 307  THR n 
5 308  LEU n 
5 309  LYS n 
5 310  ILE n 
5 311  ALA n 
5 312  GLN n 
5 313  GLU n 
5 314  PRO n 
5 315  VAL n 
5 316  SER n 
5 317  LEU n 
5 318  GLU n 
5 319  THR n 
5 320  PRO n 
5 321  ILE n 
5 322  GLY n 
5 323  ASP n 
5 324  GLU n 
5 325  LYS n 
5 326  ASP n 
5 327  SER n 
5 328  PHE n 
5 329  TYR n 
5 330  GLY n 
5 331  ASP n 
5 332  PHE n 
5 333  ILE n 
5 334  PRO n 
5 335  ASP n 
5 336  GLU n 
5 337  HIS n 
5 338  LEU n 
5 339  PRO n 
5 340  SER n 
5 341  PRO n 
5 342  VAL n 
5 343  ASP n 
5 344  ALA n 
5 345  ALA n 
5 346  THR n 
5 347  GLN n 
5 348  SER n 
5 349  LEU n 
5 350  LEU n 
5 351  SER n 
5 352  GLU n 
5 353  GLU n 
5 354  LEU n 
5 355  GLU n 
5 356  LYS n 
5 357  ALA n 
5 358  LEU n 
5 359  SER n 
5 360  LYS n 
5 361  LEU n 
5 362  SER n 
5 363  GLU n 
5 364  ARG n 
5 365  GLU n 
5 366  ALA n 
5 367  MET n 
5 368  VAL n 
5 369  LEU n 
5 370  LYS n 
5 371  LEU n 
5 372  ARG n 
5 373  LYS n 
5 374  GLY n 
5 375  LEU n 
5 376  ILE n 
5 377  ASP n 
5 378  GLY n 
5 379  ARG n 
5 380  GLU n 
5 381  HIS n 
5 382  THR n 
5 383  LEU n 
5 384  GLU n 
5 385  GLU n 
5 386  VAL n 
5 387  GLY n 
5 388  ALA n 
5 389  PHE n 
5 390  PHE n 
5 391  GLY n 
5 392  VAL n 
5 393  THR n 
5 394  ARG n 
5 395  GLU n 
5 396  ARG n 
5 397  ILE n 
5 398  ARG n 
5 399  GLN n 
5 400  ILE n 
5 401  GLU n 
5 402  ASN n 
5 403  LYS n 
5 404  ALA n 
5 405  LEU n 
5 406  ARG n 
5 407  LYS n 
5 408  LEU n 
5 409  LYS n 
5 410  TYR n 
5 411  HIS n 
5 412  GLU n 
5 413  SER n 
5 414  ARG n 
5 415  THR n 
5 416  ARG n 
5 417  LYS n 
5 418  LEU n 
5 419  ARG n 
5 420  ASP n 
5 421  PHE n 
5 422  LEU n 
5 423  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DC  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DA  n 
6 10   DG  n 
6 11   DA  n 
6 12   DG  n 
6 13   DC  n 
6 14   DC  n 
6 15   DC  n 
6 16   DA  n 
6 17   DA  n 
6 18   DA  n 
6 19   DA  n 
6 20   DT  n 
6 21   DA  n 
6 22   DC  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DG  n 
7 16   DC  n 
7 17   DT  n 
7 18   DC  n 
7 19   DT  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    GTP n 
8 2    G   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 1 423  ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 22 'Bacillus subtilis'    ? 1423 ? 
7 1 sample 1 27 'Bacillus subtilis'    ? 1423 ? 
8 1 sample 1 2  'Thermus thermophilus' ? 274  ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THETH       Q9Z9H6     ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8       Q8RQE9     ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8       Q8RQE8     ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP A0A1J1EUF1_THETH A0A1J1EUF1 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP SIGA_THET2       Q72L95     ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 6OY5             6OY5       ? 6 ? 1 
7 PDB 6OY5             6OY5       ? 7 ? 1 
8 PDB 6OY5             6OY5       ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6OY5 A 1 ? 315  ? Q9Z9H6     1 ? 315  ? 1 315  
2 1 6OY5 B 1 ? 315  ? Q9Z9H6     1 ? 315  ? 1 315  
3 2 6OY5 C 1 ? 1119 ? Q8RQE9     1 ? 1119 ? 1 1119 
4 3 6OY5 D 1 ? 1524 ? Q8RQE8     1 ? 1524 ? 1 1524 
5 4 6OY5 E 1 ? 99   ? A0A1J1EUF1 1 ? 99   ? 1 99   
6 5 6OY5 F 1 ? 423  ? Q72L95     1 ? 423  ? 1 423  
7 6 6OY5 G 1 ? 22   ? 6OY5       2 ? 23   ? 2 23   
8 7 6OY5 H 1 ? 27   ? 6OY5       0 ? 26   ? 0 26   
9 8 6OY5 I 1 ? 2    ? 6OY5       7 ? 8    ? 7 8    
# 
_struct_ref_seq_dif.align_id                     6 
_struct_ref_seq_dif.pdbx_pdb_id_code             6OY5 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           F 
_struct_ref_seq_dif.seq_num                      46 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q72L95 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          46 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            46 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"          ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6OY5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.16 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris-HCl (pH 8), 0.2M KCl, 50 mM MgCl2, 9.5 % PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-06-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6OY5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       99590 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             90 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.270 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.066 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.544 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.85 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3543 
_reflns_shell.percent_possible_all        64.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            1.143 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.723 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.544 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6OY5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.100 
_refine.ls_d_res_low                             43.925 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     91743 
_refine.ls_number_reflns_R_free                  1837 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.29 
_refine.ls_percent_reflns_R_free                 2.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2083 
_refine.ls_R_factor_R_free                       0.2592 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2072 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5VO8 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 35.08 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.52 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27603 
_refine_hist.pdbx_number_atoms_nucleic_acid   894 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28534 
_refine_hist.d_res_high                       3.100 
_refine_hist.d_res_low                        43.925 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 29134 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.546  ? 39592 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.961 ? 17768 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.088  ? 4455  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.011  ? 5035  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1000 3.1838  . . 110 5667 76.00 . . . 0.4337 . 0.3867 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1838 3.2775  . . 123 6188 83.00 . . . 0.4172 . 0.3600 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2775 3.3832  . . 141 6582 87.00 . . . 0.3818 . 0.3205 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3832 3.5041  . . 127 6699 89.00 . . . 0.4034 . 0.3209 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5041 3.6443  . . 150 6828 91.00 . . . 0.3546 . 0.2740 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6443 3.8101  . . 140 6922 92.00 . . . 0.3033 . 0.2547 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8101 4.0108  . . 135 6922 92.00 . . . 0.2728 . 0.2317 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0108 4.2619  . . 148 7068 93.00 . . . 0.3197 . 0.2030 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2619 4.5907  . . 133 7149 95.00 . . . 0.2340 . 0.1892 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5907 5.0521  . . 158 7320 97.00 . . . 0.2242 . 0.1776 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0521 5.7817  . . 157 7426 98.00 . . . 0.2063 . 0.1908 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7817 7.2790  . . 157 7539 99.00 . . . 0.2389 . 0.2086 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.2790 43.9296 . . 158 7596 97.00 . . . 0.2197 . 0.1559 . . . . . . . . . . 
# 
_struct.entry_id                     6OY5 
_struct.title                        
'X-ray crystal structure of a bacterial reiterative transcription complex of pyrG promoter at 3 min' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6OY5 
_struct_keywords.text            'RNA polymerase, pyrG, reiterative transcription, TRANSCRIPTION, TRANSCRIPTION-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
M N N 10 ? 
N N N 11 ? 
O N N 9  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? LEU B 85   ? ASP B 74   LEU B 85   1 ? 12 
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P12  AB3 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P13  AB4 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P14  AB5 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P15  AB6 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  AB7 ASP C 203  ? LEU C 211  ? ASP C 203  LEU C 211  1 ? 9  
HELX_P HELX_P17  AB8 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P18  AB9 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P19  AC1 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P20  AC2 LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P21  AC3 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P22  AC4 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P23  AC5 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P24  AC6 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  AC7 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P26  AC8 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P27  AC9 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P28  AD1 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P29  AD2 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P30  AD3 PRO C 536  ? PHE C 540  ? PRO C 536  PHE C 540  5 ? 5  
HELX_P HELX_P31  AD4 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P32  AD5 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P33  AD6 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P34  AD7 LEU C 583  ? LEU C 592  ? LEU C 583  LEU C 592  1 ? 10 
HELX_P HELX_P35  AD8 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P36  AD9 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P37  AE1 GLU C 731  ? ARG C 735  ? GLU C 731  ARG C 735  5 ? 5  
HELX_P HELX_P38  AE2 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P39  AE3 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P40  AE4 LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P41  AE5 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P42  AE6 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P43  AE7 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P44  AE8 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P45  AE9 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P46  AF1 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P47  AF2 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P48  AF3 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P49  AF4 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P50  AF5 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P51  AF6 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P52  AF7 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P53  AF8 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P54  AF9 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P55  AG1 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P56  AG2 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P57  AG3 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P58  AG4 GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P59  AG5 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P60  AG6 ARG D 486  ? GLY D 506  ? ARG D 486  GLY D 506  1 ? 21 
HELX_P HELX_P61  AG7 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P62  AG8 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P63  AG9 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P64  AH1 PRO D 563  ? ASN D 584  ? PRO D 563  ASN D 584  1 ? 22 
HELX_P HELX_P65  AH2 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P66  AH3 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P67  AH4 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P68  AH5 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P69  AH6 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P70  AH7 GLN D 680  ? LYS D 684  ? GLN D 680  LYS D 684  5 ? 5  
HELX_P HELX_P71  AH8 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P72  AH9 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P73  AI1 PRO D 730  ? ALA D 735  ? PRO D 730  ALA D 735  5 ? 6  
HELX_P HELX_P74  AI2 SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P75  AI3 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P76  AI4 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P77  AI5 THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P78  AI6 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P79  AI7 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P80  AI8 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P81  AI9 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P82  AJ1 GLU D 907  ? GLY D 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P83  AJ2 GLY D 923  ? SER D 945  ? GLY D 923  SER D 945  1 ? 23 
HELX_P HELX_P84  AJ3 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P85  AJ4 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P86  AJ5 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P87  AJ6 ASN D 1018 ? SER D 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P88  AJ7 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P89  AJ8 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P90  AJ9 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P91  AK1 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P92  AK2 SER D 1190 ? CYS D 1194 ? SER D 1190 CYS D 1194 5 ? 5  
HELX_P HELX_P93  AK3 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P94  AK4 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P95  AK5 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P96  AK6 GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P97  AK7 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P98  AK8 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P99  AK9 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P100 AL1 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P101 AL2 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P102 AL3 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P103 AL4 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P104 AL5 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P105 AL6 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P106 AL7 GLN D 1489 ? LYS D 1500 ? GLN D 1489 LYS D 1500 1 ? 12 
HELX_P HELX_P107 AL8 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P108 AL9 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P109 AM1 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P110 AM2 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P111 AM3 ASP F 79   ? GLY F 89   ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P112 AM4 THR F 95   ? GLY F 121  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P113 AM5 ASP F 123  ? GLY F 137  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P114 AM6 ASP F 152  ? LYS F 164  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P115 AM7 PRO F 167  ? ASN F 191  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P116 AM8 LEU F 192  ? LYS F 200  ? LEU F 192  LYS F 200  1 ? 9  
HELX_P HELX_P117 AM9 LYS F 201  ? THR F 203  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P118 AN1 SER F 208  ? PHE F 227  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P119 AN2 GLU F 228  ? ARG F 232  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P120 AN3 LYS F 234  ? ALA F 255  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P121 AN4 PRO F 261  ? GLY F 283  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P122 AN5 THR F 287  ? MET F 295  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P123 AN6 ASP F 300  ? GLN F 312  ? ASP F 300  GLN F 312  1 ? 13 
HELX_P HELX_P124 AN7 PHE F 328  ? ILE F 333  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P125 AN8 SER F 340  ? SER F 359  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P126 AN9 SER F 362  ? GLY F 374  ? SER F 362  GLY F 374  1 ? 13 
HELX_P HELX_P127 AO1 GLU F 384  ? ALA F 388  ? GLU F 384  ALA F 388  5 ? 5  
HELX_P HELX_P128 AO2 ARG F 394  ? THR F 415  ? ARG F 394  THR F 415  1 ? 22 
HELX_P HELX_P129 AO3 ARG F 416  ? ASP F 423  ? ARG F 416  ASP F 423  5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? B GLU 154  OE2   ? ? ? 1_555 J MG  .  MG ? ? B GLU 154  B MG  1001 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc2  metalc ?    ? D CYS 58   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc3  metalc ?    ? D CYS 60   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc4  metalc ?    ? D CYS 73   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc5  metalc ?    ? D CYS 76   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc6  metalc ?    ? D ASP 739  OD1   ? ? ? 1_555 K MG  .  MG ? ? D ASP 739  D MG  2001 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc7  metalc ?    ? D ASP 739  OD2   ? ? ? 1_555 O MG  .  MG ? ? D ASP 739  D MG  2005 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc8  metalc ?    ? D ASP 741  OD1   ? ? ? 1_555 K MG  .  MG ? ? D ASP 741  D MG  2001 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc9  metalc ?    ? D ASP 741  OD2   ? ? ? 1_555 K MG  .  MG ? ? D ASP 741  D MG  2001 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc10 metalc ?    ? D ASP 743  OD1   ? ? ? 1_555 K MG  .  MG ? ? D ASP 743  D MG  2001 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc11 metalc ?    ? D LYS 840  O     ? ? ? 1_555 J MG  .  MG ? ? D LYS 840  B MG  1001 1_555 ? ? ? ? ? ? ? 1.913 ? 
metalc12 metalc ?    ? D CYS 1112 SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 1112 D ZN  2003 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc13 metalc ?    ? D CYS 1194 SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 1194 D ZN  2003 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc14 metalc ?    ? D CYS 1201 SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 1201 D ZN  2003 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc15 metalc ?    ? D CYS 1204 SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 1204 D ZN  2003 1_555 ? ? ? ? ? ? ? 2.514 ? 
covale1  covale both ? I GTP 1    "O3'" ? ? ? 1_555 I G   2  P  ? ? I GTP 7    I G   8    1_555 ? ? ? ? ? ? ? 1.614 ? 
metalc16 metalc ?    ? I G   2    "O3'" ? ? ? 1_555 K MG  .  MG ? ? I G   8    D MG  2001 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc17 metalc ?    ? N GTP .    O2G   ? ? ? 1_555 O MG  .  MG ? ? D GTP 2004 D MG  2005 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc18 metalc ?    ? N GTP .    O1A   ? ? ? 1_555 O MG  .  MG ? ? D GTP 2004 D MG  2005 1_555 ? ? ? ? ? ? ? 2.869 ? 
hydrog1  hydrog ?    ? G DC  2    N4    ? ? ? 1_555 H DG  26 O6 ? ? G DC  3    H DG  25   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog2  hydrog ?    ? G DC  3    N4    ? ? ? 1_555 H DA  25 N1 ? ? G DC  4    H DA  24   1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     
? 
hydrog3  hydrog ?    ? G DC  5    N3    ? ? ? 1_555 H DG  23 N1 ? ? G DC  6    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? G DC  5    N4    ? ? ? 1_555 H DG  23 O6 ? ? G DC  6    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? G DC  5    O2    ? ? ? 1_555 H DG  23 N2 ? ? G DC  6    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? G DA  6    N1    ? ? ? 1_555 H DT  22 N3 ? ? G DA  7    H DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? G DA  6    N6    ? ? ? 1_555 H DT  22 O4 ? ? G DA  7    H DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? G DT  7    N3    ? ? ? 1_555 H DA  21 N1 ? ? G DT  8    H DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? G DT  7    O4    ? ? ? 1_555 H DA  21 N6 ? ? G DT  8    H DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? G DC  8    N3    ? ? ? 1_555 H DG  20 N1 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? G DC  8    N4    ? ? ? 1_555 H DG  20 O6 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? G DC  8    O2    ? ? ? 1_555 H DG  20 N2 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? G DA  9    N1    ? ? ? 1_555 H DT  19 N3 ? ? G DA  10   H DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? G DA  9    N6    ? ? ? 1_555 H DT  19 O4 ? ? G DA  10   H DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? G DG  10   N1    ? ? ? 1_555 H DC  18 N3 ? ? G DG  11   H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? G DG  10   N2    ? ? ? 1_555 H DC  18 O2 ? ? G DG  11   H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? G DG  10   O6    ? ? ? 1_555 H DC  18 N4 ? ? G DG  11   H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? G DA  11   N1    ? ? ? 1_555 H DT  17 N3 ? ? G DA  12   H DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? G DA  11   N6    ? ? ? 1_555 H DT  17 O4 ? ? G DA  12   H DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? G DG  12   N1    ? ? ? 1_555 H DC  16 N3 ? ? G DG  13   H DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? G DG  12   N2    ? ? ? 1_555 H DC  16 O2 ? ? G DG  13   H DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? G DG  12   O6    ? ? ? 1_555 H DC  16 N4 ? ? G DG  13   H DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? G DC  14   N3    ? ? ? 1_555 I G   2  N1 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? G DC  14   N4    ? ? ? 1_555 I G   2  O6 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? G DC  14   O2    ? ? ? 1_555 I G   2  N2 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? G DC  15   N3    ? ? ? 1_555 I GTP 1  N2 ? ? G DC  16   I GTP 7    1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog27 hydrog ?    ? G DC  15   O2    ? ? ? 1_555 I GTP 1  N1 ? ? G DC  16   I GTP 7    1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -13.24 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -9.11  
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 2.12   
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -7.62  
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -2.20  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 5 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 3 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? VAL A 13   ? VAL A 10   VAL A 13   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA1 4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA2 1 LEU A 99   ? ALA A 103  ? LEU A 99   ALA A 103  
AA2 2 LEU A 138  ? GLY A 147  ? LEU A 138  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? THR B 15   ? VAL B 10   THR B 15   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
AA7 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 LYS C 109  ? PRO C 119  ? LYS C 109  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? ASP C 173  ? ILE C 172  ASP C 173  
AB6 4 SER C 183  ? VAL C 186  ? SER C 183  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 ILE C 496  ? ALA C 497  ? ILE C 496  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AD7 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AD7 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD8 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AD9 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD9 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD9 3 ARG D 210  ? PRO D 226  ? ARG D 210  PRO D 226  
AD9 4 GLY D 383  ? HIS D 388  ? GLY D 383  HIS D 388  
AD9 5 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AE3 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 315  ? SER F 316  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE8 3 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AF3 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 VAL D 1280 ? ILE D 1283 ? VAL D 1280 ILE D 1283 
AF5 2 VAL D 1292 ? GLU D 1295 ? VAL D 1292 GLU D 1295 
AF5 3 GLU D 1302 ? TYR D 1303 ? GLU D 1302 TYR D 1303 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 10   ? N VAL A 10   O GLU A 26   ? O GLU A 26   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O LYS A 194  ? O LYS A 194  N GLU A 182  ? N GLU A 182  
AA2 1 2 N LEU A 99   ? N LEU A 99   O VAL A 142  ? O VAL A 142  
AA2 2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
AA7 1 2 N LEU B 99   ? N LEU B 99   O VAL B 142  ? O VAL B 142  
AA7 2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ALA B 130  ? O ALA B 130  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N LEU C 69   ? N LEU C 69   O ARG C 97   ? O ARG C 97   
AB3 2 3 N LEU C 100  ? N LEU C 100  O LYS C 109  ? O LYS C 109  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N GLY C 145  ? N GLY C 145  O ILE C 163  ? O ILE C 163  
AB6 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB6 3 4 N ASP C 173  ? N ASP C 173  O LYS C 185  ? O LYS C 185  
AB6 4 5 N VAL C 186  ? N VAL C 186  O ARG C 189  ? O ARG C 189  
AB7 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N VAL C 475  ? N VAL C 475  O VAL C 478  ? O VAL C 478  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O LYS C 851  ? O LYS C 851  N ILE C 690  ? N ILE C 690  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N ALA C 712  ? N ALA C 712  O GLU C 821  ? O GLU C 821  
AC7 2 3 O ARG C 824  ? O ARG C 824  N VAL C 804  ? N VAL C 804  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N GLY D 627  ? N GLY D 627  O VAL D 747  ? O VAL D 747  
AD1 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 630  ? N VAL D 630  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD3 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AD7 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AD8 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AD9 1 2 N ARG D 318  ? N ARG D 318  O GLU D 338  ? O GLU D 338  
AD9 2 3 O VAL D 331  ? O VAL D 331  N LEU D 225  ? N LEU D 225  
AD9 3 4 N GLU D 214  ? N GLU D 214  O VAL D 384  ? O VAL D 384  
AD9 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AE1 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE1 2 3 O LEU D 304  ? O LEU D 304  N PHE D 251  ? N PHE D 251  
AE2 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE3 2 3 O VAL D 271  ? O VAL D 271  N GLU D 260  ? N GLU D 260  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE5 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N THR D 537  ? N THR D 537  O VAL F 315  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 N VAL D 1280 ? N VAL D 1280 O GLU D 1295 ? O GLU D 1295 
AF5 2 3 N VAL D 1292 ? N VAL D 1292 O TYR D 1303 ? O TYR D 1303 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N ASP D 1383 ? N ASP D 1383 O ALA D 1416 ? O ALA D 1416 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  1001 ? 3  'binding site for residue MG B 1001'               
AC2 Software D MG  2001 ? 4  'binding site for residue MG D 2001'               
AC3 Software D ZN  2002 ? 4  'binding site for residue ZN D 2002'               
AC4 Software D ZN  2003 ? 4  'binding site for residue ZN D 2003'               
AC5 Software D GTP 2004 ? 10 'binding site for residue GTP D 2004'              
AC6 Software D MG  2005 ? 2  'binding site for residue MG D 2005'               
AC7 Software I GTP 7    ? 15 'binding site for Di-nucleotide GTP I 7 and G I 8' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  GLU B 154  ? GLU B 154  . ? 1_555 ? 
2  AC1 3  ASP B 168  ? ASP B 168  . ? 1_555 ? 
3  AC1 3  LYS D 840  ? LYS D 840  . ? 1_555 ? 
4  AC2 4  ASP D 739  ? ASP D 739  . ? 1_555 ? 
5  AC2 4  ASP D 741  ? ASP D 741  . ? 1_555 ? 
6  AC2 4  ASP D 743  ? ASP D 743  . ? 1_555 ? 
7  AC2 4  G   I 2    ? G   I 8    . ? 1_555 ? 
8  AC3 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
12 AC4 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
13 AC4 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
14 AC4 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
15 AC4 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
16 AC5 10 ARG C 879  ? ARG C 879  . ? 1_555 ? 
17 AC5 10 ARG D 704  ? ARG D 704  . ? 1_555 ? 
18 AC5 10 PRO D 706  ? PRO D 706  . ? 1_555 ? 
19 AC5 10 ASN D 737  ? ASN D 737  . ? 1_555 ? 
20 AC5 10 ASP D 739  ? ASP D 739  . ? 1_555 ? 
21 AC5 10 ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
22 AC5 10 MG  O .    ? MG  D 2005 . ? 1_555 ? 
23 AC5 10 DC  G 13   ? DC  G 14   . ? 1_555 ? 
24 AC5 10 DC  G 14   ? DC  G 15   . ? 1_555 ? 
25 AC5 10 G   I 2    ? G   I 8    . ? 1_555 ? 
26 AC6 2  ASP D 739  ? ASP D 739  . ? 1_555 ? 
27 AC6 2  GTP N .    ? GTP D 2004 . ? 1_555 ? 
28 AC7 15 ARG C 409  ? ARG C 409  . ? 1_555 ? 
29 AC7 15 GLN C 567  ? GLN C 567  . ? 1_555 ? 
30 AC7 15 LYS C 838  ? LYS C 838  . ? 1_555 ? 
31 AC7 15 LYS C 846  ? LYS C 846  . ? 1_555 ? 
32 AC7 15 HIS C 999  ? HIS C 999  . ? 1_555 ? 
33 AC7 15 ARG D 704  ? ARG D 704  . ? 1_555 ? 
34 AC7 15 ALA D 705  ? ALA D 705  . ? 1_555 ? 
35 AC7 15 PRO D 706  ? PRO D 706  . ? 1_555 ? 
36 AC7 15 ASP D 741  ? ASP D 741  . ? 1_555 ? 
37 AC7 15 ASP D 743  ? ASP D 743  . ? 1_555 ? 
38 AC7 15 MG  K .    ? MG  D 2001 . ? 1_555 ? 
39 AC7 15 GTP N .    ? GTP D 2004 . ? 1_555 ? 
40 AC7 15 DC  G 14   ? DC  G 15   . ? 1_555 ? 
41 AC7 15 DC  G 15   ? DC  G 16   . ? 1_555 ? 
42 AC7 15 DA  G 16   ? DA  G 17   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6OY5 
_atom_sites.fract_transf_matrix[1][1]   0.005373 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000851 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009764 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? 447.602 11.149  729.967 1.00 117.04 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? 448.500 12.203  730.447 1.00 128.48 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? 449.810 12.284  729.661 1.00 134.20 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? 450.174 11.357  728.935 1.00 136.63 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? 448.824 12.001  731.934 1.00 133.04 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? 449.878 12.856  732.367 1.00 125.80 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? 450.519 13.402  729.832 1.00 136.16 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? 451.806 13.626  729.180 1.00 129.82 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? 452.914 12.849  729.885 1.00 127.02 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? 453.041 12.908  731.113 1.00 130.54 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? 452.138 15.119  729.179 1.00 129.44 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? 453.623 15.433  729.021 1.00 135.28 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? 454.063 15.481  727.541 1.00 133.41 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? 455.543 15.889  727.407 1.00 123.16 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? 455.798 16.782  726.236 1.00 117.04 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? 453.732 12.143  729.105 1.00 124.50 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? 454.819 11.357  729.666 1.00 119.39 ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? 456.023 12.240  729.962 1.00 118.37 ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? 456.230 13.286  729.340 1.00 120.48 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? 455.231 10.256  728.701 1.00 117.20 ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? 455.269 8.878   729.328 1.00 118.32 ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? 454.006 8.164   728.879 1.00 120.00 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? 456.523 8.104   728.951 1.00 104.43 ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? 456.821 11.809  730.925 1.00 114.71 ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? 458.011 12.542  731.324 1.00 115.07 ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? 459.276 11.888  730.783 1.00 114.19 ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? 459.284 10.709  730.408 1.00 111.44 ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? 458.064 12.736  732.837 1.00 109.37 ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? 456.930 13.626  733.273 1.00 117.10 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? 457.162 15.078  732.831 1.00 118.78 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? 456.114 16.039  733.439 1.00 121.01 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? 454.705 15.673  733.072 1.00 119.71 ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? 460.346 12.689  730.765 1.00 105.97 ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? 461.608 12.325  730.151 1.00 98.96  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? 462.067 10.917  730.544 1.00 100.48 ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? 462.187 10.616  731.738 1.00 104.39 ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? 462.644 13.357  730.595 1.00 100.89 ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? 462.369 10.058  729.567 1.00 102.31 ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? 462.691 8.645   729.822 1.00 96.33  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? 464.135 8.391   730.259 1.00 99.05  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 465.066 9.121   729.899 1.00 93.14  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? 462.408 7.999   728.468 1.00 101.49 ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? 462.704 9.083   727.477 1.00 108.30 ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? 462.261 10.355  728.131 1.00 108.97 ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? 464.326 7.245   730.933 1.00 100.90 ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 465.668 6.758   731.287 1.00 106.66 ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 466.461 6.261   730.076 1.00 104.09 ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 465.984 5.469   729.251 1.00 97.83  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 465.630 5.720   732.429 1.00 97.62  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 465.033 6.355   733.652 1.00 110.27 ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 464.855 4.462   732.058 1.00 100.76 ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 467.724 6.669   730.045 1.00 100.01 ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 468.689 6.446   728.986 1.00 102.49 ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 469.824 5.519   729.427 1.00 110.84 ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 470.645 5.898   730.264 1.00 120.25 ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 469.191 7.843   728.605 1.00 109.61 ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 470.334 7.881   727.638 1.00 113.73 ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 470.382 7.044   726.533 1.00 114.05 ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 471.325 8.840   727.786 1.00 115.18 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 471.439 7.123   725.627 1.00 114.48 ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 472.383 8.924   726.875 1.00 118.28 ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 472.437 8.071   725.799 1.00 111.80 ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 469.826 4.279   728.928 1.00 110.15 ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 470.805 3.249   729.291 1.00 111.61 ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 471.851 3.097   728.175 1.00 109.18 ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 471.555 3.344   727.002 1.00 104.87 ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 470.125 1.909   729.540 1.00 108.20 ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 468.931 2.143   730.283 1.00 105.92 ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 471.043 0.990   730.347 1.00 103.33 ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 473.092 2.749   728.551 1.00 112.40 ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 474.223 2.592   727.619 1.00 101.36 ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 474.999 1.298   727.895 1.00 96.27  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 475.640 1.172   728.941 1.00 101.68 ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 475.165 3.806   727.711 1.00 96.45  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 476.434 3.543   726.998 1.00 99.82  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 474.482 5.045   727.129 1.00 98.44  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 475.074 0.410   726.909 1.00 99.49  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 475.833 -0.848  727.037 1.00 104.93 ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 476.952 -0.964  725.984 1.00 107.26 ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 476.886 -1.839  725.118 1.00 102.48 ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 474.896 -2.063  726.921 1.00 98.55  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 473.755 -2.101  727.868 1.00 105.59 ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 473.010 -3.438  727.753 1.00 108.96 ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 471.949 -3.427  726.743 1.00 108.03 ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 470.665 -3.176  727.012 1.00 109.02 ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 470.284 -2.907  728.256 1.00 113.53 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 469.754 -3.190  726.041 1.00 106.59 ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 478.016 -0.167  726.096 1.00 105.49 ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 479.066 -0.241  725.092 1.00 106.60 ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 479.962 -1.452  725.360 1.00 110.77 ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 480.330 -1.747  726.497 1.00 110.13 ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 479.916 1.036   725.070 1.00 114.41 ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 480.771 1.094   726.220 1.00 112.39 ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 479.026 2.265   725.052 1.00 112.94 ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 480.314 -2.153  724.293 1.00 121.70 ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 481.344 -3.187  724.286 1.00 123.08 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 482.465 -2.726  723.362 1.00 122.21 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 482.275 -2.645  722.146 1.00 119.49 ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 480.730 -4.534  723.916 1.00 119.82 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 481.660 -5.698  723.757 1.00 119.18 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 480.888 -6.912  723.298 1.00 119.64 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 479.790 -6.785  722.749 1.00 115.67 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 481.425 -8.100  723.568 1.00 118.24 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 483.619 -2.413  723.950 1.00 128.09 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 484.837 -1.920  723.335 1.00 120.87 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 484.584 -0.632  722.575 1.00 117.10 ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 483.630 0.108   722.850 1.00 116.38 ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 485.409 -0.384  721.561 1.00 120.08 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 485.215 0.798   720.732 1.00 123.99 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 484.419 0.456   719.484 1.00 125.27 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 484.140 1.347   718.666 1.00 117.79 ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 486.563 1.420   720.312 1.00 121.60 ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 487.525 1.740   721.449 1.00 114.45 ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 488.823 2.379   720.959 1.00 106.69 ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 488.508 3.574   720.182 1.00 113.83 ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 488.231 4.764   720.721 1.00 115.20 ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 488.232 4.918   722.035 1.00 119.39 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 487.936 5.808   719.955 1.00 112.33 ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 484.150 -0.838  719.291 1.00 123.22 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 483.522 -1.348  718.083 1.00 123.69 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 481.993 -1.262  718.121 1.00 119.84 ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 481.368 -0.867  717.133 1.00 121.53 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 483.950 -2.804  717.885 1.00 125.78 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 485.421 -3.042  718.197 1.00 125.49 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 486.363 -2.718  717.052 1.00 124.93 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 486.287 -1.591  716.492 1.00 124.22 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 487.196 -3.596  716.733 1.00 118.91 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 481.377 -1.616  719.249 1.00 113.31 ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 479.952 -1.903  719.316 1.00 106.87 ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 479.331 -1.188  720.509 1.00 115.10 ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 480.022 -0.879  721.484 1.00 117.30 ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 479.747 -3.428  719.400 1.00 106.97 ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 478.318 -3.888  719.506 1.00 111.55 ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 477.368 -3.462  718.585 1.00 108.50 ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 477.911 -4.755  720.520 1.00 112.91 ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 476.046 -3.883  718.668 1.00 108.13 ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 476.589 -5.181  720.613 1.00 111.86 ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 475.659 -4.736  719.682 1.00 111.56 ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 474.336 -5.130  719.731 1.00 109.37 ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 478.041 -0.855  720.387 1.00 115.39 ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 477.265 -0.286  721.482 1.00 109.40 ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 475.783 -0.573  721.332 1.00 104.77 ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 475.314 -0.884  720.236 1.00 109.83 ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 475.062 -0.573  722.457 1.00 103.39 ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 473.602 -0.695  722.476 1.00 99.15  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 473.078 0.509   723.251 1.00 98.41  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 473.624 0.844   724.300 1.00 103.75 ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 473.152 -2.015  723.110 1.00 95.36  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 473.695 -3.255  722.387 1.00 101.15 ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 473.110 -4.561  722.918 1.00 106.70 ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 472.268 -4.495  723.833 1.00 112.55 ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 473.485 -5.656  722.438 1.00 103.90 ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 472.086 1.218   722.718 1.00 97.12  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 471.628 2.468   723.335 1.00 96.72  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 470.110 2.463   723.478 1.00 105.08 ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 469.398 2.566   722.471 1.00 104.61 ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 472.112 3.654   722.508 1.00 95.69  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 473.613 3.683   722.350 1.00 103.13 ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 474.258 2.800   721.494 1.00 99.68  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 474.376 4.617   723.010 1.00 105.47 ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 475.619 2.806   721.355 1.00 99.28  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 475.745 4.647   722.849 1.00 101.49 ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 476.362 3.734   722.023 1.00 103.42 ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 469.613 2.424   724.751 1.00 107.46 ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 468.190 2.286   725.079 1.00 96.06  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 467.611 3.617   725.533 1.00 92.66  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 468.305 4.449   726.125 1.00 95.35  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 467.940 1.213   726.153 1.00 88.93  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 466.502 0.765   726.078 1.00 87.36  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 468.878 0.042   726.002 1.00 92.07  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 466.363 3.858   725.160 1.00 86.28  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 465.614 5.021   725.606 1.00 92.20  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? 464.247 4.480   726.024 1.00 100.21 ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? 463.512 3.949   725.185 1.00 97.36  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 465.504 6.079   724.513 1.00 89.71  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 465.734 7.478   725.078 1.00 96.05  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 467.142 7.523   725.657 1.00 92.35  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 465.532 8.573   724.054 1.00 99.54  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? 463.901 4.599   727.313 1.00 105.37 ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? 462.601 4.113   727.770 1.00 99.36  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? 462.043 4.902   728.945 1.00 99.27  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? 462.818 5.415   729.760 1.00 101.23 ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? 462.874 2.666   728.195 1.00 92.54  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? 461.951 1.902   729.036 1.00 94.02  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? 462.434 0.457   729.062 1.00 95.93  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? 463.649 0.261   729.372 1.00 83.86  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? 461.608 -0.469  728.878 1.00 94.66  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? 460.696 5.023   729.066 1.00 101.10 ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? 459.648 4.721   728.080 1.00 101.47 ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? 459.413 5.932   727.136 1.00 100.99 ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? 459.648 7.095   727.543 1.00 93.05  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? 458.421 4.443   728.948 1.00 103.02 ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? 458.590 5.350   730.076 1.00 102.32 ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? 460.093 5.448   730.339 1.00 107.63 ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? 458.949 5.648   725.905 1.00 101.82 ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? 458.630 6.642   724.881 1.00 95.46  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? 457.206 6.454   724.371 1.00 93.61  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? 456.726 5.322   724.220 1.00 91.65  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? 459.653 6.492   723.729 1.00 100.03 ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? 461.082 7.013   723.919 1.00 95.85  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? 461.987 6.308   723.000 1.00 94.24  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? 461.129 8.494   723.553 1.00 96.06  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? 456.582 7.564   723.990 1.00 87.87  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? 455.236 7.509   723.425 1.00 100.44 ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? 455.130 6.605   722.200 1.00 104.14 ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? 456.084 6.426   721.440 1.00 104.04 ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? 454.702 8.911   723.105 1.00 104.49 ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? 454.250 9.684   724.325 1.00 111.48 ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? 452.972 9.060   724.926 1.00 115.71 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? 452.329 8.240   724.222 1.00 108.20 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? 452.622 9.358   726.099 1.00 121.87 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? 453.959 5.973   722.062 1.00 108.06 ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? 453.716 5.035   720.976 1.00 103.25 ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? 454.037 5.697   719.656 1.00 105.32 ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? 453.561 6.802   719.378 1.00 104.85 ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? 452.247 4.621   720.931 1.00 105.12 ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? 451.988 3.562   719.874 1.00 113.94 ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? 450.516 3.258   719.672 1.00 113.13 ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? 449.853 4.455   719.146 1.00 117.74 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? 448.722 4.455   718.442 1.00 116.72 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? 448.101 3.310   718.165 1.00 114.25 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? 448.206 5.609   718.022 1.00 106.03 ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? 454.846 5.012   718.845 1.00 104.18 ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? 455.215 5.493   717.536 1.00 101.34 ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? 456.464 6.338   717.531 1.00 99.60  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? 456.989 6.642   716.460 1.00 101.46 ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? 456.954 6.735   718.695 1.00 99.68  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? 458.173 7.518   718.755 1.00 94.55  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? 459.407 6.643   718.667 1.00 95.63  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? 460.512 7.184   718.585 1.00 98.99  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? 458.175 8.357   720.022 1.00 92.72  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? 457.580 9.706   719.839 1.00 86.87  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? 456.212 9.866   719.793 1.00 86.98  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? 458.381 10.828  719.832 1.00 80.44  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? 455.661 11.120  719.639 1.00 86.92  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? 457.841 12.092  719.698 1.00 78.37  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? 456.483 12.244  719.594 1.00 82.53  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? 459.246 5.316   718.739 1.00 93.04  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? 460.386 4.425   718.575 1.00 94.01  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? 461.053 4.622   717.227 1.00 102.00 ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? 462.267 4.864   717.133 1.00 96.02  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? 460.255 4.536   716.160 1.00 101.50 ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? 460.788 4.770   714.829 1.00 92.71  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? 460.925 6.260   714.553 1.00 90.90  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? 461.854 6.662   713.852 1.00 94.76  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? 459.943 4.037   713.766 1.00 85.24  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? 459.168 2.948   714.383 1.00 91.29  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? 458.946 4.957   713.187 1.00 76.57  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? 460.129 7.120   715.187 1.00 88.69  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? 460.288 8.544   714.913 1.00 90.24  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? 461.704 8.982   715.269 1.00 91.06  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? 462.327 9.755   714.538 1.00 87.07  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? 459.253 9.371   715.685 1.00 92.81  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? 457.943 9.038   715.228 1.00 95.10  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? 459.461 10.861  715.441 1.00 86.26  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? 462.238 8.475   716.377 1.00 95.89  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? 463.643 8.707   716.708 1.00 96.38  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? 464.599 7.741   716.022 1.00 93.98  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 465.678 8.150   715.586 1.00 91.79  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? 463.859 8.607   718.217 1.00 94.66  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? 463.627 9.866   719.017 1.00 95.07  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? 464.183 9.610   720.402 1.00 101.54 ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? 464.352 11.034  718.335 1.00 92.67  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? 464.257 6.451   715.983 1.00 99.49  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 465.217 5.448   715.523 1.00 98.42  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 465.682 5.612   714.087 1.00 92.44  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 466.868 5.468   713.788 1.00 91.77  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? 464.744 5.869   713.171 1.00 91.37  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 465.102 5.901   711.754 1.00 92.28  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 465.977 7.085   711.361 1.00 89.25  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 467.091 6.854   710.864 1.00 91.78  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? 463.824 5.849   710.913 1.00 94.05  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? 464.076 5.373   709.500 1.00 94.23  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? 464.518 4.235   709.275 1.00 95.84  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? 463.805 6.242   708.535 1.00 90.66  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 465.628 8.332   711.661 1.00 85.01  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 466.486 9.433   711.224 1.00 84.74  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 467.869 9.361   711.785 1.00 87.22  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 468.811 9.860   711.159 1.00 87.98  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 465.749 10.680  711.716 1.00 84.65  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? 464.430 10.260  711.915 1.00 84.99  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? 464.439 8.849   712.337 1.00 91.28  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 468.034 8.814   712.978 1.00 90.86  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 469.393 8.717   713.487 1.00 95.82  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 470.186 7.714   712.667 1.00 95.80  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 471.334 7.982   712.297 1.00 99.60  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 469.377 8.342   714.964 1.00 94.69  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 468.847 9.484   715.843 1.00 88.73  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 468.884 9.013   717.277 1.00 88.13  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 469.489 10.866  715.623 1.00 86.63  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 469.559 6.584   712.322 1.00 92.43  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 470.187 5.608   711.437 1.00 90.98  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 470.534 6.210   710.080 1.00 90.18  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 471.607 5.940   709.537 1.00 90.72  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 469.318 4.374   711.326 1.00 90.51  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 469.855 3.368   710.385 1.00 88.67  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 468.977 2.181   710.450 1.00 92.17  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 469.443 1.139   709.569 1.00 90.44  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 469.005 1.043   708.325 1.00 93.54  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 468.086 1.936   707.915 1.00 86.76  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 469.485 0.084   707.512 1.00 89.45  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 469.635 6.989   709.484 1.00 90.10  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 469.984 7.569   708.194 1.00 90.87  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 471.215 8.460   708.337 1.00 94.38  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 472.181 8.327   707.571 1.00 96.06  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 468.781 8.331   707.609 1.00 84.89  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 467.633 7.387   707.226 1.00 84.74  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 466.372 8.063   706.715 1.00 82.86  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 466.589 8.981   705.611 1.00 87.30  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 466.802 8.632   704.339 1.00 93.92  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 466.851 7.356   703.957 1.00 88.35  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 466.969 9.582   703.427 1.00 93.72  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 471.223 9.327   709.356 1.00 91.87  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 472.356 10.217  709.591 1.00 92.30  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 473.600 9.432   710.009 1.00 91.79  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 474.729 9.808   709.674 1.00 94.26  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 471.972 11.296  710.606 1.00 92.97  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 470.862 12.137  709.998 1.00 95.51  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 473.145 12.238  710.794 1.00 95.20  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 470.123 12.984  710.984 1.00 95.00  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 473.425 8.372   710.795 1.00 88.47  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 474.571 7.573   711.229 1.00 89.95  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 475.249 6.883   710.054 1.00 92.58  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 476.473 6.702   710.050 1.00 92.42  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 474.148 6.528   712.257 1.00 92.41  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 473.815 6.920   713.690 1.00 96.20  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 473.000 5.781   714.230 1.00 94.63  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 475.071 7.130   714.531 1.00 90.61  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 474.467 6.426   709.078 1.00 94.42  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 475.033 5.683   707.960 1.00 93.59  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 475.711 6.589   706.939 1.00 92.33  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 476.653 6.150   706.264 1.00 87.67  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 473.932 4.848   707.286 1.00 84.99  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 473.483 3.604   708.066 1.00 78.96  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 472.345 2.856   707.430 1.00 75.40  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 474.645 2.666   708.310 1.00 84.46  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 475.328 7.866   706.904 1.00 92.04  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 475.768 8.818   705.897 1.00 95.72  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 476.735 9.886   706.395 1.00 98.68  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 477.850 9.987   705.871 1.00 104.90 ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 474.521 9.478   705.300 1.00 100.00 ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 473.852 10.278  706.256 1.00 91.98  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 476.322 10.719  707.358 1.00 93.87  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 476.954 12.013  707.609 1.00 94.51  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 478.047 12.020  708.681 1.00 91.92  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 478.556 13.102  709.012 1.00 81.78  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 475.876 13.030  707.980 1.00 91.68  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 474.852 13.020  707.003 1.00 92.89  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 478.428 10.861  709.214 1.00 96.09  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 479.442 10.785  710.272 1.00 99.38  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 480.871 10.848  709.757 1.00 101.44 ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 481.300 9.932   709.042 1.00 108.51 ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 479.276 9.510   711.110 1.00 102.31 ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 477.879 9.459   711.752 1.00 95.07  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 480.402 9.405   712.104 1.00 103.07 ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 477.442 10.740  712.414 1.00 89.25  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 481.634 11.889  710.099 1.00 103.29 ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 483.030 11.998  709.626 1.00 109.57 ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 483.920 10.839  710.080 1.00 108.58 ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 483.607 10.112  711.030 1.00 101.40 ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 483.495 13.352  710.186 1.00 101.05 ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 482.194 14.147  710.293 1.00 100.84 ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 481.159 13.135  710.730 1.00 99.06  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 484.994 10.617  709.312 1.00 107.89 ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 485.899 9.504   709.516 1.00 106.73 ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 487.222 9.693   708.780 1.00 113.83 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 487.553 10.788  708.318 1.00 112.93 ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 487.973 8.596   708.640 1.00 116.23 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 489.230 8.635   707.900 1.00 115.55 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 489.281 7.546   706.830 1.00 114.93 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 488.706 6.461   706.983 1.00 118.42 ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 490.455 8.467   708.838 1.00 110.84 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 490.393 7.211   709.538 1.00 99.46  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 490.571 9.630   709.814 1.00 103.96 ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 489.984 7.855   705.736 1.00 114.19 ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 490.225 6.885   704.674 1.00 114.99 ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 491.513 7.191   703.899 1.00 110.30 ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 491.922 8.347   703.761 1.00 108.91 ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 489.020 6.834   703.730 1.00 118.38 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 492.141 6.126   703.391 1.00 106.85 ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 493.272 6.219   702.464 1.00 106.65 ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 492.842 6.911   701.181 1.00 101.05 ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 491.870 6.486   700.553 1.00 105.04 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 493.788 4.820   702.144 1.00 107.85 ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 494.847 4.863   701.043 1.00 98.82  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 494.235 4.131   703.416 1.00 117.91 ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 493.462 8.048   700.851 1.00 97.95  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 493.164 8.710   699.577 1.00 103.67 ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 494.197 8.571   698.427 1.00 112.21 ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 493.836 8.860   697.275 1.00 108.29 ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 492.874 10.192  699.829 1.00 101.58 ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 494.032 10.838  700.373 1.00 106.70 ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 491.711 10.335  700.754 1.00 103.89 ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 495.458 8.183   698.669 1.00 111.67 ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 496.438 8.145   697.576 1.00 103.16 ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 497.597 7.206   697.909 1.00 101.58 ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 497.901 6.987   699.076 1.00 106.51 ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 496.944 9.565   697.298 1.00 105.64 ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 497.775 9.638   696.168 1.00 110.15 ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 498.256 6.659   696.891 1.00 103.17 ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 499.405 5.775   697.114 1.00 109.59 ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 500.515 6.082   696.107 1.00 113.90 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 500.237 6.267   694.918 1.00 116.64 ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 499.012 4.286   697.031 1.00 109.50 ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 500.230 3.388   697.239 1.00 110.29 ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 497.977 3.966   698.071 1.00 105.85 ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 501.766 6.197   696.580 1.00 119.50 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 502.932 6.231   695.688 1.00 126.43 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 503.825 5.060   696.074 1.00 122.70 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 504.356 5.030   697.186 1.00 124.30 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 503.756 7.526   695.781 1.00 127.37 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 505.114 7.393   695.096 1.00 128.60 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 505.196 7.395   693.707 1.00 131.70 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 506.285 7.183   695.810 1.00 130.87 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 506.405 7.256   693.045 1.00 132.74 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 507.511 7.025   695.147 1.00 132.62 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 507.557 7.066   693.762 1.00 133.49 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 508.744 6.924   693.073 1.00 137.13 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 504.018 4.120   695.163 1.00 120.63 ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 504.928 3.001   695.371 1.00 121.47 ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 506.149 3.232   694.511 1.00 123.57 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 506.030 3.702   693.377 1.00 129.02 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 504.301 1.627   695.091 1.00 121.23 ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 503.011 1.500   695.889 1.00 121.14 ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 505.285 0.507   695.451 1.00 116.11 ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 502.310 0.188   695.716 1.00 123.88 ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 507.323 2.976   695.074 1.00 121.31 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 508.547 3.256   694.350 1.00 127.35 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 508.648 2.339   693.131 1.00 126.72 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 508.389 1.130   693.217 1.00 123.07 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 509.729 2.999   695.287 1.00 124.24 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 511.098 3.369   694.775 1.00 132.29 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 512.218 2.875   695.690 1.00 131.17 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 511.952 2.570   696.865 1.00 122.49 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 513.371 2.761   695.217 1.00 143.75 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 509.072 2.915   691.996 1.00 123.08 ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 509.141 2.177   690.733 1.00 125.38 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 507.762 1.714   690.248 1.00 126.65 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 507.638 0.620   689.688 1.00 129.02 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 510.124 1.000   690.822 1.00 124.93 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 511.570 1.465   690.989 1.00 126.09 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 511.895 2.545   690.459 1.00 124.06 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 512.377 0.773   691.654 1.00 125.34 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 506.703 2.499   690.496 1.00 123.04 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 505.351 2.182   690.011 1.00 119.26 ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 504.677 3.421   689.407 1.00 114.42 ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 504.613 4.475   690.048 1.00 115.54 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 504.478 1.595   691.132 1.00 117.83 ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 503.029 1.647   690.742 1.00 117.49 ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 504.879 0.166   691.434 1.00 118.85 ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 504.319 3.339   688.124 1.00 109.73 ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 503.760 4.490   687.424 1.00 110.28 ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 502.234 4.622   687.459 1.00 110.65 ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 501.731 5.731   687.219 1.00 107.37 ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 504.243 4.464   685.983 1.00 121.04 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 505.765 4.572   685.887 1.00 123.36 ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 506.256 4.156   684.512 1.00 125.38 ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 506.198 6.006   686.202 1.00 127.69 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 501.482 3.546   687.733 1.00 110.41 ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 500.013 3.587   687.672 1.00 107.35 ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 499.429 2.325   688.311 1.00 104.93 ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 500.156 1.367   688.593 1.00 105.05 ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 499.522 3.668   686.232 1.00 108.12 ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 500.020 2.541   685.382 1.00 109.07 ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 499.558 1.247   685.521 1.00 106.03 ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 500.930 2.509   684.381 1.00 108.55 ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 500.168 0.464   684.652 1.00 103.65 ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 501.004 1.207   683.945 1.00 111.81 ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 498.082 2.287   688.423 1.00 98.57  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 497.406 1.233   689.201 1.00 100.72 ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 497.545 -0.179  688.624 1.00 100.99 ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 497.486 -1.165  689.375 1.00 96.05  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 495.915 1.530   689.362 1.00 102.56 ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 495.218 0.462   690.246 1.00 105.10 ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 493.878 0.876   690.803 1.00 109.44 ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 493.417 2.011   690.529 1.00 113.82 ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 493.261 0.032   691.489 1.00 112.20 ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 497.751 -0.307  687.320 1.00 108.83 ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 497.723 -1.601  686.637 1.00 108.93 ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 499.085 -2.268  686.624 1.00 108.22 ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 499.290 -3.237  685.889 1.00 105.25 ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 497.164 -1.419  685.230 1.00 102.72 ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 495.826 -0.723  685.222 1.00 98.16  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 495.747 0.661   685.060 1.00 98.98  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 494.658 -1.434  685.392 1.00 97.30  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 494.532 1.321   685.051 1.00 95.91  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 493.428 -0.776  685.392 1.00 101.14 ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 493.370 0.603   685.216 1.00 100.27 ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 500.014 -1.728  687.406 1.00 104.88 ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 501.357 -2.237  687.557 1.00 103.19 ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 501.374 -3.538  688.377 1.00 100.67 ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 500.339 -4.076  688.777 1.00 101.62 ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 502.172 -1.157  688.264 1.00 105.56 ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 502.153 0.062   687.524 1.00 111.96 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 502.565 -4.119  688.514 1.00 104.76 ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 502.790 -5.334  689.292 1.00 109.80 ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 504.243 -5.256  689.789 1.00 113.95 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 505.100 -4.741  689.067 1.00 118.07 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 502.478 -6.589  688.471 1.00 108.02 ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 503.024 -7.749  689.111 1.00 107.68 ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 503.075 -6.438  687.065 1.00 112.56 ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 504.531 -5.704  691.004 1.00 118.64 ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 505.847 -5.502  691.630 1.00 123.95 ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 506.613 -6.819  691.658 1.00 123.70 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 506.073 -7.829  692.128 1.00 119.56 ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 505.766 -4.893  693.045 1.00 128.53 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 505.430 -3.400  692.966 1.00 128.27 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 507.102 -5.079  693.764 1.00 125.45 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 506.687 -2.534  692.701 1.00 133.02 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 507.857 -6.849  691.164 1.00 128.51 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 508.669 -8.072  691.238 1.00 123.34 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 508.918 -8.460  692.685 1.00 123.94 ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 509.131 -7.599  693.542 1.00 126.62 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 509.973 -7.681  690.529 1.00 112.28 ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 509.621 -6.497  689.688 1.00 115.88 ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 508.569 -5.760  690.464 1.00 124.68 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 508.762 -9.756  692.976 1.00 121.21 ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 508.938 -10.271 694.318 1.00 126.53 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 507.674 -10.301 695.154 1.00 126.57 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 507.621 -11.029 696.151 1.00 122.15 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 506.660 -9.536  694.769 1.00 127.94 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 505.395 -9.438  695.486 1.00 123.05 ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 504.365 -10.315 694.784 1.00 123.40 ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 504.315 -10.379 693.543 1.00 120.23 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 504.923 -7.974  695.567 1.00 119.50 ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 503.638 -7.888  696.342 1.00 115.19 ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 505.985 -7.121  696.213 1.00 119.09 ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 503.548 -11.007 695.584 1.00 118.34 ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 502.511 -11.885 695.049 1.00 117.40 ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 501.302 -11.097 694.544 1.00 114.74 ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 500.787 -11.347 693.443 1.00 112.32 ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 502.107 -12.890 696.122 1.00 107.73 ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 501.126 -13.911 695.669 1.00 104.69 ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 500.669 -14.758 696.816 1.00 104.69 ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 499.794 -15.878 696.312 1.00 109.20 ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 499.009 -16.550 697.367 1.00 113.72 ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 500.854 -10.132 695.329 1.00 112.50 ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 499.671 -9.353  694.994 1.00 114.99 ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 499.983 -8.317  693.914 1.00 103.40 ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 501.076 -7.753  693.874 1.00 104.99 ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 499.082 -8.658  696.241 1.00 113.10 ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 498.307 -9.515  697.314 1.00 107.89 ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 499.161 -10.243 698.372 1.00 114.68 ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 498.576 -10.829 699.318 1.00 116.45 ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 500.401 -10.206 698.302 1.00 117.75 ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 499.050 -8.142  692.984 1.00 94.00  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 499.117 -7.032  692.046 1.00 99.78  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 498.753 -5.724  692.738 1.00 99.35  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 498.196 -5.724  693.828 1.00 102.99 ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 498.155 -7.266  690.889 1.00 103.45 ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 496.770 -7.664  691.361 1.00 110.31 ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 495.891 -6.767  691.488 1.00 106.18 ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 496.577 -8.871  691.646 1.00 113.30 ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 499.148 -4.597  692.129 1.00 99.41  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 498.886 -3.272  692.712 1.00 99.57  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 497.392 -3.032  692.939 1.00 104.13 ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 497.005 -2.314  693.872 1.00 101.66 ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 499.512 -2.159  691.856 1.00 90.97  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 499.144 -0.779  692.396 1.00 90.78  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 500.992 -2.313  691.888 1.00 102.01 ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 496.534 -3.554  692.060 1.00 105.35 ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 495.097 -3.382  692.257 1.00 104.06 ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 494.677 -3.955  693.605 1.00 104.52 ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 493.949 -3.314  694.374 1.00 106.53 ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 494.311 -4.006  691.088 1.00 101.71 ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 492.824 -3.929  691.339 1.00 106.90 ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 494.587 -3.218  689.846 1.00 98.84  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 495.148 -5.165  693.915 1.00 101.68 ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 494.847 -5.795  695.197 1.00 98.42  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 495.517 -5.053  696.349 1.00 103.42 ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 494.959 -4.961  697.448 1.00 105.16 ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 495.267 -7.255  695.160 1.00 93.39  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 494.995 -8.009  696.402 1.00 96.04  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 495.092 -9.502  696.175 1.00 101.89 ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 494.617 -10.274 697.023 1.00 102.09 ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 495.683 -9.917  695.165 1.00 104.74 ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 496.726 -4.536  696.126 1.00 105.04 ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 497.428 -3.800  697.176 1.00 104.19 ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 496.602 -2.590  697.597 1.00 106.22 ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 496.279 -2.418  698.780 1.00 107.64 ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 498.832 -3.383  696.679 1.00 105.40 ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 499.755 -4.601  696.517 1.00 103.58 ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 499.473 -2.287  697.551 1.00 104.43 ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 499.847 -5.460  697.740 1.00 108.08 ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 496.137 -1.814  696.618 1.00 101.43 ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 495.291 -0.668  696.916 1.00 100.69 ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 493.964 -1.139  697.477 1.00 107.02 ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 493.332 -0.449  698.282 1.00 111.58 ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 495.117 0.192   695.660 1.00 100.96 ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 496.444 0.853   695.336 1.00 111.36 ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 494.107 1.274   695.870 1.00 97.51  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 496.409 1.664   694.092 1.00 113.55 ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 493.469 -2.267  696.982 1.00 107.55 ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 492.246 -2.854  697.522 1.00 105.75 ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 492.368 -3.202  699.012 1.00 106.64 ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 491.397 -3.046  699.765 1.00 106.64 ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 491.871 -4.072  696.681 1.00 105.95 ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 490.443 -4.167  696.152 1.00 101.86 ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 490.003 -2.872  695.496 1.00 102.25 ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 490.434 -5.263  695.118 1.00 101.75 ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 493.555 -3.661  699.459 1.00 106.43 ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 493.775 -3.947  700.883 1.00 102.53 ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 493.942 -2.682  701.714 1.00 106.53 ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 493.440 -2.602  702.837 1.00 111.94 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 495.000 -4.838  701.083 1.00 101.85 ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 494.821 -6.209  700.492 1.00 105.52 ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 493.701 -6.629  700.242 1.00 106.69 ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 495.923 -6.922  700.264 1.00 102.67 ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 494.632 -1.679  701.186 1.00 110.44 ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 494.778 -0.416  701.901 1.00 110.37 ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 493.458 0.334   702.076 1.00 109.18 ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 493.369 1.205   702.941 1.00 114.69 ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 495.765 0.491   701.153 1.00 109.60 ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 497.220 0.003   701.062 1.00 112.20 ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 497.969 0.784   699.983 1.00 111.98 ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 497.992 -0.032  702.375 1.00 120.39 ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 492.442 0.045   701.267 1.00 107.30 ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 491.141 0.681   701.425 1.00 107.57 ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 490.373 0.187   702.645 1.00 117.48 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 489.424 0.853   703.079 1.00 117.89 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 490.358 0.475   700.131 1.00 108.92 ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 489.344 1.549   699.813 1.00 110.70 ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 488.750 1.307   698.428 1.00 109.73 ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 487.947 0.008   698.353 1.00 111.86 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 487.292 -0.181  697.014 1.00 106.17 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 490.792 -0.917  703.247 1.00 116.62 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 490.126 -1.435  704.427 1.00 113.79 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 490.778 -0.938  705.712 1.00 119.31 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 490.260 -1.208  706.801 1.00 123.07 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 490.124 -2.968  704.381 1.00 111.13 ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 489.319 -3.554  703.216 1.00 113.82 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 487.853 -3.076  703.160 1.00 125.46 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 487.206 -2.944  704.221 1.00 130.94 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 487.338 -2.820  702.047 1.00 133.51 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 491.868 -0.177  705.587 1.00 119.09 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 492.667 0.305   706.712 1.00 117.09 ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 491.927 1.374   707.516 1.00 118.74 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 491.457 2.371   706.953 1.00 118.31 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 493.985 0.873   706.201 1.00 115.73 ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 495.028 1.224   707.251 1.00 114.25 ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 495.552 -0.077  707.826 1.00 114.54 ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 496.155 2.080   706.694 1.00 112.09 ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 491.816 1.156   708.830 1.00 118.21 ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 491.168 2.093   709.742 1.00 117.83 ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 492.223 2.850   710.546 1.00 117.14 ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 492.974 2.245   711.320 1.00 119.07 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 490.218 1.348   710.687 1.00 118.96 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 489.422 2.342   711.539 1.00 123.81 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 489.324 0.436   709.894 1.00 122.91 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 492.290 4.169   710.374 1.00 110.04 ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 493.341 4.975   710.990 1.00 112.49 ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 492.678 6.074   711.791 1.00 116.31 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 492.047 6.966   711.203 1.00 106.24 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 494.325 5.583   709.978 1.00 114.78 ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 495.333 6.466   710.706 1.00 113.06 ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 495.045 4.488   709.228 1.00 118.73 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 492.880 6.041   713.119 1.00 122.07 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 492.289 6.978   714.076 1.00 116.37 ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 493.223 8.149   714.377 1.00 116.29 ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 494.398 7.942   714.697 1.00 115.77 ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 491.948 6.264   715.389 1.00 118.98 ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 491.418 7.230   716.475 1.00 123.87 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 491.310 6.646   717.890 1.00 117.30 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 490.758 7.642   718.819 1.00 120.91 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 490.682 7.496   720.144 1.00 114.84 ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 491.133 6.392   720.726 1.00 113.90 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 490.170 8.464   720.894 1.00 103.58 ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 492.698 9.376   714.271 1.00 114.22 ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 493.456 10.571  714.631 1.00 118.60 ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 493.155 10.966  716.075 1.00 131.57 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 492.012 11.294  716.418 1.00 132.75 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 493.138 11.757  713.726 1.00 121.57 ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 493.620 11.613  712.307 1.00 131.69 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 494.521 10.618  711.949 1.00 128.89 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 493.220 12.531  711.336 1.00 131.09 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 494.977 10.521  710.635 1.00 125.84 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 493.673 12.447  710.027 1.00 125.14 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 494.552 11.443  709.675 1.00 123.69 ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 494.190 10.931  716.921 1.00 136.68 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 494.013 11.305  718.316 1.00 119.97 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 493.857 12.812  718.448 1.00 123.44 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 492.996 13.285  719.187 1.00 127.00 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 495.188 10.801  719.140 1.00 114.39 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 495.076 9.290   719.368 1.00 120.07 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 493.644 8.933   719.679 1.00 120.64 ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 495.641 8.412   718.249 1.00 122.57 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 494.620 13.577  717.679 1.00 127.63 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 494.484 15.024  717.707 1.00 129.10 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 493.349 15.432  716.778 1.00 130.91 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 493.434 15.196  715.570 1.00 130.74 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 495.780 15.703  717.299 1.00 130.37 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 495.698 17.224  717.374 1.00 130.41 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 494.652 17.826  717.118 1.00 126.00 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 496.807 17.851  717.746 1.00 131.54 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 492.280 16.028  717.297 1.00 130.86 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 491.139 16.410  716.448 1.00 133.73 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 491.445 17.456  715.400 1.00 133.68 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 490.679 17.580  714.440 1.00 136.81 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 490.114 16.936  717.460 1.00 136.45 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 490.480 16.261  718.746 1.00 137.05 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 491.982 16.189  718.726 1.00 132.53 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 492.526 18.211  715.549 1.00 131.32 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 492.874 19.284  714.626 1.00 134.49 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 493.615 18.819  713.375 1.00 136.07 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 493.793 19.628  712.456 1.00 135.60 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 493.691 20.330  715.377 1.00 137.94 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 492.967 20.766  716.518 1.00 141.64 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 493.989 17.538  713.303 1.00 138.55 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 494.856 16.963  712.265 1.00 135.19 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 493.994 16.418  711.128 1.00 130.59 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 493.260 15.442  711.305 1.00 126.98 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 495.717 15.858  712.874 1.00 132.96 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 496.679 15.031  712.027 1.00 127.16 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 497.763 15.934  711.485 1.00 124.65 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 497.268 13.885  712.852 1.00 126.48 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 494.062 17.061  709.961 1.00 131.82 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 493.233 16.640  708.839 1.00 133.04 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 493.921 15.726  707.818 1.00 132.56 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 493.213 15.134  706.993 1.00 131.11 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 492.776 17.902  708.072 1.00 130.52 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 491.885 18.888  708.840 1.00 142.56 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 490.405 18.826  708.483 1.00 149.72 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 489.880 17.774  708.113 1.00 152.85 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 489.727 19.969  708.583 1.00 141.27 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 495.256 15.582  707.839 1.00 132.92 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 495.975 14.766  706.854 1.00 122.45 ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 497.314 14.237  707.362 1.00 120.45 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 498.000 14.914  708.133 1.00 121.96 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 496.234 15.537  705.563 1.00 116.70 ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 497.026 14.715  704.699 1.00 117.18 ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 496.963 16.841  705.851 1.00 116.12 ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 497.693 13.022  706.936 1.00 119.29 ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 499.004 12.495  707.336 1.00 124.03 ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 499.680 11.835  706.133 1.00 121.39 ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 499.275 12.063  704.986 1.00 115.92 ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 498.899 11.477  708.486 1.00 116.13 ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 498.301 12.117  709.704 1.00 124.00 ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 498.108 10.263  708.051 1.00 116.41 ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 500.755 11.074  706.375 1.00 116.56 ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 501.350 10.244  705.326 1.00 117.76 ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 502.118 9.106   705.986 1.00 115.85 ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 503.212 9.333   706.507 1.00 123.65 ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 502.275 11.066  704.418 1.00 123.70 ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 501.550 12.136  703.786 1.00 125.43 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 502.892 10.180  703.346 1.00 114.34 ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 501.594 7.888   705.892 1.00 112.06 ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 502.244 6.690   706.425 1.00 116.12 ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 503.327 6.136   705.505 1.00 116.98 ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 503.195 6.169   704.284 1.00 118.60 ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 501.214 5.611   706.736 1.00 117.49 ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 500.597 5.777   708.133 1.00 128.24 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 499.813 7.092   708.332 1.00 122.26 ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 499.727 4.571   708.460 1.00 127.15 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 504.422 5.668   706.096 1.00 118.61 ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 505.530 5.067   705.362 1.00 119.76 ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 505.697 3.586   705.714 1.00 124.35 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 505.492 3.191   706.864 1.00 128.37 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 506.804 5.865   705.634 1.00 119.40 ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 506.622 7.277   705.051 1.00 120.96 ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 506.764 8.397   706.053 1.00 121.04 ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 507.620 7.476   703.920 1.00 132.55 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 506.014 2.758   704.705 1.00 128.40 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 506.242 1.318   704.867 1.00 124.81 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 507.459 0.910   704.036 1.00 128.06 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 507.575 1.317   702.877 1.00 122.68 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 505.028 0.489   704.421 1.00 117.39 ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 504.982 -1.010  704.759 1.00 115.88 ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 503.537 -1.423  704.965 1.00 121.20 ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 505.677 -1.955  703.800 1.00 118.79 ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 508.396 0.174   704.641 1.00 134.08 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 509.517 -0.452  703.929 1.00 126.88 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 509.692 -1.879  704.435 1.00 131.74 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 509.862 -2.103  705.640 1.00 130.91 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 510.812 0.348   704.053 1.00 126.53 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 510.709 1.671   703.329 1.00 130.43 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 511.753 2.685   703.767 1.00 140.07 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 511.595 3.989   702.982 1.00 138.72 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 510.213 4.575   703.219 1.00 135.17 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 509.635 -2.841  703.523 1.00 129.02 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 509.699 -4.247  703.884 1.00 130.35 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 510.524 -4.981  702.848 1.00 132.57 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 510.638 -4.536  701.707 1.00 134.03 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 508.308 -4.851  703.951 1.00 131.44 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 511.133 -6.087  703.262 1.00 135.69 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 511.873 -6.933  702.336 1.00 140.24 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 511.820 -8.377  702.805 1.00 136.49 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 511.095 -8.722  703.740 1.00 134.01 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 513.331 -6.463  702.273 1.00 144.94 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 513.999 -6.480  703.661 1.00 154.98 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 515.476 -6.121  703.646 1.00 155.97 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 515.915 -5.418  702.710 1.00 151.87 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 516.186 -6.529  704.594 1.00 159.28 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 512.557 -9.234  702.105 1.00 134.99 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 512.761 -10.595 702.530 1.00 132.06 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 511.487 -11.399 702.543 1.00 132.01 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 510.422 -10.914 702.167 1.00 134.30 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 511.583 -12.663 702.927 1.00 134.10 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 510.389 -13.514 703.007 1.00 134.87 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 509.435 -13.186 704.150 1.00 137.90 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 509.334 -13.969 705.115 1.00 134.54 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 510.965 -14.918 703.201 1.00 134.96 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 512.346 -14.828 702.730 1.00 136.58 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 512.814 -13.449 703.038 1.00 138.82 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 508.710 -12.070 704.078 1.00 136.74 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 507.748 -11.752 705.132 1.00 132.23 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 506.408 -11.377 704.501 1.00 129.21 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 506.353 -10.822 703.397 1.00 129.69 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 508.213 -10.626 706.109 1.00 133.24 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 507.826 -9.198  705.746 1.00 129.99 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 507.950 -8.259  706.984 1.00 131.48 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 508.231 -6.816  706.708 1.00 128.38 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 508.080 -5.992  707.949 1.00 122.87 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 505.331 -11.591 705.257 1.00 125.84 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 503.994 -11.171 704.863 1.00 117.13 ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 503.684 -9.872  705.587 1.00 111.70 ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 503.351 -9.883  706.768 1.00 119.01 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 502.997 -12.258 705.241 1.00 117.24 ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 503.302 -13.582 704.577 1.00 121.67 ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 502.342 -14.691 704.989 1.00 129.85 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 501.423 -14.444 705.815 1.00 132.49 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 502.519 -15.828 704.493 1.00 134.69 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 503.717 -8.767  704.851 1.00 110.77 ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 503.541 -7.436  705.422 1.00 114.13 ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 502.103 -7.238  705.877 1.00 118.35 ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 501.158 -7.452  705.108 1.00 120.74 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 503.941 -6.374  704.391 1.00 107.98 ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 503.905 -4.990  704.980 1.00 103.79 ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 505.314 -6.707  703.869 1.00 114.85 ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 501.931 -6.809  707.131 1.00 117.03 ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 500.633 -6.470  707.682 1.00 112.34 ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 500.596 -4.969  707.934 1.00 113.94 ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 501.567 -4.250  707.691 1.00 115.24 ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 500.370 -7.247  708.968 1.00 110.27 ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 500.678 -8.721  708.910 1.00 110.52 ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 499.733 -9.464  707.991 1.00 109.58 ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 500.076 -10.947 707.982 1.00 112.01 ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 499.164 -11.794 707.159 1.00 112.17 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 499.462 -4.483  708.431 1.00 116.06 ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 499.354 -3.048  708.656 1.00 118.26 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 500.246 -2.541  709.780 1.00 124.77 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 500.473 -1.327  709.856 1.00 122.88 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 497.897 -2.676  708.924 1.00 123.76 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 500.708 -3.425  710.681 1.00 127.66 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 501.578 -2.986  711.776 1.00 127.63 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 502.868 -2.361  711.238 1.00 128.57 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 503.363 -1.362  711.781 1.00 127.03 ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 501.888 -4.141  712.741 1.00 124.37 ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 502.195 -5.500  712.108 1.00 123.56 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 502.089 -6.617  713.154 1.00 129.58 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 500.711 -7.044  713.402 1.00 133.40 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 500.101 -6.972  714.584 1.00 136.21 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 498.838 -7.378  714.714 1.00 134.78 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 500.745 -6.467  715.631 1.00 139.30 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 503.394 -2.903  710.130 1.00 127.18 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 504.746 -2.590  709.693 1.00 118.80 ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 504.883 -1.147  709.240 1.00 119.57 ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 506.006 -0.700  708.985 1.00 121.01 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 505.153 -3.554  708.590 1.00 114.48 ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 505.058 -4.999  709.030 1.00 115.46 ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 504.003 -5.609  708.794 1.00 113.09 ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 506.016 -5.524  709.630 1.00 120.18 ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 503.770 -0.428  709.109 1.00 119.13 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 503.824 0.997   708.824 1.00 122.78 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 504.567 1.687   709.957 1.00 129.58 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 504.317 1.418   711.138 1.00 127.89 ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 502.418 1.549   708.648 1.00 126.80 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 501.855 1.293   707.281 1.00 130.71 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 500.809 0.398   707.098 1.00 131.95 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 502.347 1.977   706.180 1.00 128.52 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 500.295 0.159   705.837 1.00 126.47 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 501.832 1.752   704.922 1.00 127.44 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 500.803 0.840   704.751 1.00 129.99 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 505.460 2.598   709.589 1.00 127.82 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 506.249 3.329   710.566 1.00 125.89 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 505.372 4.200   711.449 1.00 132.70 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 504.645 5.064   710.926 1.00 128.36 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 507.285 4.179   709.841 1.00 128.92 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 508.383 3.287   709.223 1.00 137.02 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 509.519 4.050   708.479 1.00 122.79 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 508.919 2.281   710.241 1.00 137.55 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 505.401 3.987   712.778 1.00 139.06 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 504.499 4.695   713.708 1.00 132.11 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 504.661 6.207   713.670 1.00 125.20 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 505.775 6.732   713.628 1.00 123.51 ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 504.900 4.136   715.079 1.00 129.10 ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 505.474 2.790   714.778 1.00 134.24 ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 506.218 2.974   713.479 1.00 130.98 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 503.538 6.910   713.691 1.00 121.25 ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 503.543 8.365   713.727 1.00 129.59 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 502.720 8.808   714.933 1.00 141.13 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 501.794 8.108   715.359 1.00 141.99 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 503.036 8.993   712.414 1.00 133.28 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 503.002 10.513  712.510 1.00 133.93 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 503.939 8.577   711.262 1.00 138.03 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 503.161 9.889   715.570 1.00 142.59 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 502.485 10.401  716.752 1.00 140.31 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 501.069 10.852  716.420 1.00 138.26 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 500.802 11.415  715.351 1.00 137.80 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 503.275 11.563  717.351 1.00 151.15 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 500.174 10.652  717.386 1.00 139.60 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 498.752 10.991  717.290 1.00 142.29 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 498.013 10.228  716.188 1.00 132.03 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 497.060 10.752  715.591 1.00 125.35 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 498.533 12.507  717.152 1.00 143.92 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 498.910 13.272  718.429 1.00 144.47 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 499.050 12.629  719.506 1.00 135.72 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 499.029 14.516  718.353 1.00 143.34 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 498.518 9.054   715.811 1.00 130.91 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 497.855 8.201   714.831 1.00 132.83 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 497.990 6.757   715.317 1.00 128.01 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 499.106 6.273   715.538 1.00 122.98 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 498.381 8.370   713.385 1.00 135.65 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 498.105 9.788   712.860 1.00 132.39 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 499.835 8.012   713.230 1.00 132.35 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 496.862 6.070   715.490 1.00 128.63 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 496.849 4.697   715.979 1.00 126.97 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 496.200 3.854   714.895 1.00 124.85 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 495.097 4.175   714.426 1.00 118.12 ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 496.065 4.561   717.297 1.00 128.63 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 496.000 3.121   717.856 1.00 128.01 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 494.978 2.919   719.006 1.00 128.06 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 494.368 3.911   719.496 1.00 119.97 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 494.780 1.738   719.396 1.00 119.31 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 496.854 2.751   714.538 1.00 127.59 ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 496.333 1.847   713.516 1.00 129.38 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 495.449 0.836   714.231 1.00 122.69 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 495.943 -0.059  714.919 1.00 122.94 ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 497.473 1.169   712.733 1.00 124.31 ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 498.053 2.103   711.665 1.00 115.75 ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 497.030 -0.132  712.087 1.00 124.25 ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 499.065 3.080   712.174 1.00 120.41 ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 494.139 0.935   713.995 1.00 120.44 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 493.180 0.146   714.760 1.00 123.76 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 493.161 -1.324  714.375 1.00 122.45 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 492.648 -2.137  715.146 1.00 120.83 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 491.766 0.720   714.609 1.00 124.76 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 491.621 2.231   714.808 1.00 125.40 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 492.070 2.760   716.472 1.00 130.93 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 491.093 1.614   717.419 1.00 121.06 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 493.647 -1.684  713.192 1.00 122.29 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 493.711 -3.083  712.761 1.00 125.20 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 495.091 -3.475  712.258 1.00 126.60 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 495.299 -3.689  711.057 1.00 126.72 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 492.621 -3.385  711.725 1.00 130.08 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 492.600 -2.411  710.547 1.00 116.89 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 493.146 -1.314  710.609 1.00 115.58 ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 491.957 -2.826  709.465 1.00 115.54 ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 496.044 -3.656  713.173 1.00 123.92 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 497.422 -3.950  712.769 1.00 128.67 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 497.622 -5.351  712.217 1.00 126.39 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 498.703 -5.643  711.694 1.00 126.09 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 498.211 -3.745  714.076 1.00 129.10 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 497.164 -3.526  715.156 1.00 123.98 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 495.847 -3.911  714.598 1.00 120.05 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 496.604 -6.198  712.234 1.00 124.30 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 496.743 -7.569  711.769 1.00 129.80 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 496.380 -7.742  710.283 1.00 131.04 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 496.594 -8.826  709.713 1.00 123.03 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 495.915 -8.473  712.682 1.00 133.21 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 496.672 -9.717  713.091 1.00 139.39 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 497.602 -10.125 712.348 1.00 138.20 