data_6OY6
# 
_entry.id   6OY6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6OY6         
WWPDB D_1000241583 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6OY6 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shin, Y.'       1 ? 
'Murakami, K.S.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                2144 
_citation.page_last                 2155 
_citation.title                     
'Structural basis of reiterative transcription from the pyrG and pyrBI promoters by bacterial RNA polymerase.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkz1221 
_citation.pdbx_database_id_PubMed   31965171 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shin, Y.'       1 ? 
primary 'Hedglin, M.'    2 ? 
primary 'Murakami, K.S.' 3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.81 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6OY6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     186.882 
_cell.length_a_esd                 ? 
_cell.length_b                     102.138 
_cell.length_b_esd                 ? 
_cell.length_c                     297.364 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6OY6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                        35056.164  2 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                         125436.539 1 2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
168546.672 1 2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                        11533.316  1 2.7.7.6 ? ? ? 
5  polymer     nat 'RNA polymerase sigma factor SigA'                                                 48598.031  1 ?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(P*CP*CP*TP*GP*CP*AP*TP*CP*AP*GP*AP*GP*CP*CP*CP*AP*AP*AP*A)-3')
;
6674.347   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*GP*AP*TP*CP*TP*GP*AP*TP*GP*CP*AP*GP*G)-3')
;
8436.442   1 ?       ? ? ? 
8  polymer     syn 
;RNA (5'-D(*(GTP))-R(P*GP*GP*G)-3')
;
1495.825   1 ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                    24.305     3 ?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                         65.409     2 ?       ? ? ? 
11 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                                        523.180    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DA)(DG)(DA)(DG)(DC)(DC)(DC)(DA)(DA)(DA)(DA)(DT)
(DA)(DC)
;
CCTGCATCAGAGCCCAAAATAC G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DT)(DC)(DT)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGGATCTGATGCAGG H   ? 
8 polyribonucleotide      no yes '(GTP)GGG' GGGG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    LYS n 
5 3    LYS n 
5 4    SER n 
5 5    LYS n 
5 6    ARG n 
5 7    LYS n 
5 8    ASN n 
5 9    ALA n 
5 10   GLN n 
5 11   ALA n 
5 12   GLN n 
5 13   GLU n 
5 14   ALA n 
5 15   GLN n 
5 16   GLU n 
5 17   THR n 
5 18   GLU n 
5 19   VAL n 
5 20   LEU n 
5 21   VAL n 
5 22   GLN n 
5 23   GLU n 
5 24   GLU n 
5 25   ALA n 
5 26   GLU n 
5 27   GLU n 
5 28   LEU n 
5 29   PRO n 
5 30   GLU n 
5 31   PHE n 
5 32   PRO n 
5 33   GLU n 
5 34   GLY n 
5 35   GLU n 
5 36   PRO n 
5 37   ASP n 
5 38   PRO n 
5 39   ASP n 
5 40   LEU n 
5 41   GLU n 
5 42   ASP n 
5 43   PRO n 
5 44   ASP n 
5 45   LEU n 
5 46   THR n 
5 47   LEU n 
5 48   GLU n 
5 49   ASP n 
5 50   ASP n 
5 51   LEU n 
5 52   LEU n 
5 53   ASP n 
5 54   LEU n 
5 55   PRO n 
5 56   GLU n 
5 57   GLU n 
5 58   GLY n 
5 59   GLU n 
5 60   GLY n 
5 61   LEU n 
5 62   ASP n 
5 63   LEU n 
5 64   GLU n 
5 65   GLU n 
5 66   GLU n 
5 67   GLU n 
5 68   GLU n 
5 69   ASP n 
5 70   LEU n 
5 71   PRO n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ILE n 
5 76   SER n 
5 77   THR n 
5 78   SER n 
5 79   ASP n 
5 80   PRO n 
5 81   VAL n 
5 82   ARG n 
5 83   GLN n 
5 84   TYR n 
5 85   LEU n 
5 86   HIS n 
5 87   GLU n 
5 88   ILE n 
5 89   GLY n 
5 90   GLN n 
5 91   VAL n 
5 92   PRO n 
5 93   LEU n 
5 94   LEU n 
5 95   THR n 
5 96   LEU n 
5 97   GLU n 
5 98   GLU n 
5 99   GLU n 
5 100  VAL n 
5 101  GLU n 
5 102  LEU n 
5 103  ALA n 
5 104  ARG n 
5 105  LYS n 
5 106  VAL n 
5 107  GLU n 
5 108  GLU n 
5 109  GLY n 
5 110  MET n 
5 111  GLU n 
5 112  ALA n 
5 113  ILE n 
5 114  LYS n 
5 115  LYS n 
5 116  LEU n 
5 117  SER n 
5 118  GLU n 
5 119  ILE n 
5 120  THR n 
5 121  GLY n 
5 122  LEU n 
5 123  ASP n 
5 124  PRO n 
5 125  ASP n 
5 126  LEU n 
5 127  ILE n 
5 128  ARG n 
5 129  GLU n 
5 130  VAL n 
5 131  VAL n 
5 132  ARG n 
5 133  ALA n 
5 134  LYS n 
5 135  ILE n 
5 136  LEU n 
5 137  GLY n 
5 138  SER n 
5 139  ALA n 
5 140  ARG n 
5 141  VAL n 
5 142  ARG n 
5 143  HIS n 
5 144  ILE n 
5 145  PRO n 
5 146  GLY n 
5 147  LEU n 
5 148  LYS n 
5 149  GLU n 
5 150  THR n 
5 151  LEU n 
5 152  ASP n 
5 153  PRO n 
5 154  LYS n 
5 155  THR n 
5 156  VAL n 
5 157  GLU n 
5 158  GLU n 
5 159  ILE n 
5 160  ASP n 
5 161  GLN n 
5 162  LYS n 
5 163  LEU n 
5 164  LYS n 
5 165  SER n 
5 166  LEU n 
5 167  PRO n 