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 496.361 -10.259 714.175 1.00 139.65 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 495.866 -6.685  709.651 1.00 129.80 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 495.406 -6.712  708.267 1.00 122.69 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 496.531 -7.115  707.335 1.00 122.23 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 497.625 -6.552  707.402 1.00 124.55 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 494.927 -5.304  707.902 1.00 123.94 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 494.523 -4.791  706.523 1.00 116.09 ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 493.075 -5.056  706.207 1.00 124.73 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 494.773 -3.292  706.506 1.00 109.88 ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 496.274 -8.103  706.474 1.00 127.14 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 497.293 -8.535  705.519 1.00 120.07 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 497.458 -7.479  704.425 1.00 110.98 ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 496.477 -6.907  703.945 1.00 109.99 ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 496.909 -9.876  704.889 1.00 113.86 ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 497.970 -10.443 703.996 1.00 119.45 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 498.842 -11.426 704.410 1.00 121.65 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 498.354 -10.108 702.740 1.00 117.19 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 499.686 -11.705 703.433 1.00 115.17 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 499.414 -10.915 702.410 1.00 114.35 ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 498.703 -7.220  704.021 1.00 107.63 ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 498.948 -6.215  702.983 1.00 116.68 ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 499.552 -6.797  701.705 1.00 114.70 ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 498.963 -6.675  700.626 1.00 114.02 ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 499.817 -5.053  703.505 1.00 114.69 ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 499.064 -4.263  704.548 1.00 111.86 ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 500.112 -4.075  702.393 1.00 113.19 ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 497.642 -4.041  704.159 1.00 111.20 ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 500.750 -7.362  701.786 1.00 111.89 ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 501.342 -8.009  700.624 1.00 113.11 ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 502.163 -9.202  701.072 1.00 114.76 ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 502.726 -9.186  702.166 1.00 122.34 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 502.226 -7.036  699.841 1.00 112.24 ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 502.180 -10.259 700.276 1.00 107.66 ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 503.083 -11.367 700.536 1.00 110.07 ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 504.352 -11.166 699.702 1.00 120.60 ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 504.286 -11.105 698.468 1.00 120.80 ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 502.417 -12.710 700.231 1.00 110.21 ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 501.444 -13.008 701.231 1.00 111.41 ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 503.438 -13.823 700.263 1.00 120.91 ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 505.498 -11.030 700.372 1.00 126.45 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 506.787 -10.827 699.723 1.00 122.48 ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 507.610 -12.113 699.815 1.00 123.53 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 507.470 -12.898 700.755 1.00 120.66 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 507.531 -9.633  700.347 1.00 120.75 ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 507.241 -8.243  699.744 1.00 119.93 ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 505.786 -7.806  699.879 1.00 113.94 ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 508.137 -7.180  700.353 1.00 121.68 ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 508.483 -12.321 698.838 1.00 129.23 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 509.217 -13.572 698.687 1.00 132.38 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 510.698 -13.226 698.728 1.00 131.00 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 511.061 -12.048 698.693 1.00 128.91 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 508.810 -14.309 697.401 1.00 133.36 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 509.872 -14.558 696.345 1.00 132.35 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 509.262 -14.729 694.970 1.00 131.48 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 508.382 -13.924 694.611 1.00 131.82 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 509.577 -15.720 694.288 1.00 130.45 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 511.557 -14.241 698.858 1.00 129.37 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 512.979 -13.948 698.945 1.00 132.40 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 513.382 -13.045 697.789 1.00 131.53 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 513.216 -13.405 696.623 1.00 132.58 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 513.779 -15.251 698.904 1.00 136.62 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 514.415 -15.654 700.236 1.00 138.74 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 515.524 -14.714 700.687 1.00 143.53 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 515.733 -14.603 701.914 1.00 145.67 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 516.169 -14.071 699.828 1.00 145.24 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 513.933 -11.875 698.133 1.00 133.08 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 514.293 -10.831 697.193 1.00 127.73 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 513.197 -9.812  696.918 1.00 127.25 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 513.472 -8.776  696.304 1.00 126.34 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 511.976 -10.064 697.380 1.00 133.90 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 510.878 -9.117  697.208 1.00 132.13 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 511.057 -7.873  698.056 1.00 134.04 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 511.303 -7.971  699.265 1.00 136.64 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 510.908 -6.691  697.443 1.00 133.90 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 511.106 -5.444  698.182 1.00 138.56 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 509.806 -4.634  698.101 1.00 136.10 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 508.937 -4.929  697.275 1.00 136.22 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 512.305 -4.668  697.609 1.00 138.18 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 513.623 -5.476  697.717 1.00 147.73 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 514.122 -5.813  699.130 1.00 147.98 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 515.491 -6.364  699.120 1.00 154.62 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 515.825 -7.592  699.542 1.00 149.75 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 514.899 -8.422  700.013 1.00 145.67 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 517.089 -8.002  699.482 1.00 143.94 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 509.691 -3.562  698.912 1.00 133.00 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 508.485 -2.717  698.922 1.00 128.85 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 508.563 -1.410  699.718 1.00 125.21 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 508.661 -1.431  700.948 1.00 134.65 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 507.308 -3.545  699.452 1.00 127.61 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 505.935 -2.878  699.442 1.00 125.97 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 505.603 -2.318  698.083 1.00 126.67 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 504.893 -3.907  699.858 1.00 120.48 ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 508.504 -0.271  699.032 1.00 116.65 ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 508.541 1.062   699.639 1.00 116.97 ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 507.409 1.964   699.165 1.00 117.52 ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 507.375 2.339   697.991 1.00 121.86 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 509.889 1.741   699.372 1.00 118.79 ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 509.867 3.257   699.653 1.00 122.04 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 509.131 3.744   700.507 1.00 131.22 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 510.704 4.000   698.936 1.00 125.84 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 506.491 2.339   700.060 1.00 120.82 ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 505.351 3.144   699.631 1.00 120.93 ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 505.045 4.260   700.621 1.00 116.56 ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 505.542 4.287   701.746 1.00 116.34 ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 504.099 2.296   699.397 1.00 121.33 ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 503.683 1.389   700.504 1.00 122.06 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 502.189 0.531   699.959 1.00 131.32 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 502.127 -0.823  701.130 1.00 127.31 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 504.280 5.234   700.126 1.00 115.33 ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 503.784 6.380   700.883 1.00 117.46 ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 502.277 6.470   700.673 1.00 116.42 ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 501.824 6.779   699.564 1.00 111.68 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 504.479 7.681   700.472 1.00 115.98 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 505.991 7.570   700.439 1.00 125.60 ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 506.678 8.838   699.945 1.00 138.98 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 505.981 9.812   699.575 1.00 139.87 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 507.927 8.848   699.918 1.00 140.07 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 501.516 6.270   701.755 1.00 112.75 ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 500.058 6.322   701.755 1.00 103.82 ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 499.575 7.583   702.449 1.00 103.28 ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 499.900 7.815   703.613 1.00 117.46 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 499.481 5.112   702.503 1.00 102.09 ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 497.989 5.094   702.383 1.00 104.21 ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 500.109 3.817   702.039 1.00 111.43 ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 498.802 8.395   701.746 1.00 102.41 ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 498.196 9.588   702.320 1.00 101.47 ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 496.828 9.221   702.856 1.00 109.93 ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 495.977 8.762   702.088 1.00 110.90 ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 498.069 10.726  701.323 1.00 103.95 ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 497.110 11.785  701.765 1.00 96.09  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 497.359 13.015  700.963 1.00 103.55 ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 496.349 14.040  701.152 1.00 108.51 ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 496.411 15.246  700.596 1.00 112.40 ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 497.447 15.564  699.831 1.00 112.06 ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 495.442 16.133  700.797 1.00 108.68 ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 496.625 9.405   704.164 1.00 117.42 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 495.351 9.151   704.832 1.00 108.21 ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 494.732 10.492  705.201 1.00 111.02 ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 495.433 11.371  705.715 1.00 115.44 ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 495.547 8.294   706.088 1.00 107.88 ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 494.212 8.116   706.805 1.00 108.26 ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 496.231 6.977   705.746 1.00 104.15 ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 493.444 10.678  704.881 1.00 112.87 ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 492.727 11.917  705.179 1.00 115.66 ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 491.455 11.684  705.988 1.00 121.02 ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 490.922 10.572  706.050 1.00 122.64 ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 492.369 12.669  703.902 1.00 114.22 ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 493.542 13.438  703.343 1.00 119.07 ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 493.719 14.605  703.758 1.00 123.00 ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 494.304 12.873  702.520 1.00 116.26 ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 490.968 12.771  706.600 1.00 126.48 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 489.672 12.828  707.270 1.00 118.82 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 488.647 13.462  706.339 1.00 117.51 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 488.928 14.476  705.687 1.00 112.89 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 489.768 13.604  708.589 1.00 118.54 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 488.450 13.756  709.336 1.00 126.01 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 488.541 14.598  710.642 1.00 133.31 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 488.968 13.779  711.794 1.00 130.67 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 490.089 13.967  712.495 1.00 125.50 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 490.921 14.955  712.182 1.00 129.88 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 490.391 13.149  713.494 1.00 113.66 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 487.459 12.865  706.287 1.00 116.18 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 486.404 13.348  705.410 1.00 117.09 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 485.077 12.698  705.747 1.00 115.75 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 484.948 11.968  706.736 1.00 110.33 ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 484.064 13.019  704.932 1.00 115.56 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 482.716 12.503  705.141 1.00 114.83 ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 482.193 11.767  703.914 1.00 111.94 ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 482.499 12.101  702.764 1.00 101.34 ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 481.699 13.602  705.511 1.00 106.93 ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 480.608 13.000  706.357 1.00 101.60 ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 482.365 14.763  706.198 1.00 109.88 ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 481.367 10.759  704.191 1.00 115.99 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 480.655 10.046  703.159 1.00 111.13 ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 481.560 9.205   702.298 1.00 109.34 ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 482.574 8.662   702.754 1.00 108.66 ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 481.111 9.003   701.057 1.00 113.16 ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 481.818 8.192   700.067 1.00 115.60 ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 482.256 9.079   698.901 1.00 105.67 ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 481.416 9.492   698.094 1.00 101.13 ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 480.916 7.057   699.587 1.00 111.31 ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 481.412 6.330   698.369 1.00 101.60 ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 482.480 5.459   698.459 1.00 100.86 ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 480.808 6.507   697.143 1.00 98.39  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 482.937 4.773   697.355 1.00 103.89 ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 481.253 5.827   696.026 1.00 108.31 ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 482.330 4.960   696.129 1.00 108.21 ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 482.791 4.275   695.010 1.00 104.20 ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 483.559 9.325   698.771 1.00 107.06 ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 484.086 10.137  697.678 1.00 107.90 ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 484.950 9.236   696.790 1.00 111.46 ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 486.062 8.845   697.193 1.00 106.53 ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 484.869 11.350  698.196 1.00 105.19 ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 485.418 12.161  697.039 1.00 99.82  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 483.978 12.219  699.067 1.00 107.25 ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 484.467 8.862   695.591 1.00 112.82 ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 485.217 7.961   694.698 1.00 107.18 ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 486.491 8.571   694.136 1.00 102.24 ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 486.586 9.784   693.933 1.00 100.12 ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 484.204 7.669   693.584 1.00 110.41 ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 483.377 8.931   693.527 1.00 105.94 ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 483.206 9.317   694.967 1.00 107.79 ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 487.453 7.698   693.814 1.00 103.41 ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 488.763 8.151   693.324 1.00 104.20 ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 488.651 9.123   692.144 1.00 98.89  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 489.363 10.129  692.088 1.00 95.54  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 489.614 6.943   692.927 1.00 102.12 ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 487.720 8.880   691.230 1.00 101.72 ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 487.553 9.793   690.112 1.00 96.64  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 487.213 11.195  690.593 1.00 100.97 ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 487.550 12.172  689.928 1.00 106.36 ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 486.449 9.310   689.164 1.00 97.17  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 486.494 7.835   688.734 1.00 109.39 ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 485.815 6.871   689.720 1.00 121.99 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 484.604 6.589   689.539 1.00 125.59 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 486.501 6.338   690.632 1.00 120.90 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 486.520 11.315  691.724 1.00 107.10 ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 486.114 12.625  692.232 1.00 104.27 ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 487.278 13.452  692.775 1.00 105.42 ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 487.422 14.629  692.420 1.00 101.10 ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 485.056 12.456  693.316 1.00 104.07 ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 483.652 12.400  692.788 1.00 109.52 ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 483.158 13.721  692.247 1.00 115.03 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 481.806 13.462  691.587 1.00 119.34 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 481.952 12.567  690.390 1.00 111.65 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 488.037 12.896  693.744 1.00 107.25 ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 489.079 13.668  694.428 1.00 105.12 ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 490.400 13.740  693.660 1.00 109.74 ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 491.074 14.778  693.695 1.00 112.92 ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 489.297 13.153  695.856 1.00 100.81 ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 489.836 11.759  695.978 1.00 99.12  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 491.157 11.453  695.747 1.00 101.43 ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 489.252 10.605  696.378 1.00 98.58  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 491.361 10.169  695.985 1.00 101.02 ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 490.220 9.629   696.363 1.00 95.18  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 490.790 12.665  692.979 1.00 112.56 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 492.026 12.670  692.184 1.00 113.31 ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 493.277 13.092  692.927 1.00 113.44 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 494.125 13.796  692.365 1.00 119.08 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 493.414 12.676  694.185 1.00 113.86 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 494.507 13.140  695.040 1.00 119.01 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 495.829 12.485  694.652 1.00 117.57 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 495.967 11.255  694.689 1.00 115.80 ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 494.192 12.901  696.529 1.00 114.85 ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 493.048 13.792  697.009 1.00 110.45 ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 495.422 13.049  697.413 1.00 113.16 ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 492.641 13.481  698.450 1.00 116.06 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 496.818 13.321  694.317 1.00 119.66 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 498.168 12.883  693.982 1.00 121.86 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 499.162 13.761  694.728 1.00 126.11 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 499.197 14.979  694.515 1.00 127.17 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 498.438 12.962  692.473 1.00 121.30 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 497.624 12.025  691.565 1.00 118.87 ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 497.675 12.519  690.108 1.00 115.64 ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 497.286 11.458  689.089 1.00 109.78 ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 498.150 11.558  687.876 1.00 108.60 ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 499.958 13.138  695.608 1.00 125.59 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 501.044 13.831  696.303 1.00 131.98 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 502.236 14.101  695.370 1.00 136.22 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 502.956 15.091  695.548 1.00 139.68 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 501.441 13.056  697.568 1.00 137.27 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 500.598 13.461  698.803 1.00 132.75 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 499.884 14.493  698.719 1.00 127.60 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 500.647 12.754  699.846 1.00 122.75 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 502.500 13.212  694.414 1.00 137.78 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 503.557 13.405  693.428 1.00 135.42 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 503.029 12.929  692.071 1.00 131.22 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 501.852 12.579  691.937 1.00 132.12 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 504.854 12.699  693.851 1.00 140.54 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 504.787 11.184  694.021 1.00 135.20 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 506.186 10.661  694.345 1.00 142.78 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 506.690 11.039  695.666 1.00 149.02 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 507.979 10.993  696.015 1.00 154.50 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 508.907 10.600  695.141 1.00 145.58 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 508.350 11.344  697.242 1.00 156.63 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 503.885 12.931  691.045 1.00 129.36 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 503.399 12.652  689.689 1.00 128.87 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 502.817 11.241  689.600 1.00 124.77 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 501.726 11.038  689.050 1.00 122.54 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 504.516 12.870  688.640 1.00 124.83 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 504.991 14.337  688.574 1.00 122.14 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 504.055 12.402  687.265 1.00 118.28 ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 503.976 15.335  688.040 1.00 119.77 ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 503.498 10.259  690.192 1.00 120.38 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 503.133 8.846   690.102 1.00 117.35 ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 502.127 8.364   691.139 1.00 120.69 ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 501.992 7.147   691.314 1.00 118.24 ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 504.386 7.970   690.159 1.00 123.52 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 505.274 8.128   688.925 1.00 129.57 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 504.820 8.534   687.835 1.00 128.24 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 506.553 7.823   689.098 1.00 130.26 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 501.527 9.260   691.917 1.00 127.70 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 500.538 8.854   692.914 1.00 120.36 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 499.279 8.255   692.265 1.00 110.22 ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 498.749 8.780   691.284 1.00 107.08 ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 500.159 10.043  693.792 1.00 119.65 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 498.725 7.230   692.904 1.00 111.82 ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 497.527 6.527   692.458 1.00 106.27 ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 496.360 6.942   693.358 1.00 107.74 ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 496.280 6.483   694.510 1.00 106.87 ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 497.712 5.009   692.553 1.00 102.03 ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 498.897 4.506   691.752 1.00 101.49 ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 496.436 4.334   692.115 1.00 105.93 ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 499.212 3.032   692.063 1.00 97.88  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 495.397 7.724   692.871 1.00 98.82  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 494.218 8.008   693.682 1.00 104.45 ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 493.487 6.733   694.085 1.00 109.31 ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 493.467 5.741   693.340 1.00 104.54 ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 493.378 8.919   692.778 1.00 99.06  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 494.335 9.601   692.003 1.00 93.57  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 495.435 8.618   691.713 1.00 103.46 ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 492.991 6.747   695.342 1.00 111.45 ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 492.304 5.633   695.992 1.00 106.05 ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 490.909 6.063   696.417 1.00 98.59  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 490.678 7.242   696.709 1.00 93.26  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 493.073 5.118   697.232 1.00 100.43 ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 492.352 3.923   697.847 1.00 99.50  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 494.514 4.753   696.884 1.00 109.68 ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 489.961 5.129   696.262 1.00 106.25 ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 488.585 5.227   696.759 1.00 112.05 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 488.502 5.387   698.283 1.00 110.79 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 489.026 4.558   699.043 1.00 106.50 ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 487.790 4.005   696.311 1.00 111.41 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 487.487 4.037   694.838 1.00 113.59 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 487.305 5.163   694.304 1.00 112.10 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 487.437 2.947   694.221 1.00 117.17 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 487.775 6.419   698.730 1.00 108.90 ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 487.641 6.753   700.148 1.00 108.41 ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 486.240 6.464   700.688 1.00 111.17 ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 485.265 7.118   700.295 1.00 108.05 ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 487.988 8.222   700.374 1.00 106.40 ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 486.143 5.500   701.603 1.00 112.85 ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 484.934 5.312   702.396 1.00 109.20 ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 485.229 6.027   703.709 1.00 108.58 ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 485.897 5.483   704.602 1.00 111.12 ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 484.628 3.831   702.652 1.00 107.61 ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 483.305 3.678   703.389 1.00 102.90 ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 484.690 3.005   701.378 1.00 103.10 ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 484.705 7.234   703.870 1.00 105.46 ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 485.154 7.979   705.034 1.00 108.74 ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 484.416 7.468   706.261 1.00 110.47 ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 485.031 7.207   707.303 1.00 103.10 ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 484.930 9.478   704.851 1.00 107.86 ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 485.924 10.156  703.933 1.00 113.56 ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 487.293 10.108  704.193 1.00 115.89 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 485.485 10.917  702.849 1.00 115.23 ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 488.207 10.770  703.350 1.00 111.88 ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 486.394 11.582  702.010 1.00 108.87 ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 487.749 11.511  702.269 1.00 106.04 ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 483.113 7.237   706.100 1.00 109.46 ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 482.191 6.939   707.174 1.00 103.46 ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 482.756 5.822   708.053 1.00 109.70 ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 483.131 4.750   707.534 1.00 101.43 ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 480.839 6.538   706.582 1.00 103.26 ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 479.934 6.063   707.562 1.00 97.76  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 482.931 6.081   709.361 1.00 113.51 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 483.392 5.047   710.302 1.00 103.37 ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 482.340 4.017   710.672 1.00 100.44 ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 482.698 2.970   711.216 1.00 101.21 ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 483.874 5.870   711.496 1.00 92.08  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 483.015 7.051   711.449 1.00 95.56  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 482.771 7.382   710.036 1.00 100.71 ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 481.064 4.283   710.403 1.00 102.27 ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 479.956 3.425   710.826 1.00 102.74 ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 479.868 2.209   709.907 1.00 104.23 ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 479.605 2.341   708.707 1.00 107.13 ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 478.643 4.223   710.790 1.00 100.80 ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 477.468 3.407   711.275 1.00 97.58  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 478.797 5.531   711.537 1.00 98.48  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 480.094 1.018   710.472 1.00 98.98  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 479.974 -0.210  709.689 1.00 98.46  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 478.525 -0.745  709.614 1.00 101.29 ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 478.098 -1.169  708.535 1.00 104.89 ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 481.041 -1.205  710.166 1.00 91.17  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 482.506 -0.544  709.996 1.00 109.10 ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 482.971 -0.048  708.504 1.00 119.08 ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 484.262 0.719   708.418 1.00 122.46 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 484.837 1.223   707.295 1.00 131.78 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 484.272 1.066   706.097 1.00 129.42 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 485.995 1.906   707.352 1.00 124.89 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 477.739 -0.736  710.710 1.00 103.76 ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 476.348 -1.230  710.688 1.00 95.03  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 475.487 -0.511  711.732 1.00 98.39  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 475.963 -0.166  712.817 1.00 100.77 ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 476.276 -2.755  710.927 1.00 86.79  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 474.862 -3.367  710.946 1.00 89.36  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 474.785 -4.664  710.120 1.00 96.30  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 475.725 -5.690  710.573 1.00 105.55 ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 475.439 -6.673  711.423 1.00 108.77 ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 474.217 -6.773  711.921 1.00 109.95 ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 476.376 -7.554  711.783 1.00 111.13 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 474.210 -0.289  711.400 1.00 98.09  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 473.224 0.296   712.317 1.00 91.63  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 471.905 -0.453  712.215 1.00 92.87  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 471.310 -0.509  711.137 1.00 98.44  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 472.983 1.787   712.028 1.00 87.56  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 471.989 2.347   712.986 1.00 89.57  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 474.270 2.544   712.171 1.00 84.89  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 471.414 -0.977  713.333 1.00 98.69  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 470.068 -1.537  713.411 1.00 98.56  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 469.378 -0.924  714.618 1.00 98.44  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 470.037 -0.476  715.562 1.00 101.10 ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 470.077 -3.069  713.535 1.00 95.16  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 468.046 -0.911  714.616 1.00 99.23  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 467.377 -0.499  715.846 1.00 93.94  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 466.101 -1.287  716.114 1.00 94.19  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 465.253 -1.453  715.232 1.00 91.34  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 467.135 1.016   715.902 1.00 86.19  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 466.097 1.537   714.982 1.00 85.71  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? 464.774 1.535   715.333 1.00 87.71  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 466.459 2.177   713.830 1.00 96.27  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? 463.813 2.069   714.508 1.00 88.67  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? 465.504 2.707   712.988 1.00 97.58  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? 464.175 2.661   713.343 1.00 95.23  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 465.985 -1.743  717.365 1.00 100.13 ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? 464.852 -2.491  717.893 1.00 99.63  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? 463.826 -1.568  718.534 1.00 93.99  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? 464.182 -0.582  719.183 1.00 94.25  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 465.337 -3.454  718.974 1.00 100.91 ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? 464.445 -4.628  719.241 1.00 103.06 ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? 464.701 -5.757  718.272 1.00 116.19 ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 465.533 -5.640  717.338 1.00 115.40 ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? 464.004 -6.877  718.492 1.00 112.64 ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? 462.553 -1.840  718.276 1.00 90.24  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? 461.453 -1.192  718.982 1.00 93.04  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? 460.595 -2.273  719.634 1.00 99.38  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? 459.944 -3.061  718.931 1.00 95.57  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? 460.630 -0.272  718.085 1.00 93.74  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? 459.386 0.141   718.828 1.00 92.16  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? 461.452 0.958   717.768 1.00 88.09  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? 460.575 -2.295  720.984 1.00 107.92 ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? 459.870 -3.289  721.790 1.00 99.20  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? 458.781 -2.625  722.624 1.00 97.95  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? 458.848 -1.432  722.941 1.00 95.84  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? 460.853 -4.014  722.701 1.00 94.12  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? 461.837 -4.778  721.888 1.00 104.05 ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? 463.021 -5.229  722.671 1.00 105.29 ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? 463.009 -6.398  723.101 1.00 109.38 ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? 463.918 -4.386  722.910 1.00 99.86  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? 457.800 -3.441  723.016 1.00 105.08 ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? 456.664 -2.968  723.808 1.00 108.85 ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? 457.038 -2.707  725.280 1.00 104.15 ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? 457.813 -3.458  725.889 1.00 94.54  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? 455.563 -4.029  723.748 1.00 106.86 ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? 454.179 -3.436  723.760 1.00 111.11 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? 454.061 -2.208  723.964 1.00 115.80 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? 453.208 -4.204  723.572 1.00 111.93 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? 456.427 -1.672  725.874 1.00 107.70 ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? 456.646 -1.328  727.282 1.00 104.87 ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? 455.454 -0.515  727.802 1.00 108.04 ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? 454.604 -0.052  727.032 1.00 105.00 ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? 457.980 -0.571  727.477 1.00 101.06 ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? 458.584 -0.940  728.718 1.00 94.85  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? 457.787 0.937   727.498 1.00 103.43 ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? 455.361 -0.422  729.135 1.00 117.17 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? 454.308 0.306   729.842 1.00 109.80 ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? 454.877 1.006   731.076 1.00 106.44 ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? 455.858 0.545   731.671 1.00 99.09  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? 453.128 -0.576  730.268 1.00 108.14 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? 453.475 -1.714  731.211 1.00 116.61 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? 452.237 -2.591  731.485 1.00 130.16 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? 451.124 -1.731  731.936 1.00 135.77 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? 449.890 -2.131  732.261 1.00 133.40 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? 449.556 -3.418  732.203 1.00 136.98 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? 448.983 -1.230  732.657 1.00 123.13 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? 454.245 2.130   731.449 1.00 109.55 ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? 454.451 2.824   732.727 1.00 110.97 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? 453.390 2.407   733.745 1.00 117.82 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? 453.213 3.059   734.782 1.00 111.18 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? 454.370 4.345   732.561 1.00 107.97 ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? 455.211 5.225   733.503 1.00 106.05 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? 456.450 4.519   734.055 1.00 99.77  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? 455.498 6.611   732.974 1.00 107.70 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? 452.649 1.360   733.417 1.00 121.23 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? 451.792 0.631   734.294 1.00 106.05 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? 450.437 1.273   734.361 1.00 113.45 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? 449.448 0.578   734.579 1.00 124.58 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? 450.344 2.509   733.891 1.00 114.39 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? 449.082 3.207   733.760 1.00 122.28 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? 448.611 3.073   732.321 1.00 129.08 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? 447.434 2.781   732.077 1.00 130.07 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? 449.260 4.686   734.177 1.00 124.16 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? 447.987 5.595   734.361 1.00 128.02 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? 447.392 6.237   733.096 1.00 133.06 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? 446.926 5.550   732.189 1.00 135.24 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? 447.429 7.568   733.034 1.00 133.69 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? 449.568 3.137   731.382 1.00 125.43 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? 449.352 3.216   729.947 1.00 118.09 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? 450.156 2.123   729.264 1.00 118.74 ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? 451.215 1.717   729.758 1.00 112.69 ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? 449.769 4.557   729.332 1.00 121.07 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? 450.602 5.499   730.168 1.00 118.03 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? 450.449 6.866   729.502 1.00 125.29 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? 450.359 8.037   730.377 1.00 133.57 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? 451.208 8.361   731.349 1.00 134.71 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? 452.260 7.597   731.623 1.00 131.15 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? 450.995 9.469   732.056 1.00 134.43 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? 449.640 1.664   728.114 1.00 119.58 ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? 450.176 0.545   727.341 1.00 118.12 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? 450.438 0.961   725.899 1.00 116.58 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? 450.034 2.037   725.437 1.00 114.84 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? 449.251 -0.682  727.322 1.00 112.22 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? 447.918 -0.275  726.996 1.00 107.23 ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? 449.295 -1.428  728.633 1.00 120.20 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? 451.198 0.095   725.225 1.00 115.56 ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? 451.669 0.285   723.853 1.00 118.22 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? 452.690 1.410   723.766 1.00 114.35 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? 452.900 1.998   722.699 1.00 107.41 ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? 450.518 0.532   722.865 1.00 121.99 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? 450.868 0.100   721.437 1.00 118.49 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? 452.054 -0.232  721.208 1.00 111.27 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? 449.973 0.132   720.552 1.00 113.81 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? 453.410 1.625   724.860 1.00 115.59 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? 454.539 2.534   724.851 1.00 111.45 ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? 455.722 1.842   724.153 1.00 104.46 ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? 455.739 0.616   723.967 1.00 100.65 ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? 454.864 2.959   726.286 1.00 109.23 ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? 453.925 3.961   726.958 1.00 100.44 ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? 454.709 4.762   727.985 1.00 99.59  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? 453.241 4.869   725.943 1.00 100.82 ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? 456.711 2.636   723.747 1.00 100.85 ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? 457.804 2.127   722.916 1.00 104.91 ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? 459.122 2.093   723.687 1.00 98.45  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? 459.513 3.095   724.293 1.00 100.94 ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? 457.935 3.035   721.671 1.00 102.35 ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? 456.964 2.661   720.494 1.00 99.36  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? 456.313 1.599   720.500 1.00 97.54  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? 456.768 3.513   719.591 1.00 99.87  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? 459.840 0.966   723.618 1.00 93.11  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? 461.198 0.899   724.152 1.00 96.66  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? 462.174 0.738   722.982 1.00 104.22 ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? 462.232 -0.325  722.342 1.00 100.50 ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? 461.353 -0.268  725.126 1.00 96.73  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? 462.799 -0.687  725.309 1.00 94.09  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? 462.913 -2.103  725.809 1.00 92.25  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? 464.180 -2.372  726.542 1.00 90.31  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? 464.102 -3.772  727.022 1.00 95.57  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? 463.054 1.718   722.829 1.00 102.73 ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? 463.911 1.857   721.668 1.00 90.34  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 465.335 1.471   722.011 1.00 93.84  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 465.942 2.044   722.915 1.00 96.19  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? 463.866 3.297   721.158 1.00 89.30  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? 464.893 3.689   720.103 1.00 96.67  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? 464.656 2.878   718.832 1.00 90.27  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? 464.783 5.191   719.836 1.00 94.01  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 465.905 0.590   721.213 1.00 101.48 ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 467.284 0.164   721.397 1.00 100.58 ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 468.029 0.347   720.079 1.00 102.04 ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 467.700 -0.309  719.088 1.00 105.16 ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 467.317 -1.292  721.840 1.00 98.31  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 466.201 -1.524  722.718 1.00 97.19  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 468.658 -1.620  722.510 1.00 95.84  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 469.009 1.256   720.061 1.00 99.30  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 469.854 1.521   718.896 1.00 97.26  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 471.137 0.688   718.988 1.00 97.21  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 471.902 0.863   719.940 1.00 100.92 ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 470.209 3.005   718.764 1.00 93.42  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 469.303 4.008   718.039 1.00 90.27  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 469.839 5.439   718.148 1.00 85.29  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 469.092 3.643   716.603 1.00 89.30  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 471.349 -0.251  718.053 1.00 93.59  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 472.620 -0.985  717.969 1.00 94.44  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 473.523 -0.271  716.976 1.00 97.47  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 473.090 0.045   715.866 1.00 103.10 ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 472.422 -2.461  717.570 1.00 90.76  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 471.181 -2.975  718.152 1.00 91.48  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 471.184 -4.411  718.664 1.00 93.77  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 470.842 -5.529  717.785 1.00 92.63  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 471.362 -6.758  717.850 1.00 97.55  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 470.924 -7.707  717.015 1.00 95.21  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 472.346 -7.034  718.701 1.00 98.05  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 474.755 0.046   717.400 1.00 97.39  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 475.681 0.854   716.605 1.00 97.00  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 477.030 0.131   716.562 1.00 102.10 ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 477.636 -0.109  717.615 1.00 104.83 ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 475.885 2.250   717.222 1.00 92.43  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 474.621 3.094   717.229 1.00 86.96  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 476.884 3.017   716.413 1.00 92.97  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 473.832 3.017   716.035 1.00 91.49  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 477.468 -0.277  715.364 1.00 98.30  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 478.806 -0.827  715.136 1.00 97.77  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 479.751 0.149   714.417 1.00 101.31 ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 479.345 0.820   713.465 1.00 102.66 ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 478.737 -2.088  714.298 1.00 89.80  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 478.101 -3.309  714.833 1.00 89.04  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 478.745 -4.410  715.282 1.00 90.24  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 476.703 -3.630  714.843 1.00 94.11  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 477.841 -5.398  715.610 1.00 97.46  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 476.579 -4.942  715.352 1.00 96.93  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 475.547 -2.936  714.489 1.00 94.66  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 475.348 -5.568  715.523 1.00 97.36  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 474.322 -3.563  714.651 1.00 95.83  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 474.233 -4.866  715.165 1.00 97.60  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 481.019 0.232   714.843 1.00 102.21 ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 481.967 1.165   714.227 1.00 104.89 ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 483.322 0.488   714.041 1.00 111.58 ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 483.594 -0.579  714.602 1.00 111.07 ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 482.186 2.483   714.972 1.00 103.74 ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 482.791 2.238   716.247 1.00 113.07 ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 480.898 3.277   715.079 1.00 99.30  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 484.160 1.123   713.204 1.00 115.35 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 485.523 0.682   712.908 1.00 118.36 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 486.549 1.069   713.972 1.00 123.11 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 487.680 0.568   713.922 1.00 127.06 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 485.993 1.257   711.557 1.00 114.98 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 485.982 2.802   711.510 1.00 114.13 ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 485.870 3.479   712.550 1.00 112.10 ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 486.120 3.356   710.403 1.00 121.12 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 486.184 1.912   714.943 1.00 120.52 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 487.073 2.314   716.008 1.00 118.24 ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 487.696 3.697   715.873 1.00 116.46 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 488.198 4.217   716.878 1.00 113.64 ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 487.697 4.321   714.684 1.00 117.65 ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 488.261 5.671   714.654 1.00 120.52 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 487.385 6.584   715.504 1.00 112.73 ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 487.885 7.398   716.291 1.00 111.03 ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 488.371 6.181   713.206 1.00 110.47 ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 488.742 7.559   713.150 1.00 102.88 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 486.072 6.425   715.378 1.00 105.67 ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 485.110 6.922   716.340 1.00 108.55 ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 484.317 5.697   716.773 1.00 111.68 ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 484.231 4.699   716.050 1.00 106.39 ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 484.192 8.057   715.831 1.00 104.83 ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 484.911 8.923   714.791 1.00 105.97 ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 482.864 7.502   715.338 1.00 100.59 ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 483.749 5.780   717.979 1.00 117.24 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 483.005 4.960   718.930 1.00 109.87 ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 481.497 5.048   718.693 1.00 104.71 ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 480.982 6.117   718.343 1.00 101.15 ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 483.357 5.403   720.346 1.00 105.02 ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 484.506 4.669   720.792 1.00 106.06 ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 482.191 5.314   721.315 1.00 107.56 ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 480.797 3.920   718.898 1.00 105.72 ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 479.332 3.928   718.749 1.00 105.90 ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 478.654 5.087   719.458 1.00 105.55 ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 477.747 5.734   718.906 1.00 102.49 ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 478.932 2.579   719.369 1.00 102.97 ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 480.112 1.689   719.095 1.00 104.63 ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 481.327 2.568   719.171 1.00 106.16 ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 479.105 5.386   720.674 1.00 102.15 ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 478.564 6.529   721.393 1.00 107.52 ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 478.902 7.847   720.705 1.00 105.61 ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 477.998 8.624   720.366 1.00 103.08 ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 479.057 6.532   722.848 1.00 112.40 ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 478.597 7.716   723.729 1.00 101.81 ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 477.101 7.821   723.778 1.00 92.17  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 479.166 7.576   725.121 1.00 95.35  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 480.171 8.031   720.328 1.00 102.95 ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 480.558 9.284   719.692 1.00 101.07 ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 479.693 9.551   718.470 1.00 107.14 ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 479.220 10.679  718.261 1.00 104.74 ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 482.032 9.204   719.329 1.00 102.29 ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 482.925 8.855   720.503 1.00 99.79  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 484.399 8.704   720.108 1.00 114.23 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 485.152 7.972   720.790 1.00 114.96 ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 484.830 9.361   719.134 1.00 117.14 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 479.464 8.510   717.669 1.00 108.82 ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 478.586 8.583   716.506 1.00 105.13 ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 477.192 9.077   716.889 1.00 100.62 ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 476.654 10.027  716.292 1.00 87.94  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 478.500 7.203   715.856 1.00 103.52 ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 476.582 8.396   717.867 1.00 99.19  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 475.239 8.734   718.317 1.00 100.04 ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 475.116 10.203  718.695 1.00 97.51  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 474.093 10.846  718.417 1.00 93.89  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 474.865 7.839   719.492 1.00 98.82  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 473.563 8.175   720.219 1.00 99.88  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 472.403 8.181   719.220 1.00 92.43  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 473.292 7.219   721.410 1.00 91.72  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 476.110 10.740  719.387 1.00 98.54  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 476.029 12.153  719.728 1.00 103.36 ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 476.095 13.019  718.476 1.00 101.04 ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 475.303 13.955  718.327 1.00 100.86 ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 477.129 12.517  720.730 1.00 107.43 ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 476.878 11.914  722.106 1.00 100.74 ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 475.733 11.877  722.576 1.00 102.46 ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 477.934 11.367  722.723 1.00 96.20  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 477.003 12.694  717.543 1.00 104.04 ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 477.106 13.464  716.304 1.00 100.15 ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 475.832 13.368  715.487 1.00 95.35  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 475.354 14.372  714.941 1.00 91.13  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 478.289 12.985  715.496 1.00 92.15  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 479.558 13.146  716.245 1.00 100.34 ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 480.745 12.724  715.431 1.00 109.51 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 481.029 13.320  714.381 1.00 109.64 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 481.409 11.639  715.856 1.00 107.82 ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 475.236 12.177  715.442 1.00 92.98  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 473.988 12.015  714.714 1.00 93.92  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 472.918 12.927  715.302 1.00 99.65  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 472.235 13.665  714.575 1.00 94.62  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 473.561 10.545  714.761 1.00 88.25  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 472.735 12.856  716.625 1.00 101.42 ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 471.780 13.726  717.309 1.00 99.71  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 472.105 15.200  717.064 1.00 99.64  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 471.246 16.001  716.665 1.00 95.11  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 471.778 13.409  718.817 1.00 94.38  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 470.953 14.421  719.560 1.00 95.95  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 471.271 12.012  719.075 1.00 95.02  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 473.382 15.553  717.193 1.00 102.91 ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 473.774 16.941  717.002 1.00 100.53 ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 473.490 17.439  715.603 1.00 101.75 ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 473.016 18.571  715.435 1.00 101.09 ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 475.242 17.127  717.369 1.00 99.21  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 475.695 18.506  717.068 1.00 101.31 ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 474.873 19.572  717.786 1.00 110.16 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 474.193 19.307  718.830 1.00 110.32 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 474.890 20.704  717.256 1.00 111.47 ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 473.718 16.589  714.594 1.00 105.31 ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 473.391 16.943  713.211 1.00 103.07 ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 471.894 17.187  713.088 1.00 100.98 ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 471.437 18.234  712.596 1.00 92.56  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 473.841 15.812  712.269 1.00 100.19 ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 475.355 15.791  712.140 1.00 99.90  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 473.234 15.991  710.866 1.00 100.45 ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 475.851 14.498  711.530 1.00 94.33  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 471.112 16.227  713.590 1.00 100.18 ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 469.668 16.327  713.515 1.00 94.96  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 469.174 17.567  714.244 1.00 98.76  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 468.277 18.265  713.752 1.00 98.47  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 469.073 15.033  714.048 1.00 87.39  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 467.559 14.909  713.973 1.00 92.86  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 467.002 15.477  712.681 1.00 90.22  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 467.236 13.417  714.065 1.00 90.26  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 469.734 17.848  715.427 1.00 94.39  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 469.363 19.058  716.155 1.00 97.48  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 469.663 20.292  715.314 1.00 101.59 ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 468.783 21.125  715.054 1.00 100.52 ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 470.062 19.105  717.510 1.00 108.56 ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 469.739 20.371  718.314 1.00 111.70 ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 470.945 20.900  719.055 1.00 109.12 ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 471.088 22.324  718.815 1.00 109.18 ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 472.163 22.848  718.256 1.00 105.11 ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 472.250 24.151  718.038 1.00 109.85 ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 473.169 22.053  717.965 1.00 107.83 ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 470.915 20.401  714.866 1.00 104.79 ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 471.366 21.502  714.024 1.00 106.72 ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 470.499 21.675  712.794 1.00 105.61 ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 470.308 22.801  712.311 1.00 105.38 ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 472.781 21.162  713.539 1.00 105.23 ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 473.508 22.159  712.635 1.00 111.33 ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 474.846 21.585  712.119 1.00 114.93 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 475.840 21.592  712.892 1.00 111.83 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 474.869 21.057  710.964 1.00 109.11 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 469.958 20.576  712.279 1.00 101.39 ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 469.108 20.654  711.100 1.00 106.81 ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 467.768 21.323  711.380 1.00 106.95 ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 467.279 22.109  710.554 1.00 97.80  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 468.920 19.257  710.539 1.00 106.40 ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 469.916 18.932  709.471 1.00 109.05 ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 469.800 19.375  708.172 1.00 97.84  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 471.070 18.226  709.531 1.00 104.54 ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 470.832 18.937  707.478 1.00 101.45 ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 471.618 18.242  708.281 1.00 94.66  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 467.168 21.012  712.544 1.00 109.25 ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 465.886 21.586  712.961 1.00 105.27 ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 465.930 23.100  713.112 1.00 109.01 ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 464.899 23.768  712.940 1.00 109.73 ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 465.462 20.925  714.267 1.00 105.95 ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 465.129 19.438  714.114 1.00 104.55 ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 464.889 18.747  715.440 1.00 94.08  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? 463.889 19.312  713.254 1.00 102.19 ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 467.100 23.653  713.446 1.00 109.28 ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 467.288 25.102  713.480 1.00 110.05 ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 466.866 25.778  712.180 1.00 108.45 ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 466.392 26.918  712.205 1.00 107.49 ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 468.742 25.444  713.790 1.00 111.36 ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 469.570 25.046  712.681 1.00 112.00 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 469.199 24.749  715.092 1.00 98.99  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 467.049 25.106  711.036 1.00 109.14 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 466.844 25.738  709.731 1.00 115.78 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 465.416 26.225  709.520 1.00 116.98 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 465.170 26.999  708.585 1.00 117.37 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 467.252 24.776  708.599 1.00 115.69 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 468.708 24.302  708.651 1.00 116.49 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 469.733 25.165  709.049 1.00 112.60 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 469.058 22.990  708.292 1.00 113.83 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 471.066 24.730  709.111 1.00 116.77 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 470.391 22.542  708.347 1.00 108.93 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 471.395 23.418  708.757 1.00 114.23 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 472.721 22.998  708.827 1.00 103.05 ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? 464.479 25.795  710.353 1.00 117.49 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? 463.083 26.196  710.255 1.00 121.25 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? 462.809 27.550  710.909 1.00 130.78 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? 461.647 27.956  711.004 1.00 133.72 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? 462.192 25.140  710.902 1.00 115.72 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? 462.059 23.889  710.100 1.00 107.52 ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? 461.093 23.779  709.110 1.00 108.27 ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? 462.870 22.799  710.370 1.00 102.83 ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? 460.965 22.608  708.368 1.00 101.90 ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? 462.745 21.627  709.642 1.00 100.89 ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? 461.792 21.531  708.636 1.00 96.25  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? 463.834 28.226  711.425 1.00 133.59 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? 463.616 29.444  712.202 1.00 137.00 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? 463.034 30.591  711.370 1.00 139.28 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? 461.944 31.093  711.671 1.00 135.04 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 464.930 29.871  712.873 1.00 136.87 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 465.975 30.048  711.924 1.00 136.43 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? 463.738 31.016  710.311 1.00 137.49 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? 463.381 32.248  709.615 1.00 137.32 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? 462.525 31.968  708.392 1.00 135.15 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? 463.070 31.540  707.363 1.00 140.60 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 464.671 32.959  709.196 1.00 140.15 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 465.579 33.303  710.388 1.00 146.01 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? 465.113 33.493  711.521 1.00 147.07 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 466.889 33.321  710.142 1.00 142.65 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? 461.218 32.226  708.425 1.00 126.18 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? 460.354 31.923  707.279 1.00 127.69 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? 460.442 32.971  706.169 1.00 132.11 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? 461.137 33.981  706.293 1.00 131.77 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? 458.956 31.915  707.897 1.00 118.52 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? 459.163 32.011  709.344 1.00 128.68 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? 460.433 32.731  709.544 1.00 127.18 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? 459.655 32.726  705.103 1.00 126.94 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? 459.338 33.660  704.008 1.00 115.28 ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? 458.144 33.207  703.176 1.00 113.22 ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? 458.049 33.520  701.987 1.00 111.40 ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? 460.536 33.879  703.109 1.00 114.62 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? 461.207 35.207  703.387 1.00 125.01 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? 462.617 35.064  703.942 1.00 134.15 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? 463.046 33.964  704.316 1.00 132.09 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? 463.344 36.184  704.010 1.00 131.74 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LEU B 1  6    ? 478.178 23.790  701.742 1.00 157.51 ? 6    LEU B N     1 
ATOM   1784  C  CA    . LEU B 1  6    ? 477.143 23.565  702.745 1.00 158.67 ? 6    LEU B CA    1 
ATOM   1785  C  C     . LEU B 1  6    ? 476.590 24.936  703.109 1.00 161.89 ? 6    LEU B C     1 
ATOM   1786  O  O     . LEU B 1  6    ? 476.994 25.511  704.126 1.00 163.38 ? 6    LEU B O     1 
ATOM   1787  C  CB    . LEU B 1  6    ? 477.737 22.885  703.986 1.00 157.08 ? 6    LEU B CB    1 
ATOM   1788  C  CG    . LEU B 1  6    ? 478.577 21.611  703.834 1.00 156.42 ? 6    LEU B CG    1 
ATOM   1789  C  CD1   . LEU B 1  6    ? 477.867 20.618  702.926 1.00 154.87 ? 6    LEU B CD1   1 
ATOM   1790  C  CD2   . LEU B 1  6    ? 480.024 21.898  703.351 1.00 157.15 ? 6    LEU B CD2   1 
ATOM   1791  N  N     . LYS B 1  7    ? 475.614 25.438  702.352 1.00 158.24 ? 7    LYS B N     1 
ATOM   1792  C  CA    . LYS B 1  7    ? 475.028 26.712  702.734 1.00 152.25 ? 7    LYS B CA    1 
ATOM   1793  C  C     . LYS B 1  7    ? 473.973 26.537  703.834 1.00 142.39 ? 7    LYS B C     1 
ATOM   1794  O  O     . LYS B 1  7    ? 473.735 25.440  704.350 1.00 140.95 ? 7    LYS B O     1 
ATOM   1795  C  CB    . LYS B 1  7    ? 474.378 27.347  701.505 1.00 144.97 ? 7    LYS B CB    1 
ATOM   1796  C  CG    . LYS B 1  7    ? 475.335 27.562  700.367 1.00 148.12 ? 7    LYS B CG    1 
ATOM   1797  C  CD    . LYS B 1  7    ? 476.404 28.592  700.602 1.00 159.51 ? 7    LYS B CD    1 
ATOM   1798  C  CE    . LYS B 1  7    ? 477.042 28.960  699.249 1.00 166.75 ? 7    LYS B CE    1 
ATOM   1799  N  NZ    . LYS B 1  7    ? 477.910 27.888  698.659 1.00 154.40 ? 7    LYS B NZ    1 
ATOM   1800  N  N     . ALA B 1  8    ? 473.404 27.664  704.265 1.00 137.53 ? 8    ALA B N     1 
ATOM   1801  C  CA    . ALA B 1  8    ? 472.297 27.678  705.211 1.00 123.57 ? 8    ALA B CA    1 
ATOM   1802  C  C     . ALA B 1  8    ? 470.984 27.508  704.443 1.00 122.80 ? 8    ALA B C     1 
ATOM   1803  O  O     . ALA B 1  8    ? 470.651 28.384  703.630 1.00 122.59 ? 8    ALA B O     1 
ATOM   1804  C  CB    . ALA B 1  8    ? 472.295 28.981  705.986 1.00 119.09 ? 8    ALA B CB    1 
ATOM   1805  N  N     . PRO B 1  9    ? 470.229 26.420  704.621 1.00 116.58 ? 9    PRO B N     1 
ATOM   1806  C  CA    . PRO B 1  9    ? 468.994 26.245  703.823 1.00 111.42 ? 9    PRO B CA    1 
ATOM   1807  C  C     . PRO B 1  9    ? 468.038 27.431  703.934 1.00 105.37 ? 9    PRO B C     1 
ATOM   1808  O  O     . PRO B 1  9    ? 467.966 28.078  704.969 1.00 116.69 ? 9    PRO B O     1 
ATOM   1809  C  CB    . PRO B 1  9    ? 468.379 24.977  704.416 1.00 111.83 ? 9    PRO B CB    1 
ATOM   1810  C  CG    . PRO B 1  9    ? 469.584 24.221  704.973 1.00 116.98 ? 9    PRO B CG    1 
ATOM   1811  C  CD    . PRO B 1  9    ? 470.517 25.266  705.490 1.00 114.63 ? 9    PRO B CD    1 
ATOM   1812  N  N     . VAL B 1  10   ? 467.297 27.735  702.863 1.00 105.75 ? 10   VAL B N     1 
ATOM   1813  C  CA    . VAL B 1  10   ? 466.222 28.733  702.931 1.00 109.13 ? 10   VAL B CA    1 
ATOM   1814  C  C     . VAL B 1  10   ? 464.875 28.079  703.225 1.00 118.16 ? 10   VAL B C     1 
ATOM   1815  O  O     . VAL B 1  10   ? 464.497 27.080  702.595 1.00 118.38 ? 10   VAL B O     1 
ATOM   1816  C  CB    . VAL B 1  10   ? 466.156 29.615  701.675 1.00 113.38 ? 10   VAL B CB    1 
ATOM   1817  C  CG1   . VAL B 1  10   ? 467.466 30.350  701.515 1.00 118.67 ? 10   VAL B CG1   1 
ATOM   1818  C  CG2   . VAL B 1  10   ? 465.776 28.818  700.436 1.00 125.57 ? 10   VAL B CG2   1 
ATOM   1819  N  N     . PHE B 1  11   ? 464.100 28.733  704.096 1.00 124.43 ? 11   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  11   ? 462.812 28.279  704.621 1.00 118.52 ? 11   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  11   ? 461.710 29.186  704.067 1.00 118.16 ? 11   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  11   ? 461.790 30.412  704.204 1.00 118.88 ? 11   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  11   ? 462.863 28.345  706.148 1.00 118.93 ? 11   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  11   ? 461.612 27.907  706.831 1.00 126.81 ? 11   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  11   ? 460.732 27.021  706.229 1.00 127.01 ? 11   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  11   ? 461.246 28.490  708.045 1.00 127.25 ? 11   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  11   ? 459.541 26.644  706.883 1.00 127.06 ? 11   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  11   ? 460.061 28.148  708.672 1.00 121.48 ? 11   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  11   ? 459.210 27.219  708.100 1.00 119.87 ? 11   PHE B CZ    1 
ATOM   1830  N  N     . THR B 1  12   ? 460.710 28.601  703.399 1.00 114.29 ? 12   THR B N     1 
ATOM   1831  C  CA    . THR B 1  12   ? 459.743 29.395  702.640 1.00 116.15 ? 12   THR B CA    1 
ATOM   1832  C  C     . THR B 1  12   ? 458.303 29.037  702.973 1.00 112.76 ? 12   THR B C     1 
ATOM   1833  O  O     . THR B 1  12   ? 457.944 27.856  702.975 1.00 110.27 ? 12   THR B O     1 
ATOM   1834  C  CB    . THR B 1  12   ? 459.950 29.181  701.139 1.00 115.21 ? 12   THR B CB    1 
ATOM   1835  O  OG1   . THR B 1  12   ? 461.331 29.397  700.811 1.00 117.70 ? 12   THR B OG1   1 
ATOM   1836  C  CG2   . THR B 1  12   ? 459.026 30.110  700.326 1.00 109.99 ? 12   THR B CG2   1 
ATOM   1837  N  N     . VAL B 1  13   ? 457.467 30.053  703.197 1.00 107.70 ? 13   VAL B N     1 
ATOM   1838  C  CA    . VAL B 1  13   ? 456.099 29.838  703.651 1.00 112.73 ? 13   VAL B CA    1 
ATOM   1839  C  C     . VAL B 1  13   ? 455.108 30.442  702.666 1.00 114.04 ? 13   VAL B C     1 
ATOM   1840  O  O     . VAL B 1  13   ? 455.308 31.552  702.166 1.00 118.40 ? 13   VAL B O     1 
ATOM   1841  C  CB    . VAL B 1  13   ? 455.862 30.418  705.063 1.00 115.40 ? 13   VAL B CB    1 
ATOM   1842  C  CG1   . VAL B 1  13   ? 454.498 30.025  705.570 1.00 109.25 ? 13   VAL B CG1   1 
ATOM   1843  C  CG2   . VAL B 1  13   ? 456.904 29.901  706.030 1.00 118.85 ? 13   VAL B CG2   1 
ATOM   1844  N  N     . ARG B 1  14   ? 454.044 29.698  702.383 1.00 110.05 ? 14   ARG B N     1 
ATOM   1845  C  CA    . ARG B 1  14   ? 452.923 30.172  701.586 1.00 111.78 ? 14   ARG B CA    1 
ATOM   1846  C  C     . ARG B 1  14   ? 451.683 29.723  702.335 1.00 118.21 ? 14   ARG B C     1 
ATOM   1847  O  O     . ARG B 1  14   ? 451.441 28.517  702.420 1.00 117.80 ? 14   ARG B O     1 
ATOM   1848  C  CB    . ARG B 1  14   ? 453.011 29.596  700.177 1.00 126.38 ? 14   ARG B CB    1 
ATOM   1849  C  CG    . ARG B 1  14   ? 453.104 30.631  699.031 1.00 135.41 ? 14   ARG B CG    1 
ATOM   1850  C  CD    . ARG B 1  14   ? 453.387 29.884  697.725 1.00 131.99 ? 14   ARG B CD    1 
ATOM   1851  N  NE    . ARG B 1  14   ? 454.294 28.791  698.102 1.00 135.64 ? 14   ARG B NE    1 
ATOM   1852  C  CZ    . ARG B 1  14   ? 455.509 28.572  697.609 1.00 137.32 ? 14   ARG B CZ    1 
ATOM   1853  N  NH1   . ARG B 1  14   ? 456.006 29.368  696.673 1.00 140.17 ? 14   ARG B NH1   1 
ATOM   1854  N  NH2   . ARG B 1  14   ? 456.229 27.548  698.068 1.00 133.84 ? 14   ARG B NH2   1 
ATOM   1855  N  N     . THR B 1  15   ? 450.878 30.669  702.837 1.00 127.27 ? 15   THR B N     1 
ATOM   1856  C  CA    . THR B 1  15   ? 449.749 30.372  703.725 1.00 127.98 ? 15   THR B CA    1 
ATOM   1857  C  C     . THR B 1  15   ? 448.437 30.840  703.117 1.00 129.82 ? 15   THR B C     1 
ATOM   1858  O  O     . THR B 1  15   ? 448.375 31.871  702.438 1.00 128.90 ? 15   THR B O     1 
ATOM   1859  C  CB    . THR B 1  15   ? 449.863 31.046  705.117 1.00 120.75 ? 15   THR B CB    1 
ATOM   1860  O  OG1   . THR B 1  15   ? 449.639 32.456  704.992 1.00 119.77 ? 15   THR B OG1   1 
ATOM   1861  C  CG2   . THR B 1  15   ? 451.213 30.810  705.751 1.00 117.80 ? 15   THR B CG2   1 
ATOM   1862  N  N     . GLN B 1  16   ? 447.379 30.086  703.412 1.00 130.08 ? 16   GLN B N     1 
ATOM   1863  C  CA    . GLN B 1  16   ? 446.022 30.514  703.096 1.00 136.29 ? 16   GLN B CA    1 
ATOM   1864  C  C     . GLN B 1  16   ? 445.132 30.655  704.331 1.00 141.43 ? 16   GLN B C     1 
ATOM   1865  O  O     . GLN B 1  16   ? 444.167 29.893  704.499 1.00 142.56 ? 16   GLN B O     1 
ATOM   1866  C  CB    . GLN B 1  16   ? 445.344 29.541  702.136 1.00 136.03 ? 16   GLN B CB    1 
ATOM   1867  C  CG    . GLN B 1  16   ? 444.062 30.132  701.572 1.00 148.63 ? 16   GLN B CG    1 
ATOM   1868  C  CD    . GLN B 1  16   ? 443.237 29.136  700.799 1.00 158.28 ? 16   GLN B CD    1 
ATOM   1869  O  OE1   . GLN B 1  16   ? 442.119 28.796  701.212 1.00 160.12 ? 16   GLN B OE1   1 
ATOM   1870  N  NE2   . GLN B 1  16   ? 443.768 28.660  699.680 1.00 160.59 ? 16   GLN B NE2   1 
ATOM   1871  N  N     . GLY B 1  17   ? 445.457 31.577  705.233 1.00 137.03 ? 17   GLY B N     1 
ATOM   1872  C  CA    . GLY B 1  17   ? 444.628 31.683  706.416 1.00 127.64 ? 17   GLY B CA    1 
ATOM   1873  C  C     . GLY B 1  17   ? 445.089 30.799  707.547 1.00 122.73 ? 17   GLY B C     1 
ATOM   1874  O  O     . GLY B 1  17   ? 446.290 30.543  707.693 1.00 119.79 ? 17   GLY B O     1 
ATOM   1875  N  N     . ARG B 1  18   ? 444.155 30.312  708.357 1.00 121.37 ? 18   ARG B N     1 
ATOM   1876  C  CA    . ARG B 1  18   ? 444.575 29.475  709.464 1.00 118.87 ? 18   ARG B CA    1 
ATOM   1877  C  C     . ARG B 1  18   ? 444.490 27.979  709.204 1.00 116.74 ? 18   ARG B C     1 
ATOM   1878  O  O     . ARG B 1  18   ? 444.908 27.219  710.075 1.00 120.28 ? 18   ARG B O     1 
ATOM   1879  C  CB    . ARG B 1  18   ? 443.756 29.796  710.727 1.00 121.03 ? 18   ARG B CB    1 
ATOM   1880  C  CG    . ARG B 1  18   ? 443.881 31.232  711.269 1.00 120.95 ? 18   ARG B CG    1 
ATOM   1881  C  CD    . ARG B 1  18   ? 442.985 31.468  712.501 1.00 118.41 ? 18   ARG B CD    1 
ATOM   1882  N  NE    . ARG B 1  18   ? 443.211 30.412  713.481 1.00 116.53 ? 18   ARG B NE    1 
ATOM   1883  C  CZ    . ARG B 1  18   ? 444.227 30.397  714.340 1.00 110.89 ? 18   ARG B CZ    1 
ATOM   1884  N  NH1   . ARG B 1  18   ? 444.354 29.389  715.189 1.00 113.78 ? 18   ARG B NH1   1 
ATOM   1885  N  NH2   . ARG B 1  18   ? 445.117 31.383  714.345 1.00 99.38  ? 18   ARG B NH2   1 
ATOM   1886  N  N     . GLU B 1  19   ? 443.949 27.518  708.075 1.00 117.62 ? 19   GLU B N     1 
ATOM   1887  C  CA    . GLU B 1  19   ? 443.816 26.072  707.893 1.00 117.36 ? 19   GLU B CA    1 
ATOM   1888  C  C     . GLU B 1  19   ? 444.850 25.436  706.960 1.00 120.20 ? 19   GLU B C     1 
ATOM   1889  O  O     . GLU B 1  19   ? 444.858 24.206  706.831 1.00 118.21 ? 19   GLU B O     1 
ATOM   1890  C  CB    . GLU B 1  19   ? 442.422 25.710  707.399 1.00 114.77 ? 19   GLU B CB    1 
ATOM   1891  C  CG    . GLU B 1  19   ? 441.299 26.234  708.234 1.00 114.34 ? 19   GLU B CG    1 
ATOM   1892  C  CD    . GLU B 1  19   ? 439.963 25.884  707.613 1.00 123.47 ? 19   GLU B CD    1 
ATOM   1893  O  OE1   . GLU B 1  19   ? 439.380 26.737  706.904 1.00 123.46 ? 19   GLU B OE1   1 
ATOM   1894  O  OE2   . GLU B 1  19   ? 439.530 24.720  707.771 1.00 127.40 ? 19   GLU B OE2   1 
ATOM   1895  N  N     . TYR B 1  20   ? 445.672 26.210  706.257 1.00 118.72 ? 20   TYR B N     1 
ATOM   1896  C  CA    . TYR B 1  20   ? 446.603 25.584  705.329 1.00 117.38 ? 20   TYR B CA    1 
ATOM   1897  C  C     . TYR B 1  20   ? 447.846 26.423  705.096 1.00 121.30 ? 20   TYR B C     1 
ATOM   1898  O  O     . TYR B 1  20   ? 447.770 27.641  704.909 1.00 124.66 ? 20   TYR B O     1 
ATOM   1899  C  CB    . TYR B 1  20   ? 445.963 25.279  703.975 1.00 118.98 ? 20   TYR B CB    1 
ATOM   1900  C  CG    . TYR B 1  20   ? 446.970 24.704  702.993 1.00 121.06 ? 20   TYR B CG    1 
ATOM   1901  C  CD1   . TYR B 1  20   ? 447.275 23.345  702.977 1.00 120.26 ? 20   TYR B CD1   1 
ATOM   1902  C  CD2   . TYR B 1  20   ? 447.609 25.524  702.067 1.00 122.58 ? 20   TYR B CD2   1 
ATOM   1903  C  CE1   . TYR B 1  20   ? 448.214 22.817  702.062 1.00 118.79 ? 20   TYR B CE1   1 
ATOM   1904  C  CE2   . TYR B 1  20   ? 448.542 25.010  701.153 1.00 124.37 ? 20   TYR B CE2   1 
ATOM   1905  C  CZ    . TYR B 1  20   ? 448.841 23.659  701.146 1.00 121.87 ? 20   TYR B CZ    1 
ATOM   1906  O  OH    . TYR B 1  20   ? 449.769 23.171  700.233 1.00 116.22 ? 20   TYR B OH    1 
ATOM   1907  N  N     . GLY B 1  21   ? 448.968 25.733  704.983 1.00 112.19 ? 21   GLY B N     1 
ATOM   1908  C  CA    . GLY B 1  21   ? 450.223 26.380  704.665 1.00 114.06 ? 21   GLY B CA    1 
ATOM   1909  C  C     . GLY B 1  21   ? 451.087 25.359  703.972 1.00 120.20 ? 21   GLY B C     1 
ATOM   1910  O  O     . GLY B 1  21   ? 450.949 24.151  704.190 1.00 116.55 ? 21   GLY B O     1 
ATOM   1911  N  N     . GLU B 1  22   ? 451.998 25.857  703.136 1.00 120.58 ? 22   GLU B N     1 
ATOM   1912  C  CA    . GLU B 1  22   ? 452.972 25.063  702.406 1.00 109.86 ? 22   GLU B CA    1 
ATOM   1913  C  C     . GLU B 1  22   ? 454.360 25.550  702.782 1.00 107.22 ? 22   GLU B C     1 
ATOM   1914  O  O     . GLU B 1  22   ? 454.619 26.756  702.746 1.00 110.96 ? 22   GLU B O     1 
ATOM   1915  C  CB    . GLU B 1  22   ? 452.666 25.194  700.925 1.00 116.87 ? 22   GLU B CB    1 
ATOM   1916  C  CG    . GLU B 1  22   ? 453.334 24.222  700.015 1.00 123.97 ? 22   GLU B CG    1 
ATOM   1917  C  CD    . GLU B 1  22   ? 453.048 24.582  698.579 1.00 132.55 ? 22   GLU B CD    1 
ATOM   1918  O  OE1   . GLU B 1  22   ? 451.983 25.224  698.367 1.00 131.83 ? 22   GLU B OE1   1 
ATOM   1919  O  OE2   . GLU B 1  22   ? 453.856 24.222  697.685 1.00 134.13 ? 22   GLU B OE2   1 
ATOM   1920  N  N     . PHE B 1  23   ? 455.271 24.625  703.066 1.00 102.80 ? 23   PHE B N     1 
ATOM   1921  C  CA    . PHE B 1  23   ? 456.574 24.994  703.610 1.00 106.80 ? 23   PHE B CA    1 
ATOM   1922  C  C     . PHE B 1  23   ? 457.693 24.303  702.853 1.00 106.91 ? 23   PHE B C     1 
ATOM   1923  O  O     . PHE B 1  23   ? 457.776 23.071  702.848 1.00 107.80 ? 23   PHE B O     1 
ATOM   1924  C  CB    . PHE B 1  23   ? 456.617 24.631  705.098 1.00 109.09 ? 23   PHE B CB    1 
ATOM   1925  C  CG    . PHE B 1  23   ? 455.403 25.090  705.837 1.00 113.91 ? 23   PHE B CG    1 
ATOM   1926  C  CD1   . PHE B 1  23   ? 455.328 26.380  706.346 1.00 112.76 ? 23   PHE B CD1   1 
ATOM   1927  C  CD2   . PHE B 1  23   ? 454.286 24.264  705.941 1.00 115.64 ? 23   PHE B CD2   1 
ATOM   1928  C  CE1   . PHE B 1  23   ? 454.177 26.817  706.985 1.00 109.76 ? 23   PHE B CE1   1 
ATOM   1929  C  CE2   . PHE B 1  23   ? 453.118 24.697  706.587 1.00 109.14 ? 23   PHE B CE2   1 
ATOM   1930  C  CZ    . PHE B 1  23   ? 453.068 25.970  707.102 1.00 108.20 ? 23   PHE B CZ    1 
ATOM   1931  N  N     . VAL B 1  24   ? 458.549 25.088  702.209 1.00 108.34 ? 24   VAL B N     1 
ATOM   1932  C  CA    . VAL B 1  24   ? 459.603 24.540  701.369 1.00 111.03 ? 24   VAL B CA    1 
ATOM   1933  C  C     . VAL B 1  24   ? 460.965 24.867  701.975 1.00 112.18 ? 24   VAL B C     1 
ATOM   1934  O  O     . VAL B 1  24   ? 461.316 26.043  702.131 1.00 118.40 ? 24   VAL B O     1 
ATOM   1935  C  CB    . VAL B 1  24   ? 459.491 25.090  699.942 1.00 109.08 ? 24   VAL B CB    1 
ATOM   1936  C  CG1   . VAL B 1  24   ? 460.652 24.587  699.120 1.00 114.23 ? 24   VAL B CG1   1 
ATOM   1937  C  CG2   . VAL B 1  24   ? 458.130 24.731  699.326 1.00 102.18 ? 24   VAL B CG2   1 
ATOM   1938  N  N     . LEU B 1  25   ? 461.761 23.836  702.248 1.00 104.97 ? 25   LEU B N     1 
ATOM   1939  C  CA    . LEU B 1  25   ? 463.125 23.988  702.747 1.00 106.07 ? 25   LEU B CA    1 
ATOM   1940  C  C     . LEU B 1  25   ? 464.067 23.340  701.750 1.00 111.99 ? 25   LEU B C     1 
ATOM   1941  O  O     . LEU B 1  25   ? 464.138 22.108  701.709 1.00 110.71 ? 25   LEU B O     1 
ATOM   1942  C  CB    . LEU B 1  25   ? 463.273 23.318  704.110 1.00 112.28 ? 25   LEU B CB    1 
ATOM   1943  C  CG    . LEU B 1  25   ? 464.578 23.508  704.894 1.00 115.22 ? 25   LEU B CG    1 
ATOM   1944  C  CD1   . LEU B 1  25   ? 464.865 24.988  705.105 1.00 119.99 ? 25   LEU B CD1   1 
ATOM   1945  C  CD2   . LEU B 1  25   ? 464.622 22.721  706.223 1.00 100.41 ? 25   LEU B CD2   1 
ATOM   1946  N  N     . GLU B 1  26   ? 464.889 24.145  701.059 1.00 119.36 ? 26   GLU B N     1 
ATOM   1947  C  CA    . GLU B 1  26   ? 465.906 23.645  700.124 1.00 115.28 ? 26   GLU B CA    1 
ATOM   1948  C  C     . GLU B 1  26   ? 467.080 24.606  700.046 1.00 109.69 ? 26   GLU B C     1 
ATOM   1949  O  O     . GLU B 1  26   ? 466.896 25.815  700.216 1.00 112.35 ? 26   GLU B O     1 
ATOM   1950  C  CB    . GLU B 1  26   ? 465.327 23.464  698.713 1.00 107.83 ? 26   GLU B CB    1 
ATOM   1951  C  CG    . GLU B 1  26   ? 464.929 24.768  698.054 1.00 107.39 ? 26   GLU B CG    1 
ATOM   1952  C  CD    . GLU B 1  26   ? 464.576 24.582  696.610 1.00 109.61 ? 26   GLU B CD    1 
ATOM   1953  O  OE1   . GLU B 1  26   ? 465.413 24.018  695.889 1.00 110.97 ? 26   GLU B OE1   1 
ATOM   1954  O  OE2   . GLU B 1  26   ? 463.486 25.024  696.185 1.00 110.10 ? 26   GLU B OE2   1 
ATOM   1955  N  N     . PRO B 1  27   ? 468.271 24.124  699.683 1.00 105.28 ? 27   PRO B N     1 
ATOM   1956  C  CA    . PRO B 1  27   ? 468.751 22.752  699.488 1.00 104.95 ? 27   PRO B CA    1 
ATOM   1957  C  C     . PRO B 1  27   ? 469.198 22.019  700.745 1.00 110.17 ? 27   PRO B C     1 
ATOM   1958  O  O     . PRO B 1  27   ? 469.649 22.666  701.693 1.00 110.85 ? 27   PRO B O     1 
ATOM   1959  C  CB    . PRO B 1  27   ? 469.973 22.955  698.618 1.00 110.38 ? 27   PRO B CB    1 
ATOM   1960  C  CG    . PRO B 1  27   ? 470.513 24.274  699.106 1.00 110.42 ? 27   PRO B CG    1 
ATOM   1961  C  CD    . PRO B 1  27   ? 469.319 25.115  699.400 1.00 106.51 ? 27   PRO B CD    1 
ATOM   1962  N  N     . LEU B 1  28   ? 469.069 20.687  700.736 1.00 108.65 ? 28   LEU B N     1 
ATOM   1963  C  CA    . LEU B 1  28   ? 469.562 19.805  701.787 1.00 106.02 ? 28   LEU B CA    1 
ATOM   1964  C  C     . LEU B 1  28   ? 470.463 18.755  701.166 1.00 96.40  ? 28   LEU B C     1 
ATOM   1965  O  O     . LEU B 1  28   ? 470.202 18.305  700.058 1.00 101.71 ? 28   LEU B O     1 
ATOM   1966  C  CB    . LEU B 1  28   ? 468.399 19.093  702.534 1.00 114.79 ? 28   LEU B CB    1 
ATOM   1967  C  CG    . LEU B 1  28   ? 467.256 19.776  703.311 1.00 106.57 ? 28   LEU B CG    1 
ATOM   1968  C  CD1   . LEU B 1  28   ? 466.269 18.706  703.716 1.00 100.09 ? 28   LEU B CD1   1 
ATOM   1969  C  CD2   . LEU B 1  28   ? 467.776 20.490  704.555 1.00 105.69 ? 28   LEU B CD2   1 
ATOM   1970  N  N     . GLU B 1  29   ? 471.398 18.234  701.950 1.00 96.23  ? 29   GLU B N     1 
ATOM   1971  C  CA    . GLU B 1  29   ? 472.282 17.172  701.480 1.00 106.84 ? 29   GLU B CA    1 
ATOM   1972  C  C     . GLU B 1  29   ? 471.497 15.901  701.145 1.00 107.14 ? 29   GLU B C     1 
ATOM   1973  O  O     . GLU B 1  29   ? 470.342 15.742  701.528 1.00 110.43 ? 29   GLU B O     1 
ATOM   1974  C  CB    . GLU B 1  29   ? 473.372 16.867  702.503 1.00 112.98 ? 29   GLU B CB    1 
ATOM   1975  C  CG    . GLU B 1  29   ? 474.536 16.085  701.885 1.00 123.48 ? 29   GLU B CG    1 
ATOM   1976  C  CD    . GLU B 1  29   ? 475.741 15.996  702.795 1.00 137.98 ? 29   GLU B CD    1 
ATOM   1977  O  OE1   . GLU B 1  29   ? 475.727 15.176  703.753 1.00 131.49 ? 29   GLU B OE1   1 
ATOM   1978  O  OE2   . GLU B 1  29   ? 476.700 16.766  702.549 1.00 146.79 ? 29   GLU B OE2   1 
ATOM   1979  N  N     . ARG B 1  30   ? 472.105 15.043  700.320 1.00 108.71 ? 30   ARG B N     1 
ATOM   1980  C  CA    . ARG B 1  30   ? 471.429 13.854  699.806 1.00 107.28 ? 30   ARG B CA    1 
ATOM   1981  C  C     . ARG B 1  30   ? 470.893 12.990  700.948 1.00 107.18 ? 30   ARG B C     1 
ATOM   1982  O  O     . ARG B 1  30   ? 471.641 12.575  701.839 1.00 103.66 ? 30   ARG B O     1 
ATOM   1983  C  CB    . ARG B 1  30   ? 472.372 13.027  698.940 1.00 103.62 ? 30   ARG B CB    1 
ATOM   1984  C  CG    . ARG B 1  30   ? 471.751 11.746  698.410 1.00 99.98  ? 30   ARG B CG    1 
ATOM   1985  C  CD    . ARG B 1  30   ? 472.795 10.899  697.713 1.00 102.10 ? 30   ARG B CD    1 
ATOM   1986  N  NE    . ARG B 1  30   ? 473.681 10.197  698.640 1.00 97.24  ? 30   ARG B NE    1 
ATOM   1987  C  CZ    . ARG B 1  30   ? 474.657 9.369   698.259 1.00 101.65 ? 30   ARG B CZ    1 
ATOM   1988  N  NH1   . ARG B 1  30   ? 474.887 9.136   696.973 1.00 96.64  ? 30   ARG B NH1   1 
ATOM   1989  N  NH2   . ARG B 1  30   ? 475.403 8.756   699.167 1.00 107.39 ? 30   ARG B NH2   1 
ATOM   1990  N  N     . GLY B 1  31   ? 469.589 12.694  700.881 1.00 106.04 ? 31   GLY B N     1 
ATOM   1991  C  CA    . GLY B 1  31   ? 468.881 11.832  701.805 1.00 107.50 ? 31   GLY B CA    1 
ATOM   1992  C  C     . GLY B 1  31   ? 468.093 12.579  702.867 1.00 104.67 ? 31   GLY B C     1 
ATOM   1993  O  O     . GLY B 1  31   ? 467.100 12.047  703.391 1.00 96.43  ? 31   GLY B O     1 
ATOM   1994  N  N     . PHE B 1  32   ? 468.467 13.826  703.134 1.00 104.81 ? 32   PHE B N     1 
ATOM   1995  C  CA    . PHE B 1  32   ? 467.904 14.573  704.244 1.00 100.96 ? 32   PHE B CA    1 
ATOM   1996  C  C     . PHE B 1  32   ? 466.469 15.020  704.021 1.00 98.46  ? 32   PHE B C     1 
ATOM   1997  O  O     . PHE B 1  32   ? 465.793 15.350  704.993 1.00 102.95 ? 32   PHE B O     1 
ATOM   1998  C  CB    . PHE B 1  32   ? 468.835 15.731  704.575 1.00 101.06 ? 32   PHE B CB    1 
ATOM   1999  C  CG    . PHE B 1  32   ? 469.868 15.357  705.585 1.00 101.13 ? 32   PHE B CG    1 
ATOM   2000  C  CD1   . PHE B 1  32   ? 471.070 14.802  705.198 1.00 100.85 ? 32   PHE B CD1   1 
ATOM   2001  C  CD2   . PHE B 1  32   ? 469.615 15.540  706.940 1.00 102.02 ? 32   PHE B CD2   1 
ATOM   2002  C  CE1   . PHE B 1  32   ? 472.014 14.432  706.137 1.00 99.52  ? 32   PHE B CE1   1 
ATOM   2003  C  CE2   . PHE B 1  32   ? 470.556 15.191  707.896 1.00 102.42 ? 32   PHE B CE2   1 
ATOM   2004  C  CZ    . PHE B 1  32   ? 471.758 14.631  707.493 1.00 106.12 ? 32   PHE B CZ    1 
ATOM   2005  N  N     . GLY B 1  33   ? 465.974 15.037  702.793 1.00 97.05  ? 33   GLY B N     1 
ATOM   2006  C  CA    . GLY B 1  33   ? 464.577 15.399  702.596 1.00 98.13  ? 33   GLY B CA    1 
ATOM   2007  C  C     . GLY B 1  33   ? 463.620 14.489  703.347 1.00 95.36  ? 33   GLY B C     1 
ATOM   2008  O  O     . GLY B 1  33   ? 462.649 14.949  703.948 1.00 90.86  ? 33   GLY B O     1 
ATOM   2009  N  N     . VAL B 1  34   ? 463.836 13.176  703.258 1.00 96.41  ? 34   VAL B N     1 
ATOM   2010  C  CA    . VAL B 1  34   ? 462.975 12.249  703.981 1.00 91.15  ? 34   VAL B CA    1 
ATOM   2011  C  C     . VAL B 1  34   ? 463.426 12.085  705.431 1.00 98.02  ? 34   VAL B C     1 
ATOM   2012  O  O     . VAL B 1  34   ? 462.631 11.636  706.273 1.00 103.13 ? 34   VAL B O     1 
ATOM   2013  C  CB    . VAL B 1  34   ? 462.891 10.905  703.233 1.00 96.08  ? 34   VAL B CB    1 
ATOM   2014  C  CG1   . VAL B 1  34   ? 463.186 11.112  701.754 1.00 101.61 ? 34   VAL B CG1   1 
ATOM   2015  C  CG2   . VAL B 1  34   ? 463.789 9.834   703.836 1.00 93.94  ? 34   VAL B CG2   1 
ATOM   2016  N  N     . THR B 1  35   ? 464.689 12.389  705.755 1.00 97.38  ? 35   THR B N     1 
ATOM   2017  C  CA    . THR B 1  35   ? 465.116 12.291  707.151 1.00 91.38  ? 35   THR B CA    1 
ATOM   2018  C  C     . THR B 1  35   ? 464.412 13.321  708.019 1.00 90.13  ? 35   THR B C     1 
ATOM   2019  O  O     . THR B 1  35   ? 463.995 12.996  709.126 1.00 97.14  ? 35   THR B O     1 
ATOM   2020  C  CB    . THR B 1  35   ? 466.633 12.401  707.312 1.00 94.66  ? 35   THR B CB    1 
ATOM   2021  O  OG1   . THR B 1  35   ? 467.255 11.180  706.886 1.00 95.05  ? 35   THR B OG1   1 
ATOM   2022  C  CG2   . THR B 1  35   ? 467.002 12.681  708.756 1.00 87.34  ? 35   THR B CG2   1 
ATOM   2023  N  N     . LEU B 1  36   ? 464.230 14.554  707.546 1.00 88.43  ? 36   LEU B N     1 
ATOM   2024  C  CA    . LEU B 1  36   ? 463.411 15.463  708.343 1.00 82.28  ? 36   LEU B CA    1 
ATOM   2025  C  C     . LEU B 1  36   ? 461.922 15.256  708.119 1.00 86.34  ? 36   LEU B C     1 
ATOM   2026  O  O     . LEU B 1  36   ? 461.152 15.137  709.071 1.00 98.62  ? 36   LEU B O     1 
ATOM   2027  C  CB    . LEU B 1  36   ? 463.726 16.903  707.992 1.00 79.11  ? 36   LEU B CB    1 
ATOM   2028  C  CG    . LEU B 1  36   ? 465.168 17.336  708.139 1.00 88.34  ? 36   LEU B CG    1 
ATOM   2029  C  CD1   . LEU B 1  36   ? 465.210 18.824  707.853 1.00 94.81  ? 36   LEU B CD1   1 
ATOM   2030  C  CD2   . LEU B 1  36   ? 465.757 16.985  709.485 1.00 90.23  ? 36   LEU B CD2   1 
ATOM   2031  N  N     . GLY B 1  37   ? 461.505 15.131  706.878 1.00 90.82  ? 37   GLY B N     1 
ATOM   2032  C  CA    . GLY B 1  37   ? 460.082 15.118  706.576 1.00 93.62  ? 37   GLY B CA    1 
ATOM   2033  C  C     . GLY B 1  37   ? 459.299 13.983  707.210 1.00 91.33  ? 37   GLY B C     1 
ATOM   2034  O  O     . GLY B 1  37   ? 458.187 14.187  707.691 1.00 93.90  ? 37   GLY B O     1 
ATOM   2035  N  N     . ASN B 1  38   ? 459.835 12.766  707.169 1.00 90.17  ? 38   ASN B N     1 
ATOM   2036  C  CA    . ASN B 1  38   ? 459.071 11.635  707.680 1.00 85.84  ? 38   ASN B CA    1 
ATOM   2037  C  C     . ASN B 1  38   ? 458.814 11.754  709.166 1.00 93.76  ? 38   ASN B C     1 
ATOM   2038  O  O     . ASN B 1  38   ? 457.645 11.622  709.578 1.00 94.72  ? 38   ASN B O     1 
ATOM   2039  C  CB    . ASN B 1  38   ? 459.760 10.331  707.300 1.00 90.01  ? 38   ASN B CB    1 
ATOM   2040  C  CG    . ASN B 1  38   ? 458.759 9.251   706.990 1.00 100.35 ? 38   ASN B CG    1 
ATOM   2041  O  OD1   . ASN B 1  38   ? 458.533 8.925   705.806 1.00 97.78  ? 38   ASN B OD1   1 
ATOM   2042  N  ND2   . ASN B 1  38   ? 458.105 8.713   708.040 1.00 90.43  ? 38   ASN B ND2   1 
ATOM   2043  N  N     . PRO B 1  39   ? 459.812 12.012  710.015 1.00 94.84  ? 39   PRO B N     1 
ATOM   2044  C  CA    . PRO B 1  39   ? 459.520 12.165  711.450 1.00 92.91  ? 39   PRO B CA    1 
ATOM   2045  C  C     . PRO B 1  39   ? 458.548 13.291  711.721 1.00 92.94  ? 39   PRO B C     1 
ATOM   2046  O  O     . PRO B 1  39   ? 457.615 13.102  712.514 1.00 91.64  ? 39   PRO B O     1 
ATOM   2047  C  CB    . PRO B 1  39   ? 460.893 12.424  712.058 1.00 89.52  ? 39   PRO B CB    1 
ATOM   2048  C  CG    . PRO B 1  39   ? 461.794 11.826  711.119 1.00 87.82  ? 39   PRO B CG    1 
ATOM   2049  C  CD    . PRO B 1  39   ? 461.252 11.983  709.767 1.00 93.29  ? 39   PRO B CD    1 
ATOM   2050  N  N     . LEU B 1  40   ? 458.729 14.459  711.096 1.00 89.75  ? 40   LEU B N     1 
ATOM   2051  C  CA    . LEU B 1  40   ? 457.766 15.530  711.334 1.00 92.50  ? 40   LEU B CA    1 
ATOM   2052  C  C     . LEU B 1  40   ? 456.353 15.062  711.013 1.00 92.45  ? 40   LEU B C     1 
ATOM   2053  O  O     . LEU B 1  40   ? 455.410 15.389  711.743 1.00 92.34  ? 40   LEU B O     1 
ATOM   2054  C  CB    . LEU B 1  40   ? 458.083 16.789  710.540 1.00 89.66  ? 40   LEU B CB    1 
ATOM   2055  C  CG    . LEU B 1  40   ? 459.370 17.465  710.995 1.00 94.72  ? 40   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B 1  40   ? 459.427 18.877  710.421 1.00 92.85  ? 40   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B 1  40   ? 459.651 17.403  712.503 1.00 99.25  ? 40   LEU B CD2   1 
ATOM   2058  N  N     . ARG B 1  41   ? 456.179 14.288  709.935 1.00 87.54  ? 41   ARG B N     1 
ATOM   2059  C  CA    . ARG B 1  41   ? 454.833 13.823  709.618 1.00 90.43  ? 41   ARG B CA    1 
ATOM   2060  C  C     . ARG B 1  41   ? 454.291 12.915  710.730 1.00 91.66  ? 41   ARG B C     1 
ATOM   2061  O  O     . ARG B 1  41   ? 453.124 13.047  711.135 1.00 85.48  ? 41   ARG B O     1 
ATOM   2062  C  CB    . ARG B 1  41   ? 454.812 13.111  708.260 1.00 82.93  ? 41   ARG B CB    1 
ATOM   2063  C  CG    . ARG B 1  41   ? 453.467 12.496  707.964 1.00 81.47  ? 41   ARG B CG    1 
ATOM   2064  C  CD    . ARG B 1  41   ? 453.388 11.755  706.689 1.00 70.02  ? 41   ARG B CD    1 
ATOM   2065  N  NE    . ARG B 1  41   ? 452.029 11.264  706.448 1.00 75.33  ? 41   ARG B NE    1 
ATOM   2066  C  CZ    . ARG B 1  41   ? 451.562 10.073  706.838 1.00 79.62  ? 41   ARG B CZ    1 
ATOM   2067  N  NH1   . ARG B 1  41   ? 452.374 9.215   707.470 1.00 79.21  ? 41   ARG B NH1   1 
ATOM   2068  N  NH2   . ARG B 1  41   ? 450.286 9.731   706.588 1.00 68.09  ? 41   ARG B NH2   1 
ATOM   2069  N  N     . ARG B 1  42   ? 455.116 11.983  711.237 1.00 90.91  ? 42   ARG B N     1 
ATOM   2070  C  CA    . ARG B 1  42   ? 454.640 11.110  712.308 1.00 86.01  ? 42   ARG B CA    1 
ATOM   2071  C  C     . ARG B 1  42   ? 454.225 11.934  713.510 1.00 82.25  ? 42   ARG B C     1 
ATOM   2072  O  O     . ARG B 1  42   ? 453.144 11.740  714.059 1.00 87.66  ? 42   ARG B O     1 
ATOM   2073  C  CB    . ARG B 1  42   ? 455.729 10.125  712.722 1.00 85.30  ? 42   ARG B CB    1 
ATOM   2074  C  CG    . ARG B 1  42   ? 456.042 9.097   711.688 1.00 79.87  ? 42   ARG B CG    1 
ATOM   2075  C  CD    . ARG B 1  42   ? 457.133 8.159   712.130 1.00 81.44  ? 42   ARG B CD    1 
ATOM   2076  N  NE    . ARG B 1  42   ? 456.709 7.208   713.138 1.00 80.80  ? 42   ARG B NE    1 
ATOM   2077  C  CZ    . ARG B 1  42   ? 456.108 6.050   712.855 1.00 87.63  ? 42   ARG B CZ    1 
ATOM   2078  N  NH1   . ARG B 1  42   ? 455.878 5.684   711.611 1.00 85.65  ? 42   ARG B NH1   1 
ATOM   2079  N  NH2   . ARG B 1  42   ? 455.756 5.220   713.819 1.00 100.54 ? 42   ARG B NH2   1 
ATOM   2080  N  N     . ILE B 1  43   ? 455.039 12.923  713.866 1.00 82.21  ? 43   ILE B N     1 
ATOM   2081  C  CA    . ILE B 1  43   ? 454.756 13.787  715.004 1.00 80.34  ? 43   ILE B CA    1 
ATOM   2082  C  C     . ILE B 1  43   ? 453.538 14.656  714.751 1.00 82.73  ? 43   ILE B C     1 
ATOM   2083  O  O     . ILE B 1  43   ? 452.626 14.715  715.573 1.00 86.60  ? 43   ILE B O     1 
ATOM   2084  C  CB    . ILE B 1  43   ? 455.981 14.653  715.330 1.00 82.85  ? 43   ILE B CB    1 
ATOM   2085  C  CG1   . ILE B 1  43   ? 457.130 13.792  715.893 1.00 83.09  ? 43   ILE B CG1   1 
ATOM   2086  C  CG2   . ILE B 1  43   ? 455.566 15.902  716.108 1.00 76.40  ? 43   ILE B CG2   1 
ATOM   2087  C  CD1   . ILE B 1  43   ? 458.458 14.552  716.035 1.00 79.14  ? 43   ILE B CD1   1 
ATOM   2088  N  N     . LEU B 1  44   ? 453.504 15.338  713.608 1.00 88.45  ? 44   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1  44   ? 452.403 16.240  713.265 1.00 90.80  ? 44   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1  44   ? 451.018 15.595  713.339 1.00 90.25  ? 44   LEU B C     1 
ATOM   2091  O  O     . LEU B 1  44   ? 450.016 16.301  713.513 1.00 91.57  ? 44   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1  44   ? 452.623 16.797  711.861 1.00 91.84  ? 44   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1  44   ? 453.658 17.910  711.729 1.00 93.22  ? 44   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1  44   ? 454.102 18.000  710.275 1.00 95.01  ? 44   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1  44   ? 453.162 19.242  712.249 1.00 95.62  ? 44   LEU B CD2   1 
ATOM   2096  N  N     . LEU B 1  45   ? 450.927 14.295  713.081 1.00 86.66  ? 45   LEU B N     1 
ATOM   2097  C  CA    . LEU B 1  45   ? 449.689 13.527  713.178 1.00 88.23  ? 45   LEU B CA    1 
ATOM   2098  C  C     . LEU B 1  45   ? 449.349 12.989  714.577 1.00 87.86  ? 45   LEU B C     1 
ATOM   2099  O  O     . LEU B 1  45   ? 448.169 12.920  714.939 1.00 80.75  ? 45   LEU B O     1 
ATOM   2100  C  CB    . LEU B 1  45   ? 449.735 12.369  712.188 1.00 85.66  ? 45   LEU B CB    1 
ATOM   2101  C  CG    . LEU B 1  45   ? 449.695 12.813  710.732 1.00 86.36  ? 45   LEU B CG    1 
ATOM   2102  C  CD1   . LEU B 1  45   ? 449.810 11.595  709.843 1.00 83.76  ? 45   LEU B CD1   1 
ATOM   2103  C  CD2   . LEU B 1  45   ? 448.445 13.622  710.423 1.00 91.60  ? 45   LEU B CD2   1 
ATOM   2104  N  N     . SER B 1  46   ? 450.340 12.476  715.310 1.00 85.28  ? 46   SER B N     1 
ATOM   2105  C  CA    . SER B 1  46   ? 450.151 11.812  716.602 1.00 90.03  ? 46   SER B CA    1 
ATOM   2106  C  C     . SER B 1  46   ? 450.127 12.740  717.833 1.00 90.31  ? 46   SER B C     1 
ATOM   2107  O  O     . SER B 1  46   ? 449.350 12.513  718.764 1.00 83.74  ? 46   SER B O     1 
ATOM   2108  C  CB    . SER B 1  46   ? 451.231 10.732  716.786 1.00 87.39  ? 46   SER B CB    1 
ATOM   2109  O  OG    . SER B 1  46   ? 452.525 11.269  716.987 1.00 81.65  ? 46   SER B OG    1 
ATOM   2110  N  N     . SER B 1  47   ? 451.038 13.698  717.915 1.00 85.19  ? 47   SER B N     1 
ATOM   2111  C  CA    . SER B 1  47   ? 451.310 14.450  719.126 1.00 79.04  ? 47   SER B CA    1 
ATOM   2112  C  C     . SER B 1  47   ? 450.765 15.866  719.192 1.00 85.78  ? 47   SER B C     1 
ATOM   2113  O  O     . SER B 1  47   ? 451.181 16.595  720.087 1.00 91.40  ? 47   SER B O     1 
ATOM   2114  C  CB    . SER B 1  47   ? 452.797 14.473  719.376 1.00 84.78  ? 47   SER B CB    1 
ATOM   2115  O  OG    . SER B 1  47   ? 453.191 13.144  719.628 1.00 91.52  ? 47   SER B OG    1 
ATOM   2116  N  N     . ILE B 1  48   ? 450.051 16.375  718.200 1.00 92.51  ? 48   ILE B N     1 
ATOM   2117  C  CA    . ILE B 1  48   ? 449.656 17.776  718.387 1.00 97.21  ? 48   ILE B CA    1 
ATOM   2118  C  C     . ILE B 1  48   ? 448.426 17.918  719.281 1.00 101.76 ? 48   ILE B C     1 
ATOM   2119  O  O     . ILE B 1  48   ? 447.360 17.384  718.932 1.00 103.75 ? 48   ILE B O     1 
ATOM   2120  C  CB    . ILE B 1  48   ? 449.408 18.473  717.046 1.00 99.94  ? 48   ILE B CB    1 
ATOM   2121  C  CG1   . ILE B 1  48   ? 450.693 18.376  716.214 1.00 101.10 ? 48   ILE B CG1   1 
ATOM   2122  C  CG2   . ILE B 1  48   ? 448.916 19.908  717.268 1.00 92.20  ? 48   ILE B CG2   1 
ATOM   2123  C  CD1   . ILE B 1  48   ? 451.875 19.158  716.776 1.00 95.33  ? 48   ILE B CD1   1 
ATOM   2124  N  N     . PRO B 1  49   ? 448.540 18.622  720.426 1.00 103.31 ? 49   PRO B N     1 
ATOM   2125  C  CA    . PRO B 1  49   ? 447.422 18.762  721.376 1.00 86.76  ? 49   PRO B CA    1 
ATOM   2126  C  C     . PRO B 1  49   ? 446.243 19.512  720.777 1.00 92.55  ? 49   PRO B C     1 
ATOM   2127  O  O     . PRO B 1  49   ? 446.385 20.639  720.295 1.00 90.88  ? 49   PRO B O     1 
ATOM   2128  C  CB    . PRO B 1  49   ? 448.049 19.543  722.529 1.00 85.59  ? 49   PRO B CB    1 
ATOM   2129  C  CG    . PRO B 1  49   ? 449.081 20.360  721.899 1.00 92.63  ? 49   PRO B CG    1 
ATOM   2130  C  CD    . PRO B 1  49   ? 449.686 19.453  720.842 1.00 104.06 ? 49   PRO B CD    1 
ATOM   2131  N  N     . GLY B 1  50   ? 445.058 18.939  720.933 1.00 94.65  ? 50   GLY B N     1 
ATOM   2132  C  CA    . GLY B 1  50   ? 443.841 19.496  720.371 1.00 95.68  ? 50   GLY B CA    1 
ATOM   2133  C  C     . GLY B 1  50   ? 442.660 19.062  721.212 1.00 101.15 ? 50   GLY B C     1 
ATOM   2134  O  O     . GLY B 1  50   ? 442.858 18.532  722.309 1.00 103.20 ? 50   GLY B O     1 
ATOM   2135  N  N     . THR B 1  51   ? 441.436 19.345  720.777 1.00 100.97 ? 51   THR B N     1 
ATOM   2136  C  CA    . THR B 1  51   ? 440.258 19.021  721.562 1.00 93.70  ? 51   THR B CA    1 
ATOM   2137  C  C     . THR B 1  51   ? 439.301 18.155  720.757 1.00 90.40  ? 51   THR B C     1 
ATOM   2138  O  O     . THR B 1  51   ? 439.195 18.300  719.538 1.00 103.96 ? 51   THR B O     1 
ATOM   2139  C  CB    . THR B 1  51   ? 439.548 20.306  721.938 1.00 100.40 ? 51   THR B CB    1 
ATOM   2140  O  OG1   . THR B 1  51   ? 438.652 20.650  720.875 1.00 103.77 ? 51   THR B OG1   1 
ATOM   2141  C  CG2   . THR B 1  51   ? 440.562 21.448  722.089 1.00 102.56 ? 51   THR B CG2   1 
ATOM   2142  N  N     . ALA B 1  52   ? 438.517 17.335  721.449 1.00 90.73  ? 52   ALA B N     1 
ATOM   2143  C  CA    . ALA B 1  52   ? 437.595 16.433  720.767 1.00 93.02  ? 52   ALA B CA    1 
ATOM   2144  C  C     . ALA B 1  52   ? 436.368 16.116  721.627 1.00 98.03  ? 52   ALA B C     1 
ATOM   2145  O  O     . ALA B 1  52   ? 436.433 16.119  722.862 1.00 98.07  ? 52   ALA B O     1 
ATOM   2146  C  CB    . ALA B 1  52   ? 438.298 15.130  720.383 1.00 88.67  ? 52   ALA B CB    1 
ATOM   2147  N  N     . VAL B 1  53   ? 435.265 15.784  720.956 1.00 95.41  ? 53   VAL B N     1 
ATOM   2148  C  CA    . VAL B 1  53   ? 434.049 15.305  721.610 1.00 90.64  ? 53   VAL B CA    1 
ATOM   2149  C  C     . VAL B 1  53   ? 434.247 13.835  721.963 1.00 96.12  ? 53   VAL B C     1 
ATOM   2150  O  O     . VAL B 1  53   ? 434.241 12.975  721.078 1.00 98.91  ? 53   VAL B O     1 
ATOM   2151  C  CB    . VAL B 1  53   ? 432.845 15.485  720.680 1.00 87.58  ? 53   VAL B CB    1 
ATOM   2152  C  CG1   . VAL B 1  53   ? 431.653 14.673  721.146 1.00 93.57  ? 53   VAL B CG1   1 
ATOM   2153  C  CG2   . VAL B 1  53   ? 432.490 16.951  720.559 1.00 89.37  ? 53   VAL B CG2   1 
ATOM   2154  N  N     . THR B 1  54   ? 434.319 13.526  723.264 1.00 97.63  ? 54   THR B N     1 
ATOM   2155  C  CA    . THR B 1  54   ? 434.515 12.140  723.693 1.00 99.90  ? 54   THR B CA    1 
ATOM   2156  C  C     . THR B 1  54   ? 433.262 11.404  724.148 1.00 99.12  ? 54   THR B C     1 
ATOM   2157  O  O     . THR B 1  54   ? 433.287 10.165  724.179 1.00 94.56  ? 54   THR B O     1 
ATOM   2158  C  CB    . THR B 1  54   ? 435.559 12.069  724.809 1.00 96.39  ? 54   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  54   ? 435.204 12.976  725.843 1.00 95.25  ? 54   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  54   ? 436.900 12.485  724.269 1.00 103.55 ? 54   THR B CG2   1 
ATOM   2161  N  N     . SER B 1  55   ? 432.183 12.114  724.500 1.00 102.24 ? 55   SER B N     1 
ATOM   2162  C  CA    . SER B 1  55   ? 430.990 11.451  725.018 1.00 98.58  ? 55   SER B CA    1 
ATOM   2163  C  C     . SER B 1  55   ? 429.788 12.368  724.822 1.00 93.61  ? 55   SER B C     1 
ATOM   2164  O  O     . SER B 1  55   ? 429.901 13.594  724.940 1.00 91.44  ? 55   SER B O     1 
ATOM   2165  C  CB    . SER B 1  55   ? 431.177 11.082  726.492 1.00 98.36  ? 55   SER B CB    1 
ATOM   2166  O  OG    . SER B 1  55   ? 430.423 9.934   726.815 1.00 102.83 ? 55   SER B OG    1 
ATOM   2167  N  N     . VAL B 1  56   ? 428.624 11.759  724.594 1.00 94.37  ? 56   VAL B N     1 
ATOM   2168  C  CA    . VAL B 1  56   ? 427.388 12.506  724.356 1.00 102.93 ? 56   VAL B CA    1 
ATOM   2169  C  C     . VAL B 1  56   ? 426.194 11.801  725.009 1.00 110.33 ? 56   VAL B C     1 
ATOM   2170  O  O     . VAL B 1  56   ? 426.086 10.569  724.931 1.00 108.53 ? 56   VAL B O     1 
ATOM   2171  C  CB    . VAL B 1  56   ? 427.138 12.682  722.845 1.00 103.21 ? 56   VAL B CB    1 
ATOM   2172  C  CG1   . VAL B 1  56   ? 426.947 11.319  722.169 1.00 101.55 ? 56   VAL B CG1   1 
ATOM   2173  C  CG2   . VAL B 1  56   ? 425.960 13.611  722.588 1.00 103.17 ? 56   VAL B CG2   1 
ATOM   2174  N  N     . TYR B 1  57   ? 425.345 12.573  725.724 1.00 109.10 ? 57   TYR B N     1 
ATOM   2175  C  CA    . TYR B 1  57   ? 424.053 12.124  726.264 1.00 107.96 ? 57   TYR B CA    1 
ATOM   2176  C  C     . TYR B 1  57   ? 422.898 12.905  725.634 1.00 103.45 ? 57   TYR B C     1 
ATOM   2177  O  O     . TYR B 1  57   ? 422.915 14.141  725.637 1.00 100.88 ? 57   TYR B O     1 
ATOM   2178  C  CB    . TYR B 1  57   ? 424.026 12.260  727.793 1.00 115.01 ? 57   TYR B CB    1 
ATOM   2179  C  CG    . TYR B 1  57   ? 422.663 12.018  728.417 1.00 114.01 ? 57   TYR B CG    1 
ATOM   2180  C  CD1   . TYR B 1  57   ? 422.159 10.725  728.590 1.00 117.73 ? 57   TYR B CD1   1 
ATOM   2181  C  CD2   . TYR B 1  57   ? 421.877 13.094  728.836 1.00 112.35 ? 57   TYR B CD2   1 
ATOM   2182  C  CE1   . TYR B 1  57   ? 420.890 10.516  729.158 1.00 120.22 ? 57   TYR B CE1   1 
ATOM   2183  C  CE2   . TYR B 1  57   ? 420.623 12.900  729.395 1.00 117.99 ? 57   TYR B CE2   1 
ATOM   2184  C  CZ    . TYR B 1  57   ? 420.130 11.616  729.556 1.00 121.73 ? 57   TYR B CZ    1 
ATOM   2185  O  OH    . TYR B 1  57   ? 418.880 11.457  730.118 1.00 125.54 ? 57   TYR B OH    1 
ATOM   2186  N  N     . ILE B 1  58   ? 421.937 12.183  725.042 1.00 100.94 ? 58   ILE B N     1 
ATOM   2187  C  CA    . ILE B 1  58   ? 420.709 12.738  724.453 1.00 112.75 ? 58   ILE B CA    1 
ATOM   2188  C  C     . ILE B 1  58   ? 419.477 12.178  725.157 1.00 121.42 ? 58   ILE B C     1 
ATOM   2189  O  O     . ILE B 1  58   ? 419.336 10.951  725.264 1.00 119.77 ? 58   ILE B O     1 
ATOM   2190  C  CB    . ILE B 1  58   ? 420.613 12.507  722.934 1.00 118.33 ? 58   ILE B CB    1 
ATOM   2191  C  CG1   . ILE B 1  58   ? 421.886 13.001  722.230 1.00 119.79 ? 58   ILE B CG1   1 
ATOM   2192  C  CG2   . ILE B 1  58   ? 419.378 13.183  722.381 1.00 122.48 ? 58   ILE B CG2   1 
ATOM   2193  C  CD1   . ILE B 1  58   ? 421.961 12.668  720.758 1.00 114.09 ? 58   ILE B CD1   1 
ATOM   2194  N  N     . GLU B 1  59   ? 418.533 13.068  725.525 1.00 119.99 ? 59   GLU B N     1 
ATOM   2195  C  CA    . GLU B 1  59   ? 417.536 12.776  726.555 1.00 129.27 ? 59   GLU B CA    1 
ATOM   2196  C  C     . GLU B 1  59   ? 416.865 11.413  726.437 1.00 132.01 ? 59   GLU B C     1 
ATOM   2197  O  O     . GLU B 1  59   ? 417.103 10.541  727.278 1.00 138.54 ? 59   GLU B O     1 
ATOM   2198  C  CB    . GLU B 1  59   ? 416.425 13.848  726.521 1.00 136.79 ? 59   GLU B CB    1 
ATOM   2199  C  CG    . GLU B 1  59   ? 415.314 13.736  727.636 1.00 141.16 ? 59   GLU B CG    1 
ATOM   2200  C  CD    . GLU B 1  59   ? 415.329 14.786  728.764 1.00 138.71 ? 59   GLU B CD    1 
ATOM   2201  O  OE1   . GLU B 1  59   ? 416.260 15.618  728.851 1.00 138.83 ? 59   GLU B OE1   1 
ATOM   2202  O  OE2   . GLU B 1  59   ? 414.359 14.778  729.561 1.00 133.12 ? 59   GLU B OE2   1 
ATOM   2203  N  N     . ASP B 1  60   ? 416.007 11.215  725.446 1.00 125.67 ? 60   ASP B N     1 
ATOM   2204  C  CA    . ASP B 1  60   ? 415.239 9.976   725.316 1.00 130.90 ? 60   ASP B CA    1 
ATOM   2205  C  C     . ASP B 1  60   ? 415.900 8.964   724.383 1.00 132.43 ? 60   ASP B C     1 
ATOM   2206  O  O     . ASP B 1  60   ? 415.199 8.305   723.605 1.00 136.37 ? 60   ASP B O     1 