5 168  LYS n 
5 169  GLU n 
5 170  HIS n 
5 171  LYS n 
5 172  ARG n 
5 173  TYR n 
5 174  LEU n 
5 175  HIS n 
5 176  ILE n 
5 177  ALA n 
5 178  ARG n 
5 179  GLU n 
5 180  GLY n 
5 181  GLU n 
5 182  ALA n 
5 183  ALA n 
5 184  ARG n 
5 185  GLN n 
5 186  HIS n 
5 187  LEU n 
5 188  ILE n 
5 189  GLU n 
5 190  ALA n 
5 191  ASN n 
5 192  LEU n 
5 193  ARG n 
5 194  LEU n 
5 195  VAL n 
5 196  VAL n 
5 197  SER n 
5 198  ILE n 
5 199  ALA n 
5 200  LYS n 
5 201  LYS n 
5 202  TYR n 
5 203  THR n 
5 204  GLY n 
5 205  ARG n 
5 206  GLY n 
5 207  LEU n 
5 208  SER n 
5 209  PHE n 
5 210  LEU n 
5 211  ASP n 
5 212  LEU n 
5 213  ILE n 
5 214  GLN n 
5 215  GLU n 
5 216  GLY n 
5 217  ASN n 
5 218  GLN n 
5 219  GLY n 
5 220  LEU n 
5 221  ILE n 
5 222  ARG n 
5 223  ALA n 
5 224  VAL n 
5 225  GLU n 
5 226  LYS n 
5 227  PHE n 
5 228  GLU n 
5 229  TYR n 
5 230  LYS n 
5 231  ARG n 
5 232  ARG n 
5 233  PHE n 
5 234  LYS n 
5 235  PHE n 
5 236  SER n 
5 237  THR n 
5 238  TYR n 
5 239  ALA n 
5 240  THR n 
5 241  TRP n 
5 242  TRP n 
5 243  ILE n 
5 244  ARG n 
5 245  GLN n 
5 246  ALA n 
5 247  ILE n 
5 248  ASN n 
5 249  ARG n 
5 250  ALA n 
5 251  ILE n 
5 252  ALA n 
5 253  ASP n 
5 254  GLN n 
5 255  ALA n 
5 256  ARG n 
5 257  THR n 
5 258  ILE n 
5 259  ARG n 
5 260  ILE n 
5 261  PRO n 
5 262  VAL n 
5 263  HIS n 
5 264  MET n 
5 265  VAL n 
5 266  GLU n 
5 267  THR n 
5 268  ILE n 
5 269  ASN n 
5 270  LYS n 
5 271  LEU n 
5 272  SER n 
5 273  ARG n 
5 274  THR n 
5 275  ALA n 
5 276  ARG n 
5 277  GLN n 
5 278  LEU n 
5 279  GLN n 
5 280  GLN n 
5 281  GLU n 
5 282  LEU n 
5 283  GLY n 
5 284  ARG n 
5 285  GLU n 
5 286  PRO n 
5 287  THR n 
5 288  TYR n 
5 289  GLU n 
5 290  GLU n 
5 291  ILE n 
5 292  ALA n 
5 293  GLU n 
5 294  ALA n 
5 295  MET n 
5 296  GLY n 
5 297  PRO n 
5 298  GLY n 
5 299  TRP n 
5 300  ASP n 
5 301  ALA n 
5 302  LYS n 
5 303  ARG n 
5 304  VAL n 
5 305  GLU n 
5 306  GLU n 
5 307  THR n 
5 308  LEU n 
5 309  LYS n 
5 310  ILE n 
5 311  ALA n 
5 312  GLN n 
5 313  GLU n 
5 314  PRO n 
5 315  VAL n 
5 316  SER n 
5 317  LEU n 
5 318  GLU n 
5 319  THR n 
5 320  PRO n 
5 321  ILE n 
5 322  GLY n 
5 323  ASP n 
5 324  GLU n 
5 325  LYS n 
5 326  ASP n 
5 327  SER n 
5 328  PHE n 
5 329  TYR n 
5 330  GLY n 
5 331  ASP n 
5 332  PHE n 
5 333  ILE n 
5 334  PRO n 
5 335  ASP n 
5 336  GLU n 
5 337  HIS n 
5 338  LEU n 
5 339  PRO n 
5 340  SER n 
5 341  PRO n 
5 342  VAL n 
5 343  ASP n 
5 344  ALA n 
5 345  ALA n 
5 346  THR n 
5 347  GLN n 
5 348  SER n 
5 349  LEU n 
5 350  LEU n 
5 351  SER n 
5 352  GLU n 
5 353  GLU n 
5 354  LEU n 
5 355  GLU n 
5 356  LYS n 
5 357  ALA n 
5 358  LEU n 
5 359  SER n 
5 360  LYS n 
5 361  LEU n 
5 362  SER n 
5 363  GLU n 
5 364  ARG n 
5 365  GLU n 
5 366  ALA n 
5 367  MET n 
5 368  VAL n 
5 369  LEU n 
5 370  LYS n 
5 371  LEU n 
5 372  ARG n 
5 373  LYS n 
5 374  GLY n 
5 375  LEU n 
5 376  ILE n 
5 377  ASP n 
5 378  GLY n 
5 379  ARG n 
5 380  GLU n 
5 381  HIS n 
5 382  THR n 
5 383  LEU n 
5 384  GLU n 
5 385  GLU n 
5 386  VAL n 
5 387  GLY n 
5 388  ALA n 
5 389  PHE n 
5 390  PHE n 
5 391  GLY n 
5 392  VAL n 
5 393  THR n 
5 394  ARG n 
5 395  GLU n 
5 396  ARG n 
5 397  ILE n 
5 398  ARG n 
5 399  GLN n 
5 400  ILE n 
5 401  GLU n 
5 402  ASN n 
5 403  LYS n 
5 404  ALA n 
5 405  LEU n 
5 406  ARG n 
5 407  LYS n 
5 408  LEU n 
5 409  LYS n 
5 410  TYR n 
5 411  HIS n 
5 412  GLU n 
5 413  SER n 
5 414  ARG n 
5 415  THR n 
5 416  ARG n 
5 417  LYS n 
5 418  LEU n 
5 419  ARG n 
5 420  ASP n 
5 421  PHE n 
5 422  LEU n 
5 423  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DA  n 
6 10   DG  n 
6 11   DA  n 
6 12   DG  n 
6 13   DC  n 
6 14   DC  n 
6 15   DC  n 
6 16   DA  n 
6 17   DA  n 
6 18   DA  n 
6 19   DA  n 
6 20   DT  n 
6 21   DA  n 
6 22   DC  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DG  n 
7 16   DA  n 
7 17   DT  n 
7 18   DC  n 
7 19   DT  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    GTP n 
8 2    G   n 
8 3    G   n 
8 4    G   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 1502 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 1 423  ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 22 'Bacillus subtilis'    ? 1423 ? 
7 1 sample 1 27 'Bacillus subtilis'    ? 1423 ? 
8 1 sample 1 4  'Thermus thermophilus' ? 274  ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THETH       Q9Z9H6     ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8       Q8RQE9     ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8       Q8RQE8     ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEA
;
1 
4 UNP A0A1J1EUF1_THETH A0A1J1EUF1 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP SIGA_THET2       Q72L95     ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 6OY6             6OY6       ? 6 ? 1 
7 PDB 6OY6             6OY6       ? 7 ? 1 
8 PDB 6OY6             6OY6       ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6OY6 A 1 ? 315  ? Q9Z9H6     1 ? 315  ? 1 315  