ATOM   2207  C  CB    . ASP B 1  60   ? 413.791 10.267  724.915 1.00 141.07 ? 60   ASP B CB    1 
ATOM   2208  C  CG    . ASP B 1  60   ? 412.999 10.990  726.025 1.00 138.82 ? 60   ASP B CG    1 
ATOM   2209  O  OD1   . ASP B 1  60   ? 413.155 10.599  727.203 1.00 136.84 ? 60   ASP B OD1   1 
ATOM   2210  O  OD2   . ASP B 1  60   ? 412.219 11.927  725.729 1.00 139.53 ? 60   ASP B OD2   1 
ATOM   2211  N  N     . VAL B 1  61   ? 417.219 8.768   724.446 1.00 130.09 ? 61   VAL B N     1 
ATOM   2212  C  CA    . VAL B 1  61   ? 417.905 7.890   723.499 1.00 126.50 ? 61   VAL B CA    1 
ATOM   2213  C  C     . VAL B 1  61   ? 418.686 6.832   724.256 1.00 123.56 ? 61   VAL B C     1 
ATOM   2214  O  O     . VAL B 1  61   ? 419.650 7.151   724.966 1.00 120.13 ? 61   VAL B O     1 
ATOM   2215  C  CB    . VAL B 1  61   ? 418.868 8.696   722.622 1.00 120.83 ? 61   VAL B CB    1 
ATOM   2216  C  CG1   . VAL B 1  61   ? 419.689 7.759   721.807 1.00 130.12 ? 61   VAL B CG1   1 
ATOM   2217  C  CG2   . VAL B 1  61   ? 418.127 9.702   721.760 1.00 117.11 ? 61   VAL B CG2   1 
ATOM   2218  N  N     . LEU B 1  62   ? 418.351 5.561   723.990 1.00 122.82 ? 62   LEU B N     1 
ATOM   2219  C  CA    . LEU B 1  62   ? 418.977 4.449   724.701 1.00 127.13 ? 62   LEU B CA    1 
ATOM   2220  C  C     . LEU B 1  62   ? 420.362 4.098   724.167 1.00 131.19 ? 62   LEU B C     1 
ATOM   2221  O  O     . LEU B 1  62   ? 421.318 4.014   724.949 1.00 125.87 ? 62   LEU B O     1 
ATOM   2222  C  CB    . LEU B 1  62   ? 418.054 3.224   724.674 1.00 129.33 ? 62   LEU B CB    1 
ATOM   2223  C  CG    . LEU B 1  62   ? 416.603 3.444   725.153 1.00 132.25 ? 62   LEU B CG    1 
ATOM   2224  C  CD1   . LEU B 1  62   ? 415.806 2.134   725.231 1.00 126.97 ? 62   LEU B CD1   1 
ATOM   2225  C  CD2   . LEU B 1  62   ? 416.547 4.182   726.499 1.00 123.03 ? 62   LEU B CD2   1 
ATOM   2226  N  N     . HIS B 1  63   ? 420.514 3.941   722.841 1.00 139.42 ? 63   HIS B N     1 
ATOM   2227  C  CA    . HIS B 1  63   ? 421.810 3.560   722.272 1.00 127.01 ? 63   HIS B CA    1 
ATOM   2228  C  C     . HIS B 1  63   ? 422.084 4.308   720.969 1.00 121.61 ? 63   HIS B C     1 
ATOM   2229  O  O     . HIS B 1  63   ? 421.275 5.116   720.509 1.00 119.69 ? 63   HIS B O     1 
ATOM   2230  C  CB    . HIS B 1  63   ? 421.829 2.031   722.087 1.00 128.26 ? 63   HIS B CB    1 
ATOM   2231  C  CG    . HIS B 1  63   ? 420.640 1.498   721.332 1.00 135.59 ? 63   HIS B CG    1 
ATOM   2232  N  ND1   . HIS B 1  63   ? 420.503 1.589   719.961 1.00 133.18 ? 63   HIS B ND1   1 
ATOM   2233  C  CD2   . HIS B 1  63   ? 419.508 0.895   721.780 1.00 136.56 ? 63   HIS B CD2   1 
ATOM   2234  C  CE1   . HIS B 1  63   ? 419.353 1.045   719.598 1.00 136.33 ? 63   HIS B CE1   1 
ATOM   2235  N  NE2   . HIS B 1  63   ? 418.727 0.622   720.684 1.00 137.51 ? 63   HIS B NE2   1 
ATOM   2236  N  N     . GLU B 1  64   ? 423.239 4.005   720.358 1.00 128.21 ? 64   GLU B N     1 
ATOM   2237  C  CA    . GLU B 1  64   ? 423.723 4.812   719.229 1.00 125.81 ? 64   GLU B CA    1 
ATOM   2238  C  C     . GLU B 1  64   ? 422.884 4.615   717.969 1.00 120.45 ? 64   GLU B C     1 
ATOM   2239  O  O     . GLU B 1  64   ? 422.692 5.549   717.181 1.00 112.97 ? 64   GLU B O     1 
ATOM   2240  C  CB    . GLU B 1  64   ? 425.198 4.473   718.963 1.00 124.04 ? 64   GLU B CB    1 
ATOM   2241  C  CG    . GLU B 1  64   ? 425.926 5.306   717.896 1.00 123.98 ? 64   GLU B CG    1 
ATOM   2242  C  CD    . GLU B 1  64   ? 427.435 4.995   717.813 1.00 122.37 ? 64   GLU B CD    1 
ATOM   2243  O  OE1   . GLU B 1  64   ? 427.974 4.269   718.685 1.00 117.60 ? 64   GLU B OE1   1 
ATOM   2244  O  OE2   . GLU B 1  64   ? 428.099 5.543   716.908 1.00 121.03 ? 64   GLU B OE2   1 
ATOM   2245  N  N     . PHE B 1  65   ? 422.372 3.408   717.781 1.00 121.83 ? 65   PHE B N     1 
ATOM   2246  C  CA    . PHE B 1  65   ? 421.609 3.008   716.606 1.00 122.71 ? 65   PHE B CA    1 
ATOM   2247  C  C     . PHE B 1  65   ? 420.114 3.159   716.813 1.00 125.88 ? 65   PHE B C     1 
ATOM   2248  O  O     . PHE B 1  65   ? 419.321 2.248   716.576 1.00 125.89 ? 65   PHE B O     1 
ATOM   2249  C  CB    . PHE B 1  65   ? 422.017 1.595   716.244 1.00 127.94 ? 65   PHE B CB    1 
ATOM   2250  C  CG    . PHE B 1  65   ? 423.485 1.481   716.031 1.00 129.11 ? 65   PHE B CG    1 
ATOM   2251  C  CD1   . PHE B 1  65   ? 424.201 2.573   715.542 1.00 127.93 ? 65   PHE B CD1   1 
ATOM   2252  C  CD2   . PHE B 1  65   ? 424.173 0.349   716.395 1.00 134.08 ? 65   PHE B CD2   1 
ATOM   2253  C  CE1   . PHE B 1  65   ? 425.563 2.517   715.364 1.00 120.19 ? 65   PHE B CE1   1 
ATOM   2254  C  CE2   . PHE B 1  65   ? 425.549 0.283   716.218 1.00 135.09 ? 65   PHE B CE2   1 
ATOM   2255  C  CZ    . PHE B 1  65   ? 426.242 1.371   715.702 1.00 121.41 ? 65   PHE B CZ    1 
ATOM   2256  N  N     . SER B 1  66   ? 419.736 4.330   717.290 1.00 128.75 ? 66   SER B N     1 
ATOM   2257  C  CA    . SER B 1  66   ? 418.347 4.697   717.464 1.00 132.70 ? 66   SER B CA    1 
ATOM   2258  C  C     . SER B 1  66   ? 418.016 5.876   716.574 1.00 134.81 ? 66   SER B C     1 
ATOM   2259  O  O     . SER B 1  66   ? 418.898 6.534   716.012 1.00 127.47 ? 66   SER B O     1 
ATOM   2260  C  CB    . SER B 1  66   ? 418.014 5.051   718.920 1.00 134.34 ? 66   SER B CB    1 
ATOM   2261  O  OG    . SER B 1  66   ? 418.316 3.983   719.801 1.00 139.95 ? 66   SER B OG    1 
ATOM   2262  N  N     . THR B 1  67   ? 416.719 6.052   716.375 1.00 139.94 ? 67   THR B N     1 
ATOM   2263  C  CA    . THR B 1  67   ? 416.167 7.196   715.677 1.00 139.21 ? 67   THR B CA    1 
ATOM   2264  C  C     . THR B 1  67   ? 415.414 8.045   716.701 1.00 135.33 ? 67   THR B C     1 
ATOM   2265  O  O     . THR B 1  67   ? 414.820 7.516   717.646 1.00 136.75 ? 67   THR B O     1 
ATOM   2266  C  CB    . THR B 1  67   ? 415.264 6.744   714.513 1.00 133.61 ? 67   THR B CB    1 
ATOM   2267  O  OG1   . THR B 1  67   ? 414.618 7.880   713.920 1.00 136.09 ? 67   THR B OG1   1 
ATOM   2268  C  CG2   . THR B 1  67   ? 414.233 5.720   714.973 1.00 134.31 ? 67   THR B CG2   1 
ATOM   2269  N  N     . ILE B 1  68   ? 415.467 9.358   716.524 1.00 128.72 ? 68   ILE B N     1 
ATOM   2270  C  CA    . ILE B 1  68   ? 414.803 10.315  717.404 1.00 124.79 ? 68   ILE B CA    1 
ATOM   2271  C  C     . ILE B 1  68   ? 413.488 10.709  716.743 1.00 132.82 ? 68   ILE B C     1 
ATOM   2272  O  O     . ILE B 1  68   ? 413.504 11.172  715.590 1.00 133.73 ? 68   ILE B O     1 
ATOM   2273  C  CB    . ILE B 1  68   ? 415.665 11.552  717.683 1.00 119.16 ? 68   ILE B CB    1 
ATOM   2274  C  CG1   . ILE B 1  68   ? 417.003 11.167  718.300 1.00 109.75 ? 68   ILE B CG1   1 
ATOM   2275  C  CG2   . ILE B 1  68   ? 414.897 12.553  718.505 1.00 118.41 ? 68   ILE B CG2   1 
ATOM   2276  C  CD1   . ILE B 1  68   ? 417.844 12.377  718.641 1.00 102.10 ? 68   ILE B CD1   1 
ATOM   2277  N  N     . PRO B 1  69   ? 412.345 10.531  717.405 1.00 136.00 ? 69   PRO B N     1 
ATOM   2278  C  CA    . PRO B 1  69   ? 411.093 11.001  716.812 1.00 136.54 ? 69   PRO B CA    1 
ATOM   2279  C  C     . PRO B 1  69   ? 411.065 12.517  716.802 1.00 136.91 ? 69   PRO B C     1 
ATOM   2280  O  O     . PRO B 1  69   ? 411.419 13.172  717.793 1.00 133.63 ? 69   PRO B O     1 
ATOM   2281  C  CB    . PRO B 1  69   ? 410.021 10.433  717.753 1.00 135.08 ? 69   PRO B CB    1 
ATOM   2282  C  CG    . PRO B 1  69   ? 410.712 9.366   718.555 1.00 128.50 ? 69   PRO B CG    1 
ATOM   2283  C  CD    . PRO B 1  69   ? 412.117 9.850   718.692 1.00 130.03 ? 69   PRO B CD    1 
ATOM   2284  N  N     . GLY B 1  70   ? 410.630 13.070  715.662 1.00 129.14 ? 70   GLY B N     1 
ATOM   2285  C  CA    . GLY B 1  70   ? 410.550 14.499  715.511 1.00 130.20 ? 70   GLY B CA    1 
ATOM   2286  C  C     . GLY B 1  70   ? 411.822 15.141  715.024 1.00 132.70 ? 70   GLY B C     1 
ATOM   2287  O  O     . GLY B 1  70   ? 411.828 16.356  714.780 1.00 132.79 ? 70   GLY B O     1 
ATOM   2288  N  N     . VAL B 1  71   ? 412.918 14.382  714.972 1.00 135.21 ? 71   VAL B N     1 
ATOM   2289  C  CA    . VAL B 1  71   ? 414.202 14.830  714.437 1.00 132.83 ? 71   VAL B CA    1 
ATOM   2290  C  C     . VAL B 1  71   ? 414.593 13.998  713.218 1.00 127.49 ? 71   VAL B C     1 
ATOM   2291  O  O     . VAL B 1  71   ? 414.558 12.761  713.266 1.00 126.47 ? 71   VAL B O     1 
ATOM   2292  C  CB    . VAL B 1  71   ? 415.307 14.785  715.503 1.00 131.76 ? 71   VAL B CB    1 
ATOM   2293  C  CG1   . VAL B 1  71   ? 416.630 15.192  714.886 1.00 124.62 ? 71   VAL B CG1   1 
ATOM   2294  C  CG2   . VAL B 1  71   ? 414.941 15.716  716.668 1.00 132.17 ? 71   VAL B CG2   1 
ATOM   2295  N  N     . LYS B 1  72   ? 414.964 14.703  712.134 1.00 132.32 ? 72   LYS B N     1 
ATOM   2296  C  CA    . LYS B 1  72   ? 415.337 14.130  710.829 1.00 127.41 ? 72   LYS B CA    1 
ATOM   2297  C  C     . LYS B 1  72   ? 416.597 13.255  710.873 1.00 117.61 ? 72   LYS B C     1 
ATOM   2298  O  O     . LYS B 1  72   ? 416.564 12.084  710.478 1.00 107.99 ? 72   LYS B O     1 
ATOM   2299  C  CB    . LYS B 1  72   ? 415.518 15.292  709.849 1.00 126.26 ? 72   LYS B CB    1 
ATOM   2300  C  CG    . LYS B 1  72   ? 415.990 14.963  708.444 1.00 135.62 ? 72   LYS B CG    1 
ATOM   2301  C  CD    . LYS B 1  72   ? 417.328 15.695  708.255 1.00 131.39 ? 72   LYS B CD    1 
ATOM   2302  C  CE    . LYS B 1  72   ? 417.978 15.514  706.912 1.00 126.19 ? 72   LYS B CE    1 
ATOM   2303  N  NZ    . LYS B 1  72   ? 419.219 16.358  706.898 1.00 131.19 ? 72   LYS B NZ    1 
ATOM   2304  N  N     . GLU B 1  73   ? 417.726 13.816  711.305 1.00 111.58 ? 73   GLU B N     1 
ATOM   2305  C  CA    . GLU B 1  73   ? 418.974 13.066  711.424 1.00 110.31 ? 73   GLU B CA    1 
ATOM   2306  C  C     . GLU B 1  73   ? 418.833 11.863  712.355 1.00 118.66 ? 73   GLU B C     1 
ATOM   2307  O  O     . GLU B 1  73   ? 418.082 11.895  713.334 1.00 125.81 ? 73   GLU B O     1 
ATOM   2308  C  CB    . GLU B 1  73   ? 420.072 13.979  711.950 1.00 112.41 ? 73   GLU B CB    1 
ATOM   2309  C  CG    . GLU B 1  73   ? 420.476 15.077  710.984 1.00 126.68 ? 73   GLU B CG    1 
ATOM   2310  C  CD    . GLU B 1  73   ? 419.544 16.270  711.016 1.00 127.47 ? 73   GLU B CD    1 
ATOM   2311  O  OE1   . GLU B 1  73   ? 418.450 16.138  711.609 1.00 123.05 ? 73   GLU B OE1   1 
ATOM   2312  O  OE2   . GLU B 1  73   ? 419.910 17.329  710.444 1.00 127.92 ? 73   GLU B OE2   1 
ATOM   2313  N  N     . ASP B 1  74   ? 419.562 10.783  712.054 1.00 118.67 ? 74   ASP B N     1 
ATOM   2314  C  CA    . ASP B 1  74   ? 419.634 9.706   713.036 1.00 112.78 ? 74   ASP B CA    1 
ATOM   2315  C  C     . ASP B 1  74   ? 420.690 10.036  714.091 1.00 108.64 ? 74   ASP B C     1 
ATOM   2316  O  O     . ASP B 1  74   ? 421.394 11.049  714.011 1.00 108.66 ? 74   ASP B O     1 
ATOM   2317  C  CB    . ASP B 1  74   ? 419.926 8.354   712.364 1.00 119.25 ? 74   ASP B CB    1 
ATOM   2318  C  CG    . ASP B 1  74   ? 421.076 8.406   711.327 1.00 116.54 ? 74   ASP B CG    1 
ATOM   2319  O  OD1   . ASP B 1  74   ? 422.266 8.291   711.722 1.00 112.53 ? 74   ASP B OD1   1 
ATOM   2320  O  OD2   . ASP B 1  74   ? 420.780 8.530   710.111 1.00 113.11 ? 74   ASP B OD2   1 
ATOM   2321  N  N     . VAL B 1  75   ? 420.805 9.164   715.098 1.00 108.56 ? 75   VAL B N     1 
ATOM   2322  C  CA    . VAL B 1  75   ? 421.729 9.438   716.197 1.00 112.15 ? 75   VAL B CA    1 
ATOM   2323  C  C     . VAL B 1  75   ? 423.156 9.461   715.692 1.00 107.65 ? 75   VAL B C     1 
ATOM   2324  O  O     . VAL B 1  75   ? 423.951 10.345  716.047 1.00 99.24  ? 75   VAL B O     1 
ATOM   2325  C  CB    . VAL B 1  75   ? 421.545 8.414   717.332 1.00 120.92 ? 75   VAL B CB    1 
ATOM   2326  C  CG1   . VAL B 1  75   ? 422.598 8.639   718.412 1.00 115.49 ? 75   VAL B CG1   1 
ATOM   2327  C  CG2   . VAL B 1  75   ? 420.133 8.532   717.941 1.00 121.29 ? 75   VAL B CG2   1 
ATOM   2328  N  N     . VAL B 1  76   ? 423.483 8.502   714.821 1.00 114.90 ? 76   VAL B N     1 
ATOM   2329  C  CA    . VAL B 1  76   ? 424.821 8.414   714.252 1.00 108.01 ? 76   VAL B CA    1 
ATOM   2330  C  C     . VAL B 1  76   ? 425.164 9.718   713.569 1.00 103.62 ? 76   VAL B C     1 
ATOM   2331  O  O     . VAL B 1  76   ? 426.271 10.250  713.720 1.00 98.51  ? 76   VAL B O     1 
ATOM   2332  C  CB    . VAL B 1  76   ? 424.936 7.234   713.275 1.00 99.79  ? 76   VAL B CB    1 
ATOM   2333  C  CG1   . VAL B 1  76   ? 426.346 7.170   712.823 1.00 107.28 ? 76   VAL B CG1   1 
ATOM   2334  C  CG2   . VAL B 1  76   ? 424.560 5.919   713.940 1.00 98.64  ? 76   VAL B CG2   1 
ATOM   2335  N  N     . GLU B 1  77   ? 424.226 10.213  712.754 1.00 105.01 ? 77   GLU B N     1 
ATOM   2336  C  CA    . GLU B 1  77   ? 424.455 11.440  712.008 1.00 107.86 ? 77   GLU B CA    1 
ATOM   2337  C  C     . GLU B 1  77   ? 424.734 12.621  712.924 1.00 105.76 ? 77   GLU B C     1 
ATOM   2338  O  O     . GLU B 1  77   ? 425.627 13.432  712.637 1.00 104.44 ? 77   GLU B O     1 
ATOM   2339  C  CB    . GLU B 1  77   ? 423.249 11.727  711.106 1.00 114.71 ? 77   GLU B CB    1 
ATOM   2340  C  CG    . GLU B 1  77   ? 423.450 11.258  709.642 1.00 115.79 ? 77   GLU B CG    1 
ATOM   2341  C  CD    . GLU B 1  77   ? 424.275 12.260  708.841 1.00 109.89 ? 77   GLU B CD    1 
ATOM   2342  O  OE1   . GLU B 1  77   ? 424.001 13.480  708.974 1.00 110.08 ? 77   GLU B OE1   1 
ATOM   2343  O  OE2   . GLU B 1  77   ? 425.222 11.834  708.133 1.00 109.55 ? 77   GLU B OE2   1 
ATOM   2344  N  N     . ILE B 1  78   ? 423.989 12.737  714.032 1.00 106.68 ? 78   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1  78   ? 424.242 13.824  714.980 1.00 105.60 ? 78   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1  78   ? 425.624 13.678  715.605 1.00 104.39 ? 78   ILE B C     1 
ATOM   2347  O  O     . ILE B 1  78   ? 426.373 14.654  715.733 1.00 104.07 ? 78   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1  78   ? 423.125 13.928  716.030 1.00 103.25 ? 78   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1  78   ? 421.781 14.029  715.320 1.00 107.74 ? 78   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1  78   ? 423.293 15.216  716.807 1.00 98.90  ? 78   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1  78   ? 420.613 13.878  716.210 1.00 107.80 ? 78   ILE B CD1   1 
ATOM   2352  N  N     . ILE B 1  79   ? 425.970 12.466  716.044 1.00 104.01 ? 79   ILE B N     1 
ATOM   2353  C  CA    . ILE B 1  79   ? 427.308 12.247  716.595 1.00 103.92 ? 79   ILE B CA    1 
ATOM   2354  C  C     . ILE B 1  79   ? 428.364 12.640  715.581 1.00 99.34  ? 79   ILE B C     1 
ATOM   2355  O  O     . ILE B 1  79   ? 429.338 13.333  715.910 1.00 97.72  ? 79   ILE B O     1 
ATOM   2356  C  CB    . ILE B 1  79   ? 427.501 10.781  717.028 1.00 108.68 ? 79   ILE B CB    1 
ATOM   2357  C  CG1   . ILE B 1  79   ? 426.606 10.433  718.223 1.00 98.25  ? 79   ILE B CG1   1 
ATOM   2358  C  CG2   . ILE B 1  79   ? 429.005 10.465  717.269 1.00 95.91  ? 79   ILE B CG2   1 
ATOM   2359  C  CD1   . ILE B 1  79   ? 426.712 8.979   718.612 1.00 102.56 ? 79   ILE B CD1   1 
ATOM   2360  N  N     . LEU B 1  80   ? 428.124 12.282  714.312 1.00 102.59 ? 80   LEU B N     1 
ATOM   2361  C  CA    . LEU B 1  80   ? 429.044 12.575  713.216 1.00 95.58  ? 80   LEU B CA    1 
ATOM   2362  C  C     . LEU B 1  80   ? 429.333 14.062  713.133 1.00 94.86  ? 80   LEU B C     1 
ATOM   2363  O  O     . LEU B 1  80   ? 430.496 14.478  713.182 1.00 95.23  ? 80   LEU B O     1 
ATOM   2364  C  CB    . LEU B 1  80   ? 428.428 12.069  711.912 1.00 93.07  ? 80   LEU B CB    1 
ATOM   2365  C  CG    . LEU B 1  80   ? 428.801 10.619  711.547 1.00 92.11  ? 80   LEU B CG    1 
ATOM   2366  C  CD1   . LEU B 1  80   ? 428.282 10.200  710.180 1.00 93.07  ? 80   LEU B CD1   1 
ATOM   2367  C  CD2   . LEU B 1  80   ? 430.264 10.231  711.768 1.00 83.28  ? 80   LEU B CD2   1 
ATOM   2368  N  N     . ASN B 1  81   ? 428.281 14.878  713.038 1.00 94.61  ? 81   ASN B N     1 
ATOM   2369  C  CA    . ASN B 1  81   ? 428.434 16.331  713.060 1.00 94.98  ? 81   ASN B CA    1 
ATOM   2370  C  C     . ASN B 1  81   ? 429.217 16.802  714.271 1.00 93.44  ? 81   ASN B C     1 
ATOM   2371  O  O     . ASN B 1  81   ? 429.907 17.822  714.210 1.00 93.71  ? 81   ASN B O     1 
ATOM   2372  C  CB    . ASN B 1  81   ? 427.070 17.004  712.989 1.00 96.26  ? 81   ASN B CB    1 
ATOM   2373  C  CG    . ASN B 1  81   ? 426.401 16.791  711.652 1.00 104.46 ? 81   ASN B CG    1 
ATOM   2374  O  OD1   . ASN B 1  81   ? 427.056 16.824  710.616 1.00 106.66 ? 81   ASN B OD1   1 
ATOM   2375  N  ND2   . ASN B 1  81   ? 425.111 16.512  711.665 1.00 109.30 ? 81   ASN B ND2   1 
ATOM   2376  N  N     . LEU B 1  82   ? 429.025 16.153  715.413 1.00 96.85  ? 82   LEU B N     1 
ATOM   2377  C  CA    . LEU B 1  82   ? 429.783 16.543  716.597 1.00 98.29  ? 82   LEU B CA    1 
ATOM   2378  C  C     . LEU B 1  82   ? 431.266 16.271  716.425 1.00 96.80  ? 82   LEU B C     1 
ATOM   2379  O  O     . LEU B 1  82   ? 432.102 17.071  716.856 1.00 99.21  ? 82   LEU B O     1 
ATOM   2380  C  CB    . LEU B 1  82   ? 429.230 15.835  717.826 1.00 97.53  ? 82   LEU B CB    1 
ATOM   2381  C  CG    . LEU B 1  82   ? 427.864 16.430  718.132 1.00 94.58  ? 82   LEU B CG    1 
ATOM   2382  C  CD1   . LEU B 1  82   ? 427.088 15.581  719.111 1.00 102.12 ? 82   LEU B CD1   1 
ATOM   2383  C  CD2   . LEU B 1  82   ? 428.081 17.831  718.653 1.00 94.72  ? 82   LEU B CD2   1 
ATOM   2384  N  N     . LYS B 1  83   ? 431.612 15.185  715.742 1.00 98.60  ? 83   LYS B N     1 
ATOM   2385  C  CA    . LYS B 1  83   ? 433.014 14.923  715.448 1.00 98.66  ? 83   LYS B CA    1 
ATOM   2386  C  C     . LYS B 1  83   ? 433.631 16.080  714.666 1.00 99.88  ? 83   LYS B C     1 
ATOM   2387  O  O     . LYS B 1  83   ? 434.810 16.406  714.852 1.00 101.21 ? 83   LYS B O     1 
ATOM   2388  C  CB    . LYS B 1  83   ? 433.146 13.620  714.666 1.00 88.19  ? 83   LYS B CB    1 
ATOM   2389  C  CG    . LYS B 1  83   ? 432.883 12.356  715.424 1.00 82.63  ? 83   LYS B CG    1 
ATOM   2390  C  CD    . LYS B 1  83   ? 433.060 11.182  714.475 1.00 86.31  ? 83   LYS B CD    1 
ATOM   2391  C  CE    . LYS B 1  83   ? 432.924 9.809   715.143 1.00 93.44  ? 83   LYS B CE    1 
ATOM   2392  N  NZ    . LYS B 1  83   ? 433.085 8.614   714.236 1.00 84.09  ? 83   LYS B NZ    1 
ATOM   2393  N  N     . GLU B 1  84   ? 432.812 16.792  713.902 1.00 97.51  ? 84   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  84   ? 433.268 17.901  713.082 1.00 102.67 ? 84   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  84   ? 433.567 19.161  713.897 1.00 106.20 ? 84   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  84   ? 434.451 19.937  713.531 1.00 113.74 ? 84   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  84   ? 432.145 18.241  712.103 1.00 109.97 ? 84   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  84   ? 431.696 17.162  711.088 1.00 110.20 ? 84   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  84   ? 432.493 17.124  709.814 1.00 109.10 ? 84   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  84   ? 433.490 17.874  709.712 1.00 112.06 ? 84   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  84   ? 432.065 16.384  708.897 1.00 106.53 ? 84   GLU B OE2   1 
ATOM   2402  N  N     . LEU B 1  85   ? 432.861 19.374  714.995 1.00 105.68 ? 85   LEU B N     1 
ATOM   2403  C  CA    . LEU B 1  85   ? 433.013 20.570  715.823 1.00 111.33 ? 85   LEU B CA    1 
ATOM   2404  C  C     . LEU B 1  85   ? 434.450 20.864  716.259 1.00 111.91 ? 85   LEU B C     1 
ATOM   2405  O  O     . LEU B 1  85   ? 435.169 19.982  716.745 1.00 114.79 ? 85   LEU B O     1 
ATOM   2406  C  CB    . LEU B 1  85   ? 432.112 20.435  717.053 1.00 113.79 ? 85   LEU B CB    1 
ATOM   2407  C  CG    . LEU B 1  85   ? 432.085 21.531  718.118 1.00 113.69 ? 85   LEU B CG    1 
ATOM   2408  C  CD1   . LEU B 1  85   ? 431.533 22.836  717.579 1.00 114.97 ? 85   LEU B CD1   1 
ATOM   2409  C  CD2   . LEU B 1  85   ? 431.250 21.035  719.287 1.00 111.01 ? 85   LEU B CD2   1 
ATOM   2410  N  N     . VAL B 1  86   ? 434.887 22.094  716.001 1.00 111.71 ? 86   VAL B N     1 
ATOM   2411  C  CA    . VAL B 1  86   ? 436.228 22.571  716.340 1.00 117.69 ? 86   VAL B CA    1 
ATOM   2412  C  C     . VAL B 1  86   ? 436.101 23.492  717.542 1.00 117.24 ? 86   VAL B C     1 
ATOM   2413  O  O     . VAL B 1  86   ? 435.556 24.595  717.421 1.00 121.96 ? 86   VAL B O     1 
ATOM   2414  C  CB    . VAL B 1  86   ? 436.909 23.310  715.175 1.00 118.31 ? 86   VAL B CB    1 
ATOM   2415  C  CG1   . VAL B 1  86   ? 438.319 23.792  715.570 1.00 110.45 ? 86   VAL B CG1   1 
ATOM   2416  C  CG2   . VAL B 1  86   ? 437.015 22.401  713.968 1.00 122.97 ? 86   VAL B CG2   1 
ATOM   2417  N  N     . VAL B 1  87   ? 436.579 23.046  718.704 1.00 113.47 ? 87   VAL B N     1 
ATOM   2418  C  CA    . VAL B 1  87   ? 436.448 23.791  719.956 1.00 117.05 ? 87   VAL B CA    1 
ATOM   2419  C  C     . VAL B 1  87   ? 437.835 24.155  720.462 1.00 115.52 ? 87   VAL B C     1 
ATOM   2420  O  O     . VAL B 1  87   ? 438.742 23.317  720.474 1.00 115.93 ? 87   VAL B O     1 
ATOM   2421  C  CB    . VAL B 1  87   ? 435.641 23.028  721.021 1.00 115.82 ? 87   VAL B CB    1 
ATOM   2422  C  CG1   . VAL B 1  87   ? 435.724 23.751  722.326 1.00 119.66 ? 87   VAL B CG1   1 
ATOM   2423  C  CG2   . VAL B 1  87   ? 434.168 22.992  720.625 1.00 109.48 ? 87   VAL B CG2   1 
ATOM   2424  N  N     . ARG B 1  88   ? 438.006 25.415  720.838 1.00 116.17 ? 88   ARG B N     1 
ATOM   2425  C  CA    . ARG B 1  88   ? 439.293 25.948  721.257 1.00 124.56 ? 88   ARG B CA    1 
ATOM   2426  C  C     . ARG B 1  88   ? 439.245 26.366  722.731 1.00 130.85 ? 88   ARG B C     1 
ATOM   2427  O  O     . ARG B 1  88   ? 438.504 27.291  723.087 1.00 126.27 ? 88   ARG B O     1 
ATOM   2428  C  CB    . ARG B 1  88   ? 439.683 27.125  720.379 1.00 122.65 ? 88   ARG B CB    1 
ATOM   2429  C  CG    . ARG B 1  88   ? 441.028 27.655  720.719 1.00 124.17 ? 88   ARG B CG    1 
ATOM   2430  C  CD    . ARG B 1  88   ? 441.355 28.765  719.797 1.00 126.28 ? 88   ARG B CD    1 
ATOM   2431  N  NE    . ARG B 1  88   ? 442.688 29.275  720.045 1.00 130.73 ? 88   ARG B NE    1 
ATOM   2432  C  CZ    . ARG B 1  88   ? 443.231 30.248  719.331 1.00 139.39 ? 88   ARG B CZ    1 
ATOM   2433  N  NH1   . ARG B 1  88   ? 442.533 30.799  718.340 1.00 138.36 ? 88   ARG B NH1   1 
ATOM   2434  N  NH2   . ARG B 1  88   ? 444.466 30.659  719.595 1.00 143.51 ? 88   ARG B NH2   1 
ATOM   2435  N  N     . PHE B 1  89   ? 440.033 25.685  723.587 1.00 132.79 ? 89   PHE B N     1 
ATOM   2436  C  CA    . PHE B 1  89   ? 440.138 26.029  725.010 1.00 118.97 ? 89   PHE B CA    1 
ATOM   2437  C  C     . PHE B 1  89   ? 441.084 27.216  725.146 1.00 125.16 ? 89   PHE B C     1 
ATOM   2438  O  O     . PHE B 1  89   ? 442.295 27.088  724.911 1.00 126.38 ? 89   PHE B O     1 
ATOM   2439  C  CB    . PHE B 1  89   ? 440.720 24.877  725.831 1.00 113.41 ? 89   PHE B CB    1 
ATOM   2440  C  CG    . PHE B 1  89   ? 439.829 23.693  725.963 1.00 105.21 ? 89   PHE B CG    1 
ATOM   2441  C  CD1   . PHE B 1  89   ? 438.525 23.722  725.492 1.00 103.27 ? 89   PHE B CD1   1 
ATOM   2442  C  CD2   . PHE B 1  89   ? 440.303 22.538  726.575 1.00 103.92 ? 89   PHE B CD2   1 
ATOM   2443  C  CE1   . PHE B 1  89   ? 437.705 22.607  725.618 1.00 102.62 ? 89   PHE B CE1   1 
ATOM   2444  C  CE2   . PHE B 1  89   ? 439.487 21.424  726.715 1.00 104.51 ? 89   PHE B CE2   1 
ATOM   2445  C  CZ    . PHE B 1  89   ? 438.185 21.457  726.235 1.00 101.64 ? 89   PHE B CZ    1 
ATOM   2446  N  N     . LEU B 1  90   ? 440.556 28.334  725.628 1.00 124.35 ? 90   LEU B N     1 
ATOM   2447  C  CA    . LEU B 1  90   ? 441.361 29.533  725.800 1.00 125.59 ? 90   LEU B CA    1 
ATOM   2448  C  C     . LEU B 1  90   ? 442.200 29.498  727.067 1.00 133.33 ? 90   LEU B C     1 
ATOM   2449  O  O     . LEU B 1  90   ? 443.273 30.113  727.111 1.00 135.09 ? 90   LEU B O     1 
ATOM   2450  C  CB    . LEU B 1  90   ? 440.419 30.728  725.855 1.00 128.36 ? 90   LEU B CB    1 
ATOM   2451  C  CG    . LEU B 1  90   ? 439.549 30.880  724.617 1.00 128.66 ? 90   LEU B CG    1 
ATOM   2452  C  CD1   . LEU B 1  90   ? 438.517 31.961  724.822 1.00 130.60 ? 90   LEU B CD1   1 
ATOM   2453  C  CD2   . LEU B 1  90   ? 440.419 31.212  723.442 1.00 134.29 ? 90   LEU B CD2   1 
ATOM   2454  N  N     . ASN B 1  91   ? 441.750 28.752  728.081 1.00 133.55 ? 91   ASN B N     1 
ATOM   2455  C  CA    . ASN B 1  91   ? 442.423 28.613  729.367 1.00 132.34 ? 91   ASN B CA    1 
ATOM   2456  C  C     . ASN B 1  91   ? 443.510 27.551  729.330 1.00 132.72 ? 91   ASN B C     1 
ATOM   2457  O  O     . ASN B 1  91   ? 443.234 26.363  729.115 1.00 133.36 ? 91   ASN B O     1 
ATOM   2458  C  CB    . ASN B 1  91   ? 441.414 28.290  730.468 1.00 136.39 ? 91   ASN B CB    1 
ATOM   2459  C  CG    . ASN B 1  91   ? 442.000 28.454  731.868 1.00 138.65 ? 91   ASN B CG    1 
ATOM   2460  O  OD1   . ASN B 1  91   ? 443.232 28.459  732.058 1.00 138.05 ? 91   ASN B OD1   1 
ATOM   2461  N  ND2   . ASN B 1  91   ? 441.117 28.629  732.852 1.00 135.45 ? 91   ASN B ND2   1 
ATOM   2462  N  N     . PRO B 1  92   ? 444.759 27.954  729.497 1.00 130.54 ? 92   PRO B N     1 
ATOM   2463  C  CA    . PRO B 1  92   ? 445.862 26.988  729.447 1.00 129.57 ? 92   PRO B CA    1 
ATOM   2464  C  C     . PRO B 1  92   ? 445.693 25.818  730.385 1.00 129.24 ? 92   PRO B C     1 
ATOM   2465  O  O     . PRO B 1  92   ? 446.219 24.736  730.108 1.00 134.63 ? 92   PRO B O     1 
ATOM   2466  C  CB    . PRO B 1  92   ? 447.072 27.834  729.852 1.00 132.61 ? 92   PRO B CB    1 
ATOM   2467  C  CG    . PRO B 1  92   ? 446.707 29.215  729.441 1.00 138.39 ? 92   PRO B CG    1 
ATOM   2468  C  CD    . PRO B 1  92   ? 445.226 29.333  729.686 1.00 134.64 ? 92   PRO B CD    1 
ATOM   2469  N  N     . SER B 1  93   ? 444.966 25.978  731.477 1.00 125.86 ? 93   SER B N     1 
ATOM   2470  C  CA    . SER B 1  93   ? 444.903 24.886  732.428 1.00 129.50 ? 93   SER B CA    1 
ATOM   2471  C  C     . SER B 1  93   ? 443.694 23.973  732.236 1.00 128.88 ? 93   SER B C     1 
ATOM   2472  O  O     . SER B 1  93   ? 443.660 22.889  732.824 1.00 129.89 ? 93   SER B O     1 
ATOM   2473  C  CB    . SER B 1  93   ? 444.830 25.483  733.847 1.00 134.17 ? 93   SER B CB    1 
ATOM   2474  O  OG    . SER B 1  93   ? 445.880 26.392  734.145 1.00 130.37 ? 93   SER B OG    1 
ATOM   2475  N  N     . LEU B 1  94   ? 442.800 24.294  731.311 1.00 124.70 ? 94   LEU B N     1 
ATOM   2476  C  CA    . LEU B 1  94   ? 441.542 23.570  731.159 1.00 118.42 ? 94   LEU B CA    1 
ATOM   2477  C  C     . LEU B 1  94   ? 441.687 22.258  730.403 1.00 115.94 ? 94   LEU B C     1 
ATOM   2478  O  O     . LEU B 1  94   ? 442.050 22.251  729.225 1.00 125.16 ? 94   LEU B O     1 
ATOM   2479  C  CB    . LEU B 1  94   ? 440.517 24.458  730.469 1.00 120.45 ? 94   LEU B CB    1 
ATOM   2480  C  CG    . LEU B 1  94   ? 439.178 23.744  730.303 1.00 116.28 ? 94   LEU B CG    1 
ATOM   2481  C  CD1   . LEU B 1  94   ? 438.698 23.179  731.615 1.00 117.66 ? 94   LEU B CD1   1 
ATOM   2482  C  CD2   . LEU B 1  94   ? 438.163 24.696  729.689 1.00 114.21 ? 94   LEU B CD2   1 
ATOM   2483  N  N     . GLN B 1  95   ? 441.426 21.150  731.077 1.00 111.98 ? 95   GLN B N     1 
ATOM   2484  C  CA    . GLN B 1  95   ? 441.542 19.827  730.479 1.00 112.11 ? 95   GLN B CA    1 
ATOM   2485  C  C     . GLN B 1  95   ? 440.221 19.169  730.084 1.00 110.68 ? 95   GLN B C     1 
ATOM   2486  O  O     . GLN B 1  95   ? 440.266 18.051  729.553 1.00 111.03 ? 95   GLN B O     1 
ATOM   2487  C  CB    . GLN B 1  95   ? 442.414 18.915  731.323 1.00 115.09 ? 95   GLN B CB    1 
ATOM   2488  C  CG    . GLN B 1  95   ? 443.846 19.392  731.182 1.00 115.11 ? 95   GLN B CG    1 
ATOM   2489  C  CD    . GLN B 1  95   ? 444.666 19.169  732.403 1.00 125.49 ? 95   GLN B CD    1 
ATOM   2490  O  OE1   . GLN B 1  95   ? 445.013 20.125  733.106 1.00 125.03 ? 95   GLN B OE1   1 
ATOM   2491  N  NE2   . GLN B 1  95   ? 445.000 17.904  732.675 1.00 122.49 ? 95   GLN B NE2   1 
ATOM   2492  N  N     . THR B 1  96   ? 439.060 19.784  730.351 1.00 107.33 ? 96   THR B N     1 
ATOM   2493  C  CA    . THR B 1  96   ? 437.782 19.162  729.965 1.00 105.47 ? 96   THR B CA    1 
ATOM   2494  C  C     . THR B 1  96   ? 436.605 20.073  730.291 1.00 99.65  ? 96   THR B C     1 
ATOM   2495  O  O     . THR B 1  96   ? 436.738 21.011  731.069 1.00 105.28 ? 96   THR B O     1 
ATOM   2496  C  CB    . THR B 1  96   ? 437.575 17.808  730.658 1.00 100.23 ? 96   THR B CB    1 
ATOM   2497  O  OG1   . THR B 1  96   ? 436.227 17.347  730.462 1.00 94.48  ? 96   THR B OG1   1 
ATOM   2498  C  CG2   . THR B 1  96   ? 437.909 17.907  732.114 1.00 107.15 ? 96   THR B CG2   1 
ATOM   2499  N  N     . VAL B 1  97   ? 435.485 19.844  729.581 1.00 99.72  ? 97   VAL B N     1 
ATOM   2500  C  CA    . VAL B 1  97   ? 434.238 20.614  729.674 1.00 99.64  ? 97   VAL B CA    1 
ATOM   2501  C  C     . VAL B 1  97   ? 433.067 19.724  729.262 1.00 103.64 ? 97   VAL B C     1 
ATOM   2502  O  O     . VAL B 1  97   ? 433.225 18.798  728.456 1.00 100.25 ? 97   VAL B O     1 
ATOM   2503  C  CB    . VAL B 1  97   ? 434.209 21.877  728.778 1.00 100.15 ? 97   VAL B CB    1 
ATOM   2504  C  CG1   . VAL B 1  97   ? 435.139 22.957  729.278 1.00 103.64 ? 97   VAL B CG1   1 
ATOM   2505  C  CG2   . VAL B 1  97   ? 434.510 21.515  727.367 1.00 106.78 ? 97   VAL B CG2   1 
ATOM   2506  N  N     . THR B 1  98   ? 431.883 20.000  729.832 1.00 108.03 ? 98   THR B N     1 
ATOM   2507  C  CA    . THR B 1  98   ? 430.603 19.447  729.359 1.00 109.51 ? 98   THR B CA    1 
ATOM   2508  C  C     . THR B 1  98   ? 429.777 20.568  728.721 1.00 107.02 ? 98   THR B C     1 
ATOM   2509  O  O     . THR B 1  98   ? 429.593 21.622  729.329 1.00 109.95 ? 98   THR B O     1 
ATOM   2510  C  CB    . THR B 1  98   ? 429.793 18.745  730.464 1.00 99.37  ? 98   THR B CB    1 
ATOM   2511  O  OG1   . THR B 1  98   ? 430.500 17.594  730.966 1.00 98.73  ? 98   THR B OG1   1 
ATOM   2512  C  CG2   . THR B 1  98   ? 428.428 18.293  729.929 1.00 100.39 ? 98   THR B CG2   1 
ATOM   2513  N  N     . LEU B 1  99   ? 429.402 20.397  727.452 1.00 108.30 ? 99   LEU B N     1 
ATOM   2514  C  CA    . LEU B 1  99   ? 428.553 21.348  726.735 1.00 109.09 ? 99   LEU B CA    1 
ATOM   2515  C  C     . LEU B 1  99   ? 427.083 20.915  726.736 1.00 112.11 ? 99   LEU B C     1 
ATOM   2516  O  O     . LEU B 1  99   ? 426.768 19.738  726.517 1.00 107.35 ? 99   LEU B O     1 
ATOM   2517  C  CB    . LEU B 1  99   ? 429.056 21.554  725.305 1.00 109.20 ? 99   LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1  99   ? 430.025 22.739  725.240 1.00 113.14 ? 99   LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1  99   ? 431.229 22.586  726.191 1.00 111.94 ? 99   LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1  99   ? 430.465 23.043  723.831 1.00 108.25 ? 99   LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1  100  ? 426.192 21.861  727.019 1.00 113.30 ? 100  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1  100  ? 424.760 21.603  727.086 1.00 115.78 ? 100  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1  100  ? 424.022 22.310  725.960 1.00 114.96 ? 100  LEU B C     1 
ATOM   2524  O  O     . LEU B 1  100  ? 424.408 23.413  725.553 1.00 116.03 ? 100  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1  100  ? 424.170 22.035  728.439 1.00 120.55 ? 100  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1  100  ? 424.596 21.338  729.740 1.00 116.05 ? 100  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1  100  ? 425.731 22.068  730.491 1.00 105.99 ? 100  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1  100  ? 423.351 21.144  730.627 1.00 126.82 ? 100  LEU B CD2   1 
ATOM   2529  N  N     . LEU B 1  101  ? 423.008 21.633  725.416 1.00 112.56 ? 101  LEU B N     1 
ATOM   2530  C  CA    . LEU B 1  101  ? 422.110 22.224  724.425 1.00 123.01 ? 101  LEU B CA    1 
ATOM   2531  C  C     . LEU B 1  101  ? 420.681 21.776  724.661 1.00 125.23 ? 101  LEU B C     1 
ATOM   2532  O  O     . LEU B 1  101  ? 420.403 20.572  724.702 1.00 122.35 ? 101  LEU B O     1 
ATOM   2533  C  CB    . LEU B 1  101  ? 422.486 21.899  722.987 1.00 126.81 ? 101  LEU B CB    1 
ATOM   2534  C  CG    . LEU B 1  101  ? 421.581 22.592  721.970 1.00 128.08 ? 101  LEU B CG    1 
ATOM   2535  C  CD1   . LEU B 1  101  ? 422.409 23.362  720.980 1.00 124.22 ? 101  LEU B CD1   1 
ATOM   2536  C  CD2   . LEU B 1  101  ? 420.703 21.569  721.249 1.00 129.96 ? 101  LEU B CD2   1 
ATOM   2537  N  N     . LYS B 1  102  ? 419.770 22.743  724.701 1.00 128.82 ? 102  LYS B N     1 
ATOM   2538  C  CA    . LYS B 1  102  ? 418.351 22.457  724.803 1.00 129.69 ? 102  LYS B CA    1 
ATOM   2539  C  C     . LYS B 1  102  ? 417.665 23.310  723.752 1.00 128.24 ? 102  LYS B C     1 
ATOM   2540  O  O     . LYS B 1  102  ? 417.883 24.524  723.706 1.00 132.78 ? 102  LYS B O     1 
ATOM   2541  C  CB    . LYS B 1  102  ? 417.832 22.860  726.193 1.00 133.22 ? 102  LYS B CB    1 
ATOM   2542  C  CG    . LYS B 1  102  ? 418.425 22.108  727.397 1.00 137.22 ? 102  LYS B CG    1 
ATOM   2543  C  CD    . LYS B 1  102  ? 417.508 22.111  728.643 1.00 143.73 ? 102  LYS B CD    1 
ATOM   2544  C  CE    . LYS B 1  102  ? 418.176 21.522  729.932 1.00 140.82 ? 102  LYS B CE    1 
ATOM   2545  N  NZ    . LYS B 1  102  ? 419.590 21.950  730.244 1.00 127.32 ? 102  LYS B NZ    1 
ATOM   2546  N  N     . ALA B 1  103  ? 416.934 22.668  722.848 1.00 126.75 ? 103  ALA B N     1 
ATOM   2547  C  CA    . ALA B 1  103  ? 416.157 23.369  721.833 1.00 131.10 ? 103  ALA B CA    1 
ATOM   2548  C  C     . ALA B 1  103  ? 415.068 22.411  721.370 1.00 135.44 ? 103  ALA B C     1 
ATOM   2549  O  O     . ALA B 1  103  ? 415.140 21.205  721.619 1.00 132.61 ? 103  ALA B O     1 
ATOM   2550  C  CB    . ALA B 1  103  ? 417.020 23.871  720.674 1.00 128.52 ? 103  ALA B CB    1 
ATOM   2551  N  N     . GLU B 1  104  ? 414.048 22.949  720.712 1.00 140.01 ? 104  GLU B N     1 
ATOM   2552  C  CA    . GLU B 1  104  ? 412.941 22.097  720.289 1.00 142.56 ? 104  GLU B CA    1 
ATOM   2553  C  C     . GLU B 1  104  ? 412.160 22.781  719.170 1.00 145.02 ? 104  GLU B C     1 
ATOM   2554  O  O     . GLU B 1  104  ? 412.535 23.852  718.677 1.00 144.92 ? 104  GLU B O     1 
ATOM   2555  C  CB    . GLU B 1  104  ? 412.023 21.743  721.465 1.00 150.10 ? 104  GLU B CB    1 
ATOM   2556  C  CG    . GLU B 1  104  ? 411.546 22.934  722.303 1.00 152.87 ? 104  GLU B CG    1 
ATOM   2557  C  CD    . GLU B 1  104  ? 410.498 22.533  723.324 1.00 155.84 ? 104  GLU B CD    1 
ATOM   2558  O  OE1   . GLU B 1  104  ? 410.859 22.238  724.486 1.00 159.32 ? 104  GLU B OE1   1 
ATOM   2559  O  OE2   . GLU B 1  104  ? 409.307 22.487  722.946 1.00 155.61 ? 104  GLU B OE2   1 
ATOM   2560  N  N     . GLY B 1  105  ? 411.080 22.116  718.749 1.00 140.70 ? 105  GLY B N     1 
ATOM   2561  C  CA    . GLY B 1  105  ? 410.166 22.642  717.765 1.00 141.42 ? 105  GLY B CA    1 
ATOM   2562  C  C     . GLY B 1  105  ? 410.787 22.702  716.397 1.00 146.14 ? 105  GLY B C     1 
ATOM   2563  O  O     . GLY B 1  105  ? 411.860 22.148  716.164 1.00 152.79 ? 105  GLY B O     1 
ATOM   2564  N  N     . PRO B 1  106  ? 410.143 23.391  715.468 1.00 147.96 ? 106  PRO B N     1 
ATOM   2565  C  CA    . PRO B 1  106  ? 410.693 23.481  714.088 1.00 149.23 ? 106  PRO B CA    1 
ATOM   2566  C  C     . PRO B 1  106  ? 411.888 24.410  713.833 1.00 148.90 ? 106  PRO B C     1 
ATOM   2567  O  O     . PRO B 1  106  ? 411.760 25.567  713.425 1.00 151.11 ? 106  PRO B O     1 
ATOM   2568  C  CB    . PRO B 1  106  ? 409.468 23.922  713.279 1.00 149.41 ? 106  PRO B CB    1 
ATOM   2569  C  CG    . PRO B 1  106  ? 408.606 24.657  714.252 1.00 149.56 ? 106  PRO B CG    1 
ATOM   2570  C  CD    . PRO B 1  106  ? 408.790 23.961  715.572 1.00 147.12 ? 106  PRO B CD    1 
ATOM   2571  N  N     . LYS B 1  107  ? 413.101 23.922  714.119 1.00 144.40 ? 107  LYS B N     1 
ATOM   2572  C  CA    . LYS B 1  107  ? 414.326 24.694  713.908 1.00 141.71 ? 107  LYS B CA    1 
ATOM   2573  C  C     . LYS B 1  107  ? 415.476 23.751  713.568 1.00 138.70 ? 107  LYS B C     1 
ATOM   2574  O  O     . LYS B 1  107  ? 415.496 22.592  713.993 1.00 138.69 ? 107  LYS B O     1 
ATOM   2575  C  CB    . LYS B 1  107  ? 414.807 25.640  715.021 1.00 139.80 ? 107  LYS B CB    1 
ATOM   2576  C  CG    . LYS B 1  107  ? 415.961 25.087  715.834 1.00 142.47 ? 107  LYS B CG    1 
ATOM   2577  C  CD    . LYS B 1  107  ? 416.373 25.992  716.977 1.00 141.76 ? 107  LYS B CD    1 
ATOM   2578  C  CE    . LYS B 1  107  ? 417.280 27.067  716.295 1.00 135.20 ? 107  LYS B CE    1 
ATOM   2579  N  NZ    . LYS B 1  107  ? 417.929 28.156  717.088 1.00 128.34 ? 107  LYS B NZ    1 
ATOM   2580  N  N     . GLU B 1  108  ? 416.384 24.240  712.724 1.00 135.06 ? 108  GLU B N     1 
ATOM   2581  C  CA    . GLU B 1  108  ? 417.622 23.537  712.396 1.00 136.26 ? 108  GLU B CA    1 
ATOM   2582  C  C     . GLU B 1  108  ? 418.728 24.023  713.338 1.00 133.61 ? 108  GLU B C     1 
ATOM   2583  O  O     . GLU B 1  108  ? 419.161 25.179  713.261 1.00 132.56 ? 108  GLU B O     1 
ATOM   2584  C  CB    . GLU B 1  108  ? 418.007 23.816  710.946 1.00 144.10 ? 108  GLU B CB    1 
ATOM   2585  C  CG    . GLU B 1  108  ? 417.060 23.256  709.906 1.00 144.54 ? 108  GLU B CG    1 
ATOM   2586  C  CD    . GLU B 1  108  ? 417.622 23.390  708.508 1.00 152.73 ? 108  GLU B CD    1 
ATOM   2587  O  OE1   . GLU B 1  108  ? 418.807 23.780  708.384 1.00 156.75 ? 108  GLU B OE1   1 
ATOM   2588  O  OE2   . GLU B 1  108  ? 416.887 23.108  707.536 1.00 156.03 ? 108  GLU B OE2   1 
ATOM   2589  N  N     . VAL B 1  109  ? 419.211 23.127  714.197 1.00 132.86 ? 109  VAL B N     1 
ATOM   2590  C  CA    . VAL B 1  109  ? 420.148 23.478  715.266 1.00 132.03 ? 109  VAL B CA    1 
ATOM   2591  C  C     . VAL B 1  109  ? 421.575 23.574  714.724 1.00 124.99 ? 109  VAL B C     1 
ATOM   2592  O  O     . VAL B 1  109  ? 422.123 22.594  714.209 1.00 116.99 ? 109  VAL B O     1 
ATOM   2593  C  CB    . VAL B 1  109  ? 420.061 22.467  716.420 1.00 125.94 ? 109  VAL B CB    1 
ATOM   2594  C  CG1   . VAL B 1  109  ? 420.912 22.923  717.588 1.00 122.61 ? 109  VAL B CG1   1 
ATOM   2595  C  CG2   . VAL B 1  109  ? 418.615 22.255  716.843 1.00 126.73 ? 109  VAL B CG2   1 
ATOM   2596  N  N     . LYS B 1  110  ? 422.193 24.746  714.885 1.00 123.61 ? 110  LYS B N     1 
ATOM   2597  C  CA    . LYS B 1  110  ? 423.578 24.987  714.514 1.00 121.83 ? 110  LYS B CA    1 
ATOM   2598  C  C     . LYS B 1  110  ? 424.500 24.918  715.741 1.00 123.70 ? 110  LYS B C     1 
ATOM   2599  O  O     . LYS B 1  110  ? 424.072 24.623  716.855 1.00 125.80 ? 110  LYS B O     1 
ATOM   2600  C  CB    . LYS B 1  110  ? 423.690 26.331  713.795 1.00 128.06 ? 110  LYS B CB    1 
ATOM   2601  C  CG    . LYS B 1  110  ? 422.796 26.466  712.533 1.00 133.25 ? 110  LYS B CG    1 
ATOM   2602  C  CD    . LYS B 1  110  ? 423.029 25.378  711.451 1.00 130.25 ? 110  LYS B CD    1 
ATOM   2603  C  CE    . LYS B 1  110  ? 423.621 25.976  710.146 1.00 128.67 ? 110  LYS B CE    1 
ATOM   2604  N  NZ    . LYS B 1  110  ? 423.833 24.990  709.044 1.00 115.19 ? 110  LYS B NZ    1 
ATOM   2605  N  N     . ALA B 1  111  ? 425.791 25.202  715.525 1.00 124.39 ? 111  ALA B N     1 
ATOM   2606  C  CA    . ALA B 1  111  ? 426.778 25.232  716.609 1.00 121.99 ? 111  ALA B CA    1 
ATOM   2607  C  C     . ALA B 1  111  ? 426.537 26.358  717.606 1.00 131.57 ? 111  ALA B C     1 
ATOM   2608  O  O     . ALA B 1  111  ? 426.847 26.203  718.792 1.00 135.31 ? 111  ALA B O     1 
ATOM   2609  C  CB    . ALA B 1  111  ? 428.189 25.337  716.049 1.00 124.22 ? 111  ALA B CB    1 
ATOM   2610  N  N     . ARG B 1  112  ? 426.085 27.527  717.141 1.00 137.70 ? 112  ARG B N     1 
ATOM   2611  C  CA    . ARG B 1  112  ? 425.990 28.694  718.024 1.00 138.93 ? 112  ARG B CA    1 
ATOM   2612  C  C     . ARG B 1  112  ? 425.083 28.427  719.224 1.00 133.60 ? 112  ARG B C     1 
ATOM   2613  O  O     . ARG B 1  112  ? 425.308 28.979  720.308 1.00 129.43 ? 112  ARG B O     1 
ATOM   2614  C  CB    . ARG B 1  112  ? 425.466 29.891  717.224 1.00 141.73 ? 112  ARG B CB    1 
ATOM   2615  C  CG    . ARG B 1  112  ? 426.100 30.047  715.835 1.00 138.64 ? 112  ARG B CG    1 
ATOM   2616  C  CD    . ARG B 1  112  ? 425.058 30.205  714.738 1.00 138.71 ? 112  ARG B CD    1 
ATOM   2617  N  NE    . ARG B 1  112  ? 423.853 30.871  715.219 1.00 145.37 ? 112  ARG B NE    1 
ATOM   2618  C  CZ    . ARG B 1  112  ? 422.643 30.307  715.252 1.00 143.36 ? 112  ARG B CZ    1 
ATOM   2619  N  NH1   . ARG B 1  112  ? 421.601 30.996  715.699 1.00 147.57 ? 112  ARG B NH1   1 
ATOM   2620  N  NH2   . ARG B 1  112  ? 422.472 29.047  714.873 1.00 137.68 ? 112  ARG B NH2   1 
ATOM   2621  N  N     . ASP B 1  113  ? 424.079 27.557  719.045 1.00 134.63 ? 113  ASP B N     1 
ATOM   2622  C  CA    . ASP B 1  113  ? 423.045 27.261  720.038 1.00 129.80 ? 113  ASP B CA    1 
ATOM   2623  C  C     . ASP B 1  113  ? 423.572 26.665  721.347 1.00 127.35 ? 113  ASP B C     1 
ATOM   2624  O  O     . ASP B 1  113  ? 422.834 26.670  722.336 1.00 133.66 ? 113  ASP B O     1 
ATOM   2625  C  CB    . ASP B 1  113  ? 421.966 26.366  719.423 1.00 127.53 ? 113  ASP B CB    1 
ATOM   2626  C  CG    . ASP B 1  113  ? 421.236 27.040  718.262 1.00 129.25 ? 113  ASP B CG    1 
ATOM   2627  O  OD1   . ASP B 1  113  ? 421.439 28.253  718.039 1.00 130.93 ? 113  ASP B OD1   1 
ATOM   2628  O  OD2   . ASP B 1  113  ? 420.426 26.366  717.594 1.00 128.81 ? 113  ASP B OD2   1 
ATOM   2629  N  N     . PHE B 1  114  ? 424.768 26.073  721.372 1.00 125.42 ? 114  PHE B N     1 
ATOM   2630  C  CA    . PHE B 1  114  ? 425.323 25.577  722.634 1.00 129.06 ? 114  PHE B CA    1 
ATOM   2631  C  C     . PHE B 1  114  ? 425.446 26.694  723.675 1.00 135.53 ? 114  PHE B C     1 
ATOM   2632  O  O     . PHE B 1  114  ? 425.821 27.828  723.354 1.00 135.01 ? 114  PHE B O     1 
ATOM   2633  C  CB    . PHE B 1  114  ? 426.693 24.925  722.414 1.00 125.60 ? 114  PHE B CB    1 
ATOM   2634  C  CG    . PHE B 1  114  ? 426.628 23.474  722.028 1.00 126.58 ? 114  PHE B CG    1 
ATOM   2635  C  CD1   . PHE B 1  114  ? 427.762 22.797  721.620 1.00 124.35 ? 114  PHE B CD1   1 
ATOM   2636  C  CD2   . PHE B 1  114  ? 425.446 22.769  722.119 1.00 124.97 ? 114  PHE B CD2   1 
ATOM   2637  C  CE1   . PHE B 1  114  ? 427.702 21.447  721.285 1.00 121.38 ? 114  PHE B CE1   1 
ATOM   2638  C  CE2   . PHE B 1  114  ? 425.382 21.411  721.775 1.00 121.52 ? 114  PHE B CE2   1 
ATOM   2639  C  CZ    . PHE B 1  114  ? 426.504 20.755  721.371 1.00 119.10 ? 114  PHE B CZ    1 
ATOM   2640  N  N     . LEU B 1  115  ? 425.105 26.371  724.933 1.00 129.75 ? 115  LEU B N     1 
ATOM   2641  C  CA    . LEU B 1  115  ? 425.160 27.364  726.005 1.00 128.19 ? 115  LEU B CA    1 
ATOM   2642  C  C     . LEU B 1  115  ? 426.579 27.850  726.263 1.00 128.96 ? 115  LEU B C     1 
ATOM   2643  O  O     . LEU B 1  115  ? 427.424 27.058  726.708 1.00 127.21 ? 115  LEU B O     1 
ATOM   2644  C  CB    . LEU B 1  115  ? 424.605 26.788  727.295 1.00 128.33 ? 115  LEU B CB    1 
ATOM   2645  C  CG    . LEU B 1  115  ? 423.115 26.488  727.293 1.00 130.82 ? 115  LEU B CG    1 
ATOM   2646  C  CD1   . LEU B 1  115  ? 422.680 26.008  728.668 1.00 131.75 ? 115  LEU B CD1   1 
ATOM   2647  C  CD2   . LEU B 1  115  ? 422.352 27.721  726.869 1.00 131.53 ? 115  LEU B CD2   1 
ATOM   2648  N  N     . PRO B 1  116  ? 426.855 29.143  726.062 1.00 128.38 ? 116  PRO B N     1 
ATOM   2649  C  CA    . PRO B 1  116  ? 428.219 29.682  726.208 1.00 130.53 ? 116  PRO B CA    1 
ATOM   2650  C  C     . PRO B 1  116  ? 428.885 29.330  727.537 1.00 124.37 ? 116  PRO B C     1 
ATOM   2651  O  O     . PRO B 1  116  ? 428.256 29.340  728.594 1.00 130.52 ? 116  PRO B O     1 
ATOM   2652  C  CB    . PRO B 1  116  ? 428.016 31.193  726.047 1.00 127.93 ? 116  PRO B CB    1 
ATOM   2653  C  CG    . PRO B 1  116  ? 426.788 31.300  725.201 1.00 124.43 ? 116  PRO B CG    1 
ATOM   2654  C  CD    . PRO B 1  116  ? 425.899 30.165  725.610 1.00 125.99 ? 116  PRO B CD    1 
ATOM   2655  N  N     . VAL B 1  117  ? 430.158 28.960  727.461 1.00 111.11 ? 117  VAL B N     1 
ATOM   2656  C  CA    . VAL B 1  117  ? 430.972 28.611  728.613 1.00 107.24 ? 117  VAL B CA    1 
ATOM   2657  C  C     . VAL B 1  117  ? 432.200 29.505  728.632 1.00 118.28 ? 117  VAL B C     1 
ATOM   2658  O  O     . VAL B 1  117  ? 432.700 29.907  727.579 1.00 124.16 ? 117  VAL B O     1 
ATOM   2659  C  CB    . VAL B 1  117  ? 431.374 27.126  728.606 1.00 106.54 ? 117  VAL B CB    1 
ATOM   2660  C  CG1   . VAL B 1  117  ? 432.238 26.803  729.815 1.00 108.99 ? 117  VAL B CG1   1 
ATOM   2661  C  CG2   . VAL B 1  117  ? 430.144 26.254  728.562 1.00 107.31 ? 117  VAL B CG2   1 
ATOM   2662  N  N     . ALA B 1  118  ? 432.616 29.902  729.827 1.00 129.92 ? 118  ALA B N     1 
ATOM   2663  C  CA    . ALA B 1  118  ? 433.753 30.801  729.989 1.00 134.58 ? 118  ALA B CA    1 
ATOM   2664  C  C     . ALA B 1  118  ? 435.028 30.155  729.455 1.00 134.22 ? 118  ALA B C     1 
ATOM   2665  O  O     . ALA B 1  118  ? 435.290 28.975  729.717 1.00 133.65 ? 118  ALA B O     1 
ATOM   2666  C  CB    . ALA B 1  118  ? 433.930 31.164  731.469 1.00 128.01 ? 118  ALA B CB    1 
ATOM   2667  N  N     . ASP B 1  119  ? 435.795 30.912  728.659 1.00 132.91 ? 119  ASP B N     1 
ATOM   2668  C  CA    . ASP B 1  119  ? 437.045 30.424  728.071 1.00 133.71 ? 119  ASP B CA    1 
ATOM   2669  C  C     . ASP B 1  119  ? 436.843 29.256  727.106 1.00 133.80 ? 119  ASP B C     1 
ATOM   2670  O  O     . ASP B 1  119  ? 437.765 28.460  726.894 1.00 133.02 ? 119  ASP B O     1 
ATOM   2671  C  CB    . ASP B 1  119  ? 438.071 30.058  729.155 1.00 135.05 ? 119  ASP B CB    1 
ATOM   2672  C  CG    . ASP B 1  119  ? 438.536 31.269  729.948 1.00 138.82 ? 119  ASP B CG    1 
ATOM   2673  O  OD1   . ASP B 1  119  ? 437.890 32.332  729.819 1.00 139.38 ? 119  ASP B OD1   1 
ATOM   2674  O  OD2   . ASP B 1  119  ? 439.530 31.155  730.708 1.00 138.99 ? 119  ASP B OD2   1 
ATOM   2675  N  N     . VAL B 1  120  ? 435.654 29.115  726.525 1.00 131.06 ? 120  VAL B N     1 
ATOM   2676  C  CA    . VAL B 1  120  ? 435.401 28.104  725.503 1.00 126.55 ? 120  VAL B CA    1 
ATOM   2677  C  C     . VAL B 1  120  ? 434.944 28.808  724.234 1.00 129.65 ? 120  VAL B C     1 
ATOM   2678  O  O     . VAL B 1  120  ? 433.845 29.379  724.190 1.00 128.32 ? 120  VAL B O     1 
ATOM   2679  C  CB    . VAL B 1  120  ? 434.365 27.074  725.971 1.00 121.04 ? 120  VAL B CB    1 
ATOM   2680  C  CG1   . VAL B 1  120  ? 433.918 26.195  724.833 1.00 115.30 ? 120  VAL B CG1   1 
ATOM   2681  C  CG2   . VAL B 1  120  ? 434.962 26.212  727.082 1.00 118.85 ? 120  VAL B CG2   1 
ATOM   2682  N  N     . GLU B 1  121  ? 435.805 28.763  723.203 1.00 132.93 ? 121  GLU B N     1 
ATOM   2683  C  CA    . GLU B 1  121  ? 435.594 29.393  721.901 1.00 129.81 ? 121  GLU B CA    1 
ATOM   2684  C  C     . GLU B 1  121  ? 435.205 28.341  720.875 1.00 128.42 ? 121  GLU B C     1 
ATOM   2685  O  O     . GLU B 1  121  ? 435.975 27.404  720.620 1.00 125.56 ? 121  GLU B O     1 
ATOM   2686  C  CB    . GLU B 1  121  ? 436.874 30.073  721.417 1.00 128.60 ? 121  GLU B CB    1 
ATOM   2687  C  CG    . GLU B 1  121  ? 436.759 30.715  720.053 1.00 129.04 ? 121  GLU B CG    1 
ATOM   2688  C  CD    . GLU B 1  121  ? 438.046 31.413  719.627 1.00 139.27 ? 121  GLU B CD    1 
ATOM   2689  O  OE1   . GLU B 1  121  ? 439.050 31.328  720.370 1.00 137.12 ? 121  GLU B OE1   1 
ATOM   2690  O  OE2   . GLU B 1  121  ? 438.065 32.023  718.531 1.00 143.11 ? 121  GLU B OE2   1 
ATOM   2691  N  N     . ILE B 1  122  ? 434.079 28.559  720.210 1.00 126.19 ? 122  ILE B N     1 
ATOM   2692  C  CA    . ILE B 1  122  ? 433.632 27.714  719.109 1.00 126.38 ? 122  ILE B CA    1 
ATOM   2693  C  C     . ILE B 1  122  ? 434.071 28.343  717.787 1.00 130.17 ? 122  ILE B C     1 
ATOM   2694  O  O     . ILE B 1  122  ? 433.587 29.410  717.390 1.00 131.52 ? 122  ILE B O     1 
ATOM   2695  C  CB    . ILE B 1  122  ? 432.123 27.448  719.174 1.00 120.35 ? 122  ILE B CB    1 
ATOM   2696  C  CG1   . ILE B 1  122  ? 431.824 26.505  720.339 1.00 118.73 ? 122  ILE B CG1   1 
ATOM   2697  C  CG2   . ILE B 1  122  ? 431.621 26.846  717.878 1.00 124.77 ? 122  ILE B CG2   1 
ATOM   2698  C  CD1   . ILE B 1  122  ? 431.832 27.143  721.701 1.00 127.12 ? 122  ILE B CD1   1 
ATOM   2699  N  N     . MET B 1  123  ? 435.003 27.676  717.105 1.00 126.29 ? 123  MET B N     1 
ATOM   2700  C  CA    . MET B 1  123  ? 435.618 28.254  715.922 1.00 119.57 ? 123  MET B CA    1 
ATOM   2701  C  C     . MET B 1  123  ? 434.657 28.272  714.753 1.00 119.42 ? 123  MET B C     1 
ATOM   2702  O  O     . MET B 1  123  ? 434.643 29.238  713.984 1.00 123.25 ? 123  MET B O     1 
ATOM   2703  C  CB    . MET B 1  123  ? 436.875 27.475  715.535 1.00 115.98 ? 123  MET B CB    1 
ATOM   2704  C  CG    . MET B 1  123  ? 437.920 27.415  716.600 1.00 119.03 ? 123  MET B CG    1 
ATOM   2705  S  SD    . MET B 1  123  ? 438.672 29.048  716.773 1.00 120.06 ? 123  MET B SD    1 
ATOM   2706  C  CE    . MET B 1  123  ? 439.443 29.174  715.163 1.00 135.80 ? 123  MET B CE    1 
ATOM   2707  N  N     . ASN B 1  124  ? 433.783 27.274  714.661 1.00 118.41 ? 124  ASN B N     1 
ATOM   2708  C  CA    . ASN B 1  124  ? 432.914 27.084  713.503 1.00 123.67 ? 124  ASN B CA    1 
ATOM   2709  C  C     . ASN B 1  124  ? 431.445 27.172  713.896 1.00 123.90 ? 124  ASN B C     1 
ATOM   2710  O  O     . ASN B 1  124  ? 430.706 26.184  713.794 1.00 120.94 ? 124  ASN B O     1 
ATOM   2711  C  CB    . ASN B 1  124  ? 433.202 25.732  712.846 1.00 120.71 ? 124  ASN B CB    1 
ATOM   2712  C  CG    . ASN B 1  124  ? 433.314 24.586  713.856 1.00 117.08 ? 124  ASN B CG    1 
ATOM   2713  O  OD1   . ASN B 1  124  ? 433.926 24.738  714.913 1.00 122.51 ? 124  ASN B OD1   1 
ATOM   2714  N  ND2   . ASN B 1  124  ? 432.717 23.440  713.533 1.00 104.56 ? 124  ASN B ND2   1 
ATOM   2715  N  N     . PRO B 1  125  ? 430.981 28.359  714.301 1.00 126.19 ? 125  PRO B N     1 
ATOM   2716  C  CA    . PRO B 1  125  ? 429.623 28.458  714.853 1.00 130.74 ? 125  PRO B CA    1 
ATOM   2717  C  C     . PRO B 1  125  ? 428.513 28.132  713.862 1.00 133.38 ? 125  PRO B C     1 
ATOM   2718  O  O     . PRO B 1  125  ? 427.400 27.811  714.300 1.00 133.43 ? 125  PRO B O     1 
ATOM   2719  C  CB    . PRO B 1  125  ? 429.544 29.922  715.305 1.00 136.11 ? 125  PRO B CB    1 
ATOM   2720  C  CG    . PRO B 1  125  ? 430.497 30.641  714.408 1.00 127.66 ? 125  PRO B CG    1 
ATOM   2721  C  CD    . PRO B 1  125  ? 431.631 29.678  714.204 1.00 128.17 ? 125  PRO B CD    1 
ATOM   2722  N  N     . ASP B 1  126  ? 428.761 28.178  712.555 1.00 128.12 ? 126  ASP B N     1 
ATOM   2723  C  CA    . ASP B 1  126  ? 427.680 27.887  711.619 1.00 131.36 ? 126  ASP B CA    1 
ATOM   2724  C  C     . ASP B 1  126  ? 427.542 26.404  711.322 1.00 123.20 ? 126  ASP B C     1 
ATOM   2725  O  O     . ASP B 1  126  ? 426.637 26.026  710.568 1.00 119.73 ? 126  ASP B O     1 
ATOM   2726  C  CB    . ASP B 1  126  ? 427.792 28.694  710.322 1.00 138.73 ? 126  ASP B CB    1 
ATOM   2727  C  CG    . ASP B 1  126  ? 426.613 29.671  710.148 1.00 145.99 ? 126  ASP B CG    1 
ATOM   2728  O  OD1   . ASP B 1  126  ? 425.919 29.959  711.159 1.00 143.68 ? 126  ASP B OD1   1 
ATOM   2729  O  OD2   . ASP B 1  126  ? 426.363 30.125  709.005 1.00 147.53 ? 126  ASP B OD2   1 
ATOM   2730  N  N     . LEU B 1  127  ? 428.369 25.557  711.936 1.00 114.50 ? 127  LEU B N     1 
ATOM   2731  C  CA    . LEU B 1  127  ? 428.279 24.131  711.678 1.00 110.75 ? 127  LEU B CA    1 
ATOM   2732  C  C     . LEU B 1  127  ? 426.910 23.595  712.034 1.00 109.51 ? 127  LEU B C     1 
ATOM   2733  O  O     . LEU B 1  127  ? 426.428 23.790  713.144 1.00 120.52 ? 127  LEU B O     1 
ATOM   2734  C  CB    . LEU B 1  127  ? 429.373 23.396  712.455 1.00 105.31 ? 127  LEU B CB    1 
ATOM   2735  C  CG    . LEU B 1  127  ? 429.272 21.869  712.550 1.00 104.20 ? 127  LEU B CG    1 
ATOM   2736  C  CD1   . LEU B 1  127  ? 429.236 21.195  711.221 1.00 115.38 ? 127  LEU B CD1   1 
ATOM   2737  C  CD2   . LEU B 1  127  ? 430.505 21.356  713.286 1.00 101.40 ? 127  LEU B CD2   1 
ATOM   2738  N  N     . HIS B 1  128  ? 426.292 22.905  711.079 1.00 107.39 ? 128  HIS B N     1 
ATOM   2739  C  CA    . HIS B 1  128  ? 424.984 22.314  711.293 1.00 110.96 ? 128  HIS B CA    1 
ATOM   2740  C  C     . HIS B 1  128  ? 425.118 21.124  712.225 1.00 118.04 ? 128  HIS B C     1 
ATOM   2741  O  O     . HIS B 1  128  ? 426.060 20.332  712.100 1.00 115.27 ? 128  HIS B O     1 
ATOM   2742  C  CB    . HIS B 1  128  ? 424.416 21.840  709.968 1.00 114.63 ? 128  HIS B CB    1 
ATOM   2743  C  CG    . HIS B 1  128  ? 423.046 21.258  710.066 1.00 117.93 ? 128  HIS B CG    1 
ATOM   2744  N  ND1   . HIS B 1  128  ? 421.985 21.939  710.619 1.00 126.11 ? 128  HIS B ND1   1 
ATOM   2745  C  CD2   . HIS B 1  128  ? 422.583 20.022  709.763 1.00 123.42 ? 128  HIS B CD2   1 
ATOM   2746  C  CE1   . HIS B 1  128  ? 420.912 21.167  710.595 1.00 130.26 ? 128  HIS B CE1   1 
ATOM   2747  N  NE2   . HIS B 1  128  ? 421.249 19.995  710.088 1.00 125.60 ? 128  HIS B NE2   1 
ATOM   2748  N  N     . ILE B 1  129  ? 424.155 20.984  713.151 1.00 124.61 ? 129  ILE B N     1 
ATOM   2749  C  CA    . ILE B 1  129  ? 424.084 19.836  714.056 1.00 119.64 ? 129  ILE B CA    1 
ATOM   2750  C  C     . ILE B 1  129  ? 422.847 18.966  713.798 1.00 120.90 ? 129  ILE B C     1 
ATOM   2751  O  O     . ILE B 1  129  ? 422.969 17.793  713.444 1.00 119.69 ? 129  ILE B O     1 
ATOM   2752  C  CB    . ILE B 1  129  ? 424.159 20.293  715.526 1.00 114.10 ? 129  ILE B CB    1 
ATOM   2753  C  CG1   . ILE B 1  129  ? 425.602 20.666  715.823 1.00 109.18 ? 129  ILE B CG1   1 
ATOM   2754  C  CG2   . ILE B 1  129  ? 423.760 19.143  716.435 1.00 113.21 ? 129  ILE B CG2   1 
ATOM   2755  C  CD1   . ILE B 1  129  ? 425.752 21.915  716.596 1.00 116.49 ? 129  ILE B CD1   1 
ATOM   2756  N  N     . ALA B 1  130  ? 421.648 19.522  713.969 1.00 122.07 ? 130  ALA B N     1 
ATOM   2757  C  CA    . ALA B 1  130  ? 420.477 18.727  713.625 1.00 126.89 ? 130  ALA B CA    1 
ATOM   2758  C  C     . ALA B 1  130  ? 419.310 19.620  713.239 1.00 128.92 ? 130  ALA B C     1 
ATOM   2759  O  O     . ALA B 1  130  ? 419.210 20.769  713.677 1.00 128.73 ? 130  ALA B O     1 
ATOM   2760  C  CB    . ALA B 1  130  ? 420.068 17.801  714.780 1.00 124.66 ? 130  ALA B CB    1 
ATOM   2761  N  N     . THR B 1  131  ? 418.428 19.066  712.409 1.00 132.09 ? 131  THR B N     1 
ATOM   2762  C  CA    . THR B 1  131  ? 417.167 19.698  712.041 1.00 135.68 ? 131  THR B CA    1 
ATOM   2763  C  C     . THR B 1  131  ? 416.051 19.102  712.893 1.00 134.32 ? 131  THR B C     1 
ATOM   2764  O  O     . THR B 1  131  ? 415.971 17.877  713.059 1.00 130.44 ? 131  THR B O     1 
ATOM   2765  C  CB    . THR B 1  131  ? 416.839 19.506  710.554 1.00 136.04 ? 131  THR B CB    1 
ATOM   2766  O  OG1   . THR B 1  131  ? 416.663 18.115  710.273 1.00 136.33 ? 131  THR B OG1   1 
ATOM   2767  C  CG2   . THR B 1  131  ? 417.973 20.002  709.678 1.00 132.57 ? 131  THR B CG2   1 
ATOM   2768  N  N     . LEU B 1  132  ? 415.240 19.967  713.485 1.00 137.31 ? 132  LEU B N     1 
ATOM   2769  C  CA    . LEU B 1  132  ? 414.125 19.562  714.327 1.00 137.73 ? 132  LEU B CA    1 
ATOM   2770  C  C     . LEU B 1  132  ? 412.798 19.934  713.681 1.00 133.52 ? 132  LEU B C     1 
ATOM   2771  O  O     . LEU B 1  132  ? 412.643 21.049  713.171 1.00 127.04 ? 132  LEU B O     1 
ATOM   2772  C  CB    . LEU B 1  132  ? 414.230 20.167  715.723 1.00 137.93 ? 132  LEU B CB    1 
ATOM   2773  C  CG    . LEU B 1  132  ? 415.112 19.388  716.695 1.00 135.98 ? 132  LEU B CG    1 
ATOM   2774  C  CD1   . LEU B 1  132  ? 416.554 19.293  716.230 1.00 134.71 ? 132  LEU B CD1   1 
ATOM   2775  C  CD2   . LEU B 1  132  ? 415.035 20.017  718.061 1.00 144.96 ? 132  LEU B CD2   1 
ATOM   2776  N  N     . GLU B 1  133  ? 411.869 18.986  713.648 1.00 134.22 ? 133  GLU B N     1 
ATOM   2777  C  CA    . GLU B 1  133  ? 410.568 19.258  713.064 1.00 141.72 ? 133  GLU B CA    1 
ATOM   2778  C  C     . GLU B 1  133  ? 409.637 19.796  714.159 1.00 147.57 ? 133  GLU B C     1 
ATOM   2779  O  O     . GLU B 1  133  ? 410.045 20.026  715.300 1.00 149.17 ? 133  GLU B O     1 
ATOM   2780  C  CB    . GLU B 1  133  ? 409.934 17.990  712.502 1.00 137.15 ? 133  GLU B CB    1 
ATOM   2781  C  CG    . GLU B 1  133  ? 410.831 16.957  711.915 1.00 132.57 ? 133  GLU B CG    1 
ATOM   2782  C  CD    . GLU B 1  133  ? 410.024 15.748  711.490 1.00 134.44 ? 133  GLU B CD    1 
ATOM   2783  O  OE1   . GLU B 1  133  ? 410.152 14.695  712.151 1.00 133.21 ? 133  GLU B OE1   1 
ATOM   2784  O  OE2   . GLU B 1  133  ? 409.224 15.861  710.535 1.00 136.96 ? 133  GLU B OE2   1 
ATOM   2785  N  N     . GLU B 1  134  ? 408.369 20.015  713.816 1.00 145.62 ? 134  GLU B N     1 
ATOM   2786  C  CA    . GLU B 1  134  ? 407.407 20.437  714.824 1.00 146.38 ? 134  GLU B CA    1 
ATOM   2787  C  C     . GLU B 1  134  ? 407.233 19.339  715.864 1.00 147.12 ? 134  GLU B C     1 
ATOM   2788  O  O     . GLU B 1  134  ? 406.926 18.189  715.535 1.00 144.44 ? 134  GLU B O     1 
ATOM   2789  C  CB    . GLU B 1  134  ? 406.074 20.808  714.183 1.00 153.92 ? 134  GLU B CB    1 
ATOM   2790  C  CG    . GLU B 1  134  ? 405.750 22.296  714.311 1.00 157.71 ? 134  GLU B CG    1 
ATOM   2791  C  CD    . GLU B 1  134  ? 405.315 22.680  715.732 1.00 153.76 ? 134  GLU B CD    1 
ATOM   2792  O  OE1   . GLU B 1  134  ? 405.098 23.883  715.993 1.00 155.67 ? 134  GLU B OE1   1 
ATOM   2793  O  OE2   . GLU B 1  134  ? 405.144 21.773  716.577 1.00 151.66 ? 134  GLU B OE2   1 
ATOM   2794  N  N     . GLY B 1  135  ? 407.403 19.710  717.127 1.00 148.94 ? 135  GLY B N     1 
ATOM   2795  C  CA    . GLY B 1  135  ? 407.256 18.788  718.230 1.00 147.39 ? 135  GLY B CA    1 
ATOM   2796  C  C     . GLY B 1  135  ? 408.444 17.877  718.415 1.00 143.68 ? 135  GLY B C     1 
ATOM   2797  O  O     . GLY B 1  135  ? 408.379 16.939  719.215 1.00 140.17 ? 135  GLY B O     1 
ATOM   2798  N  N     . GLY B 1  136  ? 409.514 18.098  717.657 1.00 144.69 ? 136  GLY B N     1 
ATOM   2799  C  CA    . GLY B 1  136  ? 410.744 17.373  717.881 1.00 145.90 ? 136  GLY B CA    1 
ATOM   2800  C  C     . GLY B 1  136  ? 411.539 18.083  718.962 1.00 144.11 ? 136  GLY B C     1 
ATOM   2801  O  O     . GLY B 1  136  ? 411.556 19.315  719.042 1.00 138.48 ? 136  GLY B O     1 
ATOM   2802  N  N     . ARG B 1  137  ? 412.199 17.296  719.808 1.00 142.07 ? 137  ARG B N     1 
ATOM   2803  C  CA    . ARG B 1  137  ? 412.869 17.886  720.957 1.00 141.37 ? 137  ARG B CA    1 
ATOM   2804  C  C     . ARG B 1  137  ? 414.259 17.300  721.135 1.00 135.93 ? 137  ARG B C     1 
ATOM   2805  O  O     . ARG B 1  137  ? 414.431 16.075  721.176 1.00 125.19 ? 137  ARG B O     1 
ATOM   2806  C  CB    . ARG B 1  137  ? 412.034 17.733  722.233 1.00 150.20 ? 137  ARG B CB    1 
ATOM   2807  C  CG    . ARG B 1  137  ? 410.539 17.804  721.970 1.00 152.17 ? 137  ARG B CG    1 
ATOM   2808  C  CD    . ARG B 1  137  ? 409.746 17.288  723.114 1.00 155.33 ? 137  ARG B CD    1 
ATOM   2809  N  NE    . ARG B 1  137  ? 410.106 18.105  724.260 1.00 165.29 ? 137  ARG B NE    1 
ATOM   2810  C  CZ    . ARG B 1  137  ? 409.473 19.230  724.569 1.00 167.58 ? 137  ARG B CZ    1 
ATOM   2811  N  NH1   . ARG B 1  137  ? 408.467 19.639  723.806 1.00 164.99 ? 137  ARG B NH1   1 
ATOM   2812  N  NH2   . ARG B 1  137  ? 409.848 19.947  725.621 1.00 167.36 ? 137  ARG B NH2   1 
ATOM   2813  N  N     . LEU B 1  138  ? 415.240 18.202  721.227 1.00 133.99 ? 138  LEU B N     1 
ATOM   2814  C  CA    . LEU B 1  138  ? 416.653 17.877  721.383 1.00 129.81 ? 138  LEU B CA    1 
ATOM   2815  C  C     . LEU B 1  138  ? 417.205 18.488  722.668 1.00 133.03 ? 138  LEU B C     1 
ATOM   2816  O  O     . LEU B 1  138  ? 417.307 19.715  722.797 1.00 135.29 ? 138  LEU B O     1 
ATOM   2817  C  CB    . LEU B 1  138  ? 417.457 18.390  720.198 1.00 127.14 ? 138  LEU B CB    1 
ATOM   2818  C  CG    . LEU B 1  138  ? 418.862 17.804  720.165 1.00 127.06 ? 138  LEU B CG    1 
ATOM   2819  C  CD1   . LEU B 1  138  ? 418.812 16.296  719.945 1.00 121.48 ? 138  LEU B CD1   1 
ATOM   2820  C  CD2   . LEU B 1  138  ? 419.728 18.526  719.146 1.00 128.77 ? 138  LEU B CD2   1 
ATOM   2821  N  N     . ASN B 1  139  ? 417.560 17.632  723.614 1.00 130.14 ? 139  ASN B N     1 
ATOM   2822  C  CA    . ASN B 1  139  ? 418.185 18.032  724.867 1.00 129.34 ? 139  ASN B CA    1 
ATOM   2823  C  C     . ASN B 1  139  ? 419.430 17.168  725.027 1.00 128.11 ? 139  ASN B C     1 
ATOM   2824  O  O     . ASN B 1  139  ? 419.308 15.945  725.178 1.00 122.90 ? 139  ASN B O     1 
ATOM   2825  C  CB    . ASN B 1  139  ? 417.229 17.871  726.047 1.00 133.25 ? 139  ASN B CB    1 
ATOM   2826  C  CG    . ASN B 1  139  ? 417.746 18.542  727.306 1.00 137.51 ? 139  ASN B CG    1 
ATOM   2827  O  OD1   . ASN B 1  139  ? 418.808 19.164  727.284 1.00 132.02 ? 139  ASN B OD1   1 
ATOM   2828  N  ND2   . ASN B 1  139  ? 417.014 18.396  728.420 1.00 140.43 ? 139  ASN B ND2   1 
ATOM   2829  N  N     . MET B 1  140  ? 420.626 17.774  724.976 1.00 121.77 ? 140  MET B N     1 
ATOM   2830  C  CA    . MET B 1  140  ? 421.818 16.936  725.040 1.00 114.71 ? 140  MET B CA    1 
ATOM   2831  C  C     . MET B 1  140  ? 423.007 17.637  725.693 1.00 110.92 ? 140  MET B C     1 
ATOM   2832  O  O     . MET B 1  140  ? 423.173 18.863  725.620 1.00 102.72 ? 140  MET B O     1 
ATOM   2833  C  CB    . MET B 1  140  ? 422.218 16.461  723.642 1.00 118.48 ? 140  MET B CB    1 
ATOM   2834  C  CG    . MET B 1  140  ? 422.720 17.585  722.732 1.00 127.66 ? 140  MET B CG    1 
ATOM   2835  S  SD    . MET B 1  140  ? 423.664 17.025  721.296 1.00 114.47 ? 140  MET B SD    1 
ATOM   2836  C  CE    . MET B 1  140  ? 422.359 16.095  720.499 1.00 109.04 ? 140  MET B CE    1 
ATOM   2837  N  N     . GLU B 1  141  ? 423.858 16.798  726.292 1.00 109.72 ? 141  GLU B N     1 
ATOM   2838  C  CA    . GLU B 1  141  ? 425.116 17.177  726.924 1.00 109.39 ? 141  GLU B CA    1 
ATOM   2839  C  C     . GLU B 1  141  ? 426.236 16.460  726.188 1.00 109.96 ? 141  GLU B C     1 
ATOM   2840  O  O     . GLU B 1  141  ? 426.190 15.230  726.064 1.00 109.96 ? 141  GLU B O     1 
ATOM   2841  C  CB    . GLU B 1  141  ? 425.053 16.710  728.386 1.00 115.00 ? 141  GLU B CB    1 
ATOM   2842  C  CG    . GLU B 1  141  ? 423.916 17.405  729.187 1.00 121.64 ? 141  GLU B CG    1 
ATOM   2843  C  CD    . GLU B 1  141  ? 423.797 16.991  730.659 1.00 123.41 ? 141  GLU B CD    1 
ATOM   2844  O  OE1   . GLU B 1  141  ? 424.504 16.052  731.106 1.00 121.68 ? 141  GLU B OE1   1 
ATOM   2845  O  OE2   . GLU B 1  141  ? 422.937 17.586  731.352 1.00 122.48 ? 141  GLU B OE2   1 
ATOM   2846  N  N     . VAL B 1  142  ? 427.248 17.208  725.727 1.00 106.23 ? 142  VAL B N     1 
ATOM   2847  C  CA    . VAL B 1  142  ? 428.436 16.662  725.063 1.00 101.11 ? 142  VAL B CA    1 
ATOM   2848  C  C     . VAL B 1  142  ? 429.699 16.959  725.874 1.00 100.09 ? 142  VAL B C     1 
ATOM   2849  O  O     . VAL B 1  142  ? 429.884 18.078  726.366 1.00 100.87 ? 142  VAL B O     1 
ATOM   2850  C  CB    . VAL B 1  142  ? 428.545 17.180  723.606 1.00 105.58 ? 142  VAL B CB    1 
ATOM   2851  C  CG1   . VAL B 1  142  ? 427.168 17.179  722.915 1.00 99.23  ? 142  VAL B CG1   1 
ATOM   2852  C  CG2   . VAL B 1  142  ? 429.163 18.577  723.531 1.00 107.78 ? 142  VAL B CG2   1 
ATOM   2853  N  N     . ARG B 1  143  ? 430.569 15.958  726.024 1.00 96.69  ? 143  ARG B N     1 
ATOM   2854  C  CA    . ARG B 1  143  ? 431.806 16.089  726.799 1.00 97.30  ? 143  ARG B CA    1 
ATOM   2855  C  C     . ARG B 1  143  ? 433.018 16.303  725.877 1.00 106.98 ? 143  ARG B C     1 
ATOM   2856  O  O     . ARG B 1  143  ? 433.284 15.475  724.995 1.00 105.22 ? 143  ARG B O     1 
ATOM   2857  C  CB    . ARG B 1  143  ? 432.036 14.868  727.684 1.00 96.50  ? 143  ARG B CB    1 
ATOM   2858  C  CG    . ARG B 1  143  ? 433.444 14.845  728.227 1.00 100.02 ? 143  ARG B CG    1 
ATOM   2859  C  CD    . ARG B 1  143  ? 433.639 13.948  729.419 1.00 97.79  ? 143  ARG B CD    1 
ATOM   2860  N  NE    . ARG B 1  143  ? 435.035 14.028  729.812 1.00 97.38  ? 143  ARG B NE    1 
ATOM   2861  C  CZ    . ARG B 1  143  ? 435.579 13.335  730.801 1.00 106.58 ? 143  ARG B CZ    1 
ATOM   2862  N  NH1   . ARG B 1  143  ? 434.827 12.487  731.507 1.00 109.99 ? 143  ARG B NH1   1 
ATOM   2863  N  NH2   . ARG B 1  143  ? 436.878 13.483  731.069 1.00 102.91 ? 143  ARG B NH2   1 
ATOM   2864  N  N     . VAL B 1  144  ? 433.743 17.413  726.072 1.00 104.63 ? 144  VAL B N     1 
ATOM   2865  C  CA    . VAL B 1  144  ? 434.876 17.819  725.226 1.00 99.35  ? 144  VAL B CA    1 
ATOM   2866  C  C     . VAL B 1  144  ? 436.167 17.853  726.042 1.00 102.65 ? 144  VAL B C     1 
ATOM   2867  O  O     . VAL B 1  144  ? 436.298 18.648  726.976 1.00 104.42 ? 144  VAL B O     1 
ATOM   2868  C  CB    . VAL B 1  144  ? 434.628 19.180  724.556 1.00 97.71  ? 144  VAL B CB    1 
ATOM   2869  C  CG1   . VAL B 1  144  ? 435.888 19.708  723.915 1.00 94.87  ? 144  VAL B CG1   1 
ATOM   2870  C  CG2   . VAL B 1  144  ? 433.556 19.033  723.496 1.00 98.05  ? 144  VAL B CG2   1 
ATOM   2871  N  N     . ASP B 1  145  ? 437.126 17.005  725.674 1.00 107.85 ? 145  ASP B N     1 
ATOM   2872  C  CA    . ASP B 1  145  ? 438.391 16.849  726.385 1.00 108.10 ? 145  ASP B CA    1 
ATOM   2873  C  C     . ASP B 1  145  ? 439.582 17.359  725.577 1.00 104.73 ? 145  ASP B C     1 
ATOM   2874  O  O     . ASP B 1  145  ? 439.545 17.467  724.348 1.00 98.14  ? 145  ASP B O     1 
ATOM   2875  C  CB    . ASP B 1  145  ? 438.657 15.389  726.719 1.00 105.08 ? 145  ASP B CB    1 
ATOM   2876  C  CG    . ASP B 1  145  ? 437.798 14.904  727.804 1.00 105.42 ? 145  ASP B CG    1 
ATOM   2877  O  OD1   . ASP B 1  145  ? 436.719 14.404  727.445 1.00 105.00 ? 145  ASP B OD1   1 
ATOM   2878  O  OD2   . ASP B 1  145  ? 438.177 15.034  728.991 1.00 112.17 ? 145  ASP B OD2   1 
ATOM   2879  N  N     . ARG B 1  146  ? 440.633 17.717  726.307 1.00 105.17 ? 146  ARG B N     1 
ATOM   2880  C  CA    . ARG B 1  146  ? 441.915 18.048  725.714 1.00 100.63 ? 146  ARG B CA    1 
ATOM   2881  C  C     . ARG B 1  146  ? 442.721 16.769  725.509 1.00 102.02 ? 146  ARG B C     1 
ATOM   2882  O  O     . ARG B 1  146  ? 442.790 15.925  726.405 1.00 100.05 ? 146  ARG B O     1 
ATOM   2883  C  CB    . ARG B 1  146  ? 442.661 19.034  726.614 1.00 103.12 ? 146  ARG B CB    1 
ATOM   2884  C  CG    . ARG B 1  146  ? 444.133 19.135  726.334 1.00 111.16 ? 146  ARG B CG    1 
ATOM   2885  C  CD    . ARG B 1  146  ? 444.798 20.210  727.169 1.00 112.81 ? 146  ARG B CD    1 
ATOM   2886  N  NE    . ARG B 1  146  ? 444.239 21.511  726.787 1.00 117.13 ? 146  ARG B NE    1 
ATOM   2887  C  CZ    . ARG B 1  146  ? 444.472 22.657  727.422 1.00 123.64 ? 146  ARG B CZ    1 
ATOM   2888  N  NH1   . ARG B 1  146  ? 445.270 22.673  728.487 1.00 130.47 ? 146  ARG B NH1   1 
ATOM   2889  N  NH2   . ARG B 1  146  ? 443.896 23.783  726.999 1.00 118.23 ? 146  ARG B NH2   1 
ATOM   2890  N  N     . GLY B 1  147  ? 443.327 16.630  724.333 1.00 104.67 ? 147  GLY B N     1 
ATOM   2891  C  CA    . GLY B 1  147  ? 444.127 15.451  724.057 1.00 102.15 ? 147  GLY B CA    1 
ATOM   2892  C  C     . GLY B 1  147  ? 444.933 15.544  722.768 1.00 102.06 ? 147  GLY B C     1 
ATOM   2893  O  O     . GLY B 1  147  ? 444.955 16.570  722.076 1.00 96.22  ? 147  GLY B O     1 
ATOM   2894  N  N     . VAL B 1  148  ? 445.565 14.419  722.431 1.00 100.49 ? 148  VAL B N     1 
ATOM   2895  C  CA    . VAL B 1  148  ? 446.368 14.290  721.225 1.00 95.09  ? 148  VAL B CA    1 
ATOM   2896  C  C     . VAL B 1  148  ? 446.025 13.006  720.486 1.00 97.71  ? 148  VAL B C     1 
ATOM   2897  O  O     . VAL B 1  148  ? 445.641 12.000  721.090 1.00 98.53  ? 148  VAL B O     1 
ATOM   2898  C  CB    . VAL B 1  148  ? 447.885 14.323  721.553 1.00 87.75  ? 148  VAL B CB    1 
ATOM   2899  C  CG1   . VAL B 1  148  ? 448.285 15.618  722.235 1.00 87.45  ? 148  VAL B CG1   1 
ATOM   2900  C  CG2   . VAL B 1  148  ? 448.283 13.121  722.396 1.00 75.43  ? 148  VAL B CG2   1 
ATOM   2901  N  N     . GLY B 1  149  ? 446.215 13.040  719.167 1.00 95.42  ? 149  GLY B N     1 
ATOM   2902  C  CA    . GLY B 1  149  ? 446.092 11.858  718.343 1.00 90.18  ? 149  GLY B CA    1 
ATOM   2903  C  C     . GLY B 1  149  ? 444.682 11.430  718.031 1.00 84.71  ? 149  GLY B C     1 
ATOM   2904  O  O     . GLY B 1  149  ? 443.814 12.267  717.783 1.00 89.54  ? 149  GLY B O     1 
ATOM   2905  N  N     . TYR B 1  150  ? 444.455 10.128  717.958 1.00 79.12  ? 150  TYR B N     1 
ATOM   2906  C  CA    . TYR B 1  150  ? 443.132 9.617   717.632 1.00 82.32  ? 150  TYR B CA    1 
ATOM   2907  C  C     . TYR B 1  150  ? 442.867 8.399   718.498 1.00 87.84  ? 150  TYR B C     1 
ATOM   2908  O  O     . TYR B 1  150  ? 443.688 7.474   718.553 1.00 83.73  ? 150  TYR B O     1 
ATOM   2909  C  CB    . TYR B 1  150  ? 442.986 9.332   716.142 1.00 81.60  ? 150  TYR B CB    1 
ATOM   2910  C  CG    . TYR B 1  150  ? 441.648 8.809   715.674 1.00 74.18  ? 150  TYR B CG    1 
ATOM   2911  C  CD1   . TYR B 1  150  ? 441.354 7.451   715.704 1.00 72.27  ? 150  TYR B CD1   1 
ATOM   2912  C  CD2   . TYR B 1  150  ? 440.693 9.673   715.186 1.00 74.09  ? 150  TYR B CD2   1 
ATOM   2913  C  CE1   . TYR B 1  150  ? 440.163 6.978   715.248 1.00 67.32  ? 150  TYR B CE1   1 
ATOM   2914  C  CE2   . TYR B 1  150  ? 439.490 9.207   714.733 1.00 71.54  ? 150  TYR B CE2   1 
ATOM   2915  C  CZ    . TYR B 1  150  ? 439.237 7.864   714.770 1.00 66.76  ? 150  TYR B CZ    1 
ATOM   2916  O  OH    . TYR B 1  150  ? 438.032 7.428   714.315 1.00 68.39  ? 150  TYR B OH    1 
ATOM   2917  N  N     . VAL B 1  151  ? 441.803 8.486   719.288 1.00 89.95  ? 151  VAL B N     1 
ATOM   2918  C  CA    . VAL B 1  151  ? 441.359 7.384   720.123 1.00 88.85  ? 151  VAL B CA    1 
ATOM   2919  C  C     . VAL B 1  151  ? 439.953 6.948   719.718 1.00 89.19  ? 151  VAL B C     1 
ATOM   2920  O  O     . VAL B 1  151  ? 439.000 7.747   719.796 1.00 86.71  ? 151  VAL B O     1 
ATOM   2921  C  CB    . VAL B 1  151  ? 441.447 7.782   721.600 1.00 91.66  ? 151  VAL B CB    1 
ATOM   2922  C  CG1   . VAL B 1  151  ? 441.137 6.568   722.506 1.00 91.15  ? 151  VAL B CG1   1 
ATOM   2923  C  CG2   . VAL B 1  151  ? 442.834 8.436   721.900 1.00 80.78  ? 151  VAL B CG2   1 
ATOM   2924  N  N     . PRO B 1  152  ? 439.797 5.722   719.208 1.00 90.16  ? 152  PRO B N     1 
ATOM   2925  C  CA    . PRO B 1  152  ? 438.455 5.232   718.862 1.00 91.64  ? 152  PRO B CA    1 
ATOM   2926  C  C     . PRO B 1  152  ? 437.576 5.218   720.103 1.00 94.36  ? 152  PRO B C     1 
ATOM   2927  O  O     . PRO B 1  152  ? 438.082 5.136   721.223 1.00 97.95  ? 152  PRO B O     1 
ATOM   2928  C  CB    . PRO B 1  152  ? 438.722 3.814   718.332 1.00 97.69  ? 152  PRO B CB    1 
ATOM   2929  C  CG    . PRO B 1  152  ? 440.149 3.464   718.783 1.00 89.76  ? 152  PRO B CG    1 
ATOM   2930  C  CD    . PRO B 1  152  ? 440.867 4.766   718.855 1.00 86.42  ? 152  PRO B CD    1 
ATOM   2931  N  N     . ALA B 1  153  ? 436.251 5.336   719.911 1.00 97.17  ? 153  ALA B N     1 
ATOM   2932  C  CA    . ALA B 1  153  ? 435.322 5.372   721.060 1.00 99.18  ? 153  ALA B CA    1 
ATOM   2933  C  C     . ALA B 1  153  ? 435.389 4.095   721.891 1.00 98.56  ? 153  ALA B C     1 
ATOM   2934  O  O     . ALA B 1  153  ? 435.556 4.139   723.114 1.00 97.81  ? 153  ALA B O     1 
ATOM   2935  C  CB    . ALA B 1  153  ? 433.881 5.579   720.601 1.00 99.30  ? 153  ALA B CB    1 
ATOM   2936  N  N     . GLU B 1  154  ? 435.339 2.946   721.225 1.00 101.88 ? 154  GLU B N     1 
ATOM   2937  C  CA    . GLU B 1  154  ? 435.322 1.640   721.861 1.00 101.48 ? 154  GLU B CA    1 
ATOM   2938  C  C     . GLU B 1  154  ? 436.606 1.368   722.667 1.00 102.42 ? 154  GLU B C     1 
ATOM   2939  O  O     . GLU B 1  154  ? 436.824 0.239   723.112 1.00 107.22 ? 154  GLU B O     1 
ATOM   2940  C  CB    . GLU B 1  154  ? 435.114 0.536   720.778 1.00 100.10 ? 154  GLU B CB    1 
ATOM   2941  C  CG    . GLU B 1  154  ? 433.814 0.594   719.836 1.00 99.07  ? 154  GLU B CG    1 
ATOM   2942  C  CD    . GLU B 1  154  ? 433.864 1.510   718.555 1.00 108.27 ? 154  GLU B CD    1 
ATOM   2943  O  OE1   . GLU B 1  154  ? 434.917 2.135   718.243 1.00 105.74 ? 154  GLU B OE1   1 
ATOM   2944  O  OE2   . GLU B 1  154  ? 432.819 1.593   717.841 1.00 101.59 ? 154  GLU B OE2   1 
ATOM   2945  N  N     . LYS B 1  155  ? 437.466 2.387   722.888 1.00 96.41  ? 155  LYS B N     1 
ATOM   2946  C  CA    . LYS B 1  155  ? 438.752 2.219   723.585 1.00 100.41 ? 155  LYS B CA    1 
ATOM   2947  C  C     . LYS B 1  155  ? 438.998 3.208   724.717 1.00 104.17 ? 155  LYS B C     1 
ATOM   2948  O  O     . LYS B 1  155  ? 439.630 2.835   725.709 1.00 112.19 ? 155  LYS B O     1 
ATOM   2949  C  CB    . LYS B 1  155  ? 439.979 2.174   722.609 1.00 102.01 ? 155  LYS B CB    1 
ATOM   2950  C  CG    . LYS B 1  155  ? 440.077 0.782   721.934 1.00 104.91 ? 155  LYS B CG    1 
ATOM   2951  C  CD    . LYS B 1  155  ? 441.164 0.574   720.884 1.00 110.84 ? 155  LYS B CD    1 
ATOM   2952  C  CE    . LYS B 1  155  ? 440.540 0.020   719.578 1.00 114.17 ? 155  LYS B CE    1 
ATOM   2953  N  NZ    . LYS B 1  155  ? 440.054 -1.405  719.681 1.00 107.11 ? 155  LYS B NZ    1 
ATOM   2954  N  N     . HIS B 1  156  ? 438.559 4.460   724.605 1.00 101.09 ? 156  HIS B N     1 
ATOM   2955  C  CA    . HIS B 1  156  ? 438.778 5.314   725.773 1.00 102.03 ? 156  HIS B CA    1 
ATOM   2956  C  C     . HIS B 1  156  ? 437.732 4.999   726.837 1.00 108.01 ? 156  HIS B C     1 
ATOM   2957  O  O     . HIS B 1  156  ? 438.029 5.077   728.038 1.00 101.31 ? 156  HIS B O     1 
ATOM   2958  C  CB    . HIS B 1  156  ? 438.769 6.806   725.428 1.00 96.21  ? 156  HIS B CB    1 
ATOM   2959  C  CG    . HIS B 1  156  ? 437.482 7.305   724.851 1.00 97.36  ? 156  HIS B CG    1 
ATOM   2960  N  ND1   . HIS B 1  156  ? 436.338 7.449   725.599 1.00 104.31 ? 156  HIS B ND1   1 
ATOM   2961  C  CD2   . HIS B 1  156  ? 437.179 7.787   723.625 1.00 102.08 ? 156  HIS B CD2   1 
ATOM   2962  C  CE1   . HIS B 1  156  ? 435.369 7.939   724.848 1.00 99.64  ? 156  HIS B CE1   1 
ATOM   2963  N  NE2   . HIS B 1  156  ? 435.855 8.161   723.647 1.00 101.30 ? 156  HIS B NE2   1 
ATOM   2964  N  N     . GLY B 1  157  ? 436.505 4.668   726.405 1.00 112.38 ? 157  GLY B N     1 
ATOM   2965  C  CA    . GLY B 1  157  ? 435.395 4.277   727.262 1.00 117.28 ? 157  GLY B CA    1 
ATOM   2966  C  C     . GLY B 1  157  ? 434.984 5.228   728.361 1.00 115.59 ? 157  GLY B C     1 
ATOM   2967  O  O     . GLY B 1  157  ? 434.938 4.857   729.540 1.00 120.80 ? 157  GLY B O     1 
ATOM   2968  N  N     . ILE B 1  158  ? 434.681 6.460   727.977 1.00 102.73 ? 158  ILE B N     1 
ATOM   2969  C  CA    . ILE B 1  158  ? 434.260 7.475   728.916 1.00 100.65 ? 158  ILE B CA    1 
ATOM   2970  C  C     . ILE B 1  158  ? 432.746 7.522   728.938 1.00 107.07 ? 158  ILE B C     1 
ATOM   2971  O  O     . ILE B 1  158  ? 432.098 7.672   727.895 1.00 100.64 ? 158  ILE B O     1 
ATOM   2972  C  CB    . ILE B 1  158  ? 434.846 8.845   728.529 1.00 92.30  ? 158  ILE B CB    1 
ATOM   2973  C  CG1   . ILE B 1  158  ? 436.359 8.867   728.730 1.00 95.40  ? 158  ILE B CG1   1 
ATOM   2974  C  CG2   . ILE B 1  158  ? 434.107 10.003  729.173 1.00 100.64 ? 158  ILE B CG2   1 
ATOM   2975  C  CD1   . ILE B 1  158  ? 436.942 10.251  728.603 1.00 98.33  ? 158  ILE B CD1   1 
ATOM   2976  N  N     . LYS B 1  159  ? 432.198 7.396   730.150 1.00 117.70 ? 159  LYS B N     1 
ATOM   2977  C  CA    . LYS B 1  159  ? 430.785 7.555   730.467 1.00 110.81 ? 159  LYS B CA    1 
ATOM   2978  C  C     . LYS B 1  159  ? 430.686 8.404   731.728 1.00 119.00 ? 159  LYS B C     1 
ATOM   2979  O  O     . LYS B 1  159  ? 431.239 8.023   732.770 1.00 120.35 ? 159  LYS B O     1 
ATOM   2980  C  CB    . LYS B 1  159  ? 430.071 6.212   730.643 1.00 104.97 ? 159  LYS B CB    1 
ATOM   2981  C  CG    . LYS B 1  159  ? 429.423 5.623   729.387 1.00 104.40 ? 159  LYS B CG    1 
ATOM   2982  C  CD    . LYS B 1  159  ? 428.797 4.284   729.756 1.00 112.59 ? 159  LYS B CD    1 
ATOM   2983  C  CE    . LYS B 1  159  ? 427.250 4.396   729.869 1.00 123.21 ? 159  LYS B CE    1 
ATOM   2984  N  NZ    . LYS B 1  159  ? 426.431 3.141   730.156 1.00 116.26 ? 159  LYS B NZ    1 
ATOM   2985  N  N     . ASP B 1  160  ? 430.069 9.588   731.609 1.00 121.22 ? 160  ASP B N     1 
ATOM   2986  C  CA    . ASP B 1  160  ? 429.719 10.385  732.786 1.00 120.73 ? 160  ASP B CA    1 
ATOM   2987  C  C     . ASP B 1  160  ? 428.528 9.798   733.533 1.00 112.09 ? 160  ASP B C     1 
ATOM   2988  O  O     . ASP B 1  160  ? 428.443 9.918   734.755 1.00 116.49 ? 160  ASP B O     1 
ATOM   2989  C  CB    . ASP B 1  160  ? 429.370 11.825  732.391 1.00 122.08 ? 160  ASP B CB    1 
ATOM   2990  C  CG    . ASP B 1  160  ? 430.578 12.703  732.202 1.00 125.83 ? 160  ASP B CG    1 
ATOM   2991  O  OD1   . ASP B 1  160  ? 431.668 12.324  732.702 1.00 127.07 ? 160  ASP B OD1   1 
ATOM   2992  O  OD2   . ASP B 1  160  ? 430.411 13.786  731.573 1.00 118.43 ? 160  ASP B OD2   1 
ATOM   2993  N  N     . ARG B 1  161  ? 427.595 9.187   732.813 1.00 107.83 ? 161  ARG B N     1 
ATOM   2994  C  CA    . ARG B 1  161  ? 426.389 8.629   733.385 1.00 109.56 ? 161  ARG B CA    1 
ATOM   2995  C  C     . ARG B 1  161  ? 425.961 7.448   732.532 1.00 110.09 ? 161  ARG B C     1 
ATOM   2996  O  O     . ARG B 1  161  ? 426.613 7.107   731.552 1.00 115.91 ? 161  ARG B O     1 
ATOM   2997  C  CB    . ARG B 1  161  ? 425.287 9.664   733.366 1.00 112.24 ? 161  ARG B CB    1 
ATOM   2998  C  CG    . ARG B 1  161  ? 424.848 9.896   731.973 1.00 106.90 ? 161  ARG B CG    1 
ATOM   2999  C  CD    . ARG B 1  161  ? 423.748 10.872  731.918 1.00 109.24 ? 161  ARG B CD    1 
ATOM   3000  N  NE    . ARG B 1  161  ? 424.241 12.183  732.280 1.00 107.86 ? 161  ARG B NE    1 
ATOM   3001  C  CZ    . ARG B 1  161  ? 423.451 13.204  732.546 1.00 110.40 ? 161  ARG B CZ    1 
ATOM   3002  N  NH1   . ARG B 1  161  ? 422.134 13.029  732.497 1.00 109.18 ? 161  ARG B NH1   1 
ATOM   3003  N  NH2   . ARG B 1  161  ? 423.977 14.383  732.845 1.00 110.26 ? 161  ARG B NH2   1 
ATOM   3004  N  N     . ILE B 1  162  ? 424.862 6.802   732.910 1.00 115.85 ? 162  ILE B N     1 
ATOM   3005  C  CA    . ILE B 1  162  ? 424.349 5.743   732.055 1.00 117.63 ? 162  ILE B CA    1 
ATOM   3006  C  C     . ILE B 1  162  ? 423.714 6.386   730.828 1.00 120.62 ? 162  ILE B C     1 
ATOM   3007  O  O     . ILE B 1  162  ? 423.344 7.568   730.840 1.00 122.35 ? 162  ILE B O     1 
ATOM   3008  C  CB    . ILE B 1  162  ? 423.320 4.880   732.805 1.00 120.43 ? 162  ILE B CB    1 
ATOM   3009  C  CG1   . ILE B 1  162  ? 423.854 4.434   734.158 1.00 120.37 ? 162  ILE B CG1   1 
ATOM   3010  C  CG2   . ILE B 1  162  ? 422.928 3.655   731.983 1.00 122.70 ? 162  ILE B CG2   1 
ATOM   3011  C  CD1   . ILE B 1  162  ? 424.557 3.079   734.106 1.00 123.63 ? 162  ILE B CD1   1 
ATOM   3012  N  N     . ASN B 1  163  ? 423.602 5.610   729.748 1.00 115.91 ? 163  ASN B N     1 
ATOM   3013  C  CA    . ASN B 1  163  ? 423.069 6.054   728.459 1.00 118.89 ? 163  ASN B CA    1 
ATOM   3014  C  C     . ASN B 1  163  ? 423.970 7.041   727.711 1.00 118.38 ? 163  ASN B C     1 
ATOM   3015  O  O     . ASN B 1  163  ? 423.564 7.520   726.638 1.00 115.65 ? 163  ASN B O     1 
ATOM   3016  C  CB    . ASN B 1  163  ? 421.677 6.678   728.613 1.00 123.96 ? 163  ASN B CB    1 
ATOM   3017  C  CG    . ASN B 1  163  ? 420.615 5.641   728.907 1.00 126.14 ? 163  ASN B CG    1 
ATOM   3018  O  OD1   . ASN B 1  163  ? 420.366 4.722   728.116 1.00 122.53 ? 163  ASN B OD1   1 
ATOM   3019  N  ND2   . ASN B 1  163  ? 420.020 5.751   730.094 1.00 131.56 ? 163  ASN B ND2   1 
ATOM   3020  N  N     . ALA B 1  164  ? 425.088 7.478   728.303 1.00 119.52 ? 164  ALA B N     1 
ATOM   3021  C  CA    . ALA B 1  164  ? 426.066 8.308   727.599 1.00 114.95 ? 164  ALA B CA    1 
ATOM   3022  C  C     . ALA B 1  164  ? 426.794 7.448   726.564 1.00 113.64 ? 164  ALA B C     1 
ATOM   3023  O  O     . ALA B 1  164  ? 427.195 6.317   726.870 1.00 112.36 ? 164  ALA B O     1 
ATOM   3024  C  CB    . ALA B 1  164  ? 427.071 8.934   728.579 1.00 106.41 ? 164  ALA B CB    1 
ATOM   3025  N  N     . ILE B 1  165  ? 426.904 7.950   725.335 1.00 109.00 ? 165  ILE B N     1 
ATOM   3026  C  CA    . ILE B 1  165  ? 427.535 7.234   724.224 1.00 106.92 ? 165  ILE B CA    1 
ATOM   3027  C  C     . ILE B 1  165  ? 428.982 7.695   724.072 1.00 106.70 ? 165  ILE B C     1 
ATOM   3028  O  O     . ILE B 1  165  ? 429.227 8.916   724.019 1.00 103.78 ? 165  ILE B O     1 
ATOM   3029  C  CB    . ILE B 1  165  ? 426.802 7.408   722.885 1.00 102.76 ? 165  ILE B CB    1 
ATOM   3030  C  CG1   . ILE B 1  165  ? 425.303 7.225   722.991 1.00 105.44 ? 165  ILE B CG1   1 
ATOM   3031  C  CG2   . ILE B 1  165  ? 427.298 6.352   721.927 1.00 106.15 ? 165  ILE B CG2   1 
ATOM   3032  C  CD1   . ILE B 1  165  ? 424.594 7.416   721.657 1.00 102.33 ? 165  ILE B CD1   1 
ATOM   3033  N  N     . PRO B 1  166  ? 429.964 6.788   724.107 1.00 105.01 ? 166  PRO B N     1 
ATOM   3034  C  CA    . PRO B 1  166  ? 431.348 7.194   723.834 1.00 101.46 ? 166  PRO B CA    1 
ATOM   3035  C  C     . PRO B 1  166  ? 431.492 7.472   722.334 1.00 102.33 ? 166  PRO B C     1 
ATOM   3036  O  O     . PRO B 1  166  ? 430.901 6.779   721.496 1.00 95.00  ? 166  PRO B O     1 
ATOM   3037  C  CB    . PRO B 1  166  ? 432.175 5.979   724.268 1.00 98.13  ? 166  PRO B CB    1 
ATOM   3038  C  CG    . PRO B 1  166  ? 431.239 4.822   724.084 1.00 94.95  ? 166  PRO B CG    1 
ATOM   3039  C  CD    . PRO B 1  166  ? 429.855 5.339   724.362 1.00 100.41 ? 166  PRO B CD    1 
ATOM   3040  N  N     . VAL B 1  167  ? 432.245 8.523   722.001 1.00 102.39 ? 167  VAL B N     1 
ATOM   3041  C  CA    . VAL B 1  167  ? 432.408 9.003   720.629 1.00 99.54  ? 167  VAL B CA    1 
ATOM   3042  C  C     . VAL B 1  167  ? 433.873 8.818   720.248 1.00 100.75 ? 167  VAL B C     1 
ATOM   3043  O  O     . VAL B 1  167  ? 434.750 9.007   721.098 1.00 98.37  ? 167  VAL B O     1 
ATOM   3044  C  CB    . VAL B 1  167  ? 431.989 10.483  720.483 1.00 96.77  ? 167  VAL B CB    1 
ATOM   3045  C  CG1   . VAL B 1  167  ? 432.290 10.989  719.084 1.00 98.50  ? 167  VAL B CG1   1 
ATOM   3046  C  CG2   . VAL B 1  167  ? 430.521 10.644  720.771 1.00 99.87  ? 167  VAL B CG2   1 
ATOM   3047  N  N     . ASP B 1  168  ? 434.140 8.403   718.988 1.00 96.37  ? 168  ASP B N     1 
ATOM   3048  C  CA    . ASP B 1  168  ? 435.515 8.305   718.480 1.00 87.46  ? 168  ASP B CA    1 
ATOM   3049  C  C     . ASP B 1  168  ? 436.202 9.671   718.635 1.00 83.41  ? 168  ASP B C     1 
ATOM   3050  O  O     . ASP B 1  168  ? 435.672 10.696  718.211 1.00 87.11  ? 168  ASP B O     1 
ATOM   3051  C  CB    . ASP B 1  168  ? 435.497 7.820   717.026 1.00 87.20  ? 168  ASP B CB    1 
ATOM   3052  C  CG    . ASP B 1  168  ? 434.832 6.427   716.846 1.00 89.49  ? 168  ASP B CG    1 
ATOM   3053  O  OD1   . ASP B 1  168  ? 435.167 5.483   717.593 1.00 86.97  ? 168  ASP B OD1   1 
ATOM   3054  O  OD2   . ASP B 1  168  ? 434.017 6.249   715.912 1.00 86.70  ? 168  ASP B OD2   1 
ATOM   3055  N  N     . ALA B 1  169  ? 437.342 9.720   719.304 1.00 76.35  ? 169  ALA B N     1 
ATOM   3056  C  CA    . ALA B 1  169  ? 437.911 11.006  719.713 1.00 81.28  ? 169  ALA B CA    1 
ATOM   3057  C  C     . ALA B 1  169  ? 438.939 11.501  718.721 1.00 89.01  ? 169  ALA B C     1 
ATOM   3058  O  O     . ALA B 1  169  ? 440.078 11.028  718.728 1.00 93.49  ? 169  ALA B O     1 
ATOM   3059  C  CB    . ALA B 1  169  ? 438.561 10.882  721.088 1.00 92.29  ? 169  ALA B CB    1 
ATOM   3060  N  N     . VAL B 1  170  ? 438.598 12.553  717.980 1.00 90.00  ? 170  VAL B N     1 
ATOM   3061  C  CA    . VAL B 1  170  ? 439.516 13.130  716.994 1.00 84.28  ? 170  VAL B CA    1 
ATOM   3062  C  C     . VAL B 1  170  ? 440.168 14.362  717.616 1.00 82.05  ? 170  VAL B C     1 
ATOM   3063  O  O     . VAL B 1  170  ? 439.748 15.503  717.385 1.00 80.47  ? 170  VAL B O     1 
ATOM   3064  C  CB    . VAL B 1  170  ? 438.774 13.475  715.703 1.00 86.81  ? 170  VAL B CB    1 
ATOM   3065  C  CG1   . VAL B 1  170  ? 439.738 14.010  714.648 1.00 91.31  ? 170  VAL B CG1   1 
ATOM   3066  C  CG2   . VAL B 1  170  ? 437.928 12.277  715.196 1.00 83.34  ? 170  VAL B CG2   1 
ATOM   3067  N  N     . PHE B 1  171  ? 441.330 14.160  718.233 1.00 78.64  ? 171  PHE B N     1 
ATOM   3068  C  CA    . PHE B 1  171  ? 441.917 15.278  718.959 1.00 90.24  ? 171  PHE B CA    1 
ATOM   3069  C  C     . PHE B 1  171  ? 442.672 16.197  718.027 1.00 94.44  ? 171  PHE B C     1 
ATOM   3070  O  O     . PHE B 1  171  ? 442.471 17.420  718.036 1.00 89.75  ? 171  PHE B O     1 
ATOM   3071  C  CB    . PHE B 1  171  ? 442.894 14.772  720.027 1.00 91.21  ? 171  PHE B CB    1 
ATOM   3072  C  CG    . PHE B 1  171  ? 442.227 14.148  721.188 1.00 98.68  ? 171  PHE B CG    1 
ATOM   3073  C  CD1   . PHE B 1  171  ? 441.361 14.886  721.984 1.00 99.42  ? 171  PHE B CD1   1 
ATOM   3074  C  CD2   . PHE B 1  171  ? 442.431 12.806  721.477 1.00 100.04 ? 171  PHE B CD2   1 
ATOM   3075  C  CE1   . PHE B 1  171  ? 440.714 14.289  723.054 1.00 101.12 ? 171  PHE B CE1   1 
ATOM   3076  C  CE2   . PHE B 1  171  ? 441.783 12.204  722.542 1.00 97.16  ? 171  PHE B CE2   1 
ATOM   3077  C  CZ    . PHE B 1  171  ? 440.923 12.944  723.330 1.00 97.05  ? 171  PHE B CZ    1 
ATOM   3078  N  N     . SER B 1  172  ? 443.468 15.591  717.154 1.00 99.97  ? 172  SER B N     1 
ATOM   3079  C  CA    . SER B 1  172  ? 444.455 16.284  716.364 1.00 97.47  ? 172  SER B CA    1 
ATOM   3080  C  C     . SER B 1  172  ? 443.845 17.443  715.594 1.00 101.39 ? 172  SER B C     1 
ATOM   3081  O  O     . SER B 1  172  ? 442.882 17.242  714.838 1.00 95.66  ? 172  SER B O     1 
ATOM   3082  C  CB    . SER B 1  172  ? 445.120 15.334  715.395 1.00 97.38  ? 172  SER B CB    1 
ATOM   3083  O  OG    . SER B 1  172  ? 446.242 15.984  714.832 1.00 104.11 ? 172  SER B OG    1 
ATOM   3084  N  N     . PRO B 1  173  ? 444.321 18.667  715.819 1.00 105.02 ? 173  PRO B N     1 
ATOM   3085  C  CA    . PRO B 1  173  ? 443.879 19.787  714.988 1.00 104.02 ? 173  PRO B CA    1 
ATOM   3086  C  C     . PRO B 1  173  ? 444.387 19.638  713.558 1.00 106.32 ? 173  PRO B C     1 
ATOM   3087  O  O     . PRO B 1  173  ? 443.854 20.292  712.655 1.00 110.87 ? 173  PRO B O     1 
ATOM   3088  C  CB    . PRO B 1  173  ? 444.464 21.011  715.705 1.00 105.17 ? 173  PRO B CB    1 
ATOM   3089  C  CG    . PRO B 1  173  ? 445.666 20.476  716.419 1.00 102.63 ? 173  PRO B CG    1 
ATOM   3090  C  CD    . PRO B 1  173  ? 445.316 19.076  716.830 1.00 100.64 ? 173  PRO B CD    1 
ATOM   3091  N  N     . VAL B 1  174  ? 445.428 18.825  713.351 1.00 107.11 ? 174  VAL B N     1 
ATOM   3092  C  CA    . VAL B 1  174  ? 445.995 18.518  712.034 1.00 107.14 ? 174  VAL B CA    1 
ATOM   3093  C  C     . VAL B 1  174  ? 445.123 17.486  711.321 1.00 105.85 ? 174  VAL B C     1 
ATOM   3094  O  O     . VAL B 1  174  ? 444.949 16.367  711.815 1.00 105.22 ? 174  VAL B O     1 
ATOM   3095  C  CB    . VAL B 1  174  ? 447.438 17.997  712.170 1.00 100.89 ? 174  VAL B CB    1 
ATOM   3096  C  CG1   . VAL B 1  174  ? 447.926 17.491  710.871 1.00 100.98 ? 174  VAL B CG1   1 
ATOM   3097  C  CG2   . VAL B 1  174  ? 448.380 19.098  712.630 1.00 97.45  ? 174  VAL B CG2   1 
ATOM   3098  N  N     . ARG B 1  175  ? 444.551 17.875  710.166 1.00 106.46 ? 175  ARG B N     1 
ATOM   3099  C  CA    . ARG B 1  175  ? 443.729 16.964  709.363 1.00 107.20 ? 175  ARG B CA    1 
ATOM   3100  C  C     . ARG B 1  175  ? 444.557 16.082  708.420 1.00 107.37 ? 175  ARG B C     1 
ATOM   3101  O  O     . ARG B 1  175  ? 444.191 14.927  708.153 1.00 104.59 ? 175  ARG B O     1 
ATOM   3102  C  CB    . ARG B 1  175  ? 442.667 17.747  708.584 1.00 106.58 ? 175  ARG B CB    1 
ATOM   3103  C  CG    . ARG B 1  175  ? 441.746 18.516  709.484 1.00 110.04 ? 175  ARG B CG    1 
ATOM   3104  C  CD    . ARG B 1  175  ? 440.403 18.738  708.814 1.00 120.11 ? 175  ARG B CD    1 
ATOM   3105  N  NE    . ARG B 1  175  ? 439.443 19.255  709.793 1.00 141.24 ? 175  ARG B NE    1 
ATOM   3106  C  CZ    . ARG B 1  175  ? 438.155 19.494  709.552 1.00 144.71 ? 175  ARG B CZ    1 
ATOM   3107  N  NH1   . ARG B 1  175  ? 437.652 19.260  708.331 1.00 139.85 ? 175  ARG B NH1   1 
ATOM   3108  N  NH2   . ARG B 1  175  ? 437.368 19.948  710.543 1.00 127.32 ? 175  ARG B NH2   1 
ATOM   3109  N  N     . ARG B 1  176  ? 445.632 16.621  707.855 1.00 105.39 ? 176  ARG B N     1 
ATOM   3110  C  CA    . ARG B 1  176  ? 446.475 15.869  706.942 1.00 101.65 ? 176  ARG B CA    1 
ATOM   3111  C  C     . ARG B 1  176  ? 447.863 16.480  706.905 1.00 100.30 ? 176  ARG B C     1 
ATOM   3112  O  O     . ARG B 1  176  ? 448.044 17.684  707.107 1.00 97.99  ? 176  ARG B O     1 
ATOM   3113  C  CB    . ARG B 1  176  ? 445.894 15.752  705.518 1.00 106.89 ? 176  ARG B CB    1 
ATOM   3114  C  CG    . ARG B 1  176  ? 446.849 14.956  704.525 1.00 114.97 ? 176  ARG B CG    1 
ATOM   3115  C  CD    . ARG B 1  176  ? 446.139 14.148  703.442 1.00 112.37 ? 176  ARG B CD    1 
ATOM   3116  N  NE    . ARG B 1  176  ? 445.606 14.995  702.376 1.00 113.73 ? 176  ARG B NE    1 
ATOM   3117  C  CZ    . ARG B 1  176  ? 446.108 15.115  701.150 1.00 109.97 ? 176  ARG B CZ    1 
ATOM   3118  N  NH1   . ARG B 1  176  ? 447.204 14.443  700.786 1.00 109.96 ? 176  ARG B NH1   1 
ATOM   3119  N  NH2   . ARG B 1  176  ? 445.497 15.925  700.292 1.00 102.49 ? 176  ARG B NH2   1 
ATOM   3120  N  N     . VAL B 1  177  ? 448.833 15.613  706.653 1.00 102.00 ? 177  VAL B N     1 
ATOM   3121  C  CA    . VAL B 1  177  ? 450.195 15.991  706.338 1.00 100.63 ? 177  VAL B CA    1 
ATOM   3122  C  C     . VAL B 1  177  ? 450.591 15.193  705.120 1.00 103.48 ? 177  VAL B C     1 
ATOM   3123  O  O     . VAL B 1  177  ? 450.530 13.958  705.139 1.00 103.98 ? 177  VAL B O     1 
ATOM   3124  C  CB    . VAL B 1  177  ? 451.175 15.675  707.472 1.00 98.35  ? 177  VAL B CB    1 
ATOM   3125  C  CG1   . VAL B 1  177  ? 452.599 15.975  707.018 1.00 90.07  ? 177  VAL B CG1   1 
ATOM   3126  C  CG2   . VAL B 1  177  ? 450.812 16.460  708.717 1.00 97.17  ? 177  VAL B CG2   1 
ATOM   3127  N  N     . ALA B 1  178  ? 450.979 15.904  704.060 1.00 112.52 ? 178  ALA B N     1 
ATOM   3128  C  CA    . ALA B 1  178  ? 451.541 15.328  702.848 1.00 105.75 ? 178  ALA B CA    1 
ATOM   3129  C  C     . ALA B 1  178  ? 452.862 16.036  702.619 1.00 100.41 ? 178  ALA B C     1 
ATOM   3130  O  O     . ALA B 1  178  ? 452.925 17.271  702.664 1.00 97.49  ? 178  ALA B O     1 
ATOM   3131  C  CB    . ALA B 1  178  ? 450.612 15.512  701.642 1.00 101.73 ? 178  ALA B CB    1 
ATOM   3132  N  N     . PHE B 1  179  ? 453.898 15.266  702.325 1.00 102.08 ? 179  PHE B N     1 
ATOM   3133  C  CA    . PHE B 1  179  ? 455.198 15.827  702.010 1.00 101.49 ? 179  PHE B CA    1 
ATOM   3134  C  C     . PHE B 1  179  ? 455.756 15.137  700.775 1.00 106.75 ? 179  PHE B C     1 
ATOM   3135  O  O     . PHE B 1  179  ? 455.512 13.946  700.547 1.00 102.56 ? 179  PHE B O     1 
ATOM   3136  C  CB    . PHE B 1  179  ? 456.117 15.764  703.231 1.00 97.28  ? 179  PHE B CB    1 
ATOM   3137  C  CG    . PHE B 1  179  ? 456.888 14.489  703.390 1.00 103.20 ? 179  PHE B CG    1 
ATOM   3138  C  CD1   . PHE B 1  179  ? 458.194 14.380  702.922 1.00 102.19 ? 179  PHE B CD1   1 
ATOM   3139  C  CD2   . PHE B 1  179  ? 456.336 13.420  704.099 1.00 98.40  ? 179  PHE B CD2   1 
ATOM   3140  C  CE1   . PHE B 1  179  ? 458.924 13.203  703.116 1.00 98.78  ? 179  PHE B CE1   1 
ATOM   3141  C  CE2   . PHE B 1  179  ? 457.050 12.235  704.296 1.00 97.11  ? 179  PHE B CE2   1 
ATOM   3142  C  CZ    . PHE B 1  179  ? 458.346 12.126  703.805 1.00 101.26 ? 179  PHE B CZ    1 
ATOM   3143  N  N     . GLN B 1  180  ? 456.508 15.926  699.985 1.00 116.90 ? 180  GLN B N     1 
ATOM   3144  C  CA    . GLN B 1  180  ? 457.120 15.548  698.708 1.00 112.16 ? 180  GLN B CA    1 
ATOM   3145  C  C     . GLN B 1  180  ? 458.569 16.010  698.667 1.00 107.48 ? 180  GLN B C     1 
ATOM   3146  O  O     . GLN B 1  180  ? 458.853 17.193  698.874 1.00 110.27 ? 180  GLN B O     1 
ATOM   3147  C  CB    . GLN B 1  180  ? 456.362 16.210  697.545 1.00 111.48 ? 180  GLN B CB    1 
ATOM   3148  C  CG    . GLN B 1  180  ? 456.661 15.695  696.160 1.00 110.24 ? 180  GLN B CG    1 
ATOM   3149  C  CD    . GLN B 1  180  ? 455.411 15.658  695.293 1.00 122.60 ? 180  GLN B CD    1 
ATOM   3150  O  OE1   . GLN B 1  180  ? 454.348 16.141  695.691 1.00 131.84 ? 180  GLN B OE1   1 
ATOM   3151  N  NE2   . GLN B 1  180  ? 455.530 15.085  694.108 1.00 119.61 ? 180  GLN B NE2   1 
ATOM   3152  N  N     . VAL B 1  181  ? 459.471 15.098  698.334 1.00 109.94 ? 181  VAL B N     1 
ATOM   3153  C  CA    . VAL B 1  181  ? 460.890 15.398  698.167 1.00 110.95 ? 181  VAL B CA    1 
ATOM   3154  C  C     . VAL B 1  181  ? 461.203 15.413  696.677 1.00 112.36 ? 181  VAL B C     1 
ATOM   3155  O  O     . VAL B 1  181  ? 460.825 14.493  695.940 1.00 109.32 ? 181  VAL B O     1 
ATOM   3156  C  CB    . VAL B 1  181  ? 461.782 14.378  698.893 1.00 108.89 ? 181  VAL B CB    1 
ATOM   3157  C  CG1   . VAL B 1  181  ? 463.243 14.793  698.775 1.00 105.02 ? 181  VAL B CG1   1 
ATOM   3158  C  CG2   . VAL B 1  181  ? 461.347 14.231  700.336 1.00 99.42  ? 181  VAL B CG2   1 
ATOM   3159  N  N     . GLU B 1  182  ? 461.958 16.417  696.246 1.00 114.51 ? 182  GLU B N     1 
ATOM   3160  C  CA    . GLU B 1  182  ? 462.370 16.483  694.856 1.00 110.67 ? 182  GLU B CA    1 
ATOM   3161  C  C     . GLU B 1  182  ? 463.836 16.847  694.763 1.00 110.37 ? 182  GLU B C     1 
ATOM   3162  O  O     . GLU B 1  182  ? 464.386 17.512  695.642 1.00 110.36 ? 182  GLU B O     1 
ATOM   3163  C  CB    . GLU B 1  182  ? 461.570 17.563  694.116 1.00 107.69 ? 182  GLU B CB    1 
ATOM   3164  C  CG    . GLU B 1  182  ? 460.082 17.513  694.358 1.00 113.92 ? 182  GLU B CG    1 
ATOM   3165  C  CD    . GLU B 1  182  ? 459.400 18.791  693.937 1.00 122.34 ? 182  GLU B CD    1 
ATOM   3166  O  OE1   . GLU B 1  182  ? 460.044 19.575  693.206 1.00 118.60 ? 182  GLU B OE1   1 
ATOM   3167  O  OE2   . GLU B 1  182  ? 458.241 19.027  694.367 1.00 127.86 ? 182  GLU B OE2   1 
ATOM   3168  N  N     . ASP B 1  183  ? 464.466 16.348  693.707 1.00 116.58 ? 183  ASP B N     1 
ATOM   3169  C  CA    . ASP B 1  183  ? 465.878 16.586  693.462 1.00 116.03 ? 183  ASP B CA    1 
ATOM   3170  C  C     . ASP B 1  183  ? 466.150 18.043  693.092 1.00 108.38 ? 183  ASP B C     1 
ATOM   3171  O  O     . ASP B 1  183  ? 465.340 18.702  692.436 1.00 98.23  ? 183  ASP B O     1 
ATOM   3172  C  CB    . ASP B 1  183  ? 466.360 15.643  692.376 1.00 120.18 ? 183  ASP B CB    1 
ATOM   3173  C  CG    . ASP B 1  183  ? 466.743 14.300  692.932 1.00 129.04 ? 183  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B 1  183  ? 465.865 13.661  693.570 1.00 128.83 ? 183  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B 1  183  ? 467.920 13.906  692.750 1.00 133.55 ? 183  ASP B OD2   1 
ATOM   3176  N  N     . THR B 1  184  ? 467.311 18.545  693.508 1.00 108.34 ? 184  THR B N     1 
ATOM   3177  C  CA    . THR B 1  184  ? 467.677 19.915  693.190 1.00 109.10 ? 184  THR B CA    1 
ATOM   3178  C  C     . THR B 1  184  ? 469.196 20.014  693.158 1.00 117.42 ? 184  THR B C     1 
ATOM   3179  O  O     . THR B 1  184  ? 469.895 19.165  693.720 1.00 115.31 ? 184  THR B O     1 
ATOM   3180  C  CB    . THR B 1  184  ? 467.112 20.889  694.213 1.00 106.10 ? 184  THR B CB    1 
ATOM   3181  O  OG1   . THR B 1  184  ? 467.091 22.201  693.652 1.00 110.55 ? 184  THR B OG1   1 
ATOM   3182  C  CG2   . THR B 1  184  ? 467.998 20.903  695.461 1.00 104.90 ? 184  THR B CG2   1 
ATOM   3183  N  N     . ARG B 1  185  ? 469.709 21.063  692.491 1.00 121.42 ? 185  ARG B N     1 
ATOM   3184  C  CA    . ARG B 1  185  ? 471.149 21.221  692.296 1.00 126.10 ? 185  ARG B CA    1 
ATOM   3185  C  C     . ARG B 1  185  ? 471.576 22.637  692.659 1.00 126.55 ? 185  ARG B C     1 
ATOM   3186  O  O     . ARG B 1  185  ? 470.898 23.611  692.313 1.00 121.02 ? 185  ARG B O     1 
ATOM   3187  C  CB    . ARG B 1  185  ? 471.650 20.915  690.861 1.00 135.94 ? 185  ARG B CB    1 
ATOM   3188  C  CG    . ARG B 1  185  ? 471.205 21.848  689.749 1.00 138.68 ? 185  ARG B CG    1 
ATOM   3189  C  CD    . ARG B 1  185  ? 471.915 21.449  688.462 1.00 137.74 ? 185  ARG B CD    1 
ATOM   3190  N  NE    . ARG B 1  185  ? 471.972 22.517  687.460 1.00 141.54 ? 185  ARG B NE    1 
ATOM   3191  C  CZ    . ARG B 1  185  ? 472.973 23.397  687.365 1.00 140.38 ? 185  ARG B CZ    1 
ATOM   3192  N  NH1   . ARG B 1  185  ? 474.003 23.346  688.212 1.00 141.12 ? 185  ARG B NH1   1 
ATOM   3193  N  NH2   . ARG B 1  185  ? 472.952 24.327  686.419 1.00 130.60 ? 185  ARG B NH2   1 
ATOM   3194  N  N     . LEU B 1  186  ? 472.699 22.735  693.372 1.00 134.44 ? 186  LEU B N     1 
ATOM   3195  C  CA    . LEU B 1  186  ? 473.416 23.988  693.607 1.00 139.54 ? 186  LEU B CA    1 
ATOM   3196  C  C     . LEU B 1  186  ? 474.772 23.891  692.925 1.00 142.00 ? 186  LEU B C     1 
ATOM   3197  O  O     . LEU B 1  186  ? 475.659 23.170  693.401 1.00 138.49 ? 186  LEU B O     1 
ATOM   3198  C  CB    . LEU B 1  186  ? 473.572 24.257  695.108 1.00 140.82 ? 186  LEU B CB    1 
ATOM   3199  C  CG    . LEU B 1  186  ? 473.752 25.683  695.639 1.00 135.50 ? 186  LEU B CG    1 
ATOM   3200  C  CD1   . LEU B 1  186  ? 475.222 26.072  695.626 1.00 140.68 ? 186  LEU B CD1   1 
ATOM   3201  C  CD2   . LEU B 1  186  ? 472.972 26.665  694.786 1.00 136.86 ? 186  LEU B CD2   1 
ATOM   3202  N  N     . GLY B 1  187  ? 474.931 24.639  691.824 1.00 149.89 ? 187  GLY B N     1 
ATOM   3203  C  CA    . GLY B 1  187  ? 476.176 24.616  691.065 1.00 152.43 ? 187  GLY B CA    1 
ATOM   3204  C  C     . GLY B 1  187  ? 476.475 23.232  690.520 1.00 147.55 ? 187  GLY B C     1 
ATOM   3205  O  O     . GLY B 1  187  ? 475.704 22.655  689.739 1.00 136.11 ? 187  GLY B O     1 
ATOM   3206  N  N     . GLN B 1  188  ? 477.636 22.711  690.934 1.00 150.72 ? 188  GLN B N     1 
ATOM   3207  C  CA    . GLN B 1  188  ? 478.122 21.406  690.502 1.00 151.20 ? 188  GLN B CA    1 
ATOM   3208  C  C     . GLN B 1  188  ? 477.426 20.252  691.232 1.00 156.18 ? 188  GLN B C     1 
ATOM   3209  O  O     . GLN B 1  188  ? 477.352 19.150  690.675 1.00 156.13 ? 188  GLN B O     1 
ATOM   3210  C  CB    . GLN B 1  188  ? 479.641 21.315  690.703 1.00 153.54 ? 188  GLN B CB    1 
ATOM   3211  C  CG    . GLN B 1  188  ? 480.088 20.627  692.009 1.00 158.94 ? 188  GLN B CG    1 
ATOM   3212  C  CD    . GLN B 1  188  ? 480.005 21.532  693.254 1.00 163.25 ? 188  GLN B CD    1 
ATOM   3213  O  OE1   . GLN B 1  188  ? 479.298 22.542  693.261 1.00 162.85 ? 188  GLN B OE1   1 
ATOM   3214  N  NE2   . GLN B 1  188  ? 480.725 21.157  694.314 1.00 163.66 ? 188  GLN B NE2   1 
ATOM   3215  N  N     . ARG B 1  189  ? 476.967 20.445  692.485 1.00 155.84 ? 189  ARG B N     1 
ATOM   3216  C  CA    . ARG B 1  189  ? 476.312 19.367  693.229 1.00 144.21 ? 189  ARG B CA    1 
ATOM   3217  C  C     . ARG B 1  189  ? 474.853 19.263  692.785 1.00 135.29 ? 189  ARG B C     1 
ATOM   3218  O  O     . ARG B 1  189  ? 474.109 20.246  692.879 1.00 130.88 ? 189  ARG B O     1 
ATOM   3219  C  CB    . ARG B 1  189  ? 476.373 19.592  694.746 1.00 141.31 ? 189  ARG B CB    1 
ATOM   3220  C  CG    . ARG B 1  189  ? 477.658 20.174  695.357 1.00 149.20 ? 189  ARG B CG    1 
ATOM   3221  C  CD    . ARG B 1  189  ? 477.531 20.276  696.906 1.00 150.94 ? 189  ARG B CD    1 
ATOM   3222  N  NE    . ARG B 1  189  ? 478.438 21.249  697.533 1.00 156.80 ? 189  ARG B NE    1 
ATOM   3223  C  CZ    . ARG B 1  189  ? 478.861 21.192  698.799 1.00 152.16 ? 189  ARG B CZ    1 
ATOM   3224  N  NH1   . ARG B 1  189  ? 479.675 22.134  699.277 1.00 145.60 ? 189  ARG B NH1   1 
ATOM   3225  N  NH2   . ARG B 1  189  ? 478.485 20.189  699.587 1.00 146.73 ? 189  ARG B NH2   1 
ATOM   3226  N  N     . THR B 1  190  ? 474.481 18.129  692.179 1.00 132.56 ? 190  THR B N     1 
ATOM   3227  C  CA    . THR B 1  190  ? 473.108 17.866  691.737 1.00 135.73 ? 190  THR B CA    1 
ATOM   3228  C  C     . THR B 1  190  ? 472.283 16.909  692.617 1.00 134.57 ? 190  THR B C     1 
ATOM   3229  O  O     . THR B 1  190  ? 471.103 16.671  692.304 1.00 131.12 ? 190  THR B O     1 
ATOM   3230  C  CB    . THR B 1  190  ? 473.103 17.365  690.297 1.00 133.01 ? 190  THR B CB    1 
ATOM   3231  O  OG1   . THR B 1  190  ? 473.718 16.070  690.235 1.00 135.35 ? 190  THR B OG1   1 
ATOM   3232  C  CG2   . THR B 1  190  ? 473.824 18.350  689.419 1.00 136.06 ? 190  THR B CG2   1 
ATOM   3233  N  N     . ASP B 1  191  ? 472.851 16.312  693.666 1.00 126.16 ? 191  ASP B N     1 
ATOM   3234  C  CA    . ASP B 1  191  ? 472.123 15.253  694.351 1.00 121.15 ? 191  ASP B CA    1 
ATOM   3235  C  C     . ASP B 1  191  ? 471.288 15.774  695.535 1.00 122.09 ? 191  ASP B C     1 
ATOM   3236  O  O     . ASP B 1  191  ? 470.721 14.972  696.297 1.00 116.92 ? 191  ASP B O     1 
ATOM   3237  C  CB    . ASP B 1  191  ? 473.109 14.167  694.792 1.00 118.40 ? 191  ASP B CB    1 
ATOM   3238  C  CG    . ASP B 1  191  ? 472.568 12.755  694.542 1.00 125.39 ? 191  ASP B CG    1 
ATOM   3239  O  OD1   . ASP B 1  191  ? 471.330 12.606  694.371 1.00 128.05 ? 191  ASP B OD1   1 
ATOM   3240  O  OD2   . ASP B 1  191  ? 473.377 11.793  694.511 1.00 119.66 ? 191  ASP B OD2   1 
ATOM   3241  N  N     . LEU B 1  192  ? 471.189 17.099  695.684 1.00 119.67 ? 192  LEU B N     1 
ATOM   3242  C  CA    . LEU B 1  192  ? 470.618 17.735  696.864 1.00 109.85 ? 192  LEU B CA    1 
ATOM   3243  C  C     . LEU B 1  192  ? 469.102 17.504  696.928 1.00 108.33 ? 192  LEU B C     1 
ATOM   3244  O  O     . LEU B 1  192  ? 468.461 17.138  695.939 1.00 109.20 ? 192  LEU B O     1 
ATOM   3245  C  CB    . LEU B 1  192  ? 470.981 19.223  696.870 1.00 104.55 ? 192  LEU B CB    1 
ATOM   3246  C  CG    . LEU B 1  192  ? 472.512 19.452  696.764 1.00 105.85 ? 192  LEU B CG    1 
ATOM   3247  C  CD1   . LEU B 1  192  ? 472.926 20.927  696.881 1.00 108.05 ? 192  LEU B CD1   1 
ATOM   3248  C  CD2   . LEU B 1  192  ? 473.374 18.555  697.672 1.00 98.30  ? 192  LEU B CD2   1 
ATOM   3249  N  N     . ASP B 1  193  ? 468.535 17.705  698.125 1.00 109.76 ? 193  ASP B N     1 
ATOM   3250  C  CA    . ASP B 1  193  ? 467.120 17.463  698.401 1.00 105.38 ? 193  ASP B CA    1 
ATOM   3251  C  C     . ASP B 1  193  ? 466.336 18.771  698.496 1.00 103.75 ? 193  ASP B C     1 
ATOM   3252  O  O     . ASP B 1  193  ? 466.840 19.765  699.022 1.00 106.13 ? 193  ASP B O     1 
ATOM   3253  C  CB    . ASP B 1  193  ? 466.975 16.720  699.734 1.00 103.49 ? 193  ASP B CB    1 
ATOM   3254  C  CG    . ASP B 1  193  ? 467.123 15.198  699.611 1.00 106.24 ? 193  ASP B CG    1 
ATOM   3255  O  OD1   . ASP B 1  193  ? 468.279 14.749  699.473 1.00 108.01 ? 193  ASP B OD1   1 
ATOM   3256  O  OD2   . ASP B 1  193  ? 466.121 14.445  699.709 1.00 101.36 ? 193  ASP B OD2   1 
ATOM   3257  N  N     . LYS B 1  194  ? 465.091 18.765  698.018 1.00 101.79 ? 194  LYS B N     1 
ATOM   3258  C  CA    . LYS B 1  194  ? 464.185 19.892  698.215 1.00 100.21 ? 194  LYS B CA    1 
ATOM   3259  C  C     . LYS B 1  194  ? 462.910 19.362  698.860 1.00 111.49 ? 194  LYS B C     1 
ATOM   3260  O  O     . LYS B 1  194  ? 462.214 18.528  698.264 1.00 109.42 ? 194  LYS B O     1 
ATOM   3261  C  CB    . LYS B 1  194  ? 463.850 20.608  696.906 1.00 97.92  ? 194  LYS B CB    1 
ATOM   3262  C  CG    . LYS B 1  194  ? 462.726 21.610  697.063 1.00 101.87 ? 194  LYS B CG    1 
ATOM   3263  C  CD    . LYS B 1  194  ? 462.283 22.223  695.752 1.00 104.08 ? 194  LYS B CD    1 
ATOM   3264  C  CE    . LYS B 1  194  ? 461.036 23.073  695.946 1.00 97.34  ? 194  LYS B CE    1 
ATOM   3265  N  NZ    . LYS B 1  194  ? 459.880 22.649  695.113 1.00 94.68  ? 194  LYS B NZ    1 
ATOM   3266  N  N     . LEU B 1  195  ? 462.604 19.848  700.072 1.00 114.17 ? 195  LEU B N     1 
ATOM   3267  C  CA    . LEU B 1  195  ? 461.486 19.372  700.889 1.00 107.76 ? 195  LEU B CA    1 
ATOM   3268  C  C     . LEU B 1  195  ? 460.300 20.335  700.838 1.00 106.94 ? 195  LEU B C     1 
ATOM   3269  O  O     . LEU B 1  195  ? 460.464 21.543  701.034 1.00 110.18 ? 195  LEU B O     1 
ATOM   3270  C  CB    . LEU B 1  195  ? 461.921 19.141  702.336 1.00 105.75 ? 195  LEU B CB    1 
ATOM   3271  C  CG    . LEU B 1  195  ? 460.805 18.758  703.313 1.00 99.05  ? 195  LEU B CG    1 
ATOM   3272  C  CD1   . LEU B 1  195  ? 460.020 17.550  702.837 1.00 100.15 ? 195  LEU B CD1   1 
ATOM   3273  C  CD2   . LEU B 1  195  ? 461.455 18.461  704.633 1.00 85.12  ? 195  LEU B CD2   1 
ATOM   3274  N  N     . THR B 1  196  ? 459.134 19.804  700.488 1.00 100.16 ? 196  THR B N     1 
ATOM   3275  C  CA    . THR B 1  196  ? 457.881 20.543  700.456 1.00 104.02 ? 196  THR B CA    1 
ATOM   3276  C  C     . THR B 1  196  ? 456.886 19.894  701.399 1.00 107.51 ? 196  THR B C     1 
ATOM   3277  O  O     . THR B 1  196  ? 456.630 18.691  701.294 1.00 110.72 ? 196  THR B O     1 
ATOM   3278  C  CB    . THR B 1  196  ? 457.319 20.647  699.039 1.00 107.16 ? 196  THR B CB    1 
ATOM   3279  O  OG1   . THR B 1  196  ? 458.097 21.606  698.323 1.00 109.18 ? 196  THR B OG1   1 
ATOM   3280  C  CG2   . THR B 1  196  ? 455.843 21.052  699.027 1.00 108.01 ? 196  THR B CG2   1 
ATOM   3281  N  N     . LEU B 1  197  ? 456.382 20.673  702.356 1.00 108.00 ? 197  LEU B N     1 
ATOM   3282  C  CA    . LEU B 1  197  ? 455.480 20.204  703.404 1.00 105.30 ? 197  LEU B CA    1 
ATOM   3283  C  C     . LEU B 1  197  ? 454.129 20.880  703.277 1.00 106.15 ? 197  LEU B C     1 
ATOM   3284  O  O     . LEU B 1  197  ? 454.052 22.109  703.159 1.00 108.53 ? 197  LEU B O     1 
ATOM   3285  C  CB    . LEU B 1  197  ? 456.053 20.464  704.795 1.00 106.35 ? 197  LEU B CB    1 
ATOM   3286  C  CG    . LEU B 1  197  ? 456.456 19.183  705.509 1.00 103.68 ? 197  LEU B CG    1 
ATOM   3287  C  CD1   . LEU B 1  197  ? 456.650 19.411  706.970 1.00 95.14  ? 197  LEU B CD1   1 
ATOM   3288  C  CD2   . LEU B 1  197  ? 455.267 18.278  705.325 1.00 105.03 ? 197  LEU B CD2   1 
ATOM   3289  N  N     . ARG B 1  198  ? 453.072 20.072  703.316 1.00 103.47 ? 198  ARG B N     1 
ATOM   3290  C  CA    . ARG B 1  198  ? 451.704 20.554  703.185 1.00 106.50 ? 198  ARG B CA    1 
ATOM   3291  C  C     . ARG B 1  198  ? 450.965 20.153  704.455 1.00 105.76 ? 198  ARG B C     1 
ATOM   3292  O  O     . ARG B 1  198  ? 450.906 18.964  704.786 1.00 105.92 ? 198  ARG B O     1 
ATOM   3293  C  CB    . ARG B 1  198  ? 451.058 19.938  701.936 1.00 110.84 ? 198  ARG B CB    1 
ATOM   3294  C  CG    . ARG B 1  198  ? 451.769 20.338  700.636 1.00 108.88 ? 198  ARG B CG    1 
ATOM   3295  C  CD    . ARG B 1  198  ? 450.990 20.128  699.312 1.00 112.12 ? 198  ARG B CD    1 
ATOM   3296  N  NE    . ARG B 1  198  ? 450.507 18.765  699.035 1.00 115.33 ? 198  ARG B NE    1 
ATOM   3297  C  CZ    . ARG B 1  198  ? 451.225 17.810  698.422 1.00 120.22 ? 198  ARG B CZ    1 
ATOM   3298  N  NH1   . ARG B 1  198  ? 450.689 16.602  698.213 1.00 110.45 ? 198  ARG B NH1   1 
ATOM   3299  N  NH2   . ARG B 1  198  ? 452.501 18.032  698.067 1.00 118.05 ? 198  ARG B NH2   1 
ATOM   3300  N  N     . ILE B 1  199  ? 450.413 21.138  705.174 1.00 108.52 ? 199  ILE B N     1 
ATOM   3301  C  CA    . ILE B 1  199  ? 449.739 20.900  706.450 1.00 103.11 ? 199  ILE B CA    1 
ATOM   3302  C  C     . ILE B 1  199  ? 448.317 21.452  706.418 1.00 103.83 ? 199  ILE B C     1 
ATOM   3303  O  O     . ILE B 1  199  ? 448.110 22.647  706.174 1.00 106.00 ? 199  ILE B O     1 
ATOM   3304  C  CB    . ILE B 1  199  ? 450.534 21.507  707.611 1.00 96.29  ? 199  ILE B CB    1 
ATOM   3305  C  CG1   . ILE B 1  199  ? 452.026 21.226  707.430 1.00 99.51  ? 199  ILE B CG1   1 
ATOM   3306  C  CG2   . ILE B 1  199  ? 450.074 20.878  708.867 1.00 106.36 ? 199  ILE B CG2   1 
ATOM   3307  C  CD1   . ILE B 1  199  ? 452.813 21.007  708.727 1.00 100.66 ? 199  ILE B CD1   1 
ATOM   3308  N  N     . TRP B 1  200  ? 447.356 20.623  706.797 1.00 97.70  ? 200  TRP B N     1 
ATOM   3309  C  CA    . TRP B 1  200  ? 445.964 21.047  706.875 1.00 108.63 ? 200  TRP B CA    1 
ATOM   3310  C  C     . TRP B 1  200  ? 445.480 20.978  708.324 1.00 116.86 ? 200  TRP B C     1 
ATOM   3311  O  O     . TRP B 1  200  ? 445.524 19.907  708.945 1.00 114.62 ? 200  TRP B O     1 
ATOM   3312  C  CB    . TRP B 1  200  ? 445.087 20.126  706.026 1.00 108.67 ? 200  TRP B CB    1 
ATOM   3313  C  CG    . TRP B 1  200  ? 445.220 20.214  704.550 1.00 111.06 ? 200  TRP B CG    1 
ATOM   3314  C  CD1   . TRP B 1  200  ? 444.454 20.943  703.681 1.00 110.80 ? 200  TRP B CD1   1 
ATOM   3315  C  CD2   . TRP B 1  200  ? 446.167 19.507  703.754 1.00 111.40 ? 200  TRP B CD2   1 
ATOM   3316  N  NE1   . TRP B 1  200  ? 444.875 20.727  702.393 1.00 104.75 ? 200  TRP B NE1   1 
ATOM   3317  C  CE2   . TRP B 1  200  ? 445.929 19.850  702.418 1.00 104.01 ? 200  TRP B CE2   1 
ATOM   3318  C  CE3   . TRP B 1  200  ? 447.205 18.615  704.046 1.00 112.20 ? 200  TRP B CE3   1 
ATOM   3319  C  CZ2   . TRP B 1  200  ? 446.680 19.333  701.390 1.00 105.56 ? 200  TRP B CZ2   1 
ATOM   3320  C  CZ3   . TRP B 1  200  ? 447.951 18.108  703.016 1.00 103.96 ? 200  TRP B CZ3   1 
ATOM   3321  C  CH2   . TRP B 1  200  ? 447.687 18.467  701.712 1.00 106.43 ? 200  TRP B CH2   1 
ATOM   3322  N  N     . THR B 1  201  ? 445.042 22.107  708.877 1.00 113.68 ? 201  THR B N     1 
ATOM   3323  C  CA    . THR B 1  201  ? 444.470 22.060  710.208 1.00 107.83 ? 201  THR B CA    1 
ATOM   3324  C  C     . THR B 1  201  ? 442.993 22.450  710.140 1.00 115.56 ? 201  THR B C     1 
ATOM   3325  O  O     . THR B 1  201  ? 442.481 22.852  709.086 1.00 117.71 ? 201  THR B O     1 
ATOM   3326  C  CB    . THR B 1  201  ? 445.255 22.956  711.161 1.00 109.41 ? 201  THR B CB    1 
ATOM   3327  O  OG1   . THR B 1  201  ? 444.883 24.318  710.945 1.00 113.27 ? 201  THR B OG1   1 
ATOM   3328  C  CG2   . THR B 1  201  ? 446.753 22.781  710.950 1.00 103.21 ? 201  THR B CG2   1 
ATOM   3329  N  N     . ASP B 1  202  ? 442.328 22.397  711.301 1.00 114.50 ? 202  ASP B N     1 
ATOM   3330  C  CA    . ASP B 1  202  ? 440.912 22.737  711.426 1.00 117.92 ? 202  ASP B CA    1 
ATOM   3331  C  C     . ASP B 1  202  ? 440.683 24.191  711.809 1.00 114.78 ? 202  ASP B C     1 
ATOM   3332  O  O     . ASP B 1  202  ? 439.525 24.615  711.893 1.00 108.74 ? 202  ASP B O     1 
ATOM   3333  C  CB    . ASP B 1  202  ? 440.225 21.819  712.456 1.00 117.00 ? 202  ASP B CB    1 
ATOM   3334  C  CG    . ASP B 1  202  ? 440.889 21.873  713.836 1.00 112.56 ? 202  ASP B CG    1 
ATOM   3335  O  OD1   . ASP B 1  202  ? 441.551 22.880  714.149 1.00 112.78 ? 202  ASP B OD1   1 
ATOM   3336  O  OD2   . ASP B 1  202  ? 440.771 20.898  714.607 1.00 109.55 ? 202  ASP B OD2   1 
ATOM   3337  N  N     . GLY B 1  203  ? 441.749 24.983  711.926 1.00 112.61 ? 203  GLY B N     1 
ATOM   3338  C  CA    . GLY B 1  203  ? 441.644 26.387  712.218 1.00 112.85 ? 203  GLY B CA    1 
ATOM   3339  C  C     . GLY B 1  203  ? 441.937 26.741  713.657 1.00 116.16 ? 203  GLY B C     1 
ATOM   3340  O  O     . GLY B 1  203  ? 442.176 27.921  713.950 1.00 112.97 ? 203  GLY B O     1 
ATOM   3341  N  N     . SER B 1  204  ? 441.836 25.770  714.575 1.00 118.34 ? 204  SER B N     1 
ATOM   3342  C  CA    . SER B 1  204  ? 442.173 26.040  715.970 1.00 111.55 ? 204  SER B CA    1 
ATOM   3343  C  C     . SER B 1  204  ? 443.668 26.295  716.120 1.00 110.38 ? 204  SER B C     1 
ATOM   3344  O  O     . SER B 1  204  ? 444.090 27.363  716.574 1.00 113.89 ? 204  SER B O     1 
ATOM   3345  C  CB    . SER B 1  204  ? 441.748 24.871  716.868 1.00 109.33 ? 204  SER B CB    1 
ATOM   3346  O  OG    . SER B 1  204  ? 442.403 23.660  716.531 1.00 105.45 ? 204  SER B OG    1 
ATOM   3347  N  N     . VAL B 1  205  ? 444.489 25.351  715.678 1.00 110.75 ? 205  VAL B N     1 
ATOM   3348  C  CA    . VAL B 1  205  ? 445.925 25.564  715.566 1.00 111.07 ? 205  VAL B CA    1 
ATOM   3349  C  C     . VAL B 1  205  ? 446.244 25.920  714.118 1.00 113.98 ? 205  VAL B C     1 
ATOM   3350  O  O     . VAL B 1  205  ? 445.631 25.388  713.179 1.00 107.15 ? 205  VAL B O     1 
ATOM   3351  C  CB    . VAL B 1  205  ? 446.731 24.337  716.030 1.00 105.77 ? 205  VAL B CB    1 
ATOM   3352  C  CG1   . VAL B 1  205  ? 448.214 24.656  715.989 1.00 106.79 ? 205  VAL B CG1   1 
ATOM   3353  C  CG2   . VAL B 1  205  ? 446.308 23.902  717.407 1.00 107.98 ? 205  VAL B CG2   1 
ATOM   3354  N  N     . THR B 1  206  ? 447.106 26.910  713.943 1.00 115.09 ? 206  THR B N     1 
ATOM   3355  C  CA    . THR B 1  206  ? 447.539 27.318  712.619 1.00 110.65 ? 206  THR B CA    1 
ATOM   3356  C  C     . THR B 1  206  ? 448.603 26.364  712.062 1.00 111.82 ? 206  THR B C     1 
ATOM   3357  O  O     . THR B 1  206  ? 449.379 25.772  712.825 1.00 107.95 ? 206  THR B O     1 
ATOM   3358  C  CB    . THR B 1  206  ? 448.047 28.763  712.667 1.00 109.96 ? 206  THR B CB    1 
ATOM   3359  O  OG1   . THR B 1  206  ? 447.261 29.562  711.775 1.00 113.90 ? 206  THR B OG1   1 
ATOM   3360  C  CG2   . THR B 1  206  ? 449.508 28.889  712.334 1.00 107.38 ? 206  THR B CG2   1 
ATOM   3361  N  N     . PRO B 1  207  ? 448.628 26.179  710.727 1.00 114.05 ? 207  PRO B N     1 
ATOM   3362  C  CA    . PRO B 1  207  ? 449.591 25.243  710.135 1.00 103.45 ? 207  PRO B CA    1 
ATOM   3363  C  C     . PRO B 1  207  ? 451.031 25.557  710.498 1.00 106.69 ? 207  PRO B C     1 
ATOM   3364  O  O     . PRO B 1  207  ? 451.788 24.649  710.884 1.00 106.16 ? 207  PRO B O     1 
ATOM   3365  C  CB    . PRO B 1  207  ? 449.319 25.403  708.638 1.00 108.20 ? 207  PRO B CB    1 
ATOM   3366  C  CG    . PRO B 1  207  ? 447.928 25.824  708.543 1.00 102.98 ? 207  PRO B CG    1 
ATOM   3367  C  CD    . PRO B 1  207  ? 447.736 26.736  709.695 1.00 113.28 ? 207  PRO B CD    1 
ATOM   3368  N  N     . LEU B 1  208  ? 451.430 26.835  710.400 1.00 103.50 ? 208  LEU B N     1 
ATOM   3369  C  CA    . LEU B 1  208  ? 452.779 27.211  710.814 1.00 101.76 ? 208  LEU B CA    1 
ATOM   3370  C  C     . LEU B 1  208  ? 453.012 26.924  712.292 1.00 110.98 ? 208  LEU B C     1 
ATOM   3371  O  O     . LEU B 1  208  ? 454.083 26.423  712.670 1.00 109.26 ? 208  LEU B O     1 
ATOM   3372  C  CB    . LEU B 1  208  ? 453.026 28.682  710.484 1.00 90.33  ? 208  LEU B CB    1 
ATOM   3373  C  CG    . LEU B 1  208  ? 454.369 29.235  710.953 1.00 92.74  ? 208  LEU B CG    1 
ATOM   3374  C  CD1   . LEU B 1  208  ? 455.509 28.318  710.649 1.00 97.79  ? 208  LEU B CD1   1 
ATOM   3375  C  CD2   . LEU B 1  208  ? 454.599 30.570  710.235 1.00 96.67  ? 208  LEU B CD2   1 
ATOM   3376  N  N     . GLU B 1  209  ? 452.008 27.208  713.136 1.00 109.37 ? 209  GLU B N     1 
ATOM   3377  C  CA    . GLU B 1  209  ? 452.109 26.902  714.556 1.00 104.74 ? 209  GLU B CA    1 
ATOM   3378  C  C     . GLU B 1  209  ? 452.316 25.411  714.753 1.00 105.27 ? 209  GLU B C     1 
ATOM   3379  O  O     . GLU B 1  209  ? 453.278 24.984  715.403 1.00 107.06 ? 209  GLU B O     1 
ATOM   3380  C  CB    . GLU B 1  209  ? 450.853 27.364  715.305 1.00 111.99 ? 209  GLU B CB    1 
ATOM   3381  C  CG    . GLU B 1  209  ? 450.725 28.869  715.594 1.00 113.32 ? 209  GLU B CG    1 
ATOM   3382  C  CD    . GLU B 1  209  ? 449.309 29.243  716.045 1.00 114.97 ? 209  GLU B CD    1 
ATOM   3383  O  OE1   . GLU B 1  209  ? 448.987 30.450  716.100 1.00 114.15 ? 209  GLU B OE1   1 
ATOM   3384  O  OE2   . GLU B 1  209  ? 448.513 28.321  716.345 1.00 108.97 ? 209  GLU B OE2   1 
ATOM   3385  N  N     . ALA B 1  210  ? 451.467 24.606  714.109 1.00 102.68 ? 210  ALA B N     1 
ATOM   3386  C  CA    . ALA B 1  210  ? 451.548 23.155  714.219 1.00 100.88 ? 210  ALA B CA    1 
ATOM   3387  C  C     . ALA B 1  210  ? 452.945 22.641  713.907 1.00 104.38 ? 210  ALA B C     1 
ATOM   3388  O  O     . ALA B 1  210  ? 453.485 21.798  714.634 1.00 98.94  ? 210  ALA B O     1 
ATOM   3389  C  CB    . ALA B 1  210  ? 450.526 22.520  713.275 1.00 100.20 ? 210  ALA B CB    1 
ATOM   3390  N  N     . LEU B 1  211  ? 453.535 23.116  712.806 1.00 107.34 ? 211  LEU B N     1 
ATOM   3391  C  CA    . LEU B 1  211  ? 454.892 22.704  712.461 1.00 107.52 ? 211  LEU B CA    1 
ATOM   3392  C  C     . LEU B 1  211  ? 455.891 23.037  713.569 1.00 102.90 ? 211  LEU B C     1 
ATOM   3393  O  O     . LEU B 1  211  ? 456.625 22.157  714.048 1.00 97.27  ? 211  LEU B O     1 
ATOM   3394  C  CB    . LEU B 1  211  ? 455.318 23.349  711.137 1.00 103.89 ? 211  LEU B CB    1 
ATOM   3395  C  CG    . LEU B 1  211  ? 456.778 23.089  710.713 1.00 97.33  ? 211  LEU B CG    1 
ATOM   3396  C  CD1   . LEU B 1  211  ? 457.113 21.606  710.594 1.00 89.54  ? 211  LEU B CD1   1 
ATOM   3397  C  CD2   . LEU B 1  211  ? 457.084 23.818  709.416 1.00 104.98 ? 211  LEU B CD2   1 
ATOM   3398  N  N     . ASN B 1  212  ? 455.918 24.304  713.999 1.00 102.64 ? 212  ASN B N     1 
ATOM   3399  C  CA    . ASN B 1  212  ? 456.865 24.711  715.032 1.00 102.83 ? 212  ASN B CA    1 
ATOM   3400  C  C     . ASN B 1  212  ? 456.752 23.846  716.277 1.00 99.37  ? 212  ASN B C     1 
ATOM   3401  O  O     . ASN B 1  212  ? 457.775 23.459  716.859 1.00 96.85  ? 212  ASN B O     1 
ATOM   3402  C  CB    . ASN B 1  212  ? 456.699 26.204  715.319 1.00 98.71  ? 212  ASN B CB    1 
ATOM   3403  C  CG    . ASN B 1  212  ? 457.199 27.067  714.140 1.00 110.24 ? 212  ASN B CG    1 
ATOM   3404  O  OD1   . ASN B 1  212  ? 456.475 27.909  713.601 1.00 106.47 ? 212  ASN B OD1   1 
ATOM   3405  N  ND2   . ASN B 1  212  ? 458.438 26.811  713.711 1.00 111.46 ? 212  ASN B ND2   1 
ATOM   3406  N  N     . GLN B 1  213  ? 455.523 23.496  716.680 1.00 100.31 ? 213  GLN B N     1 
ATOM   3407  C  CA    . GLN B 1  213  ? 455.354 22.599  717.825 1.00 101.98 ? 213  GLN B CA    1 
ATOM   3408  C  C     . GLN B 1  213  ? 455.981 21.241  717.530 1.00 97.34  ? 213  GLN B C     1 
ATOM   3409  O  O     . GLN B 1  213  ? 456.721 20.684  718.353 1.00 95.59  ? 213  GLN B O     1 
ATOM   3410  C  CB    . GLN B 1  213  ? 453.865 22.421  718.174 1.00 101.97 ? 213  GLN B CB    1 
ATOM   3411  C  CG    . GLN B 1  213  ? 453.099 23.631  718.776 1.00 101.53 ? 213  GLN B CG    1 
ATOM   3412  C  CD    . GLN B 1  213  ? 451.626 23.282  719.141 1.00 105.89 ? 213  GLN B CD    1 
ATOM   3413  O  OE1   . GLN B 1  213  ? 451.323 22.158  719.563 1.00 102.04 ? 213  GLN B OE1   1 
ATOM   3414  N  NE2   . GLN B 1  213  ? 450.712 24.235  718.936 1.00 105.86 ? 213  GLN B NE2   1 
ATOM   3415  N  N     . ALA B 1  214  ? 455.775 20.751  716.310 1.00 99.69  ? 214  ALA B N     1 
ATOM   3416  C  CA    . ALA B 1  214  ? 456.306 19.460  715.903 1.00 96.11  ? 214  ALA B CA    1 
ATOM   3417  C  C     . ALA B 1  214  ? 457.824 19.466  715.946 1.00 98.43  ? 214  ALA B C     1 
ATOM   3418  O  O     . ALA B 1  214  ? 458.447 18.529  716.467 1.00 97.22  ? 214  ALA B O     1 
ATOM   3419  C  CB    . ALA B 1  214  ? 455.802 19.122  714.502 1.00 93.31  ? 214  ALA B CB    1 
ATOM   3420  N  N     . VAL B 1  215  ? 458.434 20.504  715.370 1.00 94.00  ? 215  VAL B N     1 
ATOM   3421  C  CA    . VAL B 1  215  ? 459.886 20.639  715.404 1.00 96.70  ? 215  VAL B CA    1 
ATOM   3422  C  C     . VAL B 1  215  ? 460.397 20.708  716.845 1.00 103.93 ? 215  VAL B C     1 
ATOM   3423  O  O     . VAL B 1  215  ? 461.354 20.012  717.230 1.00 97.36  ? 215  VAL B O     1 
ATOM   3424  C  CB    . VAL B 1  215  ? 460.275 21.917  714.629 1.00 100.15 ? 215  VAL B CB    1 
ATOM   3425  C  CG1   . VAL B 1  215  ? 461.775 22.239  714.756 1.00 97.23  ? 215  VAL B CG1   1 
ATOM   3426  C  CG2   . VAL B 1  215  ? 459.797 21.862  713.181 1.00 105.29 ? 215  VAL B CG2   1 
ATOM   3427  N  N     . GLU B 1  216  ? 459.690 21.464  717.688 1.00 106.65 ? 216  GLU B N     1 
ATOM   3428  C  CA    . GLU B 1  216  ? 460.068 21.611  719.089 1.00 103.40 ? 216  GLU B CA    1 
ATOM   3429  C  C     . GLU B 1  216  ? 460.071 20.265  719.818 1.00 100.43 ? 216  GLU B C     1 
ATOM   3430  O  O     . GLU B 1  216  ? 461.059 19.913  720.477 1.00 104.64 ? 216  GLU B O     1 
ATOM   3431  C  CB    . GLU B 1  216  ? 459.138 22.633  719.763 1.00 108.16 ? 216  GLU B CB    1 
ATOM   3432  C  CG    . GLU B 1  216  ? 459.264 22.840  721.308 1.00 113.63 ? 216  GLU B CG    1 
ATOM   3433  C  CD    . GLU B 1  216  ? 460.666 23.306  721.782 1.00 119.56 ? 216  GLU B CD    1 
ATOM   3434  O  OE1   . GLU B 1  216  ? 461.618 22.493  721.818 1.00 120.57 ? 216  GLU B OE1   1 
ATOM   3435  O  OE2   . GLU B 1  216  ? 460.810 24.495  722.147 1.00 121.45 ? 216  GLU B OE2   1 
ATOM   3436  N  N     . ILE B 1  217  ? 458.991 19.482  719.683 1.00 91.96  ? 217  ILE B N     1 
ATOM   3437  C  CA    . ILE B 1  217  ? 458.945 18.154  720.305 1.00 90.07  ? 217  ILE B CA    1 
ATOM   3438  C  C     . ILE B 1  217  ? 460.199 17.354  719.991 1.00 96.78  ? 217  ILE B C     1 
ATOM   3439  O  O     . ILE B 1  217  ? 460.781 16.701  720.873 1.00 86.70  ? 217  ILE B O     1 
ATOM   3440  C  CB    . ILE B 1  217  ? 457.709 17.367  719.832 1.00 84.67  ? 217  ILE B CB    1 
ATOM   3441  C  CG1   . ILE B 1  217  ? 456.399 17.992  720.293 1.00 80.50  ? 217  ILE B CG1   1 
ATOM   3442  C  CG2   . ILE B 1  217  ? 457.813 15.889  720.282 1.00 75.58  ? 217  ILE B CG2   1 
ATOM   3443  C  CD1   . ILE B 1  217  ? 455.179 17.213  719.808 1.00 75.36  ? 217  ILE B CD1   1 
ATOM   3444  N  N     . LEU B 1  218  ? 460.610 17.374  718.708 1.00 101.63 ? 218  LEU B N     1 
ATOM   3445  C  CA    . LEU B 1  218  ? 461.754 16.585  718.245 1.00 97.74  ? 218  LEU B CA    1 
ATOM   3446  C  C     . LEU B 1  218  ? 463.061 17.035  718.895 1.00 99.79  ? 218  LEU B C     1 
ATOM   3447  O  O     . LEU B 1  218  ? 463.875 16.199  719.330 1.00 93.37  ? 218  LEU B O     1 
ATOM   3448  C  CB    . LEU B 1  218  ? 461.831 16.641  716.718 1.00 96.87  ? 218  LEU B CB    1 
ATOM   3449  C  CG    . LEU B 1  218  ? 462.803 15.706  715.956 1.00 101.11 ? 218  LEU B CG    1 
ATOM   3450  C  CD1   . LEU B 1  218  ? 462.562 14.214  716.253 1.00 94.05  ? 218  LEU B CD1   1 
ATOM   3451  C  CD2   . LEU B 1  218  ? 462.814 15.987  714.431 1.00 92.58  ? 218  LEU B CD2   1 
ATOM   3452  N  N     . ARG B 1  219  ? 463.272 18.351  718.989 1.00 100.07 ? 219  ARG B N     1 
ATOM   3453  C  CA    . ARG B 1  219  ? 464.481 18.838  719.640 1.00 104.23 ? 219  ARG B CA    1 
ATOM   3454  C  C     . ARG B 1  219  ? 464.587 18.309  721.061 1.00 110.87 ? 219  ARG B C     1 
ATOM   3455  O  O     . ARG B 1  219  ? 465.623 17.746  721.451 1.00 109.80 ? 219  ARG B O     1 
ATOM   3456  C  CB    . ARG B 1  219  ? 464.477 20.362  719.648 1.00 104.68 ? 219  ARG B CB    1 
ATOM   3457  C  CG    . ARG B 1  219  ? 465.736 20.924  720.245 1.00 113.87 ? 219  ARG B CG    1 
ATOM   3458  C  CD    . ARG B 1  219  ? 465.521 22.362  720.674 1.00 116.94 ? 219  ARG B CD    1 
ATOM   3459  N  NE    . ARG B 1  219  ? 464.348 22.557  721.527 1.00 112.82 ? 219  ARG B NE    1 
ATOM   3460  C  CZ    . ARG B 1  219  ? 464.311 22.301  722.831 1.00 115.18 ? 219  ARG B CZ    1 
ATOM   3461  N  NH1   . ARG B 1  219  ? 465.387 21.831  723.456 1.00 118.51 ? 219  ARG B NH1   1 
ATOM   3462  N  NH2   . ARG B 1  219  ? 463.197 22.531  723.514 1.00 108.07 ? 219  ARG B NH2   1 
ATOM   3463  N  N     . GLU B 1  220  ? 463.488 18.434  721.822 1.00 105.95 ? 220  GLU B N     1 
ATOM   3464  C  CA    . GLU B 1  220  ? 463.410 17.943  723.191 1.00 101.98 ? 220  GLU B CA    1 
ATOM   3465  C  C     . GLU B 1  220  ? 463.778 16.472  723.298 1.00 104.10 ? 220  GLU B C     1 
ATOM   3466  O  O     . GLU B 1  220  ? 464.524 16.060  724.197 1.00 105.66 ? 220  GLU B O     1 
ATOM   3467  C  CB    . GLU B 1  220  ? 461.994 18.141  723.726 1.00 108.63 ? 220  GLU B CB    1 
ATOM   3468  C  CG    . GLU B 1  220  ? 461.864 17.698  725.205 1.00 113.85 ? 220  GLU B CG    1 
ATOM   3469  C  CD    . GLU B 1  220  ? 460.492 17.934  725.824 1.00 108.66 ? 220  GLU B CD    1 
ATOM   3470  O  OE1   . GLU B 1  220  ? 459.594 18.510  725.157 1.00 101.16 ? 220  GLU B OE1   1 
ATOM   3471  O  OE2   . GLU B 1  220  ? 460.340 17.566  727.009 1.00 115.31 ? 220  GLU B OE2   1 
ATOM   3472  N  N     . HIS B 1  221  ? 463.218 15.658  722.412 1.00 101.24 ? 221  HIS B N     1 
ATOM   3473  C  CA    . HIS B 1  221  ? 463.522 14.238  722.419 1.00 100.47 ? 221  HIS B CA    1 
ATOM   3474  C  C     . HIS B 1  221  ? 464.994 13.967  722.186 1.00 105.02 ? 221  HIS B C     1 
ATOM   3475  O  O     . HIS B 1  221  ? 465.509 12.936  722.641 1.00 103.93 ? 221  HIS B O     1 
ATOM   3476  C  CB    . HIS B 1  221  ? 462.726 13.546  721.348 1.00 101.10 ? 221  HIS B CB    1 
ATOM   3477  C  CG    . HIS B 1  221  ? 461.411 13.046  721.822 1.00 100.18 ? 221  HIS B CG    1 
ATOM   3478  N  ND1   . HIS B 1  221  ? 461.236 11.775  722.325 1.00 101.07 ? 221  HIS B ND1   1 
ATOM   3479  C  CD2   . HIS B 1  221  ? 460.187 13.622  721.794 1.00 91.27  ? 221  HIS B CD2   1 
ATOM   3480  C  CE1   . HIS B 1  221  ? 459.964 11.606  722.633 1.00 96.24  ? 221  HIS B CE1   1 
ATOM   3481  N  NE2   . HIS B 1  221  ? 459.307 12.709  722.315 1.00 94.12  ? 221  HIS B NE2   1 
ATOM   3482  N  N     . LEU B 1  222  ? 465.681 14.864  721.468 1.00 100.91 ? 222  LEU B N     1 
ATOM   3483  C  CA    . LEU B 1  222  ? 467.107 14.673  721.255 1.00 102.49 ? 222  LEU B CA    1 
ATOM   3484  C  C     . LEU B 1  222  ? 467.891 14.852  722.547 1.00 106.76 ? 222  LEU B C     1 
ATOM   3485  O  O     . LEU B 1  222  ? 468.929 14.200  722.743 1.00 103.93 ? 222  LEU B O     1 
ATOM   3486  C  CB    . LEU B 1  222  ? 467.577 15.669  720.202 1.00 107.26 ? 222  LEU B CB    1 
ATOM   3487  C  CG    . LEU B 1  222  ? 467.022 15.301  718.823 1.00 107.94 ? 222  LEU B CG    1 
ATOM   3488  C  CD1   . LEU B 1  222  ? 467.589 16.197  717.764 1.00 95.49  ? 222  LEU B CD1   1 
ATOM   3489  C  CD2   . LEU B 1  222  ? 467.299 13.830  718.494 1.00 103.13 ? 222  LEU B CD2   1 
ATOM   3490  N  N     . THR B 1  223  ? 467.388 15.699  723.450 1.00 110.56 ? 223  THR B N     1 
ATOM   3491  C  CA    . THR B 1  223  ? 468.005 15.881  724.754 1.00 102.82 ? 223  THR B CA    1 
ATOM   3492  C  C     . THR B 1  223  ? 467.932 14.625  725.611 1.00 102.14 ? 223  THR B C     1 
ATOM   3493  O  O     . THR B 1  223  ? 468.677 14.530  726.589 1.00 107.71 ? 223  THR B O     1 
ATOM   3494  C  CB    . THR B 1  223  ? 467.324 17.028  725.489 1.00 100.39 ? 223  THR B CB    1 
ATOM   3495  O  OG1   . THR B 1  223  ? 465.966 16.650  725.751 1.00 104.85 ? 223  THR B OG1   1 
ATOM   3496  C  CG2   . THR B 1  223  ? 467.353 18.329  724.677 1.00 95.50  ? 223  THR B CG2   1 
ATOM   3497  N  N     . TYR B 1  224  ? 467.067 13.656  725.264 1.00 98.60  ? 224  TYR B N     1 
ATOM   3498  C  CA    . TYR B 1  224  ? 466.897 12.470  726.099 1.00 95.22  ? 224  TYR B CA    1 
ATOM   3499  C  C     . TYR B 1  224  ? 468.095 11.576  726.069 1.00 98.37  ? 224  TYR B C     1 
ATOM   3500  O  O     . TYR B 1  224  ? 468.026 10.471  726.598 1.00 96.84  ? 224  TYR B O     1 
ATOM   3501  C  CB    . TYR B 1  224  ? 465.649 11.676  725.742 1.00 97.76  ? 224  TYR B CB    1 
ATOM   3502  C  CG    . TYR B 1  224  ? 464.381 12.487  726.013 1.00 110.26 ? 224  TYR B CG    1 
ATOM   3503  C  CD1   . TYR B 1  224  ? 464.409 13.616  726.843 1.00 109.21 ? 224  TYR B CD1   1 
ATOM   3504  C  CD2   . TYR B 1  224  ? 463.153 12.101  725.494 1.00 108.29 ? 224  TYR B CD2   1 
ATOM   3505  C  CE1   . TYR B 1  224  ? 463.270 14.368  727.079 1.00 102.92 ? 224  TYR B CE1   1 
ATOM   3506  C  CE2   . TYR B 1  224  ? 462.006 12.838  725.744 1.00 104.24 ? 224  TYR B CE2   1 
ATOM   3507  C  CZ    . TYR B 1  224  ? 462.072 13.967  726.531 1.00 104.87 ? 224  TYR B CZ    1 
ATOM   3508  O  OH    . TYR B 1  224  ? 460.922 14.690  726.748 1.00 108.05 ? 224  TYR B OH    1 
ATOM   3509  N  N     . PHE B 1  225  ? 469.092 11.946  725.285 1.00 107.28 ? 225  PHE B N     1 
ATOM   3510  C  CA    . PHE B 1  225  ? 470.390 11.281  725.196 1.00 111.96 ? 225  PHE B CA    1 
ATOM   3511  C  C     . PHE B 1  225  ? 471.392 11.989  726.126 1.00 120.18 ? 225  PHE B C     1 
ATOM   3512  O  O     . PHE B 1  225  ? 472.483 12.387  725.698 1.00 118.81 ? 225  PHE B O     1 
ATOM   3513  C  CB    . PHE B 1  225  ? 470.833 11.278  723.736 1.00 108.52 ? 225  PHE B CB    1 
ATOM   3514  C  CG    . PHE B 1  225  ? 469.953 10.417  722.834 1.00 104.84 ? 225  PHE B CG    1 
ATOM   3515  C  CD1   . PHE B 1  225  ? 470.033 9.027   722.850 1.00 98.39  ? 225  PHE B CD1   1 
ATOM   3516  C  CD2   . PHE B 1  225  ? 468.945 11.011  722.059 1.00 102.08 ? 225  PHE B CD2   1 
ATOM   3517  C  CE1   . PHE B 1  225  ? 469.189 8.252   722.025 1.00 90.58  ? 225  PHE B CE1   1 
ATOM   3518  C  CE2   . PHE B 1  225  ? 468.093 10.238  721.257 1.00 92.65  ? 225  PHE B CE2   1 
ATOM   3519  C  CZ    . PHE B 1  225  ? 468.215 8.860   721.248 1.00 81.29  ? 225  PHE B CZ    1 
ATOM   3520  N  N     . SER B 1  226  ? 471.027 12.184  727.411 1.00 124.13 ? 226  SER B N     1 
ATOM   3521  C  CA    . SER B 1  226  ? 471.835 12.963  728.359 1.00 128.82 ? 226  SER B CA    1 
ATOM   3522  C  C     . SER B 1  226  ? 472.423 12.169  729.523 1.00 131.80 ? 226  SER B C     1 
ATOM   3523  O  O     . SER B 1  226  ? 473.647 12.105  729.676 1.00 130.97 ? 226  SER B O     1 
ATOM   3524  C  CB    . SER B 1  226  ? 470.969 14.102  728.915 1.00 130.55 ? 226  SER B CB    1 
ATOM   3525  O  OG    . SER B 1  226  ? 469.777 13.576  729.492 1.00 130.09 ? 226  SER B OG    1 
ATOM   3526  N  N     . ASN B 1  227  ? 471.598 11.596  730.389 1.00 130.31 ? 227  ASN B N     1 
ATOM   3527  C  CA    . ASN B 1  227  ? 472.133 11.044  731.627 1.00 132.93 ? 227  ASN B CA    1 
ATOM   3528  C  C     . ASN B 1  227  ? 472.076 9.545   731.407 1.00 132.08 ? 227  ASN B C     1 
ATOM   3529  O  O     . ASN B 1  227  ? 470.976 8.973   731.349 1.00 135.96 ? 227  ASN B O     1 
ATOM   3530  C  CB    . ASN B 1  227  ? 471.320 11.472  732.853 1.00 137.26 ? 227  ASN B CB    1 
ATOM   3531  C  CG    . ASN B 1  227  ? 471.788 10.795  734.142 1.00 146.44 ? 227  ASN B CG    1 
ATOM   3532  O  OD1   . ASN B 1  227  ? 471.656 9.577   734.310 1.00 149.67 ? 227  ASN B OD1   1 
ATOM   3533  N  ND2   . ASN B 1  227  ? 472.348 11.587  735.057 1.00 145.42 ? 227  ASN B ND2   1 
ATOM   3534  N  N     . PRO B 1  228  ? 473.198 8.872   731.314 1.00 128.29 ? 228  PRO B N     1 
ATOM   3535  C  CA    . PRO B 1  228  ? 473.174 7.410   731.173 1.00 129.33 ? 228  PRO B CA    1 
ATOM   3536  C  C     . PRO B 1  228  ? 472.957 6.512   732.382 1.00 126.43 ? 228  PRO B C     1 
ATOM   3537  O  O     . PRO B 1  228  ? 472.399 6.896   733.417 1.00 124.70 ? 228  PRO B O     1 
ATOM   3538  C  CB    . PRO B 1  228  ? 474.548 7.138   730.551 1.00 130.47 ? 228  PRO B CB    1 
ATOM   3539  C  CG    . PRO B 1  228  ? 475.432 8.189   731.168 1.00 136.38 ? 228  PRO B CG    1 
ATOM   3540  C  CD    . PRO B 1  228  ? 474.564 9.400   731.448 1.00 131.14 ? 228  PRO B CD    1 
ATOM   3541  N  N     . GLN B 1  229  ? 473.341 5.253   732.151 1.00 125.32 ? 229  GLN B N     1 
ATOM   3542  C  CA    . GLN B 1  229  ? 473.383 4.143   733.104 1.00 129.55 ? 229  GLN B CA    1 
ATOM   3543  C  C     . GLN B 1  229  ? 473.946 2.915   732.356 1.00 116.32 ? 229  GLN B C     1 
ATOM   3544  O  O     . GLN B 1  229  ? 475.106 2.525   732.519 1.00 104.09 ? 229  GLN B O     1 
ATOM   3545  C  CB    . GLN B 1  229  ? 471.983 3.857   733.702 1.00 125.64 ? 229  GLN B CB    1 
ATOM   3546  C  CG    . GLN B 1  229  ? 471.880 2.687   734.724 1.00 127.59 ? 229  GLN B CG    1 
ATOM   3547  C  CD    . GLN B 1  229  ? 472.706 2.870   736.010 1.00 132.86 ? 229  GLN B CD    1 
ATOM   3548  O  OE1   . GLN B 1  229  ? 472.746 3.959   736.593 1.00 133.03 ? 229  GLN B OE1   1 
ATOM   3549  N  NE2   . GLN B 1  229  ? 473.336 1.783   736.472 1.00 125.72 ? 229  GLN B NE2   1 
ATOM   3550  N  N     . MET C 2  1    ? 484.216 -22.040 702.318 1.00 147.24 ? 1    MET C N     1 
ATOM   3551  C  CA    . MET C 2  1    ? 482.965 -22.544 702.882 1.00 137.10 ? 1    MET C CA    1 
ATOM   3552  C  C     . MET C 2  1    ? 482.707 -23.979 702.406 1.00 138.37 ? 1    MET C C     1 
ATOM   3553  O  O     . MET C 2  1    ? 483.286 -24.434 701.408 1.00 141.36 ? 1    MET C O     1 
ATOM   3554  C  CB    . MET C 2  1    ? 481.791 -21.640 702.478 1.00 125.24 ? 1    MET C CB    1 
ATOM   3555  C  CG    . MET C 2  1    ? 481.272 -21.878 701.058 1.00 132.60 ? 1    MET C CG    1 
ATOM   3556  S  SD    . MET C 2  1    ? 482.397 -21.420 699.692 1.00 159.41 ? 1    MET C SD    1 
ATOM   3557  C  CE    . MET C 2  1    ? 482.720 -19.690 700.089 1.00 146.32 ? 1    MET C CE    1 
ATOM   3558  N  N     . GLU C 2  2    ? 481.838 -24.685 703.124 1.00 131.56 ? 2    GLU C N     1 
ATOM   3559  C  CA    . GLU C 2  2    ? 481.493 -26.052 702.765 1.00 134.44 ? 2    GLU C CA    1 
ATOM   3560  C  C     . GLU C 2  2    ? 480.693 -26.045 701.460 1.00 130.56 ? 2    GLU C C     1 
ATOM   3561  O  O     . GLU C 2  2    ? 479.966 -25.092 701.161 1.00 124.19 ? 2    GLU C O     1 
ATOM   3562  C  CB    . GLU C 2  2    ? 480.715 -26.750 703.885 1.00 133.29 ? 2    GLU C CB    1 
ATOM   3563  C  CG    . GLU C 2  2    ? 480.522 -28.246 703.606 1.00 138.37 ? 2    GLU C CG    1 
ATOM   3564  C  CD    . GLU C 2  2    ? 479.486 -28.916 704.485 1.00 140.10 ? 2    GLU C CD    1 
ATOM   3565  O  OE1   . GLU C 2  2    ? 479.065 -28.303 705.493 1.00 135.01 ? 2    GLU C OE1   1 
ATOM   3566  O  OE2   . GLU C 2  2    ? 479.097 -30.062 704.154 1.00 140.61 ? 2    GLU C OE2   1 
ATOM   3567  N  N     . ILE C 2  3    ? 480.853 -27.106 700.667 1.00 132.58 ? 3    ILE C N     1 
ATOM   3568  C  CA    . ILE C 2  3    ? 480.105 -27.280 699.424 1.00 126.51 ? 3    ILE C CA    1 
ATOM   3569  C  C     . ILE C 2  3    ? 479.338 -28.592 699.498 1.00 127.32 ? 3    ILE C C     1 
ATOM   3570  O  O     . ILE C 2  3    ? 479.931 -29.677 699.442 1.00 134.67 ? 3    ILE C O     1 
ATOM   3571  C  CB    . ILE C 2  3    ? 481.020 -27.280 698.190 1.00 122.19 ? 3    ILE C CB    1 
ATOM   3572  C  CG1   . ILE C 2  3    ? 481.946 -26.061 698.184 1.00 125.55 ? 3    ILE C CG1   1 
ATOM   3573  C  CG2   . ILE C 2  3    ? 480.192 -27.335 696.926 1.00 112.17 ? 3    ILE C CG2   1 
ATOM   3574  C  CD1   . ILE C 2  3    ? 481.282 -24.772 697.779 1.00 117.77 ? 3    ILE C CD1   1 
ATOM   3575  N  N     . LYS C 2  4    ? 478.014 -28.477 699.528 1.00 118.23 ? 4    LYS C N     1 
ATOM   3576  C  CA    . LYS C 2  4    ? 477.077 -29.586 699.660 1.00 119.01 ? 4    LYS C CA    1 
ATOM   3577  C  C     . LYS C 2  4    ? 476.518 -29.910 698.286 1.00 115.07 ? 4    LYS C C     1 
ATOM   3578  O  O     . LYS C 2  4    ? 476.019 -29.022 697.583 1.00 112.45 ? 4    LYS C O     1 
ATOM   3579  C  CB    . LYS C 2  4    ? 475.919 -29.254 700.604 1.00 121.83 ? 4    LYS C CB    1 
ATOM   3580  C  CG    . LYS C 2  4    ? 474.974 -30.442 700.865 1.00 120.32 ? 4    LYS C CG    1 
ATOM   3581  C  CD    . LYS C 2  4    ? 473.929 -30.127 701.934 1.00 126.70 ? 4    LYS C CD    1 
ATOM   3582  C  CE    . LYS C 2  4    ? 473.095 -31.366 702.342 1.00 135.39 ? 4    LYS C CE    1 
ATOM   3583  N  NZ    . LYS C 2  4    ? 473.598 -32.703 701.877 1.00 135.14 ? 4    LYS C NZ    1 
ATOM   3584  N  N     . ARG C 2  5    ? 476.712 -31.134 697.845 1.00 107.19 ? 5    ARG C N     1 
ATOM   3585  C  CA    . ARG C 2  5    ? 476.214 -31.503 696.539 1.00 109.90 ? 5    ARG C CA    1 
ATOM   3586  C  C     . ARG C 2  5    ? 474.989 -32.397 696.661 1.00 109.02 ? 5    ARG C C     1 
ATOM   3587  O  O     . ARG C 2  5    ? 474.965 -33.326 697.470 1.00 113.82 ? 5    ARG C O     1 
ATOM   3588  C  CB    . ARG C 2  5    ? 477.328 -32.175 695.734 1.00 117.95 ? 5    ARG C CB    1 
ATOM   3589  C  CG    . ARG C 2  5    ? 477.898 -33.453 696.316 1.00 122.60 ? 5    ARG C CG    1 
ATOM   3590  C  CD    . ARG C 2  5    ? 478.968 -33.970 695.383 1.00 121.81 ? 5    ARG C CD    1 
ATOM   3591  N  NE    . ARG C 2  5    ? 478.539 -34.070 693.991 1.00 123.22 ? 5    ARG C NE    1 
ATOM   3592  C  CZ    . ARG C 2  5    ? 479.259 -33.590 692.978 1.00 123.52 ? 5    ARG C CZ    1 
ATOM   3593  N  NH1   . ARG C 2  5    ? 480.423 -32.989 693.225 1.00 114.37 ? 5    ARG C NH1   1 
ATOM   3594  N  NH2   . ARG C 2  5    ? 478.829 -33.718 691.725 1.00 120.16 ? 5    ARG C NH2   1 
ATOM   3595  N  N     . PHE C 2  6    ? 473.975 -32.104 695.875 1.00 104.01 ? 6    PHE C N     1 
ATOM   3596  C  CA    . PHE C 2  6    ? 472.767 -32.893 695.847 1.00 100.16 ? 6    PHE C CA    1 
ATOM   3597  C  C     . PHE C 2  6    ? 472.868 -33.842 694.654 1.00 110.30 ? 6    PHE C C     1 
ATOM   3598  O  O     . PHE C 2  6    ? 473.825 -33.824 693.876 1.00 112.65 ? 6    PHE C O     1 
ATOM   3599  C  CB    . PHE C 2  6    ? 471.530 -32.009 695.713 1.00 103.75 ? 6    PHE C CB    1 
ATOM   3600  C  CG    . PHE C 2  6    ? 471.379 -30.989 696.781 1.00 104.62 ? 6    PHE C CG    1 
ATOM   3601  C  CD1   . PHE C 2  6    ? 471.876 -29.713 696.622 1.00 107.84 ? 6    PHE C CD1   1 
ATOM   3602  C  CD2   . PHE C 2  6    ? 470.649 -31.273 697.913 1.00 114.24 ? 6    PHE C CD2   1 
ATOM   3603  C  CE1   . PHE C 2  6    ? 471.706 -28.750 697.614 1.00 107.16 ? 6    PHE C CE1   1 
ATOM   3604  C  CE2   . PHE C 2  6    ? 470.479 -30.325 698.907 1.00 114.82 ? 6    PHE C CE2   1 
ATOM   3605  C  CZ    . PHE C 2  6    ? 471.012 -29.061 698.754 1.00 110.16 ? 6    PHE C CZ    1 
ATOM   3606  N  N     . GLY C 2  7    ? 471.854 -34.671 694.501 1.00 117.25 ? 7    GLY C N     1 
ATOM   3607  C  CA    . GLY C 2  7    ? 471.664 -35.509 693.334 1.00 121.28 ? 7    GLY C CA    1 
ATOM   3608  C  C     . GLY C 2  7    ? 472.227 -36.907 693.484 1.00 128.00 ? 7    GLY C C     1 
ATOM   3609  O  O     . GLY C 2  7    ? 473.363 -37.098 693.936 1.00 126.56 ? 7    GLY C O     1 
ATOM   3610  N  N     . ARG C 2  8    ? 471.462 -37.877 692.974 1.00 131.29 ? 8    ARG C N     1 
ATOM   3611  C  CA    . ARG C 2  8    ? 471.758 -39.301 693.055 1.00 133.25 ? 8    ARG C CA    1 
ATOM   3612  C  C     . ARG C 2  8    ? 472.326 -39.914 691.785 1.00 127.16 ? 8    ARG C C     1 
ATOM   3613  O  O     . ARG C 2  8    ? 472.709 -41.093 691.806 1.00 121.09 ? 8    ARG C O     1 
ATOM   3614  C  CB    . ARG C 2  8    ? 470.462 -40.043 693.404 1.00 132.70 ? 8    ARG C CB    1 
ATOM   3615  C  CG    . ARG C 2  8    ? 469.355 -39.119 693.922 1.00 129.70 ? 8    ARG C CG    1 
ATOM   3616  C  CD    . ARG C 2  8    ? 468.264 -39.900 694.637 1.00 136.06 ? 8    ARG C CD    1 
ATOM   3617  N  NE    . ARG C 2  8    ? 467.869 -41.065 693.843 1.00 141.12 ? 8    ARG C NE    1 
ATOM   3618  C  CZ    . ARG C 2  8    ? 468.159 -42.332 694.129 1.00 140.00 ? 8    ARG C CZ    1 
ATOM   3619  N  NH1   . ARG C 2  8    ? 468.858 -42.629 695.223 1.00 138.17 ? 8    ARG C NH1   1 
ATOM   3620  N  NH2   . ARG C 2  8    ? 467.743 -43.298 693.311 1.00 132.13 ? 8    ARG C NH2   1 
ATOM   3621  N  N     . ILE C 2  9    ? 472.397 -39.160 690.695 1.00 127.99 ? 9    ILE C N     1 
ATOM   3622  C  CA    . ILE C 2  9    ? 472.841 -39.721 689.425 1.00 128.78 ? 9    ILE C CA    1 
ATOM   3623  C  C     . ILE C 2  9    ? 474.355 -39.882 689.436 1.00 128.32 ? 9    ILE C C     1 
ATOM   3624  O  O     . ILE C 2  9    ? 475.102 -38.912 689.607 1.00 126.40 ? 9    ILE C O     1 
ATOM   3625  C  CB    . ILE C 2  9    ? 472.361 -38.873 688.236 1.00 126.68 ? 9    ILE C CB    1 
ATOM   3626  C  CG1   . ILE C 2  9    ? 470.847 -39.029 688.088 1.00 124.55 ? 9    ILE C CG1   1 
ATOM   3627  C  CG2   . ILE C 2  9    ? 473.019 -39.319 686.943 1.00 122.19 ? 9    ILE C CG2   1 
ATOM   3628  C  CD1   . ILE C 2  9    ? 470.290 -38.485 686.802 1.00 121.69 ? 9    ILE C CD1   1 
ATOM   3629  N  N     . ARG C 2  10   ? 474.808 -41.105 689.207 1.00 124.92 ? 10   ARG C N     1 
ATOM   3630  C  CA    . ARG C 2  10   ? 476.220 -41.427 689.146 1.00 123.42 ? 10   ARG C CA    1 
ATOM   3631  C  C     . ARG C 2  10   ? 476.540 -41.434 687.657 1.00 134.93 ? 10   ARG C C     1 
ATOM   3632  O  O     . ARG C 2  10   ? 475.992 -42.246 686.901 1.00 138.77 ? 10   ARG C O     1 
ATOM   3633  C  CB    . ARG C 2  10   ? 476.460 -42.786 689.808 1.00 126.55 ? 10   ARG C CB    1 
ATOM   3634  C  CG    . ARG C 2  10   ? 477.873 -43.167 690.247 1.00 133.15 ? 10   ARG C CG    1 
ATOM   3635  C  CD    . ARG C 2  10   ? 478.478 -44.180 689.274 1.00 137.47 ? 10   ARG C CD    1 
ATOM   3636  N  NE    . ARG C 2  10   ? 477.697 -45.424 689.211 1.00 140.18 ? 10   ARG C NE    1 
ATOM   3637  C  CZ    . ARG C 2  10   ? 478.060 -46.514 688.534 1.00 144.61 ? 10   ARG C CZ    1 
ATOM   3638  N  NH1   . ARG C 2  10   ? 477.280 -47.591 688.528 1.00 141.06 ? 10   ARG C NH1   1 
ATOM   3639  N  NH2   . ARG C 2  10   ? 479.213 -46.539 687.873 1.00 147.72 ? 10   ARG C NH2   1 
ATOM   3640  N  N     . GLU C 2  11   ? 477.397 -40.513 687.233 1.00 130.22 ? 11   GLU C N     1 
ATOM   3641  C  CA    . GLU C 2  11   ? 477.761 -40.386 685.831 1.00 117.61 ? 11   GLU C CA    1 
ATOM   3642  C  C     . GLU C 2  11   ? 478.978 -41.248 685.567 1.00 124.11 ? 11   GLU C C     1 
ATOM   3643  O  O     . GLU C 2  11   ? 480.062 -40.984 686.099 1.00 128.30 ? 11   GLU C O     1 
ATOM   3644  C  CB    . GLU C 2  11   ? 477.992 -38.915 685.526 1.00 113.90 ? 11   GLU C CB    1 
ATOM   3645  C  CG    . GLU C 2  11   ? 476.724 -38.166 685.838 1.00 117.03 ? 11   GLU C CG    1 
ATOM   3646  C  CD    . GLU C 2  11   ? 476.849 -36.665 685.828 1.00 119.52 ? 11   GLU C CD    1 
ATOM   3647  O  OE1   . GLU C 2  11   ? 477.975 -36.152 685.621 1.00 117.21 ? 11   GLU C OE1   1 
ATOM   3648  O  OE2   . GLU C 2  11   ? 475.790 -36.008 686.017 1.00 120.00 ? 11   GLU C OE2   1 
ATOM   3649  N  N     . VAL C 2  12   ? 478.783 -42.294 684.756 1.00 127.01 ? 12   VAL C N     1 
ATOM   3650  C  CA    . VAL C 2  12   ? 479.841 -43.268 684.516 1.00 126.90 ? 12   VAL C CA    1 
ATOM   3651  C  C     . VAL C 2  12   ? 481.034 -42.713 683.752 1.00 119.43 ? 12   VAL C C     1 
ATOM   3652  O  O     . VAL C 2  12   ? 482.135 -43.248 683.902 1.00 126.05 ? 12   VAL C O     1 
ATOM   3653  C  CB    . VAL C 2  12   ? 479.296 -44.492 683.765 1.00 125.51 ? 12   VAL C CB    1 
ATOM   3654  C  CG1   . VAL C 2  12   ? 478.364 -45.261 684.670 1.00 136.01 ? 12   VAL C CG1   1 
ATOM   3655  C  CG2   . VAL C 2  12   ? 478.608 -44.067 682.492 1.00 119.13 ? 12   VAL C CG2   1 
ATOM   3656  N  N     . ILE C 2  13   ? 480.878 -41.653 682.961 1.00 116.72 ? 13   ILE C N     1 
ATOM   3657  C  CA    . ILE C 2  13   ? 482.021 -41.118 682.209 1.00 117.77 ? 13   ILE C CA    1 
ATOM   3658  C  C     . ILE C 2  13   ? 482.064 -39.603 682.353 1.00 112.07 ? 13   ILE C C     1 
ATOM   3659  O  O     . ILE C 2  13   ? 481.012 -38.958 682.469 1.00 111.09 ? 13   ILE C O     1 
ATOM   3660  C  CB    . ILE C 2  13   ? 482.028 -41.530 680.720 1.00 111.23 ? 13   ILE C CB    1 
ATOM   3661  C  CG1   . ILE C 2  13   ? 480.740 -41.158 680.003 1.00 113.29 ? 13   ILE C CG1   1 
ATOM   3662  C  CG2   . ILE C 2  13   ? 482.372 -43.016 680.530 1.00 106.15 ? 13   ILE C CG2   1 
ATOM   3663  C  CD1   . ILE C 2  13   ? 480.850 -41.360 678.509 1.00 110.35 ? 13   ILE C CD1   1 
ATOM   3664  N  N     . PRO C 2  14   ? 483.250 -39.003 682.361 1.00 107.67 ? 14   PRO C N     1 
ATOM   3665  C  CA    . PRO C 2  14   ? 483.343 -37.545 682.373 1.00 107.86 ? 14   PRO C CA    1 
ATOM   3666  C  C     . PRO C 2  14   ? 483.043 -36.954 681.006 1.00 109.68 ? 14   PRO C C     1 
ATOM   3667  O  O     . PRO C 2  14   ? 482.977 -37.645 679.987 1.00 112.68 ? 14   PRO C O     1 
ATOM   3668  C  CB    . PRO C 2  14   ? 484.800 -37.291 682.777 1.00 103.69 ? 14   PRO C CB    1 
ATOM   3669  C  CG    . PRO C 2  14   ? 485.515 -38.450 682.218 1.00 104.20 ? 14   PRO C CG    1 
ATOM   3670  C  CD    . PRO C 2  14   ? 484.583 -39.629 682.361 1.00 107.69 ? 14   PRO C CD    1 
ATOM   3671  N  N     . LEU C 2  15   ? 482.792 -35.656 681.027 1.00 107.20 ? 15   LEU C N     1 
ATOM   3672  C  CA    . LEU C 2  15   ? 482.624 -34.891 679.808 1.00 106.47 ? 15   LEU C CA    1 
ATOM   3673  C  C     . LEU C 2  15   ? 483.860 -35.087 678.923 1.00 112.10 ? 15   LEU C C     1 
ATOM   3674  O  O     . LEU C 2  15   ? 484.982 -35.132 679.445 1.00 113.63 ? 15   LEU C O     1 
ATOM   3675  C  CB    . LEU C 2  15   ? 482.446 -33.428 680.219 1.00 111.07 ? 15   LEU C CB    1 
ATOM   3676  C  CG    . LEU C 2  15   ? 481.105 -32.691 680.107 1.00 106.39 ? 15   LEU C CG    1 
ATOM   3677  C  CD1   . LEU C 2  15   ? 479.959 -33.579 680.526 1.00 95.36  ? 15   LEU C CD1   1 
ATOM   3678  C  CD2   . LEU C 2  15   ? 481.153 -31.492 681.046 1.00 90.89  ? 15   LEU C CD2   1 
ATOM   3679  N  N     . PRO C 2  16   ? 483.703 -35.229 677.599 1.00 111.38 ? 16   PRO C N     1 
ATOM   3680  C  CA    . PRO C 2  16   ? 484.881 -35.390 676.715 1.00 105.06 ? 16   PRO C CA    1 
ATOM   3681  C  C     . PRO C 2  16   ? 485.702 -34.114 676.696 1.00 107.12 ? 16   PRO C C     1 
ATOM   3682  O  O     . PRO C 2  16   ? 485.197 -33.059 677.109 1.00 107.04 ? 16   PRO C O     1 
ATOM   3683  C  CB    . PRO C 2  16   ? 484.258 -35.673 675.341 1.00 107.66 ? 16   PRO C CB    1 
ATOM   3684  C  CG    . PRO C 2  16   ? 482.859 -36.100 675.619 1.00 106.98 ? 16   PRO C CG    1 
ATOM   3685  C  CD    . PRO C 2  16   ? 482.445 -35.330 676.840 1.00 109.40 ? 16   PRO C CD    1 
ATOM   3686  N  N     . PRO C 2  17   ? 486.935 -34.140 676.176 1.00 109.23 ? 17   PRO C N     1 
ATOM   3687  C  CA    . PRO C 2  17   ? 487.690 -32.879 676.020 1.00 104.91 ? 17   PRO C CA    1 
ATOM   3688  C  C     . PRO C 2  17   ? 486.908 -31.915 675.146 1.00 106.89 ? 17   PRO C C     1 
ATOM   3689  O  O     . PRO C 2  17   ? 486.596 -32.205 673.990 1.00 105.27 ? 17   PRO C O     1 
ATOM   3690  C  CB    . PRO C 2  17   ? 488.994 -33.325 675.372 1.00 104.62 ? 17   PRO C CB    1 
ATOM   3691  C  CG    . PRO C 2  17   ? 489.096 -34.793 675.700 1.00 109.93 ? 17   PRO C CG    1 
ATOM   3692  C  CD    . PRO C 2  17   ? 487.708 -35.312 675.736 1.00 110.93 ? 17   PRO C CD    1 
ATOM   3693  N  N     . LEU C 2  18   ? 486.668 -30.722 675.690 1.00 111.65 ? 18   LEU C N     1 
ATOM   3694  C  CA    . LEU C 2  18   ? 485.636 -29.859 675.123 1.00 105.92 ? 18   LEU C CA    1 
ATOM   3695  C  C     . LEU C 2  18   ? 486.027 -29.197 673.804 1.00 104.57 ? 18   LEU C C     1 
ATOM   3696  O  O     . LEU C 2  18   ? 485.144 -28.968 672.974 1.00 109.15 ? 18   LEU C O     1 
ATOM   3697  C  CB    . LEU C 2  18   ? 485.201 -28.839 676.181 1.00 105.66 ? 18   LEU C CB    1 
ATOM   3698  C  CG    . LEU C 2  18   ? 484.436 -29.571 677.317 1.00 108.72 ? 18   LEU C CG    1 
ATOM   3699  C  CD1   . LEU C 2  18   ? 483.946 -28.645 678.444 1.00 106.77 ? 18   LEU C CD1   1 
ATOM   3700  C  CD2   . LEU C 2  18   ? 483.297 -30.480 676.821 1.00 106.28 ? 18   LEU C CD2   1 
ATOM   3701  N  N     . THR C 2  19   ? 487.309 -28.894 673.569 1.00 106.37 ? 19   THR C N     1 
ATOM   3702  C  CA    . THR C 2  19   ? 487.728 -28.325 672.286 1.00 101.36 ? 19   THR C CA    1 
ATOM   3703  C  C     . THR C 2  19   ? 488.184 -29.388 671.325 1.00 97.88  ? 19   THR C C     1 
ATOM   3704  O  O     . THR C 2  19   ? 488.719 -29.051 670.276 1.00 103.26 ? 19   THR C O     1 
ATOM   3705  C  CB    . THR C 2  19   ? 488.881 -27.324 672.416 1.00 99.39  ? 19   THR C CB    1 
ATOM   3706  O  OG1   . THR C 2  19   ? 489.963 -27.920 673.129 1.00 106.73 ? 19   THR C OG1   1 
ATOM   3707  C  CG2   . THR C 2  19   ? 488.428 -26.111 673.201 1.00 105.86 ? 19   THR C CG2   1 
ATOM   3708  N  N     . GLU C 2  20   ? 488.006 -30.658 671.659 1.00 100.08 ? 20   GLU C N     1 
ATOM   3709  C  CA    . GLU C 2  20   ? 488.511 -31.719 670.800 1.00 104.03 ? 20   GLU C CA    1 
ATOM   3710  C  C     . GLU C 2  20   ? 487.974 -31.638 669.371 1.00 108.60 ? 20   GLU C C     1 
ATOM   3711  O  O     . GLU C 2  20   ? 488.671 -32.035 668.422 1.00 103.70 ? 20   GLU C O     1 
ATOM   3712  C  CB    . GLU C 2  20   ? 488.157 -33.065 671.426 1.00 104.52 ? 20   GLU C CB    1 
ATOM   3713  C  CG    . GLU C 2  20   ? 486.768 -33.536 671.023 1.00 108.39 ? 20   GLU C CG    1 
ATOM   3714  C  CD    . GLU C 2  20   ? 486.458 -34.943 671.464 1.00 114.74 ? 20   GLU C CD    1 
ATOM   3715  O  OE1   . GLU C 2  20   ? 487.371 -35.796 671.391 1.00 114.01 ? 20   GLU C OE1   1 
ATOM   3716  O  OE2   . GLU C 2  20   ? 485.294 -35.191 671.870 1.00 114.96 ? 20   GLU C OE2   1 
ATOM   3717  N  N     . ILE C 2  21   ? 486.774 -31.087 669.181 1.00 106.94 ? 21   ILE C N     1 
ATOM   3718  C  CA    . ILE C 2  21   ? 486.241 -30.979 667.827 1.00 102.19 ? 21   ILE C CA    1 
ATOM   3719  C  C     . ILE C 2  21   ? 487.161 -30.133 666.948 1.00 101.89 ? 21   ILE C C     1 
ATOM   3720  O  O     . ILE C 2  21   ? 487.272 -30.368 665.740 1.00 101.95 ? 21   ILE C O     1 
ATOM   3721  C  CB    . ILE C 2  21   ? 484.809 -30.418 667.863 1.00 97.07  ? 21   ILE C CB    1 
ATOM   3722  C  CG1   . ILE C 2  21   ? 484.188 -30.449 666.483 1.00 92.84  ? 21   ILE C CG1   1 
ATOM   3723  C  CG2   . ILE C 2  21   ? 484.833 -28.956 668.270 1.00 94.24  ? 21   ILE C CG2   1 
ATOM   3724  C  CD1   . ILE C 2  21   ? 482.792 -29.907 666.461 1.00 93.23  ? 21   ILE C CD1   1 
ATOM   3725  N  N     . GLN C 2  22   ? 487.850 -29.158 667.538 1.00 99.64  ? 22   GLN C N     1 
ATOM   3726  C  CA    . GLN C 2  22   ? 488.806 -28.309 666.833 1.00 98.36  ? 22   GLN C CA    1 
ATOM   3727  C  C     . GLN C 2  22   ? 490.193 -28.953 666.780 1.00 101.24 ? 22   GLN C C     1 
ATOM   3728  O  O     . GLN C 2  22   ? 490.759 -29.147 665.698 1.00 99.19  ? 22   GLN C O     1 
ATOM   3729  C  CB    . GLN C 2  22   ? 488.863 -26.960 667.556 1.00 95.23  ? 22   GLN C CB    1 
ATOM   3730  C  CG    . GLN C 2  22   ? 487.595 -26.112 667.416 1.00 94.67  ? 22   GLN C CG    1 
ATOM   3731  C  CD    . GLN C 2  22   ? 487.462 -25.383 666.110 1.00 92.98  ? 22   GLN C CD    1 
ATOM   3732  O  OE1   . GLN C 2  22   ? 488.413 -24.784 665.613 1.00 92.98  ? 22   GLN C OE1   1 
ATOM   3733  N  NE2   . GLN C 2  22   ? 486.265 -25.415 665.547 1.00 94.49  ? 22   GLN C NE2   1 
ATOM   3734  N  N     . VAL C 2  23   ? 490.796 -29.162 667.950 1.00 97.16  ? 23   VAL C N     1 
ATOM   3735  C  CA    . VAL C 2  23   ? 492.146 -29.707 668.033 1.00 95.64  ? 23   VAL C CA    1 
ATOM   3736  C  C     . VAL C 2  23   ? 492.263 -31.003 667.240 1.00 97.56  ? 23   VAL C C     1 
ATOM   3737  O  O     . VAL C 2  23   ? 493.163 -31.162 666.414 1.00 97.05  ? 23   VAL C O     1 
ATOM   3738  C  CB    . VAL C 2  23   ? 492.565 -29.861 669.503 1.00 98.07  ? 23   VAL C CB    1 
ATOM   3739  C  CG1   . VAL C 2  23   ? 493.808 -30.709 669.628 1.00 105.94 ? 23   VAL C CG1   1 
ATOM   3740  C  CG2   . VAL C 2  23   ? 492.875 -28.475 670.052 1.00 94.61  ? 23   VAL C CG2   1 
ATOM   3741  N  N     . GLU C 2  24   ? 491.371 -31.960 667.491 1.00 100.15 ? 24   GLU C N     1 
ATOM   3742  C  CA    . GLU C 2  24   ? 491.477 -33.247 666.804 1.00 104.86 ? 24   GLU C CA    1 
ATOM   3743  C  C     . GLU C 2  24   ? 491.260 -33.145 665.304 1.00 105.13 ? 24   GLU C C     1 
ATOM   3744  O  O     . GLU C 2  24   ? 491.849 -33.923 664.547 1.00 109.64 ? 24   GLU C O     1 
ATOM   3745  C  CB    . GLU C 2  24   ? 490.485 -34.262 667.372 1.00 106.77 ? 24   GLU C CB    1 
ATOM   3746  C  CG    . GLU C 2  24   ? 490.968 -34.972 668.592 1.00 111.37 ? 24   GLU C CG    1 
ATOM   3747  C  CD    . GLU C 2  24   ? 492.390 -35.468 668.370 1.00 124.60 ? 24   GLU C CD    1 
ATOM   3748  O  OE1   . GLU C 2  24   ? 493.291 -35.083 669.160 1.00 126.72 ? 24   GLU C OE1   1 
ATOM   3749  O  OE2   . GLU C 2  24   ? 492.611 -36.193 667.352 1.00 118.88 ? 24   GLU C OE2   1 
ATOM   3750  N  N     . SER C 2  25   ? 490.379 -32.254 664.861 1.00 104.82 ? 25   SER C N     1 
ATOM   3751  C  CA    . SER C 2  25   ? 490.129 -32.098 663.433 1.00 98.94  ? 25   SER C CA    1 
ATOM   3752  C  C     . SER C 2  25   ? 491.379 -31.659 662.677 1.00 100.95 ? 25   SER C C     1 
ATOM   3753  O  O     . SER C 2  25   ? 491.762 -32.283 661.684 1.00 106.29 ? 25   SER C O     1 
ATOM   3754  C  CB    . SER C 2  25   ? 488.984 -31.109 663.225 1.00 99.56  ? 25   SER C CB    1 
ATOM   3755  O  OG    . SER C 2  25   ? 488.917 -30.660 661.892 1.00 98.33  ? 25   SER C OG    1 
ATOM   3756  N  N     . TYR C 2  26   ? 492.048 -30.600 663.143 1.00 100.57 ? 26   TYR C N     1 
ATOM   3757  C  CA    . TYR C 2  26   ? 493.209 -30.091 662.412 1.00 95.25  ? 26   TYR C CA    1 
ATOM   3758  C  C     . TYR C 2  26   ? 494.394 -31.026 662.516 1.00 97.60  ? 26   TYR C C     1 
ATOM   3759  O  O     . TYR C 2  26   ? 495.089 -31.260 661.530 1.00 105.11 ? 26   TYR C O     1 
ATOM   3760  C  CB    . TYR C 2  26   ? 493.577 -28.728 662.964 1.00 88.78  ? 26   TYR C CB    1 
ATOM   3761  C  CG    . TYR C 2  26   ? 494.174 -27.742 662.013 1.00 91.35  ? 26   TYR C CG    1 
ATOM   3762  C  CD1   . TYR C 2  26   ? 493.468 -27.312 660.890 1.00 94.50  ? 26   TYR C CD1   1 
ATOM   3763  C  CD2   . TYR C 2  26   ? 495.384 -27.120 662.307 1.00 96.47  ? 26   TYR C CD2   1 
ATOM   3764  C  CE1   . TYR C 2  26   ? 493.988 -26.349 660.032 1.00 86.59  ? 26   TYR C CE1   1 
ATOM   3765  C  CE2   . TYR C 2  26   ? 495.912 -26.155 661.459 1.00 95.92  ? 26   TYR C CE2   1 
ATOM   3766  C  CZ    . TYR C 2  26   ? 495.201 -25.777 660.331 1.00 88.29  ? 26   TYR C CZ    1 
ATOM   3767  O  OH    . TYR C 2  26   ? 495.715 -24.830 659.501 1.00 88.85  ? 26   TYR C OH    1 
ATOM   3768  N  N     . ARG C 2  27   ? 494.605 -31.619 663.679 1.00 101.84 ? 27   ARG C N     1 
ATOM   3769  C  CA    . ARG C 2  27   ? 495.694 -32.573 663.820 1.00 107.54 ? 27   ARG C CA    1 
ATOM   3770  C  C     . ARG C 2  27   ? 495.514 -33.684 662.793 1.00 107.93 ? 27   ARG C C     1 
ATOM   3771  O  O     . ARG C 2  27   ? 496.484 -34.127 662.171 1.00 113.77 ? 27   ARG C O     1 
ATOM   3772  C  CB    . ARG C 2  27   ? 495.802 -33.051 665.266 1.00 113.01 ? 27   ARG C CB    1 
ATOM   3773  C  CG    . ARG C 2  27   ? 497.191 -33.548 665.627 1.00 117.48 ? 27   ARG C CG    1 
ATOM   3774  C  CD    . ARG C 2  27   ? 497.187 -34.264 666.960 1.00 120.95 ? 27   ARG C CD    1 
ATOM   3775  N  NE    . ARG C 2  27   ? 496.086 -35.213 667.024 1.00 126.28 ? 27   ARG C NE    1 
ATOM   3776  C  CZ    . ARG C 2  27   ? 496.054 -36.372 666.379 1.00 127.67 ? 27   ARG C CZ    1 
ATOM   3777  N  NH1   . ARG C 2  27   ? 497.074 -36.737 665.612 1.00 126.22 ? 27   ARG C NH1   1 
ATOM   3778  N  NH2   . ARG C 2  27   ? 494.995 -37.164 666.500 1.00 130.69 ? 27   ARG C NH2   1 
ATOM   3779  N  N     . ARG C 2  28   ? 494.270 -34.142 662.608 1.00 107.45 ? 28   ARG C N     1 
ATOM   3780  C  CA    . ARG C 2  28   ? 493.977 -35.165 661.607 1.00 111.21 ? 28   ARG C CA    1 
ATOM   3781  C  C     . ARG C 2  28   ? 494.321 -34.701 660.191 1.00 110.25 ? 28   ARG C C     1 
ATOM   3782  O  O     . ARG C 2  28   ? 494.784 -35.496 659.373 1.00 116.38 ? 28   ARG C O     1 
ATOM   3783  C  CB    . ARG C 2  28   ? 492.470 -35.448 661.623 1.00 113.30 ? 28   ARG C CB    1 
ATOM   3784  C  CG    . ARG C 2  28   ? 491.890 -36.396 660.527 1.00 120.38 ? 28   ARG C CG    1 
ATOM   3785  C  CD    . ARG C 2  28   ? 490.808 -37.411 660.981 1.00 128.37 ? 28   ARG C CD    1 
ATOM   3786  N  NE    . ARG C 2  28   ? 491.081 -38.337 662.074 1.00 134.93 ? 28   ARG C NE    1 
ATOM   3787  C  CZ    . ARG C 2  28   ? 491.527 -39.580 661.905 1.00 138.20 ? 28   ARG C CZ    1 
ATOM   3788  N  NH1   . ARG C 2  28   ? 491.738 -40.055 660.679 1.00 125.86 ? 28   ARG C NH1   1 
ATOM   3789  N  NH2   . ARG C 2  28   ? 491.732 -40.360 662.962 1.00 142.82 ? 28   ARG C NH2   1 
ATOM   3790  N  N     . ALA C 2  29   ? 494.086 -33.429 659.869 1.00 106.60 ? 29   ALA C N     1 
ATOM   3791  C  CA    . ALA C 2  29   ? 494.408 -32.922 658.530 1.00 108.02 ? 29   ALA C CA    1 
ATOM   3792  C  C     . ALA C 2  29   ? 495.912 -32.781 658.253 1.00 107.81 ? 29   ALA C C     1 
ATOM   3793  O  O     . ALA C 2  29   ? 496.387 -33.155 657.175 1.00 109.40 ? 29   ALA C O     1 
ATOM   3794  C  CB    . ALA C 2  29   ? 493.702 -31.593 658.284 1.00 108.83 ? 29   ALA C CB    1 
ATOM   3795  N  N     . LEU C 2  30   ? 496.677 -32.216 659.197 1.00 107.28 ? 30   LEU C N     1 
ATOM   3796  C  CA    . LEU C 2  30   ? 498.095 -31.943 658.942 1.00 107.11 ? 30   LEU C CA    1 
ATOM   3797  C  C     . LEU C 2  30   ? 499.010 -33.148 659.125 1.00 106.71 ? 30   LEU C C     1 
ATOM   3798  O  O     . LEU C 2  30   ? 499.986 -33.294 658.389 1.00 98.12  ? 30   LEU C O     1 
ATOM   3799  C  CB    . LEU C 2  30   ? 498.577 -30.815 659.847 1.00 105.80 ? 30   LEU C CB    1 
ATOM   3800  C  CG    . LEU C 2  30   ? 497.837 -29.498 659.669 1.00 99.78  ? 30   LEU C CG    1 
ATOM   3801  C  CD1   . LEU C 2  30   ? 498.552 -28.389 660.436 1.00 97.10  ? 30   LEU C CD1   1 
ATOM   3802  C  CD2   . LEU C 2  30   ? 497.635 -29.159 658.195 1.00 99.71  ? 30   LEU C CD2   1 
ATOM   3803  N  N     . GLN C 2  31   ? 498.729 -34.002 660.098 1.00 110.58 ? 31   GLN C N     1 
ATOM   3804  C  CA    . GLN C 2  31   ? 499.578 -35.148 660.412 1.00 107.15 ? 31   GLN C CA    1 
ATOM   3805  C  C     . GLN C 2  31   ? 501.045 -34.759 660.523 1.00 101.40 ? 31   GLN C C     1 
ATOM   3806  O  O     . GLN C 2  31   ? 501.929 -35.517 660.144 1.00 110.15 ? 31   GLN C O     1 
ATOM   3807  C  CB    . GLN C 2  31   ? 499.398 -36.262 659.385 1.00 105.90 ? 31   GLN C CB    1 
ATOM   3808  C  CG    . GLN C 2  31   ? 497.947 -36.526 659.094 1.00 108.30 ? 31   GLN C CG    1 
ATOM   3809  C  CD    . GLN C 2  31   ? 497.735 -37.573 658.046 1.00 109.49 ? 31   GLN C CD    1 
ATOM   3810  O  OE1   . GLN C 2  31   ? 498.095 -38.730 658.241 1.00 112.55 ? 31   GLN C OE1   1 
ATOM   3811  N  NE2   . GLN C 2  31   ? 497.182 -37.170 656.906 1.00 112.40 ? 31   GLN C NE2   1 
ATOM   3812  N  N     . ALA C 2  32   ? 501.314 -33.615 661.144 1.00 97.67  ? 32   ALA C N     1 
ATOM   3813  C  CA    . ALA C 2  32   ? 502.675 -33.098 661.177 1.00 97.23  ? 32   ALA C CA    1 
ATOM   3814  C  C     . ALA C 2  32   ? 503.560 -33.994 662.036 1.00 107.49 ? 32   ALA C C     1 
ATOM   3815  O  O     . ALA C 2  32   ? 504.766 -34.079 661.810 1.00 113.46 ? 32   ALA C O     1 
ATOM   3816  C  CB    . ALA C 2  32   ? 502.689 -31.662 661.685 1.00 97.44  ? 32   ALA C CB    1 
ATOM   3817  N  N     . ASP C 2  33   ? 503.005 -34.580 663.082 1.00 119.43 ? 33   ASP C N     1 
ATOM   3818  C  CA    . ASP C 2  33   ? 503.736 -35.446 663.996 1.00 121.90 ? 33   ASP C CA    1 
ATOM   3819  C  C     . ASP C 2  33   ? 503.787 -36.896 663.503 1.00 118.94 ? 33   ASP C C     1 
ATOM   3820  O  O     . ASP C 2  33   ? 504.340 -37.755 664.196 1.00 122.40 ? 33   ASP C O     1 
ATOM   3821  C  CB    . ASP C 2  33   ? 503.094 -35.369 665.388 1.00 122.80 ? 33   ASP C CB    1 
ATOM   3822  C  CG    . ASP C 2  33   ? 503.511 -34.115 666.143 1.00 135.19 ? 33   ASP C CG    1 
ATOM   3823  O  OD1   . ASP C 2  33   ? 503.873 -33.114 665.468 1.00 130.51 ? 33   ASP C OD1   1 
ATOM   3824  O  OD2   . ASP C 2  33   ? 503.469 -34.125 667.399 1.00 138.46 ? 33   ASP C OD2   1 
ATOM   3825  N  N     . VAL C 2  34   ? 503.191 -37.187 662.347 1.00 112.88 ? 34   VAL C N     1 
ATOM   3826  C  CA    . VAL C 2  34   ? 503.266 -38.489 661.680 1.00 118.79 ? 34   VAL C CA    1 
ATOM   3827  C  C     . VAL C 2  34   ? 504.422 -38.523 660.681 1.00 124.96 ? 34   VAL C C     1 
ATOM   3828  O  O     . VAL C 2  34   ? 504.541 -37.632 659.821 1.00 121.03 ? 34   VAL C O     1 
ATOM   3829  C  CB    . VAL C 2  34   ? 501.930 -38.818 660.995 1.00 114.40 ? 34   VAL C CB    1 
ATOM   3830  C  CG1   . VAL C 2  34   ? 502.017 -40.114 660.231 1.00 118.47 ? 34   VAL C CG1   1 
ATOM   3831  C  CG2   . VAL C 2  34   ? 500.852 -38.913 662.030 1.00 120.42 ? 34   VAL C CG2   1 
ATOM   3832  N  N     . PRO C 2  35   ? 505.252 -39.562 660.712 1.00 128.85 ? 35   PRO C N     1 
ATOM   3833  C  CA    . PRO C 2  35   ? 506.308 -39.721 659.704 1.00 126.04 ? 35   PRO C CA    1 
ATOM   3834  C  C     . PRO C 2  35   ? 505.730 -39.957 658.323 1.00 125.46 ? 35   PRO C C     1 
ATOM   3835  O  O     . PRO C 2  35   ? 504.846 -40.811 658.159 1.00 126.47 ? 35   PRO C O     1 
ATOM   3836  C  CB    . PRO C 2  35   ? 507.075 -40.964 660.187 1.00 125.84 ? 35   PRO C CB    1 
ATOM   3837  C  CG    . PRO C 2  35   ? 506.131 -41.653 661.091 1.00 129.16 ? 35   PRO C CG    1 
ATOM   3838  C  CD    . PRO C 2  35   ? 505.317 -40.605 661.744 1.00 129.13 ? 35   PRO C CD    1 
ATOM   3839  N  N     . PRO C 2  36   ? 506.216 -39.228 657.312 1.00 121.94 ? 36   PRO C N     1 
ATOM   3840  C  CA    . PRO C 2  36   ? 505.573 -39.253 655.991 1.00 122.39 ? 36   PRO C CA    1 
ATOM   3841  C  C     . PRO C 2  36   ? 505.229 -40.642 655.494 1.00 132.83 ? 36   PRO C C     1 
ATOM   3842  O  O     . PRO C 2  36   ? 504.174 -40.808 654.873 1.00 138.38 ? 36   PRO C O     1 
ATOM   3843  C  CB    . PRO C 2  36   ? 506.611 -38.565 655.104 1.00 124.99 ? 36   PRO C CB    1 
ATOM   3844  C  CG    . PRO C 2  36   ? 507.205 -37.552 656.001 1.00 125.50 ? 36   PRO C CG    1 
ATOM   3845  C  CD    . PRO C 2  36   ? 507.188 -38.131 657.413 1.00 125.11 ? 36   PRO C CD    1 
ATOM   3846  N  N     . GLU C 2  37   ? 506.099 -41.640 655.699 1.00 138.48 ? 37   GLU C N     1 
ATOM   3847  C  CA    . GLU C 2  37   ? 505.778 -42.963 655.173 1.00 144.86 ? 37   GLU C CA    1 
ATOM   3848  C  C     . GLU C 2  37   ? 504.567 -43.571 655.885 1.00 148.40 ? 37   GLU C C     1 
ATOM   3849  O  O     . GLU C 2  37   ? 503.878 -44.421 655.306 1.00 152.36 ? 37   GLU C O     1 
ATOM   3850  C  CB    . GLU C 2  37   ? 506.959 -43.936 655.296 1.00 143.75 ? 37   GLU C CB    1 
ATOM   3851  C  CG    . GLU C 2  37   ? 507.498 -44.232 656.710 1.00 139.56 ? 37   GLU C CG    1 
ATOM   3852  C  CD    . GLU C 2  37   ? 508.511 -43.221 657.240 1.00 140.74 ? 37   GLU C CD    1 
ATOM   3853  O  OE1   . GLU C 2  37   ? 508.999 -42.367 656.457 1.00 133.39 ? 37   GLU C OE1   1 
ATOM   3854  O  OE2   . GLU C 2  37   ? 508.851 -43.321 658.449 1.00 137.04 ? 37   GLU C OE2   1 
ATOM   3855  N  N     . LYS C 2  38   ? 504.281 -43.147 657.118 1.00 139.37 ? 38   LYS C N     1 
ATOM   3856  C  CA    . LYS C 2  38   ? 503.188 -43.705 657.899 1.00 139.18 ? 38   LYS C CA    1 
ATOM   3857  C  C     . LYS C 2  38   ? 501.913 -42.890 657.775 1.00 138.72 ? 38   LYS C C     1 
ATOM   3858  O  O     . LYS C 2  38   ? 500.934 -43.187 658.467 1.00 135.56 ? 38   LYS C O     1 
ATOM   3859  C  CB    . LYS C 2  38   ? 503.610 -43.851 659.369 1.00 134.37 ? 38   LYS C CB    1 
ATOM   3860  C  CG    . LYS C 2  38   ? 504.451 -45.103 659.620 1.00 136.51 ? 38   LYS C CG    1 
ATOM   3861  C  CD    . LYS C 2  38   ? 505.461 -44.950 660.741 1.00 132.39 ? 38   LYS C CD    1 
ATOM   3862  C  CE    . LYS C 2  38   ? 504.871 -44.825 662.113 1.00 130.56 ? 38   LYS C CE    1 
ATOM   3863  N  NZ    . LYS C 2  38   ? 505.994 -44.595 663.069 1.00 125.18 ? 38   LYS C NZ    1 
ATOM   3864  N  N     . ARG C 2  39   ? 501.892 -41.871 656.914 1.00 136.03 ? 39   ARG C N     1 
ATOM   3865  C  CA    . ARG C 2  39   ? 500.676 -41.086 656.825 1.00 131.60 ? 39   ARG C CA    1 
ATOM   3866  C  C     . ARG C 2  39   ? 499.607 -41.896 656.114 1.00 132.72 ? 39   ARG C C     1 
ATOM   3867  O  O     . ARG C 2  39   ? 499.865 -42.513 655.080 1.00 136.93 ? 39   ARG C O     1 
ATOM   3868  C  CB    . ARG C 2  39   ? 500.923 -39.753 656.097 1.00 120.54 ? 39   ARG C CB    1 
ATOM   3869  C  CG    . ARG C 2  39   ? 501.788 -38.758 656.908 1.00 120.17 ? 39   ARG C CG    1 
ATOM   3870  C  CD    . ARG C 2  39   ? 501.681 -37.298 656.430 1.00 110.20 ? 39   ARG C CD    1 
ATOM   3871  N  NE    . ARG C 2  39   ? 502.460 -36.353 657.248 1.00 106.60 ? 39   ARG C NE    1 
ATOM   3872  C  CZ    . ARG C 2  39   ? 503.560 -35.708 656.873 1.00 108.87 ? 39   ARG C CZ    1 
ATOM   3873  N  NH1   . ARG C 2  39   ? 504.050 -35.879 655.658 1.00 121.78 ? 39   ARG C NH1   1 
ATOM   3874  N  NH2   . ARG C 2  39   ? 504.169 -34.875 657.707 1.00 102.16 ? 39   ARG C NH2   1 
ATOM   3875  N  N     . GLU C 2  40   ? 498.392 -41.853 656.652 1.00 133.96 ? 40   GLU C N     1 
ATOM   3876  C  CA    . GLU C 2  40   ? 497.215 -42.391 655.987 1.00 136.80 ? 40   GLU C CA    1 
ATOM   3877  C  C     . GLU C 2  40   ? 496.745 -41.404 654.930 1.00 130.40 ? 40   GLU C C     1 
ATOM   3878  O  O     . GLU C 2  40   ? 497.112 -40.226 654.943 1.00 125.55 ? 40   GLU C O     1 
ATOM   3879  C  CB    . GLU C 2  40   ? 496.110 -42.729 656.995 1.00 135.16 ? 40   GLU C CB    1 
ATOM   3880  C  CG    . GLU C 2  40   ? 496.495 -43.834 657.986 1.00 143.33 ? 40   GLU C CG    1 
ATOM   3881  C  CD    . GLU C 2  40   ? 497.337 -43.369 659.169 1.00 147.17 ? 40   GLU C CD    1 
ATOM   3882  O  OE1   . GLU C 2  40   ? 497.112 -42.256 659.691 1.00 143.52 ? 40   GLU C OE1   1 
ATOM   3883  O  OE2   . GLU C 2  40   ? 498.220 -44.147 659.598 1.00 153.35 ? 40   GLU C OE2   1 
ATOM   3884  N  N     . ASN C 2  41   ? 495.959 -41.902 653.979 1.00 132.55 ? 41   ASN C N     1 
ATOM   3885  C  CA    . ASN C 2  41   ? 495.517 -41.056 652.872 1.00 131.76 ? 41   ASN C CA    1 
ATOM   3886  C  C     . ASN C 2  41   ? 494.237 -40.344 653.295 1.00 134.52 ? 41   ASN C C     1 
ATOM   3887  O  O     . ASN C 2  41   ? 493.123 -40.807 653.038 1.00 137.35 ? 41   ASN C O     1 
ATOM   3888  C  CB    . ASN C 2  41   ? 495.321 -41.910 651.621 1.00 141.62 ? 41   ASN C CB    1 
ATOM   3889  C  CG    . ASN C 2  41   ? 494.927 -41.103 650.391 1.00 136.87 ? 41   ASN C CG    1 
ATOM   3890  O  OD1   . ASN C 2  41   ? 494.055 -40.246 650.435 1.00 123.27 ? 41   ASN C OD1   1 
ATOM   3891  N  ND2   . ASN C 2  41   ? 495.578 -41.402 649.270 1.00 146.85 ? 41   ASN C ND2   1 
ATOM   3892  N  N     . VAL C 2  42   ? 494.409 -39.143 653.851 1.00 132.97 ? 42   VAL C N     1 
ATOM   3893  C  CA    . VAL C 2  42   ? 493.329 -38.356 654.444 1.00 118.78 ? 42   VAL C CA    1 
ATOM   3894  C  C     . VAL C 2  42   ? 493.872 -36.944 654.543 1.00 113.24 ? 42   VAL C C     1 
ATOM   3895  O  O     . VAL C 2  42   ? 495.077 -36.736 654.660 1.00 117.99 ? 42   VAL C O     1 
ATOM   3896  C  CB    . VAL C 2  42   ? 492.891 -38.863 655.845 1.00 116.78 ? 42   VAL C CB    1 
ATOM   3897  C  CG1   . VAL C 2  42   ? 492.293 -40.269 655.820 1.00 120.43 ? 42   VAL C CG1   1 
ATOM   3898  C  CG2   . VAL C 2  42   ? 494.062 -38.811 656.801 1.00 116.06 ? 42   VAL C CG2   1 
ATOM   3899  N  N     . GLY C 2  43   ? 492.979 -35.982 654.647 1.00 112.28 ? 43   GLY C N     1 
ATOM   3900  C  CA    . GLY C 2  43   ? 493.421 -34.608 654.808 1.00 119.23 ? 43   GLY C CA    1 
ATOM   3901  C  C     . GLY C 2  43   ? 494.417 -34.140 653.754 1.00 113.88 ? 43   GLY C C     1 
ATOM   3902  O  O     . GLY C 2  43   ? 494.270 -34.417 652.560 1.00 114.68 ? 43   GLY C O     1 
ATOM   3903  N  N     . ILE C 2  44   ? 495.418 -33.373 654.205 1.00 112.22 ? 44   ILE C N     1 
ATOM   3904  C  CA    . ILE C 2  44   ? 496.476 -32.855 653.329 1.00 117.85 ? 44   ILE C CA    1 
ATOM   3905  C  C     . ILE C 2  44   ? 497.113 -33.928 652.456 1.00 120.95 ? 44   ILE C C     1 
ATOM   3906  O  O     . ILE C 2  44   ? 497.296 -33.727 651.250 1.00 120.01 ? 44   ILE C O     1 
ATOM   3907  C  CB    . ILE C 2  44   ? 497.533 -32.101 654.159 1.00 117.64 ? 44   ILE C CB    1 
ATOM   3908  C  CG1   . ILE C 2  44   ? 496.954 -30.784 654.647 1.00 116.75 ? 44   ILE C CG1   1 
ATOM   3909  C  CG2   . ILE C 2  44   ? 498.795 -31.847 653.374 1.00 118.59 ? 44   ILE C CG2   1 
ATOM   3910  C  CD1   . ILE C 2  44   ? 496.110 -30.123 653.569 1.00 110.64 ? 44   ILE C CD1   1 
ATOM   3911  N  N     . GLN C 2  45   ? 497.503 -35.058 653.048 1.00 123.32 ? 45   GLN C N     1 
ATOM   3912  C  CA    . GLN C 2  45   ? 498.105 -36.121 652.247 1.00 120.21 ? 45   GLN C CA    1 
ATOM   3913  C  C     . GLN C 2  45   ? 497.192 -36.498 651.090 1.00 123.97 ? 45   GLN C C     1 
ATOM   3914  O  O     . GLN C 2  45   ? 497.624 -36.552 649.933 1.00 126.22 ? 45   GLN C O     1 
ATOM   3915  C  CB    . GLN C 2  45   ? 498.433 -37.341 653.102 1.00 123.56 ? 45   GLN C CB    1 
ATOM   3916  C  CG    . GLN C 2  45   ? 499.933 -37.484 653.387 1.00 127.17 ? 45   GLN C CG    1 
ATOM   3917  C  CD    . GLN C 2  45   ? 500.785 -37.757 652.152 1.00 124.13 ? 45   GLN C CD    1 
ATOM   3918  O  OE1   . GLN C 2  45   ? 500.528 -38.700 651.408 1.00 125.82 ? 45   GLN C OE1   1 
ATOM   3919  N  NE2   . GLN C 2  45   ? 501.846 -36.964 651.970 1.00 118.38 ? 45   GLN C NE2   1 
ATOM   3920  N  N     . ALA C 2  46   ? 495.908 -36.733 651.396 1.00 123.99 ? 46   ALA C N     1 
ATOM   3921  C  CA    . ALA C 2  46   ? 494.929 -37.119 650.384 1.00 121.77 ? 46   ALA C CA    1 
ATOM   3922  C  C     . ALA C 2  46   ? 494.762 -36.046 649.322 1.00 119.00 ? 46   ALA C C     1 
ATOM   3923  O  O     . ALA C 2  46   ? 494.435 -36.360 648.176 1.00 121.47 ? 46   ALA C O     1 
ATOM   3924  C  CB    . ALA C 2  46   ? 493.583 -37.405 651.040 1.00 122.86 ? 46   ALA C CB    1 
ATOM   3925  N  N     . ALA C 2  47   ? 494.854 -34.772 649.711 1.00 119.19 ? 47   ALA C N     1 
ATOM   3926  C  CA    . ALA C 2  47   ? 494.769 -33.684 648.739 1.00 119.90 ? 47   ALA C CA    1 
ATOM   3927  C  C     . ALA C 2  47   ? 495.916 -33.747 647.738 1.00 125.36 ? 47   ALA C C     1 
ATOM   3928  O  O     . ALA C 2  47   ? 495.709 -33.580 646.529 1.00 128.46 ? 47   ALA C O     1 
ATOM   3929  C  CB    . ALA C 2  47   ? 494.756 -32.329 649.447 1.00 120.59 ? 47   ALA C CB    1 
ATOM   3930  N  N     . PHE C 2  48   ? 497.148 -33.928 648.234 1.00 125.25 ? 48   PHE C N     1 
ATOM   3931  C  CA    . PHE C 2  48   ? 498.295 -34.041 647.339 1.00 121.41 ? 48   PHE C CA    1 
ATOM   3932  C  C     . PHE C 2  48   ? 498.148 -35.237 646.403 1.00 123.68 ? 48   PHE C C     1 
ATOM   3933  O  O     . PHE C 2  48   ? 498.163 -35.084 645.178 1.00 126.01 ? 48   PHE C O     1 
ATOM   3934  C  CB    . PHE C 2  48   ? 499.596 -34.206 648.138 1.00 121.13 ? 48   PHE C CB    1 
ATOM   3935  C  CG    . PHE C 2  48   ? 500.237 -32.916 648.613 1.00 122.56 ? 48   PHE C CG    1 
ATOM   3936  C  CD1   . PHE C 2  48   ? 500.911 -32.084 647.721 1.00 117.59 ? 48   PHE C CD1   1 
ATOM   3937  C  CD2   . PHE C 2  48   ? 500.312 -32.627 649.978 1.00 118.26 ? 48   PHE C CD2   1 
ATOM   3938  C  CE1   . PHE C 2  48   ? 501.543 -30.925 648.161 1.00 114.17 ? 48   PHE C CE1   1 
ATOM   3939  C  CE2   . PHE C 2  48   ? 500.953 -31.478 650.432 1.00 113.54 ? 48   PHE C CE2   1 
ATOM   3940  C  CZ    . PHE C 2  48   ? 501.571 -30.625 649.519 1.00 117.79 ? 48   PHE C CZ    1 
ATOM   3941  N  N     . ARG C 2  49   ? 497.837 -36.405 646.976 1.00 122.76 ? 49   ARG C N     1 
ATOM   3942  C  CA    . ARG C 2  49   ? 497.690 -37.653 646.232 1.00 126.31 ? 49   ARG C CA    1 
ATOM   3943  C  C     . ARG C 2  49   ? 496.623 -37.557 645.157 1.00 128.53 ? 49   ARG C C     1 
ATOM   3944  O  O     . ARG C 2  49   ? 496.692 -38.253 644.137 1.00 136.95 ? 49   ARG C O     1 
ATOM   3945  C  CB    . ARG C 2  49   ? 497.383 -38.786 647.204 1.00 130.21 ? 49   ARG C CB    1 
ATOM   3946  C  CG    . ARG C 2  49   ? 498.531 -39.065 648.167 1.00 134.83 ? 49   ARG C CG    1 
ATOM   3947  C  CD    . ARG C 2  49   ? 499.664 -39.852 647.534 1.00 145.85 ? 49   ARG C CD    1 
ATOM   3948  N  NE    . ARG C 2  49   ? 499.237 -41.226 647.273 1.00 165.09 ? 49   ARG C NE    1 
ATOM   3949  C  CZ    . ARG C 2  49   ? 498.844 -41.686 646.094 1.00 172.22 ? 49   ARG C CZ    1 
ATOM   3950  N  NH1   . ARG C 2  49   ? 498.832 -40.893 645.027 1.00 167.76 ? 49   ARG C NH1   1 
ATOM   3951  N  NH2   . ARG C 2  49   ? 498.468 -42.954 645.978 1.00 181.36 ? 49   ARG C NH2   1 
ATOM   3952  N  N     . GLU C 2  50   ? 495.620 -36.725 645.382 1.00 125.28 ? 50   GLU C N     1 
ATOM   3953  C  CA    . GLU C 2  50   ? 494.561 -36.529 644.406 1.00 125.22 ? 50   GLU C CA    1 
ATOM   3954  C  C     . GLU C 2  50   ? 495.037 -35.679 643.234 1.00 122.84 ? 50   GLU C C     1 
ATOM   3955  O  O     . GLU C 2  50   ? 494.704 -35.978 642.084 1.00 128.84 ? 50   GLU C O     1 
ATOM   3956  C  CB    . GLU C 2  50   ? 493.357 -35.936 645.130 1.00 132.80 ? 50   GLU C CB    1 
ATOM   3957  C  CG    . GLU C 2  50   ? 492.017 -36.560 644.781 1.00 137.53 ? 50   GLU C CG    1 
ATOM   3958  C  CD    . GLU C 2  50   ? 490.947 -36.210 645.815 1.00 135.50 ? 50   GLU C CD    1 
ATOM   3959  O  OE1   . GLU C 2  50   ? 490.913 -36.881 646.882 1.00 125.66 ? 50   GLU C OE1   1 
ATOM   3960  O  OE2   . GLU C 2  50   ? 490.167 -35.264 645.578 1.00 136.90 ? 50   GLU C OE2   1 
ATOM   3961  N  N     . THR C 2  51   ? 495.763 -34.584 643.490 1.00 120.86 ? 51   THR C N     1 
ATOM   3962  C  CA    . THR C 2  51   ? 496.159 -33.700 642.381 1.00 127.26 ? 51   THR C CA    1 
ATOM   3963  C  C     . THR C 2  51   ? 497.240 -34.322 641.479 1.00 133.94 ? 51   THR C C     1 
ATOM   3964  O  O     . THR C 2  51   ? 497.278 -34.039 640.274 1.00 133.81 ? 51   THR C O     1 
ATOM   3965  C  CB    . THR C 2  51   ? 496.638 -32.334 642.899 1.00 125.61 ? 51   THR C CB    1 
ATOM   3966  O  OG1   . THR C 2  51   ? 495.694 -31.787 643.825 1.00 123.33 ? 51   THR C OG1   1 
ATOM   3967  C  CG2   . THR C 2  51   ? 496.765 -31.346 641.738 1.00 120.18 ? 51   THR C CG2   1 
ATOM   3968  N  N     . PHE C 2  52   ? 498.132 -35.206 642.035 1.00 132.11 ? 52   PHE C N     1 
ATOM   3969  C  CA    . PHE C 2  52   ? 499.261 -35.752 641.284 1.00 128.71 ? 52   PHE C CA    1 
ATOM   3970  C  C     . PHE C 2  52   ? 499.128 -37.239 640.980 1.00 133.37 ? 52   PHE C C     1 
ATOM   3971  O  O     . PHE C 2  52   ? 498.529 -37.985 641.768 1.00 122.98 ? 52   PHE C O     1 
ATOM   3972  C  CB    . PHE C 2  52   ? 500.566 -35.557 642.061 1.00 124.52 ? 52   PHE C CB    1 
ATOM   3973  C  CG    . PHE C 2  52   ? 501.012 -34.142 642.150 1.00 126.56 ? 52   PHE C CG    1 
ATOM   3974  C  CD1   . PHE C 2  52   ? 500.593 -33.327 643.162 1.00 127.51 ? 52   PHE C CD1   1 
ATOM   3975  C  CD2   . PHE C 2  52   ? 501.885 -33.628 641.211 1.00 132.29 ? 52   PHE C CD2   1 
ATOM   3976  C  CE1   . PHE C 2  52   ? 501.030 -32.014 643.226 1.00 126.08 ? 52   PHE C CE1   1 
ATOM   3977  C  CE2   . PHE C 2  52   ? 502.324 -32.323 641.282 1.00 127.91 ? 52   PHE C CE2   1 
ATOM   3978  C  CZ    . PHE C 2  52   ? 501.900 -31.519 642.290 1.00 116.20 ? 52   PHE C CZ    1 
ATOM   3979  N  N     . PRO C 2  53   ? 499.777 -37.725 639.868 1.00 137.41 ? 53   PRO C N     1 
ATOM   3980  C  CA    . PRO C 2  53   ? 500.660 -37.050 638.878 1.00 127.27 ? 53   PRO C CA    1 
ATOM   3981  C  C     . PRO C 2  53   ? 500.015 -36.147 637.797 1.00 129.76 ? 53   PRO C C     1 
ATOM   3982  O  O     . PRO C 2  53   ? 498.937 -36.447 637.301 1.00 132.16 ? 53   PRO C O     1 
ATOM   3983  C  CB    . PRO C 2  53   ? 501.354 -38.220 638.200 1.00 128.90 ? 53   PRO C CB    1 
ATOM   3984  C  CG    . PRO C 2  53   ? 500.414 -39.322 638.318 1.00 125.97 ? 53   PRO C CG    1 
ATOM   3985  C  CD    . PRO C 2  53   ? 499.723 -39.175 639.615 1.00 130.96 ? 53   PRO C CD    1 
ATOM   3986  N  N     . ILE C 2  54   ? 500.733 -35.090 637.415 1.00 135.84 ? 54   ILE C N     1 
ATOM   3987  C  CA    . ILE C 2  54   ? 500.321 -34.130 636.382 1.00 147.04 ? 54   ILE C CA    1 
ATOM   3988  C  C     . ILE C 2  54   ? 500.859 -34.466 634.976 1.00 154.28 ? 54   ILE C C     1 
ATOM   3989  O  O     . ILE C 2  54   ? 502.057 -34.299 634.710 1.00 148.09 ? 54   ILE C O     1 
ATOM   3990  C  CB    . ILE C 2  54   ? 500.752 -32.714 636.786 1.00 143.10 ? 54   ILE C CB    1 
ATOM   3991  C  CG1   . ILE C 2  54   ? 500.186 -32.364 638.175 1.00 134.64 ? 54   ILE C CG1   1 
ATOM   3992  C  CG2   . ILE C 2  54   ? 500.383 -31.694 635.690 1.00 138.86 ? 54   ILE C CG2   1 
ATOM   3993  C  CD1   . ILE C 2  54   ? 498.697 -32.125 638.241 1.00 135.66 ? 54   ILE C CD1   1 
ATOM   3994  N  N     . GLU C 2  55   ? 499.981 -34.913 634.064 1.00 162.10 ? 55   GLU C N     1 
ATOM   3995  C  CA    . GLU C 2  55   ? 500.347 -35.493 632.768 1.00 158.49 ? 55   GLU C CA    1 
ATOM   3996  C  C     . GLU C 2  55   ? 500.545 -34.378 631.729 1.00 161.14 ? 55   GLU C C     1 
ATOM   3997  O  O     . GLU C 2  55   ? 500.167 -33.226 631.944 1.00 163.39 ? 55   GLU C O     1 
ATOM   3998  C  CB    . GLU C 2  55   ? 499.281 -36.478 632.287 1.00 162.37 ? 55   GLU C CB    1 
ATOM   3999  C  CG    . GLU C 2  55   ? 499.054 -37.643 633.227 1.00 163.81 ? 55   GLU C CG    1 
ATOM   4000  C  CD    . GLU C 2  55   ? 499.606 -38.951 632.695 1.00 170.31 ? 55   GLU C CD    1 
ATOM   4001  O  OE1   . GLU C 2  55   ? 499.401 -39.981 633.374 1.00 171.35 ? 55   GLU C OE1   1 
ATOM   4002  O  OE2   . GLU C 2  55   ? 500.233 -38.953 631.607 1.00 164.80 ? 55   GLU C OE2   1 
ATOM   4003  N  N     . GLU C 2  56   ? 501.128 -34.719 630.579 1.00 162.32 ? 56   GLU C N     1 
ATOM   4004  C  CA    . GLU C 2  56   ? 501.470 -33.671 629.607 1.00 163.15 ? 56   GLU C CA    1 
ATOM   4005  C  C     . GLU C 2  56   ? 500.311 -33.386 628.660 1.00 164.27 ? 56   GLU C C     1 
ATOM   4006  O  O     . GLU C 2  56   ? 499.963 -32.228 628.438 1.00 162.06 ? 56   GLU C O     1 
ATOM   4007  C  CB    . GLU C 2  56   ? 502.741 -34.037 628.812 1.00 173.07 ? 56   GLU C CB    1 
ATOM   4008  C  CG    . GLU C 2  56   ? 502.669 -33.984 627.259 1.00 179.64 ? 56   GLU C CG    1 
ATOM   4009  C  CD    . GLU C 2  56   ? 501.980 -35.190 626.597 1.00 179.58 ? 56   GLU C CD    1 
ATOM   4010  O  OE1   . GLU C 2  56   ? 501.023 -35.747 627.179 1.00 178.87 ? 56   GLU C OE1   1 
ATOM   4011  O  OE2   . GLU C 2  56   ? 502.408 -35.578 625.481 1.00 174.18 ? 56   GLU C OE2   1 
ATOM   4012  N  N     . LEU C 2  64   ? 505.955 -36.118 629.477 1.00 160.56 ? 64   LEU C N     1 
ATOM   4013  C  CA    . LEU C 2  64   ? 506.159 -35.370 630.725 1.00 162.39 ? 64   LEU C CA    1 
ATOM   4014  C  C     . LEU C 2  64   ? 505.179 -35.687 631.877 1.00 162.09 ? 64   LEU C C     1 
ATOM   4015  O  O     . LEU C 2  64   ? 503.961 -35.584 631.707 1.00 164.00 ? 64   LEU C O     1 
ATOM   4016  C  CB    . LEU C 2  64   ? 506.068 -33.879 630.425 1.00 162.55 ? 64   LEU C CB    1 
ATOM   4017  C  CG    . LEU C 2  64   ? 507.268 -33.164 629.847 1.00 161.89 ? 64   LEU C CG    1 
ATOM   4018  C  CD1   . LEU C 2  64   ? 506.896 -31.726 629.570 1.00 159.00 ? 64   LEU C CD1   1 
ATOM   4019  C  CD2   . LEU C 2  64   ? 508.369 -33.230 630.891 1.00 156.17 ? 64   LEU C CD2   1 
ATOM   4020  N  N     . VAL C 2  65   ? 505.714 -36.019 633.057 1.00 157.81 ? 65   VAL C N     1 
ATOM   4021  C  CA    . VAL C 2  65   ? 504.917 -36.304 634.253 1.00 150.60 ? 65   VAL C CA    1 
ATOM   4022  C  C     . VAL C 2  65   ? 505.626 -35.743 635.485 1.00 145.71 ? 65   VAL C C     1 
ATOM   4023  O  O     . VAL C 2  65   ? 506.790 -36.073 635.735 1.00 144.38 ? 65   VAL C O     1 
ATOM   4024  C  CB    . VAL C 2  65   ? 504.680 -37.824 634.423 1.00 145.68 ? 65   VAL C CB    1 
ATOM   4025  C  CG1   . VAL C 2  65   ? 504.188 -38.149 635.812 1.00 138.49 ? 65   VAL C CG1   1 
ATOM   4026  C  CG2   . VAL C 2  65   ? 503.681 -38.341 633.403 1.00 152.68 ? 65   VAL C CG2   1 
ATOM   4027  N  N     . LEU C 2  66   ? 504.921 -34.925 636.276 1.00 144.06 ? 66   LEU C N     1 
ATOM   4028  C  CA    . LEU C 2  66   ? 505.458 -34.378 637.526 1.00 139.11 ? 66   LEU C CA    1 
ATOM   4029  C  C     . LEU C 2  66   ? 504.753 -35.123 638.658 1.00 131.60 ? 66   LEU C C     1 
ATOM   4030  O  O     . LEU C 2  66   ? 503.524 -35.091 638.758 1.00 131.27 ? 66   LEU C O     1 
ATOM   4031  C  CB    . LEU C 2  66   ? 505.262 -32.867 637.627 1.00 132.82 ? 66   LEU C CB    1 
ATOM   4032  C  CG    . LEU C 2  66   ? 505.904 -32.189 638.836 1.00 125.64 ? 66   LEU C CG    1 
ATOM   4033  C  CD1   . LEU C 2  66   ? 507.332 -32.687 639.054 1.00 127.05 ? 66   LEU C CD1   1 
ATOM   4034  C  CD2   . LEU C 2  66   ? 505.915 -30.694 638.619 1.00 126.09 ? 66   LEU C CD2   1 
ATOM   4035  N  N     . ASP C 2  67   ? 505.519 -35.787 639.507 1.00 128.52 ? 67   ASP C N     1 
ATOM   4036  C  CA    . ASP C 2  67   ? 504.942 -36.668 640.503 1.00 127.64 ? 67   ASP C CA    1 
ATOM   4037  C  C     . ASP C 2  67   ? 505.274 -36.203 641.921 1.00 130.97 ? 67   ASP C C     1 
ATOM   4038  O  O     . ASP C 2  67   ? 506.290 -35.551 642.169 1.00 131.21 ? 67   ASP C O     1 
ATOM   4039  C  CB    . ASP C 2  67   ? 505.418 -38.096 640.251 1.00 132.45 ? 67   ASP C CB    1 
ATOM   4040  C  CG    . ASP C 2  67   ? 504.418 -39.125 640.710 1.00 135.28 ? 67   ASP C CG    1 
ATOM   4041  O  OD1   . ASP C 2  67   ? 504.191 -40.087 639.944 1.00 140.72 ? 67   ASP C OD1   1 
ATOM   4042  O  OD2   . ASP C 2  67   ? 503.814 -38.952 641.784 1.00 130.43 ? 67   ASP C OD2   1 
ATOM   4043  N  N     . PHE C 2  68   ? 504.386 -36.534 642.847 1.00 131.08 ? 68   PHE C N     1 
ATOM   4044  C  CA    . PHE C 2  68   ? 504.483 -36.129 644.243 1.00 126.67 ? 68   PHE C CA    1 
ATOM   4045  C  C     . PHE C 2  68   ? 505.172 -37.196 645.081 1.00 128.26 ? 68   PHE C C     1 
ATOM   4046  O  O     . PHE C 2  68   ? 504.745 -38.353 645.094 1.00 133.25 ? 68   PHE C O     1 
ATOM   4047  C  CB    . PHE C 2  68   ? 503.080 -35.865 644.787 1.00 126.10 ? 68   PHE C CB    1 
ATOM   4048  C  CG    . PHE C 2  68   ? 502.989 -35.869 646.292 1.00 128.09 ? 68   PHE C CG    1 
ATOM   4049  C  CD1   . PHE C 2  68   ? 503.412 -34.765 647.037 1.00 121.65 ? 68   PHE C CD1   1 
ATOM   4050  C  CD2   . PHE C 2  68   ? 502.438 -36.960 646.961 1.00 127.42 ? 68   PHE C CD2   1 
ATOM   4051  C  CE1   . PHE C 2  68   ? 503.319 -34.758 648.404 1.00 112.80 ? 68   PHE C CE1   1 
ATOM   4052  C  CE2   . PHE C 2  68   ? 502.330 -36.956 648.338 1.00 122.53 ? 68   PHE C CE2   1 
ATOM   4053  C  CZ    . PHE C 2  68   ? 502.771 -35.854 649.058 1.00 119.16 ? 68   PHE C CZ    1 
ATOM   4054  N  N     . LEU C 2  69   ? 506.183 -36.787 645.849 1.00 124.97 ? 69   LEU C N     1 
ATOM   4055  C  CA    . LEU C 2  69   ? 506.878 -37.728 646.723 1.00 124.22 ? 69   LEU C CA    1 
ATOM   4056  C  C     . LEU C 2  69   ? 506.302 -37.717 648.137 1.00 121.15 ? 69   LEU C C     1 
ATOM   4057  O  O     . LEU C 2  69   ? 505.802 -38.742 648.610 1.00 119.21 ? 69   LEU C O     1 
ATOM   4058  C  CB    . LEU C 2  69   ? 508.379 -37.405 646.788 1.00 128.88 ? 69   LEU C CB    1 
ATOM   4059  C  CG    . LEU C 2  69   ? 509.363 -37.799 645.677 1.00 127.98 ? 69   LEU C CG    1 
ATOM   4060  C  CD1   . LEU C 2  69   ? 510.818 -37.692 646.194 1.00 122.76 ? 69   LEU C CD1   1 
ATOM   4061  C  CD2   . LEU C 2  69   ? 509.057 -39.180 645.127 1.00 120.93 ? 69   LEU C CD2   1 
ATOM   4062  N  N     . GLU C 2  70   ? 506.360 -36.569 648.811 1.00 123.73 ? 70   GLU C N     1 
ATOM   4063  C  CA    . GLU C 2  70   ? 505.986 -36.398 650.213 1.00 120.19 ? 70   GLU C CA    1 
ATOM   4064  C  C     . GLU C 2  70   ? 506.085 -34.909 650.552 1.00 118.86 ? 70   GLU C C     1 
ATOM   4065  O  O     . GLU C 2  70   ? 506.650 -34.124 649.787 1.00 118.87 ? 70   GLU C O     1 
ATOM   4066  C  CB    . GLU C 2  70   ? 506.864 -37.278 651.138 1.00 121.69 ? 70   GLU C CB    1 
ATOM   4067  C  CG    . GLU C 2  70   ? 508.398 -37.206 650.915 1.00 125.89 ? 70   GLU C CG    1 
ATOM   4068  C  CD    . GLU C 2  70   ? 509.226 -37.658 652.139 1.00 133.45 ? 70   GLU C CD    1 
ATOM   4069  O  OE1   . GLU C 2  70   ? 509.156 -36.994 653.202 1.00 132.38 ? 70   GLU C OE1   1 
ATOM   4070  O  OE2   . GLU C 2  70   ? 509.952 -38.683 652.035 1.00 129.77 ? 70   GLU C OE2   1 
ATOM   4071  N  N     . TYR C 2  71   ? 505.451 -34.513 651.655 1.00 118.81 ? 71   TYR C N     1 
ATOM   4072  C  CA    . TYR C 2  71   ? 505.503 -33.132 652.121 1.00 113.67 ? 71   TYR C CA    1 
ATOM   4073  C  C     . TYR C 2  71   ? 506.086 -33.112 653.518 1.00 109.60 ? 71   TYR C C     1 
ATOM   4074  O  O     . TYR C 2  71   ? 506.151 -34.138 654.198 1.00 110.64 ? 71   TYR C O     1 
ATOM   4075  C  CB    . TYR C 2  71   ? 504.124 -32.445 652.106 1.00 115.35 ? 71   TYR C CB    1 
ATOM   4076  C  CG    . TYR C 2  71   ? 503.155 -32.932 653.165 1.00 117.44 ? 71   TYR C CG    1 
ATOM   4077  C  CD1   . TYR C 2  71   ? 503.144 -32.405 654.463 1.00 117.34 ? 71   TYR C CD1   1 
ATOM   4078  C  CD2   . TYR C 2  71   ? 502.239 -33.932 652.860 1.00 116.79 ? 71   TYR C CD2   1 
ATOM   4079  C  CE1   . TYR C 2  71   ? 502.240 -32.881 655.426 1.00 112.18 ? 71   TYR C CE1   1 
ATOM   4080  C  CE2   . TYR C 2  71   ? 501.344 -34.401 653.803 1.00 119.35 ? 71   TYR C CE2   1 
ATOM   4081  C  CZ    . TYR C 2  71   ? 501.337 -33.881 655.080 1.00 115.10 ? 71   TYR C CZ    1 
ATOM   4082  O  OH    . TYR C 2  71   ? 500.416 -34.388 655.981 1.00 112.47 ? 71   TYR C OH    1 
ATOM   4083  N  N     . ARG C 2  72   ? 506.537 -31.938 653.938 1.00 104.84 ? 72   ARG C N     1 
ATOM   4084  C  CA    . ARG C 2  72   ? 506.919 -31.786 655.323 1.00 110.77 ? 72   ARG C CA    1 
ATOM   4085  C  C     . ARG C 2  72   ? 506.508 -30.401 655.806 1.00 111.68 ? 72   ARG C C     1 
ATOM   4086  O  O     . ARG C 2  72   ? 506.240 -29.496 655.013 1.00 105.41 ? 72   ARG C O     1 
ATOM   4087  C  CB    . ARG C 2  72   ? 508.424 -32.012 655.549 1.00 109.27 ? 72   ARG C CB    1 
ATOM   4088  C  CG    . ARG C 2  72   ? 509.318 -30.932 655.016 1.00 113.51 ? 72   ARG C CG    1 
ATOM   4089  C  CD    . ARG C 2  72   ? 510.686 -31.045 655.678 1.00 114.77 ? 72   ARG C CD    1 
ATOM   4090  N  NE    . ARG C 2  72   ? 511.604 -30.047 655.151 1.00 115.73 ? 72   ARG C NE    1 
ATOM   4091  C  CZ    . ARG C 2  72   ? 511.918 -28.934 655.810 1.00 120.53 ? 72   ARG C CZ    1 
ATOM   4092  N  NH1   . ARG C 2  72   ? 511.413 -28.710 657.017 1.00 117.78 ? 72   ARG C NH1   1 
ATOM   4093  N  NH2   . ARG C 2  72   ? 512.750 -28.050 655.279 1.00 127.38 ? 72   ARG C NH2   1 
ATOM   4094  N  N     . LEU C 2  73   ? 506.317 -30.293 657.116 1.00 110.03 ? 73   LEU C N     1 
ATOM   4095  C  CA    . LEU C 2  73   ? 506.040 -29.027 657.772 1.00 108.61 ? 73   LEU C CA    1 
ATOM   4096  C  C     . LEU C 2  73   ? 507.220 -28.626 658.648 1.00 108.06 ? 73   LEU C C     1 
ATOM   4097  O  O     . LEU C 2  73   ? 507.785 -29.471 659.349 1.00 111.17 ? 73   LEU C O     1 
ATOM   4098  C  CB    . LEU C 2  73   ? 504.764 -29.099 658.615 1.00 115.09 ? 73   LEU C CB    1 
ATOM   4099  C  CG    . LEU C 2  73   ? 503.432 -29.175 657.857 1.00 115.80 ? 73   LEU C CG    1 
ATOM   4100  C  CD1   . LEU C 2  73   ? 502.310 -29.660 658.767 1.00 112.36 ? 73   LEU C CD1   1 
ATOM   4101  C  CD2   . LEU C 2  73   ? 503.069 -27.805 657.262 1.00 109.14 ? 73   LEU C CD2   1 
ATOM   4102  N  N     . GLY C 2  74   ? 507.688 -27.393 658.496 1.00 103.80 ? 74   GLY C N     1 
ATOM   4103  C  CA    . GLY C 2  74   ? 508.758 -26.902 659.336 1.00 106.66 ? 74   GLY C CA    1 
ATOM   4104  C  C     . GLY C 2  74   ? 508.212 -26.477 660.697 1.00 112.89 ? 74   GLY C C     1 
ATOM   4105  O  O     . GLY C 2  74   ? 507.058 -26.727 661.050 1.00 115.66 ? 74   GLY C O     1 
ATOM   4106  N  N     . GLU C 2  75   ? 509.078 -25.813 661.478 1.00 114.69 ? 75   GLU C N     1 
ATOM   4107  C  CA    . GLU C 2  75   ? 508.703 -25.220 662.758 1.00 111.02 ? 75   GLU C CA    1 
ATOM   4108  C  C     . GLU C 2  75   ? 508.270 -23.778 662.513 1.00 107.39 ? 75   GLU C C     1 
ATOM   4109  O  O     . GLU C 2  75   ? 508.641 -23.174 661.505 1.00 105.38 ? 75   GLU C O     1 
ATOM   4110  C  CB    . GLU C 2  75   ? 509.870 -25.268 663.750 1.00 111.47 ? 75   GLU C CB    1 
ATOM   4111  C  CG    . GLU C 2  75   ? 510.389 -26.663 664.154 1.00 114.35 ? 75   GLU C CG    1 
ATOM   4112  C  CD    . GLU C 2  75   ? 509.305 -27.701 664.392 1.00 120.98 ? 75   GLU C CD    1 
ATOM   4113  O  OE1   . GLU C 2  75   ? 508.830 -28.306 663.404 1.00 126.61 ? 75   GLU C OE1   1 
ATOM   4114  O  OE2   . GLU C 2  75   ? 508.944 -27.938 665.566 1.00 126.23 ? 75   GLU C OE2   1 
ATOM   4115  N  N     . PRO C 2  76   ? 507.446 -23.193 663.370 1.00 109.12 ? 76   PRO C N     1 
ATOM   4116  C  CA    . PRO C 2  76   ? 507.026 -21.794 663.142 1.00 106.89 ? 76   PRO C CA    1 
ATOM   4117  C  C     . PRO C 2  76   ? 508.176 -20.811 663.274 1.00 101.87 ? 76   PRO C C     1 
ATOM   4118  O  O     . PRO C 2  76   ? 509.026 -20.939 664.165 1.00 98.55  ? 76   PRO C O     1 
ATOM   4119  C  CB    . PRO C 2  76   ? 505.962 -21.553 664.223 1.00 104.68 ? 76   PRO C CB    1 
ATOM   4120  C  CG    . PRO C 2  76   ? 505.605 -22.923 664.736 1.00 106.20 ? 76   PRO C CG    1 
ATOM   4121  C  CD    . PRO C 2  76   ? 506.794 -23.792 664.546 1.00 107.52 ? 76   PRO C CD    1 
ATOM   4122  N  N     . PRO C 2  77   ? 508.289 -19.877 662.325 1.00 104.16 ? 77   PRO C N     1 
ATOM   4123  C  CA    . PRO C 2  77   ? 509.339 -18.841 662.398 1.00 104.33 ? 77   PRO C CA    1 
ATOM   4124  C  C     . PRO C 2  77   ? 509.270 -17.976 663.642 1.00 103.86 ? 77   PRO C C     1 
ATOM   4125  O  O     . PRO C 2  77   ? 510.296 -17.461 664.101 1.00 98.27  ? 77   PRO C O     1 
ATOM   4126  C  CB    . PRO C 2  77   ? 509.094 -18.001 661.138 1.00 101.96 ? 77   PRO C CB    1 
ATOM   4127  C  CG    . PRO C 2  77   ? 508.294 -18.886 660.228 1.00 108.26 ? 77   PRO C CG    1 
ATOM   4128  C  CD    . PRO C 2  77   ? 507.467 -19.757 661.114 1.00 106.58 ? 77   PRO C CD    1 
ATOM   4129  N  N     . PHE C 2  78   ? 508.067 -17.747 664.169 1.00 111.60 ? 78   PHE C N     1 
ATOM   4130  C  CA    . PHE C 2  78   ? 507.877 -16.899 665.330 1.00 107.13 ? 78   PHE C CA    1 
ATOM   4131  C  C     . PHE C 2  78   ? 506.858 -17.550 666.253 1.00 110.38 ? 78   PHE C C     1 
ATOM   4132  O  O     . PHE C 2  78   ? 505.937 -18.228 665.767 1.00 108.24 ? 78   PHE C O     1 
ATOM   4133  C  CB    . PHE C 2  78   ? 507.387 -15.502 664.931 1.00 105.48 ? 78   PHE C CB    1 
ATOM   4134  C  CG    . PHE C 2  78   ? 508.244 -14.836 663.896 1.00 111.92 ? 78   PHE C CG    1 
ATOM   4135  C  CD1   . PHE C 2  78   ? 507.971 -15.013 662.544 1.00 106.56 ? 78   PHE C CD1   1 
ATOM   4136  C  CD2   . PHE C 2  78   ? 509.340 -14.076 664.264 1.00 106.59 ? 78   PHE C CD2   1 
ATOM   4137  C  CE1   . PHE C 2  78   ? 508.733 -14.422 661.606 1.00 98.07  ? 78   PHE C CE1   1 
ATOM   4138  C  CE2   . PHE C 2  78   ? 510.115 -13.491 663.315 1.00 106.43 ? 78   PHE C CE2   1 
ATOM   4139  C  CZ    . PHE C 2  78   ? 509.810 -13.660 661.986 1.00 103.34 ? 78   PHE C CZ    1 
ATOM   4140  N  N     . PRO C 2  79   ? 507.038 -17.411 667.575 1.00 114.29 ? 79   PRO C N     1 
ATOM   4141  C  CA    . PRO C 2  79   ? 506.079 -17.979 668.539 1.00 108.96 ? 79   PRO C CA    1 
ATOM   4142  C  C     . PRO C 2  79   ? 504.769 -17.204 668.578 1.00 105.49 ? 79   PRO C C     1 
ATOM   4143  O  O     . PRO C 2  79   ? 504.635 -16.117 668.013 1.00 103.04 ? 79   PRO C O     1 
ATOM   4144  C  CB    . PRO C 2  79   ? 506.824 -17.858 669.862 1.00 113.82 ? 79   PRO C CB    1 
ATOM   4145  C  CG    . PRO C 2  79   ? 507.752 -16.673 669.650 1.00 113.34 ? 79   PRO C CG    1 
ATOM   4146  C  CD    . PRO C 2  79   ? 508.170 -16.729 668.237 1.00 104.84 ? 79   PRO C CD    1 
ATOM   4147  N  N     . GLN C 2  80   ? 503.819 -17.734 669.357 1.00 111.41 ? 80   GLN C N     1 
ATOM   4148  C  CA    . GLN C 2  80   ? 502.458 -17.188 669.318 1.00 114.47 ? 80   GLN C CA    1 
ATOM   4149  C  C     . GLN C 2  80   ? 502.434 -15.753 669.838 1.00 112.45 ? 80   GLN C C     1 
ATOM   4150  O  O     . GLN C 2  80   ? 501.843 -14.859 669.212 1.00 105.95 ? 80   GLN C O     1 
ATOM   4151  C  CB    . GLN C 2  80   ? 501.462 -18.078 670.087 1.00 103.39 ? 80   GLN C CB    1 
ATOM   4152  C  CG    . GLN C 2  80   ? 501.431 -19.536 669.631 1.00 101.24 ? 80   GLN C CG    1 
ATOM   4153  C  CD    . GLN C 2  80   ? 500.548 -20.449 670.490 1.00 109.91 ? 80   GLN C CD    1 
ATOM   4154  O  OE1   . GLN C 2  80   ? 499.749 -19.991 671.320 1.00 111.26 ? 80   GLN C OE1   1 
ATOM   4155  N  NE2   . GLN C 2  80   ? 500.693 -21.759 670.285 1.00 108.73 ? 80   GLN C NE2   1 
ATOM   4156  N  N     . ASP C 2  81   ? 503.022 -15.532 671.014 1.00 118.06 ? 81   ASP C N     1 
ATOM   4157  C  CA    . ASP C 2  81   ? 503.068 -14.195 671.591 1.00 118.55 ? 81   ASP C CA    1 
ATOM   4158  C  C     . ASP C 2  81   ? 503.655 -13.208 670.592 1.00 114.68 ? 81   ASP C C     1 
ATOM   4159  O  O     . ASP C 2  81   ? 503.114 -12.119 670.365 1.00 111.87 ? 81   ASP C O     1 
ATOM   4160  C  CB    . ASP C 2  81   ? 503.939 -14.205 672.855 1.00 122.85 ? 81   ASP C CB    1 
ATOM   4161  C  CG    . ASP C 2  81   ? 504.858 -15.451 672.947 1.00 126.62 ? 81   ASP C CG    1 
ATOM   4162  O  OD1   . ASP C 2  81   ? 504.360 -16.601 672.823 1.00 126.59 ? 81   ASP C OD1   1 
ATOM   4163  O  OD2   . ASP C 2  81   ? 506.098 -15.271 673.103 1.00 122.93 ? 81   ASP C OD2   1 
ATOM   4164  N  N     . GLU C 2  82   ? 504.752 -13.608 669.952 1.00 113.27 ? 82   GLU C N     1 
ATOM   4165  C  CA    . GLU C 2  82   ? 505.410 -12.749 668.980 1.00 114.41 ? 82   GLU C CA    1 
ATOM   4166  C  C     . GLU C 2  82   ? 504.504 -12.423 667.799 1.00 110.76 ? 82   GLU C C     1 
ATOM   4167  O  O     . GLU C 2  82   ? 504.469 -11.281 667.323 1.00 108.42 ? 82   GLU C O     1 
ATOM   4168  C  CB    . GLU C 2  82   ? 506.674 -13.447 668.505 1.00 115.48 ? 82   GLU C CB    1 
ATOM   4169  C  CG    . GLU C 2  82   ? 507.406 -12.696 667.453 1.00 120.32 ? 82   GLU C CG    1 
ATOM   4170  C  CD    . GLU C 2  82   ? 508.879 -12.826 667.649 1.00 119.45 ? 82   GLU C CD    1 
ATOM   4171  O  OE1   . GLU C 2  82   ? 509.272 -13.524 668.625 1.00 108.50 ? 82   GLU C OE1   1 
ATOM   4172  O  OE2   . GLU C 2  82   ? 509.623 -12.216 666.842 1.00 124.55 ? 82   GLU C OE2   1 
ATOM   4173  N  N     . CYS C 2  83   ? 503.793 -13.425 667.291 1.00 109.54 ? 83   CYS C N     1 
ATOM   4174  C  CA    . CYS C 2  83   ? 502.871 -13.203 666.184 1.00 109.03 ? 83   CYS C CA    1 
ATOM   4175  C  C     . CYS C 2  83   ? 501.800 -12.181 666.557 1.00 109.77 ? 83   CYS C C     1 
ATOM   4176  O  O     . CYS C 2  83   ? 501.483 -11.284 665.764 1.00 103.52 ? 83   CYS C O     1 
ATOM   4177  C  CB    . CYS C 2  83   ? 502.276 -14.534 665.742 1.00 109.03 ? 83   CYS C CB    1 
ATOM   4178  S  SG    . CYS C 2  83   ? 503.514 -15.575 664.944 1.00 112.91 ? 83   CYS C SG    1 
ATOM   4179  N  N     . ARG C 2  84   ? 501.185 -12.342 667.743 1.00 111.20 ? 84   ARG C N     1 
ATOM   4180  C  CA    . ARG C 2  84   ? 500.167 -11.394 668.200 1.00 109.24 ? 84   ARG C CA    1 
ATOM   4181  C  C     . ARG C 2  84   ? 500.737 -9.988  668.312 1.00 110.38 ? 84   ARG C C     1 
ATOM   4182  O  O     . ARG C 2  84   ? 500.114 -9.009  667.875 1.00 107.61 ? 84   ARG C O     1 
ATOM   4183  C  CB    . ARG C 2  84   ? 499.623 -11.815 669.567 1.00 106.41 ? 84   ARG C CB    1 
ATOM   4184  C  CG    . ARG C 2  84   ? 498.836 -13.080 669.570 1.00 106.12 ? 84   ARG C CG    1 
ATOM   4185  C  CD    . ARG C 2  84   ? 498.285 -13.433 670.937 1.00 93.05  ? 84   ARG C CD    1 
ATOM   4186  N  NE    . ARG C 2  84   ? 497.540 -14.687 670.861 1.00 83.17  ? 84   ARG C NE    1 
ATOM   4187  C  CZ    . ARG C 2  84   ? 497.966 -15.836 671.377 1.00 88.52  ? 84   ARG C CZ    1 
ATOM   4188  N  NH1   . ARG C 2  84   ? 499.133 -15.896 672.016 1.00 94.21  ? 84   ARG C NH1   1 
ATOM   4189  N  NH2   . ARG C 2  84   ? 497.221 -16.926 671.261 1.00 93.18  ? 84   ARG C NH2   1 
ATOM   4190  N  N     . GLU C 2  85   ? 501.956 -9.890  668.844 1.00 108.81 ? 85   GLU C N     1 
ATOM   4191  C  CA    . GLU C 2  85   ? 502.650 -8.618  668.986 1.00 110.44 ? 85   GLU C CA    1 
ATOM   4192  C  C     . GLU C 2  85   ? 502.825 -7.889  667.659 1.00 115.70 ? 85   GLU C C     1 
ATOM   4193  O  O     . GLU C 2  85   ? 502.477 -6.709  667.543 1.00 116.52 ? 85   GLU C O     1 
ATOM   4194  C  CB    . GLU C 2  85   ? 504.010 -8.893  669.620 1.00 113.54 ? 85   GLU C CB    1 
ATOM   4195  C  CG    . GLU C 2  85   ? 505.034 -7.824  669.368 1.00 119.20 ? 85   GLU C CG    1 
ATOM   4196  C  CD    . GLU C 2  85   ? 504.929 -6.661  670.314 1.00 130.07 ? 85   GLU C CD    1 
ATOM   4197  O  OE1   . GLU C 2  85   ? 503.938 -6.582  671.085 1.00 130.93 ? 85   GLU C OE1   1 
ATOM   4198  O  OE2   . GLU C 2  85   ? 505.860 -5.825  670.280 1.00 129.66 ? 85   GLU C OE2   1 
ATOM   4199  N  N     . LYS C 2  86   ? 503.327 -8.584  666.636 1.00 117.38 ? 86   LYS C N     1 
ATOM   4200  C  CA    . LYS C 2  86   ? 503.778 -7.960  665.396 1.00 113.85 ? 86   LYS C CA    1 
ATOM   4201  C  C     . LYS C 2  86   ? 502.719 -7.963  664.299 1.00 114.12 ? 86   LYS C C     1 
ATOM   4202  O  O     . LYS C 2  86   ? 503.032 -7.630  663.150 1.00 114.56 ? 86   LYS C O     1 
ATOM   4203  C  CB    . LYS C 2  86   ? 505.034 -8.682  664.904 1.00 111.83 ? 86   LYS C CB    1 
ATOM   4204  C  CG    . LYS C 2  86   ? 506.219 -8.515  665.829 1.00 118.33 ? 86   LYS C CG    1 
ATOM   4205  C  CD    . LYS C 2  86   ? 507.498 -9.119  665.276 1.00 120.34 ? 86   LYS C CD    1 
ATOM   4206  C  CE    . LYS C 2  86   ? 508.640 -8.924  666.269 1.00 128.14 ? 86   LYS C CE    1 
ATOM   4207  N  NZ    . LYS C 2  86   ? 509.969 -9.325  665.735 1.00 135.97 ? 86   LYS C NZ    1 
ATOM   4208  N  N     . ASP C 2  87   ? 501.494 -8.389  664.618 1.00 114.96 ? 87   ASP C N     1 
ATOM   4209  C  CA    . ASP C 2  87   ? 500.385 -8.476  663.655 1.00 115.71 ? 87   ASP C CA    1 
ATOM   4210  C  C     . ASP C 2  87   ? 500.746 -9.443  662.518 1.00 111.83 ? 87   ASP C C     1 
ATOM   4211  O  O     . ASP C 2  87   ? 500.498 -9.177  661.337 1.00 112.93 ? 87   ASP C O     1 
ATOM   4212  C  CB    . ASP C 2  87   ? 499.932 -7.083  663.161 1.00 115.05 ? 87   ASP C CB    1 
ATOM   4213  C  CG    . ASP C 2  87   ? 499.097 -6.287  664.260 1.00 126.93 ? 87   ASP C CG    1 
ATOM   4214  O  OD1   . ASP C 2  87   ? 499.439 -5.110  664.553 1.00 125.40 ? 87   ASP C OD1   1 
ATOM   4215  O  OD2   . ASP C 2  87   ? 498.124 -6.843  664.861 1.00 118.21 ? 87   ASP C OD2   1 
ATOM   4216  N  N     . LEU C 2  88   ? 501.310 -10.595 662.914 1.00 113.63 ? 88   LEU C N     1 
ATOM   4217  C  CA    . LEU C 2  88   ? 501.793 -11.687 662.068 1.00 109.68 ? 88   LEU C CA    1 
ATOM   4218  C  C     . LEU C 2  88   ? 500.873 -12.896 662.188 1.00 103.92 ? 88   LEU C C     1 
ATOM   4219  O  O     . LEU C 2  88   ? 500.256 -13.118 663.231 1.00 110.55 ? 88   LEU C O     1 
ATOM   4220  C  CB    . LEU C 2  88   ? 503.192 -12.114 662.500 1.00 105.51 ? 88   LEU C CB    1 
ATOM   4221  C  CG    . LEU C 2  88   ? 504.168 -10.949 662.486 1.00 104.37 ? 88   LEU C CG    1 
ATOM   4222  C  CD1   . LEU C 2  88   ? 505.588 -11.456 662.638 1.00 107.89 ? 88   LEU C CD1   1 
ATOM   4223  C  CD2   . LEU C 2  88   ? 503.970 -10.071 661.256 1.00 101.48 ? 88   LEU C CD2   1 
ATOM   4224  N  N     . THR C 2  89   ? 500.827 -13.713 661.146 1.00 98.73  ? 89   THR C N     1 
ATOM   4225  C  CA    . THR C 2  89   ? 500.119 -14.986 661.218 1.00 95.86  ? 89   THR C CA    1 
ATOM   4226  C  C     . THR C 2  89   ? 500.983 -16.087 661.811 1.00 95.69  ? 89   THR C C     1 
ATOM   4227  O  O     . THR C 2  89   ? 502.170 -16.199 661.500 1.00 97.97  ? 89   THR C O     1 
ATOM   4228  C  CB    . THR C 2  89   ? 499.627 -15.410 659.846 1.00 92.92  ? 89   THR C CB    1 
ATOM   4229  O  OG1   . THR C 2  89   ? 498.611 -14.498 659.424 1.00 92.71  ? 89   THR C OG1   1 
ATOM   4230  C  CG2   . THR C 2  89   ? 499.039 -16.827 659.918 1.00 85.51  ? 89   THR C CG2   1 
ATOM   4231  N  N     . TYR C 2  90   ? 500.406 -16.831 662.750 1.00 96.62  ? 90   TYR C N     1 
ATOM   4232  C  CA    . TYR C 2  90   ? 501.082 -17.968 663.358 1.00 100.86 ? 90   TYR C CA    1 
ATOM   4233  C  C     . TYR C 2  90   ? 500.954 -19.151 662.391 1.00 99.74  ? 90   TYR C C     1 
ATOM   4234  O  O     . TYR C 2  90   ? 499.852 -19.681 662.211 1.00 100.04 ? 90   TYR C O     1 
ATOM   4235  C  CB    . TYR C 2  90   ? 500.453 -18.281 664.722 1.00 94.25  ? 90   TYR C CB    1 
ATOM   4236  C  CG    . TYR C 2  90   ? 501.109 -19.421 665.459 1.00 96.51  ? 90   TYR C CG    1 
ATOM   4237  C  CD1   . TYR C 2  90   ? 502.428 -19.310 665.892 1.00 98.67  ? 90   TYR C CD1   1 
ATOM   4238  C  CD2   . TYR C 2  90   ? 500.458 -20.626 665.657 1.00 97.06  ? 90   TYR C CD2   1 
ATOM   4239  C  CE1   . TYR C 2  90   ? 503.067 -20.352 666.541 1.00 95.76  ? 90   TYR C CE1   1 
ATOM   4240  C  CE2   . TYR C 2  90   ? 501.097 -21.679 666.308 1.00 98.53  ? 90   TYR C CE2   1 
ATOM   4241  C  CZ    . TYR C 2  90   ? 502.401 -21.530 666.743 1.00 94.42  ? 90   TYR C CZ    1 
ATOM   4242  O  OH    . TYR C 2  90   ? 503.033 -22.563 667.384 1.00 96.03  ? 90   TYR C OH    1 
ATOM   4243  N  N     . GLN C 2  91   ? 502.084 -19.622 661.846 1.00 105.40 ? 91   GLN C N     1 
ATOM   4244  C  CA    . GLN C 2  91   ? 502.115 -20.505 660.673 1.00 103.95 ? 91   GLN C CA    1 
ATOM   4245  C  C     . GLN C 2  91   ? 503.445 -21.249 660.608 1.00 103.87 ? 91   GLN C C     1 
ATOM   4246  O  O     . GLN C 2  91   ? 504.401 -20.910 661.313 1.00 107.48 ? 91   GLN C O     1 
ATOM   4247  C  CB    . GLN C 2  91   ? 501.916 -19.698 659.382 1.00 92.05  ? 91   GLN C CB    1 
ATOM   4248  C  CG    . GLN C 2  91   ? 502.898 -18.540 659.362 1.00 96.49  ? 91   GLN C CG    1 
ATOM   4249  C  CD    . GLN C 2  91   ? 502.766 -17.575 658.197 1.00 99.98  ? 91   GLN C CD    1 
ATOM   4250  O  OE1   . GLN C 2  91   ? 501.717 -17.477 657.546 1.00 99.89  ? 91   GLN C OE1   1 
ATOM   4251  N  NE2   . GLN C 2  91   ? 503.818 -16.780 657.989 1.00 98.91  ? 91   GLN C NE2   1 
ATOM   4252  N  N     . ALA C 2  92   ? 503.463 -22.329 659.809 1.00 100.31 ? 92   ALA C N     1 
ATOM   4253  C  CA    . ALA C 2  92   ? 504.650 -23.138 659.540 1.00 103.00 ? 92   ALA C CA    1 
ATOM   4254  C  C     . ALA C 2  92   ? 504.978 -23.154 658.050 1.00 104.03 ? 92   ALA C C     1 
ATOM   4255  O  O     . ALA C 2  92   ? 504.056 -23.200 657.229 1.00 101.47 ? 92   ALA C O     1 
ATOM   4256  C  CB    . ALA C 2  92   ? 504.458 -24.583 660.027 1.00 103.56 ? 92   ALA C CB    1 
ATOM   4257  N  N     . PRO C 2  93   ? 506.266 -23.159 657.669 1.00 113.36 ? 93   PRO C N     1 
ATOM   4258  C  CA    . PRO C 2  93   ? 506.627 -23.319 656.250 1.00 106.39 ? 93   PRO C CA    1 
ATOM   4259  C  C     . PRO C 2  93   ? 506.309 -24.723 655.750 1.00 102.38 ? 93   PRO C C     1 
ATOM   4260  O  O     . PRO C 2  93   ? 506.638 -25.718 656.405 1.00 100.16 ? 93   PRO C O     1 
ATOM   4261  C  CB    . PRO C 2  93   ? 508.135 -23.032 656.233 1.00 105.15 ? 93   PRO C CB    1 
ATOM   4262  C  CG    . PRO C 2  93   ? 508.600 -23.333 657.581 1.00 102.96 ? 93   PRO C CG    1 
ATOM   4263  C  CD    . PRO C 2  93   ? 507.466 -22.925 658.494 1.00 114.64 ? 93   PRO C CD    1 
ATOM   4264  N  N     . LEU C 2  94   ? 505.664 -24.796 654.585 1.00 101.06 ? 94   LEU C N     1 
ATOM   4265  C  CA    . LEU C 2  94   ? 505.350 -26.061 653.925 1.00 106.47 ? 94   LEU C CA    1 
ATOM   4266  C  C     . LEU C 2  94   ? 506.274 -26.287 652.717 1.00 115.46 ? 94   LEU C C     1 
ATOM   4267  O  O     . LEU C 2  94   ? 506.394 -25.428 651.830 1.00 114.76 ? 94   LEU C O     1 
ATOM   4268  C  CB    . LEU C 2  94   ? 503.869 -26.114 653.522 1.00 94.21  ? 94   LEU C CB    1 
ATOM   4269  C  CG    . LEU C 2  94   ? 503.392 -27.320 652.699 1.00 94.68  ? 94   LEU C CG    1 
ATOM   4270  C  CD1   . LEU C 2  94   ? 503.333 -28.601 653.525 1.00 97.10  ? 94   LEU C CD1   1 
ATOM   4271  C  CD2   . LEU C 2  94   ? 502.045 -27.044 652.060 1.00 85.65  ? 94   LEU C CD2   1 
ATOM   4272  N  N     . TYR C 2  95   ? 506.889 -27.467 652.663 1.00 109.25 ? 95   TYR C N     1 
ATOM   4273  C  CA    . TYR C 2  95   ? 507.723 -27.858 651.547 1.00 109.95 ? 95   TYR C CA    1 
ATOM   4274  C  C     . TYR C 2  95   ? 507.175 -29.135 650.929 1.00 113.03 ? 95   TYR C C     1 
ATOM   4275  O  O     . TYR C 2  95   ? 506.534 -29.943 651.607 1.00 110.32 ? 95   TYR C O     1 
ATOM   4276  C  CB    . TYR C 2  95   ? 509.148 -28.098 652.002 1.00 115.95 ? 95   TYR C CB    1 
ATOM   4277  C  CG    . TYR C 2  95   ? 509.778 -26.962 652.765 1.00 112.91 ? 95   TYR C CG    1 
ATOM   4278  C  CD1   . TYR C 2  95   ? 510.363 -25.897 652.099 1.00 121.58 ? 95   TYR C CD1   1 
ATOM   4279  C  CD2   . TYR C 2  95   ? 509.928 -27.029 654.130 1.00 109.02 ? 95   TYR C CD2   1 
ATOM   4280  C  CE1   . TYR C 2  95   ? 510.990 -24.879 652.785 1.00 120.26 ? 95   TYR C CE1   1 
ATOM   4281  C  CE2   . TYR C 2  95   ? 510.558 -26.022 654.828 1.00 111.80 ? 95   TYR C CE2   1 
ATOM   4282  C  CZ    . TYR C 2  95   ? 511.093 -24.951 654.150 1.00 117.07 ? 95   TYR C CZ    1 
ATOM   4283  O  OH    . TYR C 2  95   ? 511.725 -23.936 654.833 1.00 120.15 ? 95   TYR C OH    1 
ATOM   4284  N  N     . ALA C 2  96   ? 507.448 -29.335 649.639 1.00 118.20 ? 96   ALA C N     1 
ATOM   4285  C  CA    . ALA C 2  96   ? 507.043 -30.576 648.990 1.00 120.06 ? 96   ALA C CA    1 
ATOM   4286  C  C     . ALA C 2  96   ? 508.135 -31.165 648.103 1.00 121.90 ? 96   ALA C C     1 
ATOM   4287  O  O     . ALA C 2  96   ? 508.677 -30.477 647.234 1.00 125.15 ? 96   ALA C O     1 
ATOM   4288  C  CB    . ALA C 2  96   ? 505.774 -30.336 648.167 1.00 118.88 ? 96   ALA C CB    1 
ATOM   4289  N  N     . ARG C 2  97   ? 508.434 -32.447 648.312 1.00 119.57 ? 97   ARG C N     1 
ATOM   4290  C  CA    . ARG C 2  97   ? 509.343 -33.173 647.437 1.00 121.03 ? 97   ARG C CA    1 
ATOM   4291  C  C     . ARG C 2  97   ? 508.621 -33.675 646.193 1.00 121.95 ? 97   ARG C C     1 
ATOM   4292  O  O     . ARG C 2  97   ? 507.658 -34.440 646.281 1.00 115.96 ? 97   ARG C O     1 
ATOM   4293  C  CB    . ARG C 2  97   ? 510.032 -34.350 648.118 1.00 122.47 ? 97   ARG C CB    1 
ATOM   4294  C  CG    . ARG C 2  97   ? 511.539 -34.124 648.213 1.00 131.48 ? 97   ARG C CG    1 
ATOM   4295  C  CD    . ARG C 2  97   ? 512.282 -35.198 648.977 1.00 129.62 ? 97   ARG C CD    1 
ATOM   4296  N  NE    . ARG C 2  97   ? 512.319 -34.981 650.414 1.00 143.22 ? 97   ARG C NE    1 
ATOM   4297  C  CZ    . ARG C 2  97   ? 512.911 -35.824 651.257 1.00 144.34 ? 97   ARG C CZ    1 
ATOM   4298  N  NH1   . ARG C 2  97   ? 513.499 -36.914 650.766 1.00 131.19 ? 97   ARG C NH1   1 
ATOM   4299  N  NH2   . ARG C 2  97   ? 512.902 -35.592 652.575 1.00 137.96 ? 97   ARG C NH2   1 
ATOM   4300  N  N     . LEU C 2  98   ? 509.083 -33.225 645.039 1.00 127.54 ? 98   LEU C N     1 
ATOM   4301  C  CA    . LEU C 2  98   ? 508.515 -33.560 643.746 1.00 129.20 ? 98   LEU C CA    1 
ATOM   4302  C  C     . LEU C 2  98   ? 509.591 -34.189 642.857 1.00 135.02 ? 98   LEU C C     1 
ATOM   4303  O  O     . LEU C 2  98   ? 510.752 -33.766 642.891 1.00 139.77 ? 98   LEU C O     1 
ATOM   4304  C  CB    . LEU C 2  98   ? 507.950 -32.303 643.093 1.00 129.93 ? 98   LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2  98   ? 506.892 -31.583 643.914 1.00 125.01 ? 98   LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2  98   ? 506.413 -30.337 643.171 1.00 118.71 ? 98   LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2  98   ? 505.751 -32.556 644.168 1.00 122.83 ? 98   LEU C CD2   1 
ATOM   4308  N  N     . GLN C 2  99   ? 509.224 -35.206 642.067 1.00 134.90 ? 99   GLN C N     1 
ATOM   4309  C  CA    . GLN C 2  99   ? 510.130 -35.759 641.061 1.00 131.79 ? 99   GLN C CA    1 
ATOM   4310  C  C     . GLN C 2  99   ? 509.569 -35.516 639.663 1.00 132.66 ? 99   GLN C C     1 
ATOM   4311  O  O     . GLN C 2  99   ? 508.451 -35.935 639.343 1.00 130.67 ? 99   GLN C O     1 
ATOM   4312  C  CB    . GLN C 2  99   ? 510.419 -37.257 641.260 1.00 127.91 ? 99   GLN C CB    1 
ATOM   4313  C  CG    . GLN C 2  99   ? 509.254 -38.210 641.064 1.00 132.99 ? 99   GLN C CG    1 
ATOM   4314  C  CD    . GLN C 2  99   ? 509.659 -39.676 641.151 1.00 134.31 ? 99   GLN C CD    1 
ATOM   4315  O  OE1   . GLN C 2  99   ? 509.385 -40.452 640.236 1.00 141.75 ? 99   GLN C OE1   1 
ATOM   4316  N  NE2   . GLN C 2  99   ? 510.380 -40.040 642.206 1.00 128.35 ? 99   GLN C NE2   1 
ATOM   4317  N  N     . LEU C 2  100  ? 510.371 -34.851 638.834 1.00 142.31 ? 100  LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  100  ? 510.101 -34.661 637.410 1.00 145.04 ? 100  LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  100  ? 510.546 -35.887 636.620 1.00 144.63 ? 100  LEU C C     1 
ATOM   4320  O  O     . LEU C 2  100  ? 511.664 -36.377 636.787 1.00 145.92 ? 100  LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  100  ? 510.799 -33.414 636.880 1.00 139.66 ? 100  LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  100  ? 510.535 -33.114 635.409 1.00 130.80 ? 100  LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  100  ? 509.063 -33.028 635.095 1.00 133.04 ? 100  LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  100  ? 511.188 -31.794 635.103 1.00 138.56 ? 100  LEU C CD2   1 
ATOM   4325  N  N     . ILE C 2  101  ? 509.654 -36.389 635.777 1.00 145.66 ? 101  ILE C N     1 
ATOM   4326  C  CA    . ILE C 2  101  ? 509.868 -37.559 634.936 1.00 147.68 ? 101  ILE C CA    1 
ATOM   4327  C  C     . ILE C 2  101  ? 509.627 -37.096 633.510 1.00 156.67 ? 101  ILE C C     1 
ATOM   4328  O  O     . ILE C 2  101  ? 509.138 -35.981 633.282 1.00 154.29 ? 101  ILE C O     1 
ATOM   4329  C  CB    . ILE C 2  101  ? 508.962 -38.753 635.268 1.00 148.81 ? 101  ILE C CB    1 
ATOM   4330  C  CG1   . ILE C 2  101  ? 508.921 -39.046 636.762 1.00 146.77 ? 101  ILE C CG1   1 
ATOM   4331  C  CG2   . ILE C 2  101  ? 509.516 -40.010 634.629 1.00 148.68 ? 101  ILE C CG2   1 
ATOM   4332  C  CD1   . ILE C 2  101  ? 507.910 -40.122 637.128 1.00 138.42 ? 101  ILE C CD1   1 
ATOM   4333  N  N     . HIS C 2  102  ? 510.259 -37.782 632.566 1.00 168.00 ? 102  HIS C N     1 
ATOM   4334  C  CA    . HIS C 2  102  ? 509.958 -37.538 631.162 1.00 169.73 ? 102  HIS C CA    1 
ATOM   4335  C  C     . HIS C 2  102  ? 509.347 -38.752 630.451 1.00 174.28 ? 102  HIS C C     1 
ATOM   4336  O  O     . HIS C 2  102  ? 510.050 -39.754 630.252 1.00 170.78 ? 102  HIS C O     1 
ATOM   4337  C  CB    . HIS C 2  102  ? 511.262 -37.060 630.566 1.00 167.89 ? 102  HIS C CB    1 
ATOM   4338  C  CG    . HIS C 2  102  ? 511.112 -36.138 629.411 1.00 174.70 ? 102  HIS C CG    1 
ATOM   4339  N  ND1   . HIS C 2  102  ? 512.153 -35.342 628.989 1.00 177.00 ? 102  HIS C ND1   1 
ATOM   4340  C  CD2   . HIS C 2  102  ? 510.059 -35.842 628.614 1.00 178.07 ? 102  HIS C CD2   1 
ATOM   4341  C  CE1   . HIS C 2  102  ? 511.751 -34.598 627.976 1.00 178.27 ? 102  HIS C CE1   1 
ATOM   4342  N  NE2   . HIS C 2  102  ? 510.486 -34.886 627.723 1.00 177.76 ? 102  HIS C NE2   1 
ATOM   4343  N  N     . LYS C 2  103  ? 508.058 -38.688 630.074 1.00 177.54 ? 103  LYS C N     1 
ATOM   4344  C  CA    . LYS C 2  103  ? 507.438 -39.855 629.442 1.00 180.52 ? 103  LYS C CA    1 
ATOM   4345  C  C     . LYS C 2  103  ? 508.096 -40.123 628.092 1.00 181.46 ? 103  LYS C C     1 
ATOM   4346  O  O     . LYS C 2  103  ? 508.159 -41.277 627.645 1.00 180.85 ? 103  LYS C O     1 
ATOM   4347  C  CB    . LYS C 2  103  ? 505.910 -39.682 629.281 1.00 175.09 ? 103  LYS C CB    1 
ATOM   4348  C  CG    . LYS C 2  103  ? 505.363 -39.810 627.837 1.00 177.36 ? 103  LYS C CG    1 
ATOM   4349  C  CD    . LYS C 2  103  ? 504.121 -38.974 627.534 1.00 172.03 ? 103  LYS C CD    1 
ATOM   4350  C  CE    . LYS C 2  103  ? 503.841 -38.964 626.031 1.00 168.45 ? 103  LYS C CE    1 
ATOM   4351  N  NZ    . LYS C 2  103  ? 503.159 -40.220 625.586 1.00 153.58 ? 103  LYS C NZ    1 
ATOM   4352  N  N     . ASP C 2  104  ? 508.578 -39.061 627.435 1.00 181.45 ? 104  ASP C N     1 
ATOM   4353  C  CA    . ASP C 2  104  ? 509.325 -39.193 626.186 1.00 179.96 ? 104  ASP C CA    1 
ATOM   4354  C  C     . ASP C 2  104  ? 510.725 -39.784 626.402 1.00 175.38 ? 104  ASP C C     1 
ATOM   4355  O  O     . ASP C 2  104  ? 511.061 -40.833 625.843 1.00 167.18 ? 104  ASP C O     1 
ATOM   4356  C  CB    . ASP C 2  104  ? 509.430 -37.805 625.535 1.00 182.22 ? 104  ASP C CB    1 
ATOM   4357  C  CG    . ASP C 2  104  ? 508.081 -37.064 625.472 1.00 184.37 ? 104  ASP C CG    1 
ATOM   4358  O  OD1   . ASP C 2  104  ? 507.029 -37.736 625.382 1.00 186.29 ? 104  ASP C OD1   1 
ATOM   4359  O  OD2   . ASP C 2  104  ? 508.073 -35.808 625.553 1.00 180.27 ? 104  ASP C OD2   1 
ATOM   4360  N  N     . THR C 2  105  ? 511.564 -39.104 627.199 1.00 176.99 ? 105  THR C N     1 
ATOM   4361  C  CA    . THR C 2  105  ? 512.966 -39.469 627.444 1.00 171.92 ? 105  THR C CA    1 
ATOM   4362  C  C     . THR C 2  105  ? 513.197 -40.636 628.408 1.00 172.70 ? 105  THR C C     1 
ATOM   4363  O  O     . THR C 2  105  ? 513.235 -41.810 628.020 1.00 165.06 ? 105  THR C O     1 
ATOM   4364  C  CB    . THR C 2  105  ? 513.752 -38.250 627.959 1.00 167.90 ? 105  THR C CB    1 
ATOM   4365  O  OG1   . THR C 2  105  ? 513.589 -37.155 627.057 1.00 164.48 ? 105  THR C OG1   1 
ATOM   4366  C  CG2   . THR C 2  105  ? 515.246 -38.552 628.046 1.00 161.38 ? 105  THR C CG2   1 
ATOM   4367  N  N     . GLY C 2  106  ? 513.360 -40.270 629.687 1.00 178.59 ? 106  GLY C N     1 
ATOM   4368  C  CA    . GLY C 2  106  ? 513.758 -41.108 630.804 1.00 177.56 ? 106  GLY C CA    1 
ATOM   4369  C  C     . GLY C 2  106  ? 514.278 -40.213 631.929 1.00 176.75 ? 106  GLY C C     1 
ATOM   4370  O  O     . GLY C 2  106  ? 514.466 -40.655 633.073 1.00 172.20 ? 106  GLY C O     1 
ATOM   4371  N  N     . LEU C 2  107  ? 514.509 -38.937 631.592 1.00 175.76 ? 107  LEU C N     1 
ATOM   4372  C  CA    . LEU C 2  107  ? 515.054 -37.935 632.514 1.00 171.50 ? 107  LEU C CA    1 
ATOM   4373  C  C     . LEU C 2  107  ? 514.320 -37.846 633.848 1.00 164.37 ? 107  LEU C C     1 
ATOM   4374  O  O     . LEU C 2  107  ? 513.087 -37.911 633.911 1.00 165.36 ? 107  LEU C O     1 
ATOM   4375  C  CB    . LEU C 2  107  ? 514.989 -36.570 631.832 1.00 171.10 ? 107  LEU C CB    1 
ATOM   4376  C  CG    . LEU C 2  107  ? 515.151 -35.282 632.635 1.00 166.08 ? 107  LEU C CG    1 
ATOM   4377  C  CD1   . LEU C 2  107  ? 516.419 -34.555 632.220 1.00 169.58 ? 107  LEU C CD1   1 
ATOM   4378  C  CD2   . LEU C 2  107  ? 513.938 -34.370 632.433 1.00 154.74 ? 107  LEU C CD2   1 
ATOM   4379  N  N     . ILE C 2  108  ? 515.103 -37.757 634.934 1.00 162.51 ? 108  ILE C N     1 
ATOM   4380  C  CA    . ILE C 2  108  ? 514.551 -37.599 636.287 1.00 162.63 ? 108  ILE C CA    1 
ATOM   4381  C  C     . ILE C 2  108  ? 515.308 -36.506 637.059 1.00 156.63 ? 108  ILE C C     1 
ATOM   4382  O  O     . ILE C 2  108  ? 516.444 -36.763 637.495 1.00 157.49 ? 108  ILE C O     1 
ATOM   4383  C  CB    . ILE C 2  108  ? 514.664 -38.938 637.053 1.00 159.56 ? 108  ILE C CB    1 
ATOM   4384  C  CG1   . ILE C 2  108  ? 513.947 -40.098 636.347 1.00 160.73 ? 108  ILE C CG1   1 
ATOM   4385  C  CG2   . ILE C 2  108  ? 514.210 -38.799 638.517 1.00 153.07 ? 108  ILE C CG2   1 
ATOM   4386  C  CD1   . ILE C 2  108  ? 513.891 -41.358 637.177 1.00 158.76 ? 108  ILE C CD1   1 
ATOM   4387  N  N     . LYS C 2  109  ? 514.641 -35.365 637.359 1.00 153.04 ? 109  LYS C N     1 
ATOM   4388  C  CA    . LYS C 2  109  ? 515.127 -34.327 638.287 1.00 148.44 ? 109  LYS C CA    1 
ATOM   4389  C  C     . LYS C 2  109  ? 514.179 -34.209 639.500 1.00 146.21 ? 109  LYS C C     1 
ATOM   4390  O  O     . LYS C 2  109  ? 512.958 -34.129 639.307 1.00 142.82 ? 109  LYS C O     1 
ATOM   4391  C  CB    . LYS C 2  109  ? 515.357 -32.942 637.590 1.00 143.12 ? 109  LYS C CB    1 
ATOM   4392  C  CG    . LYS C 2  109  ? 515.671 -31.865 638.678 1.00 142.08 ? 109  LYS C CG    1 
ATOM   4393  C  CD    . LYS C 2  109  ? 516.940 -32.303 639.495 1.00 136.91 ? 109  LYS C CD    1 
ATOM   4394  C  CE    . LYS C 2  109  ? 517.390 -31.240 640.507 1.00 128.86 ? 109  LYS C CE    1 
ATOM   4395  N  NZ    . LYS C 2  109  ? 518.385 -31.635 641.562 1.00 110.35 ? 109  LYS C NZ    1 
ATOM   4396  N  N     . GLU C 2  110  ? 514.712 -34.222 640.739 1.00 145.00 ? 110  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2  110  ? 513.919 -34.226 641.974 1.00 134.33 ? 110  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2  110  ? 514.326 -33.037 642.829 1.00 133.58 ? 110  GLU C C     1 
ATOM   4399  O  O     . GLU C 2  110  ? 515.508 -32.835 643.087 1.00 140.60 ? 110  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2  110  ? 514.178 -35.421 642.922 1.00 129.38 ? 110  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2  110  ? 513.394 -36.687 642.905 1.00 129.20 ? 110  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2  110  ? 513.878 -37.580 644.042 1.00 125.56 ? 110  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2  110  ? 514.384 -37.015 645.050 1.00 120.41 ? 110  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2  110  ? 513.742 -38.819 643.943 1.00 121.30 ? 110  GLU C OE2   1 
ATOM   4405  N  N     . ASP C 2  111  ? 513.347 -32.329 643.385 1.00 134.88 ? 111  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  111  ? 513.709 -31.154 644.168 1.00 141.40 ? 111  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  111  ? 512.602 -30.886 645.203 1.00 137.96 ? 111  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  111  ? 511.471 -31.361 645.070 1.00 137.42 ? 111  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  111  ? 513.971 -29.998 643.174 1.00 135.26 ? 111  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  111  ? 514.607 -28.752 643.805 1.00 143.24 ? 111  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  111  ? 515.453 -28.883 644.724 1.00 140.42 ? 111  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  111  ? 514.299 -27.635 643.312 1.00 145.12 ? 111  ASP C OD2   1 
ATOM   4413  N  N     . GLU C 2  112  ? 512.929 -30.151 646.263 1.00 128.64 ? 112  GLU C N     1 
ATOM   4414  C  CA    . GLU C 2  112  ? 511.942 -29.771 647.271 1.00 125.76 ? 112  GLU C CA    1 
ATOM   4415  C  C     . GLU C 2  112  ? 511.503 -28.314 647.086 1.00 125.21 ? 112  GLU C C     1 
ATOM   4416  O  O     . GLU C 2  112  ? 512.253 -27.390 647.417 1.00 125.82 ? 112  GLU C O     1 
ATOM   4417  C  CB    . GLU C 2  112  ? 512.544 -30.058 648.641 1.00 128.87 ? 112  GLU C CB    1 
ATOM   4418  C  CG    . GLU C 2  112  ? 511.681 -29.845 649.839 1.00 127.56 ? 112  GLU C CG    1 
ATOM   4419  C  CD    . GLU C 2  112  ? 512.498 -29.804 651.125 1.00 129.19 ? 112  GLU C CD    1 
ATOM   4420  O  OE1   . GLU C 2  112  ? 513.473 -29.023 651.202 1.00 125.05 ? 112  GLU C OE1   1 
ATOM   4421  O  OE2   . GLU C 2  112  ? 512.163 -30.567 652.058 1.00 130.35 ? 112  GLU C OE2   1 
ATOM   4422  N  N     . VAL C 2  113  ? 510.260 -28.098 646.643 1.00 123.12 ? 113  VAL C N     1 
ATOM   4423  C  CA    . VAL C 2  113  ? 509.778 -26.745 646.364 1.00 124.04 ? 113  VAL C CA    1 
ATOM   4424  C  C     . VAL C 2  113  ? 509.003 -26.196 647.563 1.00 127.27 ? 113  VAL C C     1 
ATOM   4425  O  O     . VAL C 2  113  ? 508.259 -26.922 648.245 1.00 117.72 ? 113  VAL C O     1 
ATOM   4426  C  CB    . VAL C 2  113  ? 508.919 -26.729 645.086 1.00 116.56 ? 113  VAL C CB    1 
ATOM   4427  C  CG1   . VAL C 2  113  ? 509.723 -27.209 643.963 1.00 125.65 ? 113  VAL C CG1   1 
ATOM   4428  C  CG2   . VAL C 2  113  ? 507.766 -27.658 645.211 1.00 121.19 ? 113  VAL C CG2   1 
ATOM   4429  N  N     . PHE C 2  114  ? 509.179 -24.893 647.810 1.00 128.93 ? 114  PHE C N     1 
ATOM   4430  C  CA    . PHE C 2  114  ? 508.556 -24.187 648.925 1.00 121.24 ? 114  PHE C CA    1 
ATOM   4431  C  C     . PHE C 2  114  ? 507.177 -23.694 648.505 1.00 124.75 ? 114  PHE C C     1 
ATOM   4432  O  O     . PHE C 2  114  ? 507.050 -22.903 647.559 1.00 121.87 ? 114  PHE C O     1 
ATOM   4433  C  CB    . PHE C 2  114  ? 509.441 -23.020 649.371 1.00 121.22 ? 114  PHE C CB    1 
ATOM   4434  C  CG    . PHE C 2  114  ? 508.842 -22.158 650.453 1.00 124.43 ? 114  PHE C CG    1 
ATOM   4435  C  CD1   . PHE C 2  114  ? 508.535 -22.684 651.692 1.00 120.96 ? 114  PHE C CD1   1 
ATOM   4436  C  CD2   . PHE C 2  114  ? 508.583 -20.817 650.226 1.00 126.06 ? 114  PHE C CD2   1 
ATOM   4437  C  CE1   . PHE C 2  114  ? 507.993 -21.887 652.684 1.00 115.03 ? 114  PHE C CE1   1 
ATOM   4438  C  CE2   . PHE C 2  114  ? 508.034 -20.022 651.219 1.00 124.89 ? 114  PHE C CE2   1 
ATOM   4439  C  CZ    . PHE C 2  114  ? 507.743 -20.561 652.447 1.00 116.63 ? 114  PHE C CZ    1 
ATOM   4440  N  N     . LEU C 2  115  ? 506.150 -24.160 649.209 1.00 122.11 ? 115  LEU C N     1 
ATOM   4441  C  CA    . LEU C 2  115  ? 504.774 -23.839 648.882 1.00 116.70 ? 115  LEU C CA    1 
ATOM   4442  C  C     . LEU C 2  115  ? 504.204 -22.705 649.719 1.00 121.82 ? 115  LEU C C     1 
ATOM   4443  O  O     . LEU C 2  115  ? 503.008 -22.423 649.611 1.00 128.55 ? 115  LEU C O     1 
ATOM   4444  C  CB    . LEU C 2  115  ? 503.912 -25.093 649.033 1.00 112.92 ? 115  LEU C CB    1 
ATOM   4445  C  CG    . LEU C 2  115  ? 504.347 -26.240 648.130 1.00 111.48 ? 115  LEU C CG    1 
ATOM   4446  C  CD1   . LEU C 2  115  ? 503.369 -27.410 648.123 1.00 102.00 ? 115  LEU C CD1   1 
ATOM   4447  C  CD2   . LEU C 2  115  ? 504.457 -25.647 646.753 1.00 112.19 ? 115  LEU C CD2   1 
ATOM   4448  N  N     . GLY C 2  116  ? 505.005 -22.051 650.549 1.00 118.21 ? 116  GLY C N     1 
ATOM   4449  C  CA    . GLY C 2  116  ? 504.460 -21.030 651.421 1.00 119.55 ? 116  GLY C CA    1 
ATOM   4450  C  C     . GLY C 2  116  ? 504.241 -21.548 652.830 1.00 113.45 ? 116  GLY C C     1 
ATOM   4451  O  O     . GLY C 2  116  ? 504.708 -22.623 653.215 1.00 110.74 ? 116  GLY C O     1 
ATOM   4452  N  N     . HIS C 2  117  ? 503.453 -20.800 653.592 1.00 107.02 ? 117  HIS C N     1 
ATOM   4453  C  CA    . HIS C 2  117  ? 503.218 -21.148 654.988 1.00 102.40 ? 117  HIS C CA    1 
ATOM   4454  C  C     . HIS C 2  117  ? 501.791 -21.645 655.214 1.00 94.25  ? 117  HIS C C     1 
ATOM   4455  O  O     . HIS C 2  117  ? 500.859 -21.211 654.545 1.00 100.38 ? 117  HIS C O     1 
ATOM   4456  C  CB    . HIS C 2  117  ? 503.477 -19.927 655.864 1.00 107.47 ? 117  HIS C CB    1 
ATOM   4457  C  CG    . HIS C 2  117  ? 504.902 -19.460 655.871 1.00 109.18 ? 117  HIS C CG    1 
ATOM   4458  N  ND1   . HIS C 2  117  ? 505.758 -19.684 656.932 1.00 105.50 ? 117  HIS C ND1   1 
ATOM   4459  C  CD2   . HIS C 2  117  ? 505.606 -18.744 654.961 1.00 109.81 ? 117  HIS C CD2   1 
ATOM   4460  C  CE1   . HIS C 2  117  ? 506.933 -19.144 656.667 1.00 114.11 ? 117  HIS C CE1   1 
ATOM   4461  N  NE2   . HIS C 2  117  ? 506.868 -18.568 655.476 1.00 121.80 ? 117  HIS C NE2   1 
ATOM   4462  N  N     . ILE C 2  118  ? 501.583 -22.482 656.225 1.00 89.73  ? 118  ILE C N     1 
ATOM   4463  C  CA    . ILE C 2  118  ? 500.245 -22.907 656.620 1.00 95.86  ? 118  ILE C CA    1 
ATOM   4464  C  C     . ILE C 2  118  ? 499.993 -22.533 658.076 1.00 103.92 ? 118  ILE C C     1 
ATOM   4465  O  O     . ILE C 2  118  ? 500.862 -22.750 658.925 1.00 102.28 ? 118  ILE C O     1 
ATOM   4466  C  CB    . ILE C 2  118  ? 500.016 -24.415 656.425 1.00 89.46  ? 118  ILE C CB    1 
ATOM   4467  C  CG1   . ILE C 2  118  ? 499.622 -24.678 654.997 1.00 93.97  ? 118  ILE C CG1   1 
ATOM   4468  C  CG2   . ILE C 2  118  ? 498.893 -24.924 657.289 1.00 89.84  ? 118  ILE C CG2   1 
ATOM   4469  C  CD1   . ILE C 2  118  ? 499.257 -26.109 654.798 1.00 102.07 ? 118  ILE C CD1   1 
ATOM   4470  N  N     . PRO C 2  119  ? 498.825 -21.967 658.400 1.00 96.18  ? 119  PRO C N     1 
ATOM   4471  C  CA    . PRO C 2  119  ? 498.562 -21.539 659.771 1.00 97.23  ? 119  PRO C CA    1 
ATOM   4472  C  C     . PRO C 2  119  ? 498.416 -22.718 660.735 1.00 96.35  ? 119  PRO C C     1 
ATOM   4473  O  O     . PRO C 2  119  ? 497.779 -23.725 660.419 1.00 91.28  ? 119  PRO C O     1 
ATOM   4474  C  CB    . PRO C 2  119  ? 497.258 -20.759 659.626 1.00 98.54  ? 119  PRO C CB    1 
ATOM   4475  C  CG    . PRO C 2  119  ? 497.274 -20.276 658.218 1.00 84.44  ? 119  PRO C CG    1 
ATOM   4476  C  CD    . PRO C 2  119  ? 497.855 -21.385 657.458 1.00 90.72  ? 119  PRO C CD    1 
ATOM   4477  N  N     . LEU C 2  120  ? 499.005 -22.576 661.926 1.00 95.17  ? 120  LEU C N     1 
ATOM   4478  C  CA    . LEU C 2  120  ? 498.916 -23.595 662.962 1.00 99.06  ? 120  LEU C CA    1 
ATOM   4479  C  C     . LEU C 2  120  ? 497.869 -23.207 663.991 1.00 100.74 ? 120  LEU C C     1 
ATOM   4480  O  O     . LEU C 2  120  ? 497.743 -22.025 664.339 1.00 96.97  ? 120  LEU C O     1 
ATOM   4481  C  CB    . LEU C 2  120  ? 500.258 -23.834 663.650 1.00 99.34  ? 120  LEU C CB    1 
ATOM   4482  C  CG    . LEU C 2  120  ? 501.420 -24.322 662.793 1.00 101.82 ? 120  LEU C CG    1 
ATOM   4483  C  CD1   . LEU C 2  120  ? 502.667 -24.421 663.623 1.00 105.47 ? 120  LEU C CD1   1 
ATOM   4484  C  CD2   . LEU C 2  120  ? 501.077 -25.700 662.252 1.00 100.36 ? 120  LEU C CD2   1 
ATOM   4485  N  N     . MET C 2  121  ? 497.138 -24.222 664.481 1.00 98.15  ? 121  MET C N     1 
ATOM   4486  C  CA    . MET C 2  121  ? 496.175 -24.073 665.578 1.00 98.86  ? 121  MET C CA    1 
ATOM   4487  C  C     . MET C 2  121  ? 496.884 -24.099 666.927 1.00 99.30  ? 121  MET C C     1 
ATOM   4488  O  O     . MET C 2  121  ? 497.753 -24.942 667.171 1.00 101.11 ? 121  MET C O     1 
ATOM   4489  C  CB    . MET C 2  121  ? 495.116 -25.177 665.497 1.00 94.80  ? 121  MET C CB    1 
ATOM   4490  C  CG    . MET C 2  121  ? 494.051 -25.205 666.582 1.00 87.86  ? 121  MET C CG    1 
ATOM   4491  S  SD    . MET C 2  121  ? 492.849 -26.559 666.325 1.00 85.36  ? 121  MET C SD    1 
ATOM   4492  C  CE    . MET C 2  121  ? 491.844 -25.873 665.007 1.00 86.04  ? 121  MET C CE    1 
ATOM   4493  N  N     . THR C 2  122  ? 496.479 -23.198 667.821 1.00 96.69  ? 122  THR C N     1 
ATOM   4494  C  CA    . THR C 2  122  ? 497.055 -23.160 669.155 1.00 97.83  ? 122  THR C CA    1 
ATOM   4495  C  C     . THR C 2  122  ? 496.548 -24.315 670.021 1.00 94.28  ? 122  THR C C     1 
ATOM   4496  O  O     . THR C 2  122  ? 495.753 -25.157 669.606 1.00 93.55  ? 122  THR C O     1 
ATOM   4497  C  CB    . THR C 2  122  ? 496.758 -21.817 669.798 1.00 101.84 ? 122  THR C CB    1 
ATOM   4498  O  OG1   . THR C 2  122  ? 495.344 -21.638 669.879 1.00 101.06 ? 122  THR C OG1   1 
ATOM   4499  C  CG2   . THR C 2  122  ? 497.329 -20.698 668.901 1.00 92.22  ? 122  THR C CG2   1 
ATOM   4500  N  N     . GLU C 2  123  ? 497.010 -24.333 671.265 1.00 97.94  ? 123  GLU C N     1 
ATOM   4501  C  CA    . GLU C 2  123  ? 496.671 -25.435 672.155 1.00 103.98 ? 123  GLU C CA    1 
ATOM   4502  C  C     . GLU C 2  123  ? 495.180 -25.455 672.489 1.00 103.26 ? 123  GLU C C     1 
ATOM   4503  O  O     . GLU C 2  123  ? 494.625 -26.529 672.760 1.00 100.36 ? 123  GLU C O     1 
ATOM   4504  C  CB    . GLU C 2  123  ? 497.572 -25.383 673.388 1.00 110.65 ? 123  GLU C CB    1 
ATOM   4505  C  CG    . GLU C 2  123  ? 497.791 -26.747 674.023 1.00 121.88 ? 123  GLU C CG    1 
ATOM   4506  C  CD    . GLU C 2  123  ? 498.663 -26.682 675.265 1.00 130.02 ? 123  GLU C CD    1 
ATOM   4507  O  OE1   . GLU C 2  123  ? 499.199 -27.745 675.688 1.00 134.26 ? 123  GLU C OE1   1 
ATOM   4508  O  OE2   . GLU C 2  123  ? 498.827 -25.559 675.795 1.00 126.64 ? 123  GLU C OE2   1 
ATOM   4509  N  N     . ASP C 2  124  ? 494.523 -24.291 672.510 1.00 102.89 ? 124  ASP C N     1 
ATOM   4510  C  CA    . ASP C 2  124  ? 493.124 -24.208 672.913 1.00 96.59  ? 124  ASP C CA    1 
ATOM   4511  C  C     . ASP C 2  124  ? 492.174 -24.317 671.722 1.00 96.89  ? 124  ASP C C     1 
ATOM   4512  O  O     . ASP C 2  124  ? 490.961 -24.190 671.894 1.00 101.46 ? 124  ASP C O     1 
ATOM   4513  C  CB    . ASP C 2  124  ? 492.832 -22.915 673.708 1.00 97.74  ? 124  ASP C CB    1 
ATOM   4514  C  CG    . ASP C 2  124  ? 493.070 -21.627 672.914 1.00 95.07  ? 124  ASP C CG    1 
ATOM   4515  O  OD1   . ASP C 2  124  ? 494.234 -21.224 672.757 1.00 104.70 ? 124  ASP C OD1   1 
ATOM   4516  O  OD2   . ASP C 2  124  ? 492.094 -20.992 672.458 1.00 89.03  ? 124  ASP C OD2   1 
ATOM   4517  N  N     . GLY C 2  125  ? 492.683 -24.562 670.522 1.00 96.27  ? 125  GLY C N     1 
ATOM   4518  C  CA    . GLY C 2  125  ? 491.819 -24.793 669.387 1.00 92.75  ? 125  GLY C CA    1 
ATOM   4519  C  C     . GLY C 2  125  ? 491.512 -23.588 668.535 1.00 92.25  ? 125  GLY C C     1 
ATOM   4520  O  O     . GLY C 2  125  ? 490.562 -23.631 667.750 1.00 93.75  ? 125  GLY C O     1 
ATOM   4521  N  N     . SER C 2  126  ? 492.269 -22.514 668.659 1.00 92.13  ? 126  SER C N     1 
ATOM   4522  C  CA    . SER C 2  126  ? 492.073 -21.300 667.874 1.00 92.10  ? 126  SER C CA    1 
ATOM   4523  C  C     . SER C 2  126  ? 493.299 -21.016 666.981 1.00 99.75  ? 126  SER C C     1 
ATOM   4524  O  O     . SER C 2  126  ? 494.260 -21.798 666.910 1.00 97.90  ? 126  SER C O     1 
ATOM   4525  C  CB    . SER C 2  126  ? 491.718 -20.133 668.793 1.00 96.46  ? 126  SER C CB    1 
ATOM   4526  O  OG    . SER C 2  126  ? 492.699 -19.967 669.807 1.00 106.98 ? 126  SER C OG    1 
ATOM   4527  N  N     . PHE C 2  127  ? 493.206 -19.925 666.219 1.00 95.91  ? 127  PHE C N     1 
ATOM   4528  C  CA    . PHE C 2  127  ? 494.234 -19.464 665.300 1.00 89.92  ? 127  PHE C CA    1 
ATOM   4529  C  C     . PHE C 2  127  ? 494.659 -18.020 665.562 1.00 94.05  ? 127  PHE C C     1 
ATOM   4530  O  O     . PHE C 2  127  ? 493.945 -17.240 666.201 1.00 98.19  ? 127  PHE C O     1 
ATOM   4531  C  CB    . PHE C 2  127  ? 493.731 -19.607 663.869 1.00 88.39  ? 127  PHE C CB    1 
ATOM   4532  C  CG    . PHE C 2  127  ? 493.597 -21.030 663.410 1.00 89.27  ? 127  PHE C CG    1 
ATOM   4533  C  CD1   . PHE C 2  127  ? 494.725 -21.738 663.019 1.00 94.01  ? 127  PHE C CD1   1 
ATOM   4534  C  CD2   . PHE C 2  127  ? 492.384 -21.670 663.379 1.00 86.92  ? 127  PHE C CD2   1 
ATOM   4535  C  CE1   . PHE C 2  127  ? 494.632 -23.045 662.582 1.00 90.27  ? 127  PHE C CE1   1 
ATOM   4536  C  CE2   . PHE C 2  127  ? 492.287 -22.993 662.946 1.00 87.47  ? 127  PHE C CE2   1 
ATOM   4537  C  CZ    . PHE C 2  127  ? 493.408 -23.671 662.550 1.00 87.96  ? 127  PHE C CZ    1 
ATOM   4538  N  N     . ILE C 2  128  ? 495.853 -17.674 665.067 1.00 92.14  ? 128  ILE C N     1 
ATOM   4539  C  CA    . ILE C 2  128  ? 496.365 -16.301 665.057 1.00 92.56  ? 128  ILE C CA    1 
ATOM   4540  C  C     . ILE C 2  128  ? 496.596 -15.934 663.602 1.00 93.09  ? 128  ILE C C     1 
ATOM   4541  O  O     . ILE C 2  128  ? 497.433 -16.550 662.939 1.00 97.48  ? 128  ILE C O     1 
ATOM   4542  C  CB    . ILE C 2  128  ? 497.671 -16.134 665.848 1.00 91.61  ? 128  ILE C CB    1 
ATOM   4543  C  CG1   . ILE C 2  128  ? 497.512 -16.602 667.289 1.00 89.35  ? 128  ILE C CG1   1 
ATOM   4544  C  CG2   . ILE C 2  128  ? 498.105 -14.652 665.842 1.00 87.80  ? 128  ILE C CG2   1 
ATOM   4545  C  CD1   . ILE C 2  128  ? 498.835 -16.758 668.014 1.00 92.48  ? 128  ILE C CD1   1 
ATOM   4546  N  N     . ILE C 2  129  ? 495.786 -15.037 663.071 1.00 93.43  ? 129  ILE C N     1 
ATOM   4547  C  CA    . ILE C 2  129  ? 495.828 -14.659 661.669 1.00 90.26  ? 129  ILE C CA    1 
ATOM   4548  C  C     . ILE C 2  129  ? 496.061 -13.161 661.624 1.00 100.13 ? 129  ILE C C     1 
ATOM   4549  O  O     . ILE C 2  129  ? 495.194 -12.393 662.047 1.00 110.20 ? 129  ILE C O     1 
ATOM   4550  C  CB    . ILE C 2  129  ? 494.539 -15.021 660.935 1.00 83.91  ? 129  ILE C CB    1 
ATOM   4551  C  CG1   . ILE C 2  129  ? 494.216 -16.504 661.108 1.00 85.84  ? 129  ILE C CG1   1 
ATOM   4552  C  CG2   . ILE C 2  129  ? 494.534 -14.459 659.533 1.00 89.53  ? 129  ILE C CG2   1 
ATOM   4553  C  CD1   . ILE C 2  129  ? 495.194 -17.453 660.573 1.00 84.90  ? 129  ILE C CD1   1 
ATOM   4554  N  N     . ASN C 2  130  ? 497.235 -12.737 661.176 1.00 102.27 ? 130  ASN C N     1 
ATOM   4555  C  CA    . ASN C 2  130  ? 497.595 -11.319 661.192 1.00 104.20 ? 130  ASN C CA    1 
ATOM   4556  C  C     . ASN C 2  130  ? 497.480 -10.668 662.569 1.00 108.34 ? 130  ASN C C     1 
ATOM   4557  O  O     . ASN C 2  130  ? 497.003 -9.536  662.684 1.00 110.93 ? 130  ASN C O     1 
ATOM   4558  C  CB    . ASN C 2  130  ? 496.710 -10.551 660.221 1.00 106.38 ? 130  ASN C CB    1 
ATOM   4559  C  CG    . ASN C 2  130  ? 497.021 -10.850 658.800 1.00 114.02 ? 130  ASN C CG    1 
ATOM   4560  O  OD1   . ASN C 2  130  ? 496.129 -11.256 658.057 1.00 113.92 ? 130  ASN C OD1   1 
ATOM   4561  N  ND2   . ASN C 2  130  ? 498.277 -10.642 658.389 1.00 113.36 ? 130  ASN C ND2   1 
ATOM   4562  N  N     . GLY C 2  131  ? 497.861 -11.374 663.634 1.00 106.50 ? 131  GLY C N     1 
ATOM   4563  C  CA    . GLY C 2  131  ? 497.898 -10.759 664.941 1.00 106.91 ? 131  GLY C CA    1 
ATOM   4564  C  C     . GLY C 2  131  ? 496.619 -10.870 665.737 1.00 114.14 ? 131  GLY C C     1 
ATOM   4565  O  O     . GLY C 2  131  ? 496.629 -10.583 666.945 1.00 117.72 ? 131  GLY C O     1 