2 1 6OY6 B 1 ? 315  ? Q9Z9H6     1 ? 315  ? 1 315  
3 2 6OY6 C 1 ? 1119 ? Q8RQE9     1 ? 1119 ? 1 1119 
4 3 6OY6 D 1 ? 1502 ? Q8RQE8     1 ? 1502 ? 1 1502 
5 4 6OY6 E 1 ? 99   ? A0A1J1EUF1 1 ? 99   ? 1 99   
6 5 6OY6 F 1 ? 423  ? Q72L95     1 ? 423  ? 1 423  
7 6 6OY6 G 1 ? 22   ? 6OY6       3 ? 24   ? 3 24   
8 7 6OY6 H 1 ? 27   ? 6OY6       1 ? 25   ? 1 25   
9 8 6OY6 I 1 ? 4    ? 6OY6       5 ? 8    ? 5 8    
# 
_struct_ref_seq_dif.align_id                     6 
_struct_ref_seq_dif.pdbx_pdb_id_code             6OY6 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           F 
_struct_ref_seq_dif.seq_num                      46 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q72L95 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          46 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            46 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"          ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6OY6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.16 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris-HCl (pH 8), 0.2M KCl, 50 mM MgCl2, 9.5 % PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-06-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6OY6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.1 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       88633 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             88 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.64 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.202 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.072 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.1 
_reflns_shell.d_res_low                   3.17 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.64 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2805 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            1.107 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.695 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.488 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6OY6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.096 
_refine.ls_d_res_low                             43.666 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     88331 
_refine.ls_number_reflns_R_free                  2024 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.32 
_refine.ls_percent_reflns_R_free                 2.29 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2132 
_refine.ls_R_factor_R_free                       0.2648 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2119 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5VO8 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.75 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.43 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.096 
_refine_hist.d_res_low                        43.666 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28578 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        27597 
_refine_hist.pdbx_number_atoms_nucleic_acid   944 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  ? 29188 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.562  ? 39676 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 24.975 ? 11333 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.087  ? 4465  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.011  ? 5036  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0960 3.1734  . . 80  3613 52.00  . . . 0.4406 . 0.3893 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1734 3.2592  . . 117 4482 64.00  . . . 0.3845 . 0.3477 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2592 3.3550  . . 117 5219 74.00  . . . 0.3477 . 0.3246 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3550 3.4633  . . 140 5841 83.00  . . . 0.3379 . 0.3140 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4633 3.5870  . . 145 6265 89.00  . . . 0.3678 . 0.3012 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5870 3.7305  . . 157 6328 90.00  . . . 0.3322 . 0.2774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7305 3.9002  . . 146 6430 91.00  . . . 0.3301 . 0.2548 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9002 4.1057  . . 150 6404 91.00  . . . 0.2934 . 0.2280 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1057 4.3627  . . 151 6519 93.00  . . . 0.2453 . 0.2063 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3627 4.6992  . . 161 6795 96.00  . . . 0.2466 . 0.1926 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6992 5.1714  . . 159 6975 99.00  . . . 0.2651 . 0.1960 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1714 5.9182  . . 168 7088 100.00 . . . 0.2904 . 0.2053 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9182 7.4503  . . 164 7117 100.00 . . . 0.2466 . 0.2038 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.4503 43.6705 . . 169 7231 100.00 . . . 0.1900 . 0.1478 . . . . . . . . . . 
# 
_struct.entry_id                     6OY6 
_struct.title                        
'X-ray crystal structure of a bacterial reiterative transcription complex of pyrG promoter at 5 min' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6OY6 
_struct_keywords.text            'RNA polymerase, pyrG, reiterative transcription, TRANSCRIPTION-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
M N N 10 ? 
N N N 11 ? 
O N N 9  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? LEU B 85   ? ASP B 74   LEU B 85   1 ? 12 
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P12  AB3 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P13  AB4 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P14  AB5 PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P15  AB6 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  AB7 ASP C 203  ? LEU C 211  ? ASP C 203  LEU C 211  1 ? 9  
HELX_P HELX_P17  AB8 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P18  AB9 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P19  AC1 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P20  AC2 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P21  AC3 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P22  AC4 VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P23  AC5 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P24  AC6 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  AC7 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P26  AC8 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P27  AC9 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P28  AD1 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P29  AD2 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P30  AD3 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P31  AD4 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P32  AD5 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P33  AD6 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P34  AD7 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P35  AD8 LEU C 583  ? LEU C 592  ? LEU C 583  LEU C 592  1 ? 10 
HELX_P HELX_P36  AD9 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P37  AE1 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P38  AE2 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P39  AE3 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P40  AE4 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P41  AE5 ASN C 872  ? LEU C 874  ? ASN C 872  LEU C 874  5 ? 3  
HELX_P HELX_P42  AE6 GLY C 875  ? MET C 880  ? GLY C 875  MET C 880  1 ? 6  
HELX_P HELX_P43  AE7 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P44  AE8 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P45  AE9 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P46  AF1 THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P47  AF2 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P48  AF3 GLY C 1033 ? TYR C 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P49  AF4 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  AF5 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P51  AF6 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P52  AF7 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P53  AF8 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P54  AF9 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P55  AG1 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P56  AG2 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P57  AG3 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P58  AG4 THR D 154  ? TYR D 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P59  AG5 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P60  AG6 MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P61  AG7 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P62  AG8 ARG D 486  ? GLY D 506  ? ARG D 486  GLY D 506  1 ? 21 
HELX_P HELX_P63  AG9 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P64  AH1 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P65  AH2 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P66  AH3 PRO D 563  ? ASN D 584  ? PRO D 563  ASN D 584  1 ? 22 
HELX_P HELX_P67  AH4 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P68  AH5 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P69  AH6 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P70  AH7 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P71  AH8 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P72  AH9 GLN D 680  ? LYS D 684  ? GLN D 680  LYS D 684  5 ? 5  
HELX_P HELX_P73  AI1 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P74  AI2 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P75  AI3 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P76  AI4 SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P77  AI5 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P78  AI6 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P79  AI7 THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P80  AI8 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P81  AI9 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P82  AJ1 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P83  AJ2 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P84  AJ3 GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P85  AJ4 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P86  AJ5 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P87  AJ6 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P88  AJ7 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P89  AJ8 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P90  AJ9 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P91  AK1 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P92  AK2 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P93  AK3 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P94  AK4 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P95  AK5 PRO D 1232 ? GLN D 1235 ? PRO D 1232 GLN D 1235 5 ? 4  
HELX_P HELX_P96  AK6 GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P97  AK7 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P98  AK8 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P99  AK9 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P100 AL1 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P101 AL2 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P102 AL3 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P103 AL4 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P104 AL5 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P105 AL6 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P106 AL7 GLN D 1489 ? LYS D 1500 ? GLN D 1489 LYS D 1500 1 ? 12 
HELX_P HELX_P107 AL8 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P108 AL9 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P109 AM1 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P110 AM2 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P111 AM3 ASP F 79   ? GLY F 89   ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P112 AM4 THR F 95   ? GLY F 121  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P113 AM5 ASP F 123  ? GLY F 137  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P114 AM6 ASP F 152  ? SER F 165  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P115 AM7 PRO F 167  ? ASN F 191  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P116 AM8 ASN F 191  ? LYS F 200  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P117 AM9 LYS F 201  ? THR F 203  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P118 AN1 SER F 208  ? PHE F 227  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P119 AN2 GLU F 228  ? ARG F 232  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P120 AN3 LYS F 234  ? ALA F 255  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P121 AN4 PRO F 261  ? GLY F 283  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P122 AN5 THR F 287  ? MET F 295  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P123 AN6 ASP F 300  ? ALA F 311  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P124 AN7 PHE F 328  ? ILE F 333  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P125 AN8 SER F 340  ? SER F 359  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P126 AN9 SER F 362  ? ARG F 372  ? SER F 362  ARG F 372  1 ? 11 
HELX_P HELX_P127 AO1 GLU F 384  ? ALA F 388  ? GLU F 384  ALA F 388  5 ? 5  
HELX_P HELX_P128 AO2 GLU F 395  ? THR F 415  ? GLU F 395  THR F 415  1 ? 21 
HELX_P HELX_P129 AO3 ARG F 416  ? ASP F 423  ? ARG F 416  ASP F 423  5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? B GLU 154  OE2   ? ? ? 1_555 J MG .  MG ? ? B GLU 154  B MG 1601 1_555 ? ? ? ? ? ? ?               2.740 ? 