ATOM   4566  N  N     . ALA C 2  132  ? 495.502 -11.194 665.086 1.00 110.43 ? 132  ALA C N     1 
ATOM   4567  C  CA    . ALA C 2  132  ? 494.210 -11.297 665.748 1.00 100.15 ? 132  ALA C CA    1 
ATOM   4568  C  C     . ALA C 2  132  ? 493.868 -12.772 665.896 1.00 97.17  ? 132  ALA C C     1 
ATOM   4569  O  O     . ALA C 2  132  ? 494.082 -13.564 664.982 1.00 100.08 ? 132  ALA C O     1 
ATOM   4570  C  CB    . ALA C 2  132  ? 493.125 -10.575 664.956 1.00 102.36 ? 132  ALA C CB    1 
ATOM   4571  N  N     . ASP C 2  133  ? 493.308 -13.127 667.029 1.00 94.25  ? 133  ASP C N     1 
ATOM   4572  C  CA    . ASP C 2  133  ? 492.929 -14.501 667.306 1.00 89.10  ? 133  ASP C CA    1 
ATOM   4573  C  C     . ASP C 2  133  ? 491.628 -14.796 666.555 1.00 90.07  ? 133  ASP C C     1 
ATOM   4574  O  O     . ASP C 2  133  ? 490.779 -13.912 666.428 1.00 92.99  ? 133  ASP C O     1 
ATOM   4575  C  CB    . ASP C 2  133  ? 492.756 -14.694 668.814 1.00 100.22 ? 133  ASP C CB    1 
ATOM   4576  C  CG    . ASP C 2  133  ? 494.057 -15.093 669.527 1.00 95.76  ? 133  ASP C CG    1 
ATOM   4577  O  OD1   . ASP C 2  133  ? 495.050 -14.347 669.407 1.00 92.23  ? 133  ASP C OD1   1 
ATOM   4578  O  OD2   . ASP C 2  133  ? 494.103 -16.160 670.177 1.00 96.20  ? 133  ASP C OD2   1 
ATOM   4579  N  N     . ARG C 2  134  ? 491.546 -15.946 665.889 1.00 92.86  ? 134  ARG C N     1 
ATOM   4580  C  CA    . ARG C 2  134  ? 490.353 -16.333 665.122 1.00 92.50  ? 134  ARG C CA    1 
ATOM   4581  C  C     . ARG C 2  134  ? 489.872 -17.756 665.422 1.00 93.02  ? 134  ARG C C     1 
ATOM   4582  O  O     . ARG C 2  134  ? 490.599 -18.574 665.992 1.00 98.34  ? 134  ARG C O     1 
ATOM   4583  C  CB    . ARG C 2  134  ? 490.584 -16.179 663.619 1.00 95.97  ? 134  ARG C CB    1 
ATOM   4584  C  CG    . ARG C 2  134  ? 490.804 -14.747 663.220 1.00 96.77  ? 134  ARG C CG    1 
ATOM   4585  C  CD    . ARG C 2  134  ? 490.750 -14.552 661.739 1.00 91.94  ? 134  ARG C CD    1 
ATOM   4586  N  NE    . ARG C 2  134  ? 490.157 -13.248 661.514 1.00 101.06 ? 134  ARG C NE    1 
ATOM   4587  C  CZ    . ARG C 2  134  ? 488.910 -13.108 661.084 1.00 104.50 ? 134  ARG C CZ    1 
ATOM   4588  N  NH1   . ARG C 2  134  ? 488.207 -14.198 660.812 1.00 91.73  ? 134  ARG C NH1   1 
ATOM   4589  N  NH2   . ARG C 2  134  ? 488.369 -11.904 660.916 1.00 120.31 ? 134  ARG C NH2   1 
ATOM   4590  N  N     . VAL C 2  135  ? 488.585 -18.007 665.152 1.00 85.39  ? 135  VAL C N     1 
ATOM   4591  C  CA    . VAL C 2  135  ? 487.971 -19.330 665.289 1.00 85.77  ? 135  VAL C CA    1 
ATOM   4592  C  C     . VAL C 2  135  ? 487.361 -19.750 663.958 1.00 82.12  ? 135  VAL C C     1 
ATOM   4593  O  O     . VAL C 2  135  ? 486.743 -18.916 663.289 1.00 82.88  ? 135  VAL C O     1 
ATOM   4594  C  CB    . VAL C 2  135  ? 486.914 -19.333 666.421 1.00 91.89  ? 135  VAL C CB    1 
ATOM   4595  C  CG1   . VAL C 2  135  ? 486.105 -20.610 666.425 1.00 89.46  ? 135  VAL C CG1   1 
ATOM   4596  C  CG2   . VAL C 2  135  ? 487.605 -19.205 667.781 1.00 91.23  ? 135  VAL C CG2   1 
ATOM   4597  N  N     . ILE C 2  136  ? 487.510 -21.036 663.580 1.00 80.56  ? 136  ILE C N     1 
ATOM   4598  C  CA    . ILE C 2  136  ? 486.800 -21.621 662.423 1.00 88.57  ? 136  ILE C CA    1 
ATOM   4599  C  C     . ILE C 2  136  ? 485.568 -22.410 662.884 1.00 82.20  ? 136  ILE C C     1 
ATOM   4600  O  O     . ILE C 2  136  ? 485.690 -23.471 663.506 1.00 83.52  ? 136  ILE C O     1 
ATOM   4601  C  CB    . ILE C 2  136  ? 487.725 -22.512 661.555 1.00 90.22  ? 136  ILE C CB    1 
ATOM   4602  C  CG1   . ILE C 2  136  ? 489.014 -21.804 661.136 1.00 81.84  ? 136  ILE C CG1   1 
ATOM   4603  C  CG2   . ILE C 2  136  ? 487.028 -23.067 660.274 1.00 80.38  ? 136  ILE C CG2   1 
ATOM   4604  C  CD1   . ILE C 2  136  ? 488.757 -20.562 660.317 1.00 78.37  ? 136  ILE C CD1   1 
ATOM   4605  N  N     . VAL C 2  137  ? 484.375 -21.915 662.559 1.00 77.39  ? 137  VAL C N     1 
ATOM   4606  C  CA    . VAL C 2  137  ? 483.131 -22.560 662.988 1.00 85.25  ? 137  VAL C CA    1 
ATOM   4607  C  C     . VAL C 2  137  ? 482.777 -23.741 662.089 1.00 81.18  ? 137  VAL C C     1 
ATOM   4608  O  O     . VAL C 2  137  ? 482.642 -23.575 660.877 1.00 85.70  ? 137  VAL C O     1 
ATOM   4609  C  CB    . VAL C 2  137  ? 481.980 -21.539 663.037 1.00 90.93  ? 137  VAL C CB    1 
ATOM   4610  C  CG1   . VAL C 2  137  ? 480.646 -22.245 663.262 1.00 88.10  ? 137  VAL C CG1   1 
ATOM   4611  C  CG2   . VAL C 2  137  ? 482.216 -20.512 664.161 1.00 91.70  ? 137  VAL C CG2   1 
ATOM   4612  N  N     . SER C 2  138  ? 482.502 -24.902 662.691 1.00 84.12  ? 138  SER C N     1 
ATOM   4613  C  CA    . SER C 2  138  ? 482.047 -26.086 661.951 1.00 84.37  ? 138  SER C CA    1 
ATOM   4614  C  C     . SER C 2  138  ? 480.753 -25.786 661.203 1.00 82.85  ? 138  SER C C     1 
ATOM   4615  O  O     . SER C 2  138  ? 479.996 -24.893 661.565 1.00 90.61  ? 138  SER C O     1 
ATOM   4616  C  CB    . SER C 2  138  ? 481.831 -27.305 662.865 1.00 85.14  ? 138  SER C CB    1 
ATOM   4617  O  OG    . SER C 2  138  ? 482.817 -27.414 663.876 1.00 92.79  ? 138  SER C OG    1 
ATOM   4618  N  N     . GLN C 2  139  ? 480.545 -26.480 660.097 1.00 88.26  ? 139  GLN C N     1 
ATOM   4619  C  CA    . GLN C 2  139  ? 479.395 -26.274 659.223 1.00 89.79  ? 139  GLN C CA    1 
ATOM   4620  C  C     . GLN C 2  139  ? 478.573 -27.553 659.088 1.00 89.33  ? 139  GLN C C     1 
ATOM   4621  O  O     . GLN C 2  139  ? 479.121 -28.613 658.775 1.00 95.36  ? 139  GLN C O     1 
ATOM   4622  C  CB    . GLN C 2  139  ? 479.846 -25.786 657.847 1.00 91.85  ? 139  GLN C CB    1 
ATOM   4623  C  CG    . GLN C 2  139  ? 478.752 -25.796 656.824 1.00 92.51  ? 139  GLN C CG    1 
ATOM   4624  C  CD    . GLN C 2  139  ? 479.236 -25.366 655.468 1.00 102.59 ? 139  GLN C CD    1 
ATOM   4625  O  OE1   . GLN C 2  139  ? 479.583 -26.207 654.639 1.00 112.43 ? 139  GLN C OE1   1 
ATOM   4626  N  NE2   . GLN C 2  139  ? 479.266 -24.051 655.223 1.00 107.40 ? 139  GLN C NE2   1 
ATOM   4627  N  N     . ILE C 2  140  ? 477.290 -27.484 659.434 1.00 92.01  ? 140  ILE C N     1 
ATOM   4628  C  CA    . ILE C 2  140  ? 476.379 -28.609 659.204 1.00 95.24  ? 140  ILE C CA    1 
ATOM   4629  C  C     . ILE C 2  140  ? 475.916 -28.580 657.739 1.00 92.05  ? 140  ILE C C     1 
ATOM   4630  O  O     . ILE C 2  140  ? 475.672 -27.501 657.167 1.00 90.74  ? 140  ILE C O     1 
ATOM   4631  C  CB    . ILE C 2  140  ? 475.206 -28.543 660.228 1.00 86.23  ? 140  ILE C CB    1 
ATOM   4632  C  CG1   . ILE C 2  140  ? 474.391 -29.827 660.252 1.00 84.74  ? 140  ILE C CG1   1 
ATOM   4633  C  CG2   . ILE C 2  140  ? 474.299 -27.331 660.032 1.00 82.71  ? 140  ILE C CG2   1 
ATOM   4634  C  CD1   . ILE C 2  140  ? 473.639 -30.016 661.476 1.00 79.06  ? 140  ILE C CD1   1 
ATOM   4635  N  N     . HIS C 2  141  ? 475.720 -29.763 657.132 1.00 87.13  ? 141  HIS C N     1 
ATOM   4636  C  CA    . HIS C 2  141  ? 475.216 -29.822 655.758 1.00 96.11  ? 141  HIS C CA    1 
ATOM   4637  C  C     . HIS C 2  141  ? 474.709 -31.225 655.478 1.00 95.19  ? 141  HIS C C     1 
ATOM   4638  O  O     . HIS C 2  141  ? 474.864 -32.125 656.303 1.00 93.38  ? 141  HIS C O     1 
ATOM   4639  C  CB    . HIS C 2  141  ? 476.306 -29.446 654.738 1.00 100.82 ? 141  HIS C CB    1 
ATOM   4640  C  CG    . HIS C 2  141  ? 477.370 -30.495 654.558 1.00 104.37 ? 141  HIS C CG    1 
ATOM   4641  N  ND1   . HIS C 2  141  ? 477.898 -30.816 653.324 1.00 107.30 ? 141  HIS C ND1   1 
ATOM   4642  C  CD2   . HIS C 2  141  ? 477.952 -31.343 655.443 1.00 101.40 ? 141  HIS C CD2   1 
ATOM   4643  C  CE1   . HIS C 2  141  ? 478.794 -31.779 653.464 1.00 104.42 ? 141  HIS C CE1   1 
ATOM   4644  N  NE2   . HIS C 2  141  ? 478.844 -32.119 654.739 1.00 102.69 ? 141  HIS C NE2   1 
ATOM   4645  N  N     . ARG C 2  142  ? 474.136 -31.407 654.279 1.00 99.92  ? 142  ARG C N     1 
ATOM   4646  C  CA    . ARG C 2  142  ? 473.658 -32.722 653.852 1.00 106.81 ? 142  ARG C CA    1 
ATOM   4647  C  C     . ARG C 2  142  ? 474.815 -33.663 653.541 1.00 108.68 ? 142  ARG C C     1 
ATOM   4648  O  O     . ARG C 2  142  ? 475.669 -33.371 652.697 1.00 113.43 ? 142  ARG C O     1 
ATOM   4649  C  CB    . ARG C 2  142  ? 472.752 -32.609 652.626 1.00 109.07 ? 142  ARG C CB    1 
ATOM   4650  C  CG    . ARG C 2  142  ? 471.508 -31.804 652.890 1.00 122.86 ? 142  ARG C CG    1 
ATOM   4651  C  CD    . ARG C 2  142  ? 470.476 -31.882 651.765 1.00 128.24 ? 142  ARG C CD    1 
ATOM   4652  N  NE    . ARG C 2  142  ? 470.024 -33.248 651.505 1.00 130.52 ? 142  ARG C NE    1 
ATOM   4653  C  CZ    . ARG C 2  142  ? 469.250 -33.604 650.479 1.00 129.59 ? 142  ARG C CZ    1 
ATOM   4654  N  NH1   . ARG C 2  142  ? 468.828 -32.696 649.602 1.00 124.39 ? 142  ARG C NH1   1 
ATOM   4655  N  NH2   . ARG C 2  142  ? 468.893 -34.874 650.325 1.00 128.44 ? 142  ARG C NH2   1 
ATOM   4656  N  N     . SER C 2  143  ? 474.769 -34.838 654.153 1.00 107.96 ? 143  SER C N     1 
ATOM   4657  C  CA    . SER C 2  143  ? 475.747 -35.883 653.908 1.00 107.97 ? 143  SER C CA    1 
ATOM   4658  C  C     . SER C 2  143  ? 475.635 -36.374 652.464 1.00 109.35 ? 143  SER C C     1 
ATOM   4659  O  O     . SER C 2  143  ? 474.532 -36.458 651.919 1.00 108.24 ? 143  SER C O     1 
ATOM   4660  C  CB    . SER C 2  143  ? 475.538 -37.021 654.914 1.00 105.25 ? 143  SER C CB    1 
ATOM   4661  O  OG    . SER C 2  143  ? 476.112 -38.247 654.510 1.00 112.46 ? 143  SER C OG    1 
ATOM   4662  N  N     . PRO C 2  144  ? 476.759 -36.621 651.793 1.00 114.47 ? 144  PRO C N     1 
ATOM   4663  C  CA    . PRO C 2  144  ? 476.702 -37.280 650.488 1.00 118.79 ? 144  PRO C CA    1 
ATOM   4664  C  C     . PRO C 2  144  ? 476.065 -38.654 650.581 1.00 118.92 ? 144  PRO C C     1 
ATOM   4665  O  O     . PRO C 2  144  ? 476.035 -39.283 651.637 1.00 123.16 ? 144  PRO C O     1 
ATOM   4666  C  CB    . PRO C 2  144  ? 478.180 -37.420 650.121 1.00 121.45 ? 144  PRO C CB    1 
ATOM   4667  C  CG    . PRO C 2  144  ? 478.825 -36.269 650.789 1.00 119.53 ? 144  PRO C CG    1 
ATOM   4668  C  CD    . PRO C 2  144  ? 478.112 -36.113 652.095 1.00 112.26 ? 144  PRO C CD    1 
ATOM   4669  N  N     . GLY C 2  145  ? 475.588 -39.136 649.451 1.00 114.99 ? 145  GLY C N     1 
ATOM   4670  C  CA    . GLY C 2  145  ? 474.903 -40.409 649.418 1.00 121.09 ? 145  GLY C CA    1 
ATOM   4671  C  C     . GLY C 2  145  ? 473.812 -40.386 648.369 1.00 129.25 ? 145  GLY C C     1 
ATOM   4672  O  O     . GLY C 2  145  ? 473.790 -39.510 647.503 1.00 128.82 ? 145  GLY C O     1 
ATOM   4673  N  N     . VAL C 2  146  ? 472.896 -41.352 648.491 1.00 131.76 ? 146  VAL C N     1 
ATOM   4674  C  CA    . VAL C 2  146  ? 471.729 -41.477 647.613 1.00 137.89 ? 146  VAL C CA    1 
ATOM   4675  C  C     . VAL C 2  146  ? 470.458 -41.434 648.462 1.00 140.37 ? 146  VAL C C     1 
ATOM   4676  O  O     . VAL C 2  146  ? 470.280 -42.272 649.361 1.00 135.66 ? 146  VAL C O     1 
ATOM   4677  C  CB    . VAL C 2  146  ? 471.762 -42.762 646.772 1.00 136.12 ? 146  VAL C CB    1 
ATOM   4678  C  CG1   . VAL C 2  146  ? 470.422 -42.972 646.092 1.00 136.74 ? 146  VAL C CG1   1 
ATOM   4679  C  CG2   . VAL C 2  146  ? 472.855 -42.704 645.753 1.00 140.35 ? 146  VAL C CG2   1 
ATOM   4680  N  N     . TYR C 2  147  ? 469.587 -40.455 648.199 1.00 140.81 ? 147  TYR C N     1 
ATOM   4681  C  CA    . TYR C 2  147  ? 468.380 -40.271 648.996 1.00 141.44 ? 147  TYR C CA    1 
ATOM   4682  C  C     . TYR C 2  147  ? 467.155 -40.477 648.106 1.00 145.71 ? 147  TYR C C     1 
ATOM   4683  O  O     . TYR C 2  147  ? 467.202 -40.220 646.898 1.00 145.87 ? 147  TYR C O     1 
ATOM   4684  C  CB    . TYR C 2  147  ? 468.343 -38.861 649.611 1.00 138.98 ? 147  TYR C CB    1 
ATOM   4685  C  CG    . TYR C 2  147  ? 469.530 -38.556 650.497 1.00 135.35 ? 147  TYR C CG    1 
ATOM   4686  C  CD1   . TYR C 2  147  ? 469.746 -39.244 651.688 1.00 127.87 ? 147  TYR C CD1   1 
ATOM   4687  C  CD2   . TYR C 2  147  ? 470.466 -37.602 650.111 1.00 132.98 ? 147  TYR C CD2   1 
ATOM   4688  C  CE1   . TYR C 2  147  ? 470.849 -38.972 652.477 1.00 120.52 ? 147  TYR C CE1   1 
ATOM   4689  C  CE2   . TYR C 2  147  ? 471.563 -37.320 650.894 1.00 128.66 ? 147  TYR C CE2   1 
ATOM   4690  C  CZ    . TYR C 2  147  ? 471.752 -38.008 652.072 1.00 120.56 ? 147  TYR C CZ    1 
ATOM   4691  O  OH    . TYR C 2  147  ? 472.857 -37.723 652.836 1.00 118.28 ? 147  TYR C OH    1 
ATOM   4692  N  N     . PHE C 2  148  ? 466.039 -40.895 648.711 1.00 148.78 ? 148  PHE C N     1 
ATOM   4693  C  CA    . PHE C 2  148  ? 464.765 -41.031 648.005 1.00 149.97 ? 148  PHE C CA    1 
ATOM   4694  C  C     . PHE C 2  148  ? 463.667 -40.296 648.755 1.00 150.48 ? 148  PHE C C     1 
ATOM   4695  O  O     . PHE C 2  148  ? 463.342 -40.655 649.891 1.00 146.35 ? 148  PHE C O     1 
ATOM   4696  C  CB    . PHE C 2  148  ? 464.345 -42.491 647.836 1.00 152.87 ? 148  PHE C CB    1 
ATOM   4697  C  CG    . PHE C 2  148  ? 465.351 -43.350 647.151 1.00 152.93 ? 148  PHE C CG    1 
ATOM   4698  C  CD1   . PHE C 2  148  ? 466.359 -43.968 647.874 1.00 151.22 ? 148  PHE C CD1   1 
ATOM   4699  C  CD2   . PHE C 2  148  ? 465.289 -43.538 645.776 1.00 149.90 ? 148  PHE C CD2   1 
ATOM   4700  C  CE1   . PHE C 2  148  ? 467.279 -44.771 647.236 1.00 154.66 ? 148  PHE C CE1   1 
ATOM   4701  C  CE2   . PHE C 2  148  ? 466.201 -44.333 645.129 1.00 147.34 ? 148  PHE C CE2   1 
ATOM   4702  C  CZ    . PHE C 2  148  ? 467.200 -44.952 645.854 1.00 153.42 ? 148  PHE C CZ    1 
ATOM   4703  N  N     . THR C 2  149  ? 463.117 -39.257 648.138 1.00 153.08 ? 149  THR C N     1 
ATOM   4704  C  CA    . THR C 2  149  ? 462.069 -38.464 648.759 1.00 153.90 ? 149  THR C CA    1 
ATOM   4705  C  C     . THR C 2  149  ? 460.790 -38.551 647.927 1.00 159.76 ? 149  THR C C     1 
ATOM   4706  O  O     . THR C 2  149  ? 460.855 -38.828 646.726 1.00 163.74 ? 149  THR C O     1 
ATOM   4707  C  CB    . THR C 2  149  ? 462.489 -37.003 648.931 1.00 155.80 ? 149  THR C CB    1 
ATOM   4708  O  OG1   . THR C 2  149  ? 461.633 -36.382 649.898 1.00 160.80 ? 149  THR C OG1   1 
ATOM   4709  C  CG2   . THR C 2  149  ? 462.401 -36.253 647.607 1.00 151.19 ? 149  THR C CG2   1 
ATOM   4710  N  N     . PRO C 2  150  ? 459.617 -38.385 648.536 1.00 158.19 ? 150  PRO C N     1 
ATOM   4711  C  CA    . PRO C 2  150  ? 458.372 -38.372 647.751 1.00 162.02 ? 150  PRO C CA    1 
ATOM   4712  C  C     . PRO C 2  150  ? 458.273 -37.148 646.851 1.00 163.21 ? 150  PRO C C     1 
ATOM   4713  O  O     . PRO C 2  150  ? 458.566 -36.024 647.264 1.00 157.77 ? 150  PRO C O     1 
ATOM   4714  C  CB    . PRO C 2  150  ? 457.279 -38.377 648.820 1.00 162.09 ? 150  PRO C CB    1 
ATOM   4715  C  CG    . PRO C 2  150  ? 457.933 -38.983 650.013 1.00 158.14 ? 150  PRO C CG    1 
ATOM   4716  C  CD    . PRO C 2  150  ? 459.346 -38.499 649.974 1.00 156.09 ? 150  PRO C CD    1 
ATOM   4717  N  N     . ASP C 2  151  ? 457.812 -37.381 645.625 1.00 169.61 ? 151  ASP C N     1 
ATOM   4718  C  CA    . ASP C 2  151  ? 457.592 -36.337 644.624 1.00 172.12 ? 151  ASP C CA    1 
ATOM   4719  C  C     . ASP C 2  151  ? 456.354 -35.510 644.940 1.00 171.67 ? 151  ASP C C     1 
ATOM   4720  O  O     . ASP C 2  151  ? 455.242 -36.052 644.938 1.00 170.98 ? 151  ASP C O     1 
ATOM   4721  C  CB    . ASP C 2  151  ? 457.469 -36.983 643.221 1.00 174.98 ? 151  ASP C CB    1 
ATOM   4722  C  CG    . ASP C 2  151  ? 457.241 -35.955 642.075 1.00 179.88 ? 151  ASP C CG    1 
ATOM   4723  O  OD1   . ASP C 2  151  ? 457.442 -34.736 642.274 1.00 181.83 ? 151  ASP C OD1   1 
ATOM   4724  O  OD2   . ASP C 2  151  ? 456.881 -36.376 640.947 1.00 176.19 ? 151  ASP C OD2   1 
ATOM   4725  N  N     . PRO C 2  152  ? 456.510 -34.218 645.257 1.00 171.67 ? 152  PRO C N     1 
ATOM   4726  C  CA    . PRO C 2  152  ? 455.363 -33.386 645.658 1.00 176.00 ? 152  PRO C CA    1 
ATOM   4727  C  C     . PRO C 2  152  ? 454.276 -33.284 644.607 1.00 179.46 ? 152  PRO C C     1 
ATOM   4728  O  O     . PRO C 2  152  ? 453.091 -33.211 644.954 1.00 184.54 ? 152  PRO C O     1 
ATOM   4729  C  CB    . PRO C 2  152  ? 456.001 -32.012 645.917 1.00 173.18 ? 152  PRO C CB    1 
ATOM   4730  C  CG    . PRO C 2  152  ? 457.294 -32.046 645.192 1.00 170.75 ? 152  PRO C CG    1 
ATOM   4731  C  CD    . PRO C 2  152  ? 457.768 -33.457 645.284 1.00 171.46 ? 152  PRO C CD    1 
ATOM   4732  N  N     . ALA C 2  153  ? 454.639 -33.268 643.328 1.00 177.17 ? 153  ALA C N     1 
ATOM   4733  C  CA    . ALA C 2  153  ? 453.632 -33.129 642.283 1.00 181.95 ? 153  ALA C CA    1 
ATOM   4734  C  C     . ALA C 2  153  ? 452.745 -34.368 642.178 1.00 184.82 ? 153  ALA C C     1 
ATOM   4735  O  O     . ALA C 2  153  ? 451.516 -34.267 642.276 1.00 183.72 ? 153  ALA C O     1 
ATOM   4736  C  CB    . ALA C 2  153  ? 454.310 -32.839 640.941 1.00 183.63 ? 153  ALA C CB    1 
ATOM   4737  N  N     . ARG C 2  154  ? 453.343 -35.551 642.014 1.00 186.93 ? 154  ARG C N     1 
ATOM   4738  C  CA    . ARG C 2  154  ? 452.551 -36.760 641.802 1.00 184.32 ? 154  ARG C CA    1 
ATOM   4739  C  C     . ARG C 2  154  ? 452.502 -37.653 643.038 1.00 179.38 ? 154  ARG C C     1 
ATOM   4740  O  O     . ARG C 2  154  ? 453.508 -38.292 643.386 1.00 178.76 ? 154  ARG C O     1 
ATOM   4741  C  CB    . ARG C 2  154  ? 453.124 -37.517 640.598 1.00 184.47 ? 154  ARG C CB    1 
ATOM   4742  C  CG    . ARG C 2  154  ? 453.247 -36.595 639.364 1.00 182.74 ? 154  ARG C CG    1 
ATOM   4743  C  CD    . ARG C 2  154  ? 454.541 -36.796 638.584 1.00 179.80 ? 154  ARG C CD    1 
ATOM   4744  N  NE    . ARG C 2  154  ? 454.764 -38.198 638.244 1.00 182.31 ? 154  ARG C NE    1 
ATOM   4745  C  CZ    . ARG C 2  154  ? 454.118 -38.836 637.269 1.00 181.25 ? 154  ARG C CZ    1 
ATOM   4746  N  NH1   . ARG C 2  154  ? 453.205 -38.198 636.547 1.00 178.10 ? 154  ARG C NH1   1 
ATOM   4747  N  NH2   . ARG C 2  154  ? 454.375 -40.113 637.016 1.00 181.31 ? 154  ARG C NH2   1 
ATOM   4748  N  N     . PRO C 2  155  ? 451.354 -37.721 643.718 1.00 175.97 ? 155  PRO C N     1 
ATOM   4749  C  CA    . PRO C 2  155  ? 451.252 -38.422 645.010 1.00 183.50 ? 155  PRO C CA    1 
ATOM   4750  C  C     . PRO C 2  155  ? 451.641 -39.897 645.033 1.00 182.16 ? 155  PRO C C     1 
ATOM   4751  O  O     . PRO C 2  155  ? 451.535 -40.531 646.088 1.00 181.35 ? 155  PRO C O     1 
ATOM   4752  C  CB    . PRO C 2  155  ? 449.770 -38.248 645.385 1.00 186.79 ? 155  PRO C CB    1 
ATOM   4753  C  CG    . PRO C 2  155  ? 449.088 -37.740 644.142 1.00 185.50 ? 155  PRO C CG    1 
ATOM   4754  C  CD    . PRO C 2  155  ? 450.124 -36.992 643.382 1.00 177.10 ? 155  PRO C CD    1 
ATOM   4755  N  N     . GLY C 2  156  ? 452.045 -40.481 643.913 1.00 179.38 ? 156  GLY C N     1 
ATOM   4756  C  CA    . GLY C 2  156  ? 452.356 -41.895 643.962 1.00 182.65 ? 156  GLY C CA    1 
ATOM   4757  C  C     . GLY C 2  156  ? 453.709 -42.213 643.364 1.00 187.91 ? 156  GLY C C     1 
ATOM   4758  O  O     . GLY C 2  156  ? 454.072 -43.385 643.208 1.00 188.12 ? 156  GLY C O     1 
ATOM   4759  N  N     . ARG C 2  157  ? 454.481 -41.168 643.067 1.00 189.03 ? 157  ARG C N     1 
ATOM   4760  C  CA    . ARG C 2  157  ? 455.778 -41.287 642.415 1.00 187.81 ? 157  ARG C CA    1 
ATOM   4761  C  C     . ARG C 2  157  ? 456.834 -40.625 643.298 1.00 185.50 ? 157  ARG C C     1 
ATOM   4762  O  O     . ARG C 2  157  ? 456.516 -39.857 644.214 1.00 181.78 ? 157  ARG C O     1 
ATOM   4763  C  CB    . ARG C 2  157  ? 455.743 -40.716 640.979 1.00 183.08 ? 157  ARG C CB    1 
ATOM   4764  C  CG    . ARG C 2  157  ? 454.818 -41.544 640.066 1.00 182.29 ? 157  ARG C CG    1 
ATOM   4765  C  CD    . ARG C 2  157  ? 455.168 -43.031 640.223 1.00 184.02 ? 157  ARG C CD    1 
ATOM   4766  N  NE    . ARG C 2  157  ? 454.189 -43.964 639.664 1.00 184.49 ? 157  ARG C NE    1 
ATOM   4767  C  CZ    . ARG C 2  157  ? 454.195 -44.423 638.418 1.00 185.39 ? 157  ARG C CZ    1 
ATOM   4768  N  NH1   . ARG C 2  157  ? 455.134 -44.036 637.566 1.00 186.66 ? 157  ARG C NH1   1 
ATOM   4769  N  NH2   . ARG C 2  157  ? 453.259 -45.280 638.027 1.00 183.77 ? 157  ARG C NH2   1 
ATOM   4770  N  N     . TYR C 2  158  ? 458.104 -40.931 643.017 1.00 186.19 ? 158  TYR C N     1 
ATOM   4771  C  CA    . TYR C 2  158  ? 459.214 -40.463 643.843 1.00 177.88 ? 158  TYR C CA    1 
ATOM   4772  C  C     . TYR C 2  158  ? 460.384 -39.980 642.986 1.00 174.04 ? 158  TYR C C     1 
ATOM   4773  O  O     . TYR C 2  158  ? 460.556 -40.384 641.829 1.00 172.34 ? 158  TYR C O     1 
ATOM   4774  C  CB    . TYR C 2  158  ? 459.696 -41.592 644.780 1.00 174.07 ? 158  TYR C CB    1 
ATOM   4775  C  CG    . TYR C 2  158  ? 458.622 -42.155 645.692 1.00 175.71 ? 158  TYR C CG    1 
ATOM   4776  C  CD1   . TYR C 2  158  ? 457.741 -43.135 645.241 1.00 179.85 ? 158  TYR C CD1   1 
ATOM   4777  C  CD2   . TYR C 2  158  ? 458.502 -41.727 647.001 1.00 175.20 ? 158  TYR C CD2   1 
ATOM   4778  C  CE1   . TYR C 2  158  ? 456.759 -43.657 646.065 1.00 181.26 ? 158  TYR C CE1   1 
ATOM   4779  C  CE2   . TYR C 2  158  ? 457.522 -42.242 647.837 1.00 180.78 ? 158  TYR C CE2   1 
ATOM   4780  C  CZ    . TYR C 2  158  ? 456.653 -43.210 647.367 1.00 184.62 ? 158  TYR C CZ    1 
ATOM   4781  O  OH    . TYR C 2  158  ? 455.680 -43.723 648.206 1.00 180.33 ? 158  TYR C OH    1 
ATOM   4782  N  N     . ILE C 2  159  ? 461.204 -39.114 643.586 1.00 166.38 ? 159  ILE C N     1 
ATOM   4783  C  CA    . ILE C 2  159  ? 462.445 -38.636 642.988 1.00 156.42 ? 159  ILE C CA    1 
ATOM   4784  C  C     . ILE C 2  159  ? 463.612 -39.199 643.779 1.00 157.37 ? 159  ILE C C     1 
ATOM   4785  O  O     . ILE C 2  159  ? 463.658 -39.092 645.012 1.00 158.01 ? 159  ILE C O     1 
ATOM   4786  C  CB    . ILE C 2  159  ? 462.533 -37.098 642.956 1.00 151.92 ? 159  ILE C CB    1 
ATOM   4787  C  CG1   . ILE C 2  159  ? 461.268 -36.468 642.378 1.00 160.18 ? 159  ILE C CG1   1 
ATOM   4788  C  CG2   . ILE C 2  159  ? 463.800 -36.643 642.249 1.00 156.15 ? 159  ILE C CG2   1 
ATOM   4789  C  CD1   . ILE C 2  159  ? 461.495 -35.072 641.810 1.00 159.94 ? 159  ILE C CD1   1 
ATOM   4790  N  N     . ALA C 2  160  ? 464.551 -39.798 643.061 1.00 156.96 ? 160  ALA C N     1 
ATOM   4791  C  CA    . ALA C 2  160  ? 465.808 -40.269 643.617 1.00 152.84 ? 160  ALA C CA    1 
ATOM   4792  C  C     . ALA C 2  160  ? 466.863 -39.209 643.326 1.00 152.61 ? 160  ALA C C     1 
ATOM   4793  O  O     . ALA C 2  160  ? 467.025 -38.797 642.169 1.00 150.90 ? 160  ALA C O     1 
ATOM   4794  C  CB    . ALA C 2  160  ? 466.202 -41.623 643.028 1.00 148.29 ? 160  ALA C CB    1 
ATOM   4795  N  N     . SER C 2  161  ? 467.515 -38.711 644.377 1.00 150.87 ? 161  SER C N     1 
ATOM   4796  C  CA    . SER C 2  161  ? 468.533 -37.672 644.263 1.00 143.67 ? 161  SER C CA    1 
ATOM   4797  C  C     . SER C 2  161  ? 469.867 -38.258 644.704 1.00 141.18 ? 161  SER C C     1 
ATOM   4798  O  O     . SER C 2  161  ? 469.963 -38.840 645.793 1.00 138.15 ? 161  SER C O     1 
ATOM   4799  C  CB    . SER C 2  161  ? 468.164 -36.431 645.072 1.00 141.17 ? 161  SER C CB    1 
ATOM   4800  O  OG    . SER C 2  161  ? 466.764 -36.215 645.031 1.00 151.27 ? 161  SER C OG    1 
ATOM   4801  N  N     . ILE C 2  162  ? 470.866 -38.180 643.821 1.00 140.11 ? 162  ILE C N     1 
ATOM   4802  C  CA    . ILE C 2  162  ? 472.230 -38.601 644.121 1.00 136.61 ? 162  ILE C CA    1 
ATOM   4803  C  C     . ILE C 2  162  ? 473.069 -37.361 644.402 1.00 132.06 ? 162  ILE C C     1 
ATOM   4804  O  O     . ILE C 2  162  ? 473.370 -36.592 643.482 1.00 132.79 ? 162  ILE C O     1 
ATOM   4805  C  CB    . ILE C 2  162  ? 472.826 -39.383 642.947 1.00 137.62 ? 162  ILE C CB    1 
ATOM   4806  C  CG1   . ILE C 2  162  ? 472.058 -40.683 642.737 1.00 140.38 ? 162  ILE C CG1   1 
ATOM   4807  C  CG2   . ILE C 2  162  ? 474.300 -39.676 643.212 1.00 133.28 ? 162  ILE C CG2   1 
ATOM   4808  C  CD1   . ILE C 2  162  ? 472.560 -41.494 641.587 1.00 137.87 ? 162  ILE C CD1   1 
ATOM   4809  N  N     . ILE C 2  163  ? 473.474 -37.166 645.654 1.00 128.25 ? 163  ILE C N     1 
ATOM   4810  C  CA    . ILE C 2  163  ? 474.189 -35.960 646.052 1.00 128.40 ? 163  ILE C CA    1 
ATOM   4811  C  C     . ILE C 2  163  ? 475.599 -36.344 646.491 1.00 126.43 ? 163  ILE C C     1 
ATOM   4812  O  O     . ILE C 2  163  ? 475.759 -37.142 647.421 1.00 124.20 ? 163  ILE C O     1 
ATOM   4813  C  CB    . ILE C 2  163  ? 473.457 -35.151 647.136 1.00 125.56 ? 163  ILE C CB    1 
ATOM   4814  C  CG1   . ILE C 2  163  ? 472.050 -34.814 646.660 1.00 125.26 ? 163  ILE C CG1   1 
ATOM   4815  C  CG2   . ILE C 2  163  ? 474.150 -33.832 647.375 1.00 130.92 ? 163  ILE C CG2   1 
ATOM   4816  C  CD1   . ILE C 2  163  ? 471.169 -34.288 647.725 1.00 128.67 ? 163  ILE C CD1   1 
ATOM   4817  N  N     . PRO C 2  164  ? 476.657 -35.770 645.846 1.00 119.07 ? 164  PRO C N     1 
ATOM   4818  C  CA    . PRO C 2  164  ? 478.059 -35.984 646.243 1.00 118.80 ? 164  PRO C CA    1 
ATOM   4819  C  C     . PRO C 2  164  ? 478.557 -34.933 647.225 1.00 122.91 ? 164  PRO C C     1 
ATOM   4820  O  O     . PRO C 2  164  ? 477.772 -34.066 647.621 1.00 122.14 ? 164  PRO C O     1 
ATOM   4821  C  CB    . PRO C 2  164  ? 478.795 -35.863 644.916 1.00 119.67 ? 164  PRO C CB    1 
ATOM   4822  C  CG    . PRO C 2  164  ? 478.008 -34.782 644.220 1.00 121.36 ? 164  PRO C CG    1 
ATOM   4823  C  CD    . PRO C 2  164  ? 476.570 -34.946 644.630 1.00 121.96 ? 164  PRO C CD    1 
ATOM   4824  N  N     . LEU C 2  165  ? 479.842 -34.957 647.606 1.00 121.23 ? 165  LEU C N     1 
ATOM   4825  C  CA    . LEU C 2  165  ? 480.332 -33.880 648.456 1.00 116.32 ? 165  LEU C CA    1 
ATOM   4826  C  C     . LEU C 2  165  ? 480.198 -32.556 647.710 1.00 117.34 ? 165  LEU C C     1 
ATOM   4827  O  O     . LEU C 2  165  ? 480.228 -32.522 646.479 1.00 120.93 ? 165  LEU C O     1 
ATOM   4828  C  CB    . LEU C 2  165  ? 481.797 -34.100 648.837 1.00 115.42 ? 165  LEU C CB    1 
ATOM   4829  C  CG    . LEU C 2  165  ? 482.244 -35.312 649.668 1.00 118.97 ? 165  LEU C CG    1 
ATOM   4830  C  CD1   . LEU C 2  165  ? 483.713 -35.564 649.478 1.00 117.13 ? 165  LEU C CD1   1 
ATOM   4831  C  CD2   . LEU C 2  165  ? 482.010 -35.074 651.147 1.00 116.59 ? 165  LEU C CD2   1 
ATOM   4832  N  N     . PRO C 2  166  ? 480.006 -31.460 648.437 1.00 119.39 ? 166  PRO C N     1 
ATOM   4833  C  CA    . PRO C 2  166  ? 479.872 -30.140 647.803 1.00 124.00 ? 166  PRO C CA    1 
ATOM   4834  C  C     . PRO C 2  166  ? 481.014 -29.789 646.867 1.00 124.86 ? 166  PRO C C     1 
ATOM   4835  O  O     . PRO C 2  166  ? 482.186 -29.961 647.204 1.00 127.97 ? 166  PRO C O     1 
ATOM   4836  C  CB    . PRO C 2  166  ? 479.820 -29.185 648.997 1.00 124.52 ? 166  PRO C CB    1 
ATOM   4837  C  CG    . PRO C 2  166  ? 479.208 -29.999 650.086 1.00 126.30 ? 166  PRO C CG    1 
ATOM   4838  C  CD    . PRO C 2  166  ? 479.713 -31.412 649.878 1.00 124.28 ? 166  PRO C CD    1 
ATOM   4839  N  N     . LYS C 2  167  ? 480.660 -29.272 645.687 1.00 117.99 ? 167  LYS C N     1 
ATOM   4840  C  CA    . LYS C 2  167  ? 481.592 -28.805 644.670 1.00 114.31 ? 167  LYS C CA    1 
ATOM   4841  C  C     . LYS C 2  167  ? 482.404 -29.942 644.047 1.00 121.76 ? 167  LYS C C     1 
ATOM   4842  O  O     . LYS C 2  167  ? 483.332 -29.673 643.279 1.00 129.28 ? 167  LYS C O     1 
ATOM   4843  C  CB    . LYS C 2  167  ? 482.484 -27.667 645.173 1.00 111.02 ? 167  LYS C CB    1 
ATOM   4844  C  CG    . LYS C 2  167  ? 481.634 -26.417 645.401 1.00 113.50 ? 167  LYS C CG    1 
ATOM   4845  C  CD    . LYS C 2  167  ? 482.092 -25.205 644.630 1.00 123.03 ? 167  LYS C CD    1 
ATOM   4846  C  CE    . LYS C 2  167  ? 481.426 -25.195 643.248 1.00 141.67 ? 167  LYS C CE    1 
ATOM   4847  N  NZ    . LYS C 2  167  ? 481.690 -23.960 642.458 1.00 147.70 ? 167  LYS C NZ    1 
ATOM   4848  N  N     . ARG C 2  168  ? 482.155 -31.192 644.433 1.00 119.44 ? 168  ARG C N     1 
ATOM   4849  C  CA    . ARG C 2  168  ? 482.828 -32.380 643.919 1.00 118.91 ? 168  ARG C CA    1 
ATOM   4850  C  C     . ARG C 2  168  ? 481.923 -33.161 642.959 1.00 123.06 ? 168  ARG C C     1 
ATOM   4851  O  O     . ARG C 2  168  ? 482.131 -34.359 642.756 1.00 119.37 ? 168  ARG C O     1 
ATOM   4852  C  CB    . ARG C 2  168  ? 483.253 -33.302 645.056 1.00 122.82 ? 168  ARG C CB    1 
ATOM   4853  C  CG    . ARG C 2  168  ? 484.070 -32.687 646.179 1.00 128.96 ? 168  ARG C CG    1 
ATOM   4854  C  CD    . ARG C 2  168  ? 485.543 -32.992 646.053 1.00 125.69 ? 168  ARG C CD    1 
ATOM   4855  N  NE    . ARG C 2  168  ? 486.129 -32.465 644.833 1.00 132.85 ? 168  ARG C NE    1 
ATOM   4856  C  CZ    . ARG C 2  168  ? 487.347 -32.790 644.419 1.00 136.16 ? 168  ARG C CZ    1 
ATOM   4857  N  NH1   . ARG C 2  168  ? 488.068 -33.639 645.140 1.00 135.40 ? 168  ARG C NH1   1 
ATOM   4858  N  NH2   . ARG C 2  168  ? 487.846 -32.272 643.301 1.00 138.54 ? 168  ARG C NH2   1 
ATOM   4859  N  N     . GLY C 2  169  ? 480.899 -32.514 642.398 1.00 125.55 ? 169  GLY C N     1 
ATOM   4860  C  CA    . GLY C 2  169  ? 480.073 -33.110 641.376 1.00 118.54 ? 169  GLY C CA    1 
ATOM   4861  C  C     . GLY C 2  169  ? 478.692 -32.486 641.320 1.00 124.81 ? 169  GLY C C     1 
ATOM   4862  O  O     . GLY C 2  169  ? 478.299 -31.692 642.183 1.00 129.32 ? 169  GLY C O     1 
ATOM   4863  N  N     . PRO C 2  170  ? 477.936 -32.840 640.285 1.00 128.00 ? 170  PRO C N     1 
ATOM   4864  C  CA    . PRO C 2  170  ? 476.575 -32.320 640.103 1.00 134.08 ? 170  PRO C CA    1 
ATOM   4865  C  C     . PRO C 2  170  ? 475.511 -33.022 640.947 1.00 135.88 ? 170  PRO C C     1 
ATOM   4866  O  O     . PRO C 2  170  ? 475.674 -34.152 641.421 1.00 128.41 ? 170  PRO C O     1 
ATOM   4867  C  CB    . PRO C 2  170  ? 476.340 -32.541 638.611 1.00 130.03 ? 170  PRO C CB    1 
ATOM   4868  C  CG    . PRO C 2  170  ? 477.023 -33.836 638.358 1.00 123.88 ? 170  PRO C CG    1 
ATOM   4869  C  CD    . PRO C 2  170  ? 478.245 -33.866 639.272 1.00 124.94 ? 170  PRO C CD    1 
ATOM   4870  N  N     . TRP C 2  171  ? 474.368 -32.342 641.067 1.00 139.32 ? 171  TRP C N     1 
ATOM   4871  C  CA    . TRP C 2  171  ? 473.215 -32.934 641.723 1.00 142.93 ? 171  TRP C CA    1 
ATOM   4872  C  C     . TRP C 2  171  ? 472.516 -33.718 640.617 1.00 139.84 ? 171  TRP C C     1 
ATOM   4873  O  O     . TRP C 2  171  ? 472.443 -33.258 639.476 1.00 142.72 ? 171  TRP C O     1 
ATOM   4874  C  CB    . TRP C 2  171  ? 472.327 -31.759 642.190 1.00 152.05 ? 171  TRP C CB    1 
ATOM   4875  C  CG    . TRP C 2  171  ? 472.849 -30.796 643.311 1.00 160.98 ? 171  TRP C CG    1 
ATOM   4876  C  CD1   . TRP C 2  171  ? 473.976 -30.935 644.085 1.00 158.69 ? 171  TRP C CD1   1 
ATOM   4877  C  CD2   . TRP C 2  171  ? 472.485 -29.392 643.438 1.00 167.26 ? 171  TRP C CD2   1 
ATOM   4878  N  NE1   . TRP C 2  171  ? 474.184 -29.799 644.844 1.00 160.97 ? 171  TRP C NE1   1 
ATOM   4879  C  CE2   . TRP C 2  171  ? 473.308 -28.827 644.437 1.00 166.30 ? 171  TRP C CE2   1 
ATOM   4880  C  CE3   . TRP C 2  171  ? 471.495 -28.586 642.849 1.00 166.81 ? 171  TRP C CE3   1 
ATOM   4881  C  CZ2   . TRP C 2  171  ? 473.166 -27.498 644.865 1.00 168.99 ? 171  TRP C CZ2   1 
ATOM   4882  C  CZ3   . TRP C 2  171  ? 471.355 -27.267 643.279 1.00 167.05 ? 171  TRP C CZ3   1 
ATOM   4883  C  CH2   . TRP C 2  171  ? 472.186 -26.741 644.275 1.00 169.43 ? 171  TRP C CH2   1 
ATOM   4884  N  N     . ILE C 2  172  ? 472.026 -34.916 640.950 1.00 139.02 ? 172  ILE C N     1 
ATOM   4885  C  CA    . ILE C 2  172  ? 471.230 -35.761 640.054 1.00 138.93 ? 172  ILE C CA    1 
ATOM   4886  C  C     . ILE C 2  172  ? 469.789 -35.957 640.523 1.00 143.59 ? 172  ILE C C     1 
ATOM   4887  O  O     . ILE C 2  172  ? 469.560 -36.293 641.687 1.00 147.85 ? 172  ILE C O     1 
ATOM   4888  C  CB    . ILE C 2  172  ? 471.955 -37.106 639.906 1.00 142.79 ? 172  ILE C CB    1 
ATOM   4889  C  CG1   . ILE C 2  172  ? 473.133 -36.953 638.939 1.00 138.27 ? 172  ILE C CG1   1 
ATOM   4890  C  CG2   . ILE C 2  172  ? 471.000 -38.154 639.423 1.00 147.88 ? 172  ILE C CG2   1 
ATOM   4891  C  CD1   . ILE C 2  172  ? 473.793 -38.259 638.567 1.00 132.33 ? 172  ILE C CD1   1 
ATOM   4892  N  N     . ASP C 2  173  ? 468.821 -35.838 639.610 1.00 146.84 ? 173  ASP C N     1 
ATOM   4893  C  CA    . ASP C 2  173  ? 467.419 -36.151 639.901 1.00 152.68 ? 173  ASP C CA    1 
ATOM   4894  C  C     . ASP C 2  173  ? 466.916 -37.260 638.975 1.00 155.06 ? 173  ASP C C     1 
ATOM   4895  O  O     . ASP C 2  173  ? 467.065 -37.156 637.750 1.00 151.76 ? 173  ASP C O     1 
ATOM   4896  C  CB    . ASP C 2  173  ? 466.533 -34.913 639.754 1.00 156.10 ? 173  ASP C CB    1 
ATOM   4897  C  CG    . ASP C 2  173  ? 466.463 -34.079 641.011 1.00 151.42 ? 173  ASP C CG    1 
ATOM   4898  O  OD1   . ASP C 2  173  ? 467.248 -34.335 641.951 1.00 148.51 ? 173  ASP C OD1   1 
ATOM   4899  O  OD2   . ASP C 2  173  ? 465.627 -33.149 641.035 1.00 150.61 ? 173  ASP C OD2   1 
ATOM   4900  N  N     . LEU C 2  174  ? 466.342 -38.324 639.542 1.00 155.70 ? 174  LEU C N     1 
ATOM   4901  C  CA    . LEU C 2  174  ? 465.713 -39.390 638.741 1.00 155.55 ? 174  LEU C CA    1 
ATOM   4902  C  C     . LEU C 2  174  ? 464.175 -39.377 638.696 1.00 155.52 ? 174  LEU C C     1 
ATOM   4903  O  O     . LEU C 2  174  ? 463.557 -40.401 639.000 1.00 153.27 ? 174  LEU C O     1 
ATOM   4904  C  CB    . LEU C 2  174  ? 466.226 -40.752 639.196 1.00 148.93 ? 174  LEU C CB    1 
ATOM   4905  C  CG    . LEU C 2  174  ? 467.438 -41.264 638.406 1.00 142.10 ? 174  LEU C CG    1 
ATOM   4906  C  CD1   . LEU C 2  174  ? 468.446 -40.174 638.133 1.00 140.19 ? 174  LEU C CD1   1 
ATOM   4907  C  CD2   . LEU C 2  174  ? 468.110 -42.427 639.120 1.00 135.55 ? 174  LEU C CD2   1 
ATOM   4908  N  N     . GLU C 2  175  ? 463.525 -38.266 638.328 1.00 157.52 ? 175  GLU C N     1 
ATOM   4909  C  CA    . GLU C 2  175  ? 462.062 -38.211 638.329 1.00 160.16 ? 175  GLU C CA    1 
ATOM   4910  C  C     . GLU C 2  175  ? 461.519 -39.198 637.293 1.00 166.85 ? 175  GLU C C     1 
ATOM   4911  O  O     . GLU C 2  175  ? 462.151 -39.445 636.262 1.00 166.93 ? 175  GLU C O     1 
ATOM   4912  C  CB    . GLU C 2  175  ? 461.556 -36.802 638.002 1.00 159.44 ? 175  GLU C CB    1 
ATOM   4913  C  CG    . GLU C 2  175  ? 460.041 -36.648 638.143 1.00 161.58 ? 175  GLU C CG    1 
ATOM   4914  C  CD    . GLU C 2  175  ? 459.569 -35.210 638.057 1.00 166.58 ? 175  GLU C CD    1 
ATOM   4915  O  OE1   . GLU C 2  175  ? 460.420 -34.298 638.057 1.00 166.32 ? 175  GLU C OE1   1 
ATOM   4916  O  OE2   . GLU C 2  175  ? 458.342 -34.993 637.966 1.00 170.16 ? 175  GLU C OE2   1 
ATOM   4917  N  N     . VAL C 2  176  ? 460.339 -39.765 637.549 1.00 170.05 ? 176  VAL C N     1 
ATOM   4918  C  CA    . VAL C 2  176  ? 459.642 -40.585 636.551 1.00 170.82 ? 176  VAL C CA    1 
ATOM   4919  C  C     . VAL C 2  176  ? 458.507 -39.775 635.921 1.00 169.30 ? 176  VAL C C     1 
ATOM   4920  O  O     . VAL C 2  176  ? 457.487 -39.505 636.559 1.00 176.14 ? 176  VAL C O     1 
ATOM   4921  C  CB    . VAL C 2  176  ? 459.122 -41.900 637.152 1.00 168.11 ? 176  VAL C CB    1 
ATOM   4922  C  CG1   . VAL C 2  176  ? 458.345 -42.687 636.105 1.00 165.55 ? 176  VAL C CG1   1 
ATOM   4923  C  CG2   . VAL C 2  176  ? 460.275 -42.740 637.695 1.00 161.79 ? 176  VAL C CG2   1 
ATOM   4924  N  N     . GLU C 2  177  ? 458.674 -39.415 634.652 1.00 170.99 ? 177  GLU C N     1 
ATOM   4925  C  CA    . GLU C 2  177  ? 457.769 -38.516 633.943 1.00 177.39 ? 177  GLU C CA    1 
ATOM   4926  C  C     . GLU C 2  177  ? 456.388 -39.154 633.733 1.00 179.71 ? 177  GLU C C     1 
ATOM   4927  O  O     . GLU C 2  177  ? 456.218 -40.367 633.909 1.00 179.06 ? 177  GLU C O     1 
ATOM   4928  C  CB    . GLU C 2  177  ? 458.359 -38.164 632.568 1.00 175.95 ? 177  GLU C CB    1 
ATOM   4929  C  CG    . GLU C 2  177  ? 458.561 -36.680 632.199 1.00 171.04 ? 177  GLU C CG    1 
ATOM   4930  C  CD    . GLU C 2  177  ? 459.306 -35.864 633.240 1.00 172.29 ? 177  GLU C CD    1 
ATOM   4931  O  OE1   . GLU C 2  177  ? 458.720 -34.894 633.765 1.00 177.56 ? 177  GLU C OE1   1 
ATOM   4932  O  OE2   . GLU C 2  177  ? 460.490 -36.166 633.507 1.00 167.32 ? 177  GLU C OE2   1 
ATOM   4933  N  N     . PRO C 2  178  ? 455.354 -38.332 633.495 1.00 179.63 ? 178  PRO C N     1 
ATOM   4934  C  CA    . PRO C 2  178  ? 454.019 -38.890 633.201 1.00 181.98 ? 178  PRO C CA    1 
ATOM   4935  C  C     . PRO C 2  178  ? 453.966 -39.879 632.034 1.00 182.44 ? 178  PRO C C     1 
ATOM   4936  O  O     . PRO C 2  178  ? 453.117 -40.783 632.036 1.00 184.76 ? 178  PRO C O     1 
ATOM   4937  C  CB    . PRO C 2  178  ? 453.179 -37.636 632.892 1.00 177.49 ? 178  PRO C CB    1 
ATOM   4938  C  CG    . PRO C 2  178  ? 454.146 -36.515 632.730 1.00 169.98 ? 178  PRO C CG    1 
ATOM   4939  C  CD    . PRO C 2  178  ? 455.293 -36.866 633.623 1.00 174.09 ? 178  PRO C CD    1 
ATOM   4940  N  N     . ASN C 2  179  ? 454.839 -39.738 631.028 1.00 177.79 ? 179  ASN C N     1 
ATOM   4941  C  CA    . ASN C 2  179  ? 454.824 -40.662 629.889 1.00 177.51 ? 179  ASN C CA    1 
ATOM   4942  C  C     . ASN C 2  179  ? 455.232 -42.104 630.215 1.00 177.96 ? 179  ASN C C     1 
ATOM   4943  O  O     . ASN C 2  179  ? 454.944 -43.003 629.409 1.00 179.01 ? 179  ASN C O     1 
ATOM   4944  C  CB    . ASN C 2  179  ? 455.650 -40.062 628.739 1.00 179.80 ? 179  ASN C CB    1 
ATOM   4945  C  CG    . ASN C 2  179  ? 457.101 -39.778 629.099 1.00 178.89 ? 179  ASN C CG    1 
ATOM   4946  O  OD1   . ASN C 2  179  ? 457.658 -40.373 630.025 1.00 178.96 ? 179  ASN C OD1   1 
ATOM   4947  N  ND2   . ASN C 2  179  ? 457.724 -38.851 628.357 1.00 166.93 ? 179  ASN C ND2   1 
ATOM   4948  N  N     . GLY C 2  180  ? 455.814 -42.366 631.382 1.00 180.30 ? 180  GLY C N     1 
ATOM   4949  C  CA    . GLY C 2  180  ? 456.171 -43.710 631.826 1.00 182.27 ? 180  GLY C CA    1 
ATOM   4950  C  C     . GLY C 2  180  ? 457.656 -44.045 631.788 1.00 181.41 ? 180  GLY C C     1 
ATOM   4951  O  O     . GLY C 2  180  ? 458.063 -45.047 632.403 1.00 181.61 ? 180  GLY C O     1 
ATOM   4952  N  N     . VAL C 2  181  ? 458.459 -43.245 631.108 1.00 176.69 ? 181  VAL C N     1 
ATOM   4953  C  CA    . VAL C 2  181  ? 459.897 -43.463 631.016 1.00 177.73 ? 181  VAL C CA    1 
ATOM   4954  C  C     . VAL C 2  181  ? 460.592 -42.752 632.178 1.00 176.67 ? 181  VAL C C     1 
ATOM   4955  O  O     . VAL C 2  181  ? 460.191 -41.650 632.596 1.00 173.08 ? 181  VAL C O     1 
ATOM   4956  C  CB    . VAL C 2  181  ? 460.427 -43.018 629.635 1.00 177.29 ? 181  VAL C CB    1 
ATOM   4957  C  CG1   . VAL C 2  181  ? 460.580 -41.504 629.546 1.00 174.63 ? 181  VAL C CG1   1 
ATOM   4958  C  CG2   . VAL C 2  181  ? 461.729 -43.746 629.287 1.00 173.64 ? 181  VAL C CG2   1 
ATOM   4959  N  N     . VAL C 2  182  ? 461.643 -43.383 632.692 1.00 176.75 ? 182  VAL C N     1 
ATOM   4960  C  CA    . VAL C 2  182  ? 462.383 -42.893 633.849 1.00 169.97 ? 182  VAL C CA    1 
ATOM   4961  C  C     . VAL C 2  182  ? 463.425 -41.879 633.376 1.00 165.74 ? 182  VAL C C     1 
ATOM   4962  O  O     . VAL C 2  182  ? 464.324 -42.210 632.596 1.00 158.11 ? 182  VAL C O     1 
ATOM   4963  C  CB    . VAL C 2  182  ? 463.022 -44.050 634.640 1.00 170.42 ? 182  VAL C CB    1 
ATOM   4964  C  CG1   . VAL C 2  182  ? 463.639 -45.085 633.725 1.00 173.90 ? 182  VAL C CG1   1 
ATOM   4965  C  CG2   . VAL C 2  182  ? 464.053 -43.539 635.646 1.00 170.55 ? 182  VAL C CG2   1 
ATOM   4966  N  N     . SER C 2  183  ? 463.307 -40.641 633.861 1.00 167.52 ? 183  SER C N     1 
ATOM   4967  C  CA    . SER C 2  183  ? 464.109 -39.503 633.428 1.00 164.11 ? 183  SER C CA    1 
ATOM   4968  C  C     . SER C 2  183  ? 465.231 -39.177 634.417 1.00 163.26 ? 183  SER C C     1 
ATOM   4969  O  O     . SER C 2  183  ? 465.090 -39.331 635.633 1.00 161.77 ? 183  SER C O     1 
ATOM   4970  C  CB    . SER C 2  183  ? 463.216 -38.274 633.216 1.00 163.09 ? 183  SER C CB    1 
ATOM   4971  O  OG    . SER C 2  183  ? 462.769 -37.732 634.447 1.00 161.77 ? 183  SER C OG    1 
ATOM   4972  N  N     . MET C 2  184  ? 466.351 -38.711 633.867 1.00 160.11 ? 184  MET C N     1 
ATOM   4973  C  CA    . MET C 2  184  ? 467.527 -38.275 634.614 1.00 155.09 ? 184  MET C CA    1 
ATOM   4974  C  C     . MET C 2  184  ? 467.774 -36.779 634.442 1.00 159.80 ? 184  MET C C     1 
ATOM   4975  O  O     . MET C 2  184  ? 467.775 -36.274 633.316 1.00 160.91 ? 184  MET C O     1 
ATOM   4976  C  CB    . MET C 2  184  ? 468.749 -39.049 634.124 1.00 147.05 ? 184  MET C CB    1 
ATOM   4977  C  CG    . MET C 2  184  ? 470.081 -38.540 634.607 1.00 146.59 ? 184  MET C CG    1 
ATOM   4978  S  SD    . MET C 2  184  ? 471.306 -39.849 634.473 1.00 138.46 ? 184  MET C SD    1 
ATOM   4979  C  CE    . MET C 2  184  ? 472.682 -39.158 635.361 1.00 134.21 ? 184  MET C CE    1 
ATOM   4980  N  N     . LYS C 2  185  ? 467.999 -36.083 635.564 1.00 162.60 ? 185  LYS C N     1 
ATOM   4981  C  CA    . LYS C 2  185  ? 468.212 -34.635 635.633 1.00 158.34 ? 185  LYS C CA    1 
ATOM   4982  C  C     . LYS C 2  185  ? 469.644 -34.352 636.088 1.00 153.63 ? 185  LYS C C     1 
ATOM   4983  O  O     . LYS C 2  185  ? 470.031 -34.753 637.189 1.00 154.09 ? 185  LYS C O     1 
ATOM   4984  C  CB    . LYS C 2  185  ? 467.218 -33.976 636.593 1.00 156.10 ? 185  LYS C CB    1 
ATOM   4985  C  CG    . LYS C 2  185  ? 467.165 -32.449 636.538 1.00 156.35 ? 185  LYS C CG    1 
ATOM   4986  C  CD    . LYS C 2  185  ? 466.293 -31.868 637.673 1.00 164.00 ? 185  LYS C CD    1 
ATOM   4987  C  CE    . LYS C 2  185  ? 464.927 -32.567 637.857 1.00 161.69 ? 185  LYS C CE    1 
ATOM   4988  N  NZ    . LYS C 2  185  ? 463.736 -31.740 637.512 1.00 155.64 ? 185  LYS C NZ    1 
ATOM   4989  N  N     . VAL C 2  186  ? 470.423 -33.656 635.250 1.00 155.83 ? 186  VAL C N     1 
ATOM   4990  C  CA    . VAL C 2  186  ? 471.827 -33.326 635.534 1.00 157.72 ? 186  VAL C CA    1 
ATOM   4991  C  C     . VAL C 2  186  ? 472.083 -31.891 635.097 1.00 159.76 ? 186  VAL C C     1 
ATOM   4992  O  O     . VAL C 2  186  ? 471.893 -31.548 633.924 1.00 158.29 ? 186  VAL C O     1 
ATOM   4993  C  CB    . VAL C 2  186  ? 472.820 -34.257 634.817 1.00 153.15 ? 186  VAL C CB    1 
ATOM   4994  C  CG1   . VAL C 2  186  ? 474.241 -33.818 635.117 1.00 148.85 ? 186  VAL C CG1   1 
ATOM   4995  C  CG2   . VAL C 2  186  ? 472.611 -35.690 635.237 1.00 154.95 ? 186  VAL C CG2   1 
ATOM   4996  N  N     . ASN C 2  187  ? 472.573 -31.071 636.030 1.00 161.16 ? 187  ASN C N     1 
ATOM   4997  C  CA    . ASN C 2  187  ? 472.831 -29.648 635.795 1.00 163.94 ? 187  ASN C CA    1 
ATOM   4998  C  C     . ASN C 2  187  ? 471.569 -28.991 635.266 1.00 167.14 ? 187  ASN C C     1 
ATOM   4999  O  O     . ASN C 2  187  ? 471.599 -28.202 634.320 1.00 165.68 ? 187  ASN C O     1 
ATOM   5000  C  CB    . ASN C 2  187  ? 474.016 -29.389 634.862 1.00 159.89 ? 187  ASN C CB    1 
ATOM   5001  C  CG    . ASN C 2  187  ? 475.343 -29.791 635.461 1.00 159.90 ? 187  ASN C CG    1 
ATOM   5002  O  OD1   . ASN C 2  187  ? 476.029 -30.677 634.954 1.00 158.78 ? 187  ASN C OD1   1 
ATOM   5003  N  ND2   . ASN C 2  187  ? 475.729 -29.112 636.538 1.00 162.57 ? 187  ASN C ND2   1 
ATOM   5004  N  N     . LYS C 2  188  ? 470.438 -29.348 635.887 1.00 169.55 ? 188  LYS C N     1 
ATOM   5005  C  CA    . LYS C 2  188  ? 469.113 -28.802 635.601 1.00 168.71 ? 188  LYS C CA    1 
ATOM   5006  C  C     . LYS C 2  188  ? 468.548 -29.224 634.224 1.00 172.26 ? 188  LYS C C     1 
ATOM   5007  O  O     . LYS C 2  188  ? 467.416 -28.838 633.909 1.00 176.25 ? 188  LYS C O     1 
ATOM   5008  C  CB    . LYS C 2  188  ? 469.100 -27.295 635.911 1.00 164.54 ? 188  LYS C CB    1 
ATOM   5009  C  CG    . LYS C 2  188  ? 469.587 -27.213 637.403 1.00 168.75 ? 188  LYS C CG    1 
ATOM   5010  C  CD    . LYS C 2  188  ? 469.553 -25.924 638.239 1.00 168.98 ? 188  LYS C CD    1 
ATOM   5011  C  CE    . LYS C 2  188  ? 470.420 -26.185 639.519 1.00 169.67 ? 188  LYS C CE    1 
ATOM   5012  N  NZ    . LYS C 2  188  ? 470.296 -25.284 640.717 1.00 165.74 ? 188  LYS C NZ    1 
ATOM   5013  N  N     . ARG C 2  189  ? 469.301 -29.987 633.391 1.00 169.02 ? 189  ARG C N     1 
ATOM   5014  C  CA    . ARG C 2  189  ? 468.843 -30.498 632.088 1.00 164.88 ? 189  ARG C CA    1 
ATOM   5015  C  C     . ARG C 2  189  ? 468.320 -31.931 632.243 1.00 165.76 ? 189  ARG C C     1 
ATOM   5016  O  O     . ARG C 2  189  ? 468.942 -32.749 632.925 1.00 166.28 ? 189  ARG C O     1 
ATOM   5017  C  CB    . ARG C 2  189  ? 470.009 -30.532 631.095 1.00 163.20 ? 189  ARG C CB    1 
ATOM   5018  C  CG    . ARG C 2  189  ? 470.593 -29.193 630.674 1.00 166.85 ? 189  ARG C CG    1 
ATOM   5019  C  CD    . ARG C 2  189  ? 471.698 -29.409 629.628 1.00 166.72 ? 189  ARG C CD    1 
ATOM   5020  N  NE    . ARG C 2  189  ? 472.595 -28.253 629.498 1.00 176.40 ? 189  ARG C NE    1 
ATOM   5021  C  CZ    . ARG C 2  189  ? 473.213 -27.879 628.374 1.00 171.88 ? 189  ARG C CZ    1 
ATOM   5022  N  NH1   . ARG C 2  189  ? 473.036 -28.568 627.255 1.00 170.38 ? 189  ARG C NH1   1 
ATOM   5023  N  NH2   . ARG C 2  189  ? 474.024 -26.821 628.368 1.00 160.30 ? 189  ARG C NH2   1 
ATOM   5024  N  N     . LYS C 2  190  ? 467.208 -32.252 631.563 1.00 166.07 ? 190  LYS C N     1 
ATOM   5025  C  CA    . LYS C 2  190  ? 466.615 -33.591 631.577 1.00 164.33 ? 190  LYS C CA    1 
ATOM   5026  C  C     . LYS C 2  190  ? 466.637 -34.324 630.232 1.00 160.05 ? 190  LYS C C     1 
ATOM   5027  O  O     . LYS C 2  190  ? 466.568 -33.709 629.168 1.00 158.79 ? 190  LYS C O     1 
ATOM   5028  C  CB    . LYS C 2  190  ? 465.161 -33.501 632.076 1.00 155.60 ? 190  LYS C CB    1 
ATOM   5029  C  CG    . LYS C 2  190  ? 464.849 -34.301 633.331 1.00 156.80 ? 190  LYS C CG    1 
ATOM   5030  C  CD    . LYS C 2  190  ? 463.387 -34.139 633.744 1.00 162.77 ? 190  LYS C CD    1 
ATOM   5031  C  CE    . LYS C 2  190  ? 463.150 -34.674 635.160 1.00 168.76 ? 190  LYS C CE    1 
ATOM   5032  N  NZ    . LYS C 2  190  ? 461.873 -34.207 635.792 1.00 170.53 ? 190  LYS C NZ    1 
ATOM   5033  N  N     . PHE C 2  191  ? 466.751 -35.653 630.306 1.00 155.49 ? 191  PHE C N     1 
ATOM   5034  C  CA    . PHE C 2  191  ? 466.607 -36.545 629.162 1.00 155.23 ? 191  PHE C CA    1 
ATOM   5035  C  C     . PHE C 2  191  ? 466.122 -37.888 629.686 1.00 157.84 ? 191  PHE C C     1 
ATOM   5036  O  O     . PHE C 2  191  ? 466.066 -38.101 630.902 1.00 160.28 ? 191  PHE C O     1 
ATOM   5037  C  CB    . PHE C 2  191  ? 467.931 -36.718 628.423 1.00 156.82 ? 191  PHE C CB    1 
ATOM   5038  C  CG    . PHE C 2  191  ? 469.000 -37.310 629.268 1.00 156.14 ? 191  PHE C CG    1 
ATOM   5039  C  CD1   . PHE C 2  191  ? 469.708 -36.538 630.167 1.00 152.77 ? 191  PHE C CD1   1 
ATOM   5040  C  CD2   . PHE C 2  191  ? 469.289 -38.657 629.162 1.00 156.67 ? 191  PHE C CD2   1 
ATOM   5041  C  CE1   . PHE C 2  191  ? 470.686 -37.107 630.943 1.00 152.02 ? 191  PHE C CE1   1 
ATOM   5042  C  CE2   . PHE C 2  191  ? 470.258 -39.234 629.930 1.00 154.59 ? 191  PHE C CE2   1 
ATOM   5043  C  CZ    . PHE C 2  191  ? 470.964 -38.460 630.823 1.00 154.25 ? 191  PHE C CZ    1 
ATOM   5044  N  N     . PRO C 2  192  ? 465.779 -38.833 628.796 1.00 161.84 ? 192  PRO C N     1 
ATOM   5045  C  CA    . PRO C 2  192  ? 465.419 -40.184 629.276 1.00 159.12 ? 192  PRO C CA    1 
ATOM   5046  C  C     . PRO C 2  192  ? 466.649 -40.936 629.775 1.00 156.50 ? 192  PRO C C     1 
ATOM   5047  O  O     . PRO C 2  192  ? 467.665 -41.033 629.084 1.00 155.93 ? 192  PRO C O     1 
ATOM   5048  C  CB    . PRO C 2  192  ? 464.811 -40.858 628.039 1.00 157.30 ? 192  PRO C CB    1 
ATOM   5049  C  CG    . PRO C 2  192  ? 464.325 -39.730 627.202 1.00 156.80 ? 192  PRO C CG    1 
ATOM   5050  C  CD    . PRO C 2  192  ? 465.334 -38.629 627.404 1.00 159.88 ? 192  PRO C CD    1 
ATOM   5051  N  N     . LEU C 2  193  ? 466.527 -41.520 630.965 1.00 159.92 ? 193  LEU C N     1 
ATOM   5052  C  CA    . LEU C 2  193  ? 467.642 -42.237 631.575 1.00 162.40 ? 193  LEU C CA    1 
ATOM   5053  C  C     . LEU C 2  193  ? 468.101 -43.461 630.793 1.00 161.04 ? 193  LEU C C     1 
ATOM   5054  O  O     . LEU C 2  193  ? 469.282 -43.821 630.867 1.00 158.00 ? 193  LEU C O     1 
ATOM   5055  C  CB    . LEU C 2  193  ? 467.225 -42.692 632.981 1.00 157.84 ? 193  LEU C CB    1 
ATOM   5056  C  CG    . LEU C 2  193  ? 468.181 -43.566 633.786 1.00 149.85 ? 193  LEU C CG    1 
ATOM   5057  C  CD1   . LEU C 2  193  ? 469.490 -42.861 634.082 1.00 145.22 ? 193  LEU C CD1   1 
ATOM   5058  C  CD2   . LEU C 2  193  ? 467.511 -44.071 635.033 1.00 150.93 ? 193  LEU C CD2   1 
ATOM   5059  N  N     . VAL C 2  194  ? 467.223 -44.059 629.992 1.00 162.59 ? 194  VAL C N     1 
ATOM   5060  C  CA    . VAL C 2  194  ? 467.582 -45.272 629.261 1.00 162.97 ? 194  VAL C CA    1 
ATOM   5061  C  C     . VAL C 2  194  ? 468.812 -45.049 628.386 1.00 163.51 ? 194  VAL C C     1 
ATOM   5062  O  O     . VAL C 2  194  ? 469.695 -45.912 628.305 1.00 161.61 ? 194  VAL C O     1 
ATOM   5063  C  CB    . VAL C 2  194  ? 466.366 -45.772 628.453 1.00 165.75 ? 194  VAL C CB    1 
ATOM   5064  C  CG1   . VAL C 2  194  ? 465.533 -44.592 627.937 1.00 167.56 ? 194  VAL C CG1   1 
ATOM   5065  C  CG2   . VAL C 2  194  ? 466.784 -46.703 627.330 1.00 169.68 ? 194  VAL C CG2   1 
ATOM   5066  N  N     . LEU C 2  195  ? 468.925 -43.868 627.772 1.00 163.85 ? 195  LEU C N     1 
ATOM   5067  C  CA    . LEU C 2  195  ? 470.051 -43.602 626.879 1.00 163.68 ? 195  LEU C CA    1 
ATOM   5068  C  C     . LEU C 2  195  ? 471.387 -43.748 627.601 1.00 162.29 ? 195  LEU C C     1 
ATOM   5069  O  O     . LEU C 2  195  ? 472.323 -44.375 627.085 1.00 160.39 ? 195  LEU C O     1 
ATOM   5070  C  CB    . LEU C 2  195  ? 469.905 -42.210 626.260 1.00 163.70 ? 195  LEU C CB    1 
ATOM   5071  C  CG    . LEU C 2  195  ? 471.065 -41.735 625.375 1.00 169.38 ? 195  LEU C CG    1 
ATOM   5072  C  CD1   . LEU C 2  195  ? 471.337 -42.718 624.232 1.00 172.20 ? 195  LEU C CD1   1 
ATOM   5073  C  CD2   . LEU C 2  195  ? 470.796 -40.338 624.815 1.00 167.83 ? 195  LEU C CD2   1 
ATOM   5074  N  N     . LEU C 2  196  ? 471.498 -43.170 628.796 1.00 160.58 ? 196  LEU C N     1 
ATOM   5075  C  CA    . LEU C 2  196  ? 472.729 -43.302 629.568 1.00 155.19 ? 196  LEU C CA    1 
ATOM   5076  C  C     . LEU C 2  196  ? 472.988 -44.753 629.935 1.00 154.32 ? 196  LEU C C     1 
ATOM   5077  O  O     . LEU C 2  196  ? 474.140 -45.202 629.972 1.00 151.58 ? 196  LEU C O     1 
ATOM   5078  C  CB    . LEU C 2  196  ? 472.647 -42.448 630.831 1.00 156.08 ? 196  LEU C CB    1 
ATOM   5079  C  CG    . LEU C 2  196  ? 473.892 -42.291 631.708 1.00 147.42 ? 196  LEU C CG    1 
ATOM   5080  C  CD1   . LEU C 2  196  ? 473.894 -43.307 632.836 1.00 146.72 ? 196  LEU C CD1   1 
ATOM   5081  C  CD2   . LEU C 2  196  ? 475.150 -42.411 630.903 1.00 145.86 ? 196  LEU C CD2   1 
ATOM   5082  N  N     . LEU C 2  197  ? 471.926 -45.493 630.241 1.00 157.46 ? 197  LEU C N     1 
ATOM   5083  C  CA    . LEU C 2  197  ? 472.067 -46.911 630.541 1.00 161.01 ? 197  LEU C CA    1 
ATOM   5084  C  C     . LEU C 2  197  ? 472.720 -47.664 629.390 1.00 159.75 ? 197  LEU C C     1 
ATOM   5085  O  O     . LEU C 2  197  ? 473.575 -48.533 629.610 1.00 159.93 ? 197  LEU C O     1 
ATOM   5086  C  CB    . LEU C 2  197  ? 470.695 -47.498 630.868 1.00 162.90 ? 197  LEU C CB    1 
ATOM   5087  C  CG    . LEU C 2  197  ? 470.094 -47.053 632.195 1.00 152.51 ? 197  LEU C CG    1 
ATOM   5088  C  CD1   . LEU C 2  197  ? 468.712 -47.625 632.307 1.00 157.55 ? 197  LEU C CD1   1 
ATOM   5089  C  CD2   . LEU C 2  197  ? 470.974 -47.536 633.330 1.00 144.17 ? 197  LEU C CD2   1 
ATOM   5090  N  N     . ARG C 2  198  ? 472.366 -47.312 628.155 1.00 160.86 ? 198  ARG C N     1 
ATOM   5091  C  CA    . ARG C 2  198  ? 472.947 -47.986 627.002 1.00 163.76 ? 198  ARG C CA    1 
ATOM   5092  C  C     . ARG C 2  198  ? 474.451 -47.731 626.921 1.00 161.18 ? 198  ARG C C     1 
ATOM   5093  O  O     . ARG C 2  198  ? 475.230 -48.667 626.700 1.00 161.99 ? 198  ARG C O     1 
ATOM   5094  C  CB    . ARG C 2  198  ? 472.224 -47.484 625.740 1.00 166.26 ? 198  ARG C CB    1 
ATOM   5095  C  CG    . ARG C 2  198  ? 472.499 -48.147 624.371 1.00 174.33 ? 198  ARG C CG    1 
ATOM   5096  C  CD    . ARG C 2  198  ? 472.214 -49.653 624.328 1.00 180.05 ? 198  ARG C CD    1 
ATOM   5097  N  NE    . ARG C 2  198  ? 472.496 -50.222 623.006 1.00 184.90 ? 198  ARG C NE    1 
ATOM   5098  C  CZ    . ARG C 2  198  ? 472.752 -51.507 622.767 1.00 186.12 ? 198  ARG C CZ    1 
ATOM   5099  N  NH1   . ARG C 2  198  ? 472.994 -51.924 621.528 1.00 187.08 ? 198  ARG C NH1   1 
ATOM   5100  N  NH2   . ARG C 2  198  ? 472.760 -52.379 623.762 1.00 184.50 ? 198  ARG C NH2   1 
ATOM   5101  N  N     . VAL C 2  199  ? 474.885 -46.508 627.251 1.00 156.70 ? 199  VAL C N     1 
ATOM   5102  C  CA    . VAL C 2  199  ? 476.312 -46.174 627.281 1.00 154.75 ? 199  VAL C CA    1 
ATOM   5103  C  C     . VAL C 2  199  ? 477.085 -47.037 628.273 1.00 154.19 ? 199  VAL C C     1 
ATOM   5104  O  O     . VAL C 2  199  ? 478.284 -47.281 628.098 1.00 154.79 ? 199  VAL C O     1 
ATOM   5105  C  CB    . VAL C 2  199  ? 476.480 -44.674 627.577 1.00 147.03 ? 199  VAL C CB    1 
ATOM   5106  C  CG1   . VAL C 2  199  ? 477.948 -44.288 627.595 1.00 136.27 ? 199  VAL C CG1   1 
ATOM   5107  C  CG2   . VAL C 2  199  ? 475.703 -43.851 626.562 1.00 145.99 ? 199  VAL C CG2   1 
ATOM   5108  N  N     . LEU C 2  200  ? 476.450 -47.453 629.358 1.00 154.29 ? 200  LEU C N     1 
ATOM   5109  C  CA    . LEU C 2  200  ? 477.163 -48.291 630.309 1.00 158.42 ? 200  LEU C CA    1 
ATOM   5110  C  C     . LEU C 2  200  ? 477.339 -49.715 629.795 1.00 159.39 ? 200  LEU C C     1 
ATOM   5111  O  O     . LEU C 2  200  ? 478.064 -50.502 630.416 1.00 159.55 ? 200  LEU C O     1 
ATOM   5112  C  CB    . LEU C 2  200  ? 476.433 -48.264 631.651 1.00 158.30 ? 200  LEU C CB    1 
ATOM   5113  C  CG    . LEU C 2  200  ? 476.442 -46.879 632.308 1.00 148.22 ? 200  LEU C CG    1 
ATOM   5114  C  CD1   . LEU C 2  200  ? 475.422 -46.839 633.412 1.00 154.84 ? 200  LEU C CD1   1 
ATOM   5115  C  CD2   . LEU C 2  200  ? 477.812 -46.551 632.865 1.00 143.16 ? 200  LEU C CD2   1 
ATOM   5116  N  N     . GLY C 2  201  ? 476.703 -50.050 628.677 1.00 157.78 ? 201  GLY C N     1 
ATOM   5117  C  CA    . GLY C 2  201  ? 476.831 -51.353 628.066 1.00 162.33 ? 201  GLY C CA    1 
ATOM   5118  C  C     . GLY C 2  201  ? 475.700 -52.271 628.453 1.00 162.01 ? 201  GLY C C     1 
ATOM   5119  O  O     . GLY C 2  201  ? 475.819 -53.492 628.307 1.00 161.99 ? 201  GLY C O     1 
ATOM   5120  N  N     . TYR C 2  202  ? 474.623 -51.713 628.972 1.00 164.68 ? 202  TYR C N     1 
ATOM   5121  C  CA    . TYR C 2  202  ? 473.447 -52.456 629.370 1.00 172.99 ? 202  TYR C CA    1 
ATOM   5122  C  C     . TYR C 2  202  ? 472.620 -52.816 628.140 1.00 175.35 ? 202  TYR C C     1 
ATOM   5123  O  O     . TYR C 2  202  ? 472.574 -52.068 627.159 1.00 170.41 ? 202  TYR C O     1 
ATOM   5124  C  CB    . TYR C 2  202  ? 472.629 -51.641 630.383 1.00 171.82 ? 202  TYR C CB    1 
ATOM   5125  C  CG    . TYR C 2  202  ? 473.225 -51.638 631.786 1.00 165.29 ? 202  TYR C CG    1 
ATOM   5126  C  CD1   . TYR C 2  202  ? 474.243 -52.525 632.128 1.00 168.74 ? 202  TYR C CD1   1 
ATOM   5127  C  CD2   . TYR C 2  202  ? 472.801 -50.730 632.749 1.00 159.82 ? 202  TYR C CD2   1 
ATOM   5128  C  CE1   . TYR C 2  202  ? 474.809 -52.527 633.389 1.00 163.42 ? 202  TYR C CE1   1 
ATOM   5129  C  CE2   . TYR C 2  202  ? 473.369 -50.723 634.018 1.00 157.36 ? 202  TYR C CE2   1 
ATOM   5130  C  CZ    . TYR C 2  202  ? 474.370 -51.629 634.329 1.00 156.10 ? 202  TYR C CZ    1 
ATOM   5131  O  OH    . TYR C 2  202  ? 474.945 -51.649 635.576 1.00 151.55 ? 202  TYR C OH    1 
ATOM   5132  N  N     . ASP C 2  203  ? 472.003 -53.996 628.185 1.00 183.29 ? 203  ASP C N     1 
ATOM   5133  C  CA    . ASP C 2  203  ? 471.115 -54.468 627.135 1.00 189.53 ? 203  ASP C CA    1 
ATOM   5134  C  C     . ASP C 2  203  ? 469.693 -54.665 627.653 1.00 194.78 ? 203  ASP C C     1 
ATOM   5135  O  O     . ASP C 2  203  ? 469.460 -54.832 628.853 1.00 198.76 ? 203  ASP C O     1 
ATOM   5136  C  CB    . ASP C 2  203  ? 471.615 -55.794 626.557 1.00 194.15 ? 203  ASP C CB    1 
ATOM   5137  C  CG    . ASP C 2  203  ? 471.068 -56.063 625.183 1.00 197.91 ? 203  ASP C CG    1 
ATOM   5138  O  OD1   . ASP C 2  203  ? 471.552 -55.441 624.213 1.00 200.18 ? 203  ASP C OD1   1 
ATOM   5139  O  OD2   . ASP C 2  203  ? 470.139 -56.893 625.082 1.00 200.39 ? 203  ASP C OD2   1 
ATOM   5140  N  N     . GLN C 2  204  ? 468.744 -54.660 626.707 1.00 193.26 ? 204  GLN C N     1 
ATOM   5141  C  CA    . GLN C 2  204  ? 467.320 -54.769 627.025 1.00 193.92 ? 204  GLN C CA    1 
ATOM   5142  C  C     . GLN C 2  204  ? 467.022 -55.966 627.915 1.00 197.65 ? 204  GLN C C     1 
ATOM   5143  O  O     . GLN C 2  204  ? 466.131 -55.903 628.770 1.00 197.57 ? 204  GLN C O     1 
ATOM   5144  C  CB    . GLN C 2  204  ? 466.490 -54.845 625.750 1.00 193.13 ? 204  GLN C CB    1 
ATOM   5145  C  CG    . GLN C 2  204  ? 465.008 -54.752 626.033 1.00 192.74 ? 204  GLN C CG    1 
ATOM   5146  C  CD    . GLN C 2  204  ? 464.181 -54.511 624.793 1.00 194.61 ? 204  GLN C CD    1 
ATOM   5147  O  OE1   . GLN C 2  204  ? 464.714 -54.359 623.694 1.00 192.80 ? 204  GLN C OE1   1 
ATOM   5148  N  NE2   . GLN C 2  204  ? 462.865 -54.448 624.966 1.00 195.34 ? 204  GLN C NE2   1 
ATOM   5149  N  N     . GLU C 2  205  ? 467.760 -57.060 627.725 1.00 201.27 ? 205  GLU C N     1 
ATOM   5150  C  CA    . GLU C 2  205  ? 467.587 -58.261 628.538 1.00 205.21 ? 205  GLU C CA    1 
ATOM   5151  C  C     . GLU C 2  205  ? 467.877 -57.956 630.003 1.00 204.45 ? 205  GLU C C     1 
ATOM   5152  O  O     . GLU C 2  205  ? 467.113 -58.349 630.894 1.00 204.33 ? 205  GLU C O     1 
ATOM   5153  C  CB    . GLU C 2  205  ? 468.479 -59.392 628.019 1.00 208.46 ? 205  GLU C CB    1 
ATOM   5154  C  CG    . GLU C 2  205  ? 469.959 -59.068 628.041 1.00 210.41 ? 205  GLU C CG    1 
ATOM   5155  C  CD    . GLU C 2  205  ? 470.658 -59.654 629.261 1.00 216.57 ? 205  GLU C CD    1 
ATOM   5156  O  OE1   . GLU C 2  205  ? 469.969 -59.963 630.262 1.00 215.29 ? 205  GLU C OE1   1 
ATOM   5157  O  OE2   . GLU C 2  205  ? 471.902 -59.766 629.232 1.00 220.52 ? 205  GLU C OE2   1 
ATOM   5158  N  N     . THR C 2  206  ? 468.998 -57.280 630.270 1.00 203.82 ? 206  THR C N     1 
ATOM   5159  C  CA    . THR C 2  206  ? 469.422 -57.000 631.637 1.00 203.42 ? 206  THR C CA    1 
ATOM   5160  C  C     . THR C 2  206  ? 468.359 -56.211 632.384 1.00 202.07 ? 206  THR C C     1 
ATOM   5161  O  O     . THR C 2  206  ? 468.006 -56.553 633.519 1.00 198.33 ? 206  THR C O     1 
ATOM   5162  C  CB    . THR C 2  206  ? 470.739 -56.212 631.615 1.00 200.79 ? 206  THR C CB    1 
ATOM   5163  O  OG1   . THR C 2  206  ? 471.594 -56.705 630.574 1.00 201.98 ? 206  THR C OG1   1 
ATOM   5164  C  CG2   . THR C 2  206  ? 471.444 -56.187 632.974 1.00 197.38 ? 206  THR C CG2   1 
ATOM   5165  N  N     . LEU C 2  207  ? 467.806 -55.173 631.753 1.00 200.18 ? 207  LEU C N     1 
ATOM   5166  C  CA    . LEU C 2  207  ? 466.780 -54.398 632.437 1.00 200.54 ? 207  LEU C CA    1 
ATOM   5167  C  C     . LEU C 2  207  ? 465.516 -55.233 632.654 1.00 199.95 ? 207  LEU C C     1 
ATOM   5168  O  O     . LEU C 2  207  ? 464.880 -55.153 633.716 1.00 196.65 ? 207  LEU C O     1 
ATOM   5169  C  CB    . LEU C 2  207  ? 466.475 -53.152 631.601 1.00 194.71 ? 207  LEU C CB    1 
ATOM   5170  C  CG    . LEU C 2  207  ? 467.699 -52.250 631.352 1.00 191.06 ? 207  LEU C CG    1 
ATOM   5171  C  CD1   . LEU C 2  207  ? 467.312 -50.927 630.717 1.00 183.72 ? 207  LEU C CD1   1 
ATOM   5172  C  CD2   . LEU C 2  207  ? 468.577 -52.027 632.583 1.00 191.25 ? 207  LEU C CD2   1 
ATOM   5173  N  N     . ALA C 2  208  ? 465.138 -56.043 631.661 1.00 199.78 ? 208  ALA C N     1 
ATOM   5174  C  CA    . ALA C 2  208  ? 463.983 -56.920 631.814 1.00 195.66 ? 208  ALA C CA    1 
ATOM   5175  C  C     . ALA C 2  208  ? 464.224 -57.986 632.881 1.00 196.14 ? 208  ALA C C     1 
ATOM   5176  O  O     . ALA C 2  208  ? 463.408 -58.164 633.792 1.00 195.84 ? 208  ALA C O     1 
ATOM   5177  C  CB    . ALA C 2  208  ? 463.628 -57.565 630.475 1.00 194.19 ? 208  ALA C CB    1 
ATOM   5178  N  N     . ARG C 2  209  ? 465.359 -58.698 632.786 1.00 196.75 ? 209  ARG C N     1 
ATOM   5179  C  CA    . ARG C 2  209  ? 465.669 -59.775 633.731 1.00 197.20 ? 209  ARG C CA    1 
ATOM   5180  C  C     . ARG C 2  209  ? 465.939 -59.263 635.142 1.00 195.36 ? 209  ARG C C     1 
ATOM   5181  O  O     . ARG C 2  209  ? 465.596 -59.936 636.121 1.00 196.82 ? 209  ARG C O     1 
ATOM   5182  C  CB    . ARG C 2  209  ? 466.866 -60.605 633.261 1.00 202.94 ? 209  ARG C CB    1 
ATOM   5183  C  CG    . ARG C 2  209  ? 468.200 -60.042 633.706 1.00 202.14 ? 209  ARG C CG    1 
ATOM   5184  C  CD    . ARG C 2  209  ? 469.348 -60.990 633.484 1.00 203.16 ? 209  ARG C CD    1 
ATOM   5185  N  NE    . ARG C 2  209  ? 470.394 -60.686 634.456 1.00 204.45 ? 209  ARG C NE    1 
ATOM   5186  C  CZ    . ARG C 2  209  ? 471.403 -59.853 634.238 1.00 204.67 ? 209  ARG C CZ    1 
ATOM   5187  N  NH1   . ARG C 2  209  ? 471.513 -59.238 633.070 1.00 204.50 ? 209  ARG C NH1   1 
ATOM   5188  N  NH2   . ARG C 2  209  ? 472.297 -59.633 635.194 1.00 201.72 ? 209  ARG C NH2   1 
ATOM   5189  N  N     . GLU C 2  210  ? 466.584 -58.103 635.274 1.00 194.41 ? 210  GLU C N     1 
ATOM   5190  C  CA    . GLU C 2  210  ? 466.940 -57.609 636.601 1.00 193.73 ? 210  GLU C CA    1 
ATOM   5191  C  C     . GLU C 2  210  ? 465.685 -57.145 637.319 1.00 190.37 ? 210  GLU C C     1 
ATOM   5192  O  O     . GLU C 2  210  ? 465.401 -57.561 638.450 1.00 185.65 ? 210  GLU C O     1 
ATOM   5193  C  CB    . GLU C 2  210  ? 467.980 -56.493 636.511 1.00 189.54 ? 210  GLU C CB    1 
ATOM   5194  C  CG    . GLU C 2  210  ? 468.936 -56.485 637.691 1.00 186.11 ? 210  GLU C CG    1 
ATOM   5195  C  CD    . GLU C 2  210  ? 469.773 -57.755 637.750 1.00 185.90 ? 210  GLU C CD    1 
ATOM   5196  O  OE1   . GLU C 2  210  ? 470.209 -58.226 636.680 1.00 185.12 ? 210  GLU C OE1   1 
ATOM   5197  O  OE2   . GLU C 2  210  ? 469.983 -58.295 638.856 1.00 181.71 ? 210  GLU C OE2   1 
ATOM   5198  N  N     . LEU C 2  211  ? 464.920 -56.284 636.665 1.00 188.76 ? 211  LEU C N     1 
ATOM   5199  C  CA    . LEU C 2  211  ? 463.796 -55.619 637.285 1.00 188.15 ? 211  LEU C CA    1 
ATOM   5200  C  C     . LEU C 2  211  ? 462.553 -56.412 636.905 1.00 189.54 ? 211  LEU C C     1 
ATOM   5201  O  O     . LEU C 2  211  ? 462.065 -57.217 637.710 1.00 181.81 ? 211  LEU C O     1 
ATOM   5202  C  CB    . LEU C 2  211  ? 463.701 -54.179 636.784 1.00 183.80 ? 211  LEU C CB    1 
ATOM   5203  C  CG    . LEU C 2  211  ? 464.803 -53.174 637.086 1.00 179.74 ? 211  LEU C CG    1 
ATOM   5204  C  CD1   . LEU C 2  211  ? 465.901 -53.271 636.064 1.00 185.23 ? 211  LEU C CD1   1 
ATOM   5205  C  CD2   . LEU C 2  211  ? 464.203 -51.803 637.017 1.00 172.55 ? 211  LEU C CD2   1 
ATOM   5206  N  N     . GLY C 2  212  ? 462.088 -56.247 635.660 1.00 190.35 ? 212  GLY C N     1 
ATOM   5207  C  CA    . GLY C 2  212  ? 460.823 -56.750 635.131 1.00 187.35 ? 212  GLY C CA    1 
ATOM   5208  C  C     . GLY C 2  212  ? 459.691 -57.050 636.097 1.00 183.30 ? 212  GLY C C     1 
ATOM   5209  O  O     . GLY C 2  212  ? 458.518 -56.922 635.725 1.00 180.96 ? 212  GLY C O     1 
ATOM   5210  N  N     . ALA C 2  213  ? 460.027 -57.424 637.338 1.00 180.36 ? 213  ALA C N     1 
ATOM   5211  C  CA    . ALA C 2  213  ? 459.039 -57.834 638.326 1.00 181.82 ? 213  ALA C CA    1 
ATOM   5212  C  C     . ALA C 2  213  ? 457.944 -56.791 638.442 1.00 185.13 ? 213  ALA C C     1 
ATOM   5213  O  O     . ALA C 2  213  ? 456.828 -57.101 638.877 1.00 186.08 ? 213  ALA C O     1 
ATOM   5214  C  CB    . ALA C 2  213  ? 459.711 -58.065 639.681 1.00 177.93 ? 213  ALA C CB    1 
ATOM   5215  N  N     . TYR C 2  214  ? 458.262 -55.558 638.062 1.00 184.22 ? 214  TYR C N     1 
ATOM   5216  C  CA    . TYR C 2  214  ? 457.359 -54.424 638.128 1.00 184.88 ? 214  TYR C CA    1 
ATOM   5217  C  C     . TYR C 2  214  ? 456.789 -54.224 636.733 1.00 185.85 ? 214  TYR C C     1 
ATOM   5218  O  O     . TYR C 2  214  ? 457.511 -53.827 635.814 1.00 178.62 ? 214  TYR C O     1 
ATOM   5219  C  CB    . TYR C 2  214  ? 458.143 -53.209 638.615 1.00 181.99 ? 214  TYR C CB    1 
ATOM   5220  C  CG    . TYR C 2  214  ? 459.240 -53.667 639.547 1.00 180.38 ? 214  TYR C CG    1 
ATOM   5221  C  CD1   . TYR C 2  214  ? 458.975 -53.929 640.883 1.00 180.23 ? 214  TYR C CD1   1 
ATOM   5222  C  CD2   . TYR C 2  214  ? 460.529 -53.899 639.081 1.00 178.80 ? 214  TYR C CD2   1 
ATOM   5223  C  CE1   . TYR C 2  214  ? 459.966 -54.387 641.737 1.00 177.60 ? 214  TYR C CE1   1 
ATOM   5224  C  CE2   . TYR C 2  214  ? 461.527 -54.358 639.930 1.00 178.27 ? 214  TYR C CE2   1 
ATOM   5225  C  CZ    . TYR C 2  214  ? 461.239 -54.598 641.259 1.00 174.88 ? 214  TYR C CZ    1 
ATOM   5226  O  OH    . TYR C 2  214  ? 462.216 -55.046 642.120 1.00 164.01 ? 214  TYR C OH    1 
ATOM   5227  N  N     . GLY C 2  215  ? 455.506 -54.552 636.571 1.00 192.32 ? 215  GLY C N     1 
ATOM   5228  C  CA    . GLY C 2  215  ? 454.984 -54.891 635.261 1.00 191.53 ? 215  GLY C CA    1 
ATOM   5229  C  C     . GLY C 2  215  ? 455.125 -53.693 634.354 1.00 191.95 ? 215  GLY C C     1 
ATOM   5230  O  O     . GLY C 2  215  ? 455.785 -53.773 633.314 1.00 191.70 ? 215  GLY C O     1 
ATOM   5231  N  N     . GLU C 2  216  ? 454.513 -52.570 634.743 1.00 190.83 ? 216  GLU C N     1 
ATOM   5232  C  CA    . GLU C 2  216  ? 454.414 -51.431 633.843 1.00 190.42 ? 216  GLU C CA    1 
ATOM   5233  C  C     . GLU C 2  216  ? 455.608 -50.503 633.958 1.00 191.65 ? 216  GLU C C     1 
ATOM   5234  O  O     . GLU C 2  216  ? 455.801 -49.654 633.077 1.00 193.00 ? 216  GLU C O     1 
ATOM   5235  C  CB    . GLU C 2  216  ? 453.142 -50.603 634.053 1.00 189.08 ? 216  GLU C CB    1 
ATOM   5236  C  CG    . GLU C 2  216  ? 451.828 -51.324 633.886 1.00 192.32 ? 216  GLU C CG    1 
ATOM   5237  C  CD    . GLU C 2  216  ? 450.679 -50.339 633.744 1.00 191.65 ? 216  GLU C CD    1 
ATOM   5238  O  OE1   . GLU C 2  216  ? 450.920 -49.231 633.210 1.00 185.92 ? 216  GLU C OE1   1 
ATOM   5239  O  OE2   . GLU C 2  216  ? 449.546 -50.663 634.158 1.00 190.63 ? 216  GLU C OE2   1 
ATOM   5240  N  N     . LEU C 2  217  ? 456.407 -50.618 635.023 1.00 189.37 ? 217  LEU C N     1 
ATOM   5241  C  CA    . LEU C 2  217  ? 457.455 -49.622 635.173 1.00 188.31 ? 217  LEU C CA    1 
ATOM   5242  C  C     . LEU C 2  217  ? 458.688 -49.995 634.353 1.00 190.16 ? 217  LEU C C     1 
ATOM   5243  O  O     . LEU C 2  217  ? 459.241 -49.145 633.643 1.00 187.79 ? 217  LEU C O     1 
ATOM   5244  C  CB    . LEU C 2  217  ? 457.808 -49.492 636.656 1.00 185.99 ? 217  LEU C CB    1 
ATOM   5245  C  CG    . LEU C 2  217  ? 456.597 -49.482 637.596 1.00 188.96 ? 217  LEU C CG    1 
ATOM   5246  C  CD1   . LEU C 2  217  ? 457.024 -49.866 639.006 1.00 184.59 ? 217  LEU C CD1   1 
ATOM   5247  C  CD2   . LEU C 2  217  ? 455.864 -48.140 637.584 1.00 183.67 ? 217  LEU C CD2   1 
ATOM   5248  N  N     . VAL C 2  218  ? 459.126 -51.261 634.421 1.00 190.34 ? 218  VAL C N     1 
ATOM   5249  C  CA    . VAL C 2  218  ? 460.332 -51.646 633.688 1.00 184.10 ? 218  VAL C CA    1 
ATOM   5250  C  C     . VAL C 2  218  ? 460.098 -51.529 632.191 1.00 181.24 ? 218  VAL C C     1 
ATOM   5251  O  O     . VAL C 2  218  ? 460.982 -51.114 631.437 1.00 180.45 ? 218  VAL C O     1 
ATOM   5252  C  CB    . VAL C 2  218  ? 460.791 -53.060 634.080 1.00 180.02 ? 218  VAL C CB    1 
ATOM   5253  C  CG1   . VAL C 2  218  ? 462.275 -53.180 633.891 1.00 179.21 ? 218  VAL C CG1   1 
ATOM   5254  C  CG2   . VAL C 2  218  ? 460.453 -53.319 635.524 1.00 183.66 ? 218  VAL C CG2   1 
ATOM   5255  N  N     . GLN C 2  219  ? 458.893 -51.889 631.746 1.00 182.70 ? 219  GLN C N     1 
ATOM   5256  C  CA    . GLN C 2  219  ? 458.513 -51.749 630.346 1.00 185.54 ? 219  GLN C CA    1 
ATOM   5257  C  C     . GLN C 2  219  ? 458.340 -50.292 629.928 1.00 186.56 ? 219  GLN C C     1 
ATOM   5258  O  O     . GLN C 2  219  ? 458.540 -49.964 628.751 1.00 186.58 ? 219  GLN C O     1 
ATOM   5259  C  CB    . GLN C 2  219  ? 457.256 -52.583 630.076 1.00 186.36 ? 219  GLN C CB    1 
ATOM   5260  C  CG    . GLN C 2  219  ? 457.595 -53.993 629.568 1.00 182.38 ? 219  GLN C CG    1 
ATOM   5261  C  CD    . GLN C 2  219  ? 456.400 -54.762 629.034 1.00 177.59 ? 219  GLN C CD    1 
ATOM   5262  O  OE1   . GLN C 2  219  ? 455.838 -54.416 627.997 1.00 176.68 ? 219  GLN C OE1   1 
ATOM   5263  N  NE2   . GLN C 2  219  ? 456.048 -55.850 629.708 1.00 173.56 ? 219  GLN C NE2   1 
ATOM   5264  N  N     . GLY C 2  220  ? 457.943 -49.413 630.855 1.00 186.32 ? 220  GLY C N     1 
ATOM   5265  C  CA    . GLY C 2  220  ? 457.847 -47.993 630.543 1.00 187.16 ? 220  GLY C CA    1 
ATOM   5266  C  C     . GLY C 2  220  ? 459.175 -47.295 630.302 1.00 185.60 ? 220  GLY C C     1 
ATOM   5267  O  O     . GLY C 2  220  ? 459.203 -46.264 629.619 1.00 182.49 ? 220  GLY C O     1 
ATOM   5268  N  N     . LEU C 2  221  ? 460.275 -47.843 630.823 1.00 184.74 ? 221  LEU C N     1 
ATOM   5269  C  CA    . LEU C 2  221  ? 461.615 -47.320 630.569 1.00 180.93 ? 221  LEU C CA    1 
ATOM   5270  C  C     . LEU C 2  221  ? 462.143 -47.712 629.198 1.00 181.68 ? 221  LEU C C     1 
ATOM   5271  O  O     . LEU C 2  221  ? 463.035 -47.034 628.679 1.00 181.09 ? 221  LEU C O     1 
ATOM   5272  C  CB    . LEU C 2  221  ? 462.619 -47.765 631.639 1.00 179.88 ? 221  LEU C CB    1 
ATOM   5273  C  CG    . LEU C 2  221  ? 463.471 -49.018 631.466 1.00 179.39 ? 221  LEU C CG    1 
ATOM   5274  C  CD1   . LEU C 2  221  ? 464.832 -48.545 631.049 1.00 178.65 ? 221  LEU C CD1   1 
ATOM   5275  C  CD2   . LEU C 2  221  ? 463.588 -49.809 632.753 1.00 183.54 ? 221  LEU C CD2   1 
ATOM   5276  N  N     . MET C 2  222  ? 461.594 -48.772 628.606 1.00 185.74 ? 222  MET C N     1 
ATOM   5277  C  CA    . MET C 2  222  ? 462.109 -49.363 627.374 1.00 187.19 ? 222  MET C CA    1 
ATOM   5278  C  C     . MET C 2  222  ? 461.766 -48.502 626.162 1.00 187.86 ? 222  MET C C     1 
ATOM   5279  O  O     . MET C 2  222  ? 460.590 -48.267 625.853 1.00 185.54 ? 222  MET C O     1 
ATOM   5280  C  CB    . MET C 2  222  ? 461.512 -50.760 627.224 1.00 183.20 ? 222  MET C CB    1 
ATOM   5281  C  CG    . MET C 2  222  ? 461.936 -51.696 628.342 1.00 184.59 ? 222  MET C CG    1 
ATOM   5282  S  SD    . MET C 2  222  ? 462.317 -53.383 627.872 1.00 181.47 ? 222  MET C SD    1 
ATOM   5283  C  CE    . MET C 2  222  ? 462.753 -54.077 629.470 1.00 188.35 ? 222  MET C CE    1 
ATOM   5284  N  N     . ASP C 2  223  ? 462.817 -48.079 625.453 1.00 186.92 ? 223  ASP C N     1 
ATOM   5285  C  CA    . ASP C 2  223  ? 462.713 -47.319 624.212 1.00 189.93 ? 223  ASP C CA    1 
ATOM   5286  C  C     . ASP C 2  223  ? 463.619 -47.933 623.150 1.00 192.52 ? 223  ASP C C     1 
ATOM   5287  O  O     . ASP C 2  223  ? 464.845 -47.983 623.309 1.00 189.28 ? 223  ASP C O     1 
ATOM   5288  C  CB    . ASP C 2  223  ? 463.082 -45.849 624.455 1.00 188.77 ? 223  ASP C CB    1 
ATOM   5289  C  CG    . ASP C 2  223  ? 462.928 -44.987 623.217 1.00 188.59 ? 223  ASP C CG    1 
ATOM   5290  O  OD1   . ASP C 2  223  ? 463.899 -44.891 622.435 1.00 184.93 ? 223  ASP C OD1   1 
ATOM   5291  O  OD2   . ASP C 2  223  ? 461.838 -44.410 623.024 1.00 190.96 ? 223  ASP C OD2   1 
ATOM   5292  N  N     . GLU C 2  224  ? 462.977 -48.404 622.078 1.00 195.00 ? 224  GLU C N     1 
ATOM   5293  C  CA    . GLU C 2  224  ? 463.599 -49.182 621.008 1.00 190.43 ? 224  GLU C CA    1 
ATOM   5294  C  C     . GLU C 2  224  ? 464.699 -48.417 620.272 1.00 190.34 ? 224  GLU C C     1 
ATOM   5295  O  O     . GLU C 2  224  ? 465.775 -48.969 620.006 1.00 188.14 ? 224  GLU C O     1 
ATOM   5296  C  CB    . GLU C 2  224  ? 462.500 -49.634 620.045 1.00 189.14 ? 224  GLU C CB    1 
ATOM   5297  C  CG    . GLU C 2  224  ? 461.521 -48.515 619.650 1.00 189.88 ? 224  GLU C CG    1 
ATOM   5298  C  CD    . GLU C 2  224  ? 460.398 -48.288 620.666 1.00 193.33 ? 224  GLU C CD    1 
ATOM   5299  O  OE1   . GLU C 2  224  ? 459.921 -49.265 621.285 1.00 195.05 ? 224  GLU C OE1   1 
ATOM   5300  O  OE2   . GLU C 2  224  ? 459.995 -47.118 620.845 1.00 193.15 ? 224  GLU C OE2   1 
ATOM   5301  N  N     . SER C 2  225  ? 464.442 -47.148 619.931 1.00 190.07 ? 225  SER C N     1 
ATOM   5302  C  CA    . SER C 2  225  ? 465.381 -46.343 619.148 1.00 187.47 ? 225  SER C CA    1 
ATOM   5303  C  C     . SER C 2  225  ? 466.771 -46.291 619.776 1.00 187.21 ? 225  SER C C     1 
ATOM   5304  O  O     . SER C 2  225  ? 467.783 -46.270 619.067 1.00 184.07 ? 225  SER C O     1 
ATOM   5305  C  CB    . SER C 2  225  ? 464.809 -44.934 618.954 1.00 185.63 ? 225  SER C CB    1 
ATOM   5306  O  OG    . SER C 2  225  ? 464.501 -44.305 620.186 1.00 184.55 ? 225  SER C OG    1 
ATOM   5307  N  N     . VAL C 2  226  ? 466.836 -46.256 621.106 1.00 193.17 ? 226  VAL C N     1 
ATOM   5308  C  CA    . VAL C 2  226  ? 468.111 -46.202 621.817 1.00 190.49 ? 226  VAL C CA    1 
ATOM   5309  C  C     . VAL C 2  226  ? 468.909 -47.489 621.628 1.00 190.10 ? 226  VAL C C     1 
ATOM   5310  O  O     . VAL C 2  226  ? 470.135 -47.456 621.467 1.00 189.26 ? 226  VAL C O     1 
ATOM   5311  C  CB    . VAL C 2  226  ? 467.866 -45.917 623.311 1.00 188.13 ? 226  VAL C CB    1 
ATOM   5312  C  CG1   . VAL C 2  226  ? 469.164 -46.063 624.108 1.00 179.91 ? 226  VAL C CG1   1 
ATOM   5313  C  CG2   . VAL C 2  226  ? 467.241 -44.538 623.502 1.00 185.67 ? 226  VAL C CG2   1 
ATOM   5314  N  N     . PHE C 2  227  ? 468.235 -48.641 621.644 1.00 189.91 ? 227  PHE C N     1 
ATOM   5315  C  CA    . PHE C 2  227  ? 468.925 -49.915 621.462 1.00 188.46 ? 227  PHE C CA    1 
ATOM   5316  C  C     . PHE C 2  227  ? 469.535 -50.077 620.075 1.00 188.98 ? 227  PHE C C     1 
ATOM   5317  O  O     . PHE C 2  227  ? 470.526 -50.802 619.925 1.00 188.78 ? 227  PHE C O     1 
ATOM   5318  C  CB    . PHE C 2  227  ? 467.950 -51.049 621.750 1.00 188.34 ? 227  PHE C CB    1 
ATOM   5319  C  CG    . PHE C 2  227  ? 467.625 -51.193 623.201 1.00 191.15 ? 227  PHE C CG    1 
ATOM   5320  C  CD1   . PHE C 2  227  ? 468.597 -51.584 624.107 1.00 189.51 ? 227  PHE C CD1   1 
ATOM   5321  C  CD2   . PHE C 2  227  ? 466.360 -50.882 623.669 1.00 191.85 ? 227  PHE C CD2   1 
ATOM   5322  C  CE1   . PHE C 2  227  ? 468.298 -51.704 625.446 1.00 184.77 ? 227  PHE C CE1   1 
ATOM   5323  C  CE2   . PHE C 2  227  ? 466.056 -50.995 625.009 1.00 187.76 ? 227  PHE C CE2   1 
ATOM   5324  C  CZ    . PHE C 2  227  ? 467.027 -51.406 625.896 1.00 185.85 ? 227  PHE C CZ    1 
ATOM   5325  N  N     . ALA C 2  228  ? 468.976 -49.425 619.054 1.00 189.46 ? 228  ALA C N     1 
ATOM   5326  C  CA    . ALA C 2  228  ? 469.510 -49.524 617.696 1.00 188.25 ? 228  ALA C CA    1 
ATOM   5327  C  C     . ALA C 2  228  ? 470.922 -48.959 617.550 1.00 190.37 ? 228  ALA C C     1 
ATOM   5328  O  O     . ALA C 2  228  ? 471.221 -48.344 616.522 1.00 193.65 ? 228  ALA C O     1 
ATOM   5329  C  CB    . ALA C 2  228  ? 468.582 -48.814 616.705 1.00 183.57 ? 228  ALA C CB    1 
ATOM   5330  N  N     . MET C 2  229  ? 471.795 -49.145 618.546 1.00 189.67 ? 229  MET C N     1 
ATOM   5331  C  CA    . MET C 2  229  ? 473.144 -48.591 618.478 1.00 188.18 ? 229  MET C CA    1 
ATOM   5332  C  C     . MET C 2  229  ? 474.023 -49.168 619.582 1.00 186.03 ? 229  MET C C     1 
ATOM   5333  O  O     . MET C 2  229  ? 473.577 -49.314 620.722 1.00 187.13 ? 229  MET C O     1 
ATOM   5334  C  CB    . MET C 2  229  ? 473.100 -47.057 618.557 1.00 187.35 ? 229  MET C CB    1 
ATOM   5335  C  CG    . MET C 2  229  ? 472.556 -46.481 619.843 1.00 182.58 ? 229  MET C CG    1 
ATOM   5336  S  SD    . MET C 2  229  ? 472.193 -44.733 619.612 1.00 180.74 ? 229  MET C SD    1 
ATOM   5337  C  CE    . MET C 2  229  ? 471.124 -44.824 618.176 1.00 184.66 ? 229  MET C CE    1 
ATOM   5338  N  N     . ARG C 2  230  ? 475.271 -49.498 619.228 1.00 184.03 ? 230  ARG C N     1 
ATOM   5339  C  CA    . ARG C 2  230  ? 476.225 -50.036 620.192 1.00 183.67 ? 230  ARG C CA    1 
ATOM   5340  C  C     . ARG C 2  230  ? 476.603 -48.971 621.233 1.00 179.88 ? 230  ARG C C     1 
ATOM   5341  O  O     . ARG C 2  230  ? 476.334 -47.781 621.040 1.00 177.85 ? 230  ARG C O     1 
ATOM   5342  C  CB    . ARG C 2  230  ? 477.468 -50.569 619.470 1.00 181.56 ? 230  ARG C CB    1 
ATOM   5343  C  CG    . ARG C 2  230  ? 477.954 -49.759 618.273 1.00 184.58 ? 230  ARG C CG    1 
ATOM   5344  C  CD    . ARG C 2  230  ? 479.313 -50.284 617.808 1.00 186.32 ? 230  ARG C CD    1 
ATOM   5345  N  NE    . ARG C 2  230  ? 479.482 -50.292 616.355 1.00 184.45 ? 230  ARG C NE    1 
ATOM   5346  C  CZ    . ARG C 2  230  ? 479.864 -49.238 615.640 1.00 183.68 ? 230  ARG C CZ    1 
ATOM   5347  N  NH1   . ARG C 2  230  ? 479.993 -49.335 614.323 1.00 183.44 ? 230  ARG C NH1   1 
ATOM   5348  N  NH2   . ARG C 2  230  ? 480.121 -48.086 616.242 1.00 182.29 ? 230  ARG C NH2   1 
ATOM   5349  N  N     . PRO C 2  231  ? 477.193 -49.383 622.370 1.00 175.62 ? 231  PRO C N     1 
ATOM   5350  C  CA    . PRO C 2  231  ? 477.505 -48.411 623.438 1.00 171.33 ? 231  PRO C CA    1 
ATOM   5351  C  C     . PRO C 2  231  ? 478.260 -47.166 623.005 1.00 170.84 ? 231  PRO C C     1 
ATOM   5352  O  O     . PRO C 2  231  ? 478.166 -46.131 623.675 1.00 164.39 ? 231  PRO C O     1 
ATOM   5353  C  CB    . PRO C 2  231  ? 478.371 -49.243 624.393 1.00 167.35 ? 231  PRO C CB    1 
ATOM   5354  C  CG    . PRO C 2  231  ? 477.839 -50.614 624.260 1.00 171.19 ? 231  PRO C CG    1 
ATOM   5355  C  CD    . PRO C 2  231  ? 477.434 -50.770 622.815 1.00 174.78 ? 231  PRO C CD    1 
ATOM   5356  N  N     . GLU C 2  232  ? 479.033 -47.233 621.928 1.00 174.13 ? 232  GLU C N     1 
ATOM   5357  C  CA    . GLU C 2  232  ? 479.779 -46.058 621.492 1.00 172.02 ? 232  GLU C CA    1 
ATOM   5358  C  C     . GLU C 2  232  ? 478.862 -45.032 620.828 1.00 171.32 ? 232  GLU C C     1 
ATOM   5359  O  O     . GLU C 2  232  ? 478.944 -43.832 621.114 1.00 168.13 ? 232  GLU C O     1 
ATOM   5360  C  CB    . GLU C 2  232  ? 480.934 -46.451 620.579 1.00 174.36 ? 232  GLU C CB    1 
ATOM   5361  C  CG    . GLU C 2  232  ? 481.779 -45.247 620.192 1.00 177.27 ? 232  GLU C CG    1 
ATOM   5362  C  CD    . GLU C 2  232  ? 482.920 -45.593 619.255 1.00 182.70 ? 232  GLU C CD    1 
ATOM   5363  O  OE1   . GLU C 2  232  ? 483.055 -46.781 618.878 1.00 185.64 ? 232  GLU C OE1   1 
ATOM   5364  O  OE2   . GLU C 2  232  ? 483.704 -44.675 618.929 1.00 178.90 ? 232  GLU C OE2   1 
ATOM   5365  N  N     . GLU C 2  233  ? 477.992 -45.494 619.920 1.00 174.11 ? 233  GLU C N     1 
ATOM   5366  C  CA    . GLU C 2  233  ? 477.054 -44.609 619.228 1.00 174.31 ? 233  GLU C CA    1 
ATOM   5367  C  C     . GLU C 2  233  ? 476.089 -43.922 620.181 1.00 170.23 ? 233  GLU C C     1 
ATOM   5368  O  O     . GLU C 2  233  ? 475.703 -42.772 619.945 1.00 167.58 ? 233  GLU C O     1 
ATOM   5369  C  CB    . GLU C 2  233  ? 476.238 -45.397 618.198 1.00 179.95 ? 233  GLU C CB    1 
ATOM   5370  C  CG    . GLU C 2  233  ? 477.014 -46.404 617.362 1.00 181.96 ? 233  GLU C CG    1 
ATOM   5371  C  CD    . GLU C 2  233  ? 476.222 -46.908 616.162 1.00 185.28 ? 233  GLU C CD    1 
ATOM   5372  O  OE1   . GLU C 2  233  ? 474.993 -46.678 616.102 1.00 184.40 ? 233  GLU C OE1   1 
ATOM   5373  O  OE2   . GLU C 2  233  ? 476.830 -47.556 615.285 1.00 187.82 ? 233  GLU C OE2   1 
ATOM   5374  N  N     . ALA C 2  234  ? 475.681 -44.604 621.249 1.00 172.95 ? 234  ALA C N     1 
ATOM   5375  C  CA    . ALA C 2  234  ? 474.754 -44.005 622.205 1.00 171.43 ? 234  ALA C CA    1 
ATOM   5376  C  C     . ALA C 2  234  ? 475.424 -42.883 622.987 1.00 167.44 ? 234  ALA C C     1 
ATOM   5377  O  O     . ALA C 2  234  ? 474.763 -41.913 623.379 1.00 163.19 ? 234  ALA C O     1 
ATOM   5378  C  CB    . ALA C 2  234  ? 474.201 -45.074 623.148 1.00 169.75 ? 234  ALA C CB    1 
ATOM   5379  N  N     . LEU C 2  235  ? 476.740 -42.992 623.188 1.00 165.65 ? 235  LEU C N     1 
ATOM   5380  C  CA    . LEU C 2  235  ? 477.502 -41.983 623.915 1.00 161.40 ? 235  LEU C CA    1 
ATOM   5381  C  C     . LEU C 2  235  ? 477.581 -40.680 623.132 1.00 160.63 ? 235  LEU C C     1 
ATOM   5382  O  O     . LEU C 2  235  ? 477.418 -39.594 623.703 1.00 155.43 ? 235  LEU C O     1 
ATOM   5383  C  CB    . LEU C 2  235  ? 478.893 -42.563 624.201 1.00 152.69 ? 235  LEU C CB    1 
ATOM   5384  C  CG    . LEU C 2  235  ? 480.128 -41.876 624.775 1.00 142.99 ? 235  LEU C CG    1 
ATOM   5385  C  CD1   . LEU C 2  235  ? 479.864 -41.237 626.096 1.00 144.55 ? 235  LEU C CD1   1 
ATOM   5386  C  CD2   . LEU C 2  235  ? 481.164 -42.963 624.961 1.00 141.22 ? 235  LEU C CD2   1 
ATOM   5387  N  N     . ILE C 2  236  ? 477.818 -40.768 621.825 1.00 166.00 ? 236  ILE C N     1 
ATOM   5388  C  CA    . ILE C 2  236  ? 477.835 -39.577 620.977 1.00 169.12 ? 236  ILE C CA    1 
ATOM   5389  C  C     . ILE C 2  236  ? 476.450 -38.925 620.963 1.00 165.99 ? 236  ILE C C     1 
ATOM   5390  O  O     . ILE C 2  236  ? 476.317 -37.694 620.981 1.00 163.38 ? 236  ILE C O     1 
ATOM   5391  C  CB    . ILE C 2  236  ? 478.345 -39.935 619.562 1.00 166.24 ? 236  ILE C CB    1 
ATOM   5392  C  CG1   . ILE C 2  236  ? 479.840 -40.292 619.612 1.00 159.36 ? 236  ILE C CG1   1 
ATOM   5393  C  CG2   . ILE C 2  236  ? 478.160 -38.762 618.608 1.00 159.43 ? 236  ILE C CG2   1 
ATOM   5394  C  CD1   . ILE C 2  236  ? 480.443 -40.682 618.286 1.00 157.41 ? 236  ILE C CD1   1 
ATOM   5395  N  N     . ARG C 2  237  ? 475.401 -39.748 620.907 1.00 165.00 ? 237  ARG C N     1 
ATOM   5396  C  CA    . ARG C 2  237  ? 474.030 -39.247 620.886 1.00 167.24 ? 237  ARG C CA    1 
ATOM   5397  C  C     . ARG C 2  237  ? 473.700 -38.399 622.119 1.00 168.66 ? 237  ARG C C     1 
ATOM   5398  O  O     . ARG C 2  237  ? 473.148 -37.299 621.996 1.00 166.96 ? 237  ARG C O     1 
ATOM   5399  C  CB    . ARG C 2  237  ? 473.108 -40.472 620.804 1.00 172.25 ? 237  ARG C CB    1 
ATOM   5400  C  CG    . ARG C 2  237  ? 471.636 -40.340 621.212 1.00 175.90 ? 237  ARG C CG    1 
ATOM   5401  C  CD    . ARG C 2  237  ? 470.785 -41.310 620.367 1.00 179.45 ? 237  ARG C CD    1 
ATOM   5402  N  NE    . ARG C 2  237  ? 469.358 -41.313 620.698 1.00 184.15 ? 237  ARG C NE    1 
ATOM   5403  C  CZ    . ARG C 2  237  ? 468.443 -42.039 620.055 1.00 186.25 ? 237  ARG C CZ    1 
ATOM   5404  N  NH1   . ARG C 2  237  ? 467.168 -41.985 620.414 1.00 187.20 ? 237  ARG C NH1   1 
ATOM   5405  N  NH2   . ARG C 2  237  ? 468.803 -42.840 619.064 1.00 188.19 ? 237  ARG C NH2   1 
ATOM   5406  N  N     . LEU C 2  238  ? 474.022 -38.902 623.319 1.00 169.30 ? 238  LEU C N     1 
ATOM   5407  C  CA    . LEU C 2  238  ? 473.804 -38.158 624.569 1.00 166.85 ? 238  LEU C CA    1 
ATOM   5408  C  C     . LEU C 2  238  ? 474.601 -36.854 624.657 1.00 165.04 ? 238  LEU C C     1 
ATOM   5409  O  O     . LEU C 2  238  ? 474.083 -35.832 625.129 1.00 159.11 ? 238  LEU C O     1 
ATOM   5410  C  CB    . LEU C 2  238  ? 474.098 -39.040 625.787 1.00 165.71 ? 238  LEU C CB    1 
ATOM   5411  C  CG    . LEU C 2  238  ? 473.846 -38.344 627.138 1.00 156.47 ? 238  LEU C CG    1 
ATOM   5412  C  CD1   . LEU C 2  238  ? 472.418 -37.862 627.228 1.00 159.77 ? 238  LEU C CD1   1 
ATOM   5413  C  CD2   . LEU C 2  238  ? 474.153 -39.256 628.312 1.00 145.87 ? 238  LEU C CD2   1 
ATOM   5414  N  N     . PHE C 2  239  ? 475.870 -36.880 624.229 1.00 163.44 ? 239  PHE C N     1 
ATOM   5415  C  CA    . PHE C 2  239  ? 476.725 -35.697 624.303 1.00 159.90 ? 239  PHE C CA    1 
ATOM   5416  C  C     . PHE C 2  239  ? 476.131 -34.542 623.513 1.00 163.97 ? 239  PHE C C     1 
ATOM   5417  O  O     . PHE C 2  239  ? 476.254 -33.378 623.912 1.00 164.07 ? 239  PHE C O     1 
ATOM   5418  C  CB    . PHE C 2  239  ? 478.123 -36.051 623.786 1.00 160.40 ? 239  PHE C CB    1 
ATOM   5419  C  CG    . PHE C 2  239  ? 479.120 -34.922 623.855 1.00 161.61 ? 239  PHE C CG    1 
ATOM   5420  C  CD1   . PHE C 2  239  ? 479.978 -34.812 624.931 1.00 159.44 ? 239  PHE C CD1   1 
ATOM   5421  C  CD2   . PHE C 2  239  ? 479.194 -33.967 622.855 1.00 165.63 ? 239  PHE C CD2   1 
ATOM   5422  C  CE1   . PHE C 2  239  ? 480.900 -33.787 625.004 1.00 159.57 ? 239  PHE C CE1   1 
ATOM   5423  C  CE2   . PHE C 2  239  ? 480.108 -32.933 622.930 1.00 166.26 ? 239  PHE C CE2   1 
ATOM   5424  C  CZ    . PHE C 2  239  ? 480.962 -32.844 624.006 1.00 162.49 ? 239  PHE C CZ    1 
ATOM   5425  N  N     . THR C 2  240  ? 475.496 -34.845 622.382 1.00 166.26 ? 240  THR C N     1 
ATOM   5426  C  CA    . THR C 2  240  ? 474.855 -33.812 621.579 1.00 166.49 ? 240  THR C CA    1 
ATOM   5427  C  C     . THR C 2  240  ? 473.686 -33.177 622.332 1.00 164.12 ? 240  THR C C     1 
ATOM   5428  O  O     . THR C 2  240  ? 473.361 -32.004 622.105 1.00 158.85 ? 240  THR C O     1 
ATOM   5429  C  CB    . THR C 2  240  ? 474.397 -34.412 620.244 1.00 169.51 ? 240  THR C CB    1 
ATOM   5430  O  OG1   . THR C 2  240  ? 473.468 -35.477 620.488 1.00 172.15 ? 240  THR C OG1   1 
ATOM   5431  C  CG2   . THR C 2  240  ? 475.582 -34.969 619.462 1.00 161.14 ? 240  THR C CG2   1 
ATOM   5432  N  N     . LEU C 2  241  ? 473.073 -33.929 623.256 1.00 167.38 ? 241  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  241  ? 472.011 -33.382 624.099 1.00 167.86 ? 241  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  241  ? 472.556 -32.398 625.123 1.00 168.94 ? 241  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  241  ? 471.935 -31.362 625.390 1.00 171.61 ? 241  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  241  ? 471.296 -34.520 624.831 1.00 159.67 ? 241  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  241  ? 470.292 -35.380 624.083 1.00 161.86 ? 241  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  241  ? 469.643 -36.356 625.033 1.00 156.27 ? 241  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  241  ? 469.248 -34.473 623.469 1.00 163.04 ? 241  LEU C CD2   1 
ATOM   5440  N  N     . LEU C 2  242  ? 473.688 -32.729 625.743 1.00 166.09 ? 242  LEU C N     1 
ATOM   5441  C  CA    . LEU C 2  242  ? 474.237 -31.889 626.802 1.00 165.82 ? 242  LEU C CA    1 
ATOM   5442  C  C     . LEU C 2  242  ? 475.020 -30.684 626.300 1.00 166.39 ? 242  LEU C C     1 
ATOM   5443  O  O     . LEU C 2  242  ? 475.045 -29.656 626.986 1.00 165.73 ? 242  LEU C O     1 
ATOM   5444  C  CB    . LEU C 2  242  ? 475.086 -32.705 627.772 1.00 162.02 ? 242  LEU C CB    1 
ATOM   5445  C  CG    . LEU C 2  242  ? 474.293 -33.857 628.374 1.00 158.08 ? 242  LEU C CG    1 
ATOM   5446  C  CD1   . LEU C 2  242  ? 475.124 -34.601 629.396 1.00 146.83 ? 242  LEU C CD1   1 
ATOM   5447  C  CD2   . LEU C 2  242  ? 473.034 -33.287 629.007 1.00 156.15 ? 242  LEU C CD2   1 
ATOM   5448  N  N     . ARG C 2  243  ? 475.713 -30.768 625.167 1.00 168.32 ? 243  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  243  ? 476.498 -29.623 624.714 1.00 169.10 ? 243  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  243  ? 476.201 -29.246 623.269 1.00 167.88 ? 243  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  243  ? 476.992 -29.561 622.369 1.00 168.09 ? 243  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  243  ? 477.989 -29.911 624.865 1.00 167.49 ? 243  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  243  ? 478.406 -29.718 626.289 1.00 169.56 ? 243  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  243  ? 479.886 -29.694 626.513 1.00 168.86 ? 243  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  243  ? 480.272 -28.311 626.282 1.00 168.82 ? 243  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  243  ? 479.951 -27.346 627.145 1.00 172.40 ? 243  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  243  ? 479.259 -27.637 628.246 1.00 169.24 ? 243  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  243  ? 480.282 -26.090 626.911 1.00 166.99 ? 243  ARG C NH2   1 
ATOM   5459  N  N     . PRO C 2  244  ? 475.062 -28.603 622.998 1.00 165.91 ? 244  PRO C N     1 
ATOM   5460  C  CA    . PRO C 2  244  ? 474.762 -28.240 621.609 1.00 166.10 ? 244  PRO C CA    1 
ATOM   5461  C  C     . PRO C 2  244  ? 475.852 -27.334 621.045 1.00 166.27 ? 244  PRO C C     1 
ATOM   5462  O  O     . PRO C 2  244  ? 476.384 -26.464 621.738 1.00 162.26 ? 244  PRO C O     1 
ATOM   5463  C  CB    . PRO C 2  244  ? 473.416 -27.515 621.714 1.00 161.34 ? 244  PRO C CB    1 
ATOM   5464  C  CG    . PRO C 2  244  ? 472.817 -28.028 622.979 1.00 163.63 ? 244  PRO C CG    1 
ATOM   5465  C  CD    . PRO C 2  244  ? 473.969 -28.231 623.911 1.00 163.36 ? 244  PRO C CD    1 
ATOM   5466  N  N     . GLY C 2  245  ? 476.169 -27.539 619.765 1.00 170.20 ? 245  GLY C N     1 
ATOM   5467  C  CA    . GLY C 2  245  ? 477.154 -26.744 619.069 1.00 169.40 ? 245  GLY C CA    1 
ATOM   5468  C  C     . GLY C 2  245  ? 478.593 -27.197 619.228 1.00 169.29 ? 245  GLY C C     1 
ATOM   5469  O  O     . GLY C 2  245  ? 479.437 -26.818 618.408 1.00 172.29 ? 245  GLY C O     1 
ATOM   5470  N  N     . ASP C 2  246  ? 478.895 -28.014 620.239 1.00 169.63 ? 246  ASP C N     1 
ATOM   5471  C  CA    . ASP C 2  246  ? 480.234 -28.580 620.415 1.00 170.70 ? 246  ASP C CA    1 
ATOM   5472  C  C     . ASP C 2  246  ? 480.373 -29.853 619.587 1.00 169.82 ? 246  ASP C C     1 
ATOM   5473  O  O     . ASP C 2  246  ? 479.551 -30.770 619.736 1.00 165.35 ? 246  ASP C O     1 
ATOM   5474  C  CB    . ASP C 2  246  ? 480.526 -28.856 621.883 1.00 171.26 ? 246  ASP C CB    1 
ATOM   5475  C  CG    . ASP C 2  246  ? 481.992 -29.199 622.137 1.00 169.02 ? 246  ASP C CG    1 
ATOM   5476  O  OD1   . ASP C 2  246  ? 482.391 -30.364 621.933 1.00 171.87 ? 246  ASP C OD1   1 
ATOM   5477  O  OD2   . ASP C 2  246  ? 482.749 -28.294 622.552 1.00 163.05 ? 246  ASP C OD2   1 
ATOM   5478  N  N     . PRO C 2  247  ? 481.330 -29.921 618.663 1.00 176.20 ? 247  PRO C N     1 
ATOM   5479  C  CA    . PRO C 2  247  ? 481.484 -31.118 617.818 1.00 178.87 ? 247  PRO C CA    1 
ATOM   5480  C  C     . PRO C 2  247  ? 481.678 -32.381 618.638 1.00 174.37 ? 247  PRO C C     1 
ATOM   5481  O  O     . PRO C 2  247  ? 482.544 -32.444 619.525 1.00 171.33 ? 247  PRO C O     1 
ATOM   5482  C  CB    . PRO C 2  247  ? 482.745 -30.810 616.987 1.00 178.38 ? 247  PRO C CB    1 
ATOM   5483  C  CG    . PRO C 2  247  ? 483.434 -29.670 617.706 1.00 175.61 ? 247  PRO C CG    1 
ATOM   5484  C  CD    . PRO C 2  247  ? 482.328 -28.884 618.343 1.00 172.53 ? 247  PRO C CD    1 
ATOM   5485  N  N     . PRO C 2  248  ? 480.881 -33.413 618.363 1.00 172.13 ? 248  PRO C N     1 
ATOM   5486  C  CA    . PRO C 2  248  ? 480.841 -34.626 619.201 1.00 168.87 ? 248  PRO C CA    1 
ATOM   5487  C  C     . PRO C 2  248  ? 481.989 -35.579 618.868 1.00 170.75 ? 248  PRO C C     1 
ATOM   5488  O  O     . PRO C 2  248  ? 481.793 -36.763 618.575 1.00 172.15 ? 248  PRO C O     1 
ATOM   5489  C  CB    . PRO C 2  248  ? 479.459 -35.210 618.869 1.00 166.60 ? 248  PRO C CB    1 
ATOM   5490  C  CG    . PRO C 2  248  ? 478.745 -34.160 618.027 1.00 166.58 ? 248  PRO C CG    1 
ATOM   5491  C  CD    . PRO C 2  248  ? 479.812 -33.404 617.355 1.00 169.33 ? 248  PRO C CD    1 
ATOM   5492  N  N     . LYS C 2  249  ? 483.214 -35.063 618.943 1.00 169.42 ? 249  LYS C N     1 
ATOM   5493  C  CA    . LYS C 2  249  ? 484.400 -35.892 618.773 1.00 167.46 ? 249  LYS C CA    1 
ATOM   5494  C  C     . LYS C 2  249  ? 484.455 -36.991 619.823 1.00 166.00 ? 249  LYS C C     1 
ATOM   5495  O  O     . LYS C 2  249  ? 484.165 -36.756 620.997 1.00 164.42 ? 249  LYS C O     1 
ATOM   5496  C  CB    . LYS C 2  249  ? 485.658 -35.027 618.866 1.00 166.95 ? 249  LYS C CB    1 
ATOM   5497  C  CG    . LYS C 2  249  ? 486.875 -35.629 618.182 1.00 168.61 ? 249  LYS C CG    1 
ATOM   5498  C  CD    . LYS C 2  249  ? 488.001 -34.616 618.029 1.00 168.98 ? 249  LYS C CD    1 
ATOM   5499  C  CE    . LYS C 2  249  ? 489.238 -35.259 617.425 1.00 164.27 ? 249  LYS C CE    1 
ATOM   5500  N  NZ    . LYS C 2  249  ? 490.418 -34.363 617.503 1.00 159.59 ? 249  LYS C NZ    1 
ATOM   5501  N  N     . ARG C 2  250  ? 484.813 -38.208 619.385 1.00 167.05 ? 250  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  250  ? 484.728 -39.371 620.268 1.00 165.78 ? 250  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  250  ? 485.613 -39.228 621.504 1.00 168.01 ? 250  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  250  ? 485.209 -39.626 622.602 1.00 171.57 ? 250  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  250  ? 485.125 -40.640 619.520 1.00 166.82 ? 250  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  250  ? 484.899 -41.904 620.324 1.00 163.32 ? 250  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  250  ? 486.278 -42.441 620.654 1.00 160.05 ? 250  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  250  ? 486.298 -43.648 621.463 1.00 159.12 ? 250  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  250  ? 487.399 -44.103 622.051 1.00 160.78 ? 250  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  250  ? 488.538 -43.438 621.908 1.00 159.55 ? 250  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  250  ? 487.369 -45.213 622.774 1.00 158.34 ? 250  ARG C NH2   1 
ATOM   5512  N  N     . ASP C 2  251  ? 486.848 -38.739 621.349 1.00 168.88 ? 251  ASP C N     1 
ATOM   5513  C  CA    . ASP C 2  251  ? 487.662 -38.496 622.540 1.00 164.39 ? 251  ASP C CA    1 
ATOM   5514  C  C     . ASP C 2  251  ? 487.076 -37.355 623.379 1.00 164.62 ? 251  ASP C C     1 
ATOM   5515  O  O     . ASP C 2  251  ? 487.181 -37.371 624.611 1.00 167.90 ? 251  ASP C O     1 
ATOM   5516  C  CB    . ASP C 2  251  ? 489.148 -38.288 622.201 1.00 166.38 ? 251  ASP C CB    1 
ATOM   5517  C  CG    . ASP C 2  251  ? 489.386 -37.485 620.935 1.00 170.22 ? 251  ASP C CG    1 
ATOM   5518  O  OD1   . ASP C 2  251  ? 488.492 -36.735 620.504 1.00 174.03 ? 251  ASP C OD1   1 
ATOM   5519  O  OD2   . ASP C 2  251  ? 490.494 -37.609 620.369 1.00 166.02 ? 251  ASP C OD2   1 
ATOM   5520  N  N     . LYS C 2  252  ? 486.517 -36.321 622.729 1.00 162.17 ? 252  LYS C N     1 
ATOM   5521  C  CA    . LYS C 2  252  ? 485.856 -35.241 623.466 1.00 159.89 ? 252  LYS C CA    1 
ATOM   5522  C  C     . LYS C 2  252  ? 484.643 -35.709 624.273 1.00 162.61 ? 252  LYS C C     1 
ATOM   5523  O  O     . LYS C 2  252  ? 484.480 -35.306 625.429 1.00 164.15 ? 252  LYS C O     1 
ATOM   5524  C  CB    . LYS C 2  252  ? 485.433 -34.117 622.520 1.00 162.00 ? 252  LYS C CB    1 
ATOM   5525  C  CG    . LYS C 2  252  ? 486.434 -32.984 622.426 1.00 165.56 ? 252  LYS C CG    1 
ATOM   5526  C  CD    . LYS C 2  252  ? 485.728 -31.668 622.121 1.00 166.15 ? 252  LYS C CD    1 
ATOM   5527  C  CE    . LYS C 2  252  ? 486.666 -30.482 622.297 1.00 162.03 ? 252  LYS C CE    1 
ATOM   5528  N  NZ    . LYS C 2  252  ? 485.938 -29.184 622.341 1.00 156.79 ? 252  LYS C NZ    1 
ATOM   5529  N  N     . ALA C 2  253  ? 483.785 -36.565 623.703 1.00 163.32 ? 253  ALA C N     1 
ATOM   5530  C  CA    . ALA C 2  253  ? 482.612 -37.027 624.451 1.00 154.95 ? 253  ALA C CA    1 
ATOM   5531  C  C     . ALA C 2  253  ? 483.026 -37.852 625.657 1.00 153.81 ? 253  ALA C C     1 
ATOM   5532  O  O     . ALA C 2  253  ? 482.534 -37.631 626.767 1.00 159.21 ? 253  ALA C O     1 
ATOM   5533  C  CB    . ALA C 2  253  ? 481.664 -37.829 623.563 1.00 154.25 ? 253  ALA C CB    1 
ATOM   5534  N  N     . VAL C 2  254  ? 483.924 -38.817 625.454 1.00 151.84 ? 254  VAL C N     1 
ATOM   5535  C  CA    . VAL C 2  254  ? 484.453 -39.608 626.565 1.00 156.28 ? 254  VAL C CA    1 
ATOM   5536  C  C     . VAL C 2  254  ? 484.992 -38.694 627.662 1.00 159.27 ? 254  VAL C C     1 
ATOM   5537  O  O     . VAL C 2  254  ? 484.675 -38.866 628.847 1.00 159.16 ? 254  VAL C O     1 
ATOM   5538  C  CB    . VAL C 2  254  ? 485.516 -40.603 626.073 1.00 156.91 ? 254  VAL C CB    1 
ATOM   5539  C  CG1   . VAL C 2  254  ? 486.178 -41.302 627.265 1.00 155.36 ? 254  VAL C CG1   1 
ATOM   5540  C  CG2   . VAL C 2  254  ? 484.865 -41.625 625.156 1.00 153.98 ? 254  VAL C CG2   1 
ATOM   5541  N  N     . ALA C 2  255  ? 485.816 -37.711 627.280 1.00 155.73 ? 255  ALA C N     1 
ATOM   5542  C  CA    . ALA C 2  255  ? 486.404 -36.793 628.255 1.00 156.67 ? 255  ALA C CA    1 
ATOM   5543  C  C     . ALA C 2  255  ? 485.329 -36.117 629.114 1.00 154.60 ? 255  ALA C C     1 
ATOM   5544  O  O     . ALA C 2  255  ? 485.447 -36.072 630.344 1.00 151.09 ? 255  ALA C O     1 
ATOM   5545  C  CB    . ALA C 2  255  ? 487.260 -35.752 627.528 1.00 154.00 ? 255  ALA C CB    1 
ATOM   5546  N  N     . TYR C 2  256  ? 484.280 -35.570 628.488 1.00 152.35 ? 256  TYR C N     1 
ATOM   5547  C  CA    . TYR C 2  256  ? 483.230 -34.892 629.250 1.00 151.07 ? 256  TYR C CA    1 
ATOM   5548  C  C     . TYR C 2  256  ? 482.505 -35.851 630.189 1.00 154.31 ? 256  TYR C C     1 
ATOM   5549  O  O     . TYR C 2  256  ? 482.365 -35.578 631.389 1.00 154.71 ? 256  TYR C O     1 
ATOM   5550  C  CB    . TYR C 2  256  ? 482.219 -34.235 628.314 1.00 152.91 ? 256  TYR C CB    1 
ATOM   5551  C  CG    . TYR C 2  256  ? 481.104 -33.491 629.032 1.00 150.88 ? 256  TYR C CG    1 
ATOM   5552  C  CD1   . TYR C 2  256  ? 479.890 -34.114 629.281 1.00 142.81 ? 256  TYR C CD1   1 
ATOM   5553  C  CD2   . TYR C 2  256  ? 481.257 -32.171 629.446 1.00 153.11 ? 256  TYR C CD2   1 
ATOM   5554  C  CE1   . TYR C 2  256  ? 478.866 -33.451 629.921 1.00 148.86 ? 256  TYR C CE1   1 
ATOM   5555  C  CE2   . TYR C 2  256  ? 480.230 -31.495 630.087 1.00 151.35 ? 256  TYR C CE2   1 
ATOM   5556  C  CZ    . TYR C 2  256  ? 479.034 -32.142 630.322 1.00 153.35 ? 256  TYR C CZ    1 
ATOM   5557  O  OH    . TYR C 2  256  ? 477.994 -31.496 630.967 1.00 154.34 ? 256  TYR C OH    1 
ATOM   5558  N  N     . VAL C 2  257  ? 482.018 -36.974 629.654 1.00 152.27 ? 257  VAL C N     1 
ATOM   5559  C  CA    . VAL C 2  257  ? 481.286 -37.937 630.475 1.00 150.66 ? 257  VAL C CA    1 
ATOM   5560  C  C     . VAL C 2  257  ? 482.172 -38.544 631.564 1.00 148.37 ? 257  VAL C C     1 
ATOM   5561  O  O     . VAL C 2  257  ? 481.744 -38.666 632.717 1.00 144.84 ? 257  VAL C O     1 
ATOM   5562  C  CB    . VAL C 2  257  ? 480.635 -39.010 629.585 1.00 141.18 ? 257  VAL C CB    1 
ATOM   5563  C  CG1   . VAL C 2  257  ? 480.334 -40.244 630.386 1.00 137.86 ? 257  VAL C CG1   1 
ATOM   5564  C  CG2   . VAL C 2  257  ? 479.351 -38.459 629.017 1.00 131.95 ? 257  VAL C CG2   1 
ATOM   5565  N  N     . TYR C 2  258  ? 483.419 -38.904 631.240 1.00 147.44 ? 258  TYR C N     1 
ATOM   5566  C  CA    . TYR C 2  258  ? 484.327 -39.401 632.278 1.00 146.07 ? 258  TYR C CA    1 
ATOM   5567  C  C     . TYR C 2  258  ? 484.533 -38.388 633.394 1.00 144.91 ? 258  TYR C C     1 
ATOM   5568  O  O     . TYR C 2  258  ? 484.415 -38.723 634.579 1.00 145.71 ? 258  TYR C O     1 
ATOM   5569  C  CB    . TYR C 2  258  ? 485.689 -39.748 631.692 1.00 144.99 ? 258  TYR C CB    1 
ATOM   5570  C  CG    . TYR C 2  258  ? 486.718 -40.213 632.720 1.00 138.27 ? 258  TYR C CG    1 
ATOM   5571  C  CD1   . TYR C 2  258  ? 487.756 -39.378 633.128 1.00 133.67 ? 258  TYR C CD1   1 
ATOM   5572  C  CD2   . TYR C 2  258  ? 486.699 -41.512 633.215 1.00 138.66 ? 258  TYR C CD2   1 
ATOM   5573  C  CE1   . TYR C 2  258  ? 488.716 -39.810 634.034 1.00 130.64 ? 258  TYR C CE1   1 
ATOM   5574  C  CE2   . TYR C 2  258  ? 487.659 -41.953 634.115 1.00 138.12 ? 258  TYR C CE2   1 
ATOM   5575  C  CZ    . TYR C 2  258  ? 488.664 -41.098 634.523 1.00 133.73 ? 258  TYR C CZ    1 
ATOM   5576  O  OH    . TYR C 2  258  ? 489.614 -41.539 635.418 1.00 131.22 ? 258  TYR C OH    1 
ATOM   5577  N  N     . GLY C 2  259  ? 484.851 -37.142 633.038 1.00 146.14 ? 259  GLY C N     1 
ATOM   5578  C  CA    . GLY C 2  259  ? 485.109 -36.146 634.065 1.00 149.13 ? 259  GLY C CA    1 
ATOM   5579  C  C     . GLY C 2  259  ? 483.903 -35.851 634.925 1.00 146.43 ? 259  GLY C C     1 
ATOM   5580  O  O     . GLY C 2  259  ? 484.039 -35.591 636.123 1.00 143.02 ? 259  GLY C O     1 
ATOM   5581  N  N     . LEU C 2  260  ? 482.709 -35.942 634.345 1.00 146.24 ? 260  LEU C N     1 
ATOM   5582  C  CA    . LEU C 2  260  ? 481.484 -35.664 635.081 1.00 146.72 ? 260  LEU C CA    1 
ATOM   5583  C  C     . LEU C 2  260  ? 481.011 -36.827 635.949 1.00 141.23 ? 260  LEU C C     1 
ATOM   5584  O  O     . LEU C 2  260  ? 480.348 -36.588 636.964 1.00 142.58 ? 260  LEU C O     1 
ATOM   5585  C  CB    . LEU C 2  260  ? 480.383 -35.201 634.130 1.00 146.54 ? 260  LEU C CB    1 
ATOM   5586  C  CG    . LEU C 2  260  ? 480.457 -33.666 634.038 1.00 154.55 ? 260  LEU C CG    1 
ATOM   5587  C  CD1   . LEU C 2  260  ? 481.696 -33.115 633.262 1.00 146.07 ? 260  LEU C CD1   1 
ATOM   5588  C  CD2   . LEU C 2  260  ? 479.128 -33.069 633.549 1.00 153.26 ? 260  LEU C CD2   1 
ATOM   5589  N  N     . ILE C 2  261  ? 481.292 -38.077 635.577 1.00 138.63 ? 261  ILE C N     1 
ATOM   5590  C  CA    . ILE C 2  261  ? 480.634 -39.196 636.246 1.00 131.95 ? 261  ILE C CA    1 
ATOM   5591  C  C     . ILE C 2  261  ? 481.678 -40.110 636.878 1.00 134.95 ? 261  ILE C C     1 
ATOM   5592  O  O     . ILE C 2  261  ? 481.602 -40.416 638.070 1.00 136.40 ? 261  ILE C O     1 
ATOM   5593  C  CB    . ILE C 2  261  ? 479.742 -39.982 635.267 1.00 128.29 ? 261  ILE C CB    1 
ATOM   5594  C  CG1   . ILE C 2  261  ? 478.296 -39.591 635.463 1.00 125.43 ? 261  ILE C CG1   1 
ATOM   5595  C  CG2   . ILE C 2  261  ? 479.787 -41.480 635.536 1.00 126.85 ? 261  ILE C CG2   1 
ATOM   5596  C  CD1   . ILE C 2  261  ? 478.050 -38.133 635.163 1.00 129.41 ? 261  ILE C CD1   1 
ATOM   5597  N  N     . ALA C 2  262  ? 482.614 -40.616 636.081 1.00 141.86 ? 262  ALA C N     1 
ATOM   5598  C  CA    . ALA C 2  262  ? 483.540 -41.635 636.557 1.00 144.07 ? 262  ALA C CA    1 
ATOM   5599  C  C     . ALA C 2  262  ? 484.877 -41.127 637.091 1.00 140.57 ? 262  ALA C C     1 
ATOM   5600  O  O     . ALA C 2  262  ? 485.583 -41.913 637.733 1.00 136.84 ? 262  ALA C O     1 
ATOM   5601  C  CB    . ALA C 2  262  ? 483.828 -42.627 635.420 1.00 141.92 ? 262  ALA C CB    1 
ATOM   5602  N  N     . ASP C 2  263  ? 485.225 -39.839 636.914 1.00 137.82 ? 263  ASP C N     1 
ATOM   5603  C  CA    . ASP C 2  263  ? 486.581 -39.428 637.293 1.00 139.10 ? 263  ASP C CA    1 
ATOM   5604  C  C     . ASP C 2  263  ? 486.822 -39.244 638.789 1.00 137.79 ? 263  ASP C C     1 
ATOM   5605  O  O     . ASP C 2  263  ? 486.337 -38.267 639.376 1.00 138.00 ? 263  ASP C O     1 
ATOM   5606  C  CB    . ASP C 2  263  ? 486.920 -38.109 636.576 1.00 141.83 ? 263  ASP C CB    1 
ATOM   5607  C  CG    . ASP C 2  263  ? 488.429 -37.787 636.568 1.00 142.17 ? 263  ASP C CG    1 
ATOM   5608  O  OD1   . ASP C 2  263  ? 489.212 -38.438 637.293 1.00 141.04 ? 263  ASP C OD1   1 
ATOM   5609  O  OD2   . ASP C 2  263  ? 488.833 -36.862 635.826 1.00 141.68 ? 263  ASP C OD2   1 
ATOM   5610  N  N     . PRO C 2  264  ? 487.639 -40.112 639.431 1.00 136.49 ? 264  PRO C N     1 
ATOM   5611  C  CA    . PRO C 2  264  ? 487.918 -39.931 640.861 1.00 135.68 ? 264  PRO C CA    1 
ATOM   5612  C  C     . PRO C 2  264  ? 488.803 -38.725 641.134 1.00 134.68 ? 264  PRO C C     1 
ATOM   5613  O  O     . PRO C 2  264  ? 489.721 -38.800 641.952 1.00 143.10 ? 264  PRO C O     1 
ATOM   5614  C  CB    . PRO C 2  264  ? 488.593 -41.248 641.265 1.00 137.80 ? 264  PRO C CB    1 
ATOM   5615  C  CG    . PRO C 2  264  ? 489.190 -41.750 640.020 1.00 140.80 ? 264  PRO C CG    1 
ATOM   5616  C  CD    . PRO C 2  264  ? 488.248 -41.350 638.919 1.00 139.44 ? 264  PRO C CD    1 
ATOM   5617  N  N     . ARG C 2  265  ? 488.571 -37.627 640.427 1.00 131.12 ? 265  ARG C N     1 
ATOM   5618  C  CA    . ARG C 2  265  ? 489.278 -36.375 640.667 1.00 135.71 ? 265  ARG C CA    1 
ATOM   5619  C  C     . ARG C 2  265  ? 488.263 -35.251 640.559 1.00 136.15 ? 265  ARG C C     1 
ATOM   5620  O  O     . ARG C 2  265  ? 488.331 -34.271 641.307 1.00 138.75 ? 265  ARG C O     1 
ATOM   5621  C  CB    . ARG C 2  265  ? 490.475 -36.161 639.739 1.00 136.31 ? 265  ARG C CB    1 
ATOM   5622  C  CG    . ARG C 2  265  ? 491.758 -36.855 640.205 1.00 132.32 ? 265  ARG C CG    1 
ATOM   5623  C  CD    . ARG C 2  265  ? 492.985 -36.234 639.524 1.00 134.08 ? 265  ARG C CD    1 
ATOM   5624  N  NE    . ARG C 2  265  ? 494.110 -37.162 639.362 1.00 133.53 ? 265  ARG C NE    1 
ATOM   5625  C  CZ    . ARG C 2  265  ? 495.323 -36.820 638.919 1.00 130.29 ? 265  ARG C CZ    1 
ATOM   5626  N  NH1   . ARG C 2  265  ? 495.607 -35.563 638.583 1.00 124.95 ? 265  ARG C NH1   1 
ATOM   5627  N  NH2   . ARG C 2  265  ? 496.262 -37.747 638.814 1.00 133.73 ? 265  ARG C NH2   1 
ATOM   5628  N  N     . ARG C 2  266  ? 487.384 -35.340 639.565 1.00 132.89 ? 266  ARG C N     1 
ATOM   5629  C  CA    . ARG C 2  266  ? 486.347 -34.341 639.364 1.00 136.57 ? 266  ARG C CA    1 
ATOM   5630  C  C     . ARG C 2  266  ? 485.022 -34.703 640.039 1.00 132.75 ? 266  ARG C C     1 
ATOM   5631  O  O     . ARG C 2  266  ? 484.165 -33.821 640.180 1.00 128.85 ? 266  ARG C O     1 
ATOM   5632  C  CB    . ARG C 2  266  ? 486.128 -34.107 637.864 1.00 141.35 ? 266  ARG C CB    1 
ATOM   5633  N  N     . TYR C 2  267  ? 484.833 -35.963 640.458 1.00 131.28 ? 267  TYR C N     1 
ATOM   5634  C  CA    . TYR C 2  267  ? 483.609 -36.422 641.122 1.00 129.24 ? 267  TYR C CA    1 
ATOM   5635  C  C     . TYR C 2  267  ? 483.941 -37.164 642.407 1.00 129.94 ? 267  TYR C C     1 
ATOM   5636  O  O     . TYR C 2  267  ? 484.554 -38.239 642.369 1.00 126.99 ? 267  TYR C O     1 
ATOM   5637  C  CB    . TYR C 2  267  ? 482.761 -37.329 640.231 1.00 127.18 ? 267  TYR C CB    1 
ATOM   5638  C  CG    . TYR C 2  267  ? 481.370 -37.556 640.792 1.00 126.35 ? 267  TYR C CG    1 
ATOM   5639  C  CD1   . TYR C 2  267  ? 481.097 -38.626 641.650 1.00 123.77 ? 267  TYR C CD1   1 
ATOM   5640  C  CD2   . TYR C 2  267  ? 480.333 -36.698 640.463 1.00 124.81 ? 267  TYR C CD2   1 
ATOM   5641  C  CE1   . TYR C 2  267  ? 479.834 -38.821 642.158 1.00 120.58 ? 267  TYR C CE1   1 
ATOM   5642  C  CE2   . TYR C 2  267  ? 479.068 -36.888 640.961 1.00 126.80 ? 267  TYR C CE2   1 
ATOM   5643  C  CZ    . TYR C 2  267  ? 478.816 -37.947 641.805 1.00 123.63 ? 267  TYR C CZ    1 
ATOM   5644  O  OH    . TYR C 2  267  ? 477.532 -38.100 642.285 1.00 123.78 ? 267  TYR C OH    1 
ATOM   5645  N  N     . ASP C 2  268  ? 483.516 -36.609 643.543 1.00 128.06 ? 268  ASP C N     1 
ATOM   5646  C  CA    . ASP C 2  268  ? 483.773 -37.237 644.831 1.00 121.58 ? 268  ASP C CA    1 
ATOM   5647  C  C     . ASP C 2  268  ? 482.492 -37.396 645.640 1.00 124.00 ? 268  ASP C C     1 
ATOM   5648  O  O     . ASP C 2  268  ? 481.896 -36.408 646.085 1.00 121.00 ? 268  ASP C O     1 
ATOM   5649  C  CB    . ASP C 2  268  ? 484.767 -36.409 645.634 1.00 119.63 ? 268  ASP C CB    1 
ATOM   5650  C  CG    . ASP C 2  268  ? 485.598 -37.243 646.559 1.00 118.97 ? 268  ASP C CG    1 
ATOM   5651  O  OD1   . ASP C 2  268  ? 485.267 -38.432 646.776 1.00 113.96 ? 268  ASP C OD1   1 
ATOM   5652  O  OD2   . ASP C 2  268  ? 486.571 -36.677 647.096 1.00 120.17 ? 268  ASP C OD2   1 
ATOM   5653  N  N     . LEU C 2  269  ? 482.056 -38.640 645.797 1.00 130.27 ? 269  LEU C N     1 
ATOM   5654  C  CA    . LEU C 2  269  ? 481.094 -38.981 646.825 1.00 116.13 ? 269  LEU C CA    1 
ATOM   5655  C  C     . LEU C 2  269  ? 481.895 -38.949 648.118 1.00 118.20 ? 269  LEU C C     1 
ATOM   5656  O  O     . LEU C 2  269  ? 483.118 -39.054 648.099 1.00 126.52 ? 269  LEU C O     1 
ATOM   5657  C  CB    . LEU C 2  269  ? 480.528 -40.367 646.549 1.00 108.86 ? 269  LEU C CB    1 
ATOM   5658  C  CG    . LEU C 2  269  ? 479.057 -40.639 646.590 1.00 105.36 ? 269  LEU C CG    1 
ATOM   5659  C  CD1   . LEU C 2  269  ? 478.426 -39.585 645.734 1.00 110.51 ? 269  LEU C CD1   1 
ATOM   5660  C  CD2   . LEU C 2  269  ? 478.859 -41.960 645.945 1.00 101.52 ? 269  LEU C CD2   1 
ATOM   5661  N  N     . GLY C 2  270  ? 481.257 -38.819 649.236 1.00 119.50 ? 270  GLY C N     1 
ATOM   5662  C  CA    . GLY C 2  270  ? 482.052 -38.869 650.447 1.00 127.73 ? 270  GLY C CA    1 
ATOM   5663  C  C     . GLY C 2  270  ? 482.622 -40.248 650.766 1.00 124.79 ? 270  GLY C C     1 
ATOM   5664  O  O     . GLY C 2  270  ? 482.320 -41.259 650.129 1.00 124.47 ? 270  GLY C O     1 
ATOM   5665  N  N     . GLU C 2  271  ? 483.496 -40.268 651.778 1.00 122.04 ? 271  GLU C N     1 
ATOM   5666  C  CA    . GLU C 2  271  ? 483.740 -41.527 652.470 1.00 126.92 ? 271  GLU C CA    1 
ATOM   5667  C  C     . GLU C 2  271  ? 482.474 -41.913 653.218 1.00 132.78 ? 271  GLU C C     1 
ATOM   5668  O  O     . GLU C 2  271  ? 482.129 -43.099 653.326 1.00 129.18 ? 271  GLU C O     1 
ATOM   5669  C  CB    . GLU C 2  271  ? 484.929 -41.404 653.416 1.00 132.29 ? 271  GLU C CB    1 
ATOM   5670  C  CG    . GLU C 2  271  ? 485.394 -42.731 654.009 1.00 136.71 ? 271  GLU C CG    1 
ATOM   5671  C  CD    . GLU C 2  271  ? 485.991 -43.671 652.996 1.00 143.65 ? 271  GLU C CD    1 
ATOM   5672  O  OE1   . GLU C 2  271  ? 486.635 -43.190 652.039 1.00 145.89 ? 271  GLU C OE1   1 
ATOM   5673  O  OE2   . GLU C 2  271  ? 485.825 -44.900 653.170 1.00 149.27 ? 271  GLU C OE2   1 
ATOM   5674  N  N     . ALA C 2  272  ? 481.782 -40.906 653.755 1.00 127.37 ? 272  ALA C N     1 
ATOM   5675  C  CA    . ALA C 2  272  ? 480.473 -41.141 654.336 1.00 125.95 ? 272  ALA C CA    1 
ATOM   5676  C  C     . ALA C 2  272  ? 479.473 -41.427 653.229 1.00 126.83 ? 272  ALA C C     1 
ATOM   5677  O  O     . ALA C 2  272  ? 478.589 -42.277 653.385 1.00 127.73 ? 272  ALA C O     1 
ATOM   5678  C  CB    . ALA C 2  272  ? 480.036 -39.932 655.157 1.00 135.98 ? 272  ALA C CB    1 
ATOM   5679  N  N     . GLY C 2  273  ? 479.643 -40.758 652.082 1.00 128.00 ? 273  GLY C N     1 
ATOM   5680  C  CA    . GLY C 2  273  ? 478.807 -41.039 650.923 1.00 125.46 ? 273  GLY C CA    1 
ATOM   5681  C  C     . GLY C 2  273  ? 478.933 -42.491 650.495 1.00 130.37 ? 273  GLY C C     1 
ATOM   5682  O  O     . GLY C 2  273  ? 477.932 -43.158 650.220 1.00 131.81 ? 273  GLY C O     1 
ATOM   5683  N  N     . ARG C 2  274  ? 480.171 -42.985 650.377 1.00 131.34 ? 274  ARG C N     1 
ATOM   5684  C  CA    . ARG C 2  274  ? 480.367 -44.399 650.072 1.00 132.71 ? 274  ARG C CA    1 
ATOM   5685  C  C     . ARG C 2  274  ? 479.655 -45.293 651.078 1.00 138.04 ? 274  ARG C C     1 
ATOM   5686  O  O     . ARG C 2  274  ? 478.852 -46.150 650.687 1.00 138.51 ? 274  ARG C O     1 
ATOM   5687  C  CB    . ARG C 2  274  ? 481.861 -44.725 650.089 1.00 137.49 ? 274  ARG C CB    1 
ATOM   5688  C  CG    . ARG C 2  274  ? 482.191 -46.214 650.003 1.00 141.85 ? 274  ARG C CG    1 
ATOM   5689  C  CD    . ARG C 2  274  ? 483.565 -46.420 650.671 1.00 151.41 ? 274  ARG C CD    1 
ATOM   5690  N  NE    . ARG C 2  274  ? 484.230 -47.693 650.395 1.00 162.14 ? 274  ARG C NE    1 
ATOM   5691  C  CZ    . ARG C 2  274  ? 484.266 -48.715 651.254 1.00 164.63 ? 274  ARG C CZ    1 
ATOM   5692  N  NH1   . ARG C 2  274  ? 483.682 -48.614 652.443 1.00 158.30 ? 274  ARG C NH1   1 
ATOM   5693  N  NH2   . ARG C 2  274  ? 484.890 -49.842 650.930 1.00 168.23 ? 274  ARG C NH2   1 
ATOM   5694  N  N     . TYR C 2  275  ? 479.868 -45.058 652.386 1.00 137.12 ? 275  TYR C N     1 
ATOM   5695  C  CA    . TYR C 2  275  ? 479.196 -45.894 653.380 1.00 135.72 ? 275  TYR C CA    1 
ATOM   5696  C  C     . TYR C 2  275  ? 477.690 -45.759 653.291 1.00 135.60 ? 275  TYR C C     1 
ATOM   5697  O  O     . TYR C 2  275  ? 476.969 -46.761 653.342 1.00 138.99 ? 275  TYR C O     1 
ATOM   5698  C  CB    . TYR C 2  275  ? 479.657 -45.565 654.806 1.00 139.36 ? 275  TYR C CB    1 
ATOM   5699  C  CG    . TYR C 2  275  ? 478.900 -46.339 655.908 1.00 148.67 ? 275  TYR C CG    1 
ATOM   5700  C  CD1   . TYR C 2  275  ? 479.191 -47.673 656.208 1.00 151.66 ? 275  TYR C CD1   1 
ATOM   5701  C  CD2   . TYR C 2  275  ? 477.877 -45.720 656.642 1.00 148.15 ? 275  TYR C CD2   1 
ATOM   5702  C  CE1   . TYR C 2  275  ? 478.485 -48.365 657.212 1.00 148.15 ? 275  TYR C CE1   1 
ATOM   5703  C  CE2   . TYR C 2  275  ? 477.175 -46.401 657.637 1.00 151.24 ? 275  TYR C CE2   1 
ATOM   5704  C  CZ    . TYR C 2  275  ? 477.485 -47.719 657.918 1.00 152.70 ? 275  TYR C CZ    1 
ATOM   5705  O  OH    . TYR C 2  275  ? 476.788 -48.389 658.904 1.00 159.77 ? 275  TYR C OH    1 
ATOM   5706  N  N     . LYS C 2  276  ? 477.190 -44.535 653.151 1.00 132.78 ? 276  LYS C N     1 
ATOM   5707  C  CA    . LYS C 2  276  ? 475.745 -44.391 653.094 1.00 134.63 ? 276  LYS C CA    1 
ATOM   5708  C  C     . LYS C 2  276  ? 475.158 -45.044 651.851 1.00 137.15 ? 276  LYS C C     1 
ATOM   5709  O  O     . LYS C 2  276  ? 474.109 -45.697 651.929 1.00 136.75 ? 276  LYS C O     1 
ATOM   5710  C  CB    . LYS C 2  276  ? 475.380 -42.913 653.157 1.00 130.75 ? 276  LYS C CB    1 
ATOM   5711  C  CG    . LYS C 2  276  ? 475.552 -42.295 654.535 1.00 130.31 ? 276  LYS C CG    1 
ATOM   5712  C  CD    . LYS C 2  276  ? 474.450 -42.773 655.431 1.00 127.22 ? 276  LYS C CD    1 
ATOM   5713  C  CE    . LYS C 2  276  ? 473.153 -42.312 654.819 1.00 121.07 ? 276  LYS C CE    1 
ATOM   5714  N  NZ    . LYS C 2  276  ? 473.252 -40.862 654.527 1.00 116.21 ? 276  LYS C NZ    1 
ATOM   5715  N  N     . ALA C 2  277  ? 475.839 -44.909 650.706 1.00 136.45 ? 277  ALA C N     1 
ATOM   5716  C  CA    . ALA C 2  277  ? 475.397 -45.569 649.480 1.00 132.39 ? 277  ALA C CA    1 
ATOM   5717  C  C     . ALA C 2  277  ? 475.480 -47.086 649.591 1.00 132.60 ? 277  ALA C C     1 
ATOM   5718  O  O     . ALA C 2  277  ? 474.557 -47.800 649.185 1.00 132.13 ? 277  ALA C O     1 
ATOM   5719  C  CB    . ALA C 2  277  ? 476.216 -45.066 648.302 1.00 133.37 ? 277  ALA C CB    1 
ATOM   5720  N  N     . GLU C 2  278  ? 476.639 -47.596 650.019 1.00 132.87 ? 278  GLU C N     1 
ATOM   5721  C  CA    . GLU C 2  278  ? 476.806 -49.035 650.210 1.00 139.28 ? 278  GLU C CA    1 
ATOM   5722  C  C     . GLU C 2  278  ? 475.773 -49.618 651.173 1.00 144.37 ? 278  GLU C C     1 
ATOM   5723  O  O     . GLU C 2  278  ? 475.221 -50.700 650.933 1.00 145.10 ? 278  GLU C O     1 
ATOM   5724  C  CB    . GLU C 2  278  ? 478.210 -49.324 650.742 1.00 140.53 ? 278  GLU C CB    1 
ATOM   5725  C  CG    . GLU C 2  278  ? 479.330 -49.124 649.749 1.00 143.06 ? 278  GLU C CG    1 
ATOM   5726  C  CD    . GLU C 2  278  ? 480.688 -49.355 650.375 1.00 146.73 ? 278  GLU C CD    1 
ATOM   5727  O  OE1   . GLU C 2  278  ? 480.758 -49.539 651.607 1.00 151.56 ? 278  GLU C OE1   1 
ATOM   5728  O  OE2   . GLU C 2  278  ? 481.688 -49.331 649.643 1.00 148.06 ? 278  GLU C OE2   1 
ATOM   5729  N  N     . GLU C 2  279  ? 475.476 -48.891 652.254 1.00 144.04 ? 279  GLU C N     1 
ATOM   5730  C  CA    . GLU C 2  279  ? 474.580 -49.384 653.294 1.00 141.10 ? 279  GLU C CA    1 
ATOM   5731  C  C     . GLU C 2  279  ? 473.128 -49.313 652.840 1.00 138.62 ? 279  GLU C C     1 
ATOM   5732  O  O     . GLU C 2  279  ? 472.351 -50.244 653.081 1.00 138.51 ? 279  GLU C O     1 
ATOM   5733  C  CB    . GLU C 2  279  ? 474.818 -48.601 654.592 1.00 142.17 ? 279  GLU C CB    1 
ATOM   5734  C  CG    . GLU C 2  279  ? 474.175 -49.142 655.881 1.00 151.73 ? 279  GLU C CG    1 
ATOM   5735  C  CD    . GLU C 2  279  ? 474.554 -50.591 656.216 1.00 155.65 ? 279  GLU C CD    1 
ATOM   5736  O  OE1   . GLU C 2  279  ? 474.301 -51.506 655.403 1.00 150.42 ? 279  GLU C OE1   1 
ATOM   5737  O  OE2   . GLU C 2  279  ? 475.114 -50.812 657.318 1.00 158.59 ? 279  GLU C OE2   1 
ATOM   5738  N  N     . LYS C 2  280  ? 472.774 -48.243 652.121 1.00 133.70 ? 280  LYS C N     1 
ATOM   5739  C  CA    . LYS C 2  280  ? 471.397 -48.032 651.685 1.00 135.33 ? 280  LYS C CA    1 
ATOM   5740  C  C     . LYS C 2  280  ? 471.002 -48.998 650.580 1.00 140.17 ? 280  LYS C C     1 
ATOM   5741  O  O     . LYS C 2  280  ? 469.951 -49.643 650.660 1.00 141.43 ? 280  LYS C O     1 
ATOM   5742  C  CB    . LYS C 2  280  ? 471.226 -46.589 651.202 1.00 133.74 ? 280  LYS C CB    1 
ATOM   5743  C  CG    . LYS C 2  280  ? 469.831 -46.218 650.721 1.00 136.28 ? 280  LYS C CG    1 
ATOM   5744  C  CD    . LYS C 2  280  ? 468.822 -46.278 651.839 1.00 148.64 ? 280  LYS C CD    1 
ATOM   5745  C  CE    . LYS C 2  280  ? 467.487 -45.662 651.431 1.00 154.75 ? 280  LYS C CE    1 