metalc2  metalc ?    ? D CYS 58   SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 58   D ZN 1602 1_555 ? ? ? ? ? ? ?               2.680 ? 
metalc3  metalc ?    ? D CYS 60   SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 60   D ZN 1602 1_555 ? ? ? ? ? ? ?               2.600 ? 
metalc4  metalc ?    ? D CYS 73   SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 73   D ZN 1602 1_555 ? ? ? ? ? ? ?               2.370 ? 
metalc5  metalc ?    ? D CYS 76   SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 76   D ZN 1602 1_555 ? ? ? ? ? ? ?               2.408 ? 
metalc6  metalc ?    ? D ASP 739  OD1   ? ? ? 1_555 K MG .  MG ? ? D ASP 739  D MG 1601 1_555 ? ? ? ? ? ? ?               2.384 ? 
metalc7  metalc ?    ? D ASP 739  OD2   ? ? ? 1_555 O MG .  MG ? ? D ASP 739  D MG 1605 1_555 ? ? ? ? ? ? ?               2.411 ? 
metalc8  metalc ?    ? D ASP 741  OD1   ? ? ? 1_555 K MG .  MG ? ? D ASP 741  D MG 1601 1_555 ? ? ? ? ? ? ?               2.681 ? 
metalc9  metalc ?    ? D ASP 743  OD1   ? ? ? 1_555 K MG .  MG ? ? D ASP 743  D MG 1601 1_555 ? ? ? ? ? ? ?               2.462 ? 
metalc10 metalc ?    ? D ASP 743  OD2   ? ? ? 1_555 K MG .  MG ? ? D ASP 743  D MG 1601 1_555 ? ? ? ? ? ? ?               2.985 ? 
metalc11 metalc ?    ? D LYS 840  O     ? ? ? 1_555 J MG .  MG ? ? D LYS 840  B MG 1601 1_555 ? ? ? ? ? ? ?               2.014 ? 
metalc12 metalc ?    ? D CYS 1112 SG    ? ? ? 1_555 M ZN .  ZN ? ? D CYS 1112 D ZN 1603 1_555 ? ? ? ? ? ? ?               2.340 ? 
metalc13 metalc ?    ? D CYS 1194 SG    ? ? ? 1_555 M ZN .  ZN ? ? D CYS 1194 D ZN 1603 1_555 ? ? ? ? ? ? ?               2.388 ? 
metalc14 metalc ?    ? D CYS 1201 SG    ? ? ? 1_555 M ZN .  ZN ? ? D CYS 1201 D ZN 1603 1_555 ? ? ? ? ? ? ?               2.446 ? 
metalc15 metalc ?    ? D CYS 1204 SG    ? ? ? 1_555 M ZN .  ZN ? ? D CYS 1204 D ZN 1603 1_555 ? ? ? ? ? ? ?               2.707 ? 
covale1  covale both ? I GTP 1    "O3'" ? ? ? 1_555 I G  2  P  ? ? I GTP 5    I G  6    1_555 ? ? ? ? ? ? ?               1.561 ? 
metalc16 metalc ?    ? I G   4    "O3'" ? ? ? 1_555 K MG .  MG ? ? I G   8    D MG 1601 1_555 ? ? ? ? ? ? ?               2.286 ? 
metalc17 metalc ?    ? N GTP .    O2G   ? ? ? 1_555 O MG .  MG ? ? D GTP 1604 D MG 1605 1_555 ? ? ? ? ? ? ?               2.373 ? 
metalc18 metalc ?    ? N GTP .    O1B   ? ? ? 1_555 O MG .  MG ? ? D GTP 1604 D MG 1605 1_555 ? ? ? ? ? ? ?               2.929 ? 
metalc19 metalc ?    ? N GTP .    O3A   ? ? ? 1_555 O MG .  MG ? ? D GTP 1604 D MG 1605 1_555 ? ? ? ? ? ? ?               2.987 ? 
metalc20 metalc ?    ? N GTP .    O1A   ? ? ? 1_555 O MG .  MG ? ? D GTP 1604 D MG 1605 1_555 ? ? ? ? ? ? ?               2.527 ? 