ATOM   5746  N  NZ    . LYS C 2  280  ? 466.492 -45.683 652.561 1.00 157.85 ? 280  LYS C NZ    1 
ATOM   5747  N  N     . LEU C 2  281  ? 471.838 -49.133 649.554 1.00 143.52 ? 281  LEU C N     1 
ATOM   5748  C  CA    . LEU C 2  281  ? 471.496 -49.950 648.396 1.00 145.22 ? 281  LEU C CA    1 
ATOM   5749  C  C     . LEU C 2  281  ? 471.927 -51.401 648.544 1.00 147.01 ? 281  LEU C C     1 
ATOM   5750  O  O     . LEU C 2  281  ? 471.643 -52.207 647.648 1.00 148.71 ? 281  LEU C O     1 
ATOM   5751  C  CB    . LEU C 2  281  ? 472.082 -49.338 647.116 1.00 143.90 ? 281  LEU C CB    1 
ATOM   5752  C  CG    . LEU C 2  281  ? 471.827 -47.835 646.998 1.00 140.08 ? 281  LEU C CG    1 
ATOM   5753  C  CD1   . LEU C 2  281  ? 472.723 -47.179 645.980 1.00 138.13 ? 281  LEU C CD1   1 
ATOM   5754  C  CD2   . LEU C 2  281  ? 470.374 -47.641 646.607 1.00 141.69 ? 281  LEU C CD2   1 
ATOM   5755  N  N     . GLY C 2  282  ? 472.664 -51.729 649.605 1.00 146.34 ? 282  GLY C N     1 
ATOM   5756  C  CA    . GLY C 2  282  ? 473.135 -53.081 649.839 1.00 148.90 ? 282  GLY C CA    1 
ATOM   5757  C  C     . GLY C 2  282  ? 474.088 -53.577 648.778 1.00 150.22 ? 282  GLY C C     1 
ATOM   5758  O  O     . GLY C 2  282  ? 473.937 -54.687 648.256 1.00 150.07 ? 282  GLY C O     1 
ATOM   5759  N  N     . ILE C 2  283  ? 475.098 -52.771 648.482 1.00 151.66 ? 283  ILE C N     1 
ATOM   5760  C  CA    . ILE C 2  283  ? 476.129 -53.090 647.515 1.00 144.85 ? 283  ILE C CA    1 
ATOM   5761  C  C     . ILE C 2  283  ? 477.450 -52.702 648.166 1.00 144.62 ? 283  ILE C C     1 
ATOM   5762  O  O     . ILE C 2  283  ? 477.466 -52.176 649.281 1.00 147.80 ? 283  ILE C O     1 
ATOM   5763  C  CB    . ILE C 2  283  ? 475.877 -52.362 646.178 1.00 141.21 ? 283  ILE C CB    1 
ATOM   5764  C  CG1   . ILE C 2  283  ? 476.144 -50.875 646.311 1.00 141.43 ? 283  ILE C CG1   1 
ATOM   5765  C  CG2   . ILE C 2  283  ? 474.417 -52.495 645.744 1.00 138.86 ? 283  ILE C CG2   1 
ATOM   5766  C  CD1   . ILE C 2  283  ? 475.920 -50.134 645.013 1.00 145.24 ? 283  ILE C CD1   1 
ATOM   5767  N  N     . ARG C 2  284  ? 478.571 -52.934 647.495 1.00 146.97 ? 284  ARG C N     1 
ATOM   5768  C  CA    . ARG C 2  284  ? 479.804 -52.483 648.122 1.00 150.70 ? 284  ARG C CA    1 
ATOM   5769  C  C     . ARG C 2  284  ? 480.502 -51.683 647.032 1.00 146.58 ? 284  ARG C C     1 
ATOM   5770  O  O     . ARG C 2  284  ? 480.609 -52.163 645.902 1.00 148.88 ? 284  ARG C O     1 
ATOM   5771  C  CB    . ARG C 2  284  ? 480.621 -53.684 648.629 1.00 150.23 ? 284  ARG C CB    1 
ATOM   5772  C  CG    . ARG C 2  284  ? 480.265 -54.018 650.131 1.00 154.04 ? 284  ARG C CG    1 
ATOM   5773  C  CD    . ARG C 2  284  ? 481.274 -54.484 651.202 1.00 164.64 ? 284  ARG C CD    1 
ATOM   5774  N  NE    . ARG C 2  284  ? 482.313 -53.547 651.616 1.00 173.25 ? 284  ARG C NE    1 
ATOM   5775  C  CZ    . ARG C 2  284  ? 482.193 -52.780 652.707 1.00 169.32 ? 284  ARG C CZ    1 
ATOM   5776  N  NH1   . ARG C 2  284  ? 483.164 -51.940 653.051 1.00 172.47 ? 284  ARG C NH1   1 
ATOM   5777  N  NH2   . ARG C 2  284  ? 481.124 -52.900 653.496 1.00 156.41 ? 284  ARG C NH2   1 
ATOM   5778  N  N     . LEU C 2  285  ? 480.925 -50.459 647.331 1.00 150.12 ? 285  LEU C N     1 
ATOM   5779  C  CA    . LEU C 2  285  ? 481.568 -49.614 646.326 1.00 150.64 ? 285  LEU C CA    1 
ATOM   5780  C  C     . LEU C 2  285  ? 483.094 -49.752 646.316 1.00 148.93 ? 285  LEU C C     1 
ATOM   5781  O  O     . LEU C 2  285  ? 483.745 -49.716 647.368 1.00 145.37 ? 285  LEU C O     1 
ATOM   5782  C  CB    . LEU C 2  285  ? 481.154 -48.156 646.553 1.00 148.61 ? 285  LEU C CB    1 
ATOM   5783  C  CG    . LEU C 2  285  ? 479.993 -47.629 645.703 1.00 139.01 ? 285  LEU C CG    1 
ATOM   5784  C  CD1   . LEU C 2  285  ? 480.439 -47.442 644.283 1.00 148.38 ? 285  LEU C CD1   1 
ATOM   5785  C  CD2   . LEU C 2  285  ? 478.871 -48.604 645.720 1.00 130.92 ? 285  LEU C CD2   1 
ATOM   5786  N  N     . SER C 2  286  ? 483.655 -49.923 645.111 1.00 151.08 ? 286  SER C N     1 
ATOM   5787  C  CA    . SER C 2  286  ? 485.105 -49.972 644.930 1.00 152.67 ? 286  SER C CA    1 
ATOM   5788  C  C     . SER C 2  286  ? 485.750 -48.594 645.045 1.00 149.52 ? 286  SER C C     1 
ATOM   5789  O  O     . SER C 2  286  ? 486.973 -48.502 645.216 1.00 139.85 ? 286  SER C O     1 
ATOM   5790  C  CB    . SER C 2  286  ? 485.439 -50.604 643.578 1.00 149.08 ? 286  SER C CB    1 
ATOM   5791  O  OG    . SER C 2  286  ? 484.990 -49.785 642.510 1.00 152.11 ? 286  SER C OG    1 
ATOM   5792  N  N     . GLY C 2  287  ? 484.960 -47.533 644.940 1.00 151.84 ? 287  GLY C N     1 
ATOM   5793  C  CA    . GLY C 2  287  ? 485.493 -46.193 645.038 1.00 146.06 ? 287  GLY C CA    1 
ATOM   5794  C  C     . GLY C 2  287  ? 484.388 -45.181 645.243 1.00 140.97 ? 287  GLY C C     1 
ATOM   5795  O  O     . GLY C 2  287  ? 483.234 -45.527 645.496 1.00 143.28 ? 287  GLY C O     1 
ATOM   5796  N  N     . ARG C 2  288  ? 484.763 -43.917 645.107 1.00 131.27 ? 288  ARG C N     1 
ATOM   5797  C  CA    . ARG C 2  288  ? 483.891 -42.781 645.349 1.00 124.45 ? 288  ARG C CA    1 
ATOM   5798  C  C     . ARG C 2  288  ? 483.215 -42.229 644.099 1.00 127.61 ? 288  ARG C C     1 
ATOM   5799  O  O     . ARG C 2  288  ? 482.755 -41.084 644.113 1.00 125.36 ? 288  ARG C O     1 
ATOM   5800  C  CB    . ARG C 2  288  ? 484.656 -41.722 646.126 1.00 119.02 ? 288  ARG C CB    1 
ATOM   5801  C  CG    . ARG C 2  288  ? 484.974 -42.318 647.479 1.00 124.49 ? 288  ARG C CG    1 
ATOM   5802  C  CD    . ARG C 2  288  ? 485.328 -41.283 648.497 1.00 127.77 ? 288  ARG C CD    1 
ATOM   5803  N  NE    . ARG C 2  288  ? 486.541 -40.548 648.204 1.00 122.68 ? 288  ARG C NE    1 
ATOM   5804  C  CZ    . ARG C 2  288  ? 487.722 -40.909 648.696 1.00 129.85 ? 288  ARG C CZ    1 
ATOM   5805  N  NH1   . ARG C 2  288  ? 487.805 -41.970 649.494 1.00 129.77 ? 288  ARG C NH1   1 
ATOM   5806  N  NH2   . ARG C 2  288  ? 488.813 -40.211 648.408 1.00 132.40 ? 288  ARG C NH2   1 
ATOM   5807  N  N     . THR C 2  289  ? 483.239 -42.957 642.992 1.00 134.47 ? 289  THR C N     1 
ATOM   5808  C  CA    . THR C 2  289  ? 482.622 -42.470 641.768 1.00 136.21 ? 289  THR C CA    1 
ATOM   5809  C  C     . THR C 2  289  ? 481.380 -43.271 641.389 1.00 132.66 ? 289  THR C C     1 
ATOM   5810  O  O     . THR C 2  289  ? 481.191 -44.420 641.803 1.00 131.50 ? 289  THR C O     1 
ATOM   5811  C  CB    . THR C 2  289  ? 483.618 -42.489 640.600 1.00 142.11 ? 289  THR C CB    1 
ATOM   5812  O  OG1   . THR C 2  289  ? 484.396 -43.697 640.631 1.00 146.73 ? 289  THR C OG1   1 
ATOM   5813  C  CG2   . THR C 2  289  ? 484.545 -41.286 640.701 1.00 139.18 ? 289  THR C CG2   1 
ATOM   5814  N  N     . LEU C 2  290  ? 480.515 -42.616 640.606 1.00 130.85 ? 290  LEU C N     1 
ATOM   5815  C  CA    . LEU C 2  290  ? 479.272 -43.239 640.168 1.00 132.29 ? 290  LEU C CA    1 
ATOM   5816  C  C     . LEU C 2  290  ? 479.503 -44.308 639.099 1.00 139.96 ? 290  LEU C C     1 
ATOM   5817  O  O     . LEU C 2  290  ? 478.704 -45.246 638.989 1.00 139.17 ? 290  LEU C O     1 
ATOM   5818  C  CB    . LEU C 2  290  ? 478.321 -42.184 639.613 1.00 127.91 ? 290  LEU C CB    1 
ATOM   5819  C  CG    . LEU C 2  290  ? 477.951 -41.030 640.533 1.00 126.30 ? 290  LEU C CG    1 
ATOM   5820  C  CD1   . LEU C 2  290  ? 476.887 -40.145 639.899 1.00 124.20 ? 290  LEU C CD1   1 
ATOM   5821  C  CD2   . LEU C 2  290  ? 477.525 -41.534 641.900 1.00 134.89 ? 290  LEU C CD2   1 
ATOM   5822  N  N     . ALA C 2  291  ? 480.583 -44.202 638.315 1.00 145.95 ? 291  ALA C N     1 
ATOM   5823  C  CA    . ALA C 2  291  ? 480.925 -45.245 637.353 1.00 145.21 ? 291  ALA C CA    1 
ATOM   5824  C  C     . ALA C 2  291  ? 482.438 -45.309 637.159 1.00 148.19 ? 291  ALA C C     1 
ATOM   5825  O  O     . ALA C 2  291  ? 483.205 -44.566 637.784 1.00 143.21 ? 291  ALA C O     1 
ATOM   5826  C  CB    . ALA C 2  291  ? 480.225 -45.003 636.011 1.00 136.57 ? 291  ALA C CB    1 
ATOM   5827  N  N     . ARG C 2  292  ? 482.856 -46.245 636.300 1.00 155.67 ? 292  ARG C N     1 
ATOM   5828  C  CA    . ARG C 2  292  ? 484.252 -46.501 635.964 1.00 155.67 ? 292  ARG C CA    1 
ATOM   5829  C  C     . ARG C 2  292  ? 484.502 -46.527 634.456 1.00 157.94 ? 292  ARG C C     1 
ATOM   5830  O  O     . ARG C 2  292  ? 483.598 -46.747 633.642 1.00 154.35 ? 292  ARG C O     1 
ATOM   5831  C  CB    . ARG C 2  292  ? 484.740 -47.812 636.587 1.00 154.95 ? 292  ARG C CB    1 
ATOM   5832  C  CG    . ARG C 2  292  ? 484.898 -47.750 638.085 1.00 160.30 ? 292  ARG C CG    1 
ATOM   5833  C  CD    . ARG C 2  292  ? 485.212 -49.120 638.593 1.00 165.06 ? 292  ARG C CD    1 
ATOM   5834  N  NE    . ARG C 2  292  ? 484.208 -50.055 638.111 1.00 169.42 ? 292  ARG C NE    1 
ATOM   5835  C  CZ    . ARG C 2  292  ? 484.247 -51.365 638.319 1.00 172.11 ? 292  ARG C CZ    1 
ATOM   5836  N  NH1   . ARG C 2  292  ? 485.258 -51.901 638.997 1.00 167.84 ? 292  ARG C NH1   1 
ATOM   5837  N  NH2   . ARG C 2  292  ? 483.268 -52.135 637.853 1.00 169.69 ? 292  ARG C NH2   1 
ATOM   5838  N  N     . PHE C 2  293  ? 485.764 -46.285 634.100 1.00 160.47 ? 293  PHE C N     1 
ATOM   5839  C  CA    . PHE C 2  293  ? 486.301 -46.542 632.767 1.00 158.91 ? 293  PHE C CA    1 
ATOM   5840  C  C     . PHE C 2  293  ? 487.275 -47.712 632.894 1.00 160.78 ? 293  PHE C C     1 
ATOM   5841  O  O     . PHE C 2  293  ? 488.378 -47.555 633.434 1.00 158.70 ? 293  PHE C O     1 
ATOM   5842  C  CB    . PHE C 2  293  ? 486.985 -45.289 632.219 1.00 154.56 ? 293  PHE C CB    1 
ATOM   5843  C  CG    . PHE C 2  293  ? 487.324 -45.356 630.755 1.00 158.36 ? 293  PHE C CG    1 
ATOM   5844  C  CD1   . PHE C 2  293  ? 486.377 -45.057 629.789 1.00 159.31 ? 293  PHE C CD1   1 
ATOM   5845  C  CD2   . PHE C 2  293  ? 488.612 -45.665 630.345 1.00 159.45 ? 293  PHE C CD2   1 
ATOM   5846  C  CE1   . PHE C 2  293  ? 486.699 -45.102 628.443 1.00 158.57 ? 293  PHE C CE1   1 
ATOM   5847  C  CE2   . PHE C 2  293  ? 488.940 -45.713 628.999 1.00 160.65 ? 293  PHE C CE2   1 
ATOM   5848  C  CZ    . PHE C 2  293  ? 487.982 -45.431 628.050 1.00 159.55 ? 293  PHE C CZ    1 
ATOM   5849  N  N     . GLU C 2  294  ? 486.862 -48.887 632.414 1.00 160.53 ? 294  GLU C N     1 
ATOM   5850  C  CA    . GLU C 2  294  ? 487.628 -50.114 632.609 1.00 162.46 ? 294  GLU C CA    1 
ATOM   5851  C  C     . GLU C 2  294  ? 487.571 -50.943 631.330 1.00 168.11 ? 294  GLU C C     1 
ATOM   5852  O  O     . GLU C 2  294  ? 486.482 -51.186 630.794 1.00 164.49 ? 294  GLU C O     1 
ATOM   5853  C  CB    . GLU C 2  294  ? 487.105 -50.898 633.822 1.00 163.00 ? 294  GLU C CB    1 
ATOM   5854  C  CG    . GLU C 2  294  ? 487.726 -52.266 634.060 1.00 161.75 ? 294  GLU C CG    1 
ATOM   5855  C  CD    . GLU C 2  294  ? 487.180 -52.932 635.317 1.00 164.50 ? 294  GLU C CD    1 
ATOM   5856  O  OE1   . GLU C 2  294  ? 487.164 -52.278 636.382 1.00 165.93 ? 294  GLU C OE1   1 
ATOM   5857  O  OE2   . GLU C 2  294  ? 486.755 -54.103 635.240 1.00 164.44 ? 294  GLU C OE2   1 
ATOM   5858  N  N     . ASP C 2  295  ? 488.749 -51.383 630.859 1.00 167.19 ? 295  ASP C N     1 
ATOM   5859  C  CA    . ASP C 2  295  ? 488.890 -52.179 629.633 1.00 162.54 ? 295  ASP C CA    1 
ATOM   5860  C  C     . ASP C 2  295  ? 488.291 -51.467 628.417 1.00 162.46 ? 295  ASP C C     1 
ATOM   5861  O  O     . ASP C 2  295  ? 487.724 -52.090 627.516 1.00 163.90 ? 295  ASP C O     1 
ATOM   5862  C  CB    . ASP C 2  295  ? 488.324 -53.592 629.809 1.00 161.64 ? 295  ASP C CB    1 
ATOM   5863  C  CG    . ASP C 2  295  ? 488.985 -54.339 630.971 1.00 163.35 ? 295  ASP C CG    1 
ATOM   5864  O  OD1   . ASP C 2  295  ? 488.317 -55.172 631.622 1.00 166.35 ? 295  ASP C OD1   1 
ATOM   5865  O  OD2   . ASP C 2  295  ? 490.173 -54.065 631.256 1.00 156.68 ? 295  ASP C OD2   1 
ATOM   5866  N  N     . GLY C 2  296  ? 488.423 -50.138 628.408 1.00 160.39 ? 296  GLY C N     1 
ATOM   5867  C  CA    . GLY C 2  296  ? 488.057 -49.287 627.296 1.00 161.56 ? 296  GLY C CA    1 
ATOM   5868  C  C     . GLY C 2  296  ? 486.637 -48.757 627.274 1.00 162.96 ? 296  GLY C C     1 
ATOM   5869  O  O     . GLY C 2  296  ? 486.379 -47.773 626.574 1.00 163.17 ? 296  GLY C O     1 
ATOM   5870  N  N     . GLU C 2  297  ? 485.707 -49.357 628.007 1.00 163.99 ? 297  GLU C N     1 
ATOM   5871  C  CA    . GLU C 2  297  ? 484.320 -48.896 628.009 1.00 161.28 ? 297  GLU C CA    1 
ATOM   5872  C  C     . GLU C 2  297  ? 483.955 -48.453 629.435 1.00 164.14 ? 297  GLU C C     1 
ATOM   5873  O  O     . GLU C 2  297  ? 484.764 -48.557 630.365 1.00 161.83 ? 297  GLU C O     1 
ATOM   5874  C  CB    . GLU C 2  297  ? 483.379 -49.957 627.419 1.00 158.96 ? 297  GLU C CB    1 
ATOM   5875  C  CG    . GLU C 2  297  ? 483.323 -51.294 628.126 1.00 160.31 ? 297  GLU C CG    1 
ATOM   5876  C  CD    . GLU C 2  297  ? 482.317 -52.231 627.479 1.00 155.12 ? 297  GLU C CD    1 
ATOM   5877  O  OE1   . GLU C 2  297  ? 482.646 -53.422 627.296 1.00 146.07 ? 297  GLU C OE1   1 
ATOM   5878  O  OE2   . GLU C 2  297  ? 481.217 -51.760 627.105 1.00 156.08 ? 297  GLU C OE2   1 
ATOM   5879  N  N     . PHE C 2  298  ? 482.714 -47.987 629.620 1.00 167.48 ? 298  PHE C N     1 
ATOM   5880  C  CA    . PHE C 2  298  ? 482.233 -47.552 630.934 1.00 159.67 ? 298  PHE C CA    1 
ATOM   5881  C  C     . PHE C 2  298  ? 481.507 -48.682 631.644 1.00 157.36 ? 298  PHE C C     1 
ATOM   5882  O  O     . PHE C 2  298  ? 480.658 -49.361 631.056 1.00 160.24 ? 298  PHE C O     1 
ATOM   5883  C  CB    . PHE C 2  298  ? 481.273 -46.368 630.799 1.00 154.06 ? 298  PHE C CB    1 
ATOM   5884  C  CG    . PHE C 2  298  ? 481.947 -45.050 630.541 1.00 152.33 ? 298  PHE C CG    1 
ATOM   5885  C  CD1   . PHE C 2  298  ? 483.077 -44.672 631.252 1.00 154.66 ? 298  PHE C CD1   1 
ATOM   5886  C  CD2   . PHE C 2  298  ? 481.430 -44.174 629.597 1.00 146.37 ? 298  PHE C CD2   1 
ATOM   5887  C  CE1   . PHE C 2  298  ? 483.687 -43.447 631.011 1.00 152.11 ? 298  PHE C CE1   1 
ATOM   5888  C  CE2   . PHE C 2  298  ? 482.035 -42.955 629.352 1.00 148.64 ? 298  PHE C CE2   1 
ATOM   5889  C  CZ    . PHE C 2  298  ? 483.162 -42.587 630.061 1.00 149.74 ? 298  PHE C CZ    1 
ATOM   5890  N  N     . LYS C 2  299  ? 481.807 -48.850 632.930 1.00 154.59 ? 299  LYS C N     1 
ATOM   5891  C  CA    . LYS C 2  299  ? 481.165 -49.881 633.734 1.00 159.89 ? 299  LYS C CA    1 
ATOM   5892  C  C     . LYS C 2  299  ? 480.468 -49.257 634.945 1.00 163.24 ? 299  LYS C C     1 
ATOM   5893  O  O     . LYS C 2  299  ? 481.115 -48.634 635.796 1.00 162.56 ? 299  LYS C O     1 
ATOM   5894  C  CB    . LYS C 2  299  ? 482.242 -50.883 634.153 1.00 158.39 ? 299  LYS C CB    1 
ATOM   5895  C  CG    . LYS C 2  299  ? 482.698 -51.714 632.971 1.00 159.33 ? 299  LYS C CG    1 
ATOM   5896  C  CD    . LYS C 2  299  ? 483.894 -52.587 633.281 1.00 164.31 ? 299  LYS C CD    1 
ATOM   5897  C  CE    . LYS C 2  299  ? 484.203 -53.503 632.099 1.00 164.61 ? 299  LYS C CE    1 
ATOM   5898  N  NZ    . LYS C 2  299  ? 485.361 -54.399 632.362 1.00 166.24 ? 299  LYS C NZ    1 
ATOM   5899  N  N     . ASP C 2  300  ? 479.160 -49.494 635.048 1.00 159.89 ? 300  ASP C N     1 
ATOM   5900  C  CA    . ASP C 2  300  ? 478.302 -48.931 636.089 1.00 152.78 ? 300  ASP C CA    1 
ATOM   5901  C  C     . ASP C 2  300  ? 478.610 -49.467 637.486 1.00 152.85 ? 300  ASP C C     1 
ATOM   5902  O  O     . ASP C 2  300  ? 479.052 -50.605 637.657 1.00 158.01 ? 300  ASP C O     1 
ATOM   5903  C  CB    . ASP C 2  300  ? 476.835 -49.182 635.759 1.00 154.40 ? 300  ASP C CB    1 
ATOM   5904  C  CG    . ASP C 2  300  ? 475.906 -48.515 636.739 1.00 148.71 ? 300  ASP C CG    1 
ATOM   5905  O  OD1   . ASP C 2  300  ? 476.175 -47.361 637.130 1.00 147.46 ? 300  ASP C OD1   1 
ATOM   5906  O  OD2   . ASP C 2  300  ? 474.905 -49.145 637.120 1.00 150.23 ? 300  ASP C OD2   1 
ATOM   5907  N  N     . GLU C 2  301  ? 478.363 -48.620 638.493 1.00 151.29 ? 301  GLU C N     1 
ATOM   5908  C  CA    . GLU C 2  301  ? 478.529 -48.970 639.903 1.00 148.00 ? 301  GLU C CA    1 
ATOM   5909  C  C     . GLU C 2  301  ? 477.239 -48.637 640.659 1.00 148.09 ? 301  GLU C C     1 
ATOM   5910  O  O     . GLU C 2  301  ? 476.625 -49.509 641.286 1.00 144.49 ? 301  GLU C O     1 
ATOM   5911  C  CB    . GLU C 2  301  ? 479.729 -48.233 640.515 1.00 142.06 ? 301  GLU C CB    1 
ATOM   5912  C  CG    . GLU C 2  301  ? 481.081 -48.828 640.128 1.00 152.16 ? 301  GLU C CG    1 
ATOM   5913  C  CD    . GLU C 2  301  ? 482.118 -48.766 641.238 1.00 156.07 ? 301  GLU C CD    1 
ATOM   5914  O  OE1   . GLU C 2  301  ? 482.433 -49.830 641.820 1.00 153.91 ? 301  GLU C OE1   1 
ATOM   5915  O  OE2   . GLU C 2  301  ? 482.631 -47.657 641.516 1.00 154.91 ? 301  GLU C OE2   1 
ATOM   5916  N  N     . VAL C 2  302  ? 476.851 -47.365 640.626 1.00 148.95 ? 302  VAL C N     1 
ATOM   5917  C  CA    . VAL C 2  302  ? 475.739 -46.824 641.411 1.00 141.36 ? 302  VAL C CA    1 
ATOM   5918  C  C     . VAL C 2  302  ? 474.408 -46.877 640.653 1.00 142.75 ? 302  VAL C C     1 
ATOM   5919  O  O     . VAL C 2  302  ? 473.406 -47.346 641.194 1.00 146.24 ? 302  VAL C O     1 
ATOM   5920  C  CB    . VAL C 2  302  ? 476.070 -45.392 641.887 1.00 134.07 ? 302  VAL C CB    1 
ATOM   5921  C  CG1   . VAL C 2  302  ? 474.906 -44.805 642.642 1.00 130.31 ? 302  VAL C CG1   1 
ATOM   5922  C  CG2   . VAL C 2  302  ? 477.299 -45.417 642.787 1.00 130.39 ? 302  VAL C CG2   1 
ATOM   5923  N  N     . PHE C 2  303  ? 474.363 -46.325 639.430 1.00 139.92 ? 303  PHE C N     1 
ATOM   5924  C  CA    . PHE C 2  303  ? 473.108 -46.071 638.703 1.00 139.81 ? 303  PHE C CA    1 
ATOM   5925  C  C     . PHE C 2  303  ? 472.081 -47.207 638.708 1.00 144.04 ? 303  PHE C C     1 
ATOM   5926  O  O     . PHE C 2  303  ? 470.887 -46.964 638.926 1.00 143.34 ? 303  PHE C O     1 
ATOM   5927  C  CB    . PHE C 2  303  ? 473.434 -45.704 637.256 1.00 136.04 ? 303  PHE C CB    1 
ATOM   5928  C  CG    . PHE C 2  303  ? 474.119 -44.393 637.119 1.00 136.26 ? 303  PHE C CG    1 
ATOM   5929  C  CD1   . PHE C 2  303  ? 475.497 -44.313 637.099 1.00 135.87 ? 303  PHE C CD1   1 
ATOM   5930  C  CD2   . PHE C 2  303  ? 473.374 -43.231 636.983 1.00 132.87 ? 303  PHE C CD2   1 
ATOM   5931  C  CE1   . PHE C 2  303  ? 476.122 -43.094 636.978 1.00 132.49 ? 303  PHE C CE1   1 
ATOM   5932  C  CE2   . PHE C 2  303  ? 473.990 -42.009 636.856 1.00 129.80 ? 303  PHE C CE2   1 
ATOM   5933  C  CZ    . PHE C 2  303  ? 475.367 -41.938 636.852 1.00 129.70 ? 303  PHE C CZ    1 
ATOM   5934  N  N     . LEU C 2  304  ? 472.490 -48.430 638.413 1.00 146.22 ? 304  LEU C N     1 
ATOM   5935  C  CA    . LEU C 2  304  ? 471.441 -49.451 638.375 1.00 145.42 ? 304  LEU C CA    1 
ATOM   5936  C  C     . LEU C 2  304  ? 470.846 -49.750 639.754 1.00 144.28 ? 304  LEU C C     1 
ATOM   5937  O  O     . LEU C 2  304  ? 469.617 -49.789 639.880 1.00 144.35 ? 304  LEU C O     1 
ATOM   5938  C  CB    . LEU C 2  304  ? 471.911 -50.736 637.693 1.00 142.96 ? 304  LEU C CB    1 
ATOM   5939  C  CG    . LEU C 2  304  ? 470.710 -51.663 637.520 1.00 141.79 ? 304  LEU C CG    1 
ATOM   5940  C  CD1   . LEU C 2  304  ? 469.664 -51.006 636.622 1.00 141.72 ? 304  LEU C CD1   1 
ATOM   5941  C  CD2   . LEU C 2  304  ? 471.140 -52.986 636.958 1.00 147.19 ? 304  LEU C CD2   1 
ATOM   5942  N  N     . PRO C 2  305  ? 471.661 -49.899 640.814 1.00 142.84 ? 305  PRO C N     1 
ATOM   5943  C  CA    . PRO C 2  305  ? 471.081 -50.061 642.162 1.00 145.47 ? 305  PRO C CA    1 
ATOM   5944  C  C     . PRO C 2  305  ? 470.184 -48.913 642.583 1.00 145.90 ? 305  PRO C C     1 
ATOM   5945  O  O     . PRO C 2  305  ? 469.209 -49.137 643.312 1.00 144.86 ? 305  PRO C O     1 
ATOM   5946  C  CB    . PRO C 2  305  ? 472.324 -50.180 643.054 1.00 144.38 ? 305  PRO C CB    1 
ATOM   5947  C  CG    . PRO C 2  305  ? 473.327 -50.828 642.171 1.00 140.90 ? 305  PRO C CG    1 
ATOM   5948  C  CD    . PRO C 2  305  ? 473.094 -50.262 640.805 1.00 141.40 ? 305  PRO C CD    1 
ATOM   5949  N  N     . THR C 2  306  ? 470.492 -47.688 642.176 1.00 143.72 ? 306  THR C N     1 
ATOM   5950  C  CA    . THR C 2  306  ? 469.626 -46.573 642.526 1.00 142.47 ? 306  THR C CA    1 
ATOM   5951  C  C     . THR C 2  306  ? 468.310 -46.681 641.760 1.00 147.56 ? 306  THR C C     1 
ATOM   5952  O  O     . THR C 2  306  ? 467.240 -46.393 642.309 1.00 150.17 ? 306  THR C O     1 
ATOM   5953  C  CB    . THR C 2  306  ? 470.344 -45.254 642.251 1.00 139.16 ? 306  THR C CB    1 
ATOM   5954  O  OG1   . THR C 2  306  ? 471.511 -45.179 643.076 1.00 136.57 ? 306  THR C OG1   1 
ATOM   5955  C  CG2   . THR C 2  306  ? 469.453 -44.071 642.534 1.00 143.15 ? 306  THR C CG2   1 
ATOM   5956  N  N     . LEU C 2  307  ? 468.373 -47.081 640.482 1.00 150.61 ? 307  LEU C N     1 
ATOM   5957  C  CA    . LEU C 2  307  ? 467.160 -47.312 639.696 1.00 150.17 ? 307  LEU C CA    1 
ATOM   5958  C  C     . LEU C 2  307  ? 466.354 -48.480 640.264 1.00 155.20 ? 307  LEU C C     1 
ATOM   5959  O  O     . LEU C 2  307  ? 465.119 -48.425 640.339 1.00 157.28 ? 307  LEU C O     1 
ATOM   5960  C  CB    . LEU C 2  307  ? 467.520 -47.596 638.240 1.00 141.97 ? 307  LEU C CB    1 
ATOM   5961  C  CG    . LEU C 2  307  ? 466.281 -47.960 637.426 1.00 149.92 ? 307  LEU C CG    1 
ATOM   5962  C  CD1   . LEU C 2  307  ? 465.300 -46.792 637.444 1.00 154.00 ? 307  LEU C CD1   1 
ATOM   5963  C  CD2   . LEU C 2  307  ? 466.607 -48.393 636.007 1.00 158.98 ? 307  LEU C CD2   1 
ATOM   5964  N  N     . ARG C 2  308  ? 467.047 -49.552 640.652 1.00 154.26 ? 308  ARG C N     1 
ATOM   5965  C  CA    . ARG C 2  308  ? 466.414 -50.727 641.245 1.00 148.43 ? 308  ARG C CA    1 
ATOM   5966  C  C     . ARG C 2  308  ? 465.667 -50.385 642.521 1.00 154.65 ? 308  ARG C C     1 
ATOM   5967  O  O     . ARG C 2  308  ? 464.533 -50.832 642.728 1.00 159.25 ? 308  ARG C O     1 
ATOM   5968  C  CB    . ARG C 2  308  ? 467.507 -51.772 641.488 1.00 146.29 ? 308  ARG C CB    1 
ATOM   5969  C  CG    . ARG C 2  308  ? 467.087 -53.183 641.762 1.00 145.10 ? 308  ARG C CG    1 
ATOM   5970  C  CD    . ARG C 2  308  ? 466.913 -53.290 643.243 1.00 155.71 ? 308  ARG C CD    1 
ATOM   5971  N  NE    . ARG C 2  308  ? 468.032 -52.592 643.880 1.00 156.77 ? 308  ARG C NE    1 
ATOM   5972  C  CZ    . ARG C 2  308  ? 468.027 -52.128 645.127 1.00 158.36 ? 308  ARG C CZ    1 
ATOM   5973  N  NH1   . ARG C 2  308  ? 466.953 -52.284 645.889 1.00 158.55 ? 308  ARG C NH1   1 
ATOM   5974  N  NH2   . ARG C 2  308  ? 469.095 -51.501 645.611 1.00 153.43 ? 308  ARG C NH2   1 
ATOM   5975  N  N     . TYR C 2  309  ? 466.287 -49.594 643.389 1.00 157.57 ? 309  TYR C N     1 
ATOM   5976  C  CA    . TYR C 2  309  ? 465.646 -49.221 644.641 1.00 156.43 ? 309  TYR C CA    1 
ATOM   5977  C  C     . TYR C 2  309  ? 464.417 -48.357 644.378 1.00 155.73 ? 309  TYR C C     1 
ATOM   5978  O  O     . TYR C 2  309  ? 463.381 -48.534 645.018 1.00 165.25 ? 309  TYR C O     1 
ATOM   5979  C  CB    . TYR C 2  309  ? 466.668 -48.493 645.524 1.00 157.22 ? 309  TYR C CB    1 
ATOM   5980  C  CG    . TYR C 2  309  ? 466.355 -48.393 647.008 1.00 157.76 ? 309  TYR C CG    1 
ATOM   5981  C  CD1   . TYR C 2  309  ? 467.080 -49.152 647.927 1.00 154.66 ? 309  TYR C CD1   1 
ATOM   5982  C  CD2   . TYR C 2  309  ? 465.360 -47.552 647.493 1.00 158.88 ? 309  TYR C CD2   1 
ATOM   5983  C  CE1   . TYR C 2  309  ? 466.827 -49.082 649.278 1.00 155.63 ? 309  TYR C CE1   1 
ATOM   5984  C  CE2   . TYR C 2  309  ? 465.096 -47.473 648.853 1.00 160.64 ? 309  TYR C CE2   1 
ATOM   5985  C  CZ    . TYR C 2  309  ? 465.832 -48.243 649.742 1.00 162.32 ? 309  TYR C CZ    1 
ATOM   5986  O  OH    . TYR C 2  309  ? 465.570 -48.175 651.098 1.00 163.98 ? 309  TYR C OH    1 
ATOM   5987  N  N     . LEU C 2  310  ? 464.513 -47.422 643.433 1.00 152.92 ? 310  LEU C N     1 
ATOM   5988  C  CA    . LEU C 2  310  ? 463.380 -46.559 643.112 1.00 154.69 ? 310  LEU C CA    1 
ATOM   5989  C  C     . LEU C 2  310  ? 462.151 -47.330 642.634 1.00 159.49 ? 310  LEU C C     1 
ATOM   5990  O  O     . LEU C 2  310  ? 461.037 -47.082 643.105 1.00 161.51 ? 310  LEU C O     1 
ATOM   5991  C  CB    . LEU C 2  310  ? 463.827 -45.542 642.056 1.00 154.72 ? 310  LEU C CB    1 
ATOM   5992  C  CG    . LEU C 2  310  ? 462.822 -44.665 641.299 1.00 157.86 ? 310  LEU C CG    1 
ATOM   5993  C  CD1   . LEU C 2  310  ? 461.943 -43.859 642.230 1.00 162.39 ? 310  LEU C CD1   1 
ATOM   5994  C  CD2   . LEU C 2  310  ? 463.562 -43.738 640.332 1.00 153.67 ? 310  LEU C CD2   1 
ATOM   5995  N  N     . PHE C 2  311  ? 462.317 -48.227 641.657 1.00 165.36 ? 311  PHE C N     1 
ATOM   5996  C  CA    . PHE C 2  311  ? 461.173 -49.006 641.173 1.00 170.03 ? 311  PHE C CA    1 
ATOM   5997  C  C     . PHE C 2  311  ? 460.582 -49.904 642.257 1.00 171.84 ? 311  PHE C C     1 
ATOM   5998  O  O     . PHE C 2  311  ? 459.356 -49.971 642.409 1.00 175.04 ? 311  PHE C O     1 
ATOM   5999  C  CB    . PHE C 2  311  ? 461.546 -49.782 639.905 1.00 173.00 ? 311  PHE C CB    1 
ATOM   6000  C  CG    . PHE C 2  311  ? 461.460 -48.942 638.635 1.00 177.14 ? 311  PHE C CG    1 
ATOM   6001  C  CD1   . PHE C 2  311  ? 460.910 -47.660 638.666 1.00 173.87 ? 311  PHE C CD1   1 
ATOM   6002  C  CD2   . PHE C 2  311  ? 461.955 -49.417 637.425 1.00 178.72 ? 311  PHE C CD2   1 
ATOM   6003  C  CE1   . PHE C 2  311  ? 460.832 -46.880 637.510 1.00 174.27 ? 311  PHE C CE1   1 
ATOM   6004  C  CE2   . PHE C 2  311  ? 461.890 -48.642 636.265 1.00 175.73 ? 311  PHE C CE2   1 
ATOM   6005  C  CZ    . PHE C 2  311  ? 461.326 -47.371 636.310 1.00 176.67 ? 311  PHE C CZ    1 
ATOM   6006  N  N     . ALA C 2  312  ? 461.436 -50.608 643.012 1.00 169.94 ? 312  ALA C N     1 
ATOM   6007  C  CA    . ALA C 2  312  ? 460.959 -51.490 644.083 1.00 174.84 ? 312  ALA C CA    1 
ATOM   6008  C  C     . ALA C 2  312  ? 460.178 -50.716 645.144 1.00 174.16 ? 312  ALA C C     1 
ATOM   6009  O  O     . ALA C 2  312  ? 459.260 -51.259 645.772 1.00 173.17 ? 312  ALA C O     1 
ATOM   6010  C  CB    . ALA C 2  312  ? 462.133 -52.248 644.704 1.00 171.45 ? 312  ALA C CB    1 
ATOM   6011  N  N     . LEU C 2  313  ? 460.551 -49.455 645.364 1.00 175.36 ? 313  LEU C N     1 
ATOM   6012  C  CA    . LEU C 2  313  ? 459.876 -48.592 646.325 1.00 172.85 ? 313  LEU C CA    1 
ATOM   6013  C  C     . LEU C 2  313  ? 458.505 -48.188 645.801 1.00 173.30 ? 313  LEU C C     1 
ATOM   6014  O  O     . LEU C 2  313  ? 457.511 -48.252 646.533 1.00 177.80 ? 313  LEU C O     1 
ATOM   6015  C  CB    . LEU C 2  313  ? 460.729 -47.356 646.607 1.00 171.84 ? 313  LEU C CB    1 
ATOM   6016  C  CG    . LEU C 2  313  ? 460.212 -46.332 647.615 1.00 175.02 ? 313  LEU C CG    1 
ATOM   6017  C  CD1   . LEU C 2  313  ? 459.988 -46.972 648.980 1.00 170.22 ? 313  LEU C CD1   1 
ATOM   6018  C  CD2   . LEU C 2  313  ? 461.160 -45.149 647.698 1.00 169.57 ? 313  LEU C CD2   1 
ATOM   6019  N  N     . THR C 2  314  ? 458.432 -47.805 644.521 1.00 171.40 ? 314  THR C N     1 
ATOM   6020  C  CA    . THR C 2  314  ? 457.165 -47.401 643.916 1.00 174.24 ? 314  THR C CA    1 
ATOM   6021  C  C     . THR C 2  314  ? 456.126 -48.510 644.059 1.00 177.24 ? 314  THR C C     1 
ATOM   6022  O  O     . THR C 2  314  ? 454.928 -48.236 644.218 1.00 176.68 ? 314  THR C O     1 
ATOM   6023  C  CB    . THR C 2  314  ? 457.377 -47.029 642.447 1.00 171.53 ? 314  THR C CB    1 
ATOM   6024  O  OG1   . THR C 2  314  ? 458.329 -45.962 642.358 1.00 166.43 ? 314  THR C OG1   1 
ATOM   6025  C  CG2   . THR C 2  314  ? 456.071 -46.555 641.825 1.00 172.63 ? 314  THR C CG2   1 
ATOM   6026  N  N     . ALA C 2  315  ? 456.556 -49.768 643.955 1.00 177.33 ? 315  ALA C N     1 
ATOM   6027  C  CA    . ALA C 2  315  ? 455.621 -50.876 644.118 1.00 175.12 ? 315  ALA C CA    1 
ATOM   6028  C  C     . ALA C 2  315  ? 455.192 -51.036 645.574 1.00 169.39 ? 315  ALA C C     1 
ATOM   6029  O  O     . ALA C 2  315  ? 453.995 -51.145 645.861 1.00 170.37 ? 315  ALA C O     1 
ATOM   6030  C  CB    . ALA C 2  315  ? 456.253 -52.173 643.610 1.00 175.76 ? 315  ALA C CB    1 
ATOM   6031  N  N     . GLY C 2  316  ? 456.141 -51.004 646.515 1.00 168.37 ? 316  GLY C N     1 
ATOM   6032  C  CA    . GLY C 2  316  ? 455.798 -51.143 647.925 1.00 172.57 ? 316  GLY C CA    1 
ATOM   6033  C  C     . GLY C 2  316  ? 456.454 -52.381 648.509 1.00 170.63 ? 316  GLY C C     1 
ATOM   6034  O  O     . GLY C 2  316  ? 455.974 -53.012 649.459 1.00 163.67 ? 316  GLY C O     1 
ATOM   6035  N  N     . VAL C 2  317  ? 457.599 -52.701 647.935 1.00 175.08 ? 317  VAL C N     1 
ATOM   6036  C  CA    . VAL C 2  317  ? 458.405 -53.857 648.341 1.00 180.44 ? 317  VAL C CA    1 
ATOM   6037  C  C     . VAL C 2  317  ? 458.978 -53.637 649.739 1.00 180.56 ? 317  VAL C C     1 
ATOM   6038  O  O     . VAL C 2  317  ? 459.441 -52.524 650.054 1.00 179.71 ? 317  VAL C O     1 
ATOM   6039  C  CB    . VAL C 2  317  ? 459.525 -54.103 647.321 1.00 177.93 ? 317  VAL C CB    1 
ATOM   6040  C  CG1   . VAL C 2  317  ? 460.474 -55.194 647.812 1.00 174.49 ? 317  VAL C CG1   1 
ATOM   6041  C  CG2   . VAL C 2  317  ? 458.936 -54.450 645.955 1.00 176.37 ? 317  VAL C CG2   1 
ATOM   6042  N  N     . PRO C 2  318  ? 458.866 -54.624 650.630 1.00 180.40 ? 318  PRO C N     1 
ATOM   6043  C  CA    . PRO C 2  318  ? 459.453 -54.506 651.973 1.00 177.59 ? 318  PRO C CA    1 
ATOM   6044  C  C     . PRO C 2  318  ? 460.949 -54.220 651.928 1.00 178.36 ? 318  PRO C C     1 
ATOM   6045  O  O     . PRO C 2  318  ? 461.691 -54.790 651.123 1.00 177.64 ? 318  PRO C O     1 
ATOM   6046  C  CB    . PRO C 2  318  ? 459.167 -55.874 652.600 1.00 171.32 ? 318  PRO C CB    1 
ATOM   6047  C  CG    . PRO C 2  318  ? 457.965 -56.327 651.898 1.00 173.87 ? 318  PRO C CG    1 
ATOM   6048  C  CD    . PRO C 2  318  ? 458.063 -55.846 650.489 1.00 176.61 ? 318  PRO C CD    1 
ATOM   6049  N  N     . GLY C 2  319  ? 461.385 -53.341 652.831 1.00 175.92 ? 319  GLY C N     1 
ATOM   6050  C  CA    . GLY C 2  319  ? 462.770 -52.944 652.957 1.00 168.71 ? 319  GLY C CA    1 
ATOM   6051  C  C     . GLY C 2  319  ? 463.118 -51.652 652.252 1.00 165.47 ? 319  GLY C C     1 
ATOM   6052  O  O     . GLY C 2  319  ? 464.296 -51.278 652.236 1.00 159.68 ? 319  GLY C O     1 
ATOM   6053  N  N     . HIS C 2  320  ? 462.134 -50.954 651.679 1.00 168.48 ? 320  HIS C N     1 
ATOM   6054  C  CA    . HIS C 2  320  ? 462.381 -49.708 650.964 1.00 168.86 ? 320  HIS C CA    1 
ATOM   6055  C  C     . HIS C 2  320  ? 461.602 -48.580 651.624 1.00 169.77 ? 320  HIS C C     1 
ATOM   6056  O  O     . HIS C 2  320  ? 460.374 -48.661 651.741 1.00 172.66 ? 320  HIS C O     1 
ATOM   6057  C  CB    . HIS C 2  320  ? 461.916 -49.840 649.511 1.00 169.23 ? 320  HIS C CB    1 
ATOM   6058  C  CG    . HIS C 2  320  ? 462.639 -50.895 648.742 1.00 167.70 ? 320  HIS C CG    1 
ATOM   6059  N  ND1   . HIS C 2  320  ? 462.590 -52.226 649.092 1.00 170.26 ? 320  HIS C ND1   1 
ATOM   6060  C  CD2   . HIS C 2  320  ? 463.416 -50.824 647.640 1.00 165.79 ? 320  HIS C CD2   1 
ATOM   6061  C  CE1   . HIS C 2  320  ? 463.316 -52.930 648.245 1.00 168.48 ? 320  HIS C CE1   1 
ATOM   6062  N  NE2   . HIS C 2  320  ? 463.831 -52.102 647.355 1.00 168.69 ? 320  HIS C NE2   1 
ATOM   6063  N  N     . GLU C 2  321  ? 462.309 -47.526 652.030 1.00 167.69 ? 321  GLU C N     1 
ATOM   6064  C  CA    . GLU C 2  321  ? 461.718 -46.404 652.749 1.00 162.37 ? 321  GLU C CA    1 
ATOM   6065  C  C     . GLU C 2  321  ? 462.169 -45.094 652.115 1.00 157.72 ? 321  GLU C C     1 
ATOM   6066  O  O     . GLU C 2  321  ? 463.220 -45.029 651.472 1.00 158.55 ? 321  GLU C O     1 
ATOM   6067  C  CB    . GLU C 2  321  ? 462.046 -46.429 654.236 1.00 158.31 ? 321  GLU C CB    1 
ATOM   6068  C  CG    . GLU C 2  321  ? 463.492 -46.302 654.580 1.00 155.44 ? 321  GLU C CG    1 
ATOM   6069  C  CD    . GLU C 2  321  ? 463.684 -46.453 656.062 1.00 161.77 ? 321  GLU C CD    1 
ATOM   6070  O  OE1   . GLU C 2  321  ? 462.700 -46.230 656.804 1.00 161.52 ? 321  GLU C OE1   1 
ATOM   6071  O  OE2   . GLU C 2  321  ? 464.796 -46.817 656.487 1.00 165.02 ? 321  GLU C OE2   1 
ATOM   6072  N  N     . VAL C 2  322  ? 461.400 -44.030 652.351 1.00 149.67 ? 322  VAL C N     1 
ATOM   6073  C  CA    . VAL C 2  322  ? 461.903 -42.697 652.045 1.00 144.09 ? 322  VAL C CA    1 
ATOM   6074  C  C     . VAL C 2  322  ? 462.830 -42.247 653.170 1.00 142.50 ? 322  VAL C C     1 
ATOM   6075  O  O     . VAL C 2  322  ? 462.789 -42.770 654.284 1.00 146.16 ? 322  VAL C O     1 
ATOM   6076  C  CB    . VAL C 2  322  ? 460.740 -41.706 651.828 1.00 138.69 ? 322  VAL C CB    1 
ATOM   6077  C  CG1   . VAL C 2  322  ? 461.162 -40.263 652.073 1.00 135.35 ? 322  VAL C CG1   1 
ATOM   6078  C  CG2   . VAL C 2  322  ? 460.181 -41.859 650.440 1.00 146.12 ? 322  VAL C CG2   1 
ATOM   6079  N  N     . ASP C 2  323  ? 463.740 -41.328 652.850 1.00 142.81 ? 323  ASP C N     1 
ATOM   6080  C  CA    . ASP C 2  323  ? 464.696 -40.801 653.815 1.00 137.69 ? 323  ASP C CA    1 
ATOM   6081  C  C     . ASP C 2  323  ? 464.292 -39.416 654.305 1.00 131.47 ? 323  ASP C C     1 
ATOM   6082  O  O     . ASP C 2  323  ? 463.887 -38.553 653.512 1.00 124.75 ? 323  ASP C O     1 
ATOM   6083  C  CB    . ASP C 2  323  ? 466.095 -40.776 653.215 1.00 133.84 ? 323  ASP C CB    1 
ATOM   6084  C  CG    . ASP C 2  323  ? 466.593 -42.151 652.906 1.00 139.87 ? 323  ASP C CG    1 
ATOM   6085  O  OD1   . ASP C 2  323  ? 466.880 -42.896 653.874 1.00 137.57 ? 323  ASP C OD1   1 
ATOM   6086  O  OD2   . ASP C 2  323  ? 466.617 -42.508 651.709 1.00 145.14 ? 323  ASP C OD2   1 
ATOM   6087  N  N     . ASP C 2  324  ? 464.371 -39.230 655.622 1.00 126.32 ? 324  ASP C N     1 
ATOM   6088  C  CA    . ASP C 2  324  ? 464.139 -37.939 656.248 1.00 116.87 ? 324  ASP C CA    1 
ATOM   6089  C  C     . ASP C 2  324  ? 465.436 -37.147 656.185 1.00 114.69 ? 324  ASP C C     1 
ATOM   6090  O  O     . ASP C 2  324  ? 466.459 -37.571 656.734 1.00 111.92 ? 324  ASP C O     1 
ATOM   6091  C  CB    . ASP C 2  324  ? 463.635 -38.087 657.681 1.00 112.69 ? 324  ASP C CB    1 
ATOM   6092  C  CG    . ASP C 2  324  ? 463.225 -36.743 658.307 1.00 112.94 ? 324  ASP C CG    1 
ATOM   6093  O  OD1   . ASP C 2  324  ? 463.992 -36.185 659.120 1.00 106.23 ? 324  ASP C OD1   1 
ATOM   6094  O  OD2   . ASP C 2  324  ? 462.132 -36.234 657.965 1.00 120.44 ? 324  ASP C OD2   1 
ATOM   6095  N  N     . ILE C 2  325  ? 465.411 -36.017 655.480 1.00 111.34 ? 325  ILE C N     1 
ATOM   6096  C  CA    . ILE C 2  325  ? 466.653 -35.323 655.175 1.00 107.86 ? 325  ILE C CA    1 
ATOM   6097  C  C     . ILE C 2  325  ? 467.134 -34.467 656.333 1.00 103.95 ? 325  ILE C C     1 
ATOM   6098  O  O     . ILE C 2  325  ? 468.300 -34.063 656.342 1.00 105.13 ? 325  ILE C O     1 
ATOM   6099  C  CB    . ILE C 2  325  ? 466.485 -34.462 653.902 1.00 108.92 ? 325  ILE C CB    1 
ATOM   6100  C  CG1   . ILE C 2  325  ? 465.689 -33.192 654.194 1.00 110.54 ? 325  ILE C CG1   1 
ATOM   6101  C  CG2   . ILE C 2  325  ? 465.789 -35.226 652.808 1.00 105.19 ? 325  ILE C CG2   1 
ATOM   6102  C  CD1   . ILE C 2  325  ? 465.741 -32.177 653.082 1.00 104.32 ? 325  ILE C CD1   1 
ATOM   6103  N  N     . ASP C 2  326  ? 466.317 -34.251 657.359 1.00 102.34 ? 326  ASP C N     1 
ATOM   6104  C  CA    . ASP C 2  326  ? 466.786 -33.516 658.522 1.00 99.65  ? 326  ASP C CA    1 
ATOM   6105  C  C     . ASP C 2  326  ? 467.238 -34.435 659.644 1.00 95.24  ? 326  ASP C C     1 
ATOM   6106  O  O     . ASP C 2  326  ? 467.841 -33.957 660.614 1.00 89.71  ? 326  ASP C O     1 
ATOM   6107  C  CB    . ASP C 2  326  ? 465.660 -32.639 659.067 1.00 104.18 ? 326  ASP C CB    1 
ATOM   6108  C  CG    . ASP C 2  326  ? 465.204 -31.593 658.090 1.00 111.62 ? 326  ASP C CG    1 
ATOM   6109  O  OD1   . ASP C 2  326  ? 466.004 -30.686 657.773 1.00 115.89 ? 326  ASP C OD1   1 
ATOM   6110  O  OD2   . ASP C 2  326  ? 464.020 -31.658 657.677 1.00 112.78 ? 326  ASP C OD2   1 
ATOM   6111  N  N     . HIS C 2  327  ? 467.099 -35.746 659.455 1.00 94.81  ? 327  HIS C N     1 
ATOM   6112  C  CA    . HIS C 2  327  ? 467.591 -36.727 660.409 1.00 93.08  ? 327  HIS C CA    1 
ATOM   6113  C  C     . HIS C 2  327  ? 469.078 -36.549 660.595 1.00 90.97  ? 327  HIS C C     1 
ATOM   6114  O  O     . HIS C 2  327  ? 469.811 -36.378 659.628 1.00 100.72 ? 327  HIS C O     1 
ATOM   6115  C  CB    . HIS C 2  327  ? 467.282 -38.127 659.880 1.00 95.94  ? 327  HIS C CB    1 
ATOM   6116  C  CG    . HIS C 2  327  ? 467.410 -39.220 660.896 1.00 101.30 ? 327  HIS C CG    1 
ATOM   6117  N  ND1   . HIS C 2  327  ? 468.621 -39.767 661.270 1.00 106.09 ? 327  HIS C ND1   1 
ATOM   6118  C  CD2   . HIS C 2  327  ? 466.459 -39.893 661.595 1.00 95.16  ? 327  HIS C CD2   1 
ATOM   6119  C  CE1   . HIS C 2  327  ? 468.411 -40.717 662.169 1.00 105.53 ? 327  HIS C CE1   1 
ATOM   6120  N  NE2   . HIS C 2  327  ? 467.109 -40.815 662.380 1.00 100.13 ? 327  HIS C NE2   1 
ATOM   6121  N  N     . LEU C 2  328  ? 469.543 -36.641 661.830 1.00 88.84  ? 328  LEU C N     1 
ATOM   6122  C  CA    . LEU C 2  328  ? 470.943 -36.302 662.034 1.00 92.70  ? 328  LEU C CA    1 
ATOM   6123  C  C     . LEU C 2  328  ? 471.871 -37.436 661.604 1.00 101.36 ? 328  LEU C C     1 
ATOM   6124  O  O     . LEU C 2  328  ? 473.081 -37.361 661.889 1.00 97.31  ? 328  LEU C O     1 
ATOM   6125  C  CB    . LEU C 2  328  ? 471.263 -35.916 663.477 1.00 90.14  ? 328  LEU C CB    1 
ATOM   6126  C  CG    . LEU C 2  328  ? 470.948 -34.478 663.904 1.00 85.40  ? 328  LEU C CG    1 
ATOM   6127  C  CD1   . LEU C 2  328  ? 471.580 -34.149 665.265 1.00 87.02  ? 328  LEU C CD1   1 
ATOM   6128  C  CD2   . LEU C 2  328  ? 471.089 -33.393 662.871 1.00 76.59  ? 328  LEU C CD2   1 
ATOM   6129  N  N     . GLY C 2  329  ? 471.301 -38.536 661.077 1.00 99.62  ? 329  GLY C N     1 
ATOM   6130  C  CA    . GLY C 2  329  ? 472.084 -39.540 660.367 1.00 104.57 ? 329  GLY C CA    1 
ATOM   6131  C  C     . GLY C 2  329  ? 472.404 -39.186 658.917 1.00 107.95 ? 329  GLY C C     1 
ATOM   6132  O  O     . GLY C 2  329  ? 473.430 -39.626 658.379 1.00 108.64 ? 329  GLY C O     1 
ATOM   6133  N  N     . ASN C 2  330  ? 471.526 -38.425 658.256 1.00 100.23 ? 330  ASN C N     1 
ATOM   6134  C  CA    . ASN C 2  330  ? 471.710 -38.003 656.872 1.00 100.97 ? 330  ASN C CA    1 
ATOM   6135  C  C     . ASN C 2  330  ? 472.264 -36.590 656.788 1.00 102.12 ? 330  ASN C C     1 
ATOM   6136  O  O     . ASN C 2  330  ? 472.299 -36.001 655.701 1.00 99.22  ? 330  ASN C O     1 
ATOM   6137  C  CB    . ASN C 2  330  ? 470.409 -38.087 656.081 1.00 101.15 ? 330  ASN C CB    1 
ATOM   6138  C  CG    . ASN C 2  330  ? 469.754 -39.422 656.212 1.00 109.05 ? 330  ASN C CG    1 
ATOM   6139  O  OD1   . ASN C 2  330  ? 470.428 -40.445 656.234 1.00 113.93 ? 330  ASN C OD1   1 
ATOM   6140  N  ND2   . ASN C 2  330  ? 468.427 -39.437 656.165 1.00 115.73 ? 330  ASN C ND2   1 
ATOM   6141  N  N     . ARG C 2  331  ? 472.587 -36.002 657.930 1.00 97.00  ? 331  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2  331  ? 473.163 -34.677 658.020 1.00 92.33  ? 331  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2  331  ? 474.467 -34.814 658.778 1.00 93.92  ? 331  ARG C C     1 
ATOM   6144  O  O     . ARG C 2  331  ? 474.510 -35.487 659.808 1.00 104.72 ? 331  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2  331  ? 472.278 -33.687 658.759 1.00 91.31  ? 331  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2  331  ? 472.026 -32.497 657.915 1.00 97.32  ? 331  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2  331  ? 470.766 -31.737 658.215 1.00 94.89  ? 331  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2  331  ? 471.091 -30.697 659.194 1.00 91.71  ? 331  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2  331  ? 470.438 -29.542 659.306 1.00 98.29  ? 331  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2  331  ? 470.784 -28.646 660.222 1.00 103.85 ? 331  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2  331  ? 469.426 -29.281 658.504 1.00 103.39 ? 331  ARG C NH2   1 
ATOM   6152  N  N     . ARG C 2  332  ? 475.536 -34.258 658.241 1.00 93.31  ? 332  ARG C N     1 
ATOM   6153  C  CA    . ARG C 2  332  ? 476.865 -34.444 658.797 1.00 90.50  ? 332  ARG C CA    1 
ATOM   6154  C  C     . ARG C 2  332  ? 477.532 -33.087 658.996 1.00 92.18  ? 332  ARG C C     1 
ATOM   6155  O  O     . ARG C 2  332  ? 477.064 -32.064 658.480 1.00 91.30  ? 332  ARG C O     1 
ATOM   6156  C  CB    . ARG C 2  332  ? 477.699 -35.344 657.898 1.00 102.46 ? 332  ARG C CB    1 
ATOM   6157  C  CG    . ARG C 2  332  ? 478.044 -34.686 656.557 1.00 102.65 ? 332  ARG C CG    1 
ATOM   6158  C  CD    . ARG C 2  332  ? 478.861 -35.577 655.677 1.00 98.20  ? 332  ARG C CD    1 
ATOM   6159  N  NE    . ARG C 2  332  ? 480.162 -35.718 656.301 1.00 95.31  ? 332  ARG C NE    1 
ATOM   6160  C  CZ    . ARG C 2  332  ? 481.174 -34.902 656.064 1.00 95.76  ? 332  ARG C CZ    1 
ATOM   6161  N  NH1   . ARG C 2  332  ? 481.003 -33.891 655.227 1.00 93.10  ? 332  ARG C NH1   1 
ATOM   6162  N  NH2   . ARG C 2  332  ? 482.335 -35.085 656.680 1.00 94.54  ? 332  ARG C NH2   1 
ATOM   6163  N  N     . ILE C 2  333  ? 478.583 -33.085 659.826 1.00 90.59  ? 333  ILE C N     1 
ATOM   6164  C  CA    . ILE C 2  333  ? 479.350 -31.887 660.186 1.00 91.59  ? 333  ILE C CA    1 
ATOM   6165  C  C     . ILE C 2  333  ? 480.658 -31.793 659.409 1.00 97.34  ? 333  ILE C C     1 
ATOM   6166  O  O     . ILE C 2  333  ? 481.441 -32.751 659.402 1.00 100.05 ? 333  ILE C O     1 
ATOM   6167  C  CB    . ILE C 2  333  ? 479.651 -31.853 661.688 1.00 89.99  ? 333  ILE C CB    1 
ATOM   6168  C  CG1   . ILE C 2  333  ? 478.376 -32.065 662.490 1.00 92.20  ? 333  ILE C CG1   1 
ATOM   6169  C  CG2   . ILE C 2  333  ? 480.343 -30.540 662.038 1.00 92.56  ? 333  ILE C CG2   1 
ATOM   6170  C  CD1   . ILE C 2  333  ? 477.331 -30.994 662.226 1.00 90.54  ? 333  ILE C CD1   1 
ATOM   6171  N  N     . ARG C 2  334  ? 480.954 -30.600 658.853 1.00 94.97  ? 334  ARG C N     1 
ATOM   6172  C  CA    . ARG C 2  334  ? 482.254 -30.315 658.238 1.00 91.74  ? 334  ARG C CA    1 
ATOM   6173  C  C     . ARG C 2  334  ? 483.123 -29.483 659.184 1.00 85.33  ? 334  ARG C C     1 
ATOM   6174  O  O     . ARG C 2  334  ? 483.011 -28.252 659.198 1.00 78.88  ? 334  ARG C O     1 
ATOM   6175  C  CB    . ARG C 2  334  ? 482.069 -29.540 656.930 1.00 91.39  ? 334  ARG C CB    1 
ATOM   6176  C  CG    . ARG C 2  334  ? 481.193 -30.165 655.845 1.00 96.36  ? 334  ARG C CG    1 
ATOM   6177  C  CD    . ARG C 2  334  ? 481.958 -30.007 654.540 1.00 103.75 ? 334  ARG C CD    1 
ATOM   6178  N  NE    . ARG C 2  334  ? 481.944 -28.653 653.988 1.00 106.33 ? 334  ARG C NE    1 
ATOM   6179  C  CZ    . ARG C 2  334  ? 482.202 -28.363 652.716 1.00 108.58 ? 334  ARG C CZ    1 
ATOM   6180  N  NH1   . ARG C 2  334  ? 482.500 -29.331 651.855 1.00 104.15 ? 334  ARG C NH1   1 
ATOM   6181  N  NH2   . ARG C 2  334  ? 482.174 -27.102 652.308 1.00 113.40 ? 334  ARG C NH2   1 
ATOM   6182  N  N     . THR C 2  335  ? 484.134 -30.121 659.793 1.00 84.46  ? 335  THR C N     1 
ATOM   6183  C  CA    . THR C 2  335  ? 484.967 -29.477 660.807 1.00 88.01  ? 335  THR C CA    1 
ATOM   6184  C  C     . THR C 2  335  ? 486.139 -28.723 660.171 1.00 90.66  ? 335  THR C C     1 
ATOM   6185  O  O     . THR C 2  335  ? 486.290 -28.692 658.951 1.00 95.78  ? 335  THR C O     1 
ATOM   6186  C  CB    . THR C 2  335  ? 485.431 -30.488 661.858 1.00 89.23  ? 335  THR C CB    1 
ATOM   6187  O  OG1   . THR C 2  335  ? 485.831 -31.714 661.247 1.00 89.87  ? 335  THR C OG1   1 
ATOM   6188  C  CG2   . THR C 2  335  ? 484.306 -30.780 662.822 1.00 93.71  ? 335  THR C CG2   1 
ATOM   6189  N  N     . VAL C 2  336  ? 486.956 -28.068 661.011 1.00 88.81  ? 336  VAL C N     1 
ATOM   6190  C  CA    . VAL C 2  336  ? 488.059 -27.218 660.534 1.00 88.01  ? 336  VAL C CA    1 
ATOM   6191  C  C     . VAL C 2  336  ? 488.949 -27.916 659.508 1.00 99.56  ? 336  VAL C C     1 
ATOM   6192  O  O     . VAL C 2  336  ? 489.221 -27.373 658.427 1.00 101.13 ? 336  VAL C O     1 
ATOM   6193  C  CB    . VAL C 2  336  ? 488.907 -26.738 661.712 1.00 85.97  ? 336  VAL C CB    1 
ATOM   6194  C  CG1   . VAL C 2  336  ? 489.557 -25.427 661.354 1.00 75.71  ? 336  VAL C CG1   1 
ATOM   6195  C  CG2   . VAL C 2  336  ? 488.052 -26.681 662.961 1.00 98.29  ? 336  VAL C CG2   1 
ATOM   6196  N  N     . GLY C 2  337  ? 489.447 -29.116 659.832 1.00 101.16 ? 337  GLY C N     1 
ATOM   6197  C  CA    . GLY C 2  337  ? 490.341 -29.789 658.898 1.00 93.64  ? 337  GLY C CA    1 
ATOM   6198  C  C     . GLY C 2  337  ? 489.687 -29.940 657.541 1.00 95.42  ? 337  GLY C C     1 
ATOM   6199  O  O     . GLY C 2  337  ? 490.246 -29.567 656.511 1.00 93.92  ? 337  GLY C O     1 
ATOM   6200  N  N     . GLU C 2  338  ? 488.449 -30.408 657.538 1.00 95.40  ? 338  GLU C N     1 
ATOM   6201  C  CA    . GLU C 2  338  ? 487.753 -30.610 656.285 1.00 95.19  ? 338  GLU C CA    1 
ATOM   6202  C  C     . GLU C 2  338  ? 487.539 -29.282 655.554 1.00 93.95  ? 338  GLU C C     1 
ATOM   6203  O  O     . GLU C 2  338  ? 487.682 -29.215 654.329 1.00 95.70  ? 338  GLU C O     1 
ATOM   6204  C  CB    . GLU C 2  338  ? 486.449 -31.347 656.545 1.00 91.70  ? 338  GLU C CB    1 
ATOM   6205  C  CG    . GLU C 2  338  ? 485.674 -31.572 655.294 1.00 97.03  ? 338  GLU C CG    1 
ATOM   6206  C  CD    . GLU C 2  338  ? 484.571 -32.551 655.494 1.00 99.49  ? 338  GLU C CD    1 
ATOM   6207  O  OE1   . GLU C 2  338  ? 484.585 -33.263 656.525 1.00 99.44  ? 338  GLU C OE1   1 
ATOM   6208  O  OE2   . GLU C 2  338  ? 483.722 -32.643 654.593 1.00 107.07 ? 338  GLU C OE2   1 
ATOM   6209  N  N     . LEU C 2  339  ? 487.157 -28.222 656.271 1.00 93.26  ? 339  LEU C N     1 
ATOM   6210  C  CA    . LEU C 2  339  ? 486.920 -26.946 655.597 1.00 95.23  ? 339  LEU C CA    1 
ATOM   6211  C  C     . LEU C 2  339  ? 488.186 -26.423 654.959 1.00 93.31  ? 339  LEU C C     1 
ATOM   6212  O  O     . LEU C 2  339  ? 488.168 -25.999 653.801 1.00 94.68  ? 339  LEU C O     1 
ATOM   6213  C  CB    . LEU C 2  339  ? 486.382 -25.900 656.561 1.00 93.37  ? 339  LEU C CB    1 
ATOM   6214  C  CG    . LEU C 2  339  ? 485.118 -26.247 657.324 1.00 95.48  ? 339  LEU C CG    1 
ATOM   6215  C  CD1   . LEU C 2  339  ? 484.908 -25.187 658.395 1.00 90.13  ? 339  LEU C CD1   1 
ATOM   6216  C  CD2   . LEU C 2  339  ? 483.937 -26.364 656.363 1.00 91.18  ? 339  LEU C CD2   1 
ATOM   6217  N  N     . MET C 2  340  ? 489.261 -26.323 655.743 1.00 93.88  ? 340  MET C N     1 
ATOM   6218  C  CA    . MET C 2  340  ? 490.569 -25.923 655.215 1.00 99.74  ? 340  MET C CA    1 
ATOM   6219  C  C     . MET C 2  340  ? 491.052 -26.835 654.075 1.00 100.61 ? 340  MET C C     1 
ATOM   6220  O  O     . MET C 2  340  ? 491.610 -26.361 653.073 1.00 97.47  ? 340  MET C O     1 
ATOM   6221  C  CB    . MET C 2  340  ? 491.606 -25.891 656.341 1.00 98.00  ? 340  MET C CB    1 
ATOM   6222  C  CG    . MET C 2  340  ? 493.008 -25.518 655.861 1.00 97.98  ? 340  MET C CG    1 
ATOM   6223  S  SD    . MET C 2  340  ? 493.883 -26.976 655.240 1.00 98.88  ? 340  MET C SD    1 
ATOM   6224  C  CE    . MET C 2  340  ? 495.549 -26.730 655.860 1.00 96.04  ? 340  MET C CE    1 
ATOM   6225  N  N     . THR C 2  341  ? 490.931 -28.159 654.256 1.00 100.82 ? 341  THR C N     1 
ATOM   6226  C  CA    . THR C 2  341  ? 491.379 -29.091 653.224 1.00 95.32  ? 341  THR C CA    1 
ATOM   6227  C  C     . THR C 2  341  ? 490.627 -28.885 651.915 1.00 93.53  ? 341  THR C C     1 
ATOM   6228  O  O     . THR C 2  341  ? 491.217 -28.979 650.846 1.00 101.00 ? 341  THR C O     1 
ATOM   6229  C  CB    . THR C 2  341  ? 491.231 -30.528 653.723 1.00 98.86  ? 341  THR C CB    1 
ATOM   6230  O  OG1   . THR C 2  341  ? 492.124 -30.745 654.828 1.00 92.68  ? 341  THR C OG1   1 
ATOM   6231  C  CG2   . THR C 2  341  ? 491.525 -31.520 652.602 1.00 104.58 ? 341  THR C CG2   1 
ATOM   6232  N  N     . ASP C 2  342  ? 489.339 -28.571 651.962 1.00 95.80  ? 342  ASP C N     1 
ATOM   6233  C  CA    . ASP C 2  342  ? 488.652 -28.257 650.717 1.00 97.08  ? 342  ASP C CA    1 
ATOM   6234  C  C     . ASP C 2  342  ? 489.323 -27.067 650.043 1.00 94.04  ? 342  ASP C C     1 
ATOM   6235  O  O     . ASP C 2  342  ? 489.574 -27.087 648.838 1.00 102.24 ? 342  ASP C O     1 
ATOM   6236  C  CB    . ASP C 2  342  ? 487.155 -28.034 650.916 1.00 102.94 ? 342  ASP C CB    1 
ATOM   6237  C  CG    . ASP C 2  342  ? 486.315 -29.124 650.223 1.00 105.67 ? 342  ASP C CG    1 
ATOM   6238  O  OD1   . ASP C 2  342  ? 486.607 -30.331 650.425 1.00 103.85 ? 342  ASP C OD1   1 
ATOM   6239  O  OD2   . ASP C 2  342  ? 485.423 -28.772 649.415 1.00 104.22 ? 342  ASP C OD2   1 
ATOM   6240  N  N     . GLN C 2  343  ? 489.580 -26.003 650.793 1.00 87.24  ? 343  GLN C N     1 
ATOM   6241  C  CA    . GLN C 2  343  ? 490.272 -24.857 650.214 1.00 92.05  ? 343  GLN C CA    1 
ATOM   6242  C  C     . GLN C 2  343  ? 491.685 -25.199 649.784 1.00 99.39  ? 343  GLN C C     1 
ATOM   6243  O  O     . GLN C 2  343  ? 492.201 -24.593 648.837 1.00 102.03 ? 343  GLN C O     1 
ATOM   6244  C  CB    . GLN C 2  343  ? 490.284 -23.690 651.183 1.00 93.41  ? 343  GLN C CB    1 
ATOM   6245  C  CG    . GLN C 2  343  ? 488.959 -23.020 651.233 1.00 96.36  ? 343  GLN C CG    1 
ATOM   6246  C  CD    . GLN C 2  343  ? 488.396 -22.841 649.844 1.00 91.70  ? 343  GLN C CD    1 
ATOM   6247  O  OE1   . GLN C 2  343  ? 487.643 -23.679 649.325 1.00 92.14  ? 343  GLN C OE1   1 
ATOM   6248  N  NE2   . GLN C 2  343  ? 488.757 -21.724 649.228 1.00 86.62  ? 343  GLN C NE2   1 
ATOM   6249  N  N     . PHE C 2  344  ? 492.356 -26.084 650.517 1.00 100.77 ? 344  PHE C N     1 
ATOM   6250  C  CA    . PHE C 2  344  ? 493.687 -26.542 650.107 1.00 103.05 ? 344  PHE C CA    1 
ATOM   6251  C  C     . PHE C 2  344  ? 493.627 -27.227 648.737 1.00 101.94 ? 344  PHE C C     1 
ATOM   6252  O  O     . PHE C 2  344  ? 494.478 -26.995 647.876 1.00 101.58 ? 344  PHE C O     1 
ATOM   6253  C  CB    . PHE C 2  344  ? 494.251 -27.439 651.201 1.00 103.99 ? 344  PHE C CB    1 
ATOM   6254  C  CG    . PHE C 2  344  ? 495.688 -27.767 651.045 1.00 102.21 ? 344  PHE C CG    1 
ATOM   6255  C  CD1   . PHE C 2  344  ? 496.097 -28.899 650.392 1.00 111.59 ? 344  PHE C CD1   1 
ATOM   6256  C  CD2   . PHE C 2  344  ? 496.643 -26.893 651.544 1.00 99.70  ? 344  PHE C CD2   1 
ATOM   6257  C  CE1   . PHE C 2  344  ? 497.450 -29.180 650.276 1.00 116.61 ? 344  PHE C CE1   1 
ATOM   6258  C  CE2   . PHE C 2  344  ? 497.975 -27.158 651.429 1.00 102.59 ? 344  PHE C CE2   1 
ATOM   6259  C  CZ    . PHE C 2  344  ? 498.390 -28.300 650.789 1.00 107.78 ? 344  PHE C CZ    1 
ATOM   6260  N  N     . ARG C 2  345  ? 492.627 -28.087 648.536 1.00 103.75 ? 345  ARG C N     1 
ATOM   6261  C  CA    . ARG C 2  345  ? 492.434 -28.802 647.280 1.00 98.90  ? 345  ARG C CA    1 
ATOM   6262  C  C     . ARG C 2  345  ? 492.210 -27.827 646.125 1.00 99.49  ? 345  ARG C C     1 
ATOM   6263  O  O     . ARG C 2  345  ? 492.644 -28.078 645.001 1.00 103.03 ? 345  ARG C O     1 
ATOM   6264  C  CB    . ARG C 2  345  ? 491.242 -29.740 647.425 1.00 102.08 ? 345  ARG C CB    1 
ATOM   6265  C  CG    . ARG C 2  345  ? 490.802 -30.431 646.188 1.00 109.53 ? 345  ARG C CG    1 
ATOM   6266  C  CD    . ARG C 2  345  ? 489.772 -31.500 646.522 1.00 120.51 ? 345  ARG C CD    1 
ATOM   6267  N  NE    . ARG C 2  345  ? 490.272 -32.535 647.432 1.00 125.96 ? 345  ARG C NE    1 
ATOM   6268  C  CZ    . ARG C 2  345  ? 489.937 -32.632 648.724 1.00 126.41 ? 345  ARG C CZ    1 
ATOM   6269  N  NH1   . ARG C 2  345  ? 489.090 -31.757 649.262 1.00 124.27 ? 345  ARG C NH1   1 
ATOM   6270  N  NH2   . ARG C 2  345  ? 490.442 -33.602 649.489 1.00 124.99 ? 345  ARG C NH2   1 
ATOM   6271  N  N     . VAL C 2  346  ? 491.460 -26.752 646.356 1.00 103.10 ? 346  VAL C N     1 
ATOM   6272  C  CA    . VAL C 2  346  ? 491.284 -25.730 645.320 1.00 106.80 ? 346  VAL C CA    1 
ATOM   6273  C  C     . VAL C 2  346  ? 492.623 -25.088 644.930 1.00 109.62 ? 346  VAL C C     1 
ATOM   6274  O  O     . VAL C 2  346  ? 492.943 -24.962 643.741 1.00 111.21 ? 346  VAL C O     1 
ATOM   6275  C  CB    . VAL C 2  346  ? 490.248 -24.682 645.771 1.00 98.19  ? 346  VAL C CB    1 
ATOM   6276  C  CG1   . VAL C 2  346  ? 490.348 -23.434 644.920 1.00 104.60 ? 346  VAL C CG1   1 
ATOM   6277  C  CG2   . VAL C 2  346  ? 488.855 -25.252 645.619 1.00 94.78  ? 346  VAL C CG2   1 
ATOM   6278  N  N     . GLY C 2  347  ? 493.389 -24.598 645.916 1.00 110.40 ? 347  GLY C N     1 
ATOM   6279  C  CA    . GLY C 2  347  ? 494.698 -24.013 645.625 1.00 108.11 ? 347  GLY C CA    1 
ATOM   6280  C  C     . GLY C 2  347  ? 495.667 -24.937 644.904 1.00 112.50 ? 347  GLY C C     1 
ATOM   6281  O  O     . GLY C 2  347  ? 496.468 -24.485 644.081 1.00 113.65 ? 347  GLY C O     1 
ATOM   6282  N  N     . LEU C 2  348  ? 495.600 -26.240 645.186 1.00 111.62 ? 348  LEU C N     1 
ATOM   6283  C  CA    . LEU C 2  348  ? 496.479 -27.201 644.528 1.00 108.99 ? 348  LEU C CA    1 
ATOM   6284  C  C     . LEU C 2  348  ? 496.116 -27.353 643.062 1.00 111.98 ? 348  LEU C C     1 
ATOM   6285  O  O     . LEU C 2  348  ? 496.991 -27.409 642.196 1.00 117.68 ? 348  LEU C O     1 
ATOM   6286  C  CB    . LEU C 2  348  ? 496.380 -28.559 645.215 1.00 106.63 ? 348  LEU C CB    1 
ATOM   6287  C  CG    . LEU C 2  348  ? 497.671 -29.297 645.531 1.00 112.61 ? 348  LEU C CG    1 
ATOM   6288  C  CD1   . LEU C 2  348  ? 498.616 -28.341 646.250 1.00 108.65 ? 348  LEU C CD1   1 
ATOM   6289  C  CD2   . LEU C 2  348  ? 497.401 -30.533 646.370 1.00 113.27 ? 348  LEU C CD2   1 
ATOM   6290  N  N     . ALA C 2  349  ? 494.827 -27.447 642.772 1.00 111.50 ? 349  ALA C N     1 
ATOM   6291  C  CA    . ALA C 2  349  ? 494.372 -27.531 641.393 1.00 113.01 ? 349  ALA C CA    1 
ATOM   6292  C  C     . ALA C 2  349  ? 494.760 -26.301 640.582 1.00 112.81 ? 349  ALA C C     1 
ATOM   6293  O  O     . ALA C 2  349  ? 495.024 -26.419 639.382 1.00 122.20 ? 349  ALA C O     1 
ATOM   6294  C  CB    . ALA C 2  349  ? 492.866 -27.761 641.352 1.00 116.59 ? 349  ALA C CB    1 
ATOM   6295  N  N     . ARG C 2  350  ? 494.709 -25.101 641.174 1.00 108.04 ? 350  ARG C N     1 
ATOM   6296  C  CA    . ARG C 2  350  ? 495.146 -23.910 640.434 1.00 118.69 ? 350  ARG C CA    1 
ATOM   6297  C  C     . ARG C 2  350  ? 496.634 -23.955 640.074 1.00 121.34 ? 350  ARG C C     1 
ATOM   6298  O  O     . ARG C 2  350  ? 497.020 -23.652 638.934 1.00 112.94 ? 350  ARG C O     1 
ATOM   6299  C  CB    . ARG C 2  350  ? 494.846 -22.653 641.246 1.00 115.40 ? 350  ARG C CB    1 
ATOM   6300  C  CG    . ARG C 2  350  ? 493.389 -22.443 641.513 1.00 118.00 ? 350  ARG C CG    1 
ATOM   6301  C  CD    . ARG C 2  350  ? 492.945 -21.023 641.201 1.00 120.19 ? 350  ARG C CD    1 
ATOM   6302  N  NE    . ARG C 2  350  ? 491.507 -20.875 641.450 1.00 132.46 ? 350  ARG C NE    1 
ATOM   6303  C  CZ    . ARG C 2  350  ? 490.948 -20.669 642.648 1.00 122.83 ? 350  ARG C CZ    1 
ATOM   6304  N  NH1   . ARG C 2  350  ? 491.685 -20.592 643.756 1.00 114.70 ? 350  ARG C NH1   1 
ATOM   6305  N  NH2   . ARG C 2  350  ? 489.631 -20.556 642.736 1.00 114.19 ? 350  ARG C NH2   1 
ATOM   6306  N  N     . LEU C 2  351  ? 497.485 -24.311 641.049 1.00 120.23 ? 351  LEU C N     1 
ATOM   6307  C  CA    . LEU C 2  351  ? 498.916 -24.509 640.803 1.00 117.54 ? 351  LEU C CA    1 
ATOM   6308  C  C     . LEU C 2  351  ? 499.176 -25.508 639.666 1.00 118.41 ? 351  LEU C C     1 
ATOM   6309  O  O     . LEU C 2  351  ? 500.140 -25.353 638.907 1.00 119.00 ? 351  LEU C O     1 
ATOM   6310  C  CB    . LEU C 2  351  ? 499.596 -24.898 642.126 1.00 110.98 ? 351  LEU C CB    1 
ATOM   6311  C  CG    . LEU C 2  351  ? 501.074 -25.255 642.309 1.00 108.05 ? 351  LEU C CG    1 
ATOM   6312  C  CD1   . LEU C 2  351  ? 501.607 -24.692 643.619 1.00 104.38 ? 351  LEU C CD1   1 
ATOM   6313  C  CD2   . LEU C 2  351  ? 501.218 -26.742 642.339 1.00 106.55 ? 351  LEU C CD2   1 
ATOM   6314  N  N     . ALA C 2  352  ? 498.351 -26.562 639.567 1.00 116.61 ? 352  ALA C N     1 
ATOM   6315  C  CA    . ALA C 2  352  ? 498.465 -27.543 638.486 1.00 118.06 ? 352  ALA C CA    1 
ATOM   6316  C  C     . ALA C 2  352  ? 498.180 -26.908 637.132 1.00 124.53 ? 352  ALA C C     1 
ATOM   6317  O  O     . ALA C 2  352  ? 498.792 -27.281 636.130 1.00 131.97 ? 352  ALA C O     1 
ATOM   6318  C  CB    . ALA C 2  352  ? 497.538 -28.730 638.720 1.00 120.90 ? 352  ALA C CB    1 
ATOM   6319  N  N     . ARG C 2  353  ? 497.207 -25.999 637.066 1.00 122.77 ? 353  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  353  ? 496.985 -25.259 635.829 1.00 127.33 ? 353  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  353  ? 498.275 -24.587 635.343 1.00 134.80 ? 353  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  353  ? 498.610 -24.645 634.153 1.00 140.48 ? 353  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  353  ? 495.883 -24.215 636.027 1.00 125.28 ? 353  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  353  ? 495.594 -23.484 634.748 1.00 135.18 ? 353  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  353  ? 495.741 -21.971 634.940 1.00 137.78 ? 353  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  353  ? 495.847 -21.285 633.649 1.00 147.19 ? 353  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  353  ? 495.864 -19.965 633.487 1.00 143.40 ? 353  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  353  ? 495.772 -19.168 634.551 1.00 139.09 ? 353  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  353  ? 495.987 -19.451 632.258 1.00 129.71 ? 353  ARG C NH2   1 
ATOM   6330  N  N     . GLY C 2  354  ? 498.997 -23.923 636.252 1.00 132.21 ? 354  GLY C N     1 
ATOM   6331  C  CA    . GLY C 2  354  ? 500.284 -23.332 635.899 1.00 134.51 ? 354  GLY C CA    1 
ATOM   6332  C  C     . GLY C 2  354  ? 501.310 -24.340 635.402 1.00 136.82 ? 354  GLY C C     1 
ATOM   6333  O  O     . GLY C 2  354  ? 502.096 -24.042 634.501 1.00 137.40 ? 354  GLY C O     1 
ATOM   6334  N  N     . VAL C 2  355  ? 501.367 -25.519 636.037 1.00 133.65 ? 355  VAL C N     1 
ATOM   6335  C  CA    . VAL C 2  355  ? 502.273 -26.589 635.611 1.00 127.36 ? 355  VAL C CA    1 
ATOM   6336  C  C     . VAL C 2  355  ? 501.972 -27.074 634.194 1.00 138.19 ? 355  VAL C C     1 
ATOM   6337  O  O     . VAL C 2  355  ? 502.870 -27.110 633.345 1.00 148.28 ? 355  VAL C O     1 
ATOM   6338  C  CB    . VAL C 2  355  ? 502.252 -27.737 636.632 1.00 122.11 ? 355  VAL C CB    1 
ATOM   6339  C  CG1   . VAL C 2  355  ? 502.767 -28.997 636.033 1.00 126.17 ? 355  VAL C CG1   1 
ATOM   6340  C  CG2   . VAL C 2  355  ? 503.179 -27.371 637.760 1.00 121.24 ? 355  VAL C CG2   1 
ATOM   6341  N  N     . ARG C 2  356  ? 500.729 -27.465 633.905 1.00 134.03 ? 356  ARG C N     1 
ATOM   6342  C  CA    . ARG C 2  356  ? 500.442 -27.913 632.541 1.00 135.83 ? 356  ARG C CA    1 
ATOM   6343  C  C     . ARG C 2  356  ? 500.763 -26.814 631.547 1.00 145.19 ? 356  ARG C C     1 
ATOM   6344  O  O     . ARG C 2  356  ? 501.300 -27.082 630.465 1.00 149.57 ? 356  ARG C O     1 
ATOM   6345  C  CB    . ARG C 2  356  ? 499.002 -28.371 632.389 1.00 132.10 ? 356  ARG C CB    1 
ATOM   6346  C  CG    . ARG C 2  356  ? 498.602 -29.316 633.463 1.00 140.13 ? 356  ARG C CG    1 
ATOM   6347  C  CD    . ARG C 2  356  ? 497.186 -29.769 633.283 1.00 142.76 ? 356  ARG C CD    1 
ATOM   6348  N  NE    . ARG C 2  356  ? 496.763 -30.539 634.443 1.00 144.55 ? 356  ARG C NE    1 
ATOM   6349  C  CZ    . ARG C 2  356  ? 496.088 -29.991 635.455 1.00 142.27 ? 356  ARG C CZ    1 
ATOM   6350  N  NH1   . ARG C 2  356  ? 495.780 -28.694 635.409 1.00 135.42 ? 356  ARG C NH1   1 
ATOM   6351  N  NH2   . ARG C 2  356  ? 495.721 -30.723 636.504 1.00 140.50 ? 356  ARG C NH2   1 
ATOM   6352  N  N     . GLU C 2  357  ? 500.456 -25.563 631.902 1.00 143.74 ? 357  GLU C N     1 
ATOM   6353  C  CA    . GLU C 2  357  ? 500.765 -24.466 630.995 1.00 148.69 ? 357  GLU C CA    1 
ATOM   6354  C  C     . GLU C 2  357  ? 502.258 -24.218 630.865 1.00 148.10 ? 357  GLU C C     1 
ATOM   6355  O  O     . GLU C 2  357  ? 502.719 -23.829 629.787 1.00 151.43 ? 357  GLU C O     1 
ATOM   6356  C  CB    . GLU C 2  357  ? 500.116 -23.184 631.507 1.00 151.56 ? 357  GLU C CB    1 
ATOM   6357  C  CG    . GLU C 2  357  ? 500.082 -22.047 630.512 1.00 152.18 ? 357  GLU C CG    1 
ATOM   6358  C  CD    . GLU C 2  357  ? 499.613 -20.757 631.157 1.00 154.16 ? 357  GLU C CD    1 
ATOM   6359  O  OE1   . GLU C 2  357  ? 498.983 -20.811 632.243 1.00 152.17 ? 357  GLU C OE1   1 
ATOM   6360  O  OE2   . GLU C 2  357  ? 499.932 -19.684 630.605 1.00 157.87 ? 357  GLU C OE2   1 
ATOM   6361  N  N     . ARG C 2  358  ? 503.032 -24.414 631.932 1.00 146.81 ? 358  ARG C N     1 
ATOM   6362  C  CA    . ARG C 2  358  ? 504.469 -24.238 631.785 1.00 145.71 ? 358  ARG C CA    1 
ATOM   6363  C  C     . ARG C 2  358  ? 505.133 -25.435 631.117 1.00 148.69 ? 358  ARG C C     1 
ATOM   6364  O  O     . ARG C 2  358  ? 506.269 -25.303 630.644 1.00 148.32 ? 358  ARG C O     1 
ATOM   6365  C  CB    . ARG C 2  358  ? 505.091 -23.963 633.153 1.00 142.85 ? 358  ARG C CB    1 
ATOM   6366  C  CG    . ARG C 2  358  ? 505.885 -22.667 633.255 1.00 140.38 ? 358  ARG C CG    1 
ATOM   6367  C  CD    . ARG C 2  358  ? 506.183 -22.365 634.730 1.00 140.22 ? 358  ARG C CD    1 
ATOM   6368  N  NE    . ARG C 2  358  ? 504.938 -21.992 635.405 1.00 138.00 ? 358  ARG C NE    1 
ATOM   6369  C  CZ    . ARG C 2  358  ? 504.781 -20.940 636.199 1.00 128.28 ? 358  ARG C CZ    1 
ATOM   6370  N  NH1   . ARG C 2  358  ? 505.794 -20.119 636.453 1.00 124.19 ? 358  ARG C NH1   1 
ATOM   6371  N  NH2   . ARG C 2  358  ? 503.590 -20.707 636.727 1.00 129.69 ? 358  ARG C NH2   1 
ATOM   6372  N  N     . MET C 2  359  ? 504.465 -26.600 631.072 1.00 146.70 ? 359  MET C N     1 
ATOM   6373  C  CA    . MET C 2  359  ? 505.085 -27.747 630.425 1.00 150.29 ? 359  MET C CA    1 
ATOM   6374  C  C     . MET C 2  359  ? 504.830 -27.763 628.921 1.00 154.70 ? 359  MET C C     1 
ATOM   6375  O  O     . MET C 2  359  ? 505.292 -28.679 628.227 1.00 155.65 ? 359  MET C O     1 
ATOM   6376  C  CB    . MET C 2  359  ? 504.481 -29.035 631.006 1.00 143.51 ? 359  MET C CB    1 
ATOM   6377  C  CG    . MET C 2  359  ? 504.850 -29.411 632.427 1.00 137.12 ? 359  MET C CG    1 
ATOM   6378  S  SD    . MET C 2  359  ? 504.429 -31.149 632.747 1.00 140.95 ? 359  MET C SD    1 
ATOM   6379  C  CE    . MET C 2  359  ? 502.706 -31.168 632.271 1.00 151.34 ? 359  MET C CE    1 
ATOM   6380  N  N     . LEU C 2  360  ? 504.095 -26.774 628.412 1.00 153.63 ? 360  LEU C N     1 
ATOM   6381  C  CA    . LEU C 2  360  ? 503.806 -26.596 626.997 1.00 146.87 ? 360  LEU C CA    1 
ATOM   6382  C  C     . LEU C 2  360  ? 504.473 -25.351 626.429 1.00 144.93 ? 360  LEU C C     1 
ATOM   6383  O  O     . LEU C 2  360  ? 503.956 -24.766 625.476 1.00 138.57 ? 360  LEU C O     1 
ATOM   6384  C  CB    . LEU C 2  360  ? 502.296 -26.610 626.754 1.00 150.69 ? 360  LEU C CB    1 
ATOM   6385  C  CG    . LEU C 2  360  ? 501.684 -28.015 626.537 1.00 151.82 ? 360  LEU C CG    1 
ATOM   6386  C  CD1   . LEU C 2  360  ? 501.990 -29.037 627.654 1.00 151.28 ? 360  LEU C CD1   1 
ATOM   6387  C  CD2   . LEU C 2  360  ? 500.175 -27.932 626.303 1.00 150.90 ? 360  LEU C CD2   1 
ATOM   6388  N  N     . MET C 2  361  ? 505.540 -24.866 627.061 1.00 152.95 ? 361  MET C N     1 
ATOM   6389  C  CA    . MET C 2  361  ? 506.229 -23.673 626.573 1.00 162.34 ? 361  MET C CA    1 
ATOM   6390  C  C     . MET C 2  361  ? 507.754 -23.842 626.580 1.00 169.88 ? 361  MET C C     1 
ATOM   6391  O  O     . MET C 2  361  ? 508.283 -24.718 625.885 1.00 167.96 ? 361  MET C O     1 
ATOM   6392  C  CB    . MET C 2  361  ? 505.792 -22.447 627.393 1.00 157.40 ? 361  MET C CB    1 
ATOM   6393  C  CG    . MET C 2  361  ? 504.332 -22.033 627.153 1.00 154.23 ? 361  MET C CG    1 
ATOM   6394  S  SD    . MET C 2  361  ? 504.079 -20.531 626.170 1.00 150.94 ? 361  MET C SD    1 
ATOM   6395  C  CE    . MET C 2  361  ? 504.875 -19.289 627.197 1.00 148.31 ? 361  MET C CE    1 
ATOM   6396  N  N     . GLY C 2  362  ? 508.465 -23.007 627.349 1.00 172.25 ? 362  GLY C N     1 
ATOM   6397  C  CA    . GLY C 2  362  ? 509.921 -23.028 627.464 1.00 172.00 ? 362  GLY C CA    1 
ATOM   6398  C  C     . GLY C 2  362  ? 510.610 -24.381 627.545 1.00 176.93 ? 362  GLY C C     1 
ATOM   6399  O  O     . GLY C 2  362  ? 510.705 -24.969 628.624 1.00 175.01 ? 362  GLY C O     1 
ATOM   6400  N  N     . SER C 2  363  ? 511.185 -24.808 626.416 1.00 187.13 ? 363  SER C N     1 
ATOM   6401  C  CA    . SER C 2  363  ? 511.936 -26.047 626.175 1.00 188.18 ? 363  SER C CA    1 
ATOM   6402  C  C     . SER C 2  363  ? 511.546 -27.281 626.990 1.00 183.83 ? 363  SER C C     1 
ATOM   6403  O  O     . SER C 2  363  ? 511.673 -27.285 628.218 1.00 181.07 ? 363  SER C O     1 
ATOM   6404  C  CB    . SER C 2  363  ? 513.430 -25.781 626.414 1.00 185.55 ? 363  SER C CB    1 
ATOM   6405  O  OG    . SER C 2  363  ? 513.660 -25.182 627.682 1.00 176.89 ? 363  SER C OG    1 
ATOM   6406  N  N     . GLU C 2  364  ? 511.177 -28.373 626.296 1.00 183.49 ? 364  GLU C N     1 
ATOM   6407  C  CA    . GLU C 2  364  ? 510.771 -29.629 626.934 1.00 183.98 ? 364  GLU C CA    1 
ATOM   6408  C  C     . GLU C 2  364  ? 511.940 -30.428 627.493 1.00 185.14 ? 364  GLU C C     1 
ATOM   6409  O  O     . GLU C 2  364  ? 512.023 -31.641 627.271 1.00 181.41 ? 364  GLU C O     1 
ATOM   6410  C  CB    . GLU C 2  364  ? 510.007 -30.568 625.985 1.00 179.32 ? 364  GLU C CB    1 
ATOM   6411  C  CG    . GLU C 2  364  ? 508.714 -31.117 626.591 1.00 176.62 ? 364  GLU C CG    1 
ATOM   6412  C  CD    . GLU C 2  364  ? 508.001 -32.143 625.718 1.00 172.53 ? 364  GLU C CD    1 
ATOM   6413  O  OE1   . GLU C 2  364  ? 507.238 -32.960 626.276 1.00 177.10 ? 364  GLU C OE1   1 
ATOM   6414  O  OE2   . GLU C 2  364  ? 508.195 -32.149 624.492 1.00 165.79 ? 364  GLU C OE2   1 
ATOM   6415  N  N     . ASP C 2  365  ? 512.836 -29.770 628.223 1.00 186.37 ? 365  ASP C N     1 
ATOM   6416  C  CA    . ASP C 2  365  ? 514.009 -30.445 628.762 1.00 186.12 ? 365  ASP C CA    1 
ATOM   6417  C  C     . ASP C 2  365  ? 514.627 -29.620 629.879 1.00 184.16 ? 365  ASP C C     1 
ATOM   6418  O  O     . ASP C 2  365  ? 514.818 -30.126 630.993 1.00 183.74 ? 365  ASP C O     1 
ATOM   6419  C  CB    . ASP C 2  365  ? 515.049 -30.761 627.698 1.00 185.70 ? 365  ASP C CB    1 
ATOM   6420  C  CG    . ASP C 2  365  ? 516.051 -31.792 628.185 1.00 188.77 ? 365  ASP C CG    1 
ATOM   6421  O  OD1   . ASP C 2  365  ? 515.809 -33.001 627.973 1.00 186.81 ? 365  ASP C OD1   1 
ATOM   6422  O  OD2   . ASP C 2  365  ? 517.058 -31.398 628.812 1.00 190.00 ? 365  ASP C OD2   1 
ATOM   6423  N  N     . SER C 2  366  ? 514.983 -28.364 629.599 1.00 179.59 ? 366  SER C N     1 
ATOM   6424  C  CA    . SER C 2  366  ? 515.695 -27.589 630.607 1.00 175.81 ? 366  SER C CA    1 
ATOM   6425  C  C     . SER C 2  366  ? 514.636 -26.951 631.502 1.00 176.40 ? 366  SER C C     1 
ATOM   6426  O  O     . SER C 2  366  ? 514.313 -25.763 631.411 1.00 178.06 ? 366  SER C O     1 
ATOM   6427  C  CB    . SER C 2  366  ? 516.589 -26.555 629.932 1.00 171.52 ? 366  SER C CB    1 
ATOM   6428  O  OG    . SER C 2  366  ? 517.010 -25.547 630.829 1.00 165.82 ? 366  SER C OG    1 
ATOM   6429  N  N     . LEU C 2  367  ? 514.100 -27.792 632.396 1.00 171.93 ? 367  LEU C N     1 
ATOM   6430  C  CA    . LEU C 2  367  ? 513.156 -27.438 633.450 1.00 157.92 ? 367  LEU C CA    1 
ATOM   6431  C  C     . LEU C 2  367  ? 513.369 -28.405 634.605 1.00 154.84 ? 367  LEU C C     1 
ATOM   6432  O  O     . LEU C 2  367  ? 513.463 -29.617 634.382 1.00 153.84 ? 367  LEU C O     1 
ATOM   6433  C  CB    . LEU C 2  367  ? 511.697 -27.485 632.977 1.00 153.97 ? 367  LEU C CB    1 
ATOM   6434  C  CG    . LEU C 2  367  ? 511.230 -26.387 632.014 1.00 158.93 ? 367  LEU C CG    1 
ATOM   6435  C  CD1   . LEU C 2  367  ? 509.797 -26.622 631.560 1.00 157.31 ? 367  LEU C CD1   1 
ATOM   6436  C  CD2   . LEU C 2  367  ? 511.393 -24.997 632.612 1.00 156.96 ? 367  LEU C CD2   1 
ATOM   6437  N  N     . THR C 2  368  ? 513.434 -27.868 635.828 1.00 151.18 ? 368  THR C N     1 
ATOM   6438  C  CA    . THR C 2  368  ? 513.455 -28.584 637.104 1.00 144.49 ? 368  THR C CA    1 
ATOM   6439  C  C     . THR C 2  368  ? 512.074 -28.471 637.756 1.00 144.18 ? 368  THR C C     1 
ATOM   6440  O  O     . THR C 2  368  ? 511.208 -27.760 637.221 1.00 137.89 ? 368  THR C O     1 
ATOM   6441  C  CB    . THR C 2  368  ? 514.582 -28.064 638.016 1.00 142.78 ? 368  THR C CB    1 
ATOM   6442  O  OG1   . THR C 2  368  ? 514.500 -26.637 638.156 1.00 140.29 ? 368  THR C OG1   1 
ATOM   6443  C  CG2   . THR C 2  368  ? 515.964 -28.490 637.514 1.00 141.19 ? 368  THR C CG2   1 
ATOM   6444  N  N     . PRO C 2  369  ? 511.811 -29.130 638.899 1.00 145.33 ? 369  PRO C N     1 
ATOM   6445  C  CA    . PRO C 2  369  ? 510.553 -28.839 639.595 1.00 129.81 ? 369  PRO C CA    1 
ATOM   6446  C  C     . PRO C 2  369  ? 510.486 -27.461 640.207 1.00 123.55 ? 369  PRO C C     1 
ATOM   6447  O  O     . PRO C 2  369  ? 509.407 -26.868 640.179 1.00 121.76 ? 369  PRO C O     1 
ATOM   6448  C  CB    . PRO C 2  369  ? 510.512 -29.906 640.698 1.00 127.42 ? 369  PRO C CB    1 
ATOM   6449  C  CG    . PRO C 2  369  ? 511.283 -31.013 640.186 1.00 135.62 ? 369  PRO C CG    1 
ATOM   6450  C  CD    . PRO C 2  369  ? 512.415 -30.373 639.420 1.00 144.07 ? 369  PRO C CD    1 
ATOM   6451  N  N     . ALA C 2  370  ? 511.598 -26.865 640.634 1.00 127.76 ? 370  ALA C N     1 
ATOM   6452  C  CA    . ALA C 2  370  ? 511.490 -25.544 641.257 1.00 133.21 ? 370  ALA C CA    1 
ATOM   6453  C  C     . ALA C 2  370  ? 511.041 -24.448 640.282 1.00 135.85 ? 370  ALA C C     1 
ATOM   6454  O  O     . ALA C 2  370  ? 510.279 -23.551 640.670 1.00 132.21 ? 370  ALA C O     1 
ATOM   6455  C  CB    . ALA C 2  370  ? 512.825 -25.172 641.911 1.00 132.71 ? 370  ALA C CB    1 
ATOM   6456  N  N     . LYS C 2  371  ? 511.462 -24.504 639.010 1.00 139.71 ? 371  LYS C N     1 
ATOM   6457  C  CA    . LYS C 2  371  ? 511.022 -23.489 638.045 1.00 137.94 ? 371  LYS C CA    1 
ATOM   6458  C  C     . LYS C 2  371  ? 509.632 -23.783 637.489 1.00 134.20 ? 371  LYS C C     1 
ATOM   6459  O  O     . LYS C 2  371  ? 508.986 -22.874 636.953 1.00 132.64 ? 371  LYS C O     1 
ATOM   6460  C  CB    . LYS C 2  371  ? 512.059 -23.192 636.941 1.00 144.42 ? 371  LYS C CB    1 
ATOM   6461  C  CG    . LYS C 2  371  ? 512.889 -24.266 636.242 1.00 149.83 ? 371  LYS C CG    1 
ATOM   6462  C  CD    . LYS C 2  371  ? 513.648 -23.515 635.101 1.00 155.39 ? 371  LYS C CD    1 
ATOM   6463  C  CE    . LYS C 2  371  ? 514.621 -24.339 634.251 1.00 153.73 ? 371  LYS C CE    1 
ATOM   6464  N  NZ    . LYS C 2  371  ? 515.817 -24.830 634.992 1.00 153.56 ? 371  LYS C NZ    1 
ATOM   6465  N  N     . LEU C 2  372  ? 509.211 -25.045 637.508 1.00 131.28 ? 372  LEU C N     1 
ATOM   6466  C  CA    . LEU C 2  372  ? 507.940 -25.446 636.918 1.00 130.32 ? 372  LEU C CA    1 
ATOM   6467  C  C     . LEU C 2  372  ? 506.751 -25.036 637.812 1.00 134.61 ? 372  LEU C C     1 
ATOM   6468  O  O     . LEU C 2  372  ? 505.626 -24.873 637.309 1.00 132.53 ? 372  LEU C O     1 
ATOM   6469  C  CB    . LEU C 2  372  ? 507.962 -26.955 636.671 1.00 125.38 ? 372  LEU C CB    1 
ATOM   6470  C  CG    . LEU C 2  372  ? 507.031 -27.568 635.628 1.00 123.37 ? 372  LEU C CG    1 
ATOM   6471  C  CD1   . LEU C 2  372  ? 506.951 -26.694 634.380 1.00 129.49 ? 372  LEU C CD1   1 
ATOM   6472  C  CD2   . LEU C 2  372  ? 507.412 -29.016 635.307 1.00 113.17 ? 372  LEU C CD2   1 
ATOM   6473  N  N     . VAL C 2  373  ? 506.982 -24.892 639.135 1.00 132.74 ? 373  VAL C N     1 
ATOM   6474  C  CA    . VAL C 2  373  ? 505.955 -24.651 640.160 1.00 121.02 ? 373  VAL C CA    1 
ATOM   6475  C  C     . VAL C 2  373  ? 505.969 -23.186 640.596 1.00 118.66 ? 373  VAL C C     1 
ATOM   6476  O  O     . VAL C 2  373  ? 507.014 -22.658 641.006 1.00 118.90 ? 373  VAL C O     1 
ATOM   6477  C  CB    . VAL C 2  373  ? 506.172 -25.566 641.381 1.00 117.02 ? 373  VAL C CB    1 
ATOM   6478  C  CG1   . VAL C 2  373  ? 505.457 -25.023 642.584 1.00 112.84 ? 373  VAL C CG1   1 
ATOM   6479  C  CG2   . VAL C 2  373  ? 505.705 -26.984 641.092 1.00 113.00 ? 373  VAL C CG2   1 
ATOM   6480  N  N     . ASN C 2  374  ? 504.807 -22.535 640.528 1.00 116.38 ? 374  ASN C N     1 
ATOM   6481  C  CA    . ASN C 2  374  ? 504.599 -21.216 641.118 1.00 116.50 ? 374  ASN C CA    1 
ATOM   6482  C  C     . ASN C 2  374  ? 503.631 -21.377 642.268 1.00 120.34 ? 374  ASN C C     1 
ATOM   6483  O  O     . ASN C 2  374  ? 502.492 -21.786 642.046 1.00 128.15 ? 374  ASN C O     1 
ATOM   6484  C  CB    . ASN C 2  374  ? 503.996 -20.206 640.151 1.00 117.09 ? 374  ASN C CB    1 
ATOM   6485  C  CG    . ASN C 2  374  ? 503.913 -18.827 640.772 1.00 117.12 ? 374  ASN C CG    1 
ATOM   6486  O  OD1   . ASN C 2  374  ? 504.476 -18.599 641.838 1.00 115.55 ? 374  ASN C OD1   1 
ATOM   6487  N  ND2   . ASN C 2  374  ? 503.201 -17.913 640.131 1.00 116.57 ? 374  ASN C ND2   1 
ATOM   6488  N  N     . SER C 2  375  ? 504.048 -21.015 643.478 1.00 123.56 ? 375  SER C N     1 
ATOM   6489  C  CA    . SER C 2  375  ? 503.219 -21.309 644.640 1.00 118.01 ? 375  SER C CA    1 
ATOM   6490  C  C     . SER C 2  375  ? 502.192 -20.228 644.935 1.00 116.58 ? 375  SER C C     1 
ATOM   6491  O  O     . SER C 2  375  ? 501.315 -20.457 645.767 1.00 118.06 ? 375  SER C O     1 
ATOM   6492  C  CB    . SER C 2  375  ? 504.086 -21.466 645.899 1.00 120.94 ? 375  SER C CB    1 
ATOM   6493  O  OG    . SER C 2  375  ? 504.647 -20.214 646.291 1.00 119.31 ? 375  SER C OG    1 
ATOM   6494  N  N     . ARG C 2  376  ? 502.239 -19.094 644.238 1.00 121.83 ? 376  ARG C N     1 
ATOM   6495  C  CA    . ARG C 2  376  ? 501.302 -17.992 644.473 1.00 122.03 ? 376  ARG C CA    1 
ATOM   6496  C  C     . ARG C 2  376  ? 499.843 -18.428 644.523 1.00 117.50 ? 376  ARG C C     1 
ATOM   6497  O  O     . ARG C 2  376  ? 499.137 -18.013 645.455 1.00 109.99 ? 376  ARG C O     1 
ATOM   6498  C  CB    . ARG C 2  376  ? 501.533 -16.900 643.419 1.00 122.19 ? 376  ARG C CB    1 
ATOM   6499  C  CG    . ARG C 2  376  ? 502.954 -16.353 643.532 1.00 130.58 ? 376  ARG C CG    1 
ATOM   6500  C  CD    . ARG C 2  376  ? 503.303 -16.061 644.987 1.00 129.36 ? 376  ARG C CD    1 
ATOM   6501  N  NE    . ARG C 2  376  ? 504.592 -15.399 645.157 1.00 128.82 ? 376  ARG C NE    1 
ATOM   6502  C  CZ    . ARG C 2  376  ? 505.165 -15.228 646.342 1.00 132.35 ? 376  ARG C CZ    1 
ATOM   6503  N  NH1   . ARG C 2  376  ? 504.562 -15.679 647.431 1.00 135.66 ? 376  ARG C NH1   1 
ATOM   6504  N  NH2   . ARG C 2  376  ? 506.336 -14.622 646.451 1.00 132.70 ? 376  ARG C NH2   1 
ATOM   6505  N  N     . PRO C 2  377  ? 499.327 -19.226 643.579 1.00 116.17 ? 377  PRO C N     1 
ATOM   6506  C  CA    . PRO C 2  377  ? 497.938 -19.696 643.707 1.00 115.06 ? 377  PRO C CA    1 
ATOM   6507  C  C     . PRO C 2  377  ? 497.643 -20.465 644.993 1.00 107.90 ? 377  PRO C C     1 
ATOM   6508  O  O     . PRO C 2  377  ? 496.539 -20.343 645.534 1.00 105.61 ? 377  PRO C O     1 
ATOM   6509  C  CB    . PRO C 2  377  ? 497.752 -20.575 642.458 1.00 110.33 ? 377  PRO C CB    1 
ATOM   6510  C  CG    . PRO C 2  377  ? 499.092 -20.949 642.061 1.00 111.29 ? 377  PRO C CG    1 
ATOM   6511  C  CD    . PRO C 2  377  ? 499.938 -19.743 642.348 1.00 113.01 ? 377  PRO C CD    1 
ATOM   6512  N  N     . LEU C 2  378  ? 498.567 -21.289 645.482 1.00 108.08 ? 378  LEU C N     1 
ATOM   6513  C  CA    . LEU C 2  378  ? 498.288 -22.026 646.713 1.00 109.87 ? 378  LEU C CA    1 
ATOM   6514  C  C     . LEU C 2  378  ? 498.230 -21.107 647.930 1.00 104.21 ? 378  LEU C C     1 
ATOM   6515  O  O     . LEU C 2  378  ? 497.291 -21.182 648.718 1.00 100.26 ? 378  LEU C O     1 
ATOM   6516  C  CB    . LEU C 2  378  ? 499.336 -23.107 646.938 1.00 112.63 ? 378  LEU C CB    1 
ATOM   6517  C  CG    . LEU C 2  378  ? 498.985 -23.912 648.176 1.00 102.09 ? 378  LEU C CG    1 
ATOM   6518  C  CD1   . LEU C 2  378  ? 497.615 -24.448 647.919 1.00 105.78 ? 378  LEU C CD1   1 
ATOM   6519  C  CD2   . LEU C 2  378  ? 499.947 -25.048 648.405 1.00 100.35 ? 378  LEU C CD2   1 
ATOM   6520  N  N     . GLU C 2  379  ? 499.235 -20.250 648.118 1.00 107.79 ? 379  GLU C N     1 
ATOM   6521  C  CA    . GLU C 2  379  ? 499.204 -19.323 649.247 1.00 110.49 ? 379  GLU C CA    1 
ATOM   6522  C  C     . GLU C 2  379  ? 497.943 -18.469 649.258 1.00 110.08 ? 379  GLU C C     1 
ATOM   6523  O  O     . GLU C 2  379  ? 497.369 -18.218 650.323 1.00 111.51 ? 379  GLU C O     1 
ATOM   6524  C  CB    . GLU C 2  379  ? 500.429 -18.416 649.286 1.00 114.05 ? 379  GLU C CB    1 
ATOM   6525  C  CG    . GLU C 2  379  ? 501.739 -19.128 649.394 1.00 123.47 ? 379  GLU C CG    1 
ATOM   6526  C  CD    . GLU C 2  379  ? 502.895 -18.153 649.373 1.00 133.74 ? 379  GLU C CD    1 
ATOM   6527  O  OE1   . GLU C 2  379  ? 503.586 -18.049 648.323 1.00 129.60 ? 379  GLU C OE1   1 
ATOM   6528  O  OE2   . GLU C 2  379  ? 503.095 -17.498 650.432 1.00 137.50 ? 379  GLU C OE2   1 
ATOM   6529  N  N     . ALA C 2  380  ? 497.497 -17.998 648.097 1.00 112.31 ? 380  ALA C N     1 
ATOM   6530  C  CA    . ALA C 2  380  ? 496.327 -17.132 648.107 1.00 107.50 ? 380  ALA C CA    1 
ATOM   6531  C  C     . ALA C 2  380  ? 495.083 -17.885 648.545 1.00 109.83 ? 380  ALA C C     1 
ATOM   6532  O  O     . ALA C 2  380  ? 494.302 -17.357 649.341 1.00 114.00 ? 380  ALA C O     1 
ATOM   6533  C  CB    . ALA C 2  380  ? 496.094 -16.510 646.737 1.00 102.75 ? 380  ALA C CB    1 
ATOM   6534  N  N     . ALA C 2  381  ? 494.883 -19.120 648.065 1.00 106.88 ? 381  ALA C N     1 
ATOM   6535  C  CA    . ALA C 2  381  ? 493.703 -19.886 648.483 1.00 104.75 ? 381  ALA C CA    1 
ATOM   6536  C  C     . ALA C 2  381  ? 493.649 -20.114 649.990 1.00 107.08 ? 381  ALA C C     1 
ATOM   6537  O  O     . ALA C 2  381  ? 492.574 -20.028 650.592 1.00 106.38 ? 381  ALA C O     1 
ATOM   6538  C  CB    . ALA C 2  381  ? 493.653 -21.234 647.770 1.00 107.17 ? 381  ALA C CB    1 
ATOM   6539  N  N     . ILE C 2  382  ? 494.782 -20.447 650.613 1.00 108.75 ? 382  ILE C N     1 
ATOM   6540  C  CA    . ILE C 2  382  ? 494.781 -20.662 652.056 1.00 99.43  ? 382  ILE C CA    1 
ATOM   6541  C  C     . ILE C 2  382  ? 494.624 -19.339 652.785 1.00 102.56 ? 382  ILE C C     1 
ATOM   6542  O  O     . ILE C 2  382  ? 493.845 -19.221 653.735 1.00 106.52 ? 382  ILE C O     1 
ATOM   6543  C  CB    . ILE C 2  382  ? 496.056 -21.388 652.497 1.00 99.45  ? 382  ILE C CB    1 
ATOM   6544  C  CG1   . ILE C 2  382  ? 496.110 -22.743 651.817 1.00 100.96 ? 382  ILE C CG1   1 
ATOM   6545  C  CG2   . ILE C 2  382  ? 496.028 -21.585 653.999 1.00 104.36 ? 382  ILE C CG2   1 
ATOM   6546  C  CD1   . ILE C 2  382  ? 494.955 -23.608 652.181 1.00 106.70 ? 382  ILE C CD1   1 
ATOM   6547  N  N     . ARG C 2  383  ? 495.367 -18.322 652.357 1.00 102.24 ? 383  ARG C N     1 
ATOM   6548  C  CA    . ARG C 2  383  ? 495.228 -17.009 652.969 1.00 104.63 ? 383  ARG C CA    1 
ATOM   6549  C  C     . ARG C 2  383  ? 493.820 -16.473 652.784 1.00 106.05 ? 383  ARG C C     1 
ATOM   6550  O  O     . ARG C 2  383  ? 493.294 -15.781 653.661 1.00 103.21 ? 383  ARG C O     1 
ATOM   6551  C  CB    . ARG C 2  383  ? 496.269 -16.061 652.375 1.00 107.81 ? 383  ARG C CB    1 
ATOM   6552  C  CG    . ARG C 2  383  ? 496.317 -14.660 652.959 1.00 111.01 ? 383  ARG C CG    1 
ATOM   6553  C  CD    . ARG C 2  383  ? 497.556 -13.918 652.444 1.00 121.64 ? 383  ARG C CD    1 
ATOM   6554  N  NE    . ARG C 2  383  ? 497.739 -14.039 650.993 1.00 127.40 ? 383  ARG C NE    1 
ATOM   6555  C  CZ    . ARG C 2  383  ? 498.731 -14.731 650.423 1.00 124.37 ? 383  ARG C CZ    1 
ATOM   6556  N  NH1   . ARG C 2  383  ? 499.636 -15.351 651.181 1.00 126.20 ? 383  ARG C NH1   1 
ATOM   6557  N  NH2   . ARG C 2  383  ? 498.824 -14.812 649.100 1.00 115.87 ? 383  ARG C NH2   1 
ATOM   6558  N  N     . GLU C 2  384  ? 493.194 -16.806 651.657 1.00 108.36 ? 384  GLU C N     1 
ATOM   6559  C  CA    . GLU C 2  384  ? 491.833 -16.374 651.374 1.00 108.20 ? 384  GLU C CA    1 
ATOM   6560  C  C     . GLU C 2  384  ? 490.827 -17.009 652.335 1.00 106.14 ? 384  GLU C C     1 
ATOM   6561  O  O     . GLU C 2  384  ? 489.936 -16.331 652.857 1.00 108.45 ? 384  GLU C O     1 
ATOM   6562  C  CB    . GLU C 2  384  ? 491.511 -16.731 649.920 1.00 110.29 ? 384  GLU C CB    1 
ATOM   6563  C  CG    . GLU C 2  384  ? 490.235 -16.176 649.382 1.00 122.25 ? 384  GLU C CG    1 
ATOM   6564  C  CD    . GLU C 2  384  ? 490.405 -14.717 648.989 1.00 127.63 ? 384  GLU C CD    1 
ATOM   6565  O  OE1   . GLU C 2  384  ? 490.741 -13.890 649.872 1.00 124.88 ? 384  GLU C OE1   1 
ATOM   6566  O  OE2   . GLU C 2  384  ? 490.224 -14.405 647.788 1.00 134.45 ? 384  GLU C OE2   1 
ATOM   6567  N  N     . PHE C 2  385  ? 490.936 -18.319 652.559 1.00 103.29 ? 385  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2  385  ? 490.068 -18.996 653.520 1.00 98.45  ? 385  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2  385  ? 490.190 -18.426 654.923 1.00 96.81  ? 385  PHE C C     1 
ATOM   6570  O  O     . PHE C 2  385  ? 489.192 -18.049 655.535 1.00 97.32  ? 385  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2  385  ? 490.424 -20.474 653.525 1.00 98.41  ? 385  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2  385  ? 489.745 -21.281 654.584 1.00 94.61  ? 385  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2  385  ? 488.435 -21.688 654.460 1.00 100.26 ? 385  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2  385  ? 490.467 -21.708 655.676 1.00 91.51  ? 385  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2  385  ? 487.847 -22.474 655.431 1.00 94.09  ? 385  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2  385  ? 489.898 -22.490 656.630 1.00 89.60  ? 385  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2  385  ? 488.585 -22.879 656.506 1.00 91.24  ? 385  PHE C CZ    1 
ATOM   6578  N  N     . PHE C 2  386  ? 491.403 -18.332 655.441 1.00 96.78  ? 386  PHE C N     1 
ATOM   6579  C  CA    . PHE C 2  386  ? 491.599 -17.873 656.811 1.00 97.06  ? 386  PHE C CA    1 
ATOM   6580  C  C     . PHE C 2  386  ? 491.392 -16.394 657.027 1.00 100.21 ? 386  PHE C C     1 
ATOM   6581  O  O     . PHE C 2  386  ? 491.572 -15.949 658.166 1.00 101.60 ? 386  PHE C O     1 
ATOM   6582  C  CB    . PHE C 2  386  ? 492.978 -18.274 657.298 1.00 94.53  ? 386  PHE C CB    1 
ATOM   6583  C  CG    . PHE C 2  386  ? 493.023 -19.655 657.793 1.00 95.79  ? 386  PHE C CG    1 
ATOM   6584  C  CD1   . PHE C 2  386  ? 493.343 -20.699 656.952 1.00 99.34  ? 386  PHE C CD1   1 
ATOM   6585  C  CD2   . PHE C 2  386  ? 492.813 -19.909 659.131 1.00 86.36  ? 386  PHE C CD2   1 
ATOM   6586  C  CE1   . PHE C 2  386  ? 493.374 -21.995 657.435 1.00 98.79  ? 386  PHE C CE1   1 
ATOM   6587  C  CE2   . PHE C 2  386  ? 492.859 -21.189 659.612 1.00 86.90  ? 386  PHE C CE2   1 
ATOM   6588  C  CZ    . PHE C 2  386  ? 493.141 -22.237 658.767 1.00 88.91  ? 386  PHE C CZ    1 
ATOM   6589  N  N     . SER C 2  387  ? 491.012 -15.615 656.025 1.00 98.51  ? 387  SER C N     1 
ATOM   6590  C  CA    . SER C 2  387  ? 490.856 -14.195 656.265 1.00 100.75 ? 387  SER C CA    1 
ATOM   6591  C  C     . SER C 2  387  ? 489.559 -13.635 655.712 1.00 102.58 ? 387  SER C C     1 
ATOM   6592  O  O     . SER C 2  387  ? 489.278 -12.452 655.927 1.00 107.40 ? 387  SER C O     1 
ATOM   6593  C  CB    . SER C 2  387  ? 492.072 -13.428 655.706 1.00 102.43 ? 387  SER C CB    1 
ATOM   6594  O  OG    . SER C 2  387  ? 491.822 -12.042 655.591 1.00 108.17 ? 387  SER C OG    1 
ATOM   6595  N  N     . ARG C 2  388  ? 488.783 -14.418 654.994 1.00 95.31  ? 388  ARG C N     1 
ATOM   6596  C  CA    . ARG C 2  388  ? 487.623 -13.846 654.336 1.00 98.12  ? 388  ARG C CA    1 
ATOM   6597  C  C     . ARG C 2  388  ? 486.487 -14.843 654.251 1.00 99.66  ? 388  ARG C C     1 
ATOM   6598  O  O     . ARG C 2  388  ? 485.432 -14.503 653.711 1.00 108.78 ? 388  ARG C O     1 
ATOM   6599  C  CB    . ARG C 2  388  ? 487.993 -13.290 652.967 1.00 110.71 ? 388  ARG C CB    1 
ATOM   6600  C  CG    . ARG C 2  388  ? 487.454 -11.891 652.823 1.00 119.70 ? 388  ARG C CG    1 
ATOM   6601  C  CD    . ARG C 2  388  ? 488.115 -11.112 651.717 1.00 123.68 ? 388  ARG C CD    1 
ATOM   6602  N  NE    . ARG C 2  388  ? 489.498 -10.869 652.127 1.00 128.09 ? 388  ARG C NE    1 
ATOM   6603  C  CZ    . ARG C 2  388  ? 489.883 -9.926  652.989 1.00 133.09 ? 388  ARG C CZ    1 
ATOM   6604  N  NH1   . ARG C 2  388  ? 488.990 -9.119  653.566 1.00 141.65 ? 388  ARG C NH1   1 
ATOM   6605  N  NH2   . ARG C 2  388  ? 491.171 -9.801  653.289 1.00 131.88 ? 388  ARG C NH2   1 
ATOM   6606  N  N     . SER C 2  389  ? 486.682 -16.067 654.720 1.00 93.00  ? 389  SER C N     1 
ATOM   6607  C  CA    . SER C 2  389  ? 485.647 -17.082 654.727 1.00 92.54  ? 389  SER C CA    1 
ATOM   6608  C  C     . SER C 2  389  ? 484.568 -16.649 655.715 1.00 97.56  ? 389  SER C C     1 
ATOM   6609  O  O     . SER C 2  389  ? 484.796 -15.827 656.613 1.00 94.12  ? 389  SER C O     1 
ATOM   6610  C  CB    . SER C 2  389  ? 486.199 -18.467 655.101 1.00 90.31  ? 389  SER C CB    1 
ATOM   6611  O  OG    . SER C 2  389  ? 485.175 -19.452 655.274 1.00 86.50  ? 389  SER C OG    1 
ATOM   6612  N  N     . GLN C 2  390  ? 483.377 -17.194 655.551 1.00 100.40 ? 390  GLN C N     1 
ATOM   6613  C  CA    . GLN C 2  390  ? 482.324 -16.867 656.466 1.00 101.00 ? 390  GLN C CA    1 
ATOM   6614  C  C     . GLN C 2  390  ? 482.118 -18.161 657.234 1.00 103.40 ? 390  GLN C C     1 
ATOM   6615  O  O     . GLN C 2  390  ? 481.092 -18.832 657.158 1.00 118.41 ? 390  GLN C O     1 
ATOM   6616  C  CB    . GLN C 2  390  ? 481.032 -16.438 655.710 1.00 110.97 ? 390  GLN C CB    1 
ATOM   6617  C  CG    . GLN C 2  390  ? 479.826 -16.070 656.606 1.00 129.25 ? 390  GLN C CG    1 
ATOM   6618  C  CD    . GLN C 2  390  ? 478.599 -15.582 655.824 1.00 146.76 ? 390  GLN C CD    1 
ATOM   6619  O  OE1   . GLN C 2  390  ? 478.675 -14.615 655.057 1.00 160.54 ? 390  GLN C OE1   1 
ATOM   6620  N  NE2   . GLN C 2  390  ? 477.461 -16.260 656.016 1.00 134.45 ? 390  GLN C NE2   1 
ATOM   6621  N  N     . LEU C 2  391  ? 483.167 -18.473 657.999 1.00 85.98  ? 391  LEU C N     1 
ATOM   6622  C  CA    . LEU C 2  391  ? 483.329 -19.589 658.917 1.00 84.96  ? 391  LEU C CA    1 
ATOM   6623  C  C     . LEU C 2  391  ? 484.586 -19.258 659.709 1.00 86.18  ? 391  LEU C C     1 
ATOM   6624  O  O     . LEU C 2  391  ? 484.877 -19.856 660.750 1.00 83.00  ? 391  LEU C O     1 
ATOM   6625  C  CB    . LEU C 2  391  ? 483.428 -20.958 658.236 1.00 81.97  ? 391  LEU C CB    1 
ATOM   6626  C  CG    . LEU C 2  391  ? 482.170 -21.620 657.659 1.00 87.87  ? 391  LEU C CG    1 
ATOM   6627  C  CD1   . LEU C 2  391  ? 482.464 -22.947 657.018 1.00 91.71  ? 391  LEU C CD1   1 
ATOM   6628  C  CD2   . LEU C 2  391  ? 481.094 -21.790 658.687 1.00 88.57  ? 391  LEU C CD2   1 
ATOM   6629  N  N     . SER C 2  392  ? 485.339 -18.294 659.203 1.00 83.30  ? 392  SER C N     1 
ATOM   6630  C  CA    . SER C 2  392  ? 486.470 -17.731 659.919 1.00 86.03  ? 392  SER C CA    1 
ATOM   6631  C  C     . SER C 2  392  ? 485.984 -16.474 660.617 1.00 90.97  ? 392  SER C C     1 
ATOM   6632  O  O     . SER C 2  392  ? 485.762 -15.448 659.961 1.00 95.43  ? 392  SER C O     1 
ATOM   6633  C  CB    . SER C 2  392  ? 487.632 -17.405 658.981 1.00 86.69  ? 392  SER C CB    1 
ATOM   6634  O  OG    . SER C 2  392  ? 488.754 -16.877 659.692 1.00 84.44  ? 392  SER C OG    1 
ATOM   6635  N  N     . GLN C 2  393  ? 485.849 -16.547 661.945 1.00 87.24  ? 393  GLN C N     1 
ATOM   6636  C  CA    . GLN C 2  393  ? 485.269 -15.472 662.732 1.00 87.63  ? 393  GLN C CA    1 
ATOM   6637  C  C     . GLN C 2  393  ? 486.287 -14.964 663.747 1.00 94.07  ? 393  GLN C C     1 
ATOM   6638  O  O     . GLN C 2  393  ? 487.182 -15.700 664.201 1.00 88.93  ? 393  GLN C O     1 
ATOM   6639  C  CB    . GLN C 2  393  ? 484.004 -15.926 663.462 1.00 82.59  ? 393  GLN C CB    1 
ATOM   6640  C  CG    . GLN C 2  393  ? 482.901 -16.431 662.577 1.00 82.70  ? 393  GLN C CG    1 
ATOM   6641  C  CD    . GLN C 2  393  ? 481.781 -17.098 663.358 1.00 89.08  ? 393  GLN C CD    1 
ATOM   6642  O  OE1   . GLN C 2  393  ? 481.667 -16.931 664.579 1.00 100.09 ? 393  GLN C OE1   1 
ATOM   6643  N  NE2   . GLN C 2  393  ? 480.935 -17.846 662.657 1.00 80.62  ? 393  GLN C NE2   1 
ATOM   6644  N  N     . PHE C 2  394  ? 486.185 -13.664 664.008 1.00 91.33  ? 394  PHE C N     1 
ATOM   6645  C  CA    . PHE C 2  394  ? 486.910 -13.007 665.077 1.00 93.36  ? 394  PHE C CA    1 
ATOM   6646  C  C     . PHE C 2  394  ? 486.613 -13.727 666.396 1.00 101.06 ? 394  PHE C C     1 
ATOM   6647  O  O     . PHE C 2  394  ? 485.450 -13.970 666.740 1.00 101.09 ? 394  PHE C O     1 
ATOM   6648  C  CB    . PHE C 2  394  ? 486.488 -11.540 665.084 1.00 108.21 ? 394  PHE C CB    1 
ATOM   6649  C  CG    . PHE C 2  394  ? 487.473 -10.605 665.709 1.00 118.82 ? 394  PHE C CG    1 
ATOM   6650  C  CD1   . PHE C 2  394  ? 488.757 -10.508 665.232 1.00 125.15 ? 394  PHE C CD1   1 
ATOM   6651  C  CD2   . PHE C 2  394  ? 487.075 -9.738  666.720 1.00 125.51 ? 394  PHE C CD2   1 
ATOM   6652  C  CE1   . PHE C 2  394  ? 489.657 -9.609  665.803 1.00 132.47 ? 394  PHE C CE1   1 
ATOM   6653  C  CE2   . PHE C 2  394  ? 487.962 -8.839  667.290 1.00 132.23 ? 394  PHE C CE2   1 
ATOM   6654  C  CZ    . PHE C 2  394  ? 489.254 -8.773  666.833 1.00 134.96 ? 394  PHE C CZ    1 
ATOM   6655  N  N     . LYS C 2  395  ? 487.660 -14.129 667.116 1.00 103.30 ? 395  LYS C N     1 
ATOM   6656  C  CA    . LYS C 2  395  ? 487.440 -14.963 668.291 1.00 92.48  ? 395  LYS C CA    1 
ATOM   6657  C  C     . LYS C 2  395  ? 486.598 -14.219 669.303 1.00 94.36  ? 395  LYS C C     1 
ATOM   6658  O  O     . LYS C 2  395  ? 486.725 -13.005 669.478 1.00 95.06  ? 395  LYS C O     1 
ATOM   6659  C  CB    . LYS C 2  395  ? 488.775 -15.349 668.943 1.00 92.86  ? 395  LYS C CB    1 
ATOM   6660  C  CG    . LYS C 2  395  ? 488.724 -16.627 669.769 1.00 94.14  ? 395  LYS C CG    1 
ATOM   6661  C  CD    . LYS C 2  395  ? 489.501 -16.570 671.093 1.00 94.91  ? 395  LYS C CD    1 
ATOM   6662  C  CE    . LYS C 2  395  ? 490.737 -17.459 671.044 1.00 96.28  ? 395  LYS C CE    1 
ATOM   6663  N  NZ    . LYS C 2  395  ? 491.292 -17.810 672.384 1.00 100.78 ? 395  LYS C NZ    1 
ATOM   6664  N  N     . ASP C 2  396  ? 485.697 -14.949 669.945 1.00 97.64  ? 396  ASP C N     1 
ATOM   6665  C  CA    . ASP C 2  396  ? 484.919 -14.382 671.038 1.00 95.94  ? 396  ASP C CA    1 
ATOM   6666  C  C     . ASP C 2  396  ? 485.720 -14.702 672.293 1.00 94.87  ? 396  ASP C C     1 
ATOM   6667  O  O     . ASP C 2  396  ? 485.656 -15.816 672.816 1.00 89.52  ? 396  ASP C O     1 
ATOM   6668  C  CB    . ASP C 2  396  ? 483.526 -14.997 671.083 1.00 91.84  ? 396  ASP C CB    1 
ATOM   6669  C  CG    . ASP C 2  396  ? 482.648 -14.358 672.112 1.00 92.75  ? 396  ASP C CG    1 
ATOM   6670  O  OD1   . ASP C 2  396  ? 483.151 -13.473 672.834 1.00 91.61  ? 396  ASP C OD1   1 
ATOM   6671  O  OD2   . ASP C 2  396  ? 481.480 -14.794 672.244 1.00 96.85  ? 396  ASP C OD2   1 
ATOM   6672  N  N     . GLU C 2  397  ? 486.407 -13.716 672.846 1.00 93.00  ? 397  GLU C N     1 
ATOM   6673  C  CA    . GLU C 2  397  ? 487.158 -14.043 674.039 1.00 92.78  ? 397  GLU C CA    1 
ATOM   6674  C  C     . GLU C 2  397  ? 486.814 -13.038 675.122 1.00 101.27 ? 397  GLU C C     1 
ATOM   6675  O  O     . GLU C 2  397  ? 487.701 -12.515 675.811 1.00 103.96 ? 397  GLU C O     1 
ATOM   6676  C  CB    . GLU C 2  397  ? 488.669 -14.114 673.763 1.00 95.46  ? 397  GLU C CB    1 
ATOM   6677  C  CG    . GLU C 2  397  ? 489.279 -13.025 672.841 1.00 99.28  ? 397  GLU C CG    1 
ATOM   6678  C  CD    . GLU C 2  397  ? 490.843 -12.991 672.835 1.00 99.75  ? 397  GLU C CD    1 
ATOM   6679  O  OE1   . GLU C 2  397  ? 491.494 -13.949 673.322 1.00 103.71 ? 397  GLU C OE1   1 
ATOM   6680  O  OE2   . GLU C 2  397  ? 491.423 -11.944 672.457 1.00 91.71  ? 397  GLU C OE2   1 
ATOM   6681  N  N     . THR C 2  398  ? 485.503 -12.714 675.234 1.00 100.77 ? 398  THR C N     1 
ATOM   6682  C  CA    . THR C 2  398  ? 485.052 -11.791 676.273 1.00 91.99  ? 398  THR C CA    1 
ATOM   6683  C  C     . THR C 2  398  ? 485.386 -12.345 677.632 1.00 86.05  ? 398  THR C C     1 
ATOM   6684  O  O     . THR C 2  398  ? 485.974 -11.655 678.466 1.00 90.62  ? 398  THR C O     1 
ATOM   6685  C  CB    . THR C 2  398  ? 483.540 -11.589 676.207 1.00 90.69  ? 398  THR C CB    1 
ATOM   6686  O  OG1   . THR C 2  398  ? 483.119 -11.266 674.878 1.00 92.82  ? 398  THR C OG1   1 
ATOM   6687  C  CG2   . THR C 2  398  ? 483.144 -10.512 677.136 1.00 90.06  ? 398  THR C CG2   1 
ATOM   6688  N  N     . ASN C 2  399  ? 485.130 -13.626 677.817 1.00 83.64  ? 399  ASN C N     1 
ATOM   6689  C  CA    . ASN C 2  399  ? 485.484 -14.343 679.029 1.00 92.48  ? 399  ASN C CA    1 
ATOM   6690  C  C     . ASN C 2  399  ? 485.792 -15.753 678.569 1.00 89.26  ? 399  ASN C C     1 
ATOM   6691  O  O     . ASN C 2  399  ? 485.478 -16.113 677.428 1.00 88.17  ? 399  ASN C O     1 
ATOM   6692  C  CB    . ASN C 2  399  ? 484.375 -14.290 680.104 1.00 85.11  ? 399  ASN C CB    1 
ATOM   6693  C  CG    . ASN C 2  399  ? 483.101 -15.036 679.726 1.00 83.90  ? 399  ASN C CG    1 
ATOM   6694  O  OD1   . ASN C 2  399  ? 483.107 -16.248 679.497 1.00 84.31  ? 399  ASN C OD1   1 
ATOM   6695  N  ND2   . ASN C 2  399  ? 482.001 -14.305 679.646 1.00 82.38  ? 399  ASN C ND2   1 
ATOM   6696  N  N     . PRO C 2  400  ? 486.419 -16.574 679.415 1.00 86.19  ? 400  PRO C N     1 
ATOM   6697  C  CA    . PRO C 2  400  ? 486.831 -17.900 678.935 1.00 89.02  ? 400  PRO C CA    1 
ATOM   6698  C  C     . PRO C 2  400  ? 485.695 -18.698 678.342 1.00 91.66  ? 400  PRO C C     1 
ATOM   6699  O  O     . PRO C 2  400  ? 485.911 -19.420 677.360 1.00 95.81  ? 400  PRO C O     1 
ATOM   6700  C  CB    . PRO C 2  400  ? 487.412 -18.565 680.185 1.00 90.58  ? 400  PRO C CB    1 
ATOM   6701  C  CG    . PRO C 2  400  ? 487.923 -17.445 680.965 1.00 97.16  ? 400  PRO C CG    1 
ATOM   6702  C  CD    . PRO C 2  400  ? 486.972 -16.300 680.749 1.00 95.38  ? 400  PRO C CD    1 
ATOM   6703  N  N     . LEU C 2  401  ? 484.500 -18.622 678.923 1.00 86.56  ? 401  LEU C N     1 
ATOM   6704  C  CA    . LEU C 2  401  ? 483.384 -19.370 678.356 1.00 90.13  ? 401  LEU C CA    1 
ATOM   6705  C  C     . LEU C 2  401  ? 483.040 -18.889 676.935 1.00 89.34  ? 401  LEU C C     1 
ATOM   6706  O  O     . LEU C 2  401  ? 482.651 -19.701 676.086 1.00 87.93  ? 401  LEU C O     1 
ATOM   6707  C  CB    . LEU C 2  401  ? 482.159 -19.270 679.279 1.00 82.51  ? 401  LEU C CB    1 
ATOM   6708  C  CG    . LEU C 2  401  ? 480.868 -19.967 678.829 1.00 81.36  ? 401  LEU C CG    1 
ATOM   6709  C  CD1   . LEU C 2  401  ? 481.071 -21.490 678.679 1.00 80.72  ? 401  LEU C CD1   1 
ATOM   6710  C  CD2   . LEU C 2  401  ? 479.720 -19.659 679.743 1.00 85.66  ? 401  LEU C CD2   1 
ATOM   6711  N  N     . SER C 2  402  ? 483.199 -17.589 676.647 1.00 84.03  ? 402  SER C N     1 
ATOM   6712  C  CA    . SER C 2  402  ? 482.897 -17.080 675.311 1.00 87.74  ? 402  SER C CA    1 
ATOM   6713  C  C     . SER C 2  402  ? 483.596 -17.878 674.206 1.00 95.93  ? 402  SER C C     1 
ATOM   6714  O  O     . SER C 2  402  ? 482.951 -18.345 673.255 1.00 95.53  ? 402  SER C O     1 
ATOM   6715  C  CB    . SER C 2  402  ? 483.302 -15.607 675.205 1.00 90.00  ? 402  SER C CB    1 
ATOM   6716  O  OG    . SER C 2  402  ? 483.011 -14.852 676.354 1.00 86.88  ? 402  SER C OG    1 
ATOM   6717  N  N     . SER C 2  403  ? 484.927 -18.019 674.304 1.00 93.45  ? 403  SER C N     1 
ATOM   6718  C  CA    . SER C 2  403  ? 485.674 -18.723 673.272 1.00 86.94  ? 403  SER C CA    1 
ATOM   6719  C  C     . SER C 2  403  ? 485.422 -20.223 673.291 1.00 85.78  ? 403  SER C C     1 
ATOM   6720  O  O     . SER C 2  403  ? 485.305 -20.840 672.235 1.00 90.94  ? 403  SER C O     1 
ATOM   6721  C  CB    . SER C 2  403  ? 487.165 -18.430 673.430 1.00 91.59  ? 403  SER C CB    1 
ATOM   6722  O  OG    . SER C 2  403  ? 487.725 -19.212 674.467 1.00 96.76  ? 403  SER C OG    1 
ATOM   6723  N  N     . LEU C 2  404  ? 485.365 -20.845 674.464 1.00 89.81  ? 404  LEU C N     1 
ATOM   6724  C  CA    . LEU C 2  404  ? 485.045 -22.269 674.489 1.00 92.50  ? 404  LEU C CA    1 
ATOM   6725  C  C     . LEU C 2  404  ? 483.714 -22.536 673.778 1.00 91.87  ? 404  LEU C C     1 
ATOM   6726  O  O     . LEU C 2  404  ? 483.572 -23.526 673.050 1.00 91.07  ? 404  LEU C O     1 
ATOM   6727  C  CB    . LEU C 2  404  ? 485.052 -22.824 675.909 1.00 90.88  ? 404  LEU C CB    1 
ATOM   6728  C  CG    . LEU C 2  404  ? 484.659 -24.307 675.813 1.00 96.90  ? 404  LEU C CG    1 
ATOM   6729  C  CD1   . LEU C 2  404  ? 485.755 -25.152 676.451 1.00 101.52 ? 404  LEU C CD1   1 
ATOM   6730  C  CD2   . LEU C 2  404  ? 483.302 -24.658 676.398 1.00 101.66 ? 404  LEU C CD2   1 
ATOM   6731  N  N     . ARG C 2  405  ? 482.708 -21.688 674.021 1.00 91.66  ? 405  ARG C N     1 
ATOM   6732  C  CA    . ARG C 2  405  ? 481.423 -21.858 673.348 1.00 91.62  ? 405  ARG C CA    1 
ATOM   6733  C  C     . ARG C 2  405  ? 481.546 -21.600 671.847 1.00 86.40  ? 405  ARG C C     1 
ATOM   6734  O  O     . ARG C 2  405  ? 480.915 -22.294 671.034 1.00 81.90  ? 405  ARG C O     1 
ATOM   6735  C  CB    . ARG C 2  405  ? 480.369 -20.916 673.949 1.00 91.87  ? 405  ARG C CB    1 
ATOM   6736  C  CG    . ARG C 2  405  ? 479.061 -21.138 673.244 1.00 93.63  ? 405  ARG C CG    1 
ATOM   6737  C  CD    . ARG C 2  405  ? 478.041 -20.051 673.336 1.00 92.53  ? 405  ARG C CD    1 
ATOM   6738  N  NE    . ARG C 2  405  ? 478.393 -19.022 672.370 1.00 90.23  ? 405  ARG C NE    1 
ATOM   6739  C  CZ    . ARG C 2  405  ? 477.557 -18.148 671.825 1.00 91.39  ? 405  ARG C CZ    1 
ATOM   6740  N  NH1   . ARG C 2  405  ? 476.261 -18.158 672.090 1.00 80.78  ? 405  ARG C NH1   1 
ATOM   6741  N  NH2   . ARG C 2  405  ? 478.046 -17.251 670.986 1.00 105.77 ? 405  ARG C NH2   1 
ATOM   6742  N  N     . HIS C 2  406  ? 482.313 -20.566 671.474 1.00 88.04  ? 406  HIS C N     1 
ATOM   6743  C  CA    . HIS C 2  406  ? 482.503 -20.208 670.068 1.00 88.41  ? 406  HIS C CA    1 
ATOM   6744  C  C     . HIS C 2  406  ? 483.047 -21.391 669.276 1.00 84.82  ? 406  HIS C C     1 
ATOM   6745  O  O     . HIS C 2  406  ? 482.523 -21.721 668.213 1.00 84.67  ? 406  HIS C O     1 
ATOM   6746  C  CB    . HIS C 2  406  ? 483.451 -19.011 669.951 1.00 85.03  ? 406  HIS C CB    1 
ATOM   6747  C  CG    . HIS C 2  406  ? 483.402 -18.311 668.627 1.00 83.16  ? 406  HIS C CG    1 
ATOM   6748  N  ND1   . HIS C 2  406  ? 484.095 -17.142 668.381 1.00 87.34  ? 406  HIS C ND1   1 
ATOM   6749  C  CD2   . HIS C 2  406  ? 482.692 -18.569 667.503 1.00 83.24  ? 406  HIS C CD2   1 
ATOM   6750  C  CE1   . HIS C 2  406  ? 483.837 -16.726 667.156 1.00 84.79  ? 406  HIS C CE1   1 
ATOM   6751  N  NE2   . HIS C 2  406  ? 482.985 -17.571 666.604 1.00 85.12  ? 406  HIS C NE2   1 
ATOM   6752  N  N     . LYS C 2  407  ? 484.049 -22.088 669.827 1.00 82.77  ? 407  LYS C N     1 
ATOM   6753  C  CA    . LYS C 2  407  ? 484.676 -23.211 669.141 1.00 82.64  ? 407  LYS C CA    1 
ATOM   6754  C  C     . LYS C 2  407  ? 483.728 -24.382 668.955 1.00 87.44  ? 407  LYS C C     1 
ATOM   6755  O  O     . LYS C 2  407  ? 483.937 -25.187 668.030 1.00 90.85  ? 407  LYS C O     1 
ATOM   6756  C  CB    . LYS C 2  407  ? 485.930 -23.672 669.894 1.00 86.86  ? 407  LYS C CB    1 
ATOM   6757  C  CG    . LYS C 2  407  ? 487.052 -22.640 669.914 1.00 89.86  ? 407  LYS C CG    1 
ATOM   6758  C  CD    . LYS C 2  407  ? 487.890 -22.653 671.166 1.00 84.05  ? 407  LYS C CD    1 
ATOM   6759  C  CE    . LYS C 2  407  ? 488.824 -21.467 671.118 1.00 89.69  ? 407  LYS C CE    1 
ATOM   6760  N  NZ    . LYS C 2  407  ? 489.457 -21.151 672.420 1.00 99.59  ? 407  LYS C NZ    1 
ATOM   6761  N  N     . ARG C 2  408  ? 482.701 -24.510 669.807 1.00 84.94  ? 408  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2  408  ? 481.743 -25.607 669.709 1.00 80.71  ? 408  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2  408  ? 480.483 -25.227 668.946 1.00 81.16  ? 408  ARG C C     1 
ATOM   6764  O  O     . ARG C 2  408  ? 479.542 -26.019 668.921 1.00 82.56  ? 408  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2  408  ? 481.393 -26.194 671.069 1.00 75.18  ? 408  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2  408  ? 482.581 -26.403 671.974 1.00 85.22  ? 408  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2  408  ? 482.214 -27.071 673.319 1.00 91.63  ? 408  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2  408  ? 482.207 -28.538 673.364 1.00 90.47  ? 408  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2  408  ? 481.114 -29.274 673.564 1.00 91.01  ? 408  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2  408  ? 479.935 -28.673 673.735 1.00 84.76  ? 408  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2  408  ? 481.196 -30.608 673.617 1.00 86.26  ? 408  ARG C NH2   1 
ATOM   6772  N  N     . ARG C 2  409  ? 480.445 -24.053 668.313 1.00 82.74  ? 409  ARG C N     1 
ATOM   6773  C  CA    . ARG C 2  409  ? 479.273 -23.646 667.540 1.00 86.06  ? 409  ARG C CA    1 
ATOM   6774  C  C     . ARG C 2  409  ? 479.199 -24.325 666.156 1.00 86.83  ? 409  ARG C C     1 
ATOM   6775  O  O     . ARG C 2  409  ? 480.211 -24.704 665.561 1.00 87.91  ? 409  ARG C O     1 
ATOM   6776  C  CB    . ARG C 2  409  ? 479.306 -22.126 667.400 1.00 85.45  ? 409  ARG C CB    1 
ATOM   6777  C  CG    . ARG C 2  409  ? 478.608 -21.598 668.645 1.00 102.76 ? 409  ARG C CG    1 
ATOM   6778  C  CD    . ARG C 2  409  ? 477.294 -20.865 668.557 1.00 106.99 ? 409  ARG C CD    1 
ATOM   6779  N  NE    . ARG C 2  409  ? 477.359 -19.577 667.879 1.00 105.74 ? 409  ARG C NE    1 
ATOM   6780  C  CZ    . ARG C 2  409  ? 476.391 -18.680 668.014 1.00 111.97 ? 409  ARG C CZ    1 
ATOM   6781  N  NH1   . ARG C 2  409  ? 476.472 -17.506 667.391 1.00 98.47  ? 409  ARG C NH1   1 
ATOM   6782  N  NH2   . ARG C 2  409  ? 475.357 -18.970 668.833 1.00 113.82 ? 409  ARG C NH2   1 
ATOM   6783  N  N     . ILE C 2  410  ? 477.973 -24.514 665.665 1.00 88.72  ? 410  ILE C N     1 
ATOM   6784  C  CA    . ILE C 2  410  ? 477.674 -25.170 664.386 1.00 83.11  ? 410  ILE C CA    1 
ATOM   6785  C  C     . ILE C 2  410  ? 476.832 -24.258 663.508 1.00 84.98  ? 410  ILE C C     1 
ATOM   6786  O  O     . ILE C 2  410  ? 475.685 -23.966 663.858 1.00 89.69  ? 410  ILE C O     1 
ATOM   6787  C  CB    . ILE C 2  410  ? 476.918 -26.489 664.609 1.00 80.75  ? 410  ILE C CB    1 
ATOM   6788  C  CG1   . ILE C 2  410  ? 477.758 -27.459 665.427 1.00 83.69  ? 410  ILE C CG1   1 
ATOM   6789  C  CG2   . ILE C 2  410  ? 476.402 -27.055 663.312 1.00 80.24  ? 410  ILE C CG2   1 
ATOM   6790  C  CD1   . ILE C 2  410  ? 477.047 -28.735 665.734 1.00 84.38  ? 410  ILE C CD1   1 
ATOM   6791  N  N     . SER C 2  411  ? 477.320 -23.914 662.322 1.00 83.01  ? 411  SER C N     1 
ATOM   6792  C  CA    . SER C 2  411  ? 476.580 -23.010 661.449 1.00 84.40  ? 411  SER C CA    1 
ATOM   6793  C  C     . SER C 2  411  ? 476.099 -23.751 660.214 1.00 92.97  ? 411  SER C C     1 
ATOM   6794  O  O     . SER C 2  411  ? 476.843 -24.534 659.620 1.00 98.10  ? 411  SER C O     1 
ATOM   6795  C  CB    . SER C 2  411  ? 477.417 -21.802 661.014 1.00 88.77  ? 411  SER C CB    1 
ATOM   6796  O  OG    . SER C 2  411  ? 476.695 -20.982 660.096 1.00 95.35  ? 411  SER C OG    1 
ATOM   6797  N  N     . ALA C 2  412  ? 474.861 -23.487 659.822 1.00 94.72  ? 412  ALA C N     1 
ATOM   6798  C  CA    . ALA C 2  412  ? 474.294 -24.002 658.583 1.00 98.76  ? 412  ALA C CA    1 
ATOM   6799  C  C     . ALA C 2  412  ? 474.441 -23.002 657.458 1.00 104.56 ? 412  ALA C C     1 
ATOM   6800  O  O     . ALA C 2  412  ? 474.044 -23.296 656.328 1.00 111.44 ? 412  ALA C O     1 
ATOM   6801  C  CB    . ALA C 2  412  ? 472.825 -24.370 658.763 1.00 94.91  ? 412  ALA C CB    1 
ATOM   6802  N  N     . LEU C 2  413  ? 474.995 -21.833 657.768 1.00 104.43 ? 413  LEU C N     1 
ATOM   6803  C  CA    . LEU C 2  413  ? 475.275 -20.749 656.844 1.00 110.29 ? 413  LEU C CA    1 
ATOM   6804  C  C     . LEU C 2  413  ? 476.673 -20.928 656.240 1.00 115.35 ? 413  LEU C C     1 
ATOM   6805  O  O     . LEU C 2  413  ? 477.270 -22.001 656.331 1.00 114.93 ? 413  LEU C O     1 
ATOM   6806  C  CB    . LEU C 2  413  ? 475.148 -19.448 657.628 1.00 106.70 ? 413  LEU C CB    1 
ATOM   6807  C  CG    . LEU C 2  413  ? 473.933 -18.586 657.376 1.00 112.95 ? 413  LEU C CG    1 
ATOM   6808  C  CD1   . LEU C 2  413  ? 472.762 -19.408 657.682 1.00 109.26 ? 413  LEU C CD1   1 
ATOM   6809  C  CD2   . LEU C 2  413  ? 473.974 -17.399 658.319 1.00 119.71 ? 413  LEU C CD2   1 
ATOM   6810  N  N     . GLY C 2  414  ? 477.195 -19.906 655.557 1.00 117.93 ? 414  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2  414  ? 478.521 -19.992 654.982 1.00 114.51 ? 414  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2  414  ? 478.677 -20.577 653.586 1.00 125.92 ? 414  GLY C C     1 
ATOM   6813  O  O     . GLY C 2  414  ? 477.730 -21.080 652.963 1.00 124.06 ? 414  GLY C O     1 
ATOM   6814  N  N     . PRO C 2  415  ? 479.956 -20.534 653.077 1.00 131.41 ? 415  PRO C N     1 
ATOM   6815  C  CA    . PRO C 2  415  ? 480.280 -21.047 651.733 1.00 123.41 ? 415  PRO C CA    1 
ATOM   6816  C  C     . PRO C 2  415  ? 480.051 -22.531 651.488 1.00 118.53 ? 415  PRO C C     1 
ATOM   6817  O  O     . PRO C 2  415  ? 480.916 -23.367 651.775 1.00 115.41 ? 415  PRO C O     1 
ATOM   6818  C  CB    . PRO C 2  415  ? 481.769 -20.696 651.583 1.00 114.08 ? 415  PRO C CB    1 
ATOM   6819  C  CG    . PRO C 2  415  ? 482.292 -20.677 652.972 1.00 110.37 ? 415  PRO C CG    1 
ATOM   6820  C  CD    . PRO C 2  415  ? 481.169 -20.063 653.779 1.00 120.38 ? 415  PRO C CD    1 
ATOM   6821  N  N     . GLY C 2  416  ? 478.828 -22.867 651.114 1.00 115.47 ? 416  GLY C N     1 
ATOM   6822  C  CA    . GLY C 2  416  ? 478.457 -24.232 650.827 1.00 118.02 ? 416  GLY C CA    1 
ATOM   6823  C  C     . GLY C 2  416  ? 477.199 -24.584 651.566 1.00 129.37 ? 416  GLY C C     1 
ATOM   6824  O  O     . GLY C 2  416  ? 476.910 -25.757 651.819 1.00 134.09 ? 416  GLY C O     1 
ATOM   6825  N  N     . GLY C 2  417  ? 476.442 -23.557 651.925 1.00 128.40 ? 417  GLY C N     1 
ATOM   6826  C  CA    . GLY C 2  417  ? 475.268 -23.767 652.737 1.00 126.81 ? 417  GLY C CA    1 
ATOM   6827  C  C     . GLY C 2  417  ? 474.261 -22.687 652.433 1.00 131.86 ? 417  GLY C C     1 
ATOM   6828  O  O     . GLY C 2  417  ? 474.456 -21.858 651.540 1.00 140.26 ? 417  GLY C O     1 
ATOM   6829  N  N     . LEU C 2  418  ? 473.169 -22.720 653.189 1.00 126.45 ? 418  LEU C N     1 
ATOM   6830  C  CA    . LEU C 2  418  ? 472.041 -21.837 652.946 1.00 135.24 ? 418  LEU C CA    1 
ATOM   6831  C  C     . LEU C 2  418  ? 472.489 -20.375 652.944 1.00 138.56 ? 418  LEU C C     1 
ATOM   6832  O  O     . LEU C 2  418  ? 473.510 -20.012 653.538 1.00 133.25 ? 418  LEU C O     1 
ATOM   6833  C  CB    . LEU C 2  418  ? 470.944 -22.096 653.979 1.00 132.93 ? 418  LEU C CB    1 
ATOM   6834  C  CG    . LEU C 2  418  ? 470.394 -23.529 653.905 1.00 127.87 ? 418  LEU C CG    1 
ATOM   6835  C  CD1   . LEU C 2  418  ? 471.210 -24.498 654.747 1.00 125.05 ? 418  LEU C CD1   1 
ATOM   6836  C  CD2   . LEU C 2  418  ? 468.928 -23.597 654.295 1.00 132.25 ? 418  LEU C CD2   1 
ATOM   6837  N  N     . THR C 2  419  ? 471.724 -19.533 652.253 1.00 147.12 ? 419  THR C N     1 
ATOM   6838  C  CA    . THR C 2  419  ? 471.800 -18.096 652.461 1.00 150.64 ? 419  THR C CA    1 
ATOM   6839  C  C     . THR C 2  419  ? 470.837 -17.698 653.578 1.00 150.77 ? 419  THR C C     1 
ATOM   6840  O  O     . THR C 2  419  ? 470.012 -18.492 654.044 1.00 144.59 ? 419  THR C O     1 
ATOM   6841  C  CB    . THR C 2  419  ? 471.443 -17.328 651.180 1.00 152.38 ? 419  THR C CB    1 
ATOM   6842  O  OG1   . THR C 2  419  ? 471.910 -18.051 650.036 1.00 158.36 ? 419  THR C OG1   1 
ATOM   6843  C  CG2   . THR C 2  419  ? 472.050 -15.913 651.172 1.00 152.38 ? 419  THR C CG2   1 
ATOM   6844  N  N     . ARG C 2  420  ? 470.948 -16.448 654.019 1.00 153.71 ? 420  ARG C N     1 
ATOM   6845  C  CA    . ARG C 2  420  ? 470.137 -16.050 655.153 1.00 156.54 ? 420  ARG C CA    1 
ATOM   6846  C  C     . ARG C 2  420  ? 468.722 -15.821 654.662 1.00 158.30 ? 420  ARG C C     1 
ATOM   6847  O  O     . ARG C 2  420  ? 467.759 -15.995 655.415 1.00 154.03 ? 420  ARG C O     1 
ATOM   6848  C  CB    . ARG C 2  420  ? 470.706 -14.789 655.811 1.00 153.37 ? 420  ARG C CB    1 
ATOM   6849  C  CG    . ARG C 2  420  ? 470.126 -14.452 657.184 1.00 136.71 ? 420  ARG C CG    1 
ATOM   6850  C  CD    . ARG C 2  420  ? 470.876 -13.271 657.799 1.00 144.30 ? 420  ARG C CD    1 
ATOM   6851  N  NE    . ARG C 2  420  ? 472.212 -13.637 658.284 1.00 149.54 ? 420  ARG C NE    1 
ATOM   6852  C  CZ    . ARG C 2  420  ? 473.347 -13.481 657.601 1.00 155.34 ? 420  ARG C CZ    1 
ATOM   6853  N  NH1   . ARG C 2  420  ? 473.336 -12.959 656.381 1.00 154.71 ? 420  ARG C NH1   1 
ATOM   6854  N  NH2   . ARG C 2  420  ? 474.501 -13.851 658.145 1.00 154.09 ? 420  ARG C NH2   1 
ATOM   6855  N  N     . GLU C 2  421  ? 468.598 -15.496 653.377 1.00 158.39 ? 421  GLU C N     1 
ATOM   6856  C  CA    . GLU C 2  421  ? 467.303 -15.421 652.723 1.00 158.68 ? 421  GLU C CA    1 
ATOM   6857  C  C     . GLU C 2  421  ? 466.827 -16.792 652.248 1.00 157.23 ? 421  GLU C C     1 
ATOM   6858  O  O     . GLU C 2  421  ? 465.619 -17.059 652.275 1.00 156.68 ? 421  GLU C O     1 
ATOM   6859  C  CB    . GLU C 2  421  ? 467.383 -14.424 651.560 1.00 159.18 ? 421  GLU C CB    1 
ATOM   6860  C  CG    . GLU C 2  421  ? 467.794 -13.009 651.992 1.00 163.65 ? 421  GLU C CG    1 
ATOM   6861  C  CD    . GLU C 2  421  ? 468.946 -12.429 651.178 1.00 171.11 ? 421  GLU C CD    1 
ATOM   6862  O  OE1   . GLU C 2  421  ? 469.411 -13.088 650.218 1.00 171.30 ? 421  GLU C OE1   1 
ATOM   6863  O  OE2   . GLU C 2  421  ? 469.389 -11.305 651.508 1.00 173.32 ? 421  GLU C OE2   1 
ATOM   6864  N  N     . ARG C 2  422  ? 467.751 -17.680 651.859 1.00 158.12 ? 422  ARG C N     1 
ATOM   6865  C  CA    . ARG C 2  422  ? 467.433 -18.935 651.171 1.00 156.59 ? 422  ARG C CA    1 
ATOM   6866  C  C     . ARG C 2  422  ? 467.075 -20.083 652.124 1.00 150.34 ? 422  ARG C C     1 
ATOM   6867  O  O     . ARG C 2  422  ? 467.365 -21.239 651.804 1.00 146.43 ? 422  ARG C O     1 
ATOM   6868  C  CB    . ARG C 2  422  ? 468.623 -19.389 650.294 1.00 161.98 ? 422  ARG C CB    1 
ATOM   6869  C  CG    . ARG C 2  422  ? 468.969 -18.565 649.004 1.00 167.47 ? 422  ARG C CG    1 
ATOM   6870  C  CD    . ARG C 2  422  ? 469.925 -19.357 648.026 1.00 172.13 ? 422  ARG C CD    1 
ATOM   6871  N  NE    . ARG C 2  422  ? 470.219 -18.654 646.762 1.00 175.64 ? 422  ARG C NE    1 
ATOM   6872  C  CZ    . ARG C 2  422  ? 470.707 -19.222 645.654 1.00 174.91 ? 422  ARG C CZ    1 
ATOM   6873  N  NH1   . ARG C 2  422  ? 470.968 -20.524 645.612 1.00 174.66 ? 422  ARG C NH1   1 
ATOM   6874  N  NH2   . ARG C 2  422  ? 470.932 -18.481 644.573 1.00 170.57 ? 422  ARG C NH2   1 
ATOM   6875  N  N     . ALA C 2  423  ? 466.437 -19.797 653.272 1.00 153.72 ? 423  ALA C N     1 
ATOM   6876  C  CA    . ALA C 2  423  ? 466.269 -20.775 654.351 1.00 146.58 ? 423  ALA C CA    1 
ATOM   6877  C  C     . ALA C 2  423  ? 464.887 -20.706 654.999 1.00 139.02 ? 423  ALA C C     1 
ATOM   6878  O  O     . ALA C 2  423  ? 464.396 -19.614 655.297 1.00 135.23 ? 423  ALA C O     1 
ATOM   6879  C  CB    . ALA C 2  423  ? 467.324 -20.569 655.453 1.00 137.69 ? 423  ALA C CB    1 
ATOM   6880  N  N     . GLY C 2  424  ? 464.287 -21.886 655.274 1.00 139.71 ? 424  GLY C N     1 
ATOM   6881  C  CA    . GLY C 2  424  ? 462.947 -21.979 655.842 1.00 136.66 ? 424  GLY C CA    1 
ATOM   6882  C  C     . GLY C 2  424  ? 462.720 -23.212 656.705 1.00 131.33 ? 424  GLY C C     1 
ATOM   6883  O  O     . GLY C 2  424  ? 463.556 -24.114 656.761 1.00 134.97 ? 424  GLY C O     1 
ATOM   6884  N  N     . PHE C 2  425  ? 461.525 -23.281 657.318 1.00 125.33 ? 425  PHE C N     1 
ATOM   6885  C  CA    . PHE C 2  425  ? 461.308 -23.979 658.597 1.00 122.77 ? 425  PHE C CA    1 
ATOM   6886  C  C     . PHE C 2  425  ? 461.908 -25.360 658.832 1.00 118.16 ? 425  PHE C C     1 
ATOM   6887  O  O     . PHE C 2  425  ? 462.442 -25.617 659.913 1.00 118.34 ? 425  PHE C O     1 
ATOM   6888  C  CB    . PHE C 2  425  ? 459.807 -24.227 658.838 1.00 122.73 ? 425  PHE C CB    1 
ATOM   6889  C  CG    . PHE C 2  425  ? 459.015 -23.025 659.260 1.00 114.83 ? 425  PHE C CG    1 
ATOM   6890  C  CD1   . PHE C 2  425  ? 458.548 -22.936 660.552 1.00 119.54 ? 425  PHE C CD1   1 
ATOM   6891  C  CD2   . PHE C 2  425  ? 458.663 -22.037 658.362 1.00 115.85 ? 425  PHE C CD2   1 
ATOM   6892  C  CE1   . PHE C 2  425  ? 457.786 -21.851 660.962 1.00 122.01 ? 425  PHE C CE1   1 
ATOM   6893  C  CE2   . PHE C 2  425  ? 457.906 -20.962 658.757 1.00 110.52 ? 425  PHE C CE2   1 
ATOM   6894  C  CZ    . PHE C 2  425  ? 457.470 -20.860 660.058 1.00 117.74 ? 425  PHE C CZ    1 
ATOM   6895  N  N     . ASP C 2  426  ? 461.864 -26.241 657.839 1.00 121.11 ? 426  ASP C N     1 
ATOM   6896  C  CA    . ASP C 2  426  ? 462.271 -27.627 658.070 1.00 121.00 ? 426  ASP C CA    1 
ATOM   6897  C  C     . ASP C 2  426  ? 463.662 -27.709 658.691 1.00 114.51 ? 426  ASP C C     1 
ATOM   6898  O  O     . ASP C 2  426  ? 463.929 -28.574 659.532 1.00 110.01 ? 426  ASP C O     1 
ATOM   6899  C  CB    . ASP C 2  426  ? 462.140 -28.442 656.781 1.00 129.30 ? 426  ASP C CB    1 
ATOM   6900  C  CG    . ASP C 2  426  ? 460.664 -28.731 656.428 1.00 134.45 ? 426  ASP C CG    1 
ATOM   6901  O  OD1   . ASP C 2  426  ? 459.788 -27.936 656.856 1.00 130.02 ? 426  ASP C OD1   1 
ATOM   6902  O  OD2   . ASP C 2  426  ? 460.372 -29.755 655.763 1.00 133.25 ? 426  ASP C OD2   1 
ATOM   6903  N  N     . VAL C 2  427  ? 464.569 -26.835 658.255 1.00 116.09 ? 427  VAL C N     1 
ATOM   6904  C  CA    . VAL C 2  427  ? 465.964 -26.873 658.685 1.00 113.25 ? 427  VAL C CA    1 
ATOM   6905  C  C     . VAL C 2  427  ? 466.147 -26.281 660.080 1.00 111.20 ? 427  VAL C C     1 
ATOM   6906  O  O     . VAL C 2  427  ? 466.987 -26.753 660.856 1.00 107.15 ? 427  VAL C O     1 
ATOM   6907  C  CB    . VAL C 2  427  ? 466.850 -26.120 657.674 1.00 112.23 ? 427  VAL C CB    1 
ATOM   6908  C  CG1   . VAL C 2  427  ? 467.955 -26.997 657.203 1.00 117.78 ? 427  VAL C CG1   1 
ATOM   6909  C  CG2   . VAL C 2  427  ? 466.043 -25.615 656.483 1.00 116.84 ? 427  VAL C CG2   1 
ATOM   6910  N  N     . ARG C 2  428  ? 465.375 -25.255 660.425 1.00 108.22 ? 428  ARG C N     1 
ATOM   6911  C  CA    . ARG C 2  428  ? 465.511 -24.552 661.692 1.00 101.39 ? 428  ARG C CA    1 
ATOM   6912  C  C     . ARG C 2  428  ? 464.875 -25.297 662.843 1.00 107.79 ? 428  ARG C C     1 
ATOM   6913  O  O     . ARG C 2  428  ? 465.185 -25.008 664.000 1.00 109.08 ? 428  ARG C O     1 
ATOM   6914  C  CB    . ARG C 2  428  ? 464.893 -23.180 661.557 1.00 97.20  ? 428  ARG C CB    1 
ATOM   6915  C  CG    . ARG C 2  428  ? 465.386 -22.442 660.335 1.00 102.08 ? 428  ARG C CG    1 
ATOM   6916  C  CD    . ARG C 2  428  ? 464.534 -21.263 660.181 1.00 101.56 ? 428  ARG C CD    1 
ATOM   6917  N  NE    . ARG C 2  428  ? 465.244 -20.019 660.367 1.00 88.73  ? 428  ARG C NE    1 
ATOM   6918  C  CZ    . ARG C 2  428  ? 465.479 -19.164 659.396 1.00 97.01  ? 428  ARG C CZ    1 
ATOM   6919  N  NH1   . ARG C 2  428  ? 465.043 -19.427 658.170 1.00 114.20 ? 428  ARG C NH1   1 
ATOM   6920  N  NH2   . ARG C 2  428  ? 466.109 -18.036 659.661 1.00 98.10  ? 428  ARG C NH2   1 
ATOM   6921  N  N     . ASP C 2  429  ? 464.049 -26.285 662.540 1.00 109.50 ? 429  ASP C N     1 
ATOM   6922  C  CA    . ASP C 2  429  ? 463.318 -27.047 663.531 1.00 105.48 ? 429  ASP C CA    1 
ATOM   6923  C  C     . ASP C 2  429  ? 464.294 -27.785 664.439 1.00 102.14 ? 429  ASP C C     1 
ATOM   6924  O  O     . ASP C 2  429  ? 465.467 -27.982 664.112 1.00 100.69 ? 429  ASP C O     1 