hydrog1  hydrog ?    ? G DC  1    N3    ? ? ? 1_555 H DG 27 N1 ? ? G DC  3    H DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ?    ? G DC  1    N4    ? ? ? 1_555 H DG 27 O6 ? ? G DC  3    H DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ?    ? G DC  1    O2    ? ? ? 1_555 H DG 27 N2 ? ? G DC  3    H DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ?    ? G DC  2    N3    ? ? ? 1_555 H DG 26 N1 ? ? G DC  4    H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ?    ? G DC  2    N4    ? ? ? 1_555 H DG 26 O6 ? ? G DC  4    H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ?    ? G DC  2    O2    ? ? ? 1_555 H DG 26 N2 ? ? G DC  4    H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ?    ? G DT  3    O4    ? ? ? 1_555 H DC 24 N4 ? ? G DT  5    H DC 22   1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog8  hydrog ?    ? G DG  4    N1    ? ? ? 1_555 H DC 24 O2 ? ? G DG  6    H DC 22   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog9  hydrog ?    ? G DC  5    N3    ? ? ? 1_555 H DG 23 N1 ? ? G DC  7    H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ?    ? G DC  5    N4    ? ? ? 1_555 H DG 23 O6 ? ? G DC  7    H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ?    ? G DC  5    O2    ? ? ? 1_555 H DG 23 N2 ? ? G DC  7    H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ?    ? G DA  6    N1    ? ? ? 1_555 H DT 22 N3 ? ? G DA  8    H DT 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ?    ? G DA  6    N6    ? ? ? 1_555 H DT 22 O4 ? ? G DA  8    H DT 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ?    ? G DT  7    N3    ? ? ? 1_555 H DA 21 N1 ? ? G DT  9    H DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ?    ? G DT  7    O4    ? ? ? 1_555 H DA 21 N6 ? ? G DT  9    H DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ?    ? G DC  8    N3    ? ? ? 1_555 H DG 20 N1 ? ? G DC  10   H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ?    ? G DC  8    N4    ? ? ? 1_555 H DG 20 O6 ? ? G DC  10   H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ?    ? G DC  8    O2    ? ? ? 1_555 H DG 20 N2 ? ? G DC  10   H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ?    ? G DA  9    N1    ? ? ? 1_555 H DT 19 N3 ? ? G DA  11   H DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ?    ? G DA  9    N6    ? ? ? 1_555 H DT 19 O4 ? ? G DA  11   H DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ?    ? G DG  10   N1    ? ? ? 1_555 H DC 18 N3 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ?    ? G DG  10   N2    ? ? ? 1_555 H DC 18 O2 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ?    ? G DG  10   O6    ? ? ? 1_555 H DC 18 N4 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ?    ? G DA  11   N1    ? ? ? 1_555 H DT 17 N3 ? ? G DA  13   H DT 15   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog25 hydrog ?    ? G DC  13   N3    ? ? ? 1_555 I G  4  N1 ? ? G DC  15   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ?    ? G DC  13   N4    ? ? ? 1_555 I G  4  O6 ? ? G DC  15   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ?    ? G DC  13   O2    ? ? ? 1_555 I G  4  N2 ? ? G DC  15   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ?    ? G DC  14   N3    ? ? ? 1_555 I G  3  N1 ? ? G DC  16   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ?    ? G DC  14   N4    ? ? ? 1_555 I G  3  O6 ? ? G DC  16   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ?    ? G DC  14   O2    ? ? ? 1_555 I G  3  N2 ? ? G DC  16   I G  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ?    ? G DC  14   N3    ? ? ? 1_555 I G  4  N1 ? ? G DC  16   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ?    ? G DC  14   N4    ? ? ? 1_555 I G  4  O6 ? ? G DC  16   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ?    ? G DC  14   O2    ? ? ? 1_555 I G  4  N2 ? ? G DC  16   I G  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ?    ? G DC  15   N3    ? ? ? 1_555 I G  2  N1 ? ? G DC  17   I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ?    ? G DC  15   N4    ? ? ? 1_555 I G  2  O6 ? ? G DC  17   I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ?    ? G DC  15   O2    ? ? ? 1_555 I G  2  N2 ? ? G DC  17   I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -13.31 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -7.69  
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 1.84   
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -7.25  
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 0.81   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 2 ? 
AC9 ? 8 ? 
AD1 ? 2 ? 
AD2 ? 3 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 5 ? 
AD9 ? 3 ? 
AE1 ? 4 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 2 ? 
AE5 ? 3 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 4 ? 
AF4 ? 3 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? parallel      
AC9 6 7 ? anti-parallel 
AC9 7 8 ? parallel      
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD8 4 5 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? parallel      
AE6 1 2 ? parallel      
AE6 2 3 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? anti-parallel 
AE8 1 2 ? parallel      
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? VAL A 13   ? VAL A 10   VAL A 13   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA1 4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA2 1 LEU A 99   ? ALA A 103  ? LEU A 99   ALA A 103  
AA2 2 LEU A 138  ? GLY A 147  ? LEU A 138  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? THR B 15   ? VAL B 10   THR B 15   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? ASP C 173  ? ILE C 172  ASP C 173  
AB6 4 SER C 183  ? VAL C 186  ? SER C 183  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 ILE C 496  ? ALA C 497  ? ILE C 496  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 GLU C 622  ? PRO C 624  ? GLU C 622  PRO C 624  
AC2 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC2 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC2 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC3 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC3 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC4 1 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC4 2 ALA C 656  ? ASP C 657  ? ALA C 656  ASP C 657  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLY C 669  ? ILE C 676  ? GLY C 669  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AC8 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AC9 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AC9 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AC9 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AC9 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AC9 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AC9 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AC9 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD1 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD2 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD2 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD2 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD3 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD3 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD4 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD4 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD4 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD5 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD5 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD6 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD6 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AD6 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AD6 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD7 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD7 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AD8 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD8 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD8 3 ARG D 210  ? PRO D 226  ? ARG D 210  PRO D 226  