ATOM   6925  C  CB    . ASP C 2  429  ? 462.434 -28.068 662.819 1.00 111.02 ? 429  ASP C CB    1 
ATOM   6926  C  CG    . ASP C 2  429  ? 460.999 -27.653 662.758 1.00 115.81 ? 429  ASP C CG    1 
ATOM   6927  O  OD1   . ASP C 2  429  ? 460.521 -27.023 663.721 1.00 118.79 ? 429  ASP C OD1   1 
ATOM   6928  O  OD2   . ASP C 2  429  ? 460.367 -27.921 661.712 1.00 118.83 ? 429  ASP C OD2   1 
ATOM   6929  N  N     . VAL C 2  430  ? 463.813 -28.157 665.616 1.00 98.74  ? 430  VAL C N     1 
ATOM   6930  C  CA    . VAL C 2  430  ? 464.557 -29.062 666.477 1.00 97.42  ? 430  VAL C CA    1 
ATOM   6931  C  C     . VAL C 2  430  ? 464.083 -30.454 666.098 1.00 94.98  ? 430  VAL C C     1 
ATOM   6932  O  O     . VAL C 2  430  ? 462.926 -30.791 666.325 1.00 103.21 ? 430  VAL C O     1 
ATOM   6933  C  CB    . VAL C 2  430  ? 464.355 -28.768 667.965 1.00 90.15  ? 430  VAL C CB    1 
ATOM   6934  C  CG1   . VAL C 2  430  ? 464.817 -29.951 668.805 1.00 83.40  ? 430  VAL C CG1   1 
ATOM   6935  C  CG2   . VAL C 2  430  ? 465.142 -27.548 668.335 1.00 93.20  ? 430  VAL C CG2   1 
ATOM   6936  N  N     . HIS C 2  431  ? 464.966 -31.237 665.478 1.00 90.35  ? 431  HIS C N     1 
ATOM   6937  C  CA    . HIS C 2  431  ? 464.677 -32.604 665.060 1.00 91.40  ? 431  HIS C CA    1 
ATOM   6938  C  C     . HIS C 2  431  ? 464.730 -33.584 666.233 1.00 92.02  ? 431  HIS C C     1 
ATOM   6939  O  O     . HIS C 2  431  ? 465.444 -33.379 667.222 1.00 95.36  ? 431  HIS C O     1 
ATOM   6940  C  CB    . HIS C 2  431  ? 465.661 -32.993 663.945 1.00 89.00  ? 431  HIS C CB    1 
ATOM   6941  C  CG    . HIS C 2  431  ? 465.255 -34.193 663.146 1.00 87.93  ? 431  HIS C CG    1 
ATOM   6942  N  ND1   . HIS C 2  431  ? 465.474 -35.484 663.583 1.00 86.92  ? 431  HIS C ND1   1 
ATOM   6943  C  CD2   . HIS C 2  431  ? 464.558 -34.304 661.992 1.00 87.99  ? 431  HIS C CD2   1 
ATOM   6944  C  CE1   . HIS C 2  431  ? 464.991 -36.337 662.699 1.00 87.31  ? 431  HIS C CE1   1 
ATOM   6945  N  NE2   . HIS C 2  431  ? 464.417 -35.647 661.729 1.00 91.54  ? 431  HIS C NE2   1 
ATOM   6946  N  N     . ARG C 2  432  ? 463.942 -34.659 666.125 1.00 80.71  ? 432  ARG C N     1 
ATOM   6947  C  CA    . ARG C 2  432  ? 463.949 -35.651 667.191 1.00 85.78  ? 432  ARG C CA    1 
ATOM   6948  C  C     . ARG C 2  432  ? 465.339 -36.215 667.444 1.00 92.58  ? 432  ARG C C     1 
ATOM   6949  O  O     . ARG C 2  432  ? 465.672 -36.564 668.580 1.00 94.55  ? 432  ARG C O     1 
ATOM   6950  C  CB    . ARG C 2  432  ? 462.955 -36.753 666.871 1.00 87.47  ? 432  ARG C CB    1 
ATOM   6951  C  CG    . ARG C 2  432  ? 463.181 -37.505 665.641 1.00 91.18  ? 432  ARG C CG    1 
ATOM   6952  C  CD    . ARG C 2  432  ? 462.193 -38.631 665.605 1.00 98.20  ? 432  ARG C CD    1 
ATOM   6953  N  NE    . ARG C 2  432  ? 462.363 -39.509 664.456 1.00 100.28 ? 432  ARG C NE    1 
ATOM   6954  C  CZ    . ARG C 2  432  ? 463.217 -40.530 664.438 1.00 104.82 ? 432  ARG C CZ    1 
ATOM   6955  N  NH1   . ARG C 2  432  ? 463.983 -40.786 665.503 1.00 101.12 ? 432  ARG C NH1   1 
ATOM   6956  N  NH2   . ARG C 2  432  ? 463.306 -41.291 663.356 1.00 110.30 ? 432  ARG C NH2   1 
ATOM   6957  N  N     . THR C 2  433  ? 466.160 -36.306 666.406 1.00 100.02 ? 433  THR C N     1 
ATOM   6958  C  CA    . THR C 2  433  ? 467.519 -36.818 666.500 1.00 98.12  ? 433  THR C CA    1 
ATOM   6959  C  C     . THR C 2  433  ? 468.488 -35.817 667.115 1.00 99.19  ? 433  THR C C     1 
ATOM   6960  O  O     . THR C 2  433  ? 469.651 -36.173 667.349 1.00 102.28 ? 433  THR C O     1 
ATOM   6961  C  CB    . THR C 2  433  ? 468.017 -37.218 665.108 1.00 91.68  ? 433  THR C CB    1 
ATOM   6962  O  OG1   . THR C 2  433  ? 467.972 -36.061 664.282 1.00 93.00  ? 433  THR C OG1   1 
ATOM   6963  C  CG2   . THR C 2  433  ? 467.156 -38.285 664.492 1.00 91.96  ? 433  THR C CG2   1 
ATOM   6964  N  N     . HIS C 2  434  ? 468.051 -34.581 667.384 1.00 95.68  ? 434  HIS C N     1 
ATOM   6965  C  CA    . HIS C 2  434  ? 468.951 -33.655 668.053 1.00 97.36  ? 434  HIS C CA    1 
ATOM   6966  C  C     . HIS C 2  434  ? 469.246 -34.090 669.473 1.00 100.74 ? 434  HIS C C     1 
ATOM   6967  O  O     . HIS C 2  434  ? 470.276 -33.688 670.025 1.00 103.56 ? 434  HIS C O     1 
ATOM   6968  C  CB    . HIS C 2  434  ? 468.376 -32.239 668.118 1.00 95.69  ? 434  HIS C CB    1 
ATOM   6969  C  CG    . HIS C 2  434  ? 468.418 -31.483 666.824 1.00 95.46  ? 434  HIS C CG    1 
ATOM   6970  N  ND1   . HIS C 2  434  ? 468.554 -32.094 665.598 1.00 93.06  ? 434  HIS C ND1   1 
ATOM   6971  C  CD2   . HIS C 2  434  ? 468.361 -30.152 666.577 1.00 92.31  ? 434  HIS C CD2   1 
ATOM   6972  C  CE1   . HIS C 2  434  ? 468.551 -31.174 664.650 1.00 91.71  ? 434  HIS C CE1   1 
ATOM   6973  N  NE2   . HIS C 2  434  ? 468.436 -29.988 665.219 1.00 85.99  ? 434  HIS C NE2   1 
ATOM   6974  N  N     . TYR C 2  435  ? 468.449 -35.002 670.009 1.00 97.23  ? 435  TYR C N     1 
ATOM   6975  C  CA    . TYR C 2  435  ? 468.618 -35.462 671.376 1.00 96.72  ? 435  TYR C CA    1 
ATOM   6976  C  C     . TYR C 2  435  ? 470.024 -35.955 671.626 1.00 96.84  ? 435  TYR C C     1 
ATOM   6977  O  O     . TYR C 2  435  ? 470.503 -36.873 670.962 1.00 103.48 ? 435  TYR C O     1 
ATOM   6978  C  CB    . TYR C 2  435  ? 467.612 -36.579 671.645 1.00 101.04 ? 435  TYR C CB    1 
ATOM   6979  C  CG    . TYR C 2  435  ? 467.506 -36.998 673.083 1.00 102.17 ? 435  TYR C CG    1 
ATOM   6980  C  CD1   . TYR C 2  435  ? 466.440 -36.576 673.889 1.00 102.11 ? 435  TYR C CD1   1 
ATOM   6981  C  CD2   . TYR C 2  435  ? 468.457 -37.837 673.637 1.00 102.22 ? 435  TYR C CD2   1 
ATOM   6982  C  CE1   . TYR C 2  435  ? 466.344 -36.983 675.213 1.00 98.80  ? 435  TYR C CE1   1 
ATOM   6983  C  CE2   . TYR C 2  435  ? 468.371 -38.241 674.948 1.00 106.79 ? 435  TYR C CE2   1 
ATOM   6984  C  CZ    . TYR C 2  435  ? 467.317 -37.822 675.730 1.00 101.47 ? 435  TYR C CZ    1 
ATOM   6985  O  OH    . TYR C 2  435  ? 467.278 -38.262 677.026 1.00 99.42  ? 435  TYR C OH    1 
ATOM   6986  N  N     . GLY C 2  436  ? 470.687 -35.343 672.594 1.00 94.60  ? 436  GLY C N     1 
ATOM   6987  C  CA    . GLY C 2  436  ? 472.038 -35.741 672.916 1.00 101.78 ? 436  GLY C CA    1 
ATOM   6988  C  C     . GLY C 2  436  ? 473.126 -35.271 671.976 1.00 100.10 ? 436  GLY C C     1 
ATOM   6989  O  O     . GLY C 2  436  ? 474.305 -35.542 672.248 1.00 101.56 ? 436  GLY C O     1 
ATOM   6990  N  N     . ARG C 2  437  ? 472.783 -34.576 670.891 1.00 94.23  ? 437  ARG C N     1 
ATOM   6991  C  CA    . ARG C 2  437  ? 473.763 -34.191 669.885 1.00 94.73  ? 437  ARG C CA    1 
ATOM   6992  C  C     . ARG C 2  437  ? 473.910 -32.686 669.723 1.00 92.30  ? 437  ARG C C     1 
ATOM   6993  O  O     . ARG C 2  437  ? 475.018 -32.158 669.878 1.00 89.44  ? 437  ARG C O     1 
ATOM   6994  C  CB    . ARG C 2  437  ? 473.434 -34.842 668.542 1.00 103.98 ? 437  ARG C CB    1 
ATOM   6995  C  CG    . ARG C 2  437  ? 473.611 -36.331 668.554 1.00 103.49 ? 437  ARG C CG    1 
ATOM   6996  C  CD    . ARG C 2  437  ? 473.154 -36.953 667.276 1.00 101.87 ? 437  ARG C CD    1 
ATOM   6997  N  NE    . ARG C 2  437  ? 473.204 -38.400 667.398 1.00 107.18 ? 437  ARG C NE    1 
ATOM   6998  C  CZ    . ARG C 2  437  ? 472.254 -39.153 667.932 1.00 106.46 ? 437  ARG C CZ    1 
ATOM   6999  N  NH1   . ARG C 2  437  ? 471.145 -38.601 668.392 1.00 110.56 ? 437  ARG C NH1   1 
ATOM   7000  N  NH2   . ARG C 2  437  ? 472.415 -40.465 667.994 1.00 107.48 ? 437  ARG C NH2   1 
ATOM   7001  N  N     . ILE C 2  438  ? 472.843 -31.987 669.368 1.00 90.58  ? 438  ILE C N     1 
ATOM   7002  C  CA    . ILE C 2  438  ? 472.856 -30.541 669.198 1.00 93.93  ? 438  ILE C CA    1 
ATOM   7003  C  C     . ILE C 2  438  ? 471.951 -29.944 670.277 1.00 99.63  ? 438  ILE C C     1 
ATOM   7004  O  O     . ILE C 2  438  ? 470.804 -30.380 670.436 1.00 98.61  ? 438  ILE C O     1 
ATOM   7005  C  CB    . ILE C 2  438  ? 472.375 -30.171 667.788 1.00 90.69  ? 438  ILE C CB    1 
ATOM   7006  C  CG1   . ILE C 2  438  ? 473.273 -30.837 666.764 1.00 91.67  ? 438  ILE C CG1   1 
ATOM   7007  C  CG2   . ILE C 2  438  ? 472.531 -28.710 667.566 1.00 88.04  ? 438  ILE C CG2   1 
ATOM   7008  C  CD1   . ILE C 2  438  ? 472.863 -30.580 665.385 1.00 87.55  ? 438  ILE C CD1   1 
ATOM   7009  N  N     . CYS C 2  439  ? 472.438 -28.924 670.989 1.00 98.45  ? 439  CYS C N     1 
ATOM   7010  C  CA    . CYS C 2  439  ? 471.643 -28.343 672.067 1.00 91.95  ? 439  CYS C CA    1 
ATOM   7011  C  C     . CYS C 2  439  ? 470.351 -27.731 671.550 1.00 96.35  ? 439  CYS C C     1 
ATOM   7012  O  O     . CYS C 2  439  ? 470.373 -27.000 670.536 1.00 96.53  ? 439  CYS C O     1 
ATOM   7013  C  CB    . CYS C 2  439  ? 472.391 -27.255 672.822 1.00 91.94  ? 439  CYS C CB    1 
ATOM   7014  S  SG    . CYS C 2  439  ? 471.364 -26.614 674.194 1.00 81.47  ? 439  CYS C SG    1 
ATOM   7015  N  N     . PRO C 2  440  ? 469.201 -28.103 672.136 1.00 88.56  ? 440  PRO C N     1 
ATOM   7016  C  CA    . PRO C 2  440  ? 467.915 -27.508 671.742 1.00 85.95  ? 440  PRO C CA    1 
ATOM   7017  C  C     . PRO C 2  440  ? 467.719 -26.087 672.232 1.00 86.30  ? 440  PRO C C     1 
ATOM   7018  O  O     . PRO C 2  440  ? 466.819 -25.404 671.731 1.00 88.95  ? 440  PRO C O     1 
ATOM   7019  C  CB    . PRO C 2  440  ? 466.890 -28.467 672.341 1.00 78.10  ? 440  PRO C CB    1 
ATOM   7020  C  CG    . PRO C 2  440  ? 467.579 -29.034 673.495 1.00 85.61  ? 440  PRO C CG    1 
ATOM   7021  C  CD    . PRO C 2  440  ? 469.027 -29.156 673.143 1.00 83.63  ? 440  PRO C CD    1 
ATOM   7022  N  N     . VAL C 2  441  ? 468.528 -25.621 673.178 1.00 86.30  ? 441  VAL C N     1 
ATOM   7023  C  CA    . VAL C 2  441  ? 468.350 -24.307 673.803 1.00 86.28  ? 441  VAL C CA    1 
ATOM   7024  C  C     . VAL C 2  441  ? 469.171 -23.236 673.104 1.00 84.69  ? 441  VAL C C     1 
ATOM   7025  O  O     . VAL C 2  441  ? 468.635 -22.209 672.686 1.00 79.66  ? 441  VAL C O     1 
ATOM   7026  C  CB    . VAL C 2  441  ? 468.713 -24.370 675.304 1.00 87.95  ? 441  VAL C CB    1 
ATOM   7027  C  CG1   . VAL C 2  441  ? 468.722 -22.973 675.913 1.00 85.43  ? 441  VAL C CG1   1 
ATOM   7028  C  CG2   . VAL C 2  441  ? 467.771 -25.270 676.042 1.00 81.10  ? 441  VAL C CG2   1 
ATOM   7029  N  N     . GLU C 2  442  ? 470.479 -23.465 672.966 1.00 89.37  ? 442  GLU C N     1 
ATOM   7030  C  CA    . GLU C 2  442  ? 471.439 -22.410 672.641 1.00 90.10  ? 442  GLU C CA    1 
ATOM   7031  C  C     . GLU C 2  442  ? 471.414 -22.277 671.125 1.00 86.75  ? 442  GLU C C     1 
ATOM   7032  O  O     . GLU C 2  442  ? 471.857 -23.167 670.389 1.00 81.33  ? 442  GLU C O     1 
ATOM   7033  C  CB    . GLU C 2  442  ? 472.822 -22.744 673.195 1.00 89.41  ? 442  GLU C CB    1 
ATOM   7034  C  CG    . GLU C 2  442  ? 473.837 -21.607 673.100 1.00 90.63  ? 442  GLU C CG    1 
ATOM   7035  C  CD    . GLU C 2  442  ? 475.291 -22.093 673.015 1.00 95.80  ? 442  GLU C CD    1 
ATOM   7036  O  OE1   . GLU C 2  442  ? 475.975 -21.758 672.003 1.00 101.45 ? 442  GLU C OE1   1 
ATOM   7037  O  OE2   . GLU C 2  442  ? 475.761 -22.765 673.972 1.00 93.75  ? 442  GLU C OE2   1 
ATOM   7038  N  N     . THR C 2  443  ? 470.747 -21.213 670.691 1.00 83.74  ? 443  THR C N     1 
ATOM   7039  C  CA    . THR C 2  443  ? 470.560 -20.786 669.313 1.00 88.15  ? 443  THR C CA    1 
ATOM   7040  C  C     . THR C 2  443  ? 470.370 -19.281 669.308 1.00 89.00  ? 443  THR C C     1 
ATOM   7041  O  O     . THR C 2  443  ? 470.053 -18.697 670.344 1.00 92.21  ? 443  THR C O     1 
ATOM   7042  C  CB    . THR C 2  443  ? 469.341 -21.477 668.686 1.00 89.30  ? 443  THR C CB    1 
ATOM   7043  O  OG1   . THR C 2  443  ? 469.234 -21.140 667.297 1.00 92.46  ? 443  THR C OG1   1 
ATOM   7044  C  CG2   . THR C 2  443  ? 468.076 -21.080 669.396 1.00 95.13  ? 443  THR C CG2   1 
ATOM   7045  N  N     . PRO C 2  444  ? 470.674 -18.609 668.202 1.00 97.56  ? 444  PRO C N     1 
ATOM   7046  C  CA    . PRO C 2  444  ? 470.439 -17.168 668.177 1.00 100.09 ? 444  PRO C CA    1 
ATOM   7047  C  C     . PRO C 2  444  ? 468.960 -16.911 668.107 1.00 98.59  ? 444  PRO C C     1 
ATOM   7048  O  O     . PRO C 2  444  ? 468.215 -17.688 667.515 1.00 101.51 ? 444  PRO C O     1 
ATOM   7049  C  CB    . PRO C 2  444  ? 471.125 -16.700 666.885 1.00 103.17 ? 444  PRO C CB    1 
ATOM   7050  C  CG    . PRO C 2  444  ? 472.103 -17.769 666.559 1.00 101.24 ? 444  PRO C CG    1 
ATOM   7051  C  CD    . PRO C 2  444  ? 471.457 -19.046 667.035 1.00 99.87  ? 444  PRO C CD    1 
ATOM   7052  N  N     . GLU C 2  445  ? 468.528 -15.884 668.811 1.00 103.85 ? 445  GLU C N     1 
ATOM   7053  C  CA    . GLU C 2  445  ? 467.190 -15.344 668.656 1.00 105.09 ? 445  GLU C CA    1 
ATOM   7054  C  C     . GLU C 2  445  ? 467.219 -14.393 667.451 1.00 105.68 ? 445  GLU C C     1 
ATOM   7055  O  O     . GLU C 2  445  ? 468.204 -13.678 667.232 1.00 109.52 ? 445  GLU C O     1 
ATOM   7056  C  CB    . GLU C 2  445  ? 466.755 -14.744 670.000 1.00 107.12 ? 445  GLU C CB    1 
ATOM   7057  C  CG    . GLU C 2  445  ? 466.839 -13.272 670.275 1.00 111.82 ? 445  GLU C CG    1 
ATOM   7058  C  CD    . GLU C 2  445  ? 466.321 -12.971 671.688 1.00 121.84 ? 445  GLU C CD    1 
ATOM   7059  O  OE1   . GLU C 2  445  ? 467.168 -12.956 672.620 1.00 113.04 ? 445  GLU C OE1   1 
ATOM   7060  O  OE2   . GLU C 2  445  ? 465.098 -12.773 671.886 1.00 131.90 ? 445  GLU C OE2   1 
ATOM   7061  N  N     . GLY C 2  446  ? 466.156 -14.388 666.662 1.00 101.30 ? 446  GLY C N     1 
ATOM   7062  C  CA    . GLY C 2  446  ? 466.100 -13.568 665.459 1.00 95.61  ? 446  GLY C CA    1 
ATOM   7063  C  C     . GLY C 2  446  ? 466.317 -14.360 664.178 1.00 105.15 ? 446  GLY C C     1 
ATOM   7064  O  O     . GLY C 2  446  ? 466.053 -15.565 664.100 1.00 103.80 ? 446  GLY C O     1 
ATOM   7065  N  N     . ALA C 2  447  ? 466.750 -13.636 663.129 1.00 103.51 ? 447  ALA C N     1 
ATOM   7066  C  CA    . ALA C 2  447  ? 466.793 -14.182 661.766 1.00 92.65  ? 447  ALA C CA    1 
ATOM   7067  C  C     . ALA C 2  447  ? 467.540 -15.506 661.610 1.00 93.62  ? 447  ALA C C     1 
ATOM   7068  O  O     . ALA C 2  447  ? 467.193 -16.307 660.740 1.00 94.76  ? 447  ALA C O     1 
ATOM   7069  C  CB    . ALA C 2  447  ? 467.398 -13.152 660.834 1.00 98.34  ? 447  ALA C CB    1 
ATOM   7070  N  N     . ASN C 2  448  ? 468.568 -15.746 662.406 1.00 100.17 ? 448  ASN C N     1 
ATOM   7071  C  CA    . ASN C 2  448  ? 469.391 -16.954 662.326 1.00 104.96 ? 448  ASN C CA    1 
ATOM   7072  C  C     . ASN C 2  448  ? 468.865 -18.131 663.166 1.00 104.69 ? 448  ASN C C     1 
ATOM   7073  O  O     . ASN C 2  448  ? 469.559 -19.145 663.293 1.00 104.49 ? 448  ASN C O     1 
ATOM   7074  C  CB    . ASN C 2  448  ? 470.842 -16.640 662.685 1.00 106.31 ? 448  ASN C CB    1 
ATOM   7075  C  CG    . ASN C 2  448  ? 471.553 -15.934 661.579 1.00 104.74 ? 448  ASN C CG    1 
ATOM   7076  O  OD1   . ASN C 2  448  ? 471.344 -16.239 660.410 1.00 114.29 ? 448  ASN C OD1   1 
ATOM   7077  N  ND2   . ASN C 2  448  ? 472.405 -14.988 661.932 1.00 107.60 ? 448  ASN C ND2   1 
ATOM   7078  N  N     . ILE C 2  449  ? 467.673 -18.021 663.743 1.00 97.45  ? 449  ILE C N     1 
ATOM   7079  C  CA    . ILE C 2  449  ? 467.153 -19.046 664.634 1.00 94.17  ? 449  ILE C CA    1 
ATOM   7080  C  C     . ILE C 2  449  ? 467.194 -20.421 663.982 1.00 97.13  ? 449  ILE C C     1 
ATOM   7081  O  O     . ILE C 2  449  ? 466.774 -20.611 662.836 1.00 100.10 ? 449  ILE C O     1 
ATOM   7082  C  CB    . ILE C 2  449  ? 465.718 -18.653 665.030 1.00 99.43  ? 449  ILE C CB    1 
ATOM   7083  C  CG1   . ILE C 2  449  ? 465.142 -19.536 666.156 1.00 101.99 ? 449  ILE C CG1   1 
ATOM   7084  C  CG2   . ILE C 2  449  ? 464.838 -18.516 663.792 1.00 97.61  ? 449  ILE C CG2   1 
ATOM   7085  C  CD1   . ILE C 2  449  ? 465.408 -19.052 667.553 1.00 103.13 ? 449  ILE C CD1   1 
ATOM   7086  N  N     . GLY C 2  450  ? 467.787 -21.378 664.700 1.00 97.81  ? 450  GLY C N     1 
ATOM   7087  C  CA    . GLY C 2  450  ? 467.900 -22.746 664.236 1.00 97.73  ? 450  GLY C CA    1 
ATOM   7088  C  C     . GLY C 2  450  ? 469.043 -23.066 663.295 1.00 100.82 ? 450  GLY C C     1 
ATOM   7089  O  O     . GLY C 2  450  ? 469.333 -24.254 663.096 1.00 106.41 ? 450  GLY C O     1 
ATOM   7090  N  N     . LEU C 2  451  ? 469.672 -22.058 662.665 1.00 100.71 ? 451  LEU C N     1 
ATOM   7091  C  CA    . LEU C 2  451  ? 470.810 -22.277 661.761 1.00 94.64  ? 451  LEU C CA    1 
ATOM   7092  C  C     . LEU C 2  451  ? 472.150 -22.418 662.485 1.00 91.97  ? 451  LEU C C     1 
ATOM   7093  O  O     . LEU C 2  451  ? 472.905 -23.355 662.212 1.00 93.49  ? 451  LEU C O     1 
ATOM   7094  C  CB    . LEU C 2  451  ? 470.876 -21.115 660.773 1.00 88.29  ? 451  LEU C CB    1 
ATOM   7095  C  CG    . LEU C 2  451  ? 469.543 -20.926 660.060 1.00 90.42  ? 451  LEU C CG    1 
ATOM   7096  C  CD1   . LEU C 2  451  ? 469.619 -19.872 659.022 1.00 92.02  ? 451  LEU C CD1   1 
ATOM   7097  C  CD2   . LEU C 2  451  ? 469.159 -22.234 659.396 1.00 91.21  ? 451  LEU C CD2   1 
ATOM   7098  N  N     . ILE C 2  452  ? 472.407 -21.583 663.484 1.00 91.37  ? 452  ILE C N     1 
ATOM   7099  C  CA    . ILE C 2  452  ? 473.601 -21.659 664.321 1.00 88.41  ? 452  ILE C CA    1 
ATOM   7100  C  C     . ILE C 2  452  ? 473.221 -22.283 665.652 1.00 86.04  ? 452  ILE C C     1 
ATOM   7101  O  O     . ILE C 2  452  ? 472.311 -21.808 666.329 1.00 85.44  ? 452  ILE C O     1 
ATOM   7102  C  CB    . ILE C 2  452  ? 474.220 -20.276 664.533 1.00 86.98  ? 452  ILE C CB    1 
ATOM   7103  C  CG1   . ILE C 2  452  ? 474.217 -19.506 663.234 1.00 80.69  ? 452  ILE C CG1   1 
ATOM   7104  C  CG2   . ILE C 2  452  ? 475.609 -20.393 665.077 1.00 90.12  ? 452  ILE C CG2   1 
ATOM   7105  C  CD1   . ILE C 2  452  ? 474.522 -18.071 663.444 1.00 87.75  ? 452  ILE C CD1   1 
ATOM   7106  N  N     . THR C 2  453  ? 473.901 -23.362 666.009 1.00 86.22  ? 453  THR C N     1 
ATOM   7107  C  CA    . THR C 2  453  ? 473.609 -24.153 667.197 1.00 88.09  ? 453  THR C CA    1 
ATOM   7108  C  C     . THR C 2  453  ? 474.887 -24.479 667.961 1.00 87.62  ? 453  THR C C     1 
ATOM   7109  O  O     . THR C 2  453  ? 475.907 -23.820 667.766 1.00 87.67  ? 453  THR C O     1 
ATOM   7110  C  CB    . THR C 2  453  ? 472.857 -25.429 666.827 1.00 88.19  ? 453  THR C CB    1 
ATOM   7111  O  OG1   . THR C 2  453  ? 473.394 -25.989 665.633 1.00 95.60  ? 453  THR C OG1   1 
ATOM   7112  C  CG2   . THR C 2  453  ? 471.410 -25.094 666.527 1.00 94.17  ? 453  THR C CG2   1 
ATOM   7113  N  N     . SER C 2  454  ? 474.796 -25.308 668.986 1.00 93.96  ? 454  SER C N     1 
ATOM   7114  C  CA    . SER C 2  454  ? 475.962 -25.616 669.795 1.00 88.85  ? 454  SER C CA    1 
ATOM   7115  C  C     . SER C 2  454  ? 476.022 -27.120 670.016 1.00 86.71  ? 454  SER C C     1 
ATOM   7116  O  O     . SER C 2  454  ? 474.996 -27.787 670.141 1.00 88.48  ? 454  SER C O     1 
ATOM   7117  C  CB    . SER C 2  454  ? 475.966 -24.883 671.104 1.00 85.84  ? 454  SER C CB    1 
ATOM   7118  O  OG    . SER C 2  454  ? 477.298 -24.593 671.447 1.00 84.71  ? 454  SER C OG    1 
ATOM   7119  N  N     . LEU C 2  455  ? 477.238 -27.644 669.980 1.00 89.29  ? 455  LEU C N     1 
ATOM   7120  C  CA    . LEU C 2  455  ? 477.482 -29.061 670.185 1.00 88.88  ? 455  LEU C CA    1 
ATOM   7121  C  C     . LEU C 2  455  ? 477.046 -29.465 671.585 1.00 89.40  ? 455  LEU C C     1 
ATOM   7122  O  O     . LEU C 2  455  ? 477.379 -28.787 672.563 1.00 91.24  ? 455  LEU C O     1 
ATOM   7123  C  CB    . LEU C 2  455  ? 478.974 -29.340 669.989 1.00 83.85  ? 455  LEU C CB    1 
ATOM   7124  C  CG    . LEU C 2  455  ? 479.370 -30.793 669.860 1.00 84.51  ? 455  LEU C CG    1 
ATOM   7125  C  CD1   . LEU C 2  455  ? 478.718 -31.390 668.631 1.00 84.83  ? 455  LEU C CD1   1 
ATOM   7126  C  CD2   . LEU C 2  455  ? 480.854 -30.883 669.815 1.00 87.13  ? 455  LEU C CD2   1 
ATOM   7127  N  N     . ALA C 2  456  ? 476.365 -30.610 671.694 1.00 89.49  ? 456  ALA C N     1 
ATOM   7128  C  CA    . ALA C 2  456  ? 475.949 -31.082 673.013 1.00 93.09  ? 456  ALA C CA    1 
ATOM   7129  C  C     . ALA C 2  456  ? 477.160 -31.485 673.845 1.00 94.35  ? 456  ALA C C     1 
ATOM   7130  O  O     . ALA C 2  456  ? 478.257 -31.724 673.330 1.00 97.28  ? 456  ALA C O     1 
ATOM   7131  C  CB    . ALA C 2  456  ? 474.977 -32.254 672.919 1.00 92.60  ? 456  ALA C CB    1 
ATOM   7132  N  N     . ALA C 2  457  ? 476.961 -31.497 675.160 1.00 89.98  ? 457  ALA C N     1 
ATOM   7133  C  CA    . ALA C 2  457  ? 478.090 -31.647 676.068 1.00 94.82  ? 457  ALA C CA    1 
ATOM   7134  C  C     . ALA C 2  457  ? 478.777 -33.000 675.907 1.00 97.21  ? 457  ALA C C     1 
ATOM   7135  O  O     . ALA C 2  457  ? 480.009 -33.081 675.989 1.00 99.61  ? 457  ALA C O     1 
ATOM   7136  C  CB    . ALA C 2  457  ? 477.630 -31.425 677.505 1.00 97.93  ? 457  ALA C CB    1 
ATOM   7137  N  N     . TYR C 2  458  ? 478.014 -34.085 675.794 1.00 95.26  ? 458  TYR C N     1 
ATOM   7138  C  CA    . TYR C 2  458  ? 478.671 -35.380 675.671 1.00 100.09 ? 458  TYR C CA    1 
ATOM   7139  C  C     . TYR C 2  458  ? 478.858 -35.827 674.231 1.00 105.88 ? 458  TYR C C     1 
ATOM   7140  O  O     . TYR C 2  458  ? 479.378 -36.929 674.011 1.00 104.57 ? 458  TYR C O     1 
ATOM   7141  C  CB    . TYR C 2  458  ? 477.926 -36.468 676.422 1.00 97.55  ? 458  TYR C CB    1 
ATOM   7142  C  CG    . TYR C 2  458  ? 478.339 -36.610 677.863 1.00 100.80 ? 458  TYR C CG    1 
ATOM   7143  C  CD1   . TYR C 2  458  ? 479.576 -37.145 678.200 1.00 100.99 ? 458  TYR C CD1   1 
ATOM   7144  C  CD2   . TYR C 2  458  ? 477.466 -36.270 678.896 1.00 104.70 ? 458  TYR C CD2   1 
ATOM   7145  C  CE1   . TYR C 2  458  ? 479.953 -37.301 679.529 1.00 106.09 ? 458  TYR C CE1   1 
ATOM   7146  C  CE2   . TYR C 2  458  ? 477.829 -36.423 680.225 1.00 104.73 ? 458  TYR C CE2   1 
ATOM   7147  C  CZ    . TYR C 2  458  ? 479.069 -36.939 680.542 1.00 108.93 ? 458  TYR C CZ    1 
ATOM   7148  O  OH    . TYR C 2  458  ? 479.406 -37.083 681.872 1.00 105.01 ? 458  TYR C OH    1 
ATOM   7149  N  N     . ALA C 2  459  ? 478.479 -34.998 673.259 1.00 104.24 ? 459  ALA C N     1 
ATOM   7150  C  CA    . ALA C 2  459  ? 478.546 -35.372 671.853 1.00 102.53 ? 459  ALA C CA    1 
ATOM   7151  C  C     . ALA C 2  459  ? 479.973 -35.261 671.319 1.00 104.55 ? 459  ALA C C     1 
ATOM   7152  O  O     . ALA C 2  459  ? 480.772 -34.422 671.759 1.00 102.22 ? 459  ALA C O     1 
ATOM   7153  C  CB    . ALA C 2  459  ? 477.599 -34.503 671.018 1.00 96.23  ? 459  ALA C CB    1 
ATOM   7154  N  N     . ARG C 2  460  ? 480.303 -36.165 670.398 1.00 102.59 ? 460  ARG C N     1 
ATOM   7155  C  CA    . ARG C 2  460  ? 481.512 -36.053 669.602 1.00 104.99 ? 460  ARG C CA    1 
ATOM   7156  C  C     . ARG C 2  460  ? 481.230 -36.427 668.150 1.00 107.24 ? 460  ARG C C     1 
ATOM   7157  O  O     . ARG C 2  460  ? 480.344 -37.245 667.869 1.00 105.26 ? 460  ARG C O     1 
ATOM   7158  C  CB    . ARG C 2  460  ? 482.632 -36.893 670.190 1.00 114.61 ? 460  ARG C CB    1 
ATOM   7159  C  CG    . ARG C 2  460  ? 482.182 -38.091 670.944 1.00 113.36 ? 460  ARG C CG    1 
ATOM   7160  C  CD    . ARG C 2  460  ? 483.292 -39.135 670.940 1.00 127.32 ? 460  ARG C CD    1 
ATOM   7161  N  NE    . ARG C 2  460  ? 484.587 -38.570 671.334 1.00 128.87 ? 460  ARG C NE    1 
ATOM   7162  C  CZ    . ARG C 2  460  ? 485.017 -38.494 672.594 1.00 126.57 ? 460  ARG C CZ    1 
ATOM   7163  N  NH1   . ARG C 2  460  ? 484.248 -38.935 673.587 1.00 119.42 ? 460  ARG C NH1   1 
ATOM   7164  N  NH2   . ARG C 2  460  ? 486.212 -37.979 672.864 1.00 123.69 ? 460  ARG C NH2   1 
ATOM   7165  N  N     . VAL C 2  461  ? 481.955 -35.764 667.233 1.00 105.61 ? 461  VAL C N     1 
ATOM   7166  C  CA    . VAL C 2  461  ? 481.849 -35.981 665.787 1.00 97.48  ? 461  VAL C CA    1 
ATOM   7167  C  C     . VAL C 2  461  ? 482.774 -37.123 665.365 1.00 98.50  ? 461  VAL C C     1 
ATOM   7168  O  O     . VAL C 2  461  ? 483.990 -37.047 665.581 1.00 93.79  ? 461  VAL C O     1 
ATOM   7169  C  CB    . VAL C 2  461  ? 482.222 -34.703 665.030 1.00 93.19  ? 461  VAL C CB    1 
ATOM   7170  C  CG1   . VAL C 2  461  ? 482.024 -34.899 663.540 1.00 103.25 ? 461  VAL C CG1   1 
ATOM   7171  C  CG2   . VAL C 2  461  ? 481.459 -33.526 665.554 1.00 90.93  ? 461  VAL C CG2   1 
ATOM   7172  N  N     . ASP C 2  462  ? 482.212 -38.175 664.756 1.00 99.08  ? 462  ASP C N     1 
ATOM   7173  C  CA    . ASP C 2  462  ? 483.035 -39.296 664.303 1.00 105.77 ? 462  ASP C CA    1 
ATOM   7174  C  C     . ASP C 2  462  ? 483.823 -38.930 663.026 1.00 116.28 ? 462  ASP C C     1 
ATOM   7175  O  O     . ASP C 2  462  ? 483.679 -37.838 662.461 1.00 112.53 ? 462  ASP C O     1 
ATOM   7176  C  CB    . ASP C 2  462  ? 482.171 -40.550 664.106 1.00 108.81 ? 462  ASP C CB    1 
ATOM   7177  C  CG    . ASP C 2  462  ? 481.145 -40.432 662.953 1.00 114.52 ? 462  ASP C CG    1 
ATOM   7178  O  OD1   . ASP C 2  462  ? 481.304 -39.597 662.026 1.00 112.34 ? 462  ASP C OD1   1 
ATOM   7179  O  OD2   . ASP C 2  462  ? 480.171 -41.223 662.964 1.00 113.06 ? 462  ASP C OD2   1 
ATOM   7180  N  N     . GLU C 2  463  ? 484.607 -39.905 662.518 1.00 119.73 ? 463  GLU C N     1 
ATOM   7181  C  CA    . GLU C 2  463  ? 485.517 -39.669 661.389 1.00 115.30 ? 463  GLU C CA    1 
ATOM   7182  C  C     . GLU C 2  463  ? 484.758 -39.371 660.108 1.00 113.43 ? 463  GLU C C     1 
ATOM   7183  O  O     . GLU C 2  463  ? 485.286 -38.695 659.217 1.00 111.18 ? 463  GLU C O     1 
ATOM   7184  C  CB    . GLU C 2  463  ? 486.459 -40.855 661.188 1.00 124.34 ? 463  GLU C CB    1 
ATOM   7185  C  CG    . GLU C 2  463  ? 487.274 -41.184 662.443 1.00 136.24 ? 463  GLU C CG    1 
ATOM   7186  C  CD    . GLU C 2  463  ? 487.992 -42.528 662.366 1.00 143.51 ? 463  GLU C CD    1 
ATOM   7187  O  OE1   . GLU C 2  463  ? 487.863 -43.217 661.318 1.00 143.65 ? 463  GLU C OE1   1 
ATOM   7188  O  OE2   . GLU C 2  463  ? 488.643 -42.904 663.376 1.00 134.82 ? 463  GLU C OE2   1 
ATOM   7189  N  N     . LEU C 2  464  ? 483.537 -39.892 659.989 1.00 114.52 ? 464  LEU C N     1 
ATOM   7190  C  CA    . LEU C 2  464  ? 482.695 -39.640 658.827 1.00 114.31 ? 464  LEU C CA    1 
ATOM   7191  C  C     . LEU C 2  464  ? 481.983 -38.300 658.921 1.00 113.61 ? 464  LEU C C     1 
ATOM   7192  O  O     . LEU C 2  464  ? 481.425 -37.840 657.914 1.00 102.49 ? 464  LEU C O     1 
ATOM   7193  C  CB    . LEU C 2  464  ? 481.686 -40.767 658.613 1.00 114.20 ? 464  LEU C CB    1 
ATOM   7194  C  CG    . LEU C 2  464  ? 482.315 -42.103 658.229 1.00 113.97 ? 464  LEU C CG    1 
ATOM   7195  C  CD1   . LEU C 2  464  ? 481.300 -42.972 657.502 1.00 118.00 ? 464  LEU C CD1   1 
ATOM   7196  C  CD2   . LEU C 2  464  ? 483.529 -41.868 657.333 1.00 121.83 ? 464  LEU C CD2   1 
ATOM   7197  N  N     . GLY C 2  465  ? 481.940 -37.693 660.112 1.00 113.57 ? 465  GLY C N     1 
ATOM   7198  C  CA    . GLY C 2  465  ? 481.328 -36.392 660.258 1.00 105.99 ? 465  GLY C CA    1 
ATOM   7199  C  C     . GLY C 2  465  ? 479.961 -36.388 660.874 1.00 103.43 ? 465  GLY C C     1 
ATOM   7200  O  O     . GLY C 2  465  ? 479.264 -35.376 660.757 1.00 102.21 ? 465  GLY C O     1 
ATOM   7201  N  N     . PHE C 2  466  ? 479.520 -37.524 661.413 1.00 107.67 ? 466  PHE C N     1 
ATOM   7202  C  CA    . PHE C 2  466  ? 478.248 -37.673 662.112 1.00 108.54 ? 466  PHE C CA    1 
ATOM   7203  C  C     . PHE C 2  466  ? 478.444 -37.484 663.611 1.00 107.57 ? 466  PHE C C     1 
ATOM   7204  O  O     . PHE C 2  466  ? 479.471 -37.895 664.164 1.00 108.87 ? 466  PHE C O     1 
ATOM   7205  C  CB    . PHE C 2  466  ? 477.677 -39.073 661.876 1.00 112.07 ? 466  PHE C CB    1 
ATOM   7206  C  CG    . PHE C 2  466  ? 477.449 -39.419 660.435 1.00 114.74 ? 466  PHE C CG    1 
ATOM   7207  C  CD1   . PHE C 2  466  ? 477.322 -38.433 659.472 1.00 110.47 ? 466  PHE C CD1   1 
ATOM   7208  C  CD2   . PHE C 2  466  ? 477.438 -40.750 660.038 1.00 119.25 ? 466  PHE C CD2   1 
ATOM   7209  C  CE1   . PHE C 2  466  ? 477.128 -38.768 658.142 1.00 119.65 ? 466  PHE C CE1   1 
ATOM   7210  C  CE2   . PHE C 2  466  ? 477.250 -41.095 658.712 1.00 128.74 ? 466  PHE C CE2   1 
ATOM   7211  C  CZ    . PHE C 2  466  ? 477.099 -40.102 657.756 1.00 125.60 ? 466  PHE C CZ    1 
ATOM   7212  N  N     . ILE C 2  467  ? 477.500 -36.790 664.256 1.00 109.31 ? 467  ILE C N     1 
ATOM   7213  C  CA    . ILE C 2  467  ? 477.584 -36.559 665.703 1.00 106.42 ? 467  ILE C CA    1 
ATOM   7214  C  C     . ILE C 2  467  ? 477.108 -37.802 666.450 1.00 101.15 ? 467  ILE C C     1 
ATOM   7215  O  O     . ILE C 2  467  ? 476.025 -38.331 666.175 1.00 99.80  ? 467  ILE C O     1 
ATOM   7216  C  CB    . ILE C 2  467  ? 476.765 -35.329 666.125 1.00 102.05 ? 467  ILE C CB    1 
ATOM   7217  C  CG1   . ILE C 2  467  ? 477.068 -34.126 665.246 1.00 100.40 ? 467  ILE C CG1   1 
ATOM   7218  C  CG2   . ILE C 2  467  ? 477.016 -34.986 667.573 1.00 101.79 ? 467  ILE C CG2   1 
ATOM   7219  C  CD1   . ILE C 2  467  ? 476.182 -32.942 665.594 1.00 100.53 ? 467  ILE C CD1   1 
ATOM   7220  N  N     . ARG C 2  468  ? 477.918 -38.283 667.384 1.00 99.32  ? 468  ARG C N     1 
ATOM   7221  C  CA    . ARG C 2  468  ? 477.548 -39.438 668.184 1.00 105.34 ? 468  ARG C CA    1 
ATOM   7222  C  C     . ARG C 2  468  ? 477.354 -39.023 669.635 1.00 104.22 ? 468  ARG C C     1 
ATOM   7223  O  O     . ARG C 2  468  ? 477.987 -38.075 670.112 1.00 101.43 ? 468  ARG C O     1 
ATOM   7224  C  CB    . ARG C 2  468  ? 478.616 -40.531 668.124 1.00 111.14 ? 468  ARG C CB    1 
ATOM   7225  C  CG    . ARG C 2  468  ? 478.976 -41.033 666.735 1.00 115.10 ? 468  ARG C CG    1 
ATOM   7226  C  CD    . ARG C 2  468  ? 480.182 -41.994 666.783 1.00 115.18 ? 468  ARG C CD    1 
ATOM   7227  N  NE    . ARG C 2  468  ? 479.761 -43.395 666.758 1.00 117.35 ? 468  ARG C NE    1 
ATOM   7228  C  CZ    . ARG C 2  468  ? 479.780 -44.173 665.681 1.00 122.84 ? 468  ARG C CZ    1 
ATOM   7229  N  NH1   . ARG C 2  468  ? 480.213 -43.691 664.517 1.00 120.21 ? 468  ARG C NH1   1 
ATOM   7230  N  NH2   . ARG C 2  468  ? 479.363 -45.436 665.772 1.00 126.21 ? 468  ARG C NH2   1 
ATOM   7231  N  N     . THR C 2  469  ? 476.461 -39.735 670.334 1.00 104.06 ? 469  THR C N     1 
ATOM   7232  C  CA    . THR C 2  469  ? 476.204 -39.445 671.739 1.00 104.72 ? 469  THR C CA    1 
ATOM   7233  C  C     . THR C 2  469  ? 476.222 -40.721 672.581 1.00 103.34 ? 469  THR C C     1 
ATOM   7234  O  O     . THR C 2  469  ? 475.727 -41.765 672.141 1.00 102.05 ? 469  THR C O     1 
ATOM   7235  C  CB    . THR C 2  469  ? 474.870 -38.704 671.892 1.00 105.79 ? 469  THR C CB    1 
ATOM   7236  O  OG1   . THR C 2  469  ? 474.672 -38.360 673.264 1.00 102.81 ? 469  THR C OG1   1 
ATOM   7237  C  CG2   . THR C 2  469  ? 473.704 -39.566 671.405 1.00 106.93 ? 469  THR C CG2   1 
ATOM   7238  N  N     . PRO C 2  470  ? 476.749 -40.663 673.807 1.00 108.74 ? 470  PRO C N     1 
ATOM   7239  C  CA    . PRO C 2  470  ? 476.901 -41.882 674.631 1.00 112.47 ? 470  PRO C CA    1 
ATOM   7240  C  C     . PRO C 2  470  ? 475.634 -42.410 675.312 1.00 102.89 ? 470  PRO C C     1 
ATOM   7241  O  O     . PRO C 2  470  ? 474.782 -41.644 675.756 1.00 98.81  ? 470  PRO C O     1 
ATOM   7242  C  CB    . PRO C 2  470  ? 477.937 -41.444 675.672 1.00 111.21 ? 470  PRO C CB    1 
ATOM   7243  C  CG    . PRO C 2  470  ? 477.703 -39.986 675.822 1.00 106.87 ? 470  PRO C CG    1 
ATOM   7244  C  CD    . PRO C 2  470  ? 477.347 -39.480 674.453 1.00 105.21 ? 470  PRO C CD    1 
ATOM   7245  N  N     . TYR C 2  471  ? 475.537 -43.748 675.398 1.00 105.29 ? 471  TYR C N     1 
ATOM   7246  C  CA    . TYR C 2  471  ? 474.522 -44.478 676.157 1.00 105.26 ? 471  TYR C CA    1 
ATOM   7247  C  C     . TYR C 2  471  ? 475.123 -45.696 676.851 1.00 115.51 ? 471  TYR C C     1 
ATOM   7248  O  O     . TYR C 2  471  ? 476.036 -46.328 676.313 1.00 117.05 ? 471  TYR C O     1 
ATOM   7249  C  CB    . TYR C 2  471  ? 473.414 -45.007 675.253 1.00 104.17 ? 471  TYR C CB    1 
ATOM   7250  C  CG    . TYR C 2  471  ? 472.603 -43.951 674.573 1.00 104.81 ? 471  TYR C CG    1 
ATOM   7251  C  CD1   . TYR C 2  471  ? 471.800 -43.095 675.304 1.00 109.23 ? 471  TYR C CD1   1 
ATOM   7252  C  CD2   . TYR C 2  471  ? 472.613 -43.826 673.194 1.00 109.36 ? 471  TYR C CD2   1 
ATOM   7253  C  CE1   . TYR C 2  471  ? 471.039 -42.127 674.691 1.00 108.52 ? 471  TYR C CE1   1 
ATOM   7254  C  CE2   . TYR C 2  471  ? 471.855 -42.858 672.560 1.00 112.97 ? 471  TYR C CE2   1 
ATOM   7255  C  CZ    . TYR C 2  471  ? 471.064 -42.011 673.321 1.00 115.81 ? 471  TYR C CZ    1 
ATOM   7256  O  OH    . TYR C 2  471  ? 470.295 -41.040 672.719 1.00 118.50 ? 471  TYR C OH    1 
ATOM   7257  N  N     . ARG C 2  472  ? 474.576 -46.056 678.029 1.00 118.93 ? 472  ARG C N     1 
ATOM   7258  C  CA    . ARG C 2  472  ? 474.991 -47.268 678.753 1.00 121.01 ? 472  ARG C CA    1 
ATOM   7259  C  C     . ARG C 2  472  ? 474.177 -48.490 678.328 1.00 120.70 ? 472  ARG C C     1 
ATOM   7260  O  O     . ARG C 2  472  ? 472.967 -48.406 678.115 1.00 118.21 ? 472  ARG C O     1 
ATOM   7261  C  CB    . ARG C 2  472  ? 474.904 -47.155 680.282 1.00 121.84 ? 472  ARG C CB    1 
ATOM   7262  C  CG    . ARG C 2  472  ? 475.918 -46.263 680.989 1.00 126.34 ? 472  ARG C CG    1 
ATOM   7263  C  CD    . ARG C 2  472  ? 476.281 -46.896 682.357 1.00 131.98 ? 472  ARG C CD    1 
ATOM   7264  N  NE    . ARG C 2  472  ? 475.475 -46.525 683.524 1.00 132.98 ? 472  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C 2  472  ? 475.562 -47.133 684.718 1.00 143.00 ? 472  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C 2  472  ? 476.400 -48.154 684.899 1.00 141.45 ? 472  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C 2  472  ? 474.797 -46.745 685.738 1.00 145.45 ? 472  ARG C NH2   1 
ATOM   7268  N  N     . ARG C 2  473  ? 474.869 -49.608 678.126 1.00 123.69 ? 473  ARG C N     1 
ATOM   7269  C  CA    . ARG C 2  473  ? 474.198 -50.859 677.804 1.00 123.53 ? 473  ARG C CA    1 
ATOM   7270  C  C     . ARG C 2  473  ? 473.428 -51.388 678.996 1.00 129.07 ? 473  ARG C C     1 
ATOM   7271  O  O     . ARG C 2  473  ? 473.895 -51.322 680.136 1.00 137.69 ? 473  ARG C O     1 
ATOM   7272  C  CB    . ARG C 2  473  ? 475.198 -51.917 677.352 1.00 128.74 ? 473  ARG C CB    1 
ATOM   7273  C  CG    . ARG C 2  473  ? 474.552 -53.251 677.013 1.00 130.02 ? 473  ARG C CG    1 
ATOM   7274  C  CD    . ARG C 2  473  ? 475.550 -54.205 676.398 1.00 131.50 ? 473  ARG C CD    1 
ATOM   7275  N  NE    . ARG C 2  473  ? 476.181 -53.599 675.229 1.00 131.58 ? 473  ARG C NE    1 
ATOM   7276  C  CZ    . ARG C 2  473  ? 475.650 -53.605 674.009 1.00 130.49 ? 473  ARG C CZ    1 
ATOM   7277  N  NH1   . ARG C 2  473  ? 474.483 -54.187 673.791 1.00 129.58 ? 473  ARG C NH1   1 
ATOM   7278  N  NH2   . ARG C 2  473  ? 476.284 -53.027 673.003 1.00 138.18 ? 473  ARG C NH2   1 
ATOM   7279  N  N     . VAL C 2  474  ? 472.252 -51.940 678.723 1.00 129.14 ? 474  VAL C N     1 
ATOM   7280  C  CA    . VAL C 2  474  ? 471.429 -52.597 679.731 1.00 133.49 ? 474  VAL C CA    1 
ATOM   7281  C  C     . VAL C 2  474  ? 471.165 -54.009 679.229 1.00 133.14 ? 474  VAL C C     1 
ATOM   7282  O  O     . VAL C 2  474  ? 470.515 -54.187 678.193 1.00 135.78 ? 474  VAL C O     1 
ATOM   7283  C  CB    . VAL C 2  474  ? 470.112 -51.842 679.984 1.00 133.42 ? 474  VAL C CB    1 
ATOM   7284  C  CG1   . VAL C 2  474  ? 469.208 -52.627 680.935 1.00 135.86 ? 474  VAL C CG1   1 
ATOM   7285  C  CG2   . VAL C 2  474  ? 470.386 -50.449 680.524 1.00 130.74 ? 474  VAL C CG2   1 
ATOM   7286  N  N     . VAL C 2  475  ? 471.672 -55.011 679.942 1.00 134.28 ? 475  VAL C N     1 
ATOM   7287  C  CA    . VAL C 2  475  ? 471.465 -56.403 679.559 1.00 137.96 ? 475  VAL C CA    1 
ATOM   7288  C  C     . VAL C 2  475  ? 470.570 -57.048 680.610 1.00 141.70 ? 475  VAL C C     1 
ATOM   7289  O  O     . VAL C 2  475  ? 470.861 -56.974 681.812 1.00 138.83 ? 475  VAL C O     1 
ATOM   7290  C  CB    . VAL C 2  475  ? 472.805 -57.148 679.443 1.00 135.40 ? 475  VAL C CB    1 
ATOM   7291  C  CG1   . VAL C 2  475  ? 472.597 -58.557 678.908 1.00 136.43 ? 475  VAL C CG1   1 
ATOM   7292  C  CG2   . VAL C 2  475  ? 473.760 -56.373 678.584 1.00 136.46 ? 475  VAL C CG2   1 
ATOM   7293  N  N     . GLY C 2  476  ? 469.478 -57.675 680.161 1.00 139.95 ? 476  GLY C N     1 
ATOM   7294  C  CA    . GLY C 2  476  ? 468.501 -58.133 681.134 1.00 139.80 ? 476  GLY C CA    1 
ATOM   7295  C  C     . GLY C 2  476  ? 467.961 -56.888 681.802 1.00 141.10 ? 476  GLY C C     1 
ATOM   7296  O  O     . GLY C 2  476  ? 467.396 -55.994 681.150 1.00 139.09 ? 476  GLY C O     1 
ATOM   7297  N  N     . GLY C 2  477  ? 468.087 -56.847 683.129 1.00 137.74 ? 477  GLY C N     1 
ATOM   7298  C  CA    . GLY C 2  477  ? 467.826 -55.639 683.881 1.00 139.53 ? 477  GLY C CA    1 
ATOM   7299  C  C     . GLY C 2  477  ? 469.065 -55.003 684.469 1.00 136.59 ? 477  GLY C C     1 
ATOM   7300  O  O     . GLY C 2  477  ? 468.947 -54.046 685.245 1.00 139.84 ? 477  GLY C O     1 
ATOM   7301  N  N     . VAL C 2  478  ? 470.249 -55.494 684.149 1.00 136.72 ? 478  VAL C N     1 
ATOM   7302  C  CA    . VAL C 2  478  ? 471.480 -55.017 684.763 1.00 141.88 ? 478  VAL C CA    1 
ATOM   7303  C  C     . VAL C 2  478  ? 472.131 -54.018 683.802 1.00 145.06 ? 478  VAL C C     1 
ATOM   7304  O  O     . VAL C 2  478  ? 472.201 -54.258 682.587 1.00 138.27 ? 478  VAL C O     1 
ATOM   7305  C  CB    . VAL C 2  478  ? 472.403 -56.184 685.165 1.00 140.88 ? 478  VAL C CB    1 
ATOM   7306  C  CG1   . VAL C 2  478  ? 473.070 -56.849 683.961 1.00 146.40 ? 478  VAL C CG1   1 
ATOM   7307  C  CG2   . VAL C 2  478  ? 473.417 -55.725 686.199 1.00 138.74 ? 478  VAL C CG2   1 
ATOM   7308  N  N     . VAL C 2  479  ? 472.509 -52.854 684.330 1.00 147.71 ? 479  VAL C N     1 
ATOM   7309  C  CA    . VAL C 2  479  ? 473.163 -51.790 683.567 1.00 140.10 ? 479  VAL C CA    1 
ATOM   7310  C  C     . VAL C 2  479  ? 474.681 -51.938 683.616 1.00 138.82 ? 479  VAL C C     1 
ATOM   7311  O  O     . VAL C 2  479  ? 475.284 -51.826 684.692 1.00 136.41 ? 479  VAL C O     1 
ATOM   7312  C  CB    . VAL C 2  479  ? 472.750 -50.412 684.102 1.00 140.19 ? 479  VAL C CB    1 
ATOM   7313  C  CG1   . VAL C 2  479  ? 473.343 -49.317 683.239 1.00 137.68 ? 479  VAL C CG1   1 
ATOM   7314  C  CG2   . VAL C 2  479  ? 471.228 -50.301 684.219 1.00 140.04 ? 479  VAL C CG2   1 
ATOM   7315  N  N     . THR C 2  480  ? 475.302 -52.192 682.459 1.00 136.09 ? 480  THR C N     1 
ATOM   7316  C  CA    . THR C 2  480  ? 476.754 -52.329 682.426 1.00 138.13 ? 480  THR C CA    1 
ATOM   7317  C  C     . THR C 2  480  ? 477.409 -50.953 682.543 1.00 135.09 ? 480  THR C C     1 
ATOM   7318  O  O     . THR C 2  480  ? 476.745 -49.917 682.500 1.00 134.04 ? 480  THR C O     1 
ATOM   7319  C  CB    . THR C 2  480  ? 477.231 -53.016 681.141 1.00 131.26 ? 480  THR C CB    1 
ATOM   7320  O  OG1   . THR C 2  480  ? 476.657 -52.372 680.002 1.00 129.75 ? 480  THR C OG1   1 
ATOM   7321  C  CG2   . THR C 2  480  ? 476.823 -54.480 681.126 1.00 133.30 ? 480  THR C CG2   1 
ATOM   7322  N  N     . ASP C 2  481  ? 478.738 -50.949 682.635 1.00 134.26 ? 481  ASP C N     1 
ATOM   7323  C  CA    . ASP C 2  481  ? 479.528 -49.722 682.586 1.00 137.00 ? 481  ASP C CA    1 
ATOM   7324  C  C     . ASP C 2  481  ? 480.098 -49.455 681.204 1.00 138.40 ? 481  ASP C C     1 
ATOM   7325  O  O     . ASP C 2  481  ? 480.828 -48.475 681.020 1.00 136.57 ? 481  ASP C O     1 
ATOM   7326  C  CB    . ASP C 2  481  ? 480.664 -49.768 683.610 1.00 135.81 ? 481  ASP C CB    1 
ATOM   7327  C  CG    . ASP C 2  481  ? 480.181 -49.554 685.012 1.00 142.58 ? 481  ASP C CG    1 
ATOM   7328  O  OD1   . ASP C 2  481  ? 480.271 -48.404 685.492 1.00 144.18 ? 481  ASP C OD1   1 
ATOM   7329  O  OD2   . ASP C 2  481  ? 479.687 -50.524 685.622 1.00 149.92 ? 481  ASP C OD2   1 
ATOM   7330  N  N     . GLU C 2  482  ? 479.777 -50.305 680.237 1.00 136.39 ? 482  GLU C N     1 
ATOM   7331  C  CA    . GLU C 2  482  ? 480.259 -50.149 678.879 1.00 130.77 ? 482  GLU C CA    1 
ATOM   7332  C  C     . GLU C 2  482  ? 479.421 -49.077 678.198 1.00 128.59 ? 482  GLU C C     1 
ATOM   7333  O  O     . GLU C 2  482  ? 478.189 -49.143 678.200 1.00 128.97 ? 482  GLU C O     1 
ATOM   7334  C  CB    . GLU C 2  482  ? 480.165 -51.477 678.125 1.00 129.18 ? 482  GLU C CB    1 
ATOM   7335  C  CG    . GLU C 2  482  ? 479.884 -51.308 676.632 1.00 133.53 ? 482  GLU C CG    1 
ATOM   7336  C  CD    . GLU C 2  482  ? 479.295 -52.550 675.969 1.00 134.14 ? 482  GLU C CD    1 
ATOM   7337  O  OE1   . GLU C 2  482  ? 479.702 -52.881 674.827 1.00 137.89 ? 482  GLU C OE1   1 
ATOM   7338  O  OE2   . GLU C 2  482  ? 478.447 -53.210 676.599 1.00 134.08 ? 482  GLU C OE2   1 
ATOM   7339  N  N     . VAL C 2  483  ? 480.087 -48.079 677.633 1.00 126.92 ? 483  VAL C N     1 
ATOM   7340  C  CA    . VAL C 2  483  ? 479.415 -46.952 677.004 1.00 124.95 ? 483  VAL C CA    1 
ATOM   7341  C  C     . VAL C 2  483  ? 479.554 -47.091 675.494 1.00 123.21 ? 483  VAL C C     1 
ATOM   7342  O  O     . VAL C 2  483  ? 480.644 -47.371 674.981 1.00 121.97 ? 483  VAL C O     1 
ATOM   7343  C  CB    . VAL C 2  483  ? 480.015 -45.621 677.494 1.00 123.23 ? 483  VAL C CB    1 
ATOM   7344  C  CG1   . VAL C 2  483  ? 479.344 -44.454 676.820 1.00 118.83 ? 483  VAL C CG1   1 
ATOM   7345  C  CG2   . VAL C 2  483  ? 479.905 -45.519 678.994 1.00 128.21 ? 483  VAL C CG2   1 
ATOM   7346  N  N     . VAL C 2  484  ? 478.456 -46.865 674.782 1.00 123.02 ? 484  VAL C N     1 
ATOM   7347  C  CA    . VAL C 2  484  ? 478.436 -46.937 673.328 1.00 117.17 ? 484  VAL C CA    1 
ATOM   7348  C  C     . VAL C 2  484  ? 478.069 -45.569 672.774 1.00 117.56 ? 484  VAL C C     1 
ATOM   7349  O  O     . VAL C 2  484  ? 476.972 -45.056 673.037 1.00 113.68 ? 484  VAL C O     1 
ATOM   7350  C  CB    . VAL C 2  484  ? 477.425 -47.997 672.864 1.00 115.95 ? 484  VAL C CB    1 
ATOM   7351  C  CG1   . VAL C 2  484  ? 477.323 -48.030 671.376 1.00 117.86 ? 484  VAL C CG1   1 
ATOM   7352  C  CG2   . VAL C 2  484  ? 477.824 -49.361 673.399 1.00 121.86 ? 484  VAL C CG2   1 
ATOM   7353  N  N     . TYR C 2  485  ? 478.961 -45.005 671.964 1.00 114.31 ? 485  TYR C N     1 
ATOM   7354  C  CA    . TYR C 2  485  ? 478.673 -43.780 671.234 1.00 109.95 ? 485  TYR C CA    1 
ATOM   7355  C  C     . TYR C 2  485  ? 477.922 -44.135 669.953 1.00 107.42 ? 485  TYR C C     1 
ATOM   7356  O  O     . TYR C 2  485  ? 478.415 -44.922 669.145 1.00 117.08 ? 485  TYR C O     1 
ATOM   7357  C  CB    . TYR C 2  485  ? 479.974 -43.047 670.967 1.00 110.95 ? 485  TYR C CB    1 
ATOM   7358  C  CG    . TYR C 2  485  ? 480.413 -42.131 672.097 1.00 112.32 ? 485  TYR C CG    1 
ATOM   7359  C  CD1   . TYR C 2  485  ? 479.960 -40.824 672.163 1.00 112.44 ? 485  TYR C CD1   1 
ATOM   7360  C  CD2   . TYR C 2  485  ? 481.317 -42.556 673.064 1.00 107.67 ? 485  TYR C CD2   1 
ATOM   7361  C  CE1   . TYR C 2  485  ? 480.376 -39.975 673.148 1.00 110.31 ? 485  TYR C CE1   1 
ATOM   7362  C  CE2   . TYR C 2  485  ? 481.742 -41.700 674.055 1.00 107.47 ? 485  TYR C CE2   1 
ATOM   7363  C  CZ    . TYR C 2  485  ? 481.259 -40.408 674.084 1.00 111.74 ? 485  TYR C CZ    1 
ATOM   7364  O  OH    . TYR C 2  485  ? 481.644 -39.519 675.053 1.00 118.11 ? 485  TYR C OH    1 
ATOM   7365  N  N     . MET C 2  486  ? 476.730 -43.596 669.766 1.00 106.30 ? 486  MET C N     1 
ATOM   7366  C  CA    . MET C 2  486  ? 475.906 -43.980 668.631 1.00 110.12 ? 486  MET C CA    1 
ATOM   7367  C  C     . MET C 2  486  ? 475.652 -42.836 667.670 1.00 111.07 ? 486  MET C C     1 
ATOM   7368  O  O     . MET C 2  486  ? 475.549 -41.678 668.070 1.00 109.21 ? 486  MET C O     1 
ATOM   7369  C  CB    . MET C 2  486  ? 474.553 -44.518 669.073 1.00 113.23 ? 486  MET C CB    1 
ATOM   7370  C  CG    . MET C 2  486  ? 474.661 -45.802 669.821 1.00 117.14 ? 486  MET C CG    1 
ATOM   7371  S  SD    . MET C 2  486  ? 473.066 -46.472 670.221 1.00 116.70 ? 486  MET C SD    1 
ATOM   7372  C  CE    . MET C 2  486  ? 473.588 -48.105 670.695 1.00 123.85 ? 486  MET C CE    1 
ATOM   7373  N  N     . THR C 2  487  ? 475.574 -43.177 666.390 1.00 117.62 ? 487  THR C N     1 
ATOM   7374  C  CA    . THR C 2  487  ? 475.070 -42.218 665.426 1.00 113.34 ? 487  THR C CA    1 
ATOM   7375  C  C     . THR C 2  487  ? 473.550 -42.211 665.548 1.00 110.88 ? 487  THR C C     1 
ATOM   7376  O  O     . THR C 2  487  ? 472.964 -43.080 666.194 1.00 108.71 ? 487  THR C O     1 
ATOM   7377  C  CB    . THR C 2  487  ? 475.497 -42.588 664.011 1.00 110.98 ? 487  THR C CB    1 
ATOM   7378  O  OG1   . THR C 2  487  ? 474.902 -43.842 663.658 1.00 111.65 ? 487  THR C OG1   1 
ATOM   7379  C  CG2   . THR C 2  487  ? 477.002 -42.708 663.933 1.00 113.28 ? 487  THR C CG2   1 
ATOM   7380  N  N     . ALA C 2  488  ? 472.890 -41.267 664.878 1.00 109.92 ? 488  ALA C N     1 
ATOM   7381  C  CA    . ALA C 2  488  ? 471.439 -41.208 665.030 1.00 109.04 ? 488  ALA C CA    1 
ATOM   7382  C  C     . ALA C 2  488  ? 470.764 -42.424 664.416 1.00 110.16 ? 488  ALA C C     1 
ATOM   7383  O  O     . ALA C 2  488  ? 469.825 -42.967 665.001 1.00 120.70 ? 488  ALA C O     1 
ATOM   7384  C  CB    . ALA C 2  488  ? 470.884 -39.920 664.429 1.00 108.86 ? 488  ALA C CB    1 
ATOM   7385  N  N     . THR C 2  489  ? 471.213 -42.870 663.248 1.00 107.18 ? 489  THR C N     1 
ATOM   7386  C  CA    . THR C 2  489  ? 470.585 -44.026 662.615 1.00 107.62 ? 489  THR C CA    1 
ATOM   7387  C  C     . THR C 2  489  ? 470.730 -45.266 663.488 1.00 111.75 ? 489  THR C C     1 
ATOM   7388  O  O     . THR C 2  489  ? 469.798 -46.073 663.612 1.00 110.62 ? 489  THR C O     1 
ATOM   7389  C  CB    . THR C 2  489  ? 471.133 -44.263 661.219 1.00 104.37 ? 489  THR C CB    1 
ATOM   7390  O  OG1   . THR C 2  489  ? 471.031 -43.045 660.482 1.00 113.71 ? 489  THR C OG1   1 
ATOM   7391  C  CG2   . THR C 2  489  ? 470.305 -45.309 660.522 1.00 102.12 ? 489  THR C CG2   1 
ATOM   7392  N  N     . GLU C 2  490  ? 471.914 -45.469 664.052 1.00 110.25 ? 490  GLU C N     1 
ATOM   7393  C  CA    . GLU C 2  490  ? 472.113 -46.651 664.866 1.00 111.44 ? 490  GLU C CA    1 
ATOM   7394  C  C     . GLU C 2  490  ? 471.354 -46.568 666.180 1.00 120.81 ? 490  GLU C C     1 
ATOM   7395  O  O     . GLU C 2  490  ? 470.917 -47.605 666.690 1.00 126.18 ? 490  GLU C O     1 
ATOM   7396  C  CB    . GLU C 2  490  ? 473.609 -46.814 665.119 1.00 117.48 ? 490  GLU C CB    1 
ATOM   7397  C  CG    . GLU C 2  490  ? 474.046 -48.146 665.673 1.00 126.24 ? 490  GLU C CG    1 
ATOM   7398  C  CD    . GLU C 2  490  ? 475.426 -48.053 666.323 1.00 133.38 ? 490  GLU C CD    1 
ATOM   7399  O  OE1   . GLU C 2  490  ? 476.178 -47.080 666.014 1.00 126.01 ? 490  GLU C OE1   1 
ATOM   7400  O  OE2   . GLU C 2  490  ? 475.732 -48.930 667.172 1.00 133.26 ? 490  GLU C OE2   1 
ATOM   7401  N  N     . GLU C 2  491  ? 471.171 -45.359 666.735 1.00 125.64 ? 491  GLU C N     1 
ATOM   7402  C  CA    . GLU C 2  491  ? 470.398 -45.199 667.974 1.00 119.89 ? 491  GLU C CA    1 
ATOM   7403  C  C     . GLU C 2  491  ? 468.946 -45.630 667.814 1.00 112.89 ? 491  GLU C C     1 
ATOM   7404  O  O     . GLU C 2  491  ? 468.405 -46.321 668.679 1.00 116.77 ? 491  GLU C O     1 
ATOM   7405  C  CB    . GLU C 2  491  ? 470.437 -43.740 668.436 1.00 118.49 ? 491  GLU C CB    1 
ATOM   7406  C  CG    . GLU C 2  491  ? 469.519 -43.428 669.617 1.00 120.30 ? 491  GLU C CG    1 
ATOM   7407  C  CD    . GLU C 2  491  ? 469.358 -41.927 669.906 1.00 122.78 ? 491  GLU C CD    1 
ATOM   7408  O  OE1   . GLU C 2  491  ? 468.202 -41.478 670.106 1.00 123.17 ? 491  GLU C OE1   1 
ATOM   7409  O  OE2   . GLU C 2  491  ? 470.383 -41.208 669.989 1.00 118.06 ? 491  GLU C OE2   1 
ATOM   7410  N  N     . ASP C 2  492  ? 468.352 -45.360 666.653 1.00 111.36 ? 492  ASP C N     1 
ATOM   7411  C  CA    . ASP C 2  492  ? 466.949 -45.667 666.392 1.00 116.95 ? 492  ASP C CA    1 
ATOM   7412  C  C     . ASP C 2  492  ? 466.627 -47.152 666.462 1.00 122.40 ? 492  ASP C C     1 
ATOM   7413  O  O     . ASP C 2  492  ? 465.444 -47.511 666.433 1.00 121.04 ? 492  ASP C O     1 
ATOM   7414  C  CB    . ASP C 2  492  ? 466.536 -45.178 665.001 1.00 117.22 ? 492  ASP C CB    1 
ATOM   7415  C  CG    . ASP C 2  492  ? 466.256 -43.697 664.947 1.00 112.54 ? 492  ASP C CG    1 
ATOM   7416  O  OD1   . ASP C 2  492  ? 466.449 -43.006 665.962 1.00 114.91 ? 492  ASP C OD1   1 
ATOM   7417  O  OD2   . ASP C 2  492  ? 465.838 -43.225 663.872 1.00 112.42 ? 492  ASP C OD2   1 
ATOM   7418  N  N     . ARG C 2  493  ? 467.637 -48.022 666.511 1.00 129.27 ? 493  ARG C N     1 
ATOM   7419  C  CA    . ARG C 2  493  ? 467.372 -49.456 666.515 1.00 132.33 ? 493  ARG C CA    1 
ATOM   7420  C  C     . ARG C 2  493  ? 466.910 -49.936 667.892 1.00 128.68 ? 493  ARG C C     1 
ATOM   7421  O  O     . ARG C 2  493  ? 466.146 -50.903 667.972 1.00 133.13 ? 493  ARG C O     1 
ATOM   7422  C  CB    . ARG C 2  493  ? 468.608 -50.216 665.988 1.00 134.64 ? 493  ARG C CB    1 
ATOM   7423  C  CG    . ARG C 2  493  ? 468.525 -50.543 664.451 1.00 134.74 ? 493  ARG C CG    1 
ATOM   7424  C  CD    . ARG C 2  493  ? 469.713 -51.342 663.844 1.00 138.11 ? 493  ARG C CD    1 
ATOM   7425  N  NE    . ARG C 2  493  ? 469.680 -52.783 664.126 1.00 144.20 ? 493  ARG C NE    1 
ATOM   7426  C  CZ    . ARG C 2  493  ? 470.646 -53.450 664.762 1.00 151.09 ? 493  ARG C CZ    1 
ATOM   7427  N  NH1   . ARG C 2  493  ? 471.735 -52.810 665.180 1.00 149.85 ? 493  ARG C NH1   1 
ATOM   7428  N  NH2   . ARG C 2  493  ? 470.526 -54.758 664.985 1.00 153.03 ? 493  ARG C NH2   1 
ATOM   7429  N  N     . TYR C 2  494  ? 467.381 -49.311 668.976 1.00 127.23 ? 494  TYR C N     1 
ATOM   7430  C  CA    . TYR C 2  494  ? 467.205 -49.832 670.328 1.00 132.42 ? 494  TYR C CA    1 
ATOM   7431  C  C     . TYR C 2  494  ? 466.110 -49.056 671.103 1.00 127.09 ? 494  TYR C C     1 
ATOM   7432  O  O     . TYR C 2  494  ? 465.548 -48.061 670.627 1.00 119.10 ? 494  TYR C O     1 
ATOM   7433  C  CB    . TYR C 2  494  ? 468.562 -49.828 671.042 1.00 131.08 ? 494  TYR C CB    1 
ATOM   7434  C  CG    . TYR C 2  494  ? 469.668 -50.335 670.141 1.00 128.47 ? 494  TYR C CG    1 
ATOM   7435  C  CD1   . TYR C 2  494  ? 469.757 -51.682 669.806 1.00 130.29 ? 494  TYR C CD1   1 
ATOM   7436  C  CD2   . TYR C 2  494  ? 470.599 -49.466 669.595 1.00 130.33 ? 494  TYR C CD2   1 
ATOM   7437  C  CE1   . TYR C 2  494  ? 470.762 -52.158 668.957 1.00 137.45 ? 494  TYR C CE1   1 
ATOM   7438  C  CE2   . TYR C 2  494  ? 471.605 -49.929 668.741 1.00 136.09 ? 494  TYR C CE2   1 
ATOM   7439  C  CZ    . TYR C 2  494  ? 471.686 -51.275 668.429 1.00 137.26 ? 494  TYR C CZ    1 
ATOM   7440  O  OH    . TYR C 2  494  ? 472.686 -51.726 667.591 1.00 138.11 ? 494  TYR C OH    1 
ATOM   7441  N  N     . THR C 2  495  ? 465.815 -49.532 672.332 1.00 127.76 ? 495  THR C N     1 
ATOM   7442  C  CA    . THR C 2  495  ? 464.866 -48.924 673.280 1.00 124.54 ? 495  THR C CA    1 
ATOM   7443  C  C     . THR C 2  495  ? 465.686 -48.337 674.434 1.00 119.97 ? 495  THR C C     1 
ATOM   7444  O  O     . THR C 2  495  ? 466.331 -49.089 675.173 1.00 123.32 ? 495  THR C O     1 
ATOM   7445  C  CB    . THR C 2  495  ? 463.859 -49.964 673.784 1.00 123.28 ? 495  THR C CB    1 
ATOM   7446  O  OG1   . THR C 2  495  ? 463.107 -50.503 672.691 1.00 121.98 ? 495  THR C OG1   1 
ATOM   7447  C  CG2   . THR C 2  495  ? 462.897 -49.346 674.744 1.00 125.05 ? 495  THR C CG2   1 
ATOM   7448  N  N     . ILE C 2  496  ? 465.710 -47.006 674.570 1.00 113.52 ? 496  ILE C N     1 
ATOM   7449  C  CA    . ILE C 2  496  ? 466.659 -46.339 675.471 1.00 119.95 ? 496  ILE C CA    1 
ATOM   7450  C  C     . ILE C 2  496  ? 465.953 -45.685 676.659 1.00 119.13 ? 496  ILE C C     1 
ATOM   7451  O  O     . ILE C 2  496  ? 465.218 -44.702 676.496 1.00 117.13 ? 496  ILE C O     1 
ATOM   7452  C  CB    . ILE C 2  496  ? 467.513 -45.300 674.720 1.00 119.77 ? 496  ILE C CB    1 
ATOM   7453  C  CG1   . ILE C 2  496  ? 468.115 -45.899 673.453 1.00 116.43 ? 496  ILE C CG1   1 
ATOM   7454  C  CG2   . ILE C 2  496  ? 468.656 -44.802 675.592 1.00 115.53 ? 496  ILE C CG2   1 
ATOM   7455  C  CD1   . ILE C 2  496  ? 467.721 -45.149 672.200 1.00 114.44 ? 496  ILE C CD1   1 
ATOM   7456  N  N     . ALA C 2  497  ? 466.249 -46.189 677.859 1.00 115.38 ? 497  ALA C N     1 
ATOM   7457  C  CA    . ALA C 2  497  ? 465.657 -45.725 679.104 1.00 117.05 ? 497  ALA C CA    1 
ATOM   7458  C  C     . ALA C 2  497  ? 466.291 -44.410 679.530 1.00 118.68 ? 497  ALA C C     1 
ATOM   7459  O  O     . ALA C 2  497  ? 467.442 -44.116 679.190 1.00 117.55 ? 497  ALA C O     1 
ATOM   7460  C  CB    . ALA C 2  497  ? 465.830 -46.757 680.215 1.00 124.57 ? 497  ALA C CB    1 
ATOM   7461  N  N     . GLN C 2  498  ? 465.527 -43.625 680.291 1.00 114.62 ? 498  GLN C N     1 
ATOM   7462  C  CA    . GLN C 2  498  ? 465.985 -42.342 680.808 1.00 110.33 ? 498  GLN C CA    1 
ATOM   7463  C  C     . GLN C 2  498  ? 467.058 -42.505 681.877 1.00 112.79 ? 498  GLN C C     1 
ATOM   7464  O  O     . GLN C 2  498  ? 467.177 -43.544 682.531 1.00 115.85 ? 498  GLN C O     1 
ATOM   7465  C  CB    . GLN C 2  498  ? 464.838 -41.561 681.401 1.00 110.08 ? 498  GLN C CB    1 
ATOM   7466  C  CG    . GLN C 2  498  ? 463.958 -40.972 680.353 1.00 114.62 ? 498  GLN C CG    1 
ATOM   7467  C  CD    . GLN C 2  498  ? 464.614 -39.879 679.572 1.00 101.07 ? 498  GLN C CD    1 
ATOM   7468  O  OE1   . GLN C 2  498  ? 465.299 -39.019 680.132 1.00 105.91 ? 498  GLN C OE1   1 
ATOM   7469  N  NE2   . GLN C 2  498  ? 464.303 -39.828 678.285 1.00 89.71  ? 498  GLN C NE2   1 
ATOM   7470  N  N     . ALA C 2  499  ? 467.877 -41.462 682.023 1.00 109.58 ? 499  ALA C N     1 
ATOM   7471  C  CA    . ALA C 2  499  ? 469.012 -41.555 682.928 1.00 108.72 ? 499  ALA C CA    1 
ATOM   7472  C  C     . ALA C 2  499  ? 468.614 -41.538 684.391 1.00 110.09 ? 499  ALA C C     1 
ATOM   7473  O  O     . ALA C 2  499  ? 469.380 -42.029 685.223 1.00 110.32 ? 499  ALA C O     1 
ATOM   7474  C  CB    . ALA C 2  499  ? 469.993 -40.413 682.674 1.00 105.95 ? 499  ALA C CB    1 
ATOM   7475  N  N     . ASN C 2  500  ? 467.454 -40.991 684.733 1.00 111.43 ? 500  ASN C N     1 
ATOM   7476  C  CA    . ASN C 2  500  ? 467.070 -40.912 686.133 1.00 112.49 ? 500  ASN C CA    1 
ATOM   7477  C  C     . ASN C 2  500  ? 466.235 -42.099 686.598 1.00 118.06 ? 500  ASN C C     1 
ATOM   7478  O  O     . ASN C 2  500  ? 465.765 -42.085 687.736 1.00 120.51 ? 500  ASN C O     1 
ATOM   7479  C  CB    . ASN C 2  500  ? 466.297 -39.611 686.385 1.00 110.13 ? 500  ASN C CB    1 
ATOM   7480  C  CG    . ASN C 2  500  ? 464.870 -39.630 685.815 1.00 112.54 ? 500  ASN C CG    1 
ATOM   7481  O  OD1   . ASN C 2  500  ? 464.413 -40.607 685.211 1.00 115.67 ? 500  ASN C OD1   1 
ATOM   7482  N  ND2   . ASN C 2  500  ? 464.190 -38.499 685.943 1.00 108.18 ? 500  ASN C ND2   1 
ATOM   7483  N  N     . THR C 2  501  ? 466.013 -43.103 685.749 1.00 121.90 ? 501  THR C N     1 
ATOM   7484  C  CA    . THR C 2  501  ? 465.202 -44.252 686.146 1.00 124.27 ? 501  THR C CA    1 
ATOM   7485  C  C     . THR C 2  501  ? 465.810 -44.970 687.352 1.00 127.64 ? 501  THR C C     1 
ATOM   7486  O  O     . THR C 2  501  ? 467.008 -45.302 687.337 1.00 123.44 ? 501  THR C O     1 
ATOM   7487  C  CB    . THR C 2  501  ? 464.984 -45.223 684.982 1.00 121.32 ? 501  THR C CB    1 
ATOM   7488  O  OG1   . THR C 2  501  ? 466.232 -45.515 684.352 1.00 124.71 ? 501  THR C OG1   1 
ATOM   7489  C  CG2   . THR C 2  501  ? 463.993 -44.629 683.960 1.00 116.02 ? 501  THR C CG2   1 
ATOM   7490  N  N     . PRO C 2  502  ? 465.006 -45.252 688.386 1.00 126.53 ? 502  PRO C N     1 
ATOM   7491  C  CA    . PRO C 2  502  ? 465.510 -45.770 689.669 1.00 128.76 ? 502  PRO C CA    1 
ATOM   7492  C  C     . PRO C 2  502  ? 466.363 -47.025 689.558 1.00 134.49 ? 502  PRO C C     1 
ATOM   7493  O  O     . PRO C 2  502  ? 466.077 -47.933 688.775 1.00 135.41 ? 502  PRO C O     1 
ATOM   7494  C  CB    . PRO C 2  502  ? 464.225 -46.052 690.453 1.00 136.37 ? 502  PRO C CB    1 
ATOM   7495  C  CG    . PRO C 2  502  ? 463.212 -45.140 689.863 1.00 135.30 ? 502  PRO C CG    1 
ATOM   7496  C  CD    . PRO C 2  502  ? 463.544 -45.083 688.400 1.00 128.64 ? 502  PRO C CD    1 
ATOM   7497  N  N     . LEU C 2  503  ? 467.414 -47.070 690.375 1.00 136.42 ? 503  LEU C N     1 
ATOM   7498  C  CA    . LEU C 2  503  ? 468.354 -48.180 690.424 1.00 139.17 ? 503  LEU C CA    1 
ATOM   7499  C  C     . LEU C 2  503  ? 468.609 -48.583 691.870 1.00 143.32 ? 503  LEU C C     1 
ATOM   7500  O  O     . LEU C 2  503  ? 468.755 -47.722 692.742 1.00 147.29 ? 503  LEU C O     1 
ATOM   7501  C  CB    . LEU C 2  503  ? 469.676 -47.804 689.759 1.00 135.21 ? 503  LEU C CB    1 
ATOM   7502  C  CG    . LEU C 2  503  ? 469.539 -47.360 688.309 1.00 134.66 ? 503  LEU C CG    1 
ATOM   7503  C  CD1   . LEU C 2  503  ? 470.886 -46.929 687.777 1.00 144.44 ? 503  LEU C CD1   1 
ATOM   7504  C  CD2   . LEU C 2  503  ? 468.960 -48.478 687.465 1.00 133.03 ? 503  LEU C CD2   1 
ATOM   7505  N  N     . GLU C 2  504  ? 468.675 -49.892 692.121 1.00 141.84 ? 504  GLU C N     1 
ATOM   7506  C  CA    . GLU C 2  504  ? 469.262 -50.420 693.351 1.00 145.83 ? 504  GLU C CA    1 
ATOM   7507  C  C     . GLU C 2  504  ? 470.543 -51.162 692.986 1.00 143.08 ? 504  GLU C C     1 
ATOM   7508  O  O     . GLU C 2  504  ? 470.502 -52.236 692.374 1.00 142.67 ? 504  GLU C O     1 
ATOM   7509  C  CB    . GLU C 2  504  ? 468.292 -51.322 694.123 1.00 149.35 ? 504  GLU C CB    1 
ATOM   7510  C  CG    . GLU C 2  504  ? 467.490 -52.330 693.306 1.00 151.00 ? 504  GLU C CG    1 
ATOM   7511  C  CD    . GLU C 2  504  ? 466.644 -53.257 694.182 1.00 158.78 ? 504  GLU C CD    1 
ATOM   7512  O  OE1   . GLU C 2  504  ? 465.965 -52.767 695.115 1.00 151.65 ? 504  GLU C OE1   1 
ATOM   7513  O  OE2   . GLU C 2  504  ? 466.636 -54.478 693.914 1.00 165.78 ? 504  GLU C OE2   1 
ATOM   7514  N  N     . GLY C 2  505  ? 471.679 -50.570 693.341 1.00 136.92 ? 505  GLY C N     1 
ATOM   7515  C  CA    . GLY C 2  505  ? 472.936 -51.101 692.860 1.00 134.91 ? 505  GLY C CA    1 
ATOM   7516  C  C     . GLY C 2  505  ? 473.026 -50.904 691.365 1.00 142.24 ? 505  GLY C C     1 
ATOM   7517  O  O     . GLY C 2  505  ? 472.697 -49.838 690.835 1.00 141.82 ? 505  GLY C O     1 
ATOM   7518  N  N     . ASN C 2  506  ? 473.439 -51.955 690.667 1.00 143.78 ? 506  ASN C N     1 
ATOM   7519  C  CA    . ASN C 2  506  ? 473.532 -51.941 689.218 1.00 138.09 ? 506  ASN C CA    1 
ATOM   7520  C  C     . ASN C 2  506  ? 472.245 -52.449 688.569 1.00 139.75 ? 506  ASN C C     1 
ATOM   7521  O  O     . ASN C 2  506  ? 472.183 -52.590 687.344 1.00 138.88 ? 506  ASN C O     1 
ATOM   7522  C  CB    . ASN C 2  506  ? 474.752 -52.775 688.790 1.00 139.20 ? 506  ASN C CB    1 
ATOM   7523  C  CG    . ASN C 2  506  ? 475.709 -52.016 687.840 1.00 152.93 ? 506  ASN C CG    1 
ATOM   7524  O  OD1   . ASN C 2  506  ? 475.622 -50.797 687.672 1.00 156.53 ? 506  ASN C OD1   1 
ATOM   7525  N  ND2   . ASN C 2  506  ? 476.653 -52.746 687.256 1.00 155.08 ? 506  ASN C ND2   1 
ATOM   7526  N  N     . ARG C 2  507  ? 471.216 -52.711 689.370 1.00 140.36 ? 507  ARG C N     1 
ATOM   7527  C  CA    . ARG C 2  507  ? 469.944 -53.261 688.917 1.00 143.91 ? 507  ARG C CA    1 
ATOM   7528  C  C     . ARG C 2  507  ? 468.874 -52.196 688.705 1.00 139.38 ? 507  ARG C C     1 
ATOM   7529  O  O     . ARG C 2  507  ? 468.822 -51.203 689.435 1.00 139.89 ? 507  ARG C O     1 
ATOM   7530  C  CB    . ARG C 2  507  ? 469.411 -54.292 689.921 1.00 151.29 ? 507  ARG C CB    1 
ATOM   7531  C  CG    . ARG C 2  507  ? 467.967 -54.754 689.619 1.00 154.31 ? 507  ARG C CG    1 
ATOM   7532  C  CD    . ARG C 2  507  ? 467.535 -56.036 690.323 1.00 158.49 ? 507  ARG C CD    1 
ATOM   7533  N  NE    . ARG C 2  507  ? 468.375 -57.170 689.955 1.00 165.39 ? 507  ARG C NE    1 
ATOM   7534  C  CZ    . ARG C 2  507  ? 468.261 -57.826 688.802 1.00 161.02 ? 507  ARG C CZ    1 
ATOM   7535  N  NH1   . ARG C 2  507  ? 467.348 -57.452 687.910 1.00 156.71 ? 507  ARG C NH1   1 
ATOM   7536  N  NH2   . ARG C 2  507  ? 469.062 -58.852 688.536 1.00 156.73 ? 507  ARG C NH2   1 
ATOM   7537  N  N     . ILE C 2  508  ? 468.072 -52.371 687.652 1.00 137.86 ? 508  ILE C N     1 
ATOM   7538  C  CA    . ILE C 2  508  ? 466.936 -51.486 687.409 1.00 138.21 ? 508  ILE C CA    1 
ATOM   7539  C  C     . ILE C 2  508  ? 465.882 -51.778 688.466 1.00 139.54 ? 508  ILE C C     1 
ATOM   7540  O  O     . ILE C 2  508  ? 465.339 -52.887 688.525 1.00 142.73 ? 508  ILE C O     1 
ATOM   7541  C  CB    . ILE C 2  508  ? 466.380 -51.681 685.992 1.00 137.35 ? 508  ILE C CB    1 
ATOM   7542  C  CG1   . ILE C 2  508  ? 467.419 -51.230 684.962 1.00 141.14 ? 508  ILE C CG1   1 
ATOM   7543  C  CG2   . ILE C 2  508  ? 465.026 -51.000 685.820 1.00 130.95 ? 508  ILE C CG2   1 
ATOM   7544  C  CD1   . ILE C 2  508  ? 466.973 -51.395 683.540 1.00 140.81 ? 508  ILE C CD1   1 
ATOM   7545  N  N     . ALA C 2  509  ? 465.532 -50.769 689.260 1.00 139.36 ? 509  ALA C N     1 
ATOM   7546  C  CA    . ALA C 2  509  ? 464.687 -50.988 690.423 1.00 136.47 ? 509  ALA C CA    1 
ATOM   7547  C  C     . ALA C 2  509  ? 463.214 -50.687 690.185 1.00 135.61 ? 509  ALA C C     1 
ATOM   7548  O  O     . ALA C 2  509  ? 462.420 -50.836 691.115 1.00 140.87 ? 509  ALA C O     1 
ATOM   7549  C  CB    . ALA C 2  509  ? 465.200 -50.154 691.605 1.00 132.59 ? 509  ALA C CB    1 
ATOM   7550  N  N     . ALA C 2  510  ? 462.822 -50.277 688.983 1.00 128.86 ? 510  ALA C N     1 
ATOM   7551  C  CA    . ALA C 2  510  ? 461.436 -49.938 688.696 1.00 128.35 ? 510  ALA C CA    1 
ATOM   7552  C  C     . ALA C 2  510  ? 460.762 -50.993 687.832 1.00 130.70 ? 510  ALA C C     1 
ATOM   7553  O  O     . ALA C 2  510  ? 461.420 -51.697 687.067 1.00 134.67 ? 510  ALA C O     1 
ATOM   7554  C  CB    . ALA C 2  510  ? 461.338 -48.575 688.005 1.00 131.49 ? 510  ALA C CB    1 
ATOM   7555  N  N     . GLU C 2  511  ? 459.458 -51.191 688.062 1.00 140.31 ? 511  GLU C N     1 
ATOM   7556  C  CA    . GLU C 2  511  ? 458.675 -52.121 687.246 1.00 144.78 ? 511  GLU C CA    1 
ATOM   7557  C  C     . GLU C 2  511  ? 458.302 -51.524 685.894 1.00 141.65 ? 511  GLU C C     1 
ATOM   7558  O  O     . GLU C 2  511  ? 458.090 -52.266 684.926 1.00 140.62 ? 511  GLU C O     1 
ATOM   7559  C  CB    . GLU C 2  511  ? 457.398 -52.564 687.971 1.00 154.05 ? 511  GLU C CB    1 
ATOM   7560  C  CG    . GLU C 2  511  ? 456.658 -53.682 687.228 1.00 160.70 ? 511  GLU C CG    1 
ATOM   7561  C  CD    . GLU C 2  511  ? 455.926 -54.634 688.144 1.00 162.64 ? 511  GLU C CD    1 
ATOM   7562  O  OE1   . GLU C 2  511  ? 455.640 -54.240 689.292 1.00 168.33 ? 511  GLU C OE1   1 
ATOM   7563  O  OE2   . GLU C 2  511  ? 455.625 -55.769 687.709 1.00 161.80 ? 511  GLU C OE2   1 
ATOM   7564  N  N     . ARG C 2  512  ? 458.171 -50.200 685.823 1.00 138.50 ? 512  ARG C N     1 
ATOM   7565  C  CA    . ARG C 2  512  ? 457.899 -49.499 684.576 1.00 135.98 ? 512  ARG C CA    1 
ATOM   7566  C  C     . ARG C 2  512  ? 458.918 -48.374 684.443 1.00 139.44 ? 512  ARG C C     1 
ATOM   7567  O  O     . ARG C 2  512  ? 459.114 -47.602 685.392 1.00 138.31 ? 512  ARG C O     1 
ATOM   7568  C  CB    . ARG C 2  512  ? 456.456 -48.960 684.530 1.00 135.78 ? 512  ARG C CB    1 
ATOM   7569  C  CG    . ARG C 2  512  ? 456.079 -47.927 685.610 1.00 139.77 ? 512  ARG C CG    1 
ATOM   7570  C  CD    . ARG C 2  512  ? 454.865 -47.078 685.181 1.00 135.79 ? 512  ARG C CD    1 
ATOM   7571  N  NE    . ARG C 2  512  ? 453.812 -47.890 684.563 1.00 136.15 ? 512  ARG C NE    1 
ATOM   7572  C  CZ    . ARG C 2  512  ? 452.866 -47.417 683.751 1.00 135.48 ? 512  ARG C CZ    1 
ATOM   7573  N  NH1   . ARG C 2  512  ? 452.832 -46.127 683.442 1.00 134.85 ? 512  ARG C NH1   1 
ATOM   7574  N  NH2   . ARG C 2  512  ? 451.960 -48.239 683.231 1.00 134.04 ? 512  ARG C NH2   1 
ATOM   7575  N  N     . VAL C 2  513  ? 459.591 -48.305 683.275 1.00 136.36 ? 513  VAL C N     1 
ATOM   7576  C  CA    . VAL C 2  513  ? 460.643 -47.321 683.024 1.00 127.30 ? 513  VAL C CA    1 
ATOM   7577  C  C     . VAL C 2  513  ? 460.199 -46.378 681.917 1.00 118.28 ? 513  VAL C C     1 
ATOM   7578  O  O     . VAL C 2  513  ? 459.359 -46.721 681.076 1.00 116.43 ? 513  VAL C O     1 
ATOM   7579  C  CB    . VAL C 2  513  ? 461.980 -47.999 682.667 1.00 121.76 ? 513  VAL C CB    1 
ATOM   7580  C  CG1   . VAL C 2  513  ? 462.176 -49.259 683.506 1.00 124.10 ? 513  VAL C CG1   1 
ATOM   7581  C  CG2   . VAL C 2  513  ? 461.997 -48.344 681.209 1.00 122.40 ? 513  VAL C CG2   1 
ATOM   7582  N  N     . VAL C 2  514  ? 460.758 -45.170 681.942 1.00 115.22 ? 514  VAL C N     1 
ATOM   7583  C  CA    . VAL C 2  514  ? 460.486 -44.156 680.929 1.00 116.76 ? 514  VAL C CA    1 
ATOM   7584  C  C     . VAL C 2  514  ? 461.573 -44.253 679.865 1.00 117.31 ? 514  VAL C C     1 
ATOM   7585  O  O     . VAL C 2  514  ? 462.757 -44.048 680.157 1.00 114.41 ? 514  VAL C O     1 
ATOM   7586  C  CB    . VAL C 2  514  ? 460.437 -42.758 681.557 1.00 115.46 ? 514  VAL C CB    1 
ATOM   7587  C  CG1   . VAL C 2  514  ? 459.947 -41.740 680.558 1.00 112.38 ? 514  VAL C CG1   1 
ATOM   7588  C  CG2   . VAL C 2  514  ? 459.552 -42.776 682.753 1.00 112.79 ? 514  VAL C CG2   1 
ATOM   7589  N  N     . ALA C 2  515  ? 461.179 -44.553 678.628 1.00 119.25 ? 515  ALA C N     1 
ATOM   7590  C  CA    . ALA C 2  515  ? 462.150 -44.759 677.562 1.00 113.87 ? 515  ALA C CA    1 
ATOM   7591  C  C     . ALA C 2  515  ? 461.702 -44.093 676.260 1.00 116.94 ? 515  ALA C C     1 
ATOM   7592  O  O     . ALA C 2  515  ? 460.579 -43.590 676.134 1.00 119.18 ? 515  ALA C O     1 
ATOM   7593  C  CB    . ALA C 2  515  ? 462.407 -46.257 677.359 1.00 111.25 ? 515  ALA C CB    1 
ATOM   7594  N  N     . ARG C 2  516  ? 462.599 -44.151 675.266 1.00 120.02 ? 516  ARG C N     1 
ATOM   7595  C  CA    . ARG C 2  516  ? 462.384 -43.645 673.913 1.00 116.18 ? 516  ARG C CA    1 
ATOM   7596  C  C     . ARG C 2  516  ? 462.624 -44.755 672.896 1.00 115.91 ? 516  ARG C C     1 
ATOM   7597  O  O     . ARG C 2  516  ? 463.532 -45.582 673.061 1.00 115.26 ? 516  ARG C O     1 
ATOM   7598  C  CB    . ARG C 2  516  ? 463.356 -42.492 673.540 1.00 114.51 ? 516  ARG C CB    1 
ATOM   7599  C  CG    . ARG C 2  516  ? 463.221 -41.197 674.303 1.00 111.91 ? 516  ARG C CG    1 
ATOM   7600  C  CD    . ARG C 2  516  ? 464.280 -40.152 673.926 1.00 98.45  ? 516  ARG C CD    1 
ATOM   7601  N  NE    . ARG C 2  516  ? 465.635 -40.626 674.163 1.00 101.38 ? 516  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C 2  516  ? 466.607 -40.545 673.252 1.00 113.42 ? 516  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C 2  516  ? 466.362 -40.008 672.060 1.00 116.85 ? 516  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C 2  516  ? 467.825 -41.010 673.509 1.00 113.46 ? 516  ARG C NH2   1 
ATOM   7605  N  N     . ARG C 2  517  ? 461.751 -44.824 671.894 1.00 112.95 ? 517  ARG C N     1 
ATOM   7606  C  CA    . ARG C 2  517  ? 461.990 -45.625 670.702 1.00 111.94 ? 517  ARG C CA    1 
ATOM   7607  C  C     . ARG C 2  517  ? 461.791 -44.698 669.514 1.00 117.67 ? 517  ARG C C     1 
ATOM   7608  O  O     . ARG C 2  517  ? 460.660 -44.275 669.241 1.00 114.04 ? 517  ARG C O     1 
ATOM   7609  C  CB    . ARG C 2  517  ? 461.070 -46.843 670.612 1.00 115.74 ? 517  ARG C CB    1 
ATOM   7610  C  CG    . ARG C 2  517  ? 461.430 -48.018 671.543 1.00 122.11 ? 517  ARG C CG    1 
ATOM   7611  C  CD    . ARG C 2  517  ? 460.312 -49.076 671.556 1.00 122.47 ? 517  ARG C CD    1 
ATOM   7612  N  NE    . ARG C 2  517  ? 460.608 -50.220 672.414 1.00 122.38 ? 517  ARG C NE    1 
ATOM   7613  C  CZ    . ARG C 2  517  ? 459.684 -51.024 672.920 1.00 125.57 ? 517  ARG C CZ    1 
ATOM   7614  N  NH1   . ARG C 2  517  ? 458.403 -50.795 672.658 1.00 128.68 ? 517  ARG C NH1   1 
ATOM   7615  N  NH2   . ARG C 2  517  ? 460.043 -52.054 673.679 1.00 125.53 ? 517  ARG C NH2   1 
ATOM   7616  N  N     . LYS C 2  518  ? 462.881 -44.438 668.780 1.00 123.94 ? 518  LYS C N     1 
ATOM   7617  C  CA    . LYS C 2  518  ? 462.903 -43.452 667.686 1.00 117.97 ? 518  LYS C CA    1 
ATOM   7618  C  C     . LYS C 2  518  ? 462.349 -42.103 668.129 1.00 113.75 ? 518  LYS C C     1 
ATOM   7619  O  O     . LYS C 2  518  ? 461.553 -41.476 667.423 1.00 102.54 ? 518  LYS C O     1 
ATOM   7620  C  CB    . LYS C 2  518  ? 462.188 -43.963 666.434 1.00 112.76 ? 518  LYS C CB    1 
ATOM   7621  C  CG    . LYS C 2  518  ? 462.900 -45.156 665.777 1.00 116.05 ? 518  LYS C CG    1 
ATOM   7622  C  CD    . LYS C 2  518  ? 462.425 -45.371 664.337 1.00 121.14 ? 518  LYS C CD    1 
ATOM   7623  C  CE    . LYS C 2  518  ? 463.109 -46.553 663.649 1.00 121.09 ? 518  LYS C CE    1 
ATOM   7624  N  NZ    . LYS C 2  518  ? 462.809 -47.874 664.281 1.00 119.32 ? 518  LYS C NZ    1 
ATOM   7625  N  N     . GLY C 2  519  ? 462.746 -41.690 669.341 1.00 116.00 ? 519  GLY C N     1 
ATOM   7626  C  CA    . GLY C 2  519  ? 462.399 -40.397 669.894 1.00 118.37 ? 519  GLY C CA    1 
ATOM   7627  C  C     . GLY C 2  519  ? 461.010 -40.321 670.494 1.00 118.46 ? 519  GLY C C     1 
ATOM   7628  O  O     . GLY C 2  519  ? 460.732 -39.397 671.260 1.00 116.45 ? 519  GLY C O     1 
ATOM   7629  N  N     . GLU C 2  520  ? 460.126 -41.244 670.128 1.00 119.54 ? 520  GLU C N     1 
ATOM   7630  C  CA    . GLU C 2  520  ? 458.759 -41.289 670.608 1.00 113.71 ? 520  GLU C CA    1 
ATOM   7631  C  C     . GLU C 2  520  ? 458.813 -41.820 672.035 1.00 118.91 ? 520  GLU C C     1 
ATOM   7632  O  O     . GLU C 2  520  ? 459.372 -42.895 672.259 1.00 118.65 ? 520  GLU C O     1 
ATOM   7633  C  CB    . GLU C 2  520  ? 457.946 -42.237 669.728 1.00 120.92 ? 520  GLU C CB    1 
ATOM   7634  C  CG    . GLU C 2  520  ? 456.400 -42.133 669.703 1.00 133.88 ? 520  GLU C CG    1 
ATOM   7635  C  CD    . GLU C 2  520  ? 455.881 -40.902 668.958 1.00 140.65 ? 520  GLU C CD    1 
ATOM   7636  O  OE1   . GLU C 2  520  ? 454.779 -40.389 669.327 1.00 145.38 ? 520  GLU C OE1   1 
ATOM   7637  O  OE2   . GLU C 2  520  ? 456.521 -40.491 667.950 1.00 138.27 ? 520  GLU C OE2   1 
ATOM   7638  N  N     . PRO C 2  521  ? 458.302 -41.090 673.022 1.00 126.35 ? 521  PRO C N     1 
ATOM   7639  C  CA    . PRO C 2  521  ? 458.316 -41.582 674.411 1.00 122.38 ? 521  PRO C CA    1 
ATOM   7640  C  C     . PRO C 2  521  ? 457.307 -42.715 674.623 1.00 125.92 ? 521  PRO C C     1 
ATOM   7641  O  O     . PRO C 2  521  ? 456.171 -42.661 674.135 1.00 125.22 ? 521  PRO C O     1 
ATOM   7642  C  CB    . PRO C 2  521  ? 457.958 -40.337 675.227 1.00 116.04 ? 521  PRO C CB    1 
ATOM   7643  C  CG    . PRO C 2  521  ? 457.185 -39.461 674.289 1.00 119.23 ? 521  PRO C CG    1 
ATOM   7644  C  CD    . PRO C 2  521  ? 457.745 -39.730 672.914 1.00 126.81 ? 521  PRO C CD    1 
ATOM   7645  N  N     . VAL C 2  522  ? 457.721 -43.741 675.372 1.00 124.17 ? 522  VAL C N     1 
ATOM   7646  C  CA    . VAL C 2  522  ? 456.927 -44.960 675.547 1.00 128.33 ? 522  VAL C CA    1 
ATOM   7647  C  C     . VAL C 2  522  ? 457.233 -45.537 676.922 1.00 126.26 ? 522  VAL C C     1 
ATOM   7648  O  O     . VAL C 2  522  ? 458.371 -45.465 677.398 1.00 123.97 ? 522  VAL C O     1 
ATOM   7649  C  CB    . VAL C 2  522  ? 457.260 -46.033 674.475 1.00 131.98 ? 522  VAL C CB    1 
ATOM   7650  C  CG1   . VAL C 2  522  ? 456.384 -47.284 674.655 1.00 141.92 ? 522  VAL C CG1   1 
ATOM   7651  C  CG2   . VAL C 2  522  ? 457.130 -45.501 673.048 1.00 129.40 ? 522  VAL C CG2   1 
ATOM   7652  N  N     . ILE C 2  523  ? 456.209 -46.114 677.572 1.00 121.68 ? 523  ILE C N     1 
ATOM   7653  C  CA    . ILE C 2  523  ? 456.415 -46.768 678.858 1.00 123.30 ? 523  ILE C CA    1 
ATOM   7654  C  C     . ILE C 2  523  ? 456.631 -48.248 678.621 1.00 121.00 ? 523  ILE C C     1 
ATOM   7655  O  O     . ILE C 2  523  ? 455.852 -48.903 677.922 1.00 121.64 ? 523  ILE C O     1 
ATOM   7656  C  CB    . ILE C 2  523  ? 455.222 -46.550 679.804 1.00 126.20 ? 523  ILE C CB    1 
ATOM   7657  C  CG1   . ILE C 2  523  ? 454.961 -45.063 680.081 1.00 124.62 ? 523  ILE C CG1   1 
ATOM   7658  C  CG2   . ILE C 2  523  ? 455.455 -47.301 681.108 1.00 124.57 ? 523  ILE C CG2   1 
ATOM   7659  C  CD1   . ILE C 2  523  ? 456.157 -44.298 680.590 1.00 123.47 ? 523  ILE C CD1   1 
ATOM   7660  N  N     . VAL C 2  524  ? 457.665 -48.784 679.251 1.00 120.81 ? 524  VAL C N     1 
ATOM   7661  C  CA    . VAL C 2  524  ? 458.175 -50.096 678.906 1.00 124.03 ? 524  VAL C CA    1 
ATOM   7662  C  C     . VAL C 2  524  ? 458.685 -50.735 680.182 1.00 127.70 ? 524  VAL C C     1 
ATOM   7663  O  O     . VAL C 2  524  ? 459.151 -50.047 681.094 1.00 128.59 ? 524  VAL C O     1 
ATOM   7664  C  CB    . VAL C 2  524  ? 459.270 -50.011 677.808 1.00 129.47 ? 524  VAL C CB    1 
ATOM   7665  C  CG1   . VAL C 2  524  ? 459.699 -48.572 677.564 1.00 128.05 ? 524  VAL C CG1   1 
ATOM   7666  C  CG2   . VAL C 2  524  ? 460.493 -50.817 678.185 1.00 129.70 ? 524  VAL C CG2   1 
ATOM   7667  N  N     . SER C 2  525  ? 458.598 -52.058 680.236 1.00 131.02 ? 525  SER C N     1 
ATOM   7668  C  CA    . SER C 2  525  ? 459.096 -52.888 681.318 1.00 129.07 ? 525  SER C CA    1 
ATOM   7669  C  C     . SER C 2  525  ? 460.608 -53.126 681.209 1.00 134.71 ? 525  SER C C     1 
ATOM   7670  O  O     . SER C 2  525  ? 461.159 -53.205 680.104 1.00 133.29 ? 525  SER C O     1 
ATOM   7671  C  CB    . SER C 2  525  ? 458.373 -54.225 681.316 1.00 129.93 ? 525  SER C CB    1 
ATOM   7672  O  OG    . SER C 2  525  ? 458.253 -54.741 679.998 1.00 133.19 ? 525  SER C OG    1 
ATOM   7673  N  N     . PRO C 2  526  ? 461.299 -53.236 682.356 1.00 132.05 ? 526  PRO C N     1 
ATOM   7674  C  CA    . PRO C 2  526  ? 462.757 -53.444 682.364 1.00 132.58 ? 526  PRO C CA    1 
ATOM   7675  C  C     . PRO C 2  526  ? 463.264 -54.596 681.494 1.00 135.76 ? 526  PRO C C     1 
ATOM   7676  O  O     . PRO C 2  526  ? 464.463 -54.649 681.194 1.00 138.56 ? 526  PRO C O     1 
ATOM   7677  C  CB    . PRO C 2  526  ? 463.065 -53.670 683.849 1.00 128.71 ? 526  PRO C CB    1 
ATOM   7678  C  CG    . PRO C 2  526  ? 461.793 -54.142 684.418 1.00 133.38 ? 526  PRO C CG    1 
ATOM   7679  C  CD    . PRO C 2  526  ? 460.742 -53.349 683.709 1.00 131.29 ? 526  PRO C CD    1 
ATOM   7680  N  N     . GLU C 2  527  ? 462.400 -55.544 681.104 1.00 137.95 ? 527  GLU C N     1 
ATOM   7681  C  CA    . GLU C 2  527  ? 462.878 -56.624 680.238 1.00 138.13 ? 527  GLU C CA    1 
ATOM   7682  C  C     . GLU C 2  527  ? 463.213 -56.111 678.834 1.00 133.37 ? 527  GLU C C     1 
ATOM   7683  O  O     . GLU C 2  527  ? 464.110 -56.651 678.172 1.00 125.23 ? 527  GLU C O     1 
ATOM   7684  C  CB    . GLU C 2  527  ? 461.805 -57.723 680.087 1.00 134.56 ? 527  GLU C CB    1 
ATOM   7685  C  CG    . GLU C 2  527  ? 461.443 -58.655 681.265 1.00 128.82 ? 527  GLU C CG    1 
ATOM   7686  C  CD    . GLU C 2  527  ? 460.554 -57.996 682.315 1.00 133.44 ? 527  GLU C CD    1 
ATOM   7687  O  OE1   . GLU C 2  527  ? 459.808 -57.065 681.949 1.00 130.34 ? 527  GLU C OE1   1 
ATOM   7688  O  OE2   . GLU C 2  527  ? 460.532 -58.463 683.481 1.00 135.70 ? 527  GLU C OE2   1 
ATOM   7689  N  N     . GLU C 2  528  ? 462.536 -55.051 678.391 1.00 130.13 ? 528  GLU C N     1 
ATOM   7690  C  CA    . GLU C 2  528  ? 462.671 -54.478 677.059 1.00 129.58 ? 528  GLU C CA    1 
ATOM   7691  C  C     . GLU C 2  528  ? 463.761 -53.409 676.947 1.00 131.47 ? 528  GLU C C     1 
ATOM   7692  O  O     . GLU C 2  528  ? 463.897 -52.797 675.878 1.00 127.96 ? 528  GLU C O     1 
ATOM   7693  C  CB    . GLU C 2  528  ? 461.338 -53.868 676.624 1.00 129.42 ? 528  GLU C CB    1 
ATOM   7694  C  CG    . GLU C 2  528  ? 460.120 -54.740 676.823 1.00 129.93 ? 528  GLU C CG    1 
ATOM   7695  C  CD    . GLU C 2  528  ? 458.840 -54.052 676.346 1.00 134.48 ? 528  GLU C CD    1 
ATOM   7696  O  OE1   . GLU C 2  528  ? 458.070 -53.553 677.203 1.00 127.94 ? 528  GLU C OE1   1 
ATOM   7697  O  OE2   . GLU C 2  528  ? 458.614 -54.003 675.107 1.00 137.63 ? 528  GLU C OE2   1 
ATOM   7698  N  N     . VAL C 2  529  ? 464.514 -53.143 678.012 1.00 130.53 ? 529  VAL C N     1 
ATOM   7699  C  CA    . VAL C 2  529  ? 465.457 -52.027 678.039 1.00 127.99 ? 529  VAL C CA    1 
ATOM   7700  C  C     . VAL C 2  529  ? 466.831 -52.455 677.545 1.00 133.84 ? 529  VAL C C     1 
ATOM   7701  O  O     . VAL C 2  529  ? 467.518 -53.237 678.208 1.00 137.20 ? 529  VAL C O     1 
ATOM   7702  C  CB    . VAL C 2  529  ? 465.561 -51.438 679.446 1.00 132.23 ? 529  VAL C CB    1 
ATOM   7703  C  CG1   . VAL C 2  529  ? 466.650 -50.380 679.494 1.00 128.08 ? 529  VAL C CG1   1 
ATOM   7704  C  CG2   . VAL C 2  529  ? 464.216 -50.854 679.852 1.00 136.34 ? 529  VAL C CG2   1 
ATOM   7705  N  N     . GLU C 2  530  ? 467.206 -51.964 676.357 1.00 130.91 ? 530  GLU C N     1 
ATOM   7706  C  CA    . GLU C 2  530  ? 468.492 -52.214 675.712 1.00 127.68 ? 530  GLU C CA    1 
ATOM   7707  C  C     . GLU C 2  530  ? 469.602 -51.241 676.118 1.00 126.52 ? 530  GLU C C     1 
ATOM   7708  O  O     . GLU C 2  530  ? 470.742 -51.673 676.328 1.00 128.51 ? 530  GLU C O     1 
ATOM   7709  C  CB    . GLU C 2  530  ? 468.308 -52.257 674.194 1.00 128.16 ? 530  GLU C CB    1 
ATOM   7710  C  CG    . GLU C 2  530  ? 467.156 -53.185 673.825 1.00 130.08 ? 530  GLU C CG    1 
ATOM   7711  C  CD    . GLU C 2  530  ? 466.888 -53.275 672.348 1.00 130.36 ? 530  GLU C CD    1 
ATOM   7712  O  OE1   . GLU C 2  530  ? 465.787 -52.881 671.904 1.00 130.10 ? 530  GLU C OE1   1 
ATOM   7713  O  OE2   . GLU C 2  530  ? 467.760 -53.814 671.641 1.00 132.54 ? 530  GLU C OE2   1 
ATOM   7714  N  N     . PHE C 2  531  ? 469.311 -49.940 676.249 1.00 123.05 ? 531  PHE C N     1 
ATOM   7715  C  CA    . PHE C 2  531  ? 470.333 -48.968 676.639 1.00 122.83 ? 531  PHE C CA    1 
ATOM   7716  C  C     . PHE C 2  531  ? 469.738 -47.955 677.625 1.00 126.62 ? 531  PHE C C     1 
ATOM   7717  O  O     . PHE C 2  531  ? 468.541 -47.988 677.930 1.00 126.20 ? 531  PHE C O     1 
ATOM   7718  C  CB    . PHE C 2  531  ? 470.898 -48.255 675.401 1.00 123.77 ? 531  PHE C CB    1 
ATOM   7719  C  CG    . PHE C 2  531  ? 471.792 -49.127 674.526 1.00 130.06 ? 531  PHE C CG    1 
ATOM   7720  C  CD1   . PHE C 2  531  ? 473.146 -49.279 674.802 1.00 128.20 ? 531  PHE C CD1   1 
ATOM   7721  C  CD2   . PHE C 2  531  ? 471.276 -49.752 673.390 1.00 128.08 ? 531  PHE C CD2   1 
ATOM   7722  C  CE1   . PHE C 2  531  ? 473.955 -50.072 673.985 1.00 125.72 ? 531  PHE C CE1   1 
ATOM   7723  C  CE2   . PHE C 2  531  ? 472.077 -50.537 672.576 1.00 124.97 ? 531  PHE C CE2   1 
ATOM   7724  C  CZ    . PHE C 2  531  ? 473.414 -50.699 672.876 1.00 124.64 ? 531  PHE C CZ    1 
ATOM   7725  N  N     . MET C 2  532  ? 470.577 -47.030 678.123 1.00 126.09 ? 532  MET C N     1 
ATOM   7726  C  CA    . MET C 2  532  ? 470.125 -45.986 679.046 1.00 118.54 ? 532  MET C CA    1 
ATOM   7727  C  C     . MET C 2  532  ? 470.975 -44.724 678.904 1.00 115.02 ? 532  MET C C     1 
ATOM   7728  O  O     . MET C 2  532  ? 472.196 -44.810 678.752 1.00 115.42 ? 532  MET C O     1 
ATOM   7729  C  CB    . MET C 2  532  ? 470.163 -46.478 680.499 1.00 115.15 ? 532  MET C CB    1 
ATOM   7730  C  CG    . MET C 2  532  ? 469.765 -45.407 681.507 1.00 122.31 ? 532  MET C CG    1 
ATOM   7731  S  SD    . MET C 2  532  ? 469.618 -45.921 683.242 1.00 125.77 ? 532  MET C SD    1 
ATOM   7732  C  CE    . MET C 2  532  ? 471.323 -45.803 683.795 1.00 128.10 ? 532  MET C CE    1 
ATOM   7733  N  N     . ASP C 2  533  ? 470.329 -43.559 679.034 1.00 109.86 ? 533  ASP C N     1 
ATOM   7734  C  CA    . ASP C 2  533  ? 471.020 -42.277 678.917 1.00 104.96 ? 533  ASP C CA    1 
ATOM   7735  C  C     . ASP C 2  533  ? 472.164 -42.223 679.927 1.00 109.51 ? 533  ASP C C     1 
ATOM   7736  O  O     . ASP C 2  533  ? 472.069 -42.768 681.031 1.00 116.44 ? 533  ASP C O     1 
ATOM   7737  C  CB    . ASP C 2  533  ? 470.062 -41.115 679.196 1.00 104.77 ? 533  ASP C CB    1 
ATOM   7738  C  CG    . ASP C 2  533  ? 468.985 -40.926 678.122 1.00 108.83 ? 533  ASP C CG    1 
ATOM   7739  O  OD1   . ASP C 2  533  ? 468.590 -41.896 677.423 1.00 106.57 ? 533  ASP C OD1   1 
ATOM   7740  O  OD2   . ASP C 2  533  ? 468.515 -39.776 677.992 1.00 105.96 ? 533  ASP C OD2   1 
ATOM   7741  N  N     . VAL C 2  534  ? 473.273 -41.596 679.537 1.00 102.60 ? 534  VAL C N     1 
ATOM   7742  C  CA    . VAL C 2  534  ? 474.405 -41.454 680.457 1.00 106.50 ? 534  VAL C CA    1 
ATOM   7743  C  C     . VAL C 2  534  ? 474.128 -40.430 681.555 1.00 106.28 ? 534  VAL C C     1 
ATOM   7744  O  O     . VAL C 2  534  ? 474.535 -40.625 682.708 1.00 104.12 ? 534  VAL C O     1 
ATOM   7745  C  CB    . VAL C 2  534  ? 475.690 -41.099 679.674 1.00 107.69 ? 534  VAL C CB    1 
ATOM   7746  C  CG1   . VAL C 2  534  ? 476.804 -40.630 680.598 1.00 105.74 ? 534  VAL C CG1   1 
ATOM   7747  C  CG2   . VAL C 2  534  ? 476.196 -42.319 678.906 1.00 114.22 ? 534  VAL C CG2   1 
ATOM   7748  N  N     . SER C 2  535  ? 473.415 -39.355 681.237 1.00 104.43 ? 535  SER C N     1 
ATOM   7749  C  CA    . SER C 2  535  ? 473.273 -38.220 682.141 1.00 98.17  ? 535  SER C CA    1 
ATOM   7750  C  C     . SER C 2  535  ? 472.299 -37.233 681.529 1.00 95.09  ? 535  SER C C     1 
ATOM   7751  O  O     . SER C 2  535  ? 472.035 -37.285 680.330 1.00 94.11  ? 535  SER C O     1 
ATOM   7752  C  CB    . SER C 2  535  ? 474.623 -37.527 682.398 1.00 96.77  ? 535  SER C CB    1 
ATOM   7753  O  OG    . SER C 2  535  ? 474.465 -36.286 683.066 1.00 91.68  ? 535  SER C OG    1 
ATOM   7754  N  N     . PRO C 2  536  ? 471.684 -36.386 682.351 1.00 103.42 ? 536  PRO C N     1 
ATOM   7755  C  CA    . PRO C 2  536  ? 470.911 -35.291 681.767 1.00 100.91 ? 536  PRO C CA    1 
ATOM   7756  C  C     . PRO C 2  536  ? 471.806 -34.299 681.050 1.00 97.67  ? 536  PRO C C     1 
ATOM   7757  O  O     . PRO C 2  536  ? 471.385 -33.745 680.027 1.00 98.92  ? 536  PRO C O     1 
ATOM   7758  C  CB    . PRO C 2  536  ? 470.186 -34.670 682.978 1.00 98.64  ? 536  PRO C CB    1 
ATOM   7759  C  CG    . PRO C 2  536  ? 470.149 -35.754 684.006 1.00 95.78  ? 536  PRO C CG    1 
ATOM   7760  C  CD    . PRO C 2  536  ? 471.425 -36.531 683.801 1.00 107.14 ? 536  PRO C CD    1 
ATOM   7761  N  N     . LYS C 2  537  ? 473.048 -34.105 681.525 1.00 97.36  ? 537  LYS C N     1 
ATOM   7762  C  CA    . LYS C 2  537  ? 473.971 -33.158 680.894 1.00 96.25  ? 537  LYS C CA    1 
ATOM   7763  C  C     . LYS C 2  537  ? 474.153 -33.402 679.395 1.00 100.00 ? 537  LYS C C     1 
ATOM   7764  O  O     . LYS C 2  537  ? 474.377 -32.445 678.639 1.00 95.92  ? 537  LYS C O     1 
ATOM   7765  C  CB    . LYS C 2  537  ? 475.333 -33.188 681.606 1.00 89.52  ? 537  LYS C CB    1 
ATOM   7766  C  CG    . LYS C 2  537  ? 475.229 -33.009 683.078 1.00 95.58  ? 537  LYS C CG    1 
ATOM   7767  C  CD    . LYS C 2  537  ? 476.536 -32.939 683.841 1.00 93.40  ? 537  LYS C CD    1 
ATOM   7768  C  CE    . LYS C 2  537  ? 476.219 -33.157 685.372 1.00 121.11 ? 537  LYS C CE    1 
ATOM   7769  N  NZ    . LYS C 2  537  ? 475.353 -32.134 686.129 1.00 99.49  ? 537  LYS C NZ    1 
ATOM   7770  N  N     . GLN C 2  538  ? 473.990 -34.652 678.933 1.00 99.74  ? 538  GLN C N     1 
ATOM   7771  C  CA    . GLN C 2  538  ? 474.297 -34.971 677.540 1.00 101.09 ? 538  GLN C CA    1 
ATOM   7772  C  C     . GLN C 2  538  ? 473.300 -34.349 676.578 1.00 98.06  ? 538  GLN C C     1 
ATOM   7773  O  O     . GLN C 2  538  ? 473.556 -34.340 675.365 1.00 99.67  ? 538  GLN C O     1 
ATOM   7774  C  CB    . GLN C 2  538  ? 474.342 -36.485 677.303 1.00 99.93  ? 538  GLN C CB    1 
ATOM   7775  C  CG    . GLN C 2  538  ? 472.985 -37.129 677.161 1.00 102.47 ? 538  GLN C CG    1 
ATOM   7776  C  CD    . GLN C 2  538  ? 473.061 -38.622 676.882 1.00 104.43 ? 538  GLN C CD    1 
ATOM   7777  O  OE1   . GLN C 2  538  ? 472.699 -39.441 677.735 1.00 114.80 ? 538  GLN C OE1   1 
ATOM   7778  N  NE2   . GLN C 2  538  ? 473.497 -38.983 675.691 1.00 99.19  ? 538  GLN C NE2   1 
ATOM   7779  N  N     . VAL C 2  539  ? 472.147 -33.904 677.077 1.00 88.52  ? 539  VAL C N     1 
ATOM   7780  C  CA    . VAL C 2  539  ? 471.153 -33.299 676.202 1.00 91.38  ? 539  VAL C CA    1 
ATOM   7781  C  C     . VAL C 2  539  ? 471.452 -31.827 675.899 1.00 86.55  ? 539  VAL C C     1 
ATOM   7782  O  O     . VAL C 2  539  ? 470.895 -31.285 674.937 1.00 89.77  ? 539  VAL C O     1 
ATOM   7783  C  CB    . VAL C 2  539  ? 469.750 -33.546 676.787 1.00 93.91  ? 539  VAL C CB    1 
ATOM   7784  C  CG1   . VAL C 2  539  ? 468.639 -32.873 675.956 1.00 85.60  ? 539  VAL C CG1   1 
ATOM   7785  C  CG2   . VAL C 2  539  ? 469.501 -35.042 676.842 1.00 93.40  ? 539  VAL C CG2   1 
ATOM   7786  N  N     . PHE C 2  540  ? 472.283 -31.141 676.688 1.00 80.80  ? 540  PHE C N     1 
ATOM   7787  C  CA    . PHE C 2  540  ? 472.392 -29.695 676.534 1.00 84.61  ? 540  PHE C CA    1 
ATOM   7788  C  C     . PHE C 2  540  ? 473.815 -29.225 676.266 1.00 89.64  ? 540  PHE C C     1 
ATOM   7789  O  O     . PHE C 2  540  ? 474.799 -29.911 676.559 1.00 93.76  ? 540  PHE C O     1 
ATOM   7790  C  CB    . PHE C 2  540  ? 471.874 -28.945 677.768 1.00 92.33  ? 540  PHE C CB    1 
ATOM   7791  C  CG    . PHE C 2  540  ? 470.508 -29.361 678.172 1.00 93.93  ? 540  PHE C CG    1 
ATOM   7792  C  CD1   . PHE C 2  540  ? 469.411 -28.600 677.832 1.00 90.90  ? 540  PHE C CD1   1 
ATOM   7793  C  CD2   . PHE C 2  540  ? 470.327 -30.507 678.942 1.00 93.27  ? 540  PHE C CD2   1 
ATOM   7794  C  CE1   . PHE C 2  540  ? 468.150 -29.000 678.204 1.00 93.24  ? 540  PHE C CE1   1 
ATOM   7795  C  CE2   . PHE C 2  540  ? 469.082 -30.914 679.316 1.00 89.89  ? 540  PHE C CE2   1 
ATOM   7796  C  CZ    . PHE C 2  540  ? 467.986 -30.155 678.956 1.00 96.95  ? 540  PHE C CZ    1 
ATOM   7797  N  N     . SER C 2  541  ? 473.908 -27.990 675.784 1.00 81.32  ? 541  SER C N     1 
ATOM   7798  C  CA    . SER C 2  541  ? 475.192 -27.403 675.486 1.00 78.45  ? 541  SER C CA    1 
ATOM   7799  C  C     . SER C 2  541  ? 475.925 -27.099 676.781 1.00 83.59  ? 541  SER C C     1 
ATOM   7800  O  O     . SER C 2  541  ? 475.458 -27.391 677.875 1.00 93.07  ? 541  SER C O     1 
ATOM   7801  C  CB    . SER C 2  541  ? 474.993 -26.135 674.677 1.00 84.03  ? 541  SER C CB    1 
ATOM   7802  O  OG    . SER C 2  541  ? 474.374 -25.146 675.466 1.00 80.17  ? 541  SER C OG    1 
ATOM   7803  N  N     . VAL C 2  542  ? 477.130 -26.570 676.667 1.00 86.88  ? 542  VAL C N     1 
ATOM   7804  C  CA    . VAL C 2  542  ? 477.873 -26.234 677.873 1.00 85.39  ? 542  VAL C CA    1 
ATOM   7805  C  C     . VAL C 2  542  ? 477.262 -25.026 678.578 1.00 93.16  ? 542  VAL C C     1 
ATOM   7806  O  O     . VAL C 2  542  ? 477.047 -25.048 679.801 1.00 94.28  ? 542  VAL C O     1 
ATOM   7807  C  CB    . VAL C 2  542  ? 479.357 -26.058 677.530 1.00 85.21  ? 542  VAL C CB    1 
ATOM   7808  C  CG1   . VAL C 2  542  ? 480.101 -25.307 678.598 1.00 87.12  ? 542  VAL C CG1   1 
ATOM   7809  C  CG2   . VAL C 2  542  ? 479.961 -27.447 677.409 1.00 87.37  ? 542  VAL C CG2   1 
ATOM   7810  N  N     . ASN C 2  543  ? 476.837 -24.016 677.820 1.00 91.85  ? 543  ASN C N     1 
ATOM   7811  C  CA    . ASN C 2  543  ? 476.244 -22.838 678.457 1.00 93.86  ? 543  ASN C CA    1 
ATOM   7812  C  C     . ASN C 2  543  ? 474.953 -23.182 679.201 1.00 86.17  ? 543  ASN C C     1 
ATOM   7813  O  O     . ASN C 2  543  ? 474.769 -22.786 680.352 1.00 82.34  ? 543  ASN C O     1 
ATOM   7814  C  CB    . ASN C 2  543  ? 475.968 -21.785 677.390 1.00 91.82  ? 543  ASN C CB    1 
ATOM   7815  C  CG    . ASN C 2  543  ? 477.222 -21.296 676.758 1.00 91.10  ? 543  ASN C CG    1 
ATOM   7816  O  OD1   . ASN C 2  543  ? 477.974 -22.090 676.178 1.00 96.73  ? 543  ASN C OD1   1 
ATOM   7817  N  ND2   . ASN C 2  543  ? 477.486 -20.000 676.876 1.00 88.52  ? 543  ASN C ND2   1 
ATOM   7818  N  N     . THR C 2  544  ? 474.076 -23.956 678.563 1.00 85.65  ? 544  THR C N     1 
ATOM   7819  C  CA    . THR C 2  544  ? 472.829 -24.404 679.170 1.00 85.19  ? 544  THR C CA    1 
ATOM   7820  C  C     . THR C 2  544  ? 473.072 -25.243 680.409 1.00 93.28  ? 544  THR C C     1 
ATOM   7821  O  O     . THR C 2  544  ? 472.318 -25.152 681.394 1.00 89.67  ? 544  THR C O     1 
ATOM   7822  C  CB    . THR C 2  544  ? 472.026 -25.194 678.137 1.00 84.55  ? 544  THR C CB    1 
ATOM   7823  O  OG1   . THR C 2  544  ? 471.860 -24.417 676.936 1.00 90.10  ? 544  THR C OG1   1 
ATOM   7824  C  CG2   . THR C 2  544  ? 470.738 -25.623 678.669 1.00 80.45  ? 544  THR C CG2   1 
ATOM   7825  N  N     . ASN C 2  545  ? 474.142 -26.029 680.402 1.00 93.30  ? 545  ASN C N     1 
ATOM   7826  C  CA    . ASN C 2  545  ? 474.440 -26.869 681.549 1.00 95.85  ? 545  ASN C CA    1 
ATOM   7827  C  C     . ASN C 2  545  ? 474.883 -26.067 682.772 1.00 93.31  ? 545  ASN C C     1 
ATOM   7828  O  O     . ASN C 2  545  ? 475.015 -26.646 683.852 1.00 92.12  ? 545  ASN C O     1 
ATOM   7829  C  CB    . ASN C 2  545  ? 475.497 -27.889 681.124 1.00 93.01  ? 545  ASN C CB    1 
ATOM   7830  C  CG    . ASN C 2  545  ? 474.901 -29.252 680.829 1.00 94.23  ? 545  ASN C CG    1 
ATOM   7831  O  OD1   . ASN C 2  545  ? 474.417 -29.927 681.726 1.00 99.35  ? 545  ASN C OD1   1 
ATOM   7832  N  ND2   . ASN C 2  545  ? 474.876 -29.633 679.561 1.00 91.38  ? 545  ASN C ND2   1 
ATOM   7833  N  N     . LEU C 2  546  ? 475.093 -24.757 682.638 1.00 93.31  ? 546  LEU C N     1 
ATOM   7834  C  CA    . LEU C 2  546  ? 475.521 -23.916 683.745 1.00 93.09  ? 546  LEU C CA    1 
ATOM   7835  C  C     . LEU C 2  546  ? 474.366 -23.241 684.473 1.00 96.07  ? 546  LEU C C     1 
ATOM   7836  O  O     . LEU C 2  546  ? 474.607 -22.487 685.433 1.00 96.54  ? 546  LEU C O     1 
ATOM   7837  C  CB    . LEU C 2  546  ? 476.484 -22.837 683.262 1.00 87.61  ? 546  LEU C CB    1 
ATOM   7838  C  CG    . LEU C 2  546  ? 477.829 -23.414 682.878 1.00 88.93  ? 546  LEU C CG    1 
ATOM   7839  C  CD1   . LEU C 2  546  ? 478.710 -22.336 682.275 1.00 86.24  ? 546  LEU C CD1   1 
ATOM   7840  C  CD2   . LEU C 2  546  ? 478.477 -24.114 684.056 1.00 92.49  ? 546  LEU C CD2   1 
ATOM   7841  N  N     . ILE C 2  547  ? 473.129 -23.535 684.081 1.00 93.35  ? 547  ILE C N     1 
ATOM   7842  C  CA    . ILE C 2  547  ? 471.944 -22.893 684.643 1.00 93.87  ? 547  ILE C CA    1 
ATOM   7843  C  C     . ILE C 2  547  ? 471.340 -23.810 685.710 1.00 91.61  ? 547  ILE C C     1 
ATOM   7844  O  O     . ILE C 2  547  ? 470.720 -24.830 685.365 1.00 87.46  ? 547  ILE C O     1 
ATOM   7845  C  CB    . ILE C 2  547  ? 470.924 -22.541 683.552 1.00 86.03  ? 547  ILE C CB    1 
ATOM   7846  C  CG1   . ILE C 2  547  ? 471.567 -21.665 682.492 1.00 80.76  ? 547  ILE C CG1   1 
ATOM   7847  C  CG2   . ILE C 2  547  ? 469.694 -21.903 684.122 1.00 84.68  ? 547  ILE C CG2   1 
ATOM   7848  C  CD1   . ILE C 2  547  ? 470.646 -21.372 681.347 1.00 79.05  ? 547  ILE C CD1   1 
ATOM   7849  N  N     . PRO C 2  548  ? 471.486 -23.491 686.993 1.00 92.06  ? 548  PRO C N     1 
ATOM   7850  C  CA    . PRO C 2  548  ? 470.908 -24.345 688.035 1.00 91.20  ? 548  PRO C CA    1 
ATOM   7851  C  C     . PRO C 2  548  ? 469.394 -24.238 688.015 1.00 85.52  ? 548  PRO C C     1 
ATOM   7852  O  O     . PRO C 2  548  ? 468.831 -23.217 687.615 1.00 82.60  ? 548  PRO C O     1 
ATOM   7853  C  CB    . PRO C 2  548  ? 471.493 -23.769 689.329 1.00 90.65  ? 548  PRO C CB    1 
ATOM   7854  C  CG    . PRO C 2  548  ? 471.756 -22.320 689.002 1.00 89.97  ? 548  PRO C CG    1 
ATOM   7855  C  CD    . PRO C 2  548  ? 472.173 -22.308 687.549 1.00 91.37  ? 548  PRO C CD    1 
ATOM   7856  N  N     . PHE C 2  549  ? 468.735 -25.311 688.456 1.00 84.91  ? 549  PHE C N     1 
ATOM   7857  C  CA    . PHE C 2  549  ? 467.267 -25.381 688.478 1.00 93.48  ? 549  PHE C CA    1 
ATOM   7858  C  C     . PHE C 2  549  ? 466.689 -25.196 687.087 1.00 88.50  ? 549  PHE C C     1 
ATOM   7859  O  O     . PHE C 2  549  ? 465.601 -24.651 686.927 1.00 93.31  ? 549  PHE C O     1 
ATOM   7860  C  CB    . PHE C 2  549  ? 466.628 -24.342 689.424 1.00 88.76  ? 549  PHE C CB    1 
ATOM   7861  C  CG    . PHE C 2  549  ? 467.107 -24.438 690.833 1.00 84.22  ? 549  PHE C CG    1 
ATOM   7862  C  CD1   . PHE C 2  549  ? 466.795 -25.549 691.609 1.00 92.37  ? 549  PHE C CD1   1 
ATOM   7863  C  CD2   . PHE C 2  549  ? 467.842 -23.413 691.392 1.00 80.76  ? 549  PHE C CD2   1 
ATOM   7864  C  CE1   . PHE C 2  549  ? 467.244 -25.652 692.906 1.00 92.33  ? 549  PHE C CE1   1 
ATOM   7865  C  CE2   . PHE C 2  549  ? 468.285 -23.498 692.680 1.00 86.71  ? 549  PHE C CE2   1 
ATOM   7866  C  CZ    . PHE C 2  549  ? 467.982 -24.623 693.448 1.00 92.67  ? 549  PHE C CZ    1 
ATOM   7867  N  N     . LEU C 2  550  ? 467.437 -25.626 686.078 1.00 92.51  ? 550  LEU C N     1 
ATOM   7868  C  CA    . LEU C 2  550  ? 466.999 -25.489 684.691 1.00 94.31  ? 550  LEU C CA    1 
ATOM   7869  C  C     . LEU C 2  550  ? 465.657 -26.161 684.441 1.00 91.09  ? 550  LEU C C     1 
ATOM   7870  O  O     . LEU C 2  550  ? 464.890 -25.682 683.600 1.00 86.74  ? 550  LEU C O     1 
ATOM   7871  C  CB    . LEU C 2  550  ? 468.074 -26.042 683.742 1.00 95.19  ? 550  LEU C CB    1 
ATOM   7872  C  CG    . LEU C 2  550  ? 467.843 -26.271 682.237 1.00 92.76  ? 550  LEU C CG    1 
ATOM   7873  C  CD1   . LEU C 2  550  ? 467.680 -24.986 681.421 1.00 85.14  ? 550  LEU C CD1   1 
ATOM   7874  C  CD2   . LEU C 2  550  ? 468.963 -27.131 681.693 1.00 88.90  ? 550  LEU C CD2   1 
ATOM   7875  N  N     . GLU C 2  551  ? 465.352 -27.261 685.159 1.00 95.40  ? 551  GLU C N     1 
ATOM   7876  C  CA    . GLU C 2  551  ? 464.075 -27.962 684.977 1.00 96.83  ? 551  GLU C CA    1 
ATOM   7877  C  C     . GLU C 2  551  ? 462.876 -27.086 685.295 1.00 89.59  ? 551  GLU C C     1 
ATOM   7878  O  O     . GLU C 2  551  ? 461.765 -27.397 684.867 1.00 89.56  ? 551  GLU C O     1 
ATOM   7879  C  CB    . GLU C 2  551  ? 464.010 -29.254 685.805 1.00 94.87  ? 551  GLU C CB    1 
ATOM   7880  C  CG    . GLU C 2  551  ? 464.112 -29.108 687.309 1.00 98.06  ? 551  GLU C CG    1 
ATOM   7881  C  CD    . GLU C 2  551  ? 465.540 -29.197 687.835 1.00 102.84 ? 551  GLU C CD    1 
ATOM   7882  O  OE1   . GLU C 2  551  ? 465.732 -29.506 689.047 1.00 108.65 ? 551  GLU C OE1   1 
ATOM   7883  O  OE2   . GLU C 2  551  ? 466.469 -28.923 687.044 1.00 100.22 ? 551  GLU C OE2   1 
ATOM   7884  N  N     . HIS C 2  552  ? 463.082 -26.001 686.020 1.00 89.39  ? 552  HIS C N     1 
ATOM   7885  C  CA    . HIS C 2  552  ? 462.041 -25.063 686.400 1.00 91.58  ? 552  HIS C CA    1 
ATOM   7886  C  C     . HIS C 2  552  ? 461.922 -23.841 685.469 1.00 92.62  ? 552  HIS C C     1 
ATOM   7887  O  O     . HIS C 2  552  ? 461.100 -22.966 685.753 1.00 93.46  ? 552  HIS C O     1 
ATOM   7888  C  CB    . HIS C 2  552  ? 462.274 -24.608 687.866 1.00 95.89  ? 552  HIS C CB    1 
ATOM   7889  C  CG    . HIS C 2  552  ? 462.373 -25.747 688.858 1.00 100.86 ? 552  HIS C CG    1 
ATOM   7890  N  ND1   . HIS C 2  552  ? 461.272 -26.443 689.324 1.00 98.68  ? 552  HIS C ND1   1 
ATOM   7891  C  CD2   . HIS C 2  552  ? 463.447 -26.285 689.493 1.00 97.50  ? 552  HIS C CD2   1 
ATOM   7892  C  CE1   . HIS C 2  552  ? 461.669 -27.383 690.165 1.00 98.28  ? 552  HIS C CE1   1 
ATOM   7893  N  NE2   . HIS C 2  552  ? 462.983 -27.304 690.293 1.00 96.87  ? 552  HIS C NE2   1 
ATOM   7894  N  N     . ASP C 2  553  ? 462.743 -23.714 684.407 1.00 96.47  ? 553  ASP C N     1 
ATOM   7895  C  CA    . ASP C 2  553  ? 462.744 -22.535 683.521 1.00 91.79  ? 553  ASP C CA    1 
ATOM   7896  C  C     . ASP C 2  553  ? 462.104 -22.760 682.152 1.00 89.73  ? 553  ASP C C     1 
ATOM   7897  O  O     . ASP C 2  553  ? 462.551 -23.632 681.404 1.00 94.18  ? 553  ASP C O     1 
ATOM   7898  C  CB    . ASP C 2  553  ? 464.179 -22.078 683.239 1.00 84.06  ? 553  ASP C CB    1 
ATOM   7899  C  CG    . ASP C 2  553  ? 464.831 -21.395 684.410 1.00 85.59  ? 553  ASP C CG    1 
ATOM   7900  O  OD1   . ASP C 2  553  ? 464.160 -20.621 685.113 1.00 89.55  ? 553  ASP C OD1   1 
ATOM   7901  O  OD2   . ASP C 2  553  ? 466.044 -21.593 684.599 1.00 80.82  ? 553  ASP C OD2   1 
ATOM   7902  N  N     . ASP C 2  554  ? 461.176 -21.874 681.761 1.00 89.83  ? 554  ASP C N     1 
ATOM   7903  C  CA    . ASP C 2  554  ? 460.639 -21.883 680.395 1.00 89.41  ? 554  ASP C CA    1 
ATOM   7904  C  C     . ASP C 2  554  ? 461.770 -21.702 679.398 1.00 85.68  ? 554  ASP C C     1 
ATOM   7905  O  O     . ASP C 2  554  ? 462.680 -20.903 679.625 1.00 86.63  ? 554  ASP C O     1 
ATOM   7906  C  CB    . ASP C 2  554  ? 459.579 -20.802 680.187 1.00 86.46  ? 554  ASP C CB    1 
ATOM   7907  C  CG    . ASP C 2  554  ? 459.096 -20.723 678.738 1.00 84.39  ? 554  ASP C CG    1 
ATOM   7908  O  OD1   . ASP C 2  554  ? 458.270 -21.567 678.337 1.00 84.71  ? 554  ASP C OD1   1 
ATOM   7909  O  OD2   . ASP C 2  554  ? 459.453 -19.762 678.029 1.00 83.70  ? 554  ASP C OD2   1 
ATOM   7910  N  N     . ALA C 2  555  ? 461.731 -22.495 678.316 1.00 88.09  ? 555  ALA C N     1 
ATOM   7911  C  CA    . ALA C 2  555  ? 462.851 -22.562 677.370 1.00 86.63  ? 555  ALA C CA    1 
ATOM   7912  C  C     . ALA C 2  555  ? 463.251 -21.211 676.768 1.00 79.46  ? 555  ALA C C     1 
ATOM   7913  O  O     . ALA C 2  555  ? 464.447 -20.887 676.717 1.00 74.68  ? 555  ALA C O     1 
ATOM   7914  C  CB    . ALA C 2  555  ? 462.517 -23.550 676.259 1.00 75.61  ? 555  ALA C CB    1 
ATOM   7915  N  N     . ASN C 2  556  ? 462.281 -20.376 676.388 1.00 73.97  ? 556  ASN C N     1 
ATOM   7916  C  CA    . ASN C 2  556  ? 462.633 -19.103 675.760 1.00 78.09  ? 556  ASN C CA    1 
ATOM   7917  C  C     . ASN C 2  556  ? 463.491 -18.233 676.658 1.00 80.05  ? 556  ASN C C     1 
ATOM   7918  O  O     . ASN C 2  556  ? 464.250 -17.393 676.172 1.00 88.89  ? 556  ASN C O     1 
ATOM   7919  C  CB    . ASN C 2  556  ? 461.376 -18.359 675.348 1.00 76.91  ? 556  ASN C CB    1 
ATOM   7920  C  CG    . ASN C 2  556  ? 460.531 -19.153 674.380 1.00 86.11  ? 556  ASN C CG    1 
ATOM   7921  O  OD1   . ASN C 2  556  ? 459.543 -19.766 674.772 1.00 102.11 ? 556  ASN C OD1   1 
ATOM   7922  N  ND2   . ASN C 2  556  ? 460.833 -19.041 673.100 1.00 88.30  ? 556  ASN C ND2   1 
ATOM   7923  N  N     . ARG C 2  557  ? 463.297 -18.320 677.953 1.00 75.40  ? 557  ARG C N     1 
ATOM   7924  C  CA    . ARG C 2  557  ? 464.130 -17.560 678.870 1.00 76.74  ? 557  ARG C CA    1 
ATOM   7925  C  C     . ARG C 2  557  ? 465.440 -18.271 679.151 1.00 76.04  ? 557  ARG C C     1 
ATOM   7926  O  O     . ARG C 2  557  ? 466.421 -17.615 679.504 1.00 79.23  ? 557  ARG C O     1 
ATOM   7927  C  CB    . ARG C 2  557  ? 463.372 -17.242 680.161 1.00 87.08  ? 557  ARG C CB    1 
ATOM   7928  C  CG    . ARG C 2  557  ? 463.416 -15.755 680.578 1.00 80.04  ? 557  ARG C CG    1 
ATOM   7929  C  CD    . ARG C 2  557  ? 462.833 -14.739 679.548 1.00 74.67  ? 557  ARG C CD    1 
ATOM   7930  N  NE    . ARG C 2  557  ? 463.338 -13.385 679.818 1.00 70.04  ? 557  ARG C NE    1 
ATOM   7931  C  CZ    . ARG C 2  557  ? 462.872 -12.266 679.265 1.00 71.63  ? 557  ARG C CZ    1 
ATOM   7932  N  NH1   . ARG C 2  557  ? 461.853 -12.317 678.392 1.00 66.26  ? 557  ARG C NH1   1 
ATOM   7933  N  NH2   . ARG C 2  557  ? 463.420 -11.095 679.612 1.00 67.14  ? 557  ARG C NH2   1 
ATOM   7934  N  N     . ALA C 2  558  ? 465.409 -19.606 679.239 1.00 77.06  ? 558  ALA C N     1 
ATOM   7935  C  CA    . ALA C 2  558  ? 466.645 -20.375 679.420 1.00 80.01  ? 558  ALA C CA    1 
ATOM   7936  C  C     . ALA C 2  558  ? 467.666 -20.065 678.336 1.00 82.09  ? 558  ALA C C     1 
ATOM   7937  O  O     . ALA C 2  558  ? 468.866 -19.935 678.619 1.00 77.89  ? 558  ALA C O     1 
ATOM   7938  C  CB    . ALA C 2  558  ? 466.353 -21.880 679.439 1.00 73.46  ? 558  ALA C CB    1 
ATOM   7939  N  N     . LEU C 2  559  ? 467.190 -19.904 677.094 1.00 85.84  ? 559  LEU C N     1 
ATOM   7940  C  CA    . LEU C 2  559  ? 468.022 -19.474 675.967 1.00 86.49  ? 559  LEU C CA    1 
ATOM   7941  C  C     . LEU C 2  559  ? 468.804 -18.209 676.301 1.00 84.98  ? 559  LEU C C     1 
ATOM   7942  O  O     . LEU C 2  559  ? 470.015 -18.140 676.070 1.00 86.14  ? 559  LEU C O     1 
ATOM   7943  C  CB    . LEU C 2  559  ? 467.127 -19.283 674.743 1.00 82.92  ? 559  LEU C CB    1 
ATOM   7944  C  CG    . LEU C 2  559  ? 467.648 -18.764 673.428 1.00 76.82  ? 559  LEU C CG    1 
ATOM   7945  C  CD1   . LEU C 2  559  ? 466.843 -19.402 672.352 1.00 80.13  ? 559  LEU C CD1   1 
ATOM   7946  C  CD2   . LEU C 2  559  ? 467.385 -17.292 673.418 1.00 84.41  ? 559  LEU C CD2   1 
ATOM   7947  N  N     . MET C 2  560  ? 468.104 -17.163 676.752 1.00 80.18  ? 560  MET C N     1 
ATOM   7948  C  CA    . MET C 2  560  ? 468.770 -15.918 677.114 1.00 81.12  ? 560  MET C CA    1 
ATOM   7949  C  C     . MET C 2  560  ? 469.794 -16.130 678.225 1.00 86.08  ? 560  MET C C     1 
ATOM   7950  O  O     . MET C 2  560  ? 470.812 -15.427 678.293 1.00 87.64  ? 560  MET C O     1 
ATOM   7951  C  CB    . MET C 2  560  ? 467.741 -14.876 677.523 1.00 78.40  ? 560  MET C CB    1 
ATOM   7952  C  CG    . MET C 2  560  ? 466.649 -14.751 676.518 1.00 82.33  ? 560  MET C CG    1 
ATOM   7953  S  SD    . MET C 2  560  ? 465.573 -13.375 676.886 1.00 74.47  ? 560  MET C SD    1 
ATOM   7954  C  CE    . MET C 2  560  ? 464.378 -13.555 675.565 1.00 86.67  ? 560  MET C CE    1 
ATOM   7955  N  N     . GLY C 2  561  ? 469.493 -17.023 679.164 1.00 84.12  ? 561  GLY C N     1 
ATOM   7956  C  CA    . GLY C 2  561  ? 470.463 -17.335 680.199 1.00 84.15  ? 561  GLY C CA    1 
ATOM   7957  C  C     . GLY C 2  561  ? 471.766 -17.866 679.636 1.00 88.37  ? 561  GLY C C     1 
ATOM   7958  O  O     . GLY C 2  561  ? 472.848 -17.397 680.000 1.00 88.20  ? 561  GLY C O     1 
ATOM   7959  N  N     . SER C 2  562  ? 471.677 -18.908 678.797 1.00 88.09  ? 562  SER C N     1 
ATOM   7960  C  CA    . SER C 2  562  ? 472.834 -19.429 678.077 1.00 83.80  ? 562  SER C CA    1 
ATOM   7961  C  C     . SER C 2  562  ? 473.588 -18.327 677.354 1.00 87.00  ? 562  SER C C     1 
ATOM   7962  O  O     . SER C 2  562  ? 474.733 -18.007 677.692 1.00 91.77  ? 562  SER C O     1 
ATOM   7963  C  CB    . SER C 2  562  ? 472.416 -20.510 677.076 1.00 84.32  ? 562  SER C CB    1 
ATOM   7964  O  OG    . SER C 2  562  ? 472.100 -21.727 677.705 1.00 86.08  ? 562  SER C OG    1 
ATOM   7965  N  N     . ASN C 2  563  ? 472.925 -17.691 676.389 1.00 84.30  ? 563  ASN C N     1 
ATOM   7966  C  CA    . ASN C 2  563  ? 473.602 -16.723 675.539 1.00 86.62  ? 563  ASN C CA    1 
ATOM   7967  C  C     . ASN C 2  563  ? 474.243 -15.617 676.345 1.00 88.96  ? 563  ASN C C     1 
ATOM   7968  O  O     . ASN C 2  563  ? 475.289 -15.091 675.950 1.00 95.12  ? 563  ASN C O     1 
ATOM   7969  C  CB    . ASN C 2  563  ? 472.628 -16.132 674.536 1.00 82.88  ? 563  ASN C CB    1 
ATOM   7970  C  CG    . ASN C 2  563  ? 472.135 -17.157 673.572 1.00 87.65  ? 563  ASN C CG    1 
ATOM   7971  O  OD1   . ASN C 2  563  ? 472.617 -18.298 673.558 1.00 86.91  ? 563  ASN C OD1   1 
ATOM   7972  N  ND2   . ASN C 2  563  ? 471.216 -16.753 672.707 1.00 93.14  ? 563  ASN C ND2   1 
ATOM   7973  N  N     . MET C 2  564  ? 473.632 -15.222 677.446 1.00 83.42  ? 564  MET C N     1 
ATOM   7974  C  CA    . MET C 2  564  ? 474.183 -14.066 678.123 1.00 88.79  ? 564  MET C CA    1 
ATOM   7975  C  C     . MET C 2  564  ? 475.418 -14.418 678.948 1.00 86.18  ? 564  MET C C     1 
ATOM   7976  O  O     . MET C 2  564  ? 476.297 -13.567 679.134 1.00 83.05  ? 564  MET C O     1 
ATOM   7977  C  CB    . MET C 2  564  ? 473.102 -13.385 678.966 1.00 85.76  ? 564  MET C CB    1 
ATOM   7978  C  CG    . MET C 2  564  ? 472.189 -12.599 678.067 1.00 83.90  ? 564  MET C CG    1 
ATOM   7979  S  SD    . MET C 2  564  ? 470.960 -11.583 678.863 1.00 83.60  ? 564  MET C SD    1 
ATOM   7980  C  CE    . MET C 2  564  ? 470.045 -12.814 679.777 1.00 89.98  ? 564  MET C CE    1 
ATOM   7981  N  N     . GLN C 2  565  ? 475.520 -15.649 679.446 1.00 83.88  ? 565  GLN C N     1 
ATOM   7982  C  CA    . GLN C 2  565  ? 476.761 -16.023 680.103 1.00 81.37  ? 565  GLN C CA    1 
ATOM   7983  C  C     . GLN C 2  565  ? 477.941 -15.808 679.197 1.00 88.47  ? 565  GLN C C     1 
ATOM   7984  O  O     . GLN C 2  565  ? 478.998 -15.370 679.652 1.00 94.53  ? 565  GLN C O     1 
ATOM   7985  C  CB    . GLN C 2  565  ? 476.717 -17.473 680.574 1.00 87.07  ? 565  GLN C CB    1 
ATOM   7986  C  CG    . GLN C 2  565  ? 475.573 -17.752 681.543 1.00 88.37  ? 565  GLN C CG    1 
ATOM   7987  C  CD    . GLN C 2  565  ? 475.686 -19.104 682.180 1.00 87.29  ? 565  GLN C CD    1 
ATOM   7988  O  OE1   . GLN C 2  565  ? 475.200 -20.100 681.639 1.00 88.55  ? 565  GLN C OE1   1 
ATOM   7989  N  NE2   . GLN C 2  565  ? 476.342 -19.154 683.345 1.00 82.13  ? 565  GLN C NE2   1 
ATOM   7990  N  N     . THR C 2  566  ? 477.732 -15.956 677.899 1.00 91.36  ? 566  THR C N     1 
ATOM   7991  C  CA    . THR C 2  566  ? 478.777 -15.660 676.940 1.00 86.34  ? 566  THR C CA    1 
ATOM   7992  C  C     . THR C 2  566  ? 479.267 -14.229 677.035 1.00 88.23  ? 566  THR C C     1 
ATOM   7993  O  O     . THR C 2  566  ? 480.459 -13.971 676.816 1.00 90.58  ? 566  THR C O     1 
ATOM   7994  C  CB    . THR C 2  566  ? 478.220 -15.912 675.559 1.00 87.86  ? 566  THR C CB    1 
ATOM   7995  O  OG1   . THR C 2  566  ? 478.277 -17.318 675.306 1.00 97.42  ? 566  THR C OG1   1 
ATOM   7996  C  CG2   . THR C 2  566  ? 478.979 -15.102 674.488 1.00 94.20  ? 566  THR C CG2   1 
ATOM   7997  N  N     . GLN C 2  567  ? 478.395 -13.312 677.463 1.00 83.19  ? 567  GLN C N     1 
ATOM   7998  C  CA    . GLN C 2  567  ? 478.655 -11.882 677.443 1.00 77.75  ? 567  GLN C CA    1 
ATOM   7999  C  C     . GLN C 2  567  ? 479.164 -11.346 678.754 1.00 71.57  ? 567  GLN C C     1 
ATOM   8000  O  O     . GLN C 2  567  ? 479.376 -10.132 678.871 1.00 71.40  ? 567  GLN C O     1 
ATOM   8001  C  CB    . GLN C 2  567  ? 477.399 -11.138 677.003 1.00 79.59  ? 567  GLN C CB    1 
ATOM   8002  C  CG    . GLN C 2  567  ? 476.818 -11.777 675.740 1.00 87.70  ? 567  GLN C CG    1 
ATOM   8003  C  CD    . GLN C 2  567  ? 475.435 -11.281 675.325 1.00 92.75  ? 567  GLN C CD    1 
ATOM   8004  O  OE1   . GLN C 2  567  ? 474.956 -10.227 675.754 1.00 87.63  ? 567  GLN C OE1   1 
ATOM   8005  N  NE2   . GLN C 2  567  ? 474.758 -12.099 674.528 1.00 100.99 ? 567  GLN C NE2   1 
ATOM   8006  N  N     . ALA C 2  568  ? 479.393 -12.219 679.727 1.00 79.38  ? 568  ALA C N     1 
ATOM   8007  C  CA    . ALA C 2  568  ? 479.814 -11.759 681.042 1.00 81.95  ? 568  ALA C CA    1 
ATOM   8008  C  C     . ALA C 2  568  ? 481.207 -11.162 680.982 1.00 80.38  ? 568  ALA C C     1 
ATOM   8009  O  O     . ALA C 2  568  ? 482.167 -11.828 680.589 1.00 90.17  ? 568  ALA C O     1 
ATOM   8010  C  CB    . ALA C 2  568  ? 479.792 -12.926 682.039 1.00 78.88  ? 568  ALA C CB    1 
ATOM   8011  N  N     . VAL C 2  569  ? 481.345 -9.989  681.574 1.00 78.04  ? 569  VAL C N     1 
ATOM   8012  C  CA    . VAL C 2  569  ? 482.593 -9.247  681.584 1.00 81.19  ? 569  VAL C CA    1 
ATOM   8013  C  C     . VAL C 2  569  ? 483.378 -9.702  682.808 1.00 89.50  ? 569  VAL C C     1 
ATOM   8014  O  O     . VAL C 2  569  ? 482.813 -9.774  683.907 1.00 99.77  ? 569  VAL C O     1 
ATOM   8015  C  CB    . VAL C 2  569  ? 482.286 -7.747  681.623 1.00 85.51  ? 569  VAL C CB    1 
ATOM   8016  C  CG1   . VAL C 2  569  ? 483.488 -6.955  681.995 1.00 88.69  ? 569  VAL C CG1   1 
ATOM   8017  C  CG2   . VAL C 2  569  ? 481.724 -7.315  680.298 1.00 90.28  ? 569  VAL C CG2   1 
ATOM   8018  N  N     . PRO C 2  570  ? 484.669 -10.000 682.679 1.00 92.38  ? 570  PRO C N     1 
ATOM   8019  C  CA    . PRO C 2  570  ? 485.481 -10.375 683.857 1.00 91.67  ? 570  PRO C CA    1 
ATOM   8020  C  C     . PRO C 2  570  ? 485.610 -9.273  684.908 1.00 87.01  ? 570  PRO C C     1 
ATOM   8021  O  O     . PRO C 2  570  ? 485.953 -8.125  684.606 1.00 85.47  ? 570  PRO C O     1 
ATOM   8022  C  CB    . PRO C 2  570  ? 486.840 -10.740 683.242 1.00 97.73  ? 570  PRO C CB    1 
ATOM   8023  C  CG    . PRO C 2  570  ? 486.527 -11.120 681.810 1.00 89.97  ? 570  PRO C CG    1 
ATOM   8024  C  CD    . PRO C 2  570  ? 485.394 -10.202 681.412 1.00 87.31  ? 570  PRO C CD    1 
ATOM   8025  N  N     . LEU C 2  571  ? 485.273 -9.616  686.152 1.00 98.29  ? 571  LEU C N     1 
ATOM   8026  C  CA    . LEU C 2  571  ? 485.270 -8.638  687.233 1.00 94.62  ? 571  LEU C CA    1 
ATOM   8027  C  C     . LEU C 2  571  ? 486.500 -8.846  688.097 1.00 91.88  ? 571  LEU C C     1 
ATOM   8028  O  O     . LEU C 2  571  ? 486.927 -9.980  688.327 1.00 90.55  ? 571  LEU C O     1 
ATOM   8029  C  CB    . LEU C 2  571  ? 484.006 -8.769  688.082 1.00 88.31  ? 571  LEU C CB    1 
ATOM   8030  C  CG    . LEU C 2  571  ? 482.811 -8.674  687.145 1.00 90.17  ? 571  LEU C CG    1 
ATOM   8031  C  CD1   . LEU C 2  571  ? 482.058 -9.999  686.965 1.00 94.61  ? 571  LEU C CD1   1 
ATOM   8032  C  CD2   . LEU C 2  571  ? 481.926 -7.569  687.546 1.00 85.61  ? 571  LEU C CD2   1 
ATOM   8033  N  N     . ILE C 2  572  ? 487.012 -7.742  688.646 1.00 91.85  ? 572  ILE C N     1 
ATOM   8034  C  CA    . ILE C 2  572  ? 488.210 -7.811  689.477 1.00 92.58  ? 572  ILE C CA    1 
ATOM   8035  C  C     . ILE C 2  572  ? 487.955 -8.646  690.724 1.00 98.10  ? 572  ILE C C     1 
ATOM   8036  O  O     . ILE C 2  572  ? 488.849 -9.352  691.203 1.00 103.71 ? 572  ILE C O     1 
ATOM   8037  C  CB    . ILE C 2  572  ? 488.702 -6.386  689.798 1.00 96.11  ? 572  ILE C CB    1 
ATOM   8038  C  CG1   . ILE C 2  572  ? 487.833 -5.707  690.849 1.00 101.21 ? 572  ILE C CG1   1 
ATOM   8039  C  CG2   . ILE C 2  572  ? 488.640 -5.507  688.555 1.00 98.73  ? 572  ILE C CG2   1 
ATOM   8040  C  CD1   . ILE C 2  572  ? 488.211 -4.243  691.036 1.00 104.37 ? 572  ILE C CD1   1 
ATOM   8041  N  N     . ARG C 2  573  ? 486.734 -8.597  691.247 1.00 95.78  ? 573  ARG C N     1 
ATOM   8042  C  CA    . ARG C 2  573  ? 486.282 -9.362  692.397 1.00 93.18  ? 573  ARG C CA    1 
ATOM   8043  C  C     . ARG C 2  573  ? 485.490 -10.627 692.026 1.00 92.97  ? 573  ARG C C     1 
ATOM   8044  O  O     . ARG C 2  573  ? 484.720 -11.115 692.853 1.00 95.42  ? 573  ARG C O     1 
ATOM   8045  C  CB    . ARG C 2  573  ? 485.412 -8.451  693.260 1.00 99.15  ? 573  ARG C CB    1 
ATOM   8046  C  CG    . ARG C 2  573  ? 486.064 -7.136  693.712 1.00 102.59 ? 573  ARG C CG    1 
ATOM   8047  C  CD    . ARG C 2  573  ? 487.147 -7.238  694.822 1.00 104.07 ? 573  ARG C CD    1 
ATOM   8048  N  NE    . ARG C 2  573  ? 486.907 -8.247  695.859 1.00 101.77 ? 573  ARG C NE    1 
ATOM   8049  C  CZ    . ARG C 2  573  ? 486.369 -7.966  697.045 1.00 101.66 ? 573  ARG C CZ    1 
ATOM   8050  N  NH1   . ARG C 2  573  ? 486.018 -6.713  697.328 1.00 94.35  ? 573  ARG C NH1   1 
ATOM   8051  N  NH2   . ARG C 2  573  ? 486.175 -8.929  697.943 1.00 99.80  ? 573  ARG C NH2   1 
ATOM   8052  N  N     . ALA C 2  574  ? 485.533 -11.072 690.770 1.00 98.48  ? 574  ALA C N     1 
ATOM   8053  C  CA    . ALA C 2  574  ? 484.634 -12.133 690.302 1.00 97.93  ? 574  ALA C CA    1 
ATOM   8054  C  C     . ALA C 2  574  ? 484.605 -13.335 691.246 1.00 93.76  ? 574  ALA C C     1 
ATOM   8055  O  O     . ALA C 2  574  ? 485.621 -13.701 691.837 1.00 92.87  ? 574  ALA C O     1 
ATOM   8056  C  CB    . ALA C 2  574  ? 485.020 -12.576 688.882 1.00 90.08  ? 574  ALA C CB    1 
ATOM   8057  N  N     . GLN C 2  575  ? 483.405 -13.889 691.456 1.00 94.33  ? 575  GLN C N     1 
ATOM   8058  C  CA    . GLN C 2  575  ? 483.200 -15.054 692.309 1.00 91.67  ? 575  GLN C CA    1 
ATOM   8059  C  C     . GLN C 2  575  ? 482.348 -16.088 691.593 1.00 88.50  ? 575  GLN C C     1 
ATOM   8060  O  O     . GLN C 2  575  ? 481.485 -15.734 690.788 1.00 91.79  ? 575  GLN C O     1 
ATOM   8061  C  CB    . GLN C 2  575  ? 482.514 -14.670 693.611 1.00 99.45  ? 575  GLN C CB    1 
ATOM   8062  C  CG    . GLN C 2  575  ? 482.067 -13.226 693.665 1.00 96.29  ? 575  GLN C CG    1 
ATOM   8063  C  CD    . GLN C 2  575  ? 481.383 -12.919 694.957 1.00 91.33  ? 575  GLN C CD    1 
ATOM   8064  O  OE1   . GLN C 2  575  ? 480.568 -12.007 695.042 1.00 91.30  ? 575  GLN C OE1   1 
ATOM   8065  N  NE2   . GLN C 2  575  ? 481.686 -13.717 695.979 1.00 95.60  ? 575  GLN C NE2   1 
ATOM   8066  N  N     . ALA C 2  576  ? 482.529 -17.359 691.944 1.00 87.95  ? 576  ALA C N     1 
ATOM   8067  C  CA    . ALA C 2  576  ? 481.631 -18.381 691.423 1.00 92.10  ? 576  ALA C CA    1 
ATOM   8068  C  C     . ALA C 2  576  ? 480.264 -18.319 692.126 1.00 101.24 ? 576  ALA C C     1 
ATOM   8069  O  O     . ALA C 2  576  ? 480.164 -17.938 693.307 1.00 94.67  ? 576  ALA C O     1 
ATOM   8070  C  CB    . ALA C 2  576  ? 482.230 -19.775 691.579 1.00 87.87  ? 576  ALA C CB    1 
ATOM   8071  N  N     . PRO C 2  577  ? 479.197 -18.744 691.441 1.00 99.84  ? 577  PRO C N     1 
ATOM   8072  C  CA    . PRO C 2  577  ? 477.861 -18.665 692.045 1.00 98.34  ? 577  PRO C CA    1 
ATOM   8073  C  C     . PRO C 2  577  ? 477.725 -19.563 693.276 1.00 97.63  ? 577  PRO C C     1 
ATOM   8074  O  O     . PRO C 2  577  ? 478.386 -20.597 693.395 1.00 96.23  ? 577  PRO C O     1 
ATOM   8075  C  CB    . PRO C 2  577  ? 476.933 -19.111 690.897 1.00 94.06  ? 577  PRO C CB    1 
ATOM   8076  C  CG    . PRO C 2  577  ? 477.779 -19.865 689.968 1.00 92.57  ? 577  PRO C CG    1 
ATOM   8077  C  CD    . PRO C 2  577  ? 479.134 -19.218 690.047 1.00 92.95  ? 577  PRO C CD    1 
ATOM   8078  N  N     . VAL C 2  578  ? 476.874 -19.133 694.223 1.00 102.83 ? 578  VAL C N     1 
ATOM   8079  C  CA    . VAL C 2  578  ? 476.651 -19.936 695.428 1.00 101.79 ? 578  VAL C CA    1 
ATOM   8080  C  C     . VAL C 2  578  ? 475.843 -21.183 695.117 1.00 101.37 ? 578  VAL C C     1 
ATOM   8081  O  O     . VAL C 2  578  ? 475.913 -22.164 695.867 1.00 102.83 ? 578  VAL C O     1 
ATOM   8082  C  CB    . VAL C 2  578  ? 475.966 -19.129 696.546 1.00 97.47  ? 578  VAL C CB    1 
ATOM   8083  C  CG1   . VAL C 2  578  ? 476.564 -17.743 696.654 1.00 94.84  ? 578  VAL C CG1   1 
ATOM   8084  C  CG2   . VAL C 2  578  ? 474.455 -19.089 696.346 1.00 97.41  ? 578  VAL C CG2   1 
ATOM   8085  N  N     . VAL C 2  579  ? 475.021 -21.158 694.067 1.00 96.81  ? 579  VAL C N     1 
ATOM   8086  C  CA    . VAL C 2  579  ? 474.363 -22.362 693.572 1.00 99.07  ? 579  VAL C CA    1 
ATOM   8087  C  C     . VAL C 2  579  ? 474.945 -22.700 692.193 1.00 101.56 ? 579  VAL C C     1 
ATOM   8088  O  O     . VAL C 2  579  ? 474.691 -21.990 691.209 1.00 97.27  ? 579  VAL C O     1 
ATOM   8089  C  CB    . VAL C 2  579  ? 472.845 -22.181 693.528 1.00 91.94  ? 579  VAL C CB    1 
ATOM   8090  C  CG1   . VAL C 2  579  ? 472.184 -23.459 693.057 1.00 92.10  ? 579  VAL C CG1   1 
ATOM   8091  C  CG2   . VAL C 2  579  ? 472.357 -21.760 694.881 1.00 94.99  ? 579  VAL C CG2   1 
ATOM   8092  N  N     . MET C 2  580  ? 475.740 -23.767 692.117 1.00 100.75 ? 580  MET C N     1 
ATOM   8093  C  CA    . MET C 2  580  ? 476.337 -24.263 690.881 1.00 96.07  ? 580  MET C CA    1 
ATOM   8094  C  C     . MET C 2  580  ? 475.696 -25.569 690.423 1.00 95.86  ? 580  MET C C     1 
ATOM   8095  O  O     . MET C 2  580  ? 474.911 -26.186 691.148 1.00 98.73  ? 580  MET C O     1 
ATOM   8096  C  CB    . MET C 2  580  ? 477.825 -24.479 691.095 1.00 95.08  ? 580  MET C CB    1 
ATOM   8097  C  CG    . MET C 2  580  ? 478.567 -23.229 691.426 1.00 97.27  ? 580  MET C CG    1 
ATOM   8098  S  SD    . MET C 2  580  ? 480.215 -23.675 691.995 1.00 109.45 ? 580  MET C SD    1 
ATOM   8099  C  CE    . MET C 2  580  ? 480.199 -25.471 691.809 1.00 101.30 ? 580  MET C CE    1 
ATOM   8100  N  N     . THR C 2  581  ? 476.039 -25.982 689.194 1.00 93.70  ? 581  THR C N     1 
ATOM   8101  C  CA    . THR C 2  581  ? 475.608 -27.263 688.635 1.00 95.35  ? 581  THR C CA    1 
ATOM   8102  C  C     . THR C 2  581  ? 476.708 -28.324 688.628 1.00 102.64 ? 581  THR C C     1 
ATOM   8103  O  O     . THR C 2  581  ? 476.427 -29.481 688.272 1.00 100.09 ? 581  THR C O     1 
ATOM   8104  C  CB    . THR C 2  581  ? 475.087 -27.102 687.201 1.00 95.98  ? 581  THR C CB    1 
ATOM   8105  O  OG1   . THR C 2  581  ? 476.183 -26.788 686.324 1.00 100.32 ? 581  THR C OG1   1 
ATOM   8106  C  CG2   . THR C 2  581  ? 474.000 -26.032 687.116 1.00 90.58  ? 581  THR C CG2   1 
ATOM   8107  N  N     . GLY C 2  582  ? 477.950 -27.958 688.995 1.00 103.85 ? 582  GLY C N     1 
ATOM   8108  C  CA    . GLY C 2  582  ? 479.077 -28.873 688.968 1.00 99.77  ? 582  GLY C CA    1 
ATOM   8109  C  C     . GLY C 2  582  ? 479.857 -28.906 687.668 1.00 107.83 ? 582  GLY C C     1 
ATOM   8110  O  O     . GLY C 2  582  ? 480.824 -29.673 687.554 1.00 115.98 ? 582  GLY C O     1 
ATOM   8111  N  N     . LEU C 2  583  ? 479.504 -28.084 686.689 1.00 105.28 ? 583  LEU C N     1 
ATOM   8112  C  CA    . LEU C 2  583  ? 480.276 -28.048 685.461 1.00 100.88 ? 583  LEU C CA    1 
ATOM   8113  C  C     . LEU C 2  583  ? 481.270 -26.910 685.441 1.00 97.84  ? 583  LEU C C     1 
ATOM   8114  O  O     . LEU C 2  583  ? 482.005 -26.781 684.469 1.00 100.76 ? 583  LEU C O     1 
ATOM   8115  C  CB    . LEU C 2  583  ? 479.328 -27.912 684.272 1.00 99.27  ? 583  LEU C CB    1 
ATOM   8116  C  CG    . LEU C 2  583  ? 479.404 -29.016 683.240 1.00 95.82  ? 583  LEU C CG    1 
ATOM   8117  C  CD1   . LEU C 2  583  ? 478.691 -30.223 683.826 1.00 92.85  ? 583  LEU C CD1   1 
ATOM   8118  C  CD2   . LEU C 2  583  ? 478.702 -28.572 681.983 1.00 89.28  ? 583  LEU C CD2   1 
ATOM   8119  N  N     . GLU C 2  584  ? 481.223 -26.027 686.431 1.00 98.48  ? 584  GLU C N     1 
ATOM   8120  C  CA    . GLU C 2  584  ? 481.957 -24.771 686.406 1.00 99.10  ? 584  GLU C CA    1 
ATOM   8121  C  C     . GLU C 2  584  ? 483.427 -25.036 686.679 1.00 102.52 ? 584  GLU C C     1 
ATOM   8122  O  O     . GLU C 2  584  ? 484.275 -24.166 686.445 1.00 98.59  ? 584  GLU C O     1 
ATOM   8123  C  CB    . GLU C 2  584  ? 481.399 -23.737 687.409 1.00 92.74  ? 584  GLU C CB    1 
ATOM   8124  C  CG    . GLU C 2  584  ? 480.443 -24.250 688.509 1.00 99.48  ? 584  GLU C CG    1 
ATOM   8125  C  CD    . GLU C 2  584  ? 478.947 -24.412 688.119 1.00 100.59 ? 584  GLU C CD    1 
ATOM   8126  O  OE1   . GLU C 2  584  ? 478.245 -23.394 687.849 1.00 93.36  ? 584  GLU C OE1   1 
ATOM   8127  O  OE2   . GLU C 2  584  ? 478.461 -25.568 688.144 1.00 99.24  ? 584  GLU C OE2   1 
ATOM   8128  N  N     . GLU C 2  585  ? 483.700 -26.177 687.316 1.00 107.64 ? 585  GLU C N     1 
ATOM   8129  C  CA    . GLU C 2  585  ? 485.056 -26.697 687.478 1.00 112.71 ? 585  GLU C CA    1 
ATOM   8130  C  C     . GLU C 2  585  ? 485.673 -27.151 686.149 1.00 110.87 ? 585  GLU C C     1 
ATOM   8131  O  O     . GLU C 2  585  ? 486.816 -26.794 685.829 1.00 107.21 ? 585  GLU C O     1 
ATOM   8132  C  CB    . GLU C 2  585  ? 484.942 -27.841 688.492 1.00 117.76 ? 585  GLU C CB    1 
ATOM   8133  C  CG    . GLU C 2  585  ? 485.459 -27.515 689.916 1.00 120.94 ? 585  GLU C CG    1 
ATOM   8134  C  CD    . GLU C 2  585  ? 485.000 -28.538 690.988 1.00 130.71 ? 585  GLU C CD    1 
ATOM   8135  O  OE1   . GLU C 2  585  ? 483.949 -29.214 690.790 1.00 133.12 ? 585  GLU C OE1   1 
ATOM   8136  O  OE2   . GLU C 2  585  ? 485.686 -28.662 692.032 1.00 131.35 ? 585  GLU C OE2   1 
ATOM   8137  N  N     . ARG C 2  586  ? 484.924 -27.914 685.348 1.00 111.43 ? 586  ARG C N     1 
ATOM   8138  C  CA    . ARG C 2  586  ? 485.455 -28.440 684.088 1.00 104.02 ? 586  ARG C CA    1 
ATOM   8139  C  C     . ARG C 2  586  ? 485.734 -27.322 683.075 1.00 108.55 ? 586  ARG C C     1 
ATOM   8140  O  O     . ARG C 2  586  ? 486.713 -27.384 682.318 1.00 109.54 ? 586  ARG C O     1 
ATOM   8141  C  CB    . ARG C 2  586  ? 484.492 -29.461 683.473 1.00 101.38 ? 586  ARG C CB    1 
ATOM   8142  C  CG    . ARG C 2  586  ? 485.006 -30.909 683.380 1.00 99.90  ? 586  ARG C CG    1 
ATOM   8143  C  CD    . ARG C 2  586  ? 486.473 -30.974 682.975 1.00 106.80 ? 586  ARG C CD    1 
ATOM   8144  N  NE    . ARG C 2  586  ? 486.744 -31.270 681.560 1.00 109.41 ? 586  ARG C NE    1 
ATOM   8145  C  CZ    . ARG C 2  586  ? 486.381 -32.359 680.880 1.00 107.18 ? 586  ARG C CZ    1 
ATOM   8146  N  NH1   . ARG C 2  586  ? 485.704 -33.354 681.444 1.00 107.29 ? 586  ARG C NH1   1 
ATOM   8147  N  NH2   . ARG C 2  586  ? 486.718 -32.446 679.603 1.00 106.76 ? 586  ARG C NH2   1 
ATOM   8148  N  N     . VAL C 2  587  ? 484.857 -26.310 683.025 1.00 106.60 ? 587  VAL C N     1 
ATOM   8149  C  CA    . VAL C 2  587  ? 484.968 -25.218 682.054 1.00 99.56  ? 587  VAL C CA    1 
ATOM   8150  C  C     . VAL C 2  587  ? 486.252 -24.432 682.225 1.00 98.41  ? 587  VAL C C     1 
ATOM   8151  O  O     . VAL C 2  587  ? 486.916 -24.096 681.248 1.00 100.67 ? 587  VAL C O     1 
ATOM   8152  C  CB    . VAL C 2  587  ? 483.762 -24.272 682.164 1.00 94.93  ? 587  VAL C CB    1 
ATOM   8153  C  CG1   . VAL C 2  587  ? 484.059 -22.979 681.431 1.00 91.19  ? 587  VAL C CG1   1 
ATOM   8154  C  CG2   . VAL C 2  587  ? 482.519 -24.933 681.626 1.00 99.13  ? 587  VAL C CG2   1 
ATOM   8155  N  N     . VAL C 2  588  ? 486.633 -24.120 683.451 1.00 99.11  ? 588  VAL C N     1 
ATOM   8156  C  CA    . VAL C 2  588  ? 487.860 -23.359 683.595 1.00 103.30 ? 588  VAL C CA    1 
ATOM   8157  C  C     . VAL C 2  588  ? 489.047 -24.178 683.101 1.00 107.91 ? 588  VAL C C     1 
ATOM   8158  O  O     . VAL C 2  588  ? 489.927 -23.671 682.380 1.00 102.92 ? 588  VAL C O     1 
ATOM   8159  C  CB    . VAL C 2  588  ? 488.018 -22.909 685.060 1.00 99.81  ? 588  VAL C CB    1 
ATOM   8160  C  CG1   . VAL C 2  588  ? 489.339 -22.278 685.271 1.00 107.69 ? 588  VAL C CG1   1 
ATOM   8161  C  CG2   . VAL C 2  588  ? 486.952 -21.890 685.403 1.00 97.32  ? 588  VAL C CG2   1 
ATOM   8162  N  N     . ARG C 2  589  ? 489.050 -25.473 683.427 1.00 109.26 ? 589  ARG C N     1 
ATOM   8163  C  CA    . ARG C 2  589  ? 490.162 -26.344 683.061 1.00 109.81 ? 589  ARG C CA    1 
ATOM   8164  C  C     . ARG C 2  589  ? 490.283 -26.540 681.551 1.00 107.79 ? 589  ARG C C     1 
ATOM   8165  O  O     . ARG C 2  589  ? 491.373 -26.384 680.990 1.00 108.36 ? 589  ARG C O     1 
ATOM   8166  C  CB    . ARG C 2  589  ? 489.994 -27.672 683.787 1.00 105.97 ? 589  ARG C CB    1 
ATOM   8167  C  CG    . ARG C 2  589  ? 490.497 -28.895 683.105 1.00 107.65 ? 589  ARG C CG    1 
ATOM   8168  C  CD    . ARG C 2  589  ? 490.607 -29.892 684.205 1.00 108.08 ? 589  ARG C CD    1 
ATOM   8169  N  NE    . ARG C 2  589  ? 491.486 -29.354 685.236 1.00 112.01 ? 589  ARG C NE    1 
ATOM   8170  C  CZ    . ARG C 2  589  ? 492.092 -30.095 686.153 1.00 115.81 ? 589  ARG C CZ    1 
ATOM   8171  N  NH1   . ARG C 2  589  ? 491.909 -31.409 686.163 1.00 120.81 ? 589  ARG C NH1   1 
ATOM   8172  N  NH2   . ARG C 2  589  ? 492.885 -29.529 687.051 1.00 110.74 ? 589  ARG C NH2   1 
ATOM   8173  N  N     . ASP C 2  590  ? 489.175 -26.845 680.867 1.00 102.89 ? 590  ASP C N     1 
ATOM   8174  C  CA    . ASP C 2  590  ? 489.251 -27.011 679.418 1.00 95.91  ? 590  ASP C CA    1 
ATOM   8175  C  C     . ASP C 2  590  ? 489.452 -25.689 678.693 1.00 96.30  ? 590  ASP C C     1 
ATOM   8176  O  O     . ASP C 2  590  ? 489.998 -25.673 677.593 1.00 108.44 ? 590  ASP C O     1 
ATOM   8177  C  CB    . ASP C 2  590  ? 488.017 -27.738 678.896 1.00 96.13  ? 590  ASP C CB    1 
ATOM   8178  C  CG    . ASP C 2  590  ? 488.024 -29.220 679.249 1.00 99.73  ? 590  ASP C CG    1 
ATOM   8179  O  OD1   . ASP C 2  590  ? 488.637 -29.592 680.280 1.00 97.72  ? 590  ASP C OD1   1 
ATOM   8180  O  OD2   . ASP C 2  590  ? 487.410 -30.009 678.492 1.00 95.61  ? 590  ASP C OD2   1 
ATOM   8181  N  N     . SER C 2  591  ? 489.009 -24.579 679.265 1.00 100.67 ? 591  SER C N     1 
ATOM   8182  C  CA    . SER C 2  591  ? 489.214 -23.291 678.610 1.00 102.16 ? 591  SER C CA    1 
ATOM   8183  C  C     . SER C 2  591  ? 490.695 -22.943 678.487 1.00 107.62 ? 591  SER C C     1 
ATOM   8184  O  O     . SER C 2  591  ? 491.084 -22.230 677.555 1.00 108.33 ? 591  SER C O     1 
ATOM   8185  C  CB    . SER C 2  591  ? 488.458 -22.193 679.351 1.00 106.62 ? 591  SER C CB    1 
ATOM   8186  O  OG    . SER C 2  591  ? 489.322 -21.452 680.199 1.00 115.84 ? 591  SER C OG    1 
ATOM   8187  N  N     . LEU C 2  592  ? 491.509 -23.298 679.483 1.00 111.00 ? 592  LEU C N     1 
ATOM   8188  C  CA    . LEU C 2  592  ? 492.972 -23.105 679.473 1.00 117.53 ? 592  LEU C CA    1 
ATOM   8189  C  C     . LEU C 2  592  ? 493.335 -21.726 679.998 1.00 121.91 ? 592  LEU C C     1 
ATOM   8190  O  O     . LEU C 2  592  ? 494.509 -21.372 679.995 1.00 132.71 ? 592  LEU C O     1 
ATOM   8191  C  CB    . LEU C 2  592  ? 493.679 -23.344 678.122 1.00 103.69 ? 592  LEU C CB    1 
ATOM   8192  C  CG    . LEU C 2  592  ? 494.171 -24.779 677.894 1.00 103.54 ? 592  LEU C CG    1 
ATOM   8193  C  CD1   . LEU C 2  592  ? 493.052 -25.792 677.808 1.00 104.14 ? 592  LEU C CD1   1 
ATOM   8194  C  CD2   . LEU C 2  592  ? 495.086 -24.889 676.695 1.00 112.43 ? 592  LEU C CD2   1 
ATOM   8195  N  N     . ALA C 2  593  ? 492.357 -20.911 680.390 1.00 116.27 ? 593  ALA C N     1 
ATOM   8196  C  CA    . ALA C 2  593  ? 492.618 -19.668 681.134 1.00 120.85 ? 593  ALA C CA    1 
ATOM   8197  C  C     . ALA C 2  593  ? 493.432 -19.878 682.411 1.00 127.06 ? 593  ALA C C     1 
ATOM   8198  O  O     . ALA C 2  593  ? 494.419 -19.172 682.657 1.00 123.10 ? 593  ALA C O     1 
ATOM   8199  C  CB    . ALA C 2  593  ? 491.300 -19.002 681.479 1.00 125.14 ? 593  ALA C CB    1 
ATOM   8200  N  N     . ALA C 2  594  ? 493.056 -20.883 683.212 1.00 132.46 ? 594  ALA C N     1 
ATOM   8201  C  CA    . ALA C 2  594  ? 493.705 -21.297 684.468 1.00 122.26 ? 594  ALA C CA    1 
ATOM   8202  C  C     . ALA C 2  594  ? 494.983 -22.136 684.228 1.00 123.59 ? 594  ALA C C     1 
ATOM   8203  O  O     . ALA C 2  594  ? 495.135 -22.825 683.201 1.00 124.84 ? 594  ALA C O     1 
ATOM   8204  C  CB    . ALA C 2  594  ? 492.660 -22.095 685.270 1.00 105.04 ? 594  ALA C CB    1 
ATOM   8205  N  N     . LEU C 2  595  ? 495.894 -22.080 685.210 1.00 120.31 ? 595  LEU C N     1 
ATOM   8206  C  CA    . LEU C 2  595  ? 497.236 -22.662 685.181 1.00 118.24 ? 595  LEU C CA    1 
ATOM   8207  C  C     . LEU C 2  595  ? 497.309 -23.825 686.164 1.00 119.12 ? 595  LEU C C     1 
ATOM   8208  O  O     . LEU C 2  595  ? 496.792 -23.712 687.289 1.00 118.57 ? 595  LEU C O     1 
ATOM   8209  C  CB    . LEU C 2  595  ? 498.237 -21.584 685.597 1.00 113.62 ? 595  LEU C CB    1 
ATOM   8210  C  CG    . LEU C 2  595  ? 499.631 -21.977 685.262 1.00 116.91 ? 595  LEU C CG    1 
ATOM   8211  C  CD1   . LEU C 2  595  ? 499.642 -21.975 683.790 1.00 124.12 ? 595  LEU C CD1   1 
ATOM   8212  C  CD2   . LEU C 2  595  ? 500.462 -20.808 685.756 1.00 117.11 ? 595  LEU C CD2   1 
ATOM   8213  N  N     . TYR C 2  596  ? 497.835 -24.992 685.727 1.00 122.49 ? 596  TYR C N     1 
ATOM   8214  C  CA    . TYR C 2  596  ? 497.908 -26.203 686.563 1.00 122.77 ? 596  TYR C CA    1 
ATOM   8215  C  C     . TYR C 2  596  ? 499.329 -26.752 686.635 1.00 131.50 ? 596  TYR C C     1 
ATOM   8216  O  O     . TYR C 2  596  ? 500.213 -26.375 685.856 1.00 136.41 ? 596  TYR C O     1 
ATOM   8217  C  CB    . TYR C 2  596  ? 496.967 -27.329 686.084 1.00 124.81 ? 596  TYR C CB    1 
ATOM   8218  C  CG    . TYR C 2  596  ? 495.530 -26.892 686.027 1.00 126.32 ? 596  TYR C CG    1 
ATOM   8219  C  CD1   . TYR C 2  596  ? 495.017 -26.306 684.901 1.00 128.09 ? 596  TYR C CD1   1 
ATOM   8220  C  CD2   . TYR C 2  596  ? 494.688 -27.028 687.146 1.00 119.57 ? 596  TYR C CD2   1 
ATOM   8221  C  CE1   . TYR C 2  596  ? 493.724 -25.863 684.850 1.00 121.87 ? 596  TYR C CE1   1 
ATOM   8222  C  CE2   . TYR C 2  596  ? 493.388 -26.585 687.093 1.00 110.89 ? 596  TYR C CE2   1 
ATOM   8223  C  CZ    . TYR C 2  596  ? 492.919 -26.005 685.934 1.00 111.65 ? 596  TYR C CZ    1 
ATOM   8224  O  OH    . TYR C 2  596  ? 491.643 -25.543 685.825 1.00 108.00 ? 596  TYR C OH    1 
ATOM   8225  N  N     . ALA C 2  597  ? 499.567 -27.598 687.651 1.00 131.40 ? 597  ALA C N     1 
ATOM   8226  C  CA    . ALA C 2  597  ? 500.893 -28.191 687.853 1.00 140.71 ? 597  ALA C CA    1 
ATOM   8227  C  C     . ALA C 2  597  ? 501.099 -29.457 686.998 1.00 147.93 ? 597  ALA C C     1 
ATOM   8228  O  O     . ALA C 2  597  ? 500.310 -30.413 687.075 1.00 143.59 ? 597  ALA C O     1 
ATOM   8229  C  CB    . ALA C 2  597  ? 501.105 -28.532 689.325 1.00 139.57 ? 597  ALA C CB    1 
ATOM   8230  N  N     . GLU C 2  598  ? 502.226 -29.505 686.263 1.00 148.59 ? 598  GLU C N     1 
ATOM   8231  C  CA    . GLU C 2  598  ? 502.520 -30.633 685.372 1.00 149.63 ? 598  GLU C CA    1 
ATOM   8232  C  C     . GLU C 2  598  ? 502.719 -31.936 686.140 1.00 153.59 ? 598  GLU C C     1 
ATOM   8233  O  O     . GLU C 2  598  ? 502.084 -32.948 685.827 1.00 155.42 ? 598  GLU C O     1 
ATOM   8234  C  CB    . GLU C 2  598  ? 503.694 -30.323 684.437 1.00 155.68 ? 598  GLU C CB    1 
ATOM   8235  C  CG    . GLU C 2  598  ? 503.330 -29.255 683.383 1.00 156.09 ? 598  GLU C CG    1 
ATOM   8236  C  CD    . GLU C 2  598  ? 504.424 -28.990 682.351 1.00 155.69 ? 598  GLU C CD    1 
ATOM   8237  O  OE1   . GLU C 2  598  ? 505.158 -29.942 682.005 1.00 156.54 ? 598  GLU C OE1   1 
ATOM   8238  O  OE2   . GLU C 2  598  ? 504.516 -27.842 681.856 1.00 150.43 ? 598  GLU C OE2   1 
ATOM   8239  N  N     . GLU C 2  599  ? 503.645 -31.960 687.096 1.00 156.41 ? 599  GLU C N     1 
ATOM   8240  C  CA    . GLU C 2  599  ? 503.871 -33.154 687.906 1.00 160.86 ? 599  GLU C CA    1 
ATOM   8241  C  C     . GLU C 2  599  ? 503.758 -32.773 689.375 1.00 157.88 ? 599  GLU C C     1 
ATOM   8242  O  O     . GLU C 2  599  ? 503.511 -31.616 689.719 1.00 155.71 ? 599  GLU C O     1 
ATOM   8243  C  CB    . GLU C 2  599  ? 505.259 -33.769 687.645 1.00 168.22 ? 599  GLU C CB    1 
ATOM   8244  C  CG    . GLU C 2  599  ? 505.304 -35.300 687.540 1.00 171.56 ? 599  GLU C CG    1 
ATOM   8245  C  CD    . GLU C 2  599  ? 504.808 -35.837 686.214 1.00 168.71 ? 599  GLU C CD    1 
ATOM   8246  O  OE1   . GLU C 2  599  ? 505.015 -35.159 685.183 1.00 169.62 ? 599  GLU C OE1   1 
ATOM   8247  O  OE2   . GLU C 2  599  ? 504.196 -36.929 686.212 1.00 166.16 ? 599  GLU C OE2   1 
ATOM   8248  N  N     . ASP C 2  600  ? 503.948 -33.755 690.252 1.00 158.39 ? 600  ASP C N     1 
ATOM   8249  C  CA    . ASP C 2  600  ? 503.997 -33.472 691.680 1.00 159.88 ? 600  ASP C CA    1 
ATOM   8250  C  C     . ASP C 2  600  ? 505.235 -32.635 691.981 1.00 163.24 ? 600  ASP C C     1 
ATOM   8251  O  O     . ASP C 2  600  ? 506.238 -32.705 691.265 1.00 167.89 ? 600  ASP C O     1 
ATOM   8252  C  CB    . ASP C 2  600  ? 503.996 -34.772 692.484 1.00 162.04 ? 600  ASP C CB    1 
ATOM   8253  C  CG    . ASP C 2  600  ? 502.736 -35.599 692.248 1.00 159.43 ? 600  ASP C CG    1 
ATOM   8254  O  OD1   . ASP C 2  600  ? 501.837 -35.600 693.118 1.00 151.81 ? 600  ASP C OD1   1 
ATOM   8255  O  OD2   . ASP C 2  600  ? 502.654 -36.258 691.185 1.00 163.84 ? 600  ASP C OD2   1 
ATOM   8256  N  N     . GLY C 2  601  ? 505.172 -31.825 693.030 1.00 155.97 ? 601  GLY C N     1 
ATOM   8257  C  CA    . GLY C 2  601  ? 506.322 -30.990 693.312 1.00 155.41 ? 601  GLY C CA    1 
ATOM   8258  C  C     . GLY C 2  601  ? 506.087 -30.043 694.463 1.00 149.61 ? 601  GLY C C     1 
ATOM   8259  O  O     . GLY C 2  601  ? 505.095 -30.131 695.187 1.00 147.11 ? 601  GLY C O     1 
ATOM   8260  N  N     . GLU C 2  602  ? 507.031 -29.120 694.604 1.00 146.80 ? 602  GLU C N     1 
ATOM   8261  C  CA    . GLU C 2  602  ? 507.009 -28.096 695.632 1.00 142.97 ? 602  GLU C CA    1 
ATOM   8262  C  C     . GLU C 2  602  ? 507.179 -26.746 694.971 1.00 138.94 ? 602  GLU C C     1 
ATOM   8263  O  O     . GLU C 2  602  ? 507.971 -26.597 694.040 1.00 141.44 ? 602  GLU C O     1 
ATOM   8264  C  CB    . GLU C 2  602  ? 508.109 -28.297 696.687 1.00 149.57 ? 602  GLU C CB    1 
ATOM   8265  C  CG    . GLU C 2  602  ? 508.029 -27.263 697.820 1.00 150.52 ? 602  GLU C CG    1 
ATOM   8266  C  CD    . GLU C 2  602  ? 509.122 -27.389 698.867 1.00 150.39 ? 602  GLU C CD    1 
ATOM   8267  O  OE1   . GLU C 2  602  ? 509.483 -28.534 699.219 1.00 156.69 ? 602  GLU C OE1   1 
ATOM   8268  O  OE2   . GLU C 2  602  ? 509.630 -26.335 699.315 1.00 143.06 ? 602  GLU C OE2   1 
ATOM   8269  N  N     . VAL C 2  603  ? 506.453 -25.760 695.477 1.00 136.49 ? 603  VAL C N     1 
ATOM   8270  C  CA    . VAL C 2  603  ? 506.473 -24.431 694.885 1.00 138.57 ? 603  VAL C CA    1 
ATOM   8271  C  C     . VAL C 2  603  ? 507.739 -23.734 695.353 1.00 132.18 ? 603  VAL C C     1 
ATOM   8272  O  O     . VAL C 2  603  ? 507.951 -23.531 696.552 1.00 132.02 ? 603  VAL C O     1 
ATOM   8273  C  CB    . VAL C 2  603  ? 505.222 -23.631 695.274 1.00 138.81 ? 603  VAL C CB    1 
ATOM   8274  C  CG1   . VAL C 2  603  ? 505.323 -22.216 694.726 1.00 136.60 ? 603  VAL C CG1   1 
ATOM   8275  C  CG2   . VAL C 2  603  ? 503.946 -24.336 694.782 1.00 133.31 ? 603  VAL C CG2   1 
ATOM   8276  N  N     . ALA C 2  604  ? 508.602 -23.402 694.407 1.00 128.70 ? 604  ALA C N     1 
ATOM   8277  C  CA    . ALA C 2  604  ? 509.840 -22.726 694.756 1.00 134.18 ? 604  ALA C CA    1 
ATOM   8278  C  C     . ALA C 2  604  ? 509.658 -21.224 694.914 1.00 133.75 ? 604  ALA C C     1 
ATOM   8279  O  O     . ALA C 2  604  ? 510.084 -20.640 695.917 1.00 134.13 ? 604  ALA C O     1 
ATOM   8280  C  CB    . ALA C 2  604  ? 510.906 -23.024 693.699 1.00 138.31 ? 604  ALA C CB    1 
ATOM   8281  N  N     . LYS C 2  605  ? 508.966 -20.591 693.978 1.00 133.16 ? 605  LYS C N     1 
ATOM   8282  C  CA    . LYS C 2  605  ? 508.875 -19.142 693.976 1.00 133.24 ? 605  LYS C CA    1 
ATOM   8283  C  C     . LYS C 2  605  ? 507.469 -18.728 693.559 1.00 130.12 ? 605  LYS C C     1 
ATOM   8284  O  O     . LYS C 2  605  ? 506.821 -19.435 692.784 1.00 128.52 ? 605  LYS C O     1 
ATOM   8285  C  CB    . LYS C 2  605  ? 509.923 -18.585 692.987 1.00 134.54 ? 605  LYS C CB    1 
ATOM   8286  C  CG    . LYS C 2  605  ? 511.410 -18.736 693.391 1.00 132.51 ? 605  LYS C CG    1 
ATOM   8287  C  CD    . LYS C 2  605  ? 511.918 -17.641 694.347 1.00 142.43 ? 605  LYS C CD    1 
ATOM   8288  C  CE    . LYS C 2  605  ? 513.382 -17.861 694.777 1.00 142.05 ? 605  LYS C CE    1 
ATOM   8289  N  NZ    . LYS C 2  605  ? 513.899 -16.842 695.754 1.00 134.21 ? 605  LYS C NZ    1 
ATOM   8290  N  N     . VAL C 2  606  ? 506.954 -17.641 694.142 1.00 129.97 ? 606  VAL C N     1 
ATOM   8291  C  CA    . VAL C 2  606  ? 505.662 -17.085 693.737 1.00 125.74 ? 606  VAL C CA    1 
ATOM   8292  C  C     . VAL C 2  606  ? 505.757 -15.567 693.625 1.00 124.84 ? 606  VAL C C     1 
ATOM   8293  O  O     . VAL C 2  606  ? 506.061 -14.888 694.608 1.00 123.51 ? 606  VAL C O     1 
ATOM   8294  C  CB    . VAL C 2  606  ? 504.528 -17.476 694.688 1.00 127.46 ? 606  VAL C CB    1 
ATOM   8295  C  CG1   . VAL C 2  606  ? 503.294 -16.653 694.370 1.00 124.10 ? 606  VAL C CG1   1 
ATOM   8296  C  CG2   . VAL C 2  606  ? 504.230 -18.943 694.535 1.00 126.30 ? 606  VAL C CG2   1 
ATOM   8297  N  N     . ASP C 2  607  ? 505.407 -15.035 692.460 1.00 128.82 ? 607  ASP C N     1 
ATOM   8298  C  CA    . ASP C 2  607  ? 505.520 -13.624 692.104 1.00 128.44 ? 607  ASP C CA    1 
ATOM   8299  C  C     . ASP C 2  607  ? 504.223 -13.119 691.489 1.00 121.24 ? 607  ASP C C     1 
ATOM   8300  O  O     . ASP C 2  607  ? 503.337 -13.896 691.118 1.00 117.49 ? 607  ASP C O     1 
ATOM   8301  C  CB    . ASP C 2  607  ? 506.650 -13.421 691.071 1.00 129.17 ? 607  ASP C CB    1 
ATOM   8302  C  CG    . ASP C 2  607  ? 507.343 -12.087 691.192 1.00 128.67 ? 607  ASP C CG    1 
ATOM   8303  O  OD1   . ASP C 2  607  ? 507.242 -11.448 692.256 1.00 128.28 ? 607  ASP C OD1   1 
ATOM   8304  O  OD2   . ASP C 2  607  ? 507.961 -11.668 690.185 1.00 128.21 ? 607  ASP C OD2   1 
ATOM   8305  N  N     . GLY C 2  608  ? 504.128 -11.792 691.368 1.00 120.34 ? 608  GLY C N     1 
ATOM   8306  C  CA    . GLY C 2  608  ? 503.046 -11.219 690.583 1.00 118.26 ? 608  GLY C CA    1 
ATOM   8307  C  C     . GLY C 2  608  ? 503.190 -11.567 689.113 1.00 114.35 ? 608  GLY C C     1 
ATOM   8308  O  O     . GLY C 2  608  ? 502.199 -11.817 688.416 1.00 107.93 ? 608  GLY C O     1 
ATOM   8309  N  N     . ASN C 2  609  ? 504.436 -11.585 688.625 1.00 117.95 ? 609  ASN C N     1 
ATOM   8310  C  CA    . ASN C 2  609  ? 504.764 -11.872 687.238 1.00 109.39 ? 609  ASN C CA    1 
ATOM   8311  C  C     . ASN C 2  609  ? 505.029 -13.348 686.956 1.00 110.73 ? 609  ASN C C     1 
ATOM   8312  O  O     . ASN C 2  609  ? 504.903 -13.751 685.800 1.00 114.32 ? 609  ASN C O     1 
ATOM   8313  C  CB    . ASN C 2  609  ? 505.923 -10.976 686.769 1.00 104.90 ? 609  ASN C CB    1 
ATOM   8314  C  CG    . ASN C 2  609  ? 505.703 -9.478  687.098 1.00 100.51 ? 609  ASN C CG    1 
ATOM   8315  O  OD1   . ASN C 2  609  ? 504.589 -8.999  687.026 1.00 98.51  ? 609  ASN C OD1   1 
ATOM   8316  N  ND2   . ASN C 2  609  ? 506.759 -8.757  687.452 1.00 101.49 ? 609  ASN C ND2   1 
ATOM   8317  N  N     . ARG C 2  610  ? 505.354 -14.179 687.950 1.00 112.10 ? 610  ARG C N     1 
ATOM   8318  C  CA    . ARG C 2  610  ? 505.723 -15.554 687.612 1.00 116.13 ? 610  ARG C CA    1 
ATOM   8319  C  C     . ARG C 2  610  ? 505.623 -16.495 688.800 1.00 119.77 ? 610  ARG C C     1 
ATOM   8320  O  O     . ARG C 2  610  ? 505.693 -16.076 689.952 1.00 124.24 ? 610  ARG C O     1 
ATOM   8321  C  CB    . ARG C 2  610  ? 507.144 -15.640 687.078 1.00 126.16 ? 610  ARG C CB    1 
ATOM   8322  C  CG    . ARG C 2  610  ? 508.210 -15.021 687.983 1.00 129.20 ? 610  ARG C CG    1 
ATOM   8323  C  CD    . ARG C 2  610  ? 509.019 -16.092 688.702 1.00 128.11 ? 610  ARG C CD    1 
ATOM   8324  N  NE    . ARG C 2  610  ? 510.025 -15.506 689.581 1.00 130.28 ? 610  ARG C NE    1 
ATOM   8325  C  CZ    . ARG C 2  610  ? 509.909 -15.352 690.892 1.00 132.48 ? 610  ARG C CZ    1 
ATOM   8326  N  NH1   . ARG C 2  610  ? 508.812 -15.745 691.529 1.00 129.66 ? 610  ARG C NH1   1 
ATOM   8327  N  NH2   . ARG C 2  610  ? 510.913 -14.807 691.566 1.00 134.29 ? 610  ARG C NH2   1 
ATOM   8328  N  N     . ILE C 2  611  ? 505.542 -17.793 688.490 1.00 119.64 ? 611  ILE C N     1 
ATOM   8329  C  CA    . ILE C 2  611  ? 505.526 -18.876 689.478 1.00 124.26 ? 611  ILE C CA    1 
ATOM   8330  C  C     . ILE C 2  611  ? 506.520 -19.938 689.035 1.00 125.23 ? 611  ILE C C     1 
ATOM   8331  O  O     . ILE C 2  611  ? 506.370 -20.508 687.951 1.00 128.06 ? 611  ILE C O     1 
ATOM   8332  C  CB    . ILE C 2  611  ? 504.126 -19.503 689.659 1.00 121.03 ? 611  ILE C CB    1 
ATOM   8333  C  CG1   . ILE C 2  611  ? 503.121 -18.484 690.196 1.00 121.90 ? 611  ILE C CG1   1 
ATOM   8334  C  CG2   . ILE C 2  611  ? 504.167 -20.721 690.585 1.00 121.64 ? 611  ILE C CG2   1 
ATOM   8335  C  CD1   . ILE C 2  611  ? 501.702 -19.001 690.233 1.00 118.27 ? 611  ILE C CD1   1 
ATOM   8336  N  N     . VAL C 2  612  ? 507.493 -20.242 689.894 1.00 130.01 ? 612  VAL C N     1 
ATOM   8337  C  CA    . VAL C 2  612  ? 508.511 -21.266 689.664 1.00 129.64 ? 612  VAL C CA    1 
ATOM   8338  C  C     . VAL C 2  612  ? 508.238 -22.493 690.531 1.00 135.61 ? 612  VAL C C     1 
ATOM   8339  O  O     . VAL C 2  612  ? 508.044 -22.368 691.748 1.00 140.41 ? 612  VAL C O     1 
ATOM   8340  C  CB    . VAL C 2  612  ? 509.911 -20.719 689.962 1.00 128.95 ? 612  VAL C CB    1 
ATOM   8341  C  CG1   . VAL C 2  612  ? 510.947 -21.777 689.635 1.00 135.50 ? 612  VAL C CG1   1 
ATOM   8342  C  CG2   . VAL C 2  612  ? 510.124 -19.408 689.240 1.00 125.43 ? 612  VAL C CG2   1 
ATOM   8343  N  N     . VAL C 2  613  ? 508.183 -23.672 689.910 1.00 135.24 ? 613  VAL C N     1 
ATOM   8344  C  CA    . VAL C 2  613  ? 507.861 -24.916 690.605 1.00 140.46 ? 613  VAL C CA    1 
ATOM   8345  C  C     . VAL C 2  613  ? 509.025 -25.891 690.477 1.00 146.09 ? 613  VAL C C     1 
ATOM   8346  O  O     . VAL C 2  613  ? 509.556 -26.091 689.380 1.00 149.79 ? 613  VAL C O     1 
ATOM   8347  C  CB    . VAL C 2  613  ? 506.571 -25.551 690.067 1.00 137.06 ? 613  VAL C CB    1 
ATOM   8348  C  CG1   . VAL C 2  613  ? 506.327 -26.870 690.752 1.00 139.03 ? 613  VAL C CG1   1 
ATOM   8349  C  CG2   . VAL C 2  613  ? 505.425 -24.621 690.322 1.00 136.41 ? 613  VAL C CG2   1 
ATOM   8350  N  N     . ARG C 2  614  ? 509.424 -26.490 691.600 1.00 145.86 ? 614  ARG C N     1 
ATOM   8351  C  CA    . ARG C 2  614  ? 510.417 -27.560 691.620 1.00 152.14 ? 614  ARG C CA    1 
ATOM   8352  C  C     . ARG C 2  614  ? 509.693 -28.902 691.702 1.00 156.22 ? 614  ARG C C     1 
ATOM   8353  O  O     . ARG C 2  614  ? 509.065 -29.212 692.721 1.00 155.73 ? 614  ARG C O     1 
ATOM   8354  C  CB    . ARG C 2  614  ? 511.370 -27.377 692.801 1.00 155.82 ? 614  ARG C CB    1 
ATOM   8355  C  CG    . ARG C 2  614  ? 512.269 -28.574 693.114 1.00 160.55 ? 614  ARG C CG    1 
ATOM   8356  C  CD    . ARG C 2  614  ? 513.200 -28.915 691.949 1.00 166.17 ? 614  ARG C CD    1 
ATOM   8357  N  NE    . ARG C 2  614  ? 514.254 -27.918 691.777 1.00 163.12 ? 614  ARG C NE    1 
ATOM   8358  C  CZ    . ARG C 2  614  ? 515.361 -27.866 692.509 1.00 164.51 ? 614  ARG C CZ    1 
ATOM   8359  N  NH1   . ARG C 2  614  ? 516.263 -26.921 692.281 1.00 158.32 ? 614  ARG C NH1   1 
ATOM   8360  N  NH2   . ARG C 2  614  ? 515.566 -28.757 693.470 1.00 167.86 ? 614  ARG C NH2   1 
ATOM   8361  N  N     . TYR C 2  615  ? 509.777 -29.700 690.636 1.00 159.42 ? 615  TYR C N     1 
ATOM   8362  C  CA    . TYR C 2  615  ? 509.066 -30.971 690.609 1.00 166.39 ? 615  TYR C CA    1 
ATOM   8363  C  C     . TYR C 2  615  ? 509.901 -32.094 691.218 1.00 173.96 ? 615  TYR C C     1 
ATOM   8364  O  O     . TYR C 2  615  ? 511.006 -31.893 691.730 1.00 175.37 ? 615  TYR C O     1 
ATOM   8365  C  CB    . TYR C 2  615  ? 508.678 -31.376 689.181 1.00 167.54 ? 615  TYR C CB    1 
ATOM   8366  C  CG    . TYR C 2  615  ? 507.550 -30.586 688.559 1.00 164.66 ? 615  TYR C CG    1 
ATOM   8367  C  CD1   . TYR C 2  615  ? 506.474 -30.152 689.333 1.00 163.86 ? 615  TYR C CD1   1 
ATOM   8368  C  CD2   . TYR C 2  615  ? 507.533 -30.311 687.194 1.00 162.33 ? 615  TYR C CD2   1 
ATOM   8369  C  CE1   . TYR C 2  615  ? 505.427 -29.438 688.777 1.00 156.96 ? 615  TYR C CE1   1 
ATOM   8370  C  CE2   . TYR C 2  615  ? 506.484 -29.592 686.624 1.00 160.98 ? 615  TYR C CE2   1 
ATOM   8371  C  CZ    . TYR C 2  615  ? 505.430 -29.159 687.428 1.00 158.27 ? 615  TYR C CZ    1 
ATOM   8372  O  OH    . TYR C 2  615  ? 504.374 -28.444 686.899 1.00 152.09 ? 615  TYR C OH    1 
ATOM   8373  N  N     . GLU C 2  616  ? 509.324 -33.299 691.198 1.00 177.97 ? 616  GLU C N     1 
ATOM   8374  C  CA    . GLU C 2  616  ? 510.047 -34.485 691.639 1.00 183.13 ? 616  GLU C CA    1 
ATOM   8375  C  C     . GLU C 2  616  ? 511.229 -34.762 690.708 1.00 183.93 ? 616  GLU C C     1 
ATOM   8376  O  O     . GLU C 2  616  ? 512.284 -35.230 691.156 1.00 181.23 ? 616  GLU C O     1 
ATOM   8377  C  CB    . GLU C 2  616  ? 509.076 -35.666 691.759 1.00 185.32 ? 616  GLU C CB    1 
ATOM   8378  C  CG    . GLU C 2  616  ? 508.370 -36.088 690.476 1.00 185.13 ? 616  GLU C CG    1 
ATOM   8379  C  CD    . GLU C 2  616  ? 507.804 -37.496 690.562 1.00 190.20 ? 616  GLU C CD    1 
ATOM   8380  O  OE1   . GLU C 2  616  ? 507.391 -37.903 691.675 1.00 191.58 ? 616  GLU C OE1   1 
ATOM   8381  O  OE2   . GLU C 2  616  ? 507.754 -38.185 689.517 1.00 184.79 ? 616  GLU C OE2   1 
ATOM   8382  N  N     . ASP C 2  617  ? 511.061 -34.487 689.402 1.00 187.48 ? 617  ASP C N     1 
ATOM   8383  C  CA    . ASP C 2  617  ? 512.122 -34.710 688.416 1.00 185.97 ? 617  ASP C CA    1 
ATOM   8384  C  C     . ASP C 2  617  ? 513.374 -33.905 688.742 1.00 182.42 ? 617  ASP C C     1 
ATOM   8385  O  O     . ASP C 2  617  ? 514.454 -34.218 688.229 1.00 181.21 ? 617  ASP C O     1 
ATOM   8386  C  CB    . ASP C 2  617  ? 511.694 -34.358 686.970 1.00 178.71 ? 617  ASP C CB    1 
ATOM   8387  C  CG    . ASP C 2  617  ? 510.188 -34.474 686.719 1.00 182.32 ? 617  ASP C CG    1 
ATOM   8388  O  OD1   . ASP C 2  617  ? 509.465 -35.094 687.529 1.00 188.25 ? 617  ASP C OD1   1 
ATOM   8389  O  OD2   . ASP C 2  617  ? 509.733 -33.963 685.670 1.00 174.87 ? 617  ASP C OD2   1 
ATOM   8390  N  N     . GLY C 2  618  ? 513.244 -32.860 689.562 1.00 178.31 ? 618  GLY C N     1 
ATOM   8391  C  CA    . GLY C 2  618  ? 514.326 -31.965 689.880 1.00 174.18 ? 618  GLY C CA    1 
ATOM   8392  C  C     . GLY C 2  618  ? 514.345 -30.729 689.008 1.00 171.97 ? 618  GLY C C     1 
ATOM   8393  O  O     . GLY C 2  618  ? 514.955 -29.723 689.390 1.00 168.99 ? 618  GLY C O     1 
ATOM   8394  N  N     . ARG C 2  619  ? 513.677 -30.782 687.857 1.00 168.89 ? 619  ARG C N     1 
ATOM   8395  C  CA    . ARG C 2  619  ? 513.617 -29.649 686.946 1.00 164.30 ? 619  ARG C CA    1 
ATOM   8396  C  C     . ARG C 2  619  ? 512.826 -28.505 687.575 1.00 163.23 ? 619  ARG C C     1 
ATOM   8397  O  O     . ARG C 2  619  ? 511.795 -28.713 688.224 1.00 162.03 ? 619  ARG C O     1 
ATOM   8398  C  CB    . ARG C 2  619  ? 513.036 -30.132 685.613 1.00 163.55 ? 619  ARG C CB    1 
ATOM   8399  C  CG    . ARG C 2  619  ? 511.683 -30.824 685.737 1.00 166.65 ? 619  ARG C CG    1 
ATOM   8400  C  CD    . ARG C 2  619  ? 511.283 -31.512 684.428 1.00 166.99 ? 619  ARG C CD    1 
ATOM   8401  N  NE    . ARG C 2  619  ? 509.912 -32.025 684.443 1.00 167.18 ? 619  ARG C NE    1 
ATOM   8402  C  CZ    . ARG C 2  619  ? 508.863 -31.432 683.887 1.00 167.96 ? 619  ARG C CZ    1 
ATOM   8403  N  NH1   . ARG C 2  619  ? 507.662 -31.996 683.975 1.00 166.03 ? 619  ARG C NH1   1 
ATOM   8404  N  NH2   . ARG C 2  619  ? 509.020 -30.318 683.186 1.00 165.27 ? 619  ARG C NH2   1 
ATOM   8405  N  N     . LEU C 2  620  ? 513.333 -27.290 687.383 1.00 159.76 ? 620  LEU C N     1 
ATOM   8406  C  CA    . LEU C 2  620  ? 512.766 -26.076 687.973 1.00 151.91 ? 620  LEU C CA    1 
ATOM   8407  C  C     . LEU C 2  620  ? 511.936 -25.298 686.951 1.00 149.51 ? 620  LEU C C     1 
ATOM   8408  O  O     . LEU C 2  620  ? 512.277 -24.181 686.555 1.00 147.79 ? 620  LEU C O     1 
ATOM   8409  C  CB    . LEU C 2  620  ? 513.893 -25.213 688.536 1.00 148.62 ? 620  LEU C CB    1 
ATOM   8410  C  CG    . LEU C 2  620  ? 513.660 -24.221 689.669 1.00 149.53 ? 620  LEU C CG    1 
ATOM   8411  C  CD1   . LEU C 2  620  ? 513.297 -24.953 690.944 1.00 153.95 ? 620  LEU C CD1   1 
ATOM   8412  C  CD2   . LEU C 2  620  ? 514.888 -23.357 689.885 1.00 148.30 ? 620  LEU C CD2   1 
ATOM   8413  N  N     . VAL C 2  621  ? 510.822 -25.912 686.535 1.00 149.26 ? 621  VAL C N     1 
ATOM   8414  C  CA    . VAL C 2  621  ? 509.954 -25.337 685.508 1.00 140.22 ? 621  VAL C CA    1 
ATOM   8415  C  C     . VAL C 2  621  ? 509.447 -23.978 685.966 1.00 136.16 ? 621  VAL C C     1 
ATOM   8416  O  O     . VAL C 2  621  ? 508.973 -23.832 687.099 1.00 142.00 ? 621  VAL C O     1 
ATOM   8417  C  CB    . VAL C 2  621  ? 508.776 -26.277 685.223 1.00 139.45 ? 621  VAL C CB    1 
ATOM   8418  C  CG1   . VAL C 2  621  ? 507.912 -25.709 684.097 1.00 136.35 ? 621  VAL C CG1   1 
ATOM   8419  C  CG2   . VAL C 2  621  ? 509.263 -27.683 684.953 1.00 149.47 ? 621  VAL C CG2   1 
ATOM   8420  N  N     . GLU C 2  622  ? 509.544 -22.973 685.100 1.00 127.52 ? 622  GLU C N     1 
ATOM   8421  C  CA    . GLU C 2  622  ? 509.075 -21.629 685.428 1.00 123.55 ? 622  GLU C CA    1 
ATOM   8422  C  C     . GLU C 2  622  ? 507.833 -21.329 684.596 1.00 127.68 ? 622  GLU C C     1 
ATOM   8423  O  O     . GLU C 2  622  ? 507.870 -21.434 683.364 1.00 131.96 ? 622  GLU C O     1 
ATOM   8424  C  CB    . GLU C 2  622  ? 510.145 -20.561 685.176 1.00 122.50 ? 622  GLU C CB    1 
ATOM   8425  C  CG    . GLU C 2  622  ? 509.596 -19.120 685.307 1.00 118.51 ? 622  GLU C CG    1 
ATOM   8426  C  CD    . GLU C 2  622  ? 510.663 -18.043 685.612 1.00 121.41 ? 622  GLU C CD    1 
ATOM   8427  O  OE1   . GLU C 2  622  ? 511.715 -18.374 686.211 1.00 122.36 ? 622  GLU C OE1   1 
ATOM   8428  O  OE2   . GLU C 2  622  ? 510.419 -16.845 685.315 1.00 110.92 ? 622  GLU C OE2   1 
ATOM   8429  N  N     . TYR C 2  623  ? 506.728 -20.975 685.269 1.00 126.83 ? 623  TYR C N     1 
ATOM   8430  C  CA    . TYR C 2  623  ? 505.499 -20.631 684.566 1.00 117.56 ? 623  TYR C CA    1 
ATOM   8431  C  C     . TYR C 2  623  ? 505.292 -19.131 684.649 1.00 117.80 ? 623  TYR C C     1 
ATOM   8432  O  O     . TYR C 2  623  ? 504.970 -18.615 685.729 1.00 114.64 ? 623  TYR C O     1 
ATOM   8433  C  CB    . TYR C 2  623  ? 504.290 -21.337 685.167 1.00 111.31 ? 623  TYR C CB    1 
ATOM   8434  C  CG    . TYR C 2  623  ? 504.376 -22.828 685.233 1.00 116.39 ? 623  TYR C CG    1 
ATOM   8435  C  CD1   . TYR C 2  623  ? 504.966 -23.464 686.314 1.00 122.91 ? 623  TYR C CD1   1 
ATOM   8436  C  CD2   . TYR C 2  623  ? 503.886 -23.605 684.201 1.00 124.55 ? 623  TYR C CD2   1 
ATOM   8437  C  CE1   . TYR C 2  623  ? 505.040 -24.845 686.377 1.00 131.22 ? 623  TYR C CE1   1 
ATOM   8438  C  CE2   . TYR C 2  623  ? 503.963 -24.982 684.245 1.00 133.67 ? 623  TYR C CE2   1 
ATOM   8439  C  CZ    . TYR C 2  623  ? 504.539 -25.599 685.333 1.00 136.46 ? 623  TYR C CZ    1 
ATOM   8440  O  OH    . TYR C 2  623  ? 504.599 -26.972 685.361 1.00 139.96 ? 623  TYR C OH    1 
ATOM   8441  N  N     . PRO C 2  624  ? 505.479 -18.396 683.561 1.00 123.31 ? 624  PRO C N     1 
ATOM   8442  C  CA    . PRO C 2  624  ? 505.153 -16.971 683.559 1.00 119.53 ? 624  PRO C CA    1 
ATOM   8443  C  C     . PRO C 2  624  ? 503.653 -16.797 683.471 1.00 119.30 ? 624  PRO C C     1 
ATOM   8444  O  O     . PRO C 2  624  ? 502.935 -17.653 682.947 1.00 117.99 ? 624  PRO C O     1 
ATOM   8445  C  CB    . PRO C 2  624  ? 505.844 -16.443 682.303 1.00 110.31 ? 624  PRO C CB    1 
ATOM   8446  C  CG    . PRO C 2  624  ? 505.805 -17.618 681.390 1.00 122.68 ? 624  PRO C CG    1 
ATOM   8447  C  CD    . PRO C 2  624  ? 505.991 -18.840 682.254 1.00 122.30 ? 624  PRO C CD    1 
ATOM   8448  N  N     . LEU C 2  625  ? 503.176 -15.700 684.044 1.00 116.96 ? 625  LEU C N     1 
ATOM   8449  C  CA    . LEU C 2  625  ? 501.752 -15.439 684.103 1.00 113.39 ? 625  LEU C CA    1 
ATOM   8450  C  C     . LEU C 2  625  ? 501.407 -14.285 683.175 1.00 115.66 ? 625  LEU C C     1 
ATOM   8451  O  O     . LEU C 2  625  ? 502.097 -13.257 683.160 1.00 114.57 ? 625  LEU C O     1 
ATOM   8452  C  CB    . LEU C 2  625  ? 501.340 -15.066 685.527 1.00 115.61 ? 625  LEU C CB    1 
ATOM   8453  C  CG    . LEU C 2  625  ? 501.595 -16.029 686.678 1.00 113.41 ? 625  LEU C CG    1 
ATOM   8454  C  CD1   . LEU C 2  625  ? 501.217 -15.351 687.966 1.00 112.46 ? 625  LEU C CD1   1 
ATOM   8455  C  CD2   . LEU C 2  625  ? 500.784 -17.283 686.480 1.00 109.32 ? 625  LEU C CD2   1 
ATOM   8456  N  N     . ARG C 2  626  ? 500.304 -14.442 682.446 1.00 111.61 ? 626  ARG C N     1 
ATOM   8457  C  CA    . ARG C 2  626  ? 499.832 -13.392 681.562 1.00 110.82 ? 626  ARG C CA    1 
ATOM   8458  C  C     . ARG C 2  626  ? 499.121 -12.363 682.422 1.00 116.85 ? 626  ARG C C     1 
ATOM   8459  O  O     . ARG C 2  626  ? 498.147 -12.696 683.104 1.00 119.52 ? 626  ARG C O     1 
ATOM   8460  C  CB    . ARG C 2  626  ? 498.900 -13.948 680.489 1.00 113.83 ? 626  ARG C CB    1 
ATOM   8461  C  CG    . ARG C 2  626  ? 498.423 -12.899 679.478 1.00 115.45 ? 626  ARG C CG    1 
ATOM   8462  C  CD    . ARG C 2  626  ? 497.687 -13.507 678.278 1.00 121.17 ? 626  ARG C CD    1 
ATOM   8463  N  NE    . ARG C 2  626  ? 498.552 -14.331 677.427 1.00 129.21 ? 626  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C 2  626  ? 498.483 -15.657 677.316 1.00 127.44 ? 626  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C 2  626  ? 497.572 -16.342 677.994 1.00 126.76 ? 626  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C 2  626  ? 499.319 -16.301 676.510 1.00 129.88 ? 626  ARG C NH2   1 
ATOM   8467  N  N     . ARG C 2  627  ? 499.599 -11.120 682.396 1.00 118.34 ? 627  ARG C N     1 
ATOM   8468  C  CA    . ARG C 2  627  ? 499.092 -10.048 683.251 1.00 116.67 ? 627  ARG C CA    1 
ATOM   8469  C  C     . ARG C 2  627  ? 498.574 -8.907  682.384 1.00 113.65 ? 627  ARG C C     1 
ATOM   8470  O  O     . ARG C 2  627  ? 499.353 -8.275  681.666 1.00 118.49 ? 627  ARG C O     1 
ATOM   8471  C  CB    . ARG C 2  627  ? 500.188 -9.526  684.190 1.00 121.39 ? 627  ARG C CB    1 
ATOM   8472  C  CG    . ARG C 2  627  ? 500.460 -10.318 685.471 1.00 118.94 ? 627  ARG C CG    1 
ATOM   8473  C  CD    . ARG C 2  627  ? 499.204 -10.824 686.103 1.00 114.82 ? 627  ARG C CD    1 
ATOM   8474  N  NE    . ARG C 2  627  ? 499.291 -10.963 687.561 1.00 117.89 ? 627  ARG C NE    1 
ATOM   8475  C  CZ    . ARG C 2  627  ? 498.385 -10.497 688.432 1.00 121.98 ? 627  ARG C CZ    1 
ATOM   8476  N  NH1   . ARG C 2  627  ? 497.310 -9.848  688.004 1.00 121.72 ? 627  ARG C NH1   1 
ATOM   8477  N  NH2   . ARG C 2  627  ? 498.528 -10.692 689.745 1.00 119.64 ? 627  ARG C NH2   1 
ATOM   8478  N  N     . PHE C 2  628  ? 497.298 -8.566  682.557 1.00 109.85 ? 628  PHE C N     1 
ATOM   8479  C  CA    . PHE C 2  628  ? 496.633 -7.463  681.852 1.00 108.50 ? 628  PHE C CA    1 
ATOM   8480  C  C     . PHE C 2  628  ? 496.771 -7.468  680.325 1.00 119.17 ? 628  PHE C C     1 
ATOM   8481  O  O     . PHE C 2  628  ? 497.135 -6.456  679.717 1.00 123.12 ? 628  PHE C O     1 
ATOM   8482  C  CB    . PHE C 2  628  ? 497.130 -6.128  682.400 1.00 106.24 ? 628  PHE C CB    1 
ATOM   8483  C  CG    . PHE C 2  628  ? 496.991 -5.997  683.894 1.00 122.51 ? 628  PHE C CG    1 
ATOM   8484  C  CD1   . PHE C 2  628  ? 495.813 -5.521  684.460 1.00 110.19 ? 628  PHE C CD1   1 
ATOM   8485  C  CD2   . PHE C 2  628  ? 498.037 -6.362  684.742 1.00 125.90 ? 628  PHE C CD2   1 
ATOM   8486  C  CE1   . PHE C 2  628  ? 495.693 -5.398  685.813 1.00 106.64 ? 628  PHE C CE1   1 
ATOM   8487  C  CE2   . PHE C 2  628  ? 497.906 -6.241  686.117 1.00 117.29 ? 628  PHE C CE2   1 
ATOM   8488  C  CZ    . PHE C 2  628  ? 496.734 -5.760  686.647 1.00 108.74 ? 628  PHE C CZ    1 
ATOM   8489  N  N     . TYR C 2  629  ? 496.437 -8.595  679.681 1.00 118.07 ? 629  TYR C N     1 
ATOM   8490  C  CA    . TYR C 2  629  ? 496.493 -8.634  678.222 1.00 112.95 ? 629  TYR C CA    1 
ATOM   8491  C  C     . TYR C 2  629  ? 495.105 -8.258  677.724 1.00 107.54 ? 629  TYR C C     1 
ATOM   8492  O  O     . TYR C 2  629  ? 494.099 -8.617  678.336 1.00 107.82 ? 629  TYR C O     1 
ATOM   8493  C  CB    . TYR C 2  629  ? 496.945 -10.009 677.686 1.00 121.78 ? 629  TYR C CB    1 
ATOM   8494  C  CG    . TYR C 2  629  ? 496.758 -10.264 676.155 1.00 129.54 ? 629  TYR C CG    1 
ATOM   8495  C  CD1   . TYR C 2  629  ? 497.620 -9.702  675.207 1.00 110.85 ? 629  TYR C CD1   1 
ATOM   8496  C  CD2   . TYR C 2  629  ? 495.774 -11.147 675.680 1.00 127.09 ? 629  TYR C CD2   1 
ATOM   8497  C  CE1   . TYR C 2  629  ? 497.452 -9.961  673.858 1.00 115.14 ? 629  TYR C CE1   1 
ATOM   8498  C  CE2   . TYR C 2  629  ? 495.613 -11.412 674.317 1.00 113.16 ? 629  TYR C CE2   1 
ATOM   8499  C  CZ    . TYR C 2  629  ? 496.447 -10.819 673.419 1.00 117.23 ? 629  TYR C CZ    1 
ATOM   8500  O  OH    . TYR C 2  629  ? 496.268 -11.087 672.067 1.00 125.74 ? 629  TYR C OH    1 
ATOM   8501  N  N     . ARG C 2  630  ? 495.061 -7.533  676.611 1.00 107.21 ? 630  ARG C N     1 
ATOM   8502  C  CA    . ARG C 2  630  ? 493.821 -7.006  676.061 1.00 99.37  ? 630  ARG C CA    1 
ATOM   8503  C  C     . ARG C 2  630  ? 493.262 -8.016  675.073 1.00 101.39 ? 630  ARG C C     1 
ATOM   8504  O  O     . ARG C 2  630  ? 493.925 -8.355  674.091 1.00 108.65 ? 630  ARG C O     1 
ATOM   8505  C  CB    . ARG C 2  630  ? 494.056 -5.677  675.357 1.00 97.17  ? 630  ARG C CB    1 
ATOM   8506  C  CG    . ARG C 2  630  ? 492.832 -5.115  674.725 1.00 95.58  ? 630  ARG C CG    1 
ATOM   8507  C  CD    . ARG C 2  630  ? 493.161 -4.035  673.747 1.00 100.46 ? 630  ARG C CD    1 
ATOM   8508  N  NE    . ARG C 2  630  ? 491.949 -3.433  673.213 1.00 103.63 ? 630  ARG C NE    1 
ATOM   8509  C  CZ    . ARG C 2  630  ? 491.259 -3.910  672.190 1.00 107.84 ? 630  ARG C CZ    1 
ATOM   8510  N  NH1   . ARG C 2  630  ? 491.661 -5.009  671.569 1.00 105.80 ? 630  ARG C NH1   1 
ATOM   8511  N  NH2   . ARG C 2  630  ? 490.169 -3.277  671.788 1.00 114.41 ? 630  ARG C NH2   1 
ATOM   8512  N  N     . SER C 2  631  ? 492.067 -8.519  675.351 1.00 98.96  ? 631  SER C N     1 
ATOM   8513  C  CA    . SER C 2  631  ? 491.404 -9.467  674.473 1.00 99.38  ? 631  SER C CA    1 
ATOM   8514  C  C     . SER C 2  631  ? 490.787 -8.753  673.278 1.00 95.34  ? 631  SER C C     1 
ATOM   8515  O  O     . SER C 2  631  ? 490.842 -7.525  673.155 1.00 94.59  ? 631  SER C O     1 
ATOM   8516  C  CB    . SER C 2  631  ? 490.310 -10.213 675.236 1.00 97.92  ? 631  SER C CB    1 
ATOM   8517  O  OG    . SER C 2  631  ? 489.150 -9.398  675.361 1.00 91.75  ? 631  SER C OG    1 
ATOM   8518  N  N     . ASN C 2  632  ? 490.236 -9.556  672.361 1.00 93.43  ? 632  ASN C N     1 
ATOM   8519  C  CA    . ASN C 2  632  ? 489.606 -9.016  671.156 1.00 99.04  ? 632  ASN C CA    1 
ATOM   8520  C  C     . ASN C 2  632  ? 488.515 -8.015  671.497 1.00 102.65 ? 632  ASN C C     1 
ATOM   8521  O  O     . ASN C 2  632  ? 488.331 -7.012  670.795 1.00 113.53 ? 632  ASN C O     1 
ATOM   8522  C  CB    . ASN C 2  632  ? 489.023 -10.149 670.319 1.00 102.92 ? 632  ASN C CB    1 
ATOM   8523  C  CG    . ASN C 2  632  ? 490.047 -10.814 669.456 1.00 103.25 ? 632  ASN C CG    1 
ATOM   8524  O  OD1   . ASN C 2  632  ? 491.113 -10.248 669.216 1.00 106.20 ? 632  ASN C OD1   1 
ATOM   8525  N  ND2   . ASN C 2  632  ? 489.765 -12.051 669.032 1.00 97.94  ? 632  ASN C ND2   1 
ATOM   8526  N  N     . GLN C 2  633  ? 487.775 -8.278  672.568 1.00 102.46 ? 633  GLN C N     1 
ATOM   8527  C  CA    . GLN C 2  633  ? 486.658 -7.449  672.972 1.00 98.00  ? 633  GLN C CA    1 
ATOM   8528  C  C     . GLN C 2  633  ? 487.049 -6.422  674.025 1.00 91.93  ? 633  GLN C C     1 
ATOM   8529  O  O     . GLN C 2  633  ? 486.205 -5.640  674.456 1.00 96.82  ? 633  GLN C O     1 
ATOM   8530  C  CB    . GLN C 2  633  ? 485.534 -8.362  673.477 1.00 97.76  ? 633  GLN C CB    1 
ATOM   8531  C  CG    . GLN C 2  633  ? 484.988 -9.350  672.408 1.00 96.68  ? 633  GLN C CG    1 
ATOM   8532  C  CD    . GLN C 2  633  ? 485.917 -10.540 672.081 1.00 93.87  ? 633  GLN C CD    1 
ATOM   8533  O  OE1   . GLN C 2  633  ? 486.963 -10.730 672.690 1.00 93.70  ? 633  GLN C OE1   1 
ATOM   8534  N  NE2   . GLN C 2  633  ? 485.527 -11.324 671.095 1.00 92.45  ? 633  GLN C NE2   1 
ATOM   8535  N  N     . GLY C 2  634  ? 488.324 -6.342  674.369 1.00 88.39  ? 634  GLY C N     1 
ATOM   8536  C  CA    . GLY C 2  634  ? 488.852 -5.321  675.236 1.00 90.69  ? 634  GLY C CA    1 
ATOM   8537  C  C     . GLY C 2  634  ? 488.720 -5.630  676.701 1.00 89.93  ? 634  GLY C C     1 
ATOM   8538  O  O     . GLY C 2  634  ? 489.200 -4.854  677.531 1.00 91.13  ? 634  GLY C O     1 
ATOM   8539  N  N     . THR C 2  635  ? 488.240 -6.807  677.042 1.00 90.45  ? 635  THR C N     1 
ATOM   8540  C  CA    . THR C 2  635  ? 488.250 -7.222  678.424 1.00 91.31  ? 635  THR C CA    1 
ATOM   8541  C  C     . THR C 2  635  ? 489.654 -7.664  678.775 1.00 93.84  ? 635  THR C C     1 
ATOM   8542  O  O     . THR C 2  635  ? 490.367 -8.217  677.941 1.00 98.25  ? 635  THR C O     1 
ATOM   8543  C  CB    . THR C 2  635  ? 487.252 -8.353  678.666 1.00 90.87  ? 635  THR C CB    1 
ATOM   8544  O  OG1   . THR C 2  635  ? 487.629 -9.525  677.929 1.00 87.18  ? 635  THR C OG1   1 
ATOM   8545  C  CG2   . THR C 2  635  ? 485.887 -7.900  678.188 1.00 86.57  ? 635  THR C CG2   1 
ATOM   8546  N  N     . ALA C 2  636  ? 490.016 -7.504  680.044 1.00 103.07 ? 636  ALA C N     1 
ATOM   8547  C  CA    . ALA C 2  636  ? 491.380 -7.779  680.467 1.00 102.93 ? 636  ALA C CA    1 
ATOM   8548  C  C     . ALA C 2  636  ? 491.508 -9.262  680.762 1.00 103.80 ? 636  ALA C C     1 
ATOM   8549  O  O     . ALA C 2  636  ? 490.839 -9.787  681.656 1.00 108.74 ? 636  ALA C O     1 
ATOM   8550  C  CB    . ALA C 2  636  ? 491.716 -6.960  681.714 1.00 92.46  ? 636  ALA C CB    1 
ATOM   8551  N  N     . LEU C 2  637  ? 492.412 -9.926  680.054 1.00 102.86 ? 637  LEU C N     1 
ATOM   8552  C  CA    . LEU C 2  637  ? 492.746 -11.305 680.370 1.00 110.43 ? 637  LEU C CA    1 
ATOM   8553  C  C     . LEU C 2  637  ? 493.923 -11.192 681.315 1.00 115.66 ? 637  LEU C C     1 
ATOM   8554  O  O     . LEU C 2  637  ? 495.009 -10.757 680.917 1.00 116.66 ? 637  LEU C O     1 
ATOM   8555  C  CB    . LEU C 2  637  ? 493.101 -12.102 679.121 1.00 109.38 ? 637  LEU C CB    1 
ATOM   8556  C  CG    . LEU C 2  637  ? 492.021 -12.024 678.056 1.00 104.70 ? 637  LEU C CG    1 
ATOM   8557  C  CD1   . LEU C 2  637  ? 492.437 -12.850 676.888 1.00 99.66  ? 637  LEU C CD1   1 
ATOM   8558  C  CD2   . LEU C 2  637  ? 490.652 -12.432 678.592 1.00 110.49 ? 637  LEU C CD2   1 
ATOM   8559  N  N     . ASP C 2  638  ? 493.719 -11.600 682.564 1.00 120.56 ? 638  ASP C N     1 
ATOM   8560  C  CA    . ASP C 2  638  ? 494.823 -11.528 683.495 1.00 118.21 ? 638  ASP C CA    1 
ATOM   8561  C  C     . ASP C 2  638  ? 494.768 -12.683 684.492 1.00 118.32 ? 638  ASP C C     1 
ATOM   8562  O  O     . ASP C 2  638  ? 493.712 -12.991 685.058 1.00 115.15 ? 638  ASP C O     1 
ATOM   8563  C  CB    . ASP C 2  638  ? 494.698 -10.111 684.098 1.00 114.36 ? 638  ASP C CB    1 
ATOM   8564  C  CG    . ASP C 2  638  ? 495.494 -9.885  685.332 1.00 120.85 ? 638  ASP C CG    1 
ATOM   8565  O  OD1   . ASP C 2  638  ? 496.142 -10.818 685.843 1.00 126.91 ? 638  ASP C OD1   1 
ATOM   8566  O  OD2   . ASP C 2  638  ? 495.475 -8.715  685.780 1.00 117.17 ? 638  ASP C OD2   1 
ATOM   8567  N  N     . GLN C 2  639  ? 495.940 -13.276 684.728 1.00 116.96 ? 639  GLN C N     1 
ATOM   8568  C  CA    . GLN C 2  639  ? 496.117 -14.431 685.595 1.00 116.23 ? 639  GLN C CA    1 
ATOM   8569  C  C     . GLN C 2  639  ? 496.722 -13.983 686.916 1.00 119.01 ? 639  GLN C C     1 
ATOM   8570  O  O     . GLN C 2  639  ? 497.672 -13.198 686.932 1.00 117.46 ? 639  GLN C O     1 
ATOM   8571  C  CB    . GLN C 2  639  ? 497.011 -15.498 684.963 1.00 119.61 ? 639  GLN C CB    1 
ATOM   8572  C  CG    . GLN C 2  639  ? 496.475 -16.199 683.730 1.00 116.01 ? 639  GLN C CG    1 
ATOM   8573  C  CD    . GLN C 2  639  ? 497.547 -17.061 683.098 1.00 116.83 ? 639  GLN C CD    1 
ATOM   8574  O  OE1   . GLN C 2  639  ? 498.500 -16.545 682.502 1.00 120.78 ? 639  GLN C OE1   1 
ATOM   8575  N  NE2   . GLN C 2  639  ? 497.414 -18.386 683.247 1.00 112.65 ? 639  GLN C NE2   1 
ATOM   8576  N  N     . ARG C 2  640  ? 496.194 -14.504 688.021 1.00 118.36 ? 640  ARG C N     1 
ATOM   8577  C  CA    . ARG C 2  640  ? 496.701 -14.180 689.343 1.00 110.82 ? 640  ARG C CA    1 
ATOM   8578  C  C     . ARG C 2  640  ? 497.211 -15.413 690.089 1.00 111.13 ? 640  ARG C C     1 
ATOM   8579  O  O     . ARG C 2  640  ? 496.624 -16.492 689.973 1.00 107.79 ? 640  ARG C O     1 
ATOM   8580  C  CB    . ARG C 2  640  ? 495.631 -13.452 690.109 1.00 113.80 ? 640  ARG C CB    1 
ATOM   8581  C  CG    . ARG C 2  640  ? 495.570 -11.995 689.668 1.00 112.38 ? 640  ARG C CG    1 
ATOM   8582  C  CD    . ARG C 2  640  ? 494.417 -11.861 688.715 1.00 116.60 ? 640  ARG C CD    1 
ATOM   8583  N  NE    . ARG C 2  640  ? 493.149 -11.967 689.423 1.00 119.63 ? 640  ARG C NE    1 
ATOM   8584  C  CZ    . ARG C 2  640  ? 492.290 -12.962 689.239 1.00 113.75 ? 640  ARG C CZ    1 
ATOM   8585  N  NH1   . ARG C 2  640  ? 492.565 -13.923 688.373 1.00 113.46 ? 640  ARG C NH1   1 
ATOM   8586  N  NH2   . ARG C 2  640  ? 491.158 -12.999 689.921 1.00 124.02 ? 640  ARG C NH2   1 
ATOM   8587  N  N     . PRO C 2  641  ? 498.345 -15.289 690.792 1.00 117.98 ? 641  PRO C N     1 
ATOM   8588  C  CA    . PRO C 2  641  ? 498.943 -16.426 691.531 1.00 113.12 ? 641  PRO C CA    1 
ATOM   8589  C  C     . PRO C 2  641  ? 498.068 -16.916 692.675 1.00 113.41 ? 641  PRO C C     1 
ATOM   8590  O  O     . PRO C 2  641  ? 497.618 -16.119 693.502 1.00 111.86 ? 641  PRO C O     1 
ATOM   8591  C  CB    . PRO C 2  641  ? 500.235 -15.829 692.102 1.00 113.81 ? 641  PRO C CB    1 
ATOM   8592  C  CG    . PRO C 2  641  ? 499.930 -14.323 692.180 1.00 112.10 ? 641  PRO C CG    1 
ATOM   8593  C  CD    . PRO C 2  641  ? 499.074 -14.024 691.012 1.00 116.68 ? 641  PRO C CD    1 
ATOM   8594  N  N     . ARG C 2  642  ? 497.797 -18.229 692.712 1.00 115.66 ? 642  ARG C N     1 
ATOM   8595  C  CA    . ARG C 2  642  ? 497.028 -18.800 693.821 1.00 114.32 ? 642  ARG C CA    1 
ATOM   8596  C  C     . ARG C 2  642  ? 497.823 -19.613 694.861 1.00 118.70 ? 642  ARG C C     1 
ATOM   8597  O  O     . ARG C 2  642  ? 497.210 -20.122 695.815 1.00 119.72 ? 642  ARG C O     1 
ATOM   8598  C  CB    . ARG C 2  642  ? 495.875 -19.652 693.264 1.00 109.44 ? 642  ARG C CB    1 
ATOM   8599  C  CG    . ARG C 2  642  ? 494.714 -18.847 692.647 1.00 107.06 ? 642  ARG C CG    1 
ATOM   8600  C  CD    . ARG C 2  642  ? 494.081 -17.875 693.646 1.00 104.67 ? 642  ARG C CD    1 
ATOM   8601  N  NE    . ARG C 2  642  ? 493.162 -16.902 693.042 1.00 108.86 ? 642  ARG C NE    1 
ATOM   8602  C  CZ    . ARG C 2  642  ? 493.392 -15.593 692.906 1.00 107.15 ? 642  ARG C CZ    1 
ATOM   8603  N  NH1   . ARG C 2  642  ? 494.531 -15.054 693.321 1.00 97.59  ? 642  ARG C NH1   1 
ATOM   8604  N  NH2   . ARG C 2  642  ? 492.471 -14.815 692.344 1.00 110.70 ? 642  ARG C NH2   1 
ATOM   8605  N  N     . VAL C 2  643  ? 499.149 -19.754 694.745 1.00 116.93 ? 643  VAL C N     1 
ATOM   8606  C  CA    . VAL C 2  643  ? 499.895 -20.573 695.698 1.00 116.11 ? 643  VAL C CA    1 
ATOM   8607  C  C     . VAL C 2  643  ? 500.967 -19.714 696.354 1.00 117.70 ? 643  VAL C C     1 
ATOM   8608  O  O     . VAL C 2  643  ? 501.306 -18.631 695.877 1.00 113.56 ? 643  VAL C O     1 
ATOM   8609  C  CB    . VAL C 2  643  ? 500.505 -21.841 695.084 1.00 112.17 ? 643  VAL C CB    1 
ATOM   8610  C  CG1   . VAL C 2  643  ? 499.406 -22.738 694.543 1.00 111.77 ? 643  VAL C CG1   1 
ATOM   8611  C  CG2   . VAL C 2  643  ? 501.529 -21.491 694.050 1.00 120.41 ? 643  VAL C CG2   1 
ATOM   8612  N  N     . VAL C 2  644  ? 501.536 -20.239 697.437 1.00 121.89 ? 644  VAL C N     1 
ATOM   8613  C  CA    . VAL C 2  644  ? 502.528 -19.507 698.211 1.00 125.08 ? 644  VAL C CA    1 
ATOM   8614  C  C     . VAL C 2  644  ? 503.855 -20.256 698.193 1.00 128.06 ? 644  VAL C C     1 
ATOM   8615  O  O     . VAL C 2  644  ? 503.912 -21.469 697.944 1.00 122.83 ? 644  VAL C O     1 
ATOM   8616  C  CB    . VAL C 2  644  ? 502.050 -19.293 699.658 1.00 120.34 ? 644  VAL C CB    1 
ATOM   8617  C  CG1   . VAL C 2  644  ? 502.065 -20.624 700.393 1.00 120.16 ? 644  VAL C CG1   1 
ATOM   8618  C  CG2   . VAL C 2  644  ? 502.876 -18.204 700.372 1.00 123.01 ? 644  VAL C CG2   1 
ATOM   8619  N  N     . VAL C 2  645  ? 504.933 -19.505 698.476 1.00 131.06 ? 645  VAL C N     1 
ATOM   8620  C  CA    . VAL C 2  645  ? 506.270 -20.081 698.432 1.00 131.71 ? 645  VAL C CA    1 
ATOM   8621  C  C     . VAL C 2  645  ? 506.296 -21.265 699.377 1.00 125.88 ? 645  VAL C C     1 
ATOM   8622  O  O     . VAL C 2  645  ? 505.935 -21.151 700.552 1.00 116.02 ? 645  VAL C O     1 
ATOM   8623  C  CB    . VAL C 2  645  ? 507.334 -19.035 698.810 1.00 127.48 ? 645  VAL C CB    1 
ATOM   8624  C  CG1   . VAL C 2  645  ? 508.726 -19.572 698.539 1.00 125.16 ? 645  VAL C CG1   1 
ATOM   8625  C  CG2   . VAL C 2  645  ? 507.115 -17.728 698.057 1.00 128.53 ? 645  VAL C CG2   1 
ATOM   8626  N  N     . GLY C 2  646  ? 506.733 -22.403 698.864 1.00 130.75 ? 646  GLY C N     1 
ATOM   8627  C  CA    . GLY C 2  646  ? 506.861 -23.595 699.651 1.00 127.31 ? 646  GLY C CA    1 
ATOM   8628  C  C     . GLY C 2  646  ? 505.612 -24.441 699.695 1.00 127.19 ? 646  GLY C C     1 
ATOM   8629  O  O     . GLY C 2  646  ? 505.635 -25.505 700.327 1.00 128.12 ? 646  GLY C O     1 
ATOM   8630  N  N     . GLN C 2  647  ? 504.559 -24.080 698.960 1.00 125.13 ? 647  GLN C N     1 
ATOM   8631  C  CA    . GLN C 2  647  ? 503.345 -24.874 699.064 1.00 130.04 ? 647  GLN C CA    1 
ATOM   8632  C  C     . GLN C 2  647  ? 503.544 -26.201 698.350 1.00 134.84 ? 647  GLN C C     1 
ATOM   8633  O  O     . GLN C 2  647  ? 504.067 -26.259 697.233 1.00 136.40 ? 647  GLN C O     1 
ATOM   8634  C  CB    . GLN C 2  647  ? 502.156 -24.112 698.472 1.00 127.79 ? 647  GLN C CB    1 
ATOM   8635  C  CG    . GLN C 2  647  ? 500.880 -24.954 698.270 1.00 124.91 ? 647  GLN C CG    1 
ATOM   8636  C  CD    . GLN C 2  647  ? 499.645 -24.109 697.958 1.00 114.86 ? 647  GLN C CD    1 
ATOM   8637  O  OE1   . GLN C 2  647  ? 499.644 -22.889 698.133 1.00 112.98 ? 647  GLN C OE1   1 
ATOM   8638  N  NE2   . GLN C 2  647  ? 498.618 -24.751 697.423 1.00 105.46 ? 647  GLN C NE2   1 
ATOM   8639  N  N     . ARG C 2  648  ? 503.109 -27.273 699.007 1.00 136.86 ? 648  ARG C N     1 
ATOM   8640  C  CA    . ARG C 2  648  ? 503.209 -28.605 698.432 1.00 142.11 ? 648  ARG C CA    1 
ATOM   8641  C  C     . ARG C 2  648  ? 502.013 -28.832 697.518 1.00 145.28 ? 648  ARG C C     1 
ATOM   8642  O  O     . ARG C 2  648  ? 500.861 -28.765 697.968 1.00 142.20 ? 648  ARG C O     1 
ATOM   8643  C  CB    . ARG C 2  648  ? 503.306 -29.633 699.549 1.00 143.59 ? 648  ARG C CB    1 
ATOM   8644  C  CG    . ARG C 2  648  ? 504.622 -29.430 700.293 1.00 149.37 ? 648  ARG C CG    1 
ATOM   8645  C  CD    . ARG C 2  648  ? 505.848 -29.878 699.522 1.00 154.09 ? 648  ARG C CD    1 
ATOM   8646  N  NE    . ARG C 2  648  ? 506.356 -31.168 699.965 1.00 164.44 ? 648  ARG C NE    1 
ATOM   8647  C  CZ    . ARG C 2  648  ? 507.355 -31.813 699.376 1.00 165.61 ? 648  ARG C CZ    1 
ATOM   8648  N  NH1   . ARG C 2  648  ? 507.952 -31.288 698.309 1.00 155.65 ? 648  ARG C NH1   1 
ATOM   8649  N  NH2   . ARG C 2  648  ? 507.755 -32.985 699.858 1.00 171.62 ? 648  ARG C NH2   1 
ATOM   8650  N  N     . VAL C 2  649  ? 502.291 -29.097 696.238 1.00 146.09 ? 649  VAL C N     1 
ATOM   8651  C  CA    . VAL C 2  649  ? 501.277 -29.325 695.215 1.00 142.89 ? 649  VAL C CA    1 
ATOM   8652  C  C     . VAL C 2  649  ? 501.379 -30.742 694.655 1.00 145.81 ? 649  VAL C C     1 
ATOM   8653  O  O     . VAL C 2  649  ? 502.477 -31.295 694.527 1.00 147.93 ? 649  VAL C O     1 
ATOM   8654  C  CB    . VAL C 2  649  ? 501.476 -28.265 694.102 1.00 136.88 ? 649  VAL C CB    1 
ATOM   8655  C  CG1   . VAL C 2  649  ? 500.567 -28.491 692.956 1.00 137.26 ? 649  VAL C CG1   1 
ATOM   8656  C  CG2   . VAL C 2  649  ? 501.300 -26.857 694.644 1.00 132.97 ? 649  VAL C CG2   1 
ATOM   8657  N  N     . ARG C 2  650  ? 500.228 -31.317 694.268 1.00 147.70 ? 650  ARG C N     1 
ATOM   8658  C  CA    . ARG C 2  650  ? 500.221 -32.610 693.599 1.00 148.78 ? 650  ARG C CA    1 
ATOM   8659  C  C     . ARG C 2  650  ? 500.027 -32.354 692.102 1.00 152.32 ? 650  ARG C C     1 
ATOM   8660  O  O     . ARG C 2  650  ? 499.832 -31.216 691.675 1.00 149.23 ? 650  ARG C O     1 
ATOM   8661  C  CB    . ARG C 2  650  ? 499.162 -33.533 694.216 1.00 144.93 ? 650  ARG C CB    1 
ATOM   8662  C  CG    . ARG C 2  650  ? 499.514 -33.913 695.676 1.00 147.50 ? 650  ARG C CG    1 
ATOM   8663  C  CD    . ARG C 2  650  ? 498.805 -35.159 696.228 1.00 149.38 ? 650  ARG C CD    1 
ATOM   8664  N  NE    . ARG C 2  650  ? 499.480 -35.712 697.414 1.00 155.31 ? 650  ARG C NE    1 
ATOM   8665  C  CZ    . ARG C 2  650  ? 499.191 -35.411 698.685 1.00 165.04 ? 650  ARG C CZ    1 
ATOM   8666  N  NH1   . ARG C 2  650  ? 498.226 -34.544 698.987 1.00 160.50 ? 650  ARG C NH1   1 
ATOM   8667  N  NH2   . ARG C 2  650  ? 499.878 -35.981 699.670 1.00 167.20 ? 650  ARG C NH2   1 
ATOM   8668  N  N     . LYS C 2  651  ? 500.022 -33.415 691.293 1.00 160.40 ? 651  LYS C N     1 
ATOM   8669  C  CA    . LYS C 2  651  ? 499.853 -33.240 689.845 1.00 159.31 ? 651  LYS C CA    1 
ATOM   8670  C  C     . LYS C 2  651  ? 498.431 -32.835 689.451 1.00 154.73 ? 651  LYS C C     1 
ATOM   8671  O  O     . LYS C 2  651  ? 497.456 -33.515 689.787 1.00 152.77 ? 651  LYS C O     1 
ATOM   8672  C  CB    . LYS C 2  651  ? 500.348 -34.477 689.081 1.00 155.28 ? 651  LYS C CB    1 
ATOM   8673  C  CG    . LYS C 2  651  ? 500.114 -34.409 687.587 1.00 151.00 ? 651  LYS C CG    1 
ATOM   8674  C  CD    . LYS C 2  651  ? 500.483 -35.700 686.858 1.00 158.65 ? 651  LYS C CD    1 
ATOM   8675  C  CE    . LYS C 2  651  ? 499.442 -36.784 686.887 1.00 158.12 ? 651  LYS C CE    1 
ATOM   8676  N  NZ    . LYS C 2  651  ? 500.105 -38.077 686.543 1.00 161.87 ? 651  LYS C NZ    1 
ATOM   8677  N  N     . GLY C 2  652  ? 498.332 -31.727 688.708 1.00 151.73 ? 652  GLY C N     1 
ATOM   8678  C  CA    . GLY C 2  652  ? 497.077 -31.162 688.238 1.00 145.66 ? 652  GLY C CA    1 
ATOM   8679  C  C     . GLY C 2  652  ? 496.399 -30.173 689.169 1.00 135.85 ? 652  GLY C C     1 
ATOM   8680  O  O     . GLY C 2  652  ? 495.256 -29.782 688.908 1.00 128.78 ? 652  GLY C O     1 
ATOM   8681  N  N     . ASP C 2  653  ? 497.077 -29.733 690.220 1.00 137.49 ? 653  ASP C N     1 
ATOM   8682  C  CA    . ASP C 2  653  ? 496.556 -28.744 691.152 1.00 132.75 ? 653  ASP C CA    1 
ATOM   8683  C  C     . ASP C 2  653  ? 496.729 -27.335 690.587 1.00 119.16 ? 653  ASP C C     1 
ATOM   8684  O  O     . ASP C 2  653  ? 497.638 -27.062 689.807 1.00 125.98 ? 653  ASP C O     1 
ATOM   8685  C  CB    . ASP C 2  653  ? 497.251 -28.874 692.510 1.00 137.46 ? 653  ASP C CB    1 
ATOM   8686  C  CG    . ASP C 2  653  ? 496.632 -29.956 693.388 1.00 141.81 ? 653  ASP C CG    1 
ATOM   8687  O  OD1   . ASP C 2  653  ? 495.793 -29.624 694.252 1.00 146.96 ? 653  ASP C OD1   1 
ATOM   8688  O  OD2   . ASP C 2  653  ? 496.982 -31.147 693.195 1.00 143.75 ? 653  ASP C OD2   1 
ATOM   8689  N  N     . LEU C 2  654  ? 495.813 -26.455 690.962 1.00 114.22 ? 654  LEU C N     1 
ATOM   8690  C  CA    . LEU C 2  654  ? 495.797 -25.073 690.497 1.00 110.62 ? 654  LEU C CA    1 
ATOM   8691  C  C     . LEU C 2  654  ? 496.969 -24.238 691.005 1.00 111.53 ? 654  LEU C C     1 
ATOM   8692  O  O     . LEU C 2  654  ? 497.320 -24.278 692.184 1.00 113.51 ? 654  LEU C O     1 
ATOM   8693  C  CB    . LEU C 2  654  ? 494.492 -24.413 690.928 1.00 112.92 ? 654  LEU C CB    1 
ATOM   8694  C  CG    . LEU C 2  654  ? 494.320 -22.985 690.437 1.00 113.11 ? 654  LEU C CG    1 
ATOM   8695  C  CD1   . LEU C 2  654  ? 493.959 -22.994 688.970 1.00 115.75 ? 654  LEU C CD1   1 
ATOM   8696  C  CD2   . LEU C 2  654  ? 493.247 -22.279 691.257 1.00 107.29 ? 654  LEU C CD2   1 
ATOM   8697  N  N     . LEU C 2  655  ? 497.577 -23.491 690.085 1.00 112.33 ? 655  LEU C N     1 
ATOM   8698  C  CA    . LEU C 2  655  ? 498.668 -22.554 690.333 1.00 109.74 ? 655  LEU C CA    1 
ATOM   8699  C  C     . LEU C 2  655  ? 498.204 -21.106 690.234 1.00 108.47 ? 655  LEU C C     1 
ATOM   8700  O  O     . LEU C 2  655  ? 498.515 -20.298 691.110 1.00 108.93 ? 655  LEU C O     1 
ATOM   8701  C  CB    . LEU C 2  655  ? 499.819 -22.838 689.368 1.00 114.51 ? 655  LEU C CB    1 
ATOM   8702  C  CG    . LEU C 2  655  ? 500.570 -24.137 689.641 1.00 117.62 ? 655  LEU C CG    1 
ATOM   8703  C  CD1   . LEU C 2  655  ? 501.650 -24.332 688.601 1.00 129.89 ? 655  LEU C CD1   1 
ATOM   8704  C  CD2   . LEU C 2  655  ? 501.210 -24.025 690.999 1.00 114.46 ? 655  LEU C CD2   1 
ATOM   8705  N  N     . ALA C 2  656  ? 497.620 -20.709 689.108 1.00 107.77 ? 656  ALA C N     1 
ATOM   8706  C  CA    . ALA C 2  656  ? 497.063 -19.374 688.951 1.00 107.24 ? 656  ALA C CA    1 
ATOM   8707  C  C     . ALA C 2  656  ? 495.626 -19.452 688.471 1.00 107.35 ? 656  ALA C C     1 
ATOM   8708  O  O     . ALA C 2  656  ? 495.247 -20.355 687.728 1.00 108.21 ? 656  ALA C O     1 
ATOM   8709  C  CB    . ALA C 2  656  ? 497.854 -18.519 687.976 1.00 113.17 ? 656  ALA C CB    1 
ATOM   8710  N  N     . ASP C 2  657  ? 494.828 -18.504 688.934 1.00 112.11 ? 657  ASP C N     1 
ATOM   8711  C  CA    . ASP C 2  657  ? 493.471 -18.299 688.444 1.00 112.94 ? 657  ASP C CA    1 
ATOM   8712  C  C     . ASP C 2  657  ? 493.510 -17.455 687.171 1.00 113.91 ? 657  ASP C C     1 
ATOM   8713  O  O     . ASP C 2  657  ? 494.255 -16.471 687.096 1.00 111.09 ? 657  ASP C O     1 
ATOM   8714  C  CB    . ASP C 2  657  ? 492.606 -17.633 689.528 1.00 109.81 ? 657  ASP C CB    1 
ATOM   8715  C  CG    . ASP C 2  657  ? 491.708 -18.645 690.307 1.00 110.82 ? 657  ASP C CG    1 
ATOM   8716  O  OD1   . ASP C 2  657  ? 491.388 -19.740 689.781 1.00 109.68 ? 657  ASP C OD1   1 
ATOM   8717  O  OD2   . ASP C 2  657  ? 491.320 -18.339 691.465 1.00 109.20 ? 657  ASP C OD2   1 
ATOM   8718  N  N     . GLY C 2  658  ? 492.722 -17.851 686.159 1.00 110.72 ? 658  GLY C N     1 
ATOM   8719  C  CA    . GLY C 2  658  ? 492.577 -17.039 684.967 1.00 112.71 ? 658  GLY C CA    1 
ATOM   8720  C  C     . GLY C 2  658  ? 491.606 -15.887 685.186 1.00 111.23 ? 658  GLY C C     1 
ATOM   8721  O  O     . GLY C 2  658  ? 491.275 -15.554 686.324 1.00 113.35 ? 658  GLY C O     1 
ATOM   8722  N  N     . PRO C 2  659  ? 491.176 -15.210 684.123 1.00 111.79 ? 659  PRO C N     1 
ATOM   8723  C  CA    . PRO C 2  659  ? 490.162 -14.166 684.298 1.00 109.24 ? 659  PRO C CA    1 
ATOM   8724  C  C     . PRO C 2  659  ? 488.810 -14.816 684.553 1.00 107.87 ? 659  PRO C C     1 
ATOM   8725  O  O     . PRO C 2  659  ? 488.545 -15.935 684.100 1.00 104.89 ? 659  PRO C O     1 
ATOM   8726  C  CB    . PRO C 2  659  ? 490.166 -13.416 682.955 1.00 102.37 ? 659  PRO C CB    1 
ATOM   8727  C  CG    . PRO C 2  659  ? 491.098 -14.153 682.071 1.00 108.53 ? 659  PRO C CG    1 
ATOM   8728  C  CD    . PRO C 2  659  ? 491.416 -15.479 682.698 1.00 110.63 ? 659  PRO C CD    1 
ATOM   8729  N  N     . ALA C 2  660  ? 487.949 -14.121 685.300 1.00 99.25  ? 660  ALA C N     1 
ATOM   8730  C  CA    . ALA C 2  660  ? 486.606 -14.642 685.521 1.00 95.49  ? 660  ALA C CA    1 
ATOM   8731  C  C     . ALA C 2  660  ? 486.656 -16.089 686.004 1.00 98.43  ? 660  ALA C C     1 
ATOM   8732  O  O     . ALA C 2  660  ? 485.928 -16.962 685.526 1.00 95.02  ? 660  ALA C O     1 
ATOM   8733  C  CB    . ALA C 2  660  ? 485.755 -14.525 684.263 1.00 96.36  ? 660  ALA C CB    1 
ATOM   8734  N  N     . SER C 2  661  ? 487.602 -16.358 686.897 1.00 103.96 ? 661  SER C N     1 
ATOM   8735  C  CA    . SER C 2  661  ? 487.633 -17.609 687.632 1.00 103.76 ? 661  SER C CA    1 
ATOM   8736  C  C     . SER C 2  661  ? 488.105 -17.319 689.049 1.00 106.92 ? 661  SER C C     1 
ATOM   8737  O  O     . SER C 2  661  ? 488.963 -16.451 689.275 1.00 103.67 ? 661  SER C O     1 
ATOM   8738  C  CB    . SER C 2  661  ? 488.551 -18.648 686.966 1.00 101.93 ? 661  SER C CB    1 
ATOM   8739  O  OG    . SER C 2  661  ? 489.200 -19.465 687.932 1.00 97.99  ? 661  SER C OG    1 
ATOM   8740  N  N     . GLU C 2  662  ? 487.517 -18.056 689.995 1.00 105.18 ? 662  GLU C N     1 
ATOM   8741  C  CA    . GLU C 2  662  ? 487.783 -17.926 691.421 1.00 100.55 ? 662  GLU C CA    1 
ATOM   8742  C  C     . GLU C 2  662  ? 488.093 -19.324 691.922 1.00 105.29 ? 662  GLU C C     1 
ATOM   8743  O  O     . GLU C 2  662  ? 487.223 -20.201 691.880 1.00 102.90 ? 662  GLU C O     1 
ATOM   8744  C  CB    . GLU C 2  662  ? 486.598 -17.338 692.165 1.00 97.29  ? 662  GLU C CB    1 
ATOM   8745  C  CG    . GLU C 2  662  ? 486.836 -17.256 693.650 1.00 106.10 ? 662  GLU C CG    1 
ATOM   8746  C  CD    . GLU C 2  662  ? 485.583 -16.908 694.444 1.00 104.38 ? 662  GLU C CD    1 
ATOM   8747  O  OE1   . GLU C 2  662  ? 484.567 -17.636 694.294 1.00 98.46  ? 662  GLU C OE1   1 
ATOM   8748  O  OE2   . GLU C 2  662  ? 485.630 -15.920 695.219 1.00 102.62 ? 662  GLU C OE2   1 
ATOM   8749  N  N     . ASN C 2  663  ? 489.342 -19.538 692.345 1.00 110.32 ? 663  ASN C N     1 
ATOM   8750  C  CA    . ASN C 2  663  ? 489.819 -20.831 692.855 1.00 113.28 ? 663  ASN C CA    1 
ATOM   8751  C  C     . ASN C 2  663  ? 489.467 -21.987 691.917 1.00 110.11 ? 663  ASN C C     1 
ATOM   8752  O  O     . ASN C 2  663  ? 489.192 -23.104 692.365 1.00 106.53 ? 663  ASN C O     1 
ATOM   8753  C  CB    . ASN C 2  663  ? 489.262 -21.106 694.263 1.00 114.77 ? 663  ASN C CB    1 
ATOM   8754  C  CG    . ASN C 2  663  ? 489.662 -20.041 695.296 1.00 117.88 ? 663  ASN C CG    1 
ATOM   8755  O  OD1   . ASN C 2  663  ? 490.275 -19.015 694.976 1.00 116.73 ? 663  ASN C OD1   1 
ATOM   8756  N  ND2   . ASN C 2  663  ? 489.250 -20.264 696.541 1.00 122.74 ? 663  ASN C ND2   1 
ATOM   8757  N  N     . GLY C 2  664  ? 489.472 -21.735 690.605 1.00 111.76 ? 664  GLY C N     1 
ATOM   8758  C  CA    . GLY C 2  664  ? 489.220 -22.780 689.629 1.00 111.40 ? 664  GLY C CA    1 
ATOM   8759  C  C     . GLY C 2  664  ? 487.772 -22.988 689.217 1.00 108.26 ? 664  GLY C C     1 
ATOM   8760  O  O     . GLY C 2  664  ? 487.495 -23.907 688.429 1.00 107.32 ? 664  GLY C O     1 
ATOM   8761  N  N     . PHE C 2  665  ? 486.831 -22.260 689.806 1.00 102.01 ? 665  PHE C N     1 
ATOM   8762  C  CA    . PHE C 2  665  ? 485.435 -22.364 689.425 1.00 98.64  ? 665  PHE C CA    1 
ATOM   8763  C  C     . PHE C 2  665  ? 485.088 -21.163 688.560 1.00 94.58  ? 665  PHE C C     1 
ATOM   8764  O  O     . PHE C 2  665  ? 485.537 -20.050 688.848 1.00 96.13  ? 665  PHE C O     1 
ATOM   8765  C  CB    . PHE C 2  665  ? 484.546 -22.413 690.670 1.00 106.80 ? 665  PHE C CB    1 
ATOM   8766  C  CG    . PHE C 2  665  ? 484.679 -23.689 691.479 1.00 107.59 ? 665  PHE C CG    1 
ATOM   8767  C  CD1   . PHE C 2  665  ? 485.868 -23.992 692.126 1.00 108.21 ? 665  PHE C CD1   1 
ATOM   8768  C  CD2   . PHE C 2  665  ? 483.622 -24.574 691.593 1.00 108.84 ? 665  PHE C CD2   1 
ATOM   8769  C  CE1   . PHE C 2  665  ? 485.997 -25.140 692.867 1.00 110.48 ? 665  PHE C CE1   1 
ATOM   8770  C  CE2   . PHE C 2  665  ? 483.750 -25.727 692.341 1.00 114.57 ? 665  PHE C CE2   1 
ATOM   8771  C  CZ    . PHE C 2  665  ? 484.938 -26.002 692.984 1.00 113.69 ? 665  PHE C CZ    1 
ATOM   8772  N  N     . LEU C 2  666  ? 484.242 -21.366 687.551 1.00 87.79  ? 666  LEU C N     1 
ATOM   8773  C  CA    . LEU C 2  666  ? 483.880 -20.274 686.647 1.00 87.32  ? 666  LEU C CA    1 
ATOM   8774  C  C     . LEU C 2  666  ? 483.164 -19.137 687.383 1.00 90.96  ? 666  LEU C C     1 
ATOM   8775  O  O     . LEU C 2  666  ? 482.059 -19.322 687.898 1.00 90.67  ? 666  LEU C O     1 
ATOM   8776  C  CB    . LEU C 2  666  ? 483.003 -20.838 685.537 1.00 85.62  ? 666  LEU C CB    1 
ATOM   8777  C  CG    . LEU C 2  666  ? 482.515 -19.893 684.442 1.00 83.03  ? 666  LEU C CG    1 
ATOM   8778  C  CD1   . LEU C 2  666  ? 483.624 -19.198 683.739 1.00 80.22  ? 666  LEU C CD1   1 
ATOM   8779  C  CD2   . LEU C 2  666  ? 481.692 -20.684 683.465 1.00 82.23  ? 666  LEU C CD2   1 
ATOM   8780  N  N     . ALA C 2  667  ? 483.723 -17.924 687.326 1.00 89.25  ? 667  ALA C N     1 
ATOM   8781  C  CA    . ALA C 2  667  ? 483.107 -16.756 687.968 1.00 88.49  ? 667  ALA C CA    1 
ATOM   8782  C  C     . ALA C 2  667  ? 482.673 -15.688 686.966 1.00 89.54  ? 667  ALA C C     1 
ATOM   8783  O  O     . ALA C 2  667  ? 483.419 -14.741 686.684 1.00 88.00  ? 667  ALA C O     1 
ATOM   8784  C  CB    . ALA C 2  667  ? 484.094 -16.155 688.956 1.00 88.69  ? 667  ALA C CB    1 
ATOM   8785  N  N     . LEU C 2  668  ? 481.402 -15.688 686.597 1.00 84.42  ? 668  LEU C N     1 
ATOM   8786  C  CA    . LEU C 2  668  ? 480.991 -14.768 685.550 1.00 88.77  ? 668  LEU C CA    1 
ATOM   8787  C  C     . LEU C 2  668  ? 480.375 -13.494 686.114 1.00 94.88  ? 668  LEU C C     1 
ATOM   8788  O  O     . LEU C 2  668  ? 480.127 -12.538 685.364 1.00 93.60  ? 668  LEU C O     1 
ATOM   8789  C  CB    . LEU C 2  668  ? 480.036 -15.468 684.582 1.00 91.90  ? 668  LEU C CB    1 
ATOM   8790  C  CG    . LEU C 2  668  ? 480.744 -16.554 683.754 1.00 87.86  ? 668  LEU C CG    1 
ATOM   8791  C  CD1   . LEU C 2  668  ? 479.830 -17.185 682.711 1.00 84.99  ? 668  LEU C CD1   1 
ATOM   8792  C  CD2   . LEU C 2  668  ? 482.039 -16.082 683.149 1.00 81.28  ? 668  LEU C CD2   1 
ATOM   8793  N  N     . GLY C 2  669  ? 480.265 -13.404 687.430 1.00 97.19  ? 669  GLY C N     1 
ATOM   8794  C  CA    . GLY C 2  669  ? 479.510 -12.348 688.058 1.00 88.68  ? 669  GLY C CA    1 
ATOM   8795  C  C     . GLY C 2  669  ? 479.770 -12.357 689.543 1.00 85.29  ? 669  GLY C C     1 
ATOM   8796  O  O     . GLY C 2  669  ? 480.741 -12.949 690.015 1.00 80.76  ? 669  GLY C O     1 
ATOM   8797  N  N     . GLN C 2  670  ? 478.852 -11.761 690.287 1.00 93.20  ? 670  GLN C N     1 
ATOM   8798  C  CA    . GLN C 2  670  ? 478.962 -11.733 691.736 1.00 90.47  ? 670  GLN C CA    1 
ATOM   8799  C  C     . GLN C 2  670  ? 477.688 -12.275 692.353 1.00 89.07  ? 670  GLN C C     1 
ATOM   8800  O  O     . GLN C 2  670  ? 476.646 -12.373 691.695 1.00 91.91  ? 670  GLN C O     1 
ATOM   8801  C  CB    . GLN C 2  670  ? 479.250 -10.319 692.258 1.00 84.48  ? 670  GLN C CB    1 
ATOM   8802  C  CG    . GLN C 2  670  ? 480.726 -10.110 692.555 1.00 91.64  ? 670  GLN C CG    1 
ATOM   8803  C  CD    . GLN C 2  670  ? 481.235 -8.814  691.974 1.00 97.60  ? 670  GLN C CD    1 
ATOM   8804  O  OE1   . GLN C 2  670  ? 480.478 -8.091  691.320 1.00 99.62  ? 670  GLN C OE1   1 
ATOM   8805  N  NE2   . GLN C 2  670  ? 482.528 -8.526  692.165 1.00 96.52  ? 670  GLN C NE2   1 
ATOM   8806  N  N     . ASN C 2  671  ? 477.821 -12.697 693.609 1.00 89.24  ? 671  ASN C N     1 
ATOM   8807  C  CA    . ASN C 2  671  ? 476.704 -13.126 694.435 1.00 83.26  ? 671  ASN C CA    1 
ATOM   8808  C  C     . ASN C 2  671  ? 476.233 -11.948 695.263 1.00 80.92  ? 671  ASN C C     1 
ATOM   8809  O  O     . ASN C 2  671  ? 477.035 -11.329 695.963 1.00 79.33  ? 671  ASN C O     1 
ATOM   8810  C  CB    . ASN C 2  671  ? 477.125 -14.261 695.351 1.00 79.25  ? 671  ASN C CB    1 
ATOM   8811  C  CG    . ASN C 2  671  ? 477.558 -15.432 694.588 1.00 87.35  ? 671  ASN C CG    1 
ATOM   8812  O  OD1   . ASN C 2  671  ? 476.742 -16.068 693.938 1.00 89.33  ? 671  ASN C OD1   1 
ATOM   8813  N  ND2   . ASN C 2  671  ? 478.851 -15.726 694.615 1.00 91.82  ? 671  ASN C ND2   1 
ATOM   8814  N  N     . VAL C 2  672  ? 475.016 -11.505 695.024 1.00 77.65  ? 672  VAL C N     1 
ATOM   8815  C  CA    . VAL C 2  672  ? 474.518 -10.367 695.768 1.00 81.47  ? 672  VAL C CA    1 
ATOM   8816  C  C     . VAL C 2  672  ? 473.255 -10.778 696.512 1.00 86.98  ? 672  VAL C C     1 
ATOM   8817  O  O     . VAL C 2  672  ? 472.575 -11.743 696.144 1.00 87.16  ? 672  VAL C O     1 
ATOM   8818  C  CB    . VAL C 2  672  ? 474.295 -9.144  694.889 1.00 80.37  ? 672  VAL C CB    1 
ATOM   8819  C  CG1   . VAL C 2  672  ? 475.649 -8.617  694.501 1.00 81.69  ? 672  VAL C CG1   1 
ATOM   8820  C  CG2   . VAL C 2  672  ? 473.471 -9.538  693.679 1.00 80.00  ? 672  VAL C CG2   1 
ATOM   8821  N  N     . LEU C 2  673  ? 472.962 -10.028 697.586 1.00 86.28  ? 673  LEU C N     1 
ATOM   8822  C  CA    . LEU C 2  673  ? 471.757 -10.206 698.398 1.00 85.29  ? 673  LEU C CA    1 
ATOM   8823  C  C     . LEU C 2  673  ? 470.647 -9.436  697.722 1.00 83.10  ? 673  LEU C C     1 
ATOM   8824  O  O     . LEU C 2  673  ? 470.744 -8.213  697.579 1.00 82.75  ? 673  LEU C O     1 
ATOM   8825  C  CB    . LEU C 2  673  ? 471.959 -9.640  699.798 1.00 90.64  ? 673  LEU C CB    1 
ATOM   8826  C  CG    . LEU C 2  673  ? 471.132 -10.073 700.996 1.00 83.87  ? 673  LEU C CG    1 
ATOM   8827  C  CD1   . LEU C 2  673  ? 471.286 -11.562 701.224 1.00 84.88  ? 673  LEU C CD1   1 
ATOM   8828  C  CD2   . LEU C 2  673  ? 471.647 -9.289  702.164 1.00 84.09  ? 673  LEU C CD2   1 
ATOM   8829  N  N     . VAL C 2  674  ? 469.614 -10.131 697.275 1.00 79.37  ? 674  VAL C N     1 
ATOM   8830  C  CA    . VAL C 2  674  ? 468.586 -9.486  696.477 1.00 78.59  ? 674  VAL C CA    1 
ATOM   8831  C  C     . VAL C 2  674  ? 467.241 -9.505  697.199 1.00 80.76  ? 674  VAL C C     1 
ATOM   8832  O  O     . VAL C 2  674  ? 466.890 -10.492 697.856 1.00 84.25  ? 674  VAL C O     1 
ATOM   8833  C  CB    . VAL C 2  674  ? 468.494 -10.166 695.103 1.00 73.28  ? 674  VAL C CB    1 
ATOM   8834  C  CG1   . VAL C 2  674  ? 467.887 -11.574 695.225 1.00 74.15  ? 674  VAL C CG1   1 
ATOM   8835  C  CG2   . VAL C 2  674  ? 467.772 -9.278  694.136 1.00 77.01  ? 674  VAL C CG2   1 
ATOM   8836  N  N     . ALA C 2  675  ? 466.471 -8.429  697.041 1.00 74.21  ? 675  ALA C N     1 
ATOM   8837  C  CA    . ALA C 2  675  ? 465.094 -8.382  697.508 1.00 76.82  ? 675  ALA C CA    1 
ATOM   8838  C  C     . ALA C 2  675  ? 464.181 -8.275  696.294 1.00 78.97  ? 675  ALA C C     1 
ATOM   8839  O  O     . ALA C 2  675  ? 464.352 -7.374  695.456 1.00 76.56  ? 675  ALA C O     1 
ATOM   8840  C  CB    . ALA C 2  675  ? 464.879 -7.205  698.450 1.00 79.63  ? 675  ALA C CB    1 
ATOM   8841  N  N     . ILE C 2  676  ? 463.146 -9.114  696.263 1.00 74.02  ? 676  ILE C N     1 
ATOM   8842  C  CA    . ILE C 2  676  ? 462.211 -9.159  695.148 1.00 71.79  ? 676  ILE C CA    1 
ATOM   8843  C  C     . ILE C 2  676  ? 460.964 -8.372  695.510 1.00 72.23  ? 676  ILE C C     1 
ATOM   8844  O  O     . ILE C 2  676  ? 460.111 -8.869  696.238 1.00 78.88  ? 676  ILE C O     1 
ATOM   8845  C  CB    . ILE C 2  676  ? 461.840 -10.608 694.836 1.00 71.10  ? 676  ILE C CB    1 
ATOM   8846  C  CG1   . ILE C 2  676  ? 463.130 -11.428 694.635 1.00 75.69  ? 676  ILE C CG1   1 
ATOM   8847  C  CG2   . ILE C 2  676  ? 460.931 -10.621 693.602 1.00 72.22  ? 676  ILE C CG2   1 
ATOM   8848  C  CD1   . ILE C 2  676  ? 462.960 -12.860 694.126 1.00 64.69  ? 676  ILE C CD1   1 
ATOM   8849  N  N     . MET C 2  677  ? 460.799 -7.192  694.933 1.00 74.14  ? 677  MET C N     1 
ATOM   8850  C  CA    . MET C 2  677  ? 459.745 -6.236  695.275 1.00 71.25  ? 677  MET C CA    1 
ATOM   8851  C  C     . MET C 2  677  ? 459.781 -5.009  694.387 1.00 69.63  ? 677  MET C C     1 
ATOM   8852  O  O     . MET C 2  677  ? 460.864 -4.569  694.002 1.00 74.62  ? 677  MET C O     1 
ATOM   8853  C  CB    . MET C 2  677  ? 459.858 -5.822  696.744 1.00 66.95  ? 677  MET C CB    1 
ATOM   8854  C  CG    . MET C 2  677  ? 461.140 -5.129  697.076 1.00 69.36  ? 677  MET C CG    1 
ATOM   8855  S  SD    . MET C 2  677  ? 461.374 -4.328  698.684 1.00 70.73  ? 677  MET C SD    1 
ATOM   8856  C  CE    . MET C 2  677  ? 460.118 -3.048  698.519 1.00 72.53  ? 677  MET C CE    1 
ATOM   8857  N  N     . PRO C 2  678  ? 458.647 -4.390  694.100 1.00 66.41  ? 678  PRO C N     1 
ATOM   8858  C  CA    . PRO C 2  678  ? 458.673 -3.131  693.346 1.00 68.08  ? 678  PRO C CA    1 
ATOM   8859  C  C     . PRO C 2  678  ? 459.373 -2.083  694.184 1.00 70.79  ? 678  PRO C C     1 
ATOM   8860  O  O     . PRO C 2  678  ? 459.454 -2.214  695.407 1.00 74.47  ? 678  PRO C O     1 
ATOM   8861  C  CB    . PRO C 2  678  ? 457.198 -2.797  693.131 1.00 68.43  ? 678  PRO C CB    1 
ATOM   8862  C  CG    . PRO C 2  678  ? 456.488 -4.104  693.357 1.00 73.56  ? 678  PRO C CG    1 
ATOM   8863  C  CD    . PRO C 2  678  ? 457.284 -4.858  694.361 1.00 69.17  ? 678  PRO C CD    1 
ATOM   8864  N  N     . PHE C 2  679  ? 460.014 -1.113  693.525 1.00 72.40  ? 679  PHE C N     1 
ATOM   8865  C  CA    . PHE C 2  679  ? 460.512 0.036   694.276 1.00 69.18  ? 679  PHE C CA    1 
ATOM   8866  C  C     . PHE C 2  679  ? 460.222 1.341   693.545 1.00 69.41  ? 679  PHE C C     1 
ATOM   8867  O  O     . PHE C 2  679  ? 460.952 1.738   692.656 1.00 72.65  ? 679  PHE C O     1 
ATOM   8868  C  CB    . PHE C 2  679  ? 462.001 -0.137  694.498 1.00 70.49  ? 679  PHE C CB    1 
ATOM   8869  C  CG    . PHE C 2  679  ? 462.579 0.813   695.495 1.00 79.34  ? 679  PHE C CG    1 
ATOM   8870  C  CD1   . PHE C 2  679  ? 463.169 1.999   695.088 1.00 78.82  ? 679  PHE C CD1   1 
ATOM   8871  C  CD2   . PHE C 2  679  ? 462.609 0.485   696.843 1.00 84.28  ? 679  PHE C CD2   1 
ATOM   8872  C  CE1   . PHE C 2  679  ? 463.734 2.863   696.009 1.00 75.06  ? 679  PHE C CE1   1 
ATOM   8873  C  CE2   . PHE C 2  679  ? 463.167 1.346   697.764 1.00 80.75  ? 679  PHE C CE2   1 
ATOM   8874  C  CZ    . PHE C 2  679  ? 463.739 2.535   697.338 1.00 75.30  ? 679  PHE C CZ    1 
ATOM   8875  N  N     . ASP C 2  680  ? 459.207 2.045   693.989 1.00 78.41  ? 680  ASP C N     1 
ATOM   8876  C  CA    . ASP C 2  680  ? 458.855 3.397   693.579 1.00 76.96  ? 680  ASP C CA    1 
ATOM   8877  C  C     . ASP C 2  680  ? 458.975 3.710   692.092 1.00 77.53  ? 680  ASP C C     1 
ATOM   8878  O  O     . ASP C 2  680  ? 459.077 4.894   691.768 1.00 80.35  ? 680  ASP C O     1 
ATOM   8879  C  CB    . ASP C 2  680  ? 459.707 4.370   694.378 1.00 79.03  ? 680  ASP C CB    1 
ATOM   8880  C  CG    . ASP C 2  680  ? 458.976 4.895   695.620 1.00 89.25  ? 680  ASP C CG    1 
ATOM   8881  O  OD1   . ASP C 2  680  ? 458.208 4.104   696.251 1.00 89.92  ? 680  ASP C OD1   1 
ATOM   8882  O  OD2   . ASP C 2  680  ? 459.186 6.080   695.994 1.00 93.91  ? 680  ASP C OD2   1 
ATOM   8883  N  N     . GLY C 2  681  ? 458.737 2.731   691.201 1.00 75.06  ? 681  GLY C N     1 
ATOM   8884  C  CA    . GLY C 2  681  ? 458.920 2.805   689.740 1.00 73.84  ? 681  GLY C CA    1 
ATOM   8885  C  C     . GLY C 2  681  ? 460.343 2.830   689.162 1.00 77.50  ? 681  GLY C C     1 
ATOM   8886  O  O     . GLY C 2  681  ? 460.504 2.870   687.936 1.00 73.98  ? 681  GLY C O     1 
ATOM   8887  N  N     . TYR C 2  682  ? 461.380 2.707   689.968 1.00 75.09  ? 682  TYR C N     1 
ATOM   8888  C  CA    . TYR C 2  682  ? 462.729 2.555   689.448 1.00 68.51  ? 682  TYR C CA    1 
ATOM   8889  C  C     . TYR C 2  682  ? 462.943 1.113   688.978 1.00 67.87  ? 682  TYR C C     1 
ATOM   8890  O  O     . TYR C 2  682  ? 464.020 0.770   688.522 1.00 73.40  ? 682  TYR C O     1 
ATOM   8891  C  CB    . TYR C 2  682  ? 463.717 2.959   690.544 1.00 71.62  ? 682  TYR C CB    1 
ATOM   8892  C  CG    . TYR C 2  682  ? 463.698 4.454   690.832 1.00 75.84  ? 682  TYR C CG    1 
ATOM   8893  C  CD1   . TYR C 2  682  ? 464.079 5.370   689.891 1.00 75.54  ? 682  TYR C CD1   1 
ATOM   8894  C  CD2   . TYR C 2  682  ? 463.153 4.946   692.015 1.00 80.32  ? 682  TYR C CD2   1 
ATOM   8895  C  CE1   . TYR C 2  682  ? 464.016 6.739   690.142 1.00 75.39  ? 682  TYR C CE1   1 
ATOM   8896  C  CE2   . TYR C 2  682  ? 463.072 6.316   692.269 1.00 75.93  ? 682  TYR C CE2   1 
ATOM   8897  C  CZ    . TYR C 2  682  ? 463.507 7.206   691.318 1.00 74.37  ? 682  TYR C CZ    1 
ATOM   8898  O  OH    . TYR C 2  682  ? 463.457 8.570   691.526 1.00 73.49  ? 682  TYR C OH    1 
ATOM   8899  N  N     . ASN C 2  683  ? 462.017 0.222   689.284 1.00 74.88  ? 683  ASN C N     1 
ATOM   8900  C  CA    . ASN C 2  683  ? 462.009 -1.187  688.908 1.00 72.78  ? 683  ASN C CA    1 
ATOM   8901  C  C     . ASN C 2  683  ? 461.266 -1.447  687.615 1.00 71.53  ? 683  ASN C C     1 
ATOM   8902  O  O     . ASN C 2  683  ? 461.224 -2.598  687.146 1.00 71.06  ? 683  ASN C O     1 
ATOM   8903  C  CB    . ASN C 2  683  ? 461.323 -2.014  689.994 1.00 73.73  ? 683  ASN C CB    1 
ATOM   8904  C  CG    . ASN C 2  683  ? 462.290 -2.682  690.859 1.00 75.89  ? 683  ASN C CG    1 
ATOM   8905  O  OD1   . ASN C 2  683  ? 463.460 -2.775  690.494 1.00 86.42  ? 683  ASN C OD1   1 
ATOM   8906  N  ND2   . ASN C 2  683  ? 461.836 -3.221  691.972 1.00 73.59  ? 683  ASN C ND2   1 
ATOM   8907  N  N     . PHE C 2  684  ? 460.711 -0.397  687.028 1.00 65.19  ? 684  PHE C N     1 
ATOM   8908  C  CA    . PHE C 2  684  ? 459.720 -0.536  685.979 1.00 67.79  ? 684  PHE C CA    1 
ATOM   8909  C  C     . PHE C 2  684  ? 460.293 -1.243  684.741 1.00 71.89  ? 684  PHE C C     1 
ATOM   8910  O  O     . PHE C 2  684  ? 461.371 -0.904  684.230 1.00 67.59  ? 684  PHE C O     1 
ATOM   8911  C  CB    . PHE C 2  684  ? 459.259 0.866   685.622 1.00 64.87  ? 684  PHE C CB    1 
ATOM   8912  C  CG    . PHE C 2  684  ? 458.117 0.923   684.705 1.00 67.29  ? 684  PHE C CG    1 
ATOM   8913  C  CD1   . PHE C 2  684  ? 456.893 0.446   685.081 1.00 74.69  ? 684  PHE C CD1   1 
ATOM   8914  C  CD2   . PHE C 2  684  ? 458.264 1.476   683.457 1.00 71.26  ? 684  PHE C CD2   1 
ATOM   8915  C  CE1   . PHE C 2  684  ? 455.822 0.531   684.228 1.00 78.95  ? 684  PHE C CE1   1 
ATOM   8916  C  CE2   . PHE C 2  684  ? 457.205 1.553   682.590 1.00 70.62  ? 684  PHE C CE2   1 
ATOM   8917  C  CZ    . PHE C 2  684  ? 455.990 1.084   682.965 1.00 76.46  ? 684  PHE C CZ    1 
ATOM   8918  N  N     . GLU C 2  685  ? 459.523 -2.190  684.218 1.00 75.79  ? 685  GLU C N     1 
ATOM   8919  C  CA    . GLU C 2  685  ? 459.809 -2.847  682.940 1.00 75.09  ? 685  GLU C CA    1 
ATOM   8920  C  C     . GLU C 2  685  ? 461.257 -3.316  682.820 1.00 68.98  ? 685  GLU C C     1 
ATOM   8921  O  O     . GLU C 2  685  ? 461.951 -3.043  681.856 1.00 69.95  ? 685  GLU C O     1 
ATOM   8922  C  CB    . GLU C 2  685  ? 459.421 -1.924  681.787 1.00 73.77  ? 685  GLU C CB    1 
ATOM   8923  C  CG    . GLU C 2  685  ? 457.939 -1.925  681.572 1.00 72.39  ? 685  GLU C CG    1 
ATOM   8924  C  CD    . GLU C 2  685  ? 457.490 -3.183  680.867 1.00 85.51  ? 685  GLU C CD    1 
ATOM   8925  O  OE1   . GLU C 2  685  ? 458.106 -4.256  681.083 1.00 83.83  ? 685  GLU C OE1   1 
ATOM   8926  O  OE2   . GLU C 2  685  ? 456.469 -3.109  680.142 1.00 87.65  ? 685  GLU C OE2   1 
ATOM   8927  N  N     . ASP C 2  686  ? 461.672 -4.099  683.793 1.00 69.53  ? 686  ASP C N     1 
ATOM   8928  C  CA    . ASP C 2  686  ? 462.908 -4.835  683.907 1.00 65.96  ? 686  ASP C CA    1 
ATOM   8929  C  C     . ASP C 2  686  ? 464.102 -4.012  684.350 1.00 63.14  ? 686  ASP C C     1 
ATOM   8930  O  O     . ASP C 2  686  ? 465.143 -4.617  684.678 1.00 58.68  ? 686  ASP C O     1 
ATOM   8931  C  CB    . ASP C 2  686  ? 463.186 -5.608  682.621 1.00 68.24  ? 686  ASP C CB    1 
ATOM   8932  C  CG    . ASP C 2  686  ? 461.977 -6.449  682.224 1.00 83.32  ? 686  ASP C CG    1 
ATOM   8933  O  OD1   . ASP C 2  686  ? 461.860 -7.601  682.714 1.00 87.47  ? 686  ASP C OD1   1 
ATOM   8934  O  OD2   . ASP C 2  686  ? 461.132 -5.953  681.424 1.00 83.44  ? 686  ASP C OD2   1 
ATOM   8935  N  N     . ALA C 2  687  ? 463.957 -2.705  684.539 1.00 56.76  ? 687  ALA C N     1 
ATOM   8936  C  CA    . ALA C 2  687  ? 465.058 -1.941  685.108 1.00 62.95  ? 687  ALA C CA    1 
ATOM   8937  C  C     . ALA C 2  687  ? 465.403 -2.442  686.529 1.00 71.26  ? 687  ALA C C     1 
ATOM   8938  O  O     . ALA C 2  687  ? 464.596 -3.081  687.231 1.00 74.88  ? 687  ALA C O     1 
ATOM   8939  C  CB    . ALA C 2  687  ? 464.702 -0.452  685.133 1.00 54.66  ? 687  ALA C CB    1 
ATOM   8940  N  N     . ILE C 2  688  ? 466.622 -2.156  686.964 1.00 67.43  ? 688  ILE C N     1 
ATOM   8941  C  CA    . ILE C 2  688  ? 467.122 -2.688  688.225 1.00 67.44  ? 688  ILE C CA    1 
ATOM   8942  C  C     . ILE C 2  688  ? 467.639 -1.543  689.088 1.00 73.60  ? 688  ILE C C     1 
ATOM   8943  O  O     . ILE C 2  688  ? 468.238 -0.586  688.586 1.00 75.78  ? 688  ILE C O     1 
ATOM   8944  C  CB    . ILE C 2  688  ? 468.226 -3.723  687.981 1.00 64.58  ? 688  ILE C CB    1 
ATOM   8945  C  CG1   . ILE C 2  688  ? 467.687 -4.895  687.176 1.00 71.22  ? 688  ILE C CG1   1 
ATOM   8946  C  CG2   . ILE C 2  688  ? 468.747 -4.231  689.265 1.00 64.14  ? 688  ILE C CG2   1 
ATOM   8947  C  CD1   . ILE C 2  688  ? 468.752 -5.986  686.940 1.00 67.72  ? 688  ILE C CD1   1 
ATOM   8948  N  N     . VAL C 2  689  ? 467.392 -1.642  690.392 1.00 74.12  ? 689  VAL C N     1 
ATOM   8949  C  CA    . VAL C 2  689  ? 467.843 -0.681  691.393 1.00 73.73  ? 689  VAL C CA    1 
ATOM   8950  C  C     . VAL C 2  689  ? 468.974 -1.329  692.189 1.00 75.43  ? 689  VAL C C     1 
ATOM   8951  O  O     . VAL C 2  689  ? 468.883 -2.513  692.539 1.00 77.88  ? 689  VAL C O     1 
ATOM   8952  C  CB    . VAL C 2  689  ? 466.661 -0.273  692.294 1.00 75.05  ? 689  VAL C CB    1 
ATOM   8953  C  CG1   . VAL C 2  689  ? 467.083 0.687   693.342 1.00 77.86  ? 689  VAL C CG1   1 
ATOM   8954  C  CG2   . VAL C 2  689  ? 465.546 0.341   691.467 1.00 74.72  ? 689  VAL C CG2   1 
ATOM   8955  N  N     . ILE C 2  690  ? 470.071 -0.594  692.422 1.00 72.04  ? 690  ILE C N     1 
ATOM   8956  C  CA    . ILE C 2  690  ? 471.210 -1.172  693.138 1.00 77.78  ? 690  ILE C CA    1 
ATOM   8957  C  C     . ILE C 2  690  ? 471.659 -0.279  694.291 1.00 78.41  ? 690  ILE C C     1 
ATOM   8958  O  O     . ILE C 2  690  ? 471.450 0.939   694.288 1.00 77.56  ? 690  ILE C O     1 
ATOM   8959  C  CB    . ILE C 2  690  ? 472.434 -1.418  692.231 1.00 80.99  ? 690  ILE C CB    1 
ATOM   8960  C  CG1   . ILE C 2  690  ? 473.007 -0.073  691.744 1.00 76.30  ? 690  ILE C CG1   1 
ATOM   8961  C  CG2   . ILE C 2  690  ? 472.066 -2.347  691.083 1.00 76.89  ? 690  ILE C CG2   1 
ATOM   8962  C  CD1   . ILE C 2  690  ? 474.448 -0.157  691.301 1.00 75.42  ? 690  ILE C CD1   1 
ATOM   8963  N  N     . SER C 2  691  ? 472.364 -0.890  695.250 1.00 74.47  ? 691  SER C N     1 
ATOM   8964  C  CA    . SER C 2  691  ? 472.850 -0.147  696.410 1.00 79.56  ? 691  SER C CA    1 
ATOM   8965  C  C     . SER C 2  691  ? 474.191 0.489   696.102 1.00 82.60  ? 691  SER C C     1 
ATOM   8966  O  O     . SER C 2  691  ? 475.093 -0.171  695.584 1.00 85.55  ? 691  SER C O     1 
ATOM   8967  C  CB    . SER C 2  691  ? 473.010 -1.072  697.623 1.00 88.25  ? 691  SER C CB    1 
ATOM   8968  O  OG    . SER C 2  691  ? 473.646 -0.429  698.734 1.00 89.64  ? 691  SER C OG    1 
ATOM   8969  N  N     . GLU C 2  692  ? 474.367 1.732   696.545 1.00 79.71  ? 692  GLU C N     1 
ATOM   8970  C  CA    . GLU C 2  692  ? 475.671 2.361   696.378 1.00 84.01  ? 692  GLU C CA    1 
ATOM   8971  C  C     . GLU C 2  692  ? 476.773 1.563   697.050 1.00 86.38  ? 692  GLU C C     1 
ATOM   8972  O  O     . GLU C 2  692  ? 477.945 1.754   696.727 1.00 85.50  ? 692  GLU C O     1 
ATOM   8973  C  CB    . GLU C 2  692  ? 475.628 3.798   696.884 1.00 86.33  ? 692  GLU C CB    1 
ATOM   8974  C  CG    . GLU C 2  692  ? 476.858 4.601   696.571 1.00 84.95  ? 692  GLU C CG    1 
ATOM   8975  C  CD    . GLU C 2  692  ? 476.713 6.062   696.954 1.00 92.30  ? 692  GLU C CD    1 
ATOM   8976  O  OE1   . GLU C 2  692  ? 475.591 6.600   696.880 1.00 84.69  ? 692  GLU C OE1   1 
ATOM   8977  O  OE2   . GLU C 2  692  ? 477.730 6.695   697.283 1.00 104.42 ? 692  GLU C OE2   1 
ATOM   8978  N  N     . GLU C 2  693  ? 476.422 0.693   697.997 1.00 88.13  ? 693  GLU C N     1 
ATOM   8979  C  CA    . GLU C 2  693  ? 477.405 -0.196  698.612 1.00 93.42  ? 693  GLU C CA    1 
ATOM   8980  C  C     . GLU C 2  693  ? 478.157 -1.056  697.601 1.00 91.57  ? 693  GLU C C     1 
ATOM   8981  O  O     . GLU C 2  693  ? 479.292 -1.463  697.873 1.00 94.05  ? 693  GLU C O     1 
ATOM   8982  C  CB    . GLU C 2  693  ? 476.766 -1.078  699.685 1.00 94.58  ? 693  GLU C CB    1 
ATOM   8983  C  CG    . GLU C 2  693  ? 476.473 -0.295  700.945 1.00 98.64  ? 693  GLU C CG    1 
ATOM   8984  C  CD    . GLU C 2  693  ? 477.767 0.269   701.553 1.00 100.28 ? 693  GLU C CD    1 
ATOM   8985  O  OE1   . GLU C 2  693  ? 478.784 -0.472  701.589 1.00 102.70 ? 693  GLU C OE1   1 
ATOM   8986  O  OE2   . GLU C 2  693  ? 477.752 1.438   702.017 1.00 94.96  ? 693  GLU C OE2   1 
ATOM   8987  N  N     . LEU C 2  694  ? 477.526 -1.405  696.476 1.00 89.73  ? 694  LEU C N     1 
ATOM   8988  C  CA    . LEU C 2  694  ? 478.211 -2.200  695.453 1.00 92.31  ? 694  LEU C CA    1 
ATOM   8989  C  C     . LEU C 2  694  ? 479.425 -1.469  694.881 1.00 90.82  ? 694  LEU C C     1 
ATOM   8990  O  O     . LEU C 2  694  ? 480.500 -2.064  694.704 1.00 86.53  ? 694  LEU C O     1 
ATOM   8991  C  CB    . LEU C 2  694  ? 477.221 -2.585  694.352 1.00 85.64  ? 694  LEU C CB    1 
ATOM   8992  C  CG    . LEU C 2  694  ? 476.252 -3.701  694.740 1.00 83.13  ? 694  LEU C CG    1 
ATOM   8993  C  CD1   . LEU C 2  694  ? 475.373 -4.065  693.579 1.00 78.87  ? 694  LEU C CD1   1 
ATOM   8994  C  CD2   . LEU C 2  694  ? 477.064 -4.926  695.154 1.00 85.24  ? 694  LEU C CD2   1 
ATOM   8995  N  N     . LEU C 2  695  ? 479.274 -0.188  694.568 1.00 88.91  ? 695  LEU C N     1 
ATOM   8996  C  CA    . LEU C 2  695  ? 480.420 0.555   694.078 1.00 86.82  ? 695  LEU C CA    1 
ATOM   8997  C  C     . LEU C 2  695  ? 481.467 0.718   695.176 1.00 89.23  ? 695  LEU C C     1 
ATOM   8998  O  O     . LEU C 2  695  ? 482.652 0.480   694.944 1.00 98.19  ? 695  LEU C O     1 
ATOM   8999  C  CB    . LEU C 2  695  ? 479.974 1.928   693.571 1.00 84.79  ? 695  LEU C CB    1 
ATOM   9000  C  CG    . LEU C 2  695  ? 478.724 2.100   692.693 1.00 77.48  ? 695  LEU C CG    1 
ATOM   9001  C  CD1   . LEU C 2  695  ? 478.715 3.463   692.057 1.00 80.20  ? 695  LEU C CD1   1 
ATOM   9002  C  CD2   . LEU C 2  695  ? 478.427 1.016   691.693 1.00 75.17  ? 695  LEU C CD2   1 
ATOM   9003  N  N     . LYS C 2  696  ? 481.038 1.064   696.392 1.00 91.63  ? 696  LYS C N     1 
ATOM   9004  C  CA    . LYS C 2  696  ? 481.958 1.264   697.516 1.00 93.38  ? 696  LYS C CA    1 
ATOM   9005  C  C     . LYS C 2  696  ? 482.908 0.090   697.692 1.00 89.25  ? 696  LYS C C     1 
ATOM   9006  O  O     . LYS C 2  696  ? 484.105 0.281   697.889 1.00 94.49  ? 696  LYS C O     1 
ATOM   9007  C  CB    . LYS C 2  696  ? 481.163 1.474   698.808 1.00 96.46  ? 696  LYS C CB    1 
ATOM   9008  C  CG    . LYS C 2  696  ? 480.521 2.841   698.963 1.00 98.41  ? 696  LYS C CG    1 
ATOM   9009  C  CD    . LYS C 2  696  ? 479.543 2.807   700.121 1.00 95.68  ? 696  LYS C CD    1 
ATOM   9010  C  CE    . LYS C 2  696  ? 478.693 4.061   700.250 1.00 95.24  ? 696  LYS C CE    1 
ATOM   9011  N  NZ    . LYS C 2  696  ? 477.786 3.904   701.418 1.00 94.25  ? 696  LYS C NZ    1 
ATOM   9012  N  N     . ARG C 2  697  ? 482.398 -1.134  697.626 1.00 86.54  ? 697  ARG C N     1 
ATOM   9013  C  CA    . ARG C 2  697  ? 483.250 -2.302  697.785 1.00 90.96  ? 697  ARG C CA    1 
ATOM   9014  C  C     . ARG C 2  697  ? 483.734 -2.878  696.462 1.00 97.51  ? 697  ARG C C     1 
ATOM   9015  O  O     . ARG C 2  697  ? 484.308 -3.982  696.446 1.00 94.44  ? 697  ARG C O     1 
ATOM   9016  C  CB    . ARG C 2  697  ? 482.547 -3.356  698.639 1.00 93.00  ? 697  ARG C CB    1 
ATOM   9017  C  CG    . ARG C 2  697  ? 481.399 -4.154  698.044 1.00 94.57  ? 697  ARG C CG    1 
ATOM   9018  C  CD    . ARG C 2  697  ? 480.964 -5.143  699.142 1.00 97.05  ? 697  ARG C CD    1 
ATOM   9019  N  NE    . ARG C 2  697  ? 479.847 -6.027  698.825 1.00 92.49  ? 697  ARG C NE    1 
ATOM   9020  C  CZ    . ARG C 2  697  ? 478.574 -5.671  699.015 1.00 99.05  ? 697  ARG C CZ    1 
ATOM   9021  N  NH1   . ARG C 2  697  ? 478.286 -4.451  699.491 1.00 96.40  ? 697  ARG C NH1   1 
ATOM   9022  N  NH2   . ARG C 2  697  ? 477.588 -6.523  698.742 1.00 95.39  ? 697  ARG C NH2   1 
ATOM   9023  N  N     . ASP C 2  698  ? 483.504 -2.155  695.360 1.00 99.97  ? 698  ASP C N     1 
ATOM   9024  C  CA    . ASP C 2  698  ? 484.024 -2.483  694.024 1.00 101.26 ? 698  ASP C CA    1 
ATOM   9025  C  C     . ASP C 2  698  ? 483.442 -3.787  693.487 1.00 99.11  ? 698  ASP C C     1 
ATOM   9026  O  O     . ASP C 2  698  ? 484.105 -4.533  692.753 1.00 98.44  ? 698  ASP C O     1 
ATOM   9027  C  CB    . ASP C 2  698  ? 485.560 -2.493  693.989 1.00 100.87 ? 698  ASP C CB    1 
ATOM   9028  C  CG    . ASP C 2  698  ? 486.144 -1.173  693.462 1.00 103.42 ? 698  ASP C CG    1 
ATOM   9029  O  OD1   . ASP C 2  698  ? 485.593 -0.587  692.497 1.00 101.17 ? 698  ASP C OD1   1 
ATOM   9030  O  OD2   . ASP C 2  698  ? 487.133 -0.695  694.055 1.00 105.07 ? 698  ASP C OD2   1 
ATOM   9031  N  N     . PHE C 2  699  ? 482.195 -4.072  693.838 1.00 94.16  ? 699  PHE C N     1 
ATOM   9032  C  CA    . PHE C 2  699  ? 481.527 -5.142  693.142 1.00 91.95  ? 699  PHE C CA    1 
ATOM   9033  C  C     . PHE C 2  699  ? 481.131 -4.618  691.768 1.00 94.19  ? 699  PHE C C     1 
ATOM   9034  O  O     . PHE C 2  699  ? 480.911 -3.417  691.576 1.00 94.07  ? 699  PHE C O     1 
ATOM   9035  C  CB    . PHE C 2  699  ? 480.324 -5.681  693.927 1.00 86.93  ? 699  PHE C CB    1 
ATOM   9036  C  CG    . PHE C 2  699  ? 480.675 -6.805  694.881 1.00 89.10  ? 699  PHE C CG    1 
ATOM   9037  C  CD1   . PHE C 2  699  ? 481.863 -6.806  695.591 1.00 92.73  ? 699  PHE C CD1   1 
ATOM   9038  C  CD2   . PHE C 2  699  ? 479.883 -7.936  694.956 1.00 89.87  ? 699  PHE C CD2   1 
ATOM   9039  C  CE1   . PHE C 2  699  ? 482.193 -7.868  696.440 1.00 87.09  ? 699  PHE C CE1   1 
ATOM   9040  C  CE2   . PHE C 2  699  ? 480.233 -9.011  695.782 1.00 85.00  ? 699  PHE C CE2   1 
ATOM   9041  C  CZ    . PHE C 2  699  ? 481.388 -8.974  696.511 1.00 77.09  ? 699  PHE C CZ    1 
ATOM   9042  N  N     . TYR C 2  700  ? 481.172 -5.508  690.783 1.00 91.16  ? 700  TYR C N     1 
ATOM   9043  C  CA    . TYR C 2  700  ? 480.820 -5.170  689.406 1.00 90.78  ? 700  TYR C CA    1 
ATOM   9044  C  C     . TYR C 2  700  ? 481.755 -4.123  688.802 1.00 93.31  ? 700  TYR C C     1 
ATOM   9045  O  O     . TYR C 2  700  ? 481.328 -3.277  688.022 1.00 92.93  ? 700  TYR C O     1 
ATOM   9046  C  CB    . TYR C 2  700  ? 479.333 -4.800  689.254 1.00 85.04  ? 700  TYR C CB    1 
ATOM   9047  C  CG    . TYR C 2  700  ? 478.522 -6.031  689.599 1.00 89.54  ? 700  TYR C CG    1 
ATOM   9048  C  CD1   . TYR C 2  700  ? 478.487 -7.118  688.733 1.00 87.51  ? 700  TYR C CD1   1 
ATOM   9049  C  CD2   . TYR C 2  700  ? 477.790 -6.119  690.778 1.00 94.06  ? 700  TYR C CD2   1 
ATOM   9050  C  CE1   . TYR C 2  700  ? 477.785 -8.277  689.044 1.00 85.63  ? 700  TYR C CE1   1 
ATOM   9051  C  CE2   . TYR C 2  700  ? 477.071 -7.280  691.102 1.00 89.42  ? 700  TYR C CE2   1 
ATOM   9052  C  CZ    . TYR C 2  700  ? 477.074 -8.345  690.225 1.00 90.93  ? 700  TYR C CZ    1 
ATOM   9053  O  OH    . TYR C 2  700  ? 476.381 -9.483  690.531 1.00 86.40  ? 700  TYR C OH    1 
ATOM   9054  N  N     . THR C 2  701  ? 483.003 -4.055  689.269 1.00 97.15  ? 701  THR C N     1 
ATOM   9055  C  CA    . THR C 2  701  ? 484.033 -3.256  688.604 1.00 96.31  ? 701  THR C CA    1 
ATOM   9056  C  C     . THR C 2  701  ? 484.926 -4.137  687.710 1.00 96.01  ? 701  THR C C     1 
ATOM   9057  O  O     . THR C 2  701  ? 485.393 -5.212  688.110 1.00 91.44  ? 701  THR C O     1 
ATOM   9058  C  CB    . THR C 2  701  ? 484.861 -2.473  689.622 1.00 100.73 ? 701  THR C CB    1 
ATOM   9059  O  OG1   . THR C 2  701  ? 484.007 -1.549  690.328 1.00 100.64 ? 701  THR C OG1   1 
ATOM   9060  C  CG2   . THR C 2  701  ? 485.950 -1.704  688.886 1.00 101.78 ? 701  THR C CG2   1 
ATOM   9061  N  N     . SER C 2  702  ? 485.173 -3.668  686.502 1.00 96.74  ? 702  SER C N     1 
ATOM   9062  C  CA    . SER C 2  702  ? 485.900 -4.430  685.507 1.00 90.74  ? 702  SER C CA    1 
ATOM   9063  C  C     . SER C 2  702  ? 486.875 -3.515  684.784 1.00 93.99  ? 702  SER C C     1 
ATOM   9064  O  O     . SER C 2  702  ? 486.615 -2.322  684.616 1.00 94.64  ? 702  SER C O     1 
ATOM   9065  C  CB    . SER C 2  702  ? 484.897 -5.120  684.600 1.00 88.52  ? 702  SER C CB    1 
ATOM   9066  O  OG    . SER C 2  702  ? 484.023 -4.163  684.037 1.00 88.14  ? 702  SER C OG    1 
ATOM   9067  N  N     . ILE C 2  703  ? 488.029 -4.083  684.406 1.00 98.23  ? 703  ILE C N     1 
ATOM   9068  C  CA    . ILE C 2  703  ? 489.094 -3.395  683.669 1.00 100.11 ? 703  ILE C CA    1 
ATOM   9069  C  C     . ILE C 2  703  ? 488.961 -3.560  682.154 1.00 97.99  ? 703  ILE C C     1 
ATOM   9070  O  O     . ILE C 2  703  ? 488.660 -4.647  681.638 1.00 93.17  ? 703  ILE C O     1 
ATOM   9071  C  CB    . ILE C 2  703  ? 490.453 -3.925  684.139 1.00 95.29  ? 703  ILE C CB    1 
ATOM   9072  C  CG1   . ILE C 2  703  ? 490.560 -3.739  685.648 1.00 95.41  ? 703  ILE C CG1   1 
ATOM   9073  C  CG2   . ILE C 2  703  ? 491.544 -3.188  683.424 1.00 94.19  ? 703  ILE C CG2   1 
ATOM   9074  C  CD1   . ILE C 2  703  ? 491.882 -4.122  686.224 1.00 96.77  ? 703  ILE C CD1   1 
ATOM   9075  N  N     . HIS C 2  704  ? 489.162 -2.457  681.434 1.00 100.29 ? 704  HIS C N     1 
ATOM   9076  C  CA    . HIS C 2  704  ? 489.032 -2.452  679.984 1.00 102.14 ? 704  HIS C CA    1 
ATOM   9077  C  C     . HIS C 2  704  ? 490.187 -1.703  679.328 1.00 101.17 ? 704  HIS C C     1 
ATOM   9078  O  O     . HIS C 2  704  ? 490.638 -0.680  679.844 1.00 102.56 ? 704  HIS C O     1 
ATOM   9079  C  CB    . HIS C 2  704  ? 487.687 -1.836  679.603 1.00 93.62  ? 704  HIS C CB    1 
ATOM   9080  C  CG    . HIS C 2  704  ? 486.544 -2.642  680.105 1.00 94.88  ? 704  HIS C CG    1 
ATOM   9081  N  ND1   . HIS C 2  704  ? 485.861 -3.537  679.315 1.00 99.08  ? 704  HIS C ND1   1 
ATOM   9082  C  CD2   . HIS C 2  704  ? 485.996 -2.728  681.338 1.00 98.50  ? 704  HIS C CD2   1 
ATOM   9083  C  CE1   . HIS C 2  704  ? 484.926 -4.129  680.037 1.00 99.98  ? 704  HIS C CE1   1 
ATOM   9084  N  NE2   . HIS C 2  704  ? 484.977 -3.645  681.265 1.00 98.45  ? 704  HIS C NE2   1 
ATOM   9085  N  N     . ILE C 2  705  ? 490.692 -2.223  678.210 1.00 101.41 ? 705  ILE C N     1 
ATOM   9086  C  CA    . ILE C 2  705  ? 491.808 -1.587  677.522 1.00 102.61 ? 705  ILE C CA    1 
ATOM   9087  C  C     . ILE C 2  705  ? 491.424 -1.325  676.073 1.00 103.22 ? 705  ILE C C     1 
ATOM   9088  O  O     . ILE C 2  705  ? 490.882 -2.216  675.411 1.00 105.54 ? 705  ILE C O     1 
ATOM   9089  C  CB    . ILE C 2  705  ? 493.062 -2.480  677.554 1.00 102.85 ? 705  ILE C CB    1 
ATOM   9090  C  CG1   . ILE C 2  705  ? 493.278 -3.069  678.947 1.00 103.76 ? 705  ILE C CG1   1 
ATOM   9091  C  CG2   . ILE C 2  705  ? 494.279 -1.690  677.134 1.00 100.30 ? 705  ILE C CG2   1 
ATOM   9092  C  CD1   . ILE C 2  705  ? 494.259 -4.233  678.952 1.00 105.39 ? 705  ILE C CD1   1 
ATOM   9093  N  N     . GLU C 2  706  ? 491.657 -0.103  675.587 1.00 107.24 ? 706  GLU C N     1 
ATOM   9094  C  CA    . GLU C 2  706  ? 491.442 0.195   674.176 1.00 108.53 ? 706  GLU C CA    1 
ATOM   9095  C  C     . GLU C 2  706  ? 492.807 0.493   673.571 1.00 105.07 ? 706  GLU C C     1 
ATOM   9096  O  O     . GLU C 2  706  ? 493.575 1.264   674.151 1.00 101.06 ? 706  GLU C O     1 
ATOM   9097  C  CB    . GLU C 2  706  ? 490.534 1.403   673.970 1.00 108.26 ? 706  GLU C CB    1 
ATOM   9098  C  CG    . GLU C 2  706  ? 489.946 1.494   672.574 1.00 108.86 ? 706  GLU C CG    1 
ATOM   9099  C  CD    . GLU C 2  706  ? 489.409 0.141   672.078 1.00 120.76 ? 706  GLU C CD    1 
ATOM   9100  O  OE1   . GLU C 2  706  ? 488.611 -0.504  672.815 1.00 122.43 ? 706  GLU C OE1   1 
ATOM   9101  O  OE2   . GLU C 2  706  ? 489.769 -0.267  670.947 1.00 126.38 ? 706  GLU C OE2   1 
ATOM   9102  N  N     . ARG C 2  707  ? 493.049 0.029   672.345 1.00 111.62 ? 707  ARG C N     1 
ATOM   9103  C  CA    . ARG C 2  707  ? 494.332 0.216   671.658 1.00 105.79 ? 707  ARG C CA    1 
ATOM   9104  C  C     . ARG C 2  707  ? 494.186 1.283   670.573 1.00 100.62 ? 707  ARG C C     1 
ATOM   9105  O  O     . ARG C 2  707  ? 493.217 1.271   669.801 1.00 101.05 ? 707  ARG C O     1 
ATOM   9106  C  CB    . ARG C 2  707  ? 494.909 -1.096  671.120 1.00 98.74  ? 707  ARG C CB    1 
ATOM   9107  C  CG    . ARG C 2  707  ? 494.840 -1.244  669.661 1.00 110.57 ? 707  ARG C CG    1 
ATOM   9108  C  CD    . ARG C 2  707  ? 495.506 -2.508  669.231 1.00 119.89 ? 707  ARG C CD    1 
ATOM   9109  N  NE    . ARG C 2  707  ? 495.420 -2.656  667.787 1.00 119.90 ? 707  ARG C NE    1 
ATOM   9110  C  CZ    . ARG C 2  707  ? 496.084 -3.578  667.116 1.00 122.54 ? 707  ARG C CZ    1 
ATOM   9111  N  NH1   . ARG C 2  707  ? 496.883 -4.408  667.777 1.00 118.71 ? 707  ARG C NH1   1 
ATOM   9112  N  NH2   . ARG C 2  707  ? 495.953 -3.663  665.796 1.00 131.43 ? 707  ARG C NH2   1 
ATOM   9113  N  N     . TYR C 2  708  ? 495.112 2.234   670.552 1.00 93.80  ? 708  TYR C N     1 
ATOM   9114  C  CA    . TYR C 2  708  ? 495.125 3.287   669.545 1.00 100.95 ? 708  TYR C CA    1 
ATOM   9115  C  C     . TYR C 2  708  ? 496.387 3.126   668.702 1.00 106.91 ? 708  TYR C C     1 
ATOM   9116  O  O     . TYR C 2  708  ? 497.444 2.786   669.238 1.00 112.20 ? 708  TYR C O     1 
ATOM   9117  C  CB    . TYR C 2  708  ? 495.102 4.624   670.262 1.00 96.90  ? 708  TYR C CB    1 
ATOM   9118  C  CG    . TYR C 2  708  ? 493.841 4.789   671.082 1.00 101.86 ? 708  TYR C CG    1 
ATOM   9119  C  CD1   . TYR C 2  708  ? 493.758 4.259   672.386 1.00 110.96 ? 708  TYR C CD1   1 
ATOM   9120  C  CD2   . TYR C 2  708  ? 492.744 5.488   670.595 1.00 101.24 ? 708  TYR C CD2   1 
ATOM   9121  C  CE1   . TYR C 2  708  ? 492.602 4.391   673.164 1.00 100.39 ? 708  TYR C CE1   1 
ATOM   9122  C  CE2   . TYR C 2  708  ? 491.589 5.636   671.364 1.00 103.47 ? 708  TYR C CE2   1 
ATOM   9123  C  CZ    . TYR C 2  708  ? 491.532 5.087   672.639 1.00 103.85 ? 708  TYR C CZ    1 
ATOM   9124  O  OH    . TYR C 2  708  ? 490.397 5.235   673.377 1.00 111.09 ? 708  TYR C OH    1 
ATOM   9125  N  N     . GLU C 2  709  ? 496.311 3.419   667.393 1.00 105.40 ? 709  GLU C N     1 
ATOM   9126  C  CA    . GLU C 2  709  ? 497.427 3.160   666.477 1.00 96.93  ? 709  GLU C CA    1 
ATOM   9127  C  C     . GLU C 2  709  ? 497.518 4.317   665.498 1.00 95.57  ? 709  GLU C C     1 
ATOM   9128  O  O     . GLU C 2  709  ? 496.505 4.868   665.078 1.00 102.72 ? 709  GLU C O     1 
ATOM   9129  C  CB    . GLU C 2  709  ? 497.211 1.800   665.760 1.00 97.01  ? 709  GLU C CB    1 
ATOM   9130  C  CG    . GLU C 2  709  ? 498.363 1.192   664.975 1.00 102.72 ? 709  GLU C CG    1 
ATOM   9131  C  CD    . GLU C 2  709  ? 498.017 -0.190  664.328 1.00 112.66 ? 709  GLU C CD    1 
ATOM   9132  O  OE1   . GLU C 2  709  ? 497.020 -0.267  663.569 1.00 119.92 ? 709  GLU C OE1   1 
ATOM   9133  O  OE2   . GLU C 2  709  ? 498.743 -1.201  664.573 1.00 101.41 ? 709  GLU C OE2   1 
ATOM   9134  N  N     . ILE C 2  710  ? 498.733 4.663   665.099 1.00 102.56 ? 710  ILE C N     1 
ATOM   9135  C  CA    . ILE C 2  710  ? 498.922 5.695   664.084 1.00 104.28 ? 710  ILE C CA    1 
ATOM   9136  C  C     . ILE C 2  710  ? 500.180 5.376   663.301 1.00 105.76 ? 710  ILE C C     1 
ATOM   9137  O  O     . ILE C 2  710  ? 501.159 4.864   663.857 1.00 105.51 ? 710  ILE C O     1 
ATOM   9138  C  CB    . ILE C 2  710  ? 499.005 7.098   664.723 1.00 102.12 ? 710  ILE C CB    1 
ATOM   9139  C  CG1   . ILE C 2  710  ? 499.096 8.199   663.678 1.00 98.77  ? 710  ILE C CG1   1 
ATOM   9140  C  CG2   . ILE C 2  710  ? 500.252 7.211   665.555 1.00 106.02 ? 710  ILE C CG2   1 
ATOM   9141  C  CD1   . ILE C 2  710  ? 498.914 9.585   664.278 1.00 97.74  ? 710  ILE C CD1   1 
ATOM   9142  N  N     . GLU C 2  711  ? 500.124 5.638   661.992 1.00 115.36 ? 711  GLU C N     1 
ATOM   9143  C  CA    . GLU C 2  711  ? 501.239 5.441   661.067 1.00 110.94 ? 711  GLU C CA    1 
ATOM   9144  C  C     . GLU C 2  711  ? 501.790 6.787   660.619 1.00 107.14 ? 711  GLU C C     1 
ATOM   9145  O  O     . GLU C 2  711  ? 501.035 7.732   660.369 1.00 110.57 ? 711  GLU C O     1 
ATOM   9146  C  CB    . GLU C 2  711  ? 500.773 4.670   659.832 1.00 103.06 ? 711  GLU C CB    1 
ATOM   9147  C  CG    . GLU C 2  711  ? 500.358 3.253   660.110 1.00 105.90 ? 711  GLU C CG    1 
ATOM   9148  C  CD    . GLU C 2  711  ? 499.818 2.543   658.884 1.00 107.79 ? 711  GLU C CD    1 
ATOM   9149  O  OE1   . GLU C 2  711  ? 499.450 3.222   657.882 1.00 98.47  ? 711  GLU C OE1   1 
ATOM   9150  O  OE2   . GLU C 2  711  ? 499.780 1.290   658.928 1.00 111.88 ? 711  GLU C OE2   1 
ATOM   9151  N  N     . ALA C 2  712  ? 503.102 6.861   660.477 1.00 110.07 ? 712  ALA C N     1 
ATOM   9152  C  CA    . ALA C 2  712  ? 503.743 7.995   659.823 1.00 121.87 ? 712  ALA C CA    1 
ATOM   9153  C  C     . ALA C 2  712  ? 504.335 7.476   658.522 1.00 116.39 ? 712  ALA C C     1 
ATOM   9154  O  O     . ALA C 2  712  ? 505.215 6.608   658.536 1.00 116.12 ? 712  ALA C O     1 
ATOM   9155  C  CB    . ALA C 2  712  ? 504.820 8.611   660.709 1.00 126.73 ? 712  ALA C CB    1 
ATOM   9156  N  N     . ARG C 2  713  ? 503.902 8.035   657.404 1.00 114.04 ? 713  ARG C N     1 
ATOM   9157  C  CA    . ARG C 2  713  ? 504.276 7.439   656.137 1.00 120.99 ? 713  ARG C CA    1 
ATOM   9158  C  C     . ARG C 2  713  ? 504.904 8.476   655.214 1.00 122.42 ? 713  ARG C C     1 
ATOM   9159  O  O     . ARG C 2  713  ? 504.715 9.688   655.365 1.00 122.65 ? 713  ARG C O     1 
ATOM   9160  C  CB    . ARG C 2  713  ? 503.040 6.825   655.463 1.00 120.51 ? 713  ARG C CB    1 
ATOM   9161  C  CG    . ARG C 2  713  ? 502.120 7.898   654.887 1.00 123.10 ? 713  ARG C CG    1 
ATOM   9162  C  CD    . ARG C 2  713  ? 501.010 7.318   654.035 1.00 127.14 ? 713  ARG C CD    1 
ATOM   9163  N  NE    . ARG C 2  713  ? 500.147 8.352   653.456 1.00 126.88 ? 713  ARG C NE    1 
ATOM   9164  C  CZ    . ARG C 2  713  ? 500.183 8.721   652.177 1.00 124.10 ? 713  ARG C CZ    1 
ATOM   9165  N  NH1   . ARG C 2  713  ? 501.037 8.131   651.344 1.00 125.14 ? 713  ARG C NH1   1 
ATOM   9166  N  NH2   . ARG C 2  713  ? 499.364 9.668   651.727 1.00 118.08 ? 713  ARG C NH2   1 
ATOM   9167  N  N     . ASP C 2  714  ? 505.613 7.976   654.209 1.00 119.98 ? 714  ASP C N     1 
ATOM   9168  C  CA    . ASP C 2  714  ? 506.149 8.844   653.181 1.00 117.38 ? 714  ASP C CA    1 
ATOM   9169  C  C     . ASP C 2  714  ? 505.033 9.270   652.242 1.00 119.84 ? 714  ASP C C     1 
ATOM   9170  O  O     . ASP C 2  714  ? 504.237 8.443   651.785 1.00 118.66 ? 714  ASP C O     1 
ATOM   9171  C  CB    . ASP C 2  714  ? 507.263 8.095   652.461 1.00 113.45 ? 714  ASP C CB    1 
ATOM   9172  C  CG    . ASP C 2  714  ? 508.535 8.065   653.280 1.00 112.51 ? 714  ASP C CG    1 
ATOM   9173  O  OD1   . ASP C 2  714  ? 508.929 9.148   653.787 1.00 111.44 ? 714  ASP C OD1   1 
ATOM   9174  O  OD2   . ASP C 2  714  ? 509.086 6.951   653.481 1.00 106.04 ? 714  ASP C OD2   1 
ATOM   9175  N  N     . THR C 2  715  ? 505.001 10.557  651.929 1.00 121.41 ? 715  THR C N     1 
ATOM   9176  C  CA    . THR C 2  715  ? 504.046 11.130  651.000 1.00 122.82 ? 715  THR C CA    1 
ATOM   9177  C  C     . THR C 2  715  ? 504.813 11.832  649.899 1.00 124.46 ? 715  THR C C     1 
ATOM   9178  O  O     . THR C 2  715  ? 506.004 12.121  650.048 1.00 122.88 ? 715  THR C O     1 
ATOM   9179  C  CB    . THR C 2  715  ? 503.103 12.123  651.673 1.00 122.37 ? 715  THR C CB    1 
ATOM   9180  O  OG1   . THR C 2  715  ? 503.871 13.082  652.402 1.00 128.84 ? 715  THR C OG1   1 
ATOM   9181  C  CG2   . THR C 2  715  ? 502.198 11.400  652.634 1.00 124.25 ? 715  THR C CG2   1 
ATOM   9182  N  N     . LYS C 2  716  ? 504.108 12.137  648.803 1.00 127.80 ? 716  LYS C N     1 
ATOM   9183  C  CA    . LYS C 2  716  ? 504.749 12.891  647.730 1.00 130.18 ? 716  LYS C CA    1 
ATOM   9184  C  C     . LYS C 2  716  ? 505.068 14.325  648.139 1.00 128.91 ? 716  LYS C C     1 
ATOM   9185  O  O     . LYS C 2  716  ? 505.798 15.011  647.412 1.00 128.56 ? 716  LYS C O     1 
ATOM   9186  C  CB    . LYS C 2  716  ? 503.872 12.893  646.475 1.00 124.17 ? 716  LYS C CB    1 
ATOM   9187  C  CG    . LYS C 2  716  ? 503.563 11.503  645.974 1.00 121.50 ? 716  LYS C CG    1 
ATOM   9188  C  CD    . LYS C 2  716  ? 503.041 11.505  644.551 1.00 110.61 ? 716  LYS C CD    1 
ATOM   9189  C  CE    . LYS C 2  716  ? 503.057 10.082  644.012 1.00 110.48 ? 716  LYS C CE    1 
ATOM   9190  N  NZ    . LYS C 2  716  ? 504.427 9.508   644.030 1.00 117.14 ? 716  LYS C NZ    1 
ATOM   9191  N  N     . LEU C 2  717  ? 504.505 14.799  649.247 1.00 121.12 ? 717  LEU C N     1 
ATOM   9192  C  CA    . LEU C 2  717  ? 504.741 16.138  649.763 1.00 115.57 ? 717  LEU C CA    1 
ATOM   9193  C  C     . LEU C 2  717  ? 505.814 16.166  650.851 1.00 117.09 ? 717  LEU C C     1 
ATOM   9194  O  O     . LEU C 2  717  ? 506.076 17.233  651.417 1.00 115.38 ? 717  LEU C O     1 
ATOM   9195  C  CB    . LEU C 2  717  ? 503.440 16.771  650.236 1.00 124.32 ? 717  LEU C CB    1 
ATOM   9196  C  CG    . LEU C 2  717  ? 502.509 17.327  649.148 1.00 123.62 ? 717  LEU C CG    1 
ATOM   9197  C  CD1   . LEU C 2  717  ? 502.471 16.489  647.868 1.00 120.49 ? 717  LEU C CD1   1 
ATOM   9198  C  CD2   . LEU C 2  717  ? 501.094 17.510  649.717 1.00 130.94 ? 717  LEU C CD2   1 
ATOM   9199  N  N     . GLY C 2  718  ? 506.427 15.018  651.163 1.00 119.00 ? 718  GLY C N     1 
ATOM   9200  C  CA    . GLY C 2  718  ? 507.369 14.875  652.253 1.00 117.62 ? 718  GLY C CA    1 
ATOM   9201  C  C     . GLY C 2  718  ? 506.911 14.019  653.415 1.00 125.71 ? 718  GLY C C     1 
ATOM   9202  O  O     . GLY C 2  718  ? 505.729 13.694  653.556 1.00 131.78 ? 718  GLY C O     1 
ATOM   9203  N  N     . PRO C 2  719  ? 507.858 13.645  654.283 1.00 126.98 ? 719  PRO C N     1 
ATOM   9204  C  CA    . PRO C 2  719  ? 507.563 12.656  655.323 1.00 128.19 ? 719  PRO C CA    1 
ATOM   9205  C  C     . PRO C 2  719  ? 506.622 13.174  656.407 1.00 126.41 ? 719  PRO C C     1 
ATOM   9206  O  O     . PRO C 2  719  ? 506.725 14.321  656.859 1.00 125.18 ? 719  PRO C O     1 
ATOM   9207  C  CB    . PRO C 2  719  ? 508.948 12.347  655.912 1.00 116.29 ? 719  PRO C CB    1 
ATOM   9208  C  CG    . PRO C 2  719  ? 509.675 13.583  655.752 1.00 112.55 ? 719  PRO C CG    1 
ATOM   9209  C  CD    . PRO C 2  719  ? 509.234 14.143  654.416 1.00 125.02 ? 719  PRO C CD    1 
ATOM   9210  N  N     . GLU C 2  720  ? 505.668 12.324  656.788 1.00 124.45 ? 720  GLU C N     1 
ATOM   9211  C  CA    . GLU C 2  720  ? 505.001 12.519  658.062 1.00 121.55 ? 720  GLU C CA    1 
ATOM   9212  C  C     . GLU C 2  720  ? 506.002 12.212  659.163 1.00 121.30 ? 720  GLU C C     1 
ATOM   9213  O  O     . GLU C 2  720  ? 506.727 11.212  659.107 1.00 115.69 ? 720  GLU C O     1 
ATOM   9214  C  CB    . GLU C 2  720  ? 503.790 11.597  658.197 1.00 112.06 ? 720  GLU C CB    1 
ATOM   9215  C  CG    . GLU C 2  720  ? 502.606 11.966  657.340 1.00 114.73 ? 720  GLU C CG    1 
ATOM   9216  C  CD    . GLU C 2  720  ? 501.479 10.943  657.430 1.00 116.44 ? 720  GLU C CD    1 
ATOM   9217  O  OE1   . GLU C 2  720  ? 501.742 9.793   657.856 1.00 115.85 ? 720  GLU C OE1   1 
ATOM   9218  O  OE2   . GLU C 2  720  ? 500.326 11.292  657.088 1.00 114.14 ? 720  GLU C OE2   1 
ATOM   9219  N  N     . ARG C 2  721  ? 506.029 13.059  660.179 1.00 125.59 ? 721  ARG C N     1 
ATOM   9220  C  CA    . ARG C 2  721  ? 506.933 12.856  661.295 1.00 124.84 ? 721  ARG C CA    1 
ATOM   9221  C  C     . ARG C 2  721  ? 506.174 12.879  662.613 1.00 122.51 ? 721  ARG C C     1 
ATOM   9222  O  O     . ARG C 2  721  ? 505.324 13.746  662.858 1.00 116.27 ? 721  ARG C O     1 
ATOM   9223  C  CB    . ARG C 2  721  ? 508.046 13.898  661.260 1.00 125.69 ? 721  ARG C CB    1 
ATOM   9224  C  CG    . ARG C 2  721  ? 509.059 13.649  660.148 1.00 136.45 ? 721  ARG C CG    1 
ATOM   9225  C  CD    . ARG C 2  721  ? 510.205 14.647  660.229 1.00 145.51 ? 721  ARG C CD    1 
ATOM   9226  N  NE    . ARG C 2  721  ? 509.906 15.764  659.335 1.00 149.99 ? 721  ARG C NE    1 
ATOM   9227  C  CZ    . ARG C 2  721  ? 509.246 16.864  659.695 1.00 153.59 ? 721  ARG C CZ    1 
ATOM   9228  N  NH1   . ARG C 2  721  ? 508.799 17.017  660.951 1.00 141.71 ? 721  ARG C NH1   1 
ATOM   9229  N  NH2   . ARG C 2  721  ? 509.028 17.810  658.786 1.00 148.44 ? 721  ARG C NH2   1 
ATOM   9230  N  N     . ILE C 2  722  ? 506.535 11.924  663.462 1.00 121.81 ? 722  ILE C N     1 
ATOM   9231  C  CA    . ILE C 2  722  ? 506.030 11.805  664.821 1.00 119.43 ? 722  ILE C CA    1 
ATOM   9232  C  C     . ILE C 2  722  ? 506.989 12.543  665.741 1.00 122.77 ? 722  ILE C C     1 
ATOM   9233  O  O     . ILE C 2  722  ? 508.122 12.109  665.972 1.00 123.83 ? 722  ILE C O     1 
ATOM   9234  C  CB    . ILE C 2  722  ? 505.851 10.336  665.210 1.00 117.01 ? 722  ILE C CB    1 
ATOM   9235  C  CG1   . ILE C 2  722  ? 504.571 9.815   664.558 1.00 116.26 ? 722  ILE C CG1   1 
ATOM   9236  C  CG2   . ILE C 2  722  ? 505.902 10.133  666.701 1.00 119.18 ? 722  ILE C CG2   1 
ATOM   9237  C  CD1   . ILE C 2  722  ? 504.522 8.342   664.425 1.00 119.49 ? 722  ILE C CD1   1 
ATOM   9238  N  N     . THR C 2  723  ? 506.519 13.658  666.281 1.00 122.34 ? 723  THR C N     1 
ATOM   9239  C  CA    . THR C 2  723  ? 507.388 14.620  666.921 1.00 126.98 ? 723  THR C CA    1 
ATOM   9240  C  C     . THR C 2  723  ? 506.705 15.275  668.111 1.00 133.98 ? 723  THR C C     1 
ATOM   9241  O  O     . THR C 2  723  ? 505.477 15.282  668.230 1.00 131.03 ? 723  THR C O     1 
ATOM   9242  C  CB    . THR C 2  723  ? 507.748 15.710  665.931 1.00 124.93 ? 723  THR C CB    1 
ATOM   9243  O  OG1   . THR C 2  723  ? 508.366 16.788  666.637 1.00 136.56 ? 723  THR C OG1   1 
ATOM   9244  C  CG2   . THR C 2  723  ? 506.478 16.206  665.240 1.00 118.16 ? 723  THR C CG2   1 
ATOM   9245  N  N     . ARG C 2  724  ? 507.525 15.793  669.024 1.00 135.99 ? 724  ARG C N     1 
ATOM   9246  C  CA    . ARG C 2  724  ? 506.970 16.564  670.124 1.00 133.68 ? 724  ARG C CA    1 
ATOM   9247  C  C     . ARG C 2  724  ? 506.725 18.018  669.722 1.00 137.25 ? 724  ARG C C     1 
ATOM   9248  O  O     . ARG C 2  724  ? 506.116 18.766  670.495 1.00 134.10 ? 724  ARG C O     1 
ATOM   9249  C  CB    . ARG C 2  724  ? 507.893 16.498  671.334 1.00 130.14 ? 724  ARG C CB    1 
ATOM   9250  C  CG    . ARG C 2  724  ? 507.230 16.874  672.612 1.00 126.91 ? 724  ARG C CG    1 
ATOM   9251  C  CD    . ARG C 2  724  ? 508.250 17.056  673.685 1.00 134.47 ? 724  ARG C CD    1 
ATOM   9252  N  NE    . ARG C 2  724  ? 507.621 17.093  674.994 1.00 135.56 ? 724  ARG C NE    1 
ATOM   9253  C  CZ    . ARG C 2  724  ? 507.027 18.165  675.499 1.00 143.37 ? 724  ARG C CZ    1 
ATOM   9254  N  NH1   . ARG C 2  724  ? 506.988 19.289  674.791 1.00 142.31 ? 724  ARG C NH1   1 
ATOM   9255  N  NH2   . ARG C 2  724  ? 506.469 18.112  676.706 1.00 147.01 ? 724  ARG C NH2   1 
ATOM   9256  N  N     . ASP C 2  725  ? 507.228 18.439  668.553 1.00 135.51 ? 725  ASP C N     1 
ATOM   9257  C  CA    . ASP C 2  725  ? 507.098 19.813  668.062 1.00 135.46 ? 725  ASP C CA    1 
ATOM   9258  C  C     . ASP C 2  725  ? 505.869 19.889  667.168 1.00 138.20 ? 725  ASP C C     1 
ATOM   9259  O  O     . ASP C 2  725  ? 505.894 19.433  666.022 1.00 139.01 ? 725  ASP C O     1 
ATOM   9260  C  CB    . ASP C 2  725  ? 508.369 20.222  667.321 1.00 137.73 ? 725  ASP C CB    1 
ATOM   9261  C  CG    . ASP C 2  725  ? 508.479 21.729  667.084 1.00 142.55 ? 725  ASP C CG    1 
ATOM   9262  O  OD1   . ASP C 2  725  ? 507.441 22.406  666.888 1.00 137.32 ? 725  ASP C OD1   1 
ATOM   9263  O  OD2   . ASP C 2  725  ? 509.624 22.237  667.100 1.00 149.76 ? 725  ASP C OD2   1 
ATOM   9264  N  N     . ILE C 2  726  ? 504.787 20.449  667.699 1.00 134.08 ? 726  ILE C N     1 
ATOM   9265  C  CA    . ILE C 2  726  ? 503.515 20.588  667.001 1.00 132.92 ? 726  ILE C CA    1 
ATOM   9266  C  C     . ILE C 2  726  ? 503.051 22.043  666.945 1.00 136.52 ? 726  ILE C C     1 
ATOM   9267  O  O     . ILE C 2  726  ? 502.941 22.701  667.982 1.00 138.78 ? 726  ILE C O     1 
ATOM   9268  C  CB    . ILE C 2  726  ? 502.447 19.659  667.599 1.00 134.47 ? 726  ILE C CB    1 
ATOM   9269  C  CG1   . ILE C 2  726  ? 502.987 18.221  667.558 1.00 127.13 ? 726  ILE C CG1   1 
ATOM   9270  C  CG2   . ILE C 2  726  ? 501.129 19.789  666.872 1.00 135.14 ? 726  ILE C CG2   1 
ATOM   9271  C  CD1   . ILE C 2  726  ? 503.292 17.600  668.878 1.00 132.31 ? 726  ILE C CD1   1 
ATOM   9272  N  N     . PRO C 2  727  ? 502.841 22.597  665.752 1.00 141.57 ? 727  PRO C N     1 
ATOM   9273  C  CA    . PRO C 2  727  ? 502.483 24.021  665.587 1.00 151.77 ? 727  PRO C CA    1 
ATOM   9274  C  C     . PRO C 2  727  ? 501.313 24.544  666.426 1.00 151.42 ? 727  PRO C C     1 
ATOM   9275  O  O     . PRO C 2  727  ? 500.248 23.931  666.504 1.00 151.73 ? 727  PRO C O     1 
ATOM   9276  C  CB    . PRO C 2  727  ? 502.184 24.129  664.086 1.00 150.20 ? 727  PRO C CB    1 
ATOM   9277  C  CG    . PRO C 2  727  ? 501.804 22.755  663.671 1.00 145.36 ? 727  PRO C CG    1 
ATOM   9278  C  CD    . PRO C 2  727  ? 502.675 21.842  664.501 1.00 140.79 ? 727  PRO C CD    1 
ATOM   9279  N  N     . HIS C 2  728  ? 501.539 25.708  667.051 1.00 152.45 ? 728  HIS C N     1 
ATOM   9280  C  CA    . HIS C 2  728  ? 500.542 26.527  667.757 1.00 153.19 ? 728  HIS C CA    1 
ATOM   9281  C  C     . HIS C 2  728  ? 499.966 25.875  669.011 1.00 157.96 ? 728  HIS C C     1 
ATOM   9282  O  O     . HIS C 2  728  ? 498.824 26.157  669.384 1.00 163.26 ? 728  HIS C O     1 
ATOM   9283  C  CB    . HIS C 2  728  ? 499.355 26.859  666.841 1.00 158.17 ? 728  HIS C CB    1 
ATOM   9284  C  CG    . HIS C 2  728  ? 499.722 27.483  665.535 1.00 165.90 ? 728  HIS C CG    1 
ATOM   9285  N  ND1   . HIS C 2  728  ? 499.469 28.805  665.242 1.00 172.59 ? 728  HIS C ND1   1 
ATOM   9286  C  CD2   . HIS C 2  728  ? 500.270 26.947  664.418 1.00 167.9