AD8 4 GLY D 383  ? HIS D 388  ? GLY D 383  HIS D 388  
AD8 5 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 ILE D 241  ? ARG D 252  ? ILE D 241  ARG D 252  
AD9 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AD9 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE1 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AE1 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AE1 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE1 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE2 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE2 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE2 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE3 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE3 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE3 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE3 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE4 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE4 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE5 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE5 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE5 3 VAL F 315  ? SER F 316  ? VAL F 315  SER F 316  
AE6 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE6 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AE6 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AE7 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE7 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE7 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AE8 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AE8 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AE9 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AE9 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF1 1 PHE D 1123 ? GLN D 1124 ? PHE D 1123 GLN D 1124 
AF1 2 ARG D 1133 ? LEU D 1134 ? ARG D 1133 LEU D 1134 
AF2 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF2 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF3 1 GLU D 1302 ? TYR D 1303 ? GLU D 1302 TYR D 1303 
AF3 2 VAL D 1292 ? GLU D 1295 ? VAL D 1292 GLU D 1295 
AF3 3 GLY D 1279 ? ILE D 1283 ? GLY D 1279 ILE D 1283 
AF3 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF4 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF4 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF4 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF5 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF5 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF6 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF6 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 10   ? N VAL A 10   O GLU A 26   ? O GLU A 26   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
AA2 1 2 N LEU A 99   ? N LEU A 99   O VAL A 142  ? O VAL A 142  
AA2 2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
AA7 1 2 N LEU B 101  ? N LEU B 101  O MET B 140  ? O MET B 140  
AA7 2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ALA B 130  ? O ALA B 130  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 100  ? N LEU C 100  O LYS C 109  ? O LYS C 109  
AB4 1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB6 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB6 3 4 N ASP C 173  ? N ASP C 173  O LYS C 185  ? O LYS C 185  
AB6 4 5 N VAL C 186  ? N VAL C 186  O ARG C 189  ? O ARG C 189  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N VAL C 475  ? N VAL C 475  O VAL C 478  ? O VAL C 478  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC2 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC2 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC3 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC4 1 2 N ARG C 640  ? N ARG C 640  O ASP C 657  ? O ASP C 657  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O LYS C 851  ? O LYS C 851  N ILE C 690  ? N ILE C 690  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N ALA C 712  ? N ALA C 712  O GLU C 821  ? O GLU C 821  
AC7 2 3 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AC9 2 3 N GLY D 627  ? N GLY D 627  O VAL D 747  ? O VAL D 747  
AC9 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AC9 4 5 N VAL D 700  ? N VAL D 700  O PHE D 716  ? O PHE D 716  
AC9 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AC9 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AC9 7 8 O ILE D 726  ? O ILE D 726  N VAL D 630  ? N VAL D 630  
AD1 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD2 1 2 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD2 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD3 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD4 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD4 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AD5 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD6 1 2 N GLU D 167  ? N GLU D 167  O VAL D 395  ? O VAL D 395  
AD6 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AD6 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AD7 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AD8 1 2 N ALA D 320  ? N ALA D 320  O PHE D 336  ? O PHE D 336  
AD8 2 3 O TRP D 339  ? O TRP D 339  N LYS D 217  ? N LYS D 217  
AD8 3 4 N GLU D 214  ? N GLU D 214  O VAL D 384  ? O VAL D 384  
AD8 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N PHE D 251  ? N PHE D 251  O LEU D 304  ? O LEU D 304  
AD9 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE1 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE1 2 3 O VAL D 271  ? O VAL D 271  N GLU D 260  ? N GLU D 260  
AE1 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE2 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE2 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE3 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AE3 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE3 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE4 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE5 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE5 2 3 N THR D 537  ? N THR D 537  O VAL F 315  ? O VAL F 315  
AE6 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE6 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE7 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE7 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AE8 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AE9 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF1 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF2 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF3 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF3 2 3 O PHE D 1293 ? O PHE D 1293 N ARG D 1282 ? N ARG D 1282 
AF3 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF4 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF4 2 3 N ASP D 1383 ? N ASP D 1383 O ALA D 1416 ? O ALA D 1416 
AF5 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF6 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  1601 ? 3  'binding site for residue MG B 1601'               
AC2 Software D MG  1601 ? 4  'binding site for residue MG D 1601'               
AC3 Software D ZN  1602 ? 4  'binding site for residue ZN D 1602'               
AC4 Software D ZN  1603 ? 4  'binding site for residue ZN D 1603'               
AC5 Software D GTP 1604 ? 9  'binding site for residue GTP D 1604'              
AC6 Software D MG  1605 ? 3  'binding site for residue MG D 1605'               
AC7 Software I GTP 5    ? 15 'binding site for Di-nucleotide GTP I 5 and G I 6' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  GLU B 154  ? GLU B 154  . ? 1_555 ? 
2  AC1 3  ASP B 168  ? ASP B 168  . ? 1_555 ? 
3  AC1 3  LYS D 840  ? LYS D 840  . ? 1_555 ? 
4  AC2 4  ASP D 739  ? ASP D 739  . ? 1_555 ? 
5  AC2 4  ASP D 741  ? ASP D 741  . ? 1_555 ? 
6  AC2 4  ASP D 743  ? ASP D 743  . ? 1_555 ? 
7  AC2 4  G   I 4    ? G   I 8    . ? 1_555 ? 
8  AC3 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
12 AC4 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
13 AC4 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
14 AC4 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
15 AC4 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
16 AC5 9  ARG C 879  ? ARG C 879  . ? 1_555 ? 
17 AC5 9  ARG D 704  ? ARG D 704  . ? 1_555 ? 
18 AC5 9  PRO D 706  ? PRO D 706  . ? 1_555 ? 
19 AC5 9  ASN D 737  ? ASN D 737  . ? 1_555 ? 
20 AC5 9  ASP D 739  ? ASP D 739  . ? 1_555 ? 
21 AC5 9  ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
22 AC5 9  MG  O .    ? MG  D 1605 . ? 1_555 ? 
23 AC5 9  DG  G 12   ? DG  G 14   . ? 1_555 ? 
24 AC5 9  G   I 4    ? G   I 8    . ? 1_555 ? 
25 AC6 3  ASP D 739  ? ASP D 739  . ? 1_555 ? 
26 AC6 3  ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
27 AC6 3  GTP N .    ? GTP D 1604 . ? 1_555 ? 
28 AC7 15 GLN C 393  ? GLN C 393  . ? 1_555 ? 
29 AC7 15 PHE C 394  ? PHE C 394  . ? 1_555 ? 
30 AC7 15 HIS C 406  ? HIS C 406  . ? 1_555 ? 
31 AC7 15 ARG C 409  ? ARG C 409  . ? 1_555 ? 
32 AC7 15 LEU C 413  ? LEU C 413  . ? 1_555 ? 
33 AC7 15 ARG C 420  ? ARG C 420  . ? 1_555 ? 
34 AC7 15 PRO C 444  ? PRO C 444  . ? 1_555 ? 
35 AC7 15 ASN C 448  ? ASN C 448  . ? 1_555 ? 
36 AC7 15 ILE C 452  ? ILE C 452  . ? 1_555 ? 
37 AC7 15 GLN C 567  ? GLN C 567  . ? 1_555 ? 
38 AC7 15 ASP F 323  ? ASP F 323  . ? 1_555 ? 
39 AC7 15 GLU F 324  ? GLU F 324  . ? 1_555 ? 
40 AC7 15 DC  G 15   ? DC  G 17   . ? 1_555 ? 
41 AC7 15 DA  G 16   ? DA  G 18   . ? 1_555 ? 
42 AC7 15 G   I 3    ? G   I 7    . ? 1_555 ? 
# 
_atom_sites.entry_id                    6OY6 
_atom_sites.fract_transf_matrix[1][1]   0.005351 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000829 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009791 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003403 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? 452.346 13.324  730.747 1.00 99.51  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? 453.186 14.388  731.308 1.00 106.58 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? 454.549 14.432  730.611 1.00 110.71 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? 455.034 13.407  730.112 1.00 112.87 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? 453.373 14.201  732.828 1.00 107.55 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? 454.181 15.226  733.401 1.00 97.81  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? 455.159 15.622  730.597 1.00 111.17 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? 456.422 15.844  729.893 1.00 103.38 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? 457.555 15.045  730.530 1.00 104.99 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? 457.770 15.120  731.747 1.00 105.61 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? 456.768 17.332  729.908 1.00 101.16 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? 458.233 17.651  729.651 1.00 102.17 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? 458.451 18.176  728.225 1.00 100.18 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? 459.688 19.082  728.149 1.00 96.25  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? 459.872 19.753  726.820 1.00 97.25  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? 458.292 14.295  729.707 1.00 103.55 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? 459.396 13.509  730.235 1.00 97.65  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? 460.587 14.401  730.532 1.00 98.97  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? 460.802 15.432  729.883 1.00 101.68 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? 459.842 12.455  729.237 1.00 95.50  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? 459.903 11.070  729.836 1.00 97.04  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? 458.645 10.336  729.347 1.00 101.34 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? 461.190 10.345  729.483 1.00 85.28  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? 461.395 13.964  731.484 1.00 96.19  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? 462.581 14.696  731.900 1.00 95.68  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? 463.861 14.063  731.359 1.00 91.75  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? 463.888 12.896  730.953 1.00 88.92  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? 462.608 14.859  733.419 1.00 92.58  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? 461.445 15.731  733.864 1.00 96.96  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? 461.627 17.196  733.475 1.00 99.37  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? 460.539 18.095  734.103 1.00 97.31  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? 459.149 17.689  733.706 1.00 94.84  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? 464.919 14.872  731.368 1.00 86.20  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? 466.204 14.541  730.774 1.00 84.87  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? 466.689 13.129  731.152 1.00 89.32  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? 466.687 12.769  732.339 1.00 94.01  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? 467.212 15.593  731.244 1.00 83.76  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? 467.050 12.300  730.168 1.00 86.88  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? 467.402 10.886  730.399 1.00 81.41  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? 468.839 10.651  730.882 1.00 81.50  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 469.755 11.421  730.589 1.00 80.57  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? 467.211 10.272  729.011 1.00 87.91  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? 467.542 11.415  728.062 1.00 94.34  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? 467.025 12.652  728.741 1.00 93.84  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? 469.046 9.492   731.533 1.00 80.80  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 470.392 9.030   731.903 1.00 82.37  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 471.195 8.581   730.681 1.00 85.86  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 470.730 7.782   729.856 1.00 80.78  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 470.353 7.913   732.967 1.00 72.63  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 469.677 8.408   734.212 1.00 93.88  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 469.710 6.635   732.466 1.00 79.85  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 472.455 9.010   730.629 1.00 84.90  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 473.371 8.770   729.516 1.00 84.95  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 474.500 7.847   729.980 1.00 90.27  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 475.347 8.253   730.781 1.00 97.20  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 473.874 10.133  729.012 1.00 88.98  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 474.971 10.091  727.955 1.00 92.26  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 474.943 9.190   726.901 1.00 89.66  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 475.973 11.067  727.950 1.00 98.34  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 475.951 9.211   725.904 1.00 89.58  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 476.984 11.096  726.945 1.00 93.19  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 476.962 10.175  725.929 1.00 86.57  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 474.477 6.587   729.527 1.00 91.13  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 475.443 5.564   729.936 1.00 93.56  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 476.495 5.388   728.821 1.00 91.94  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 476.188 5.543   727.635 1.00 88.59  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 474.731 4.231   730.235 1.00 87.00  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 473.524 4.478   730.969 1.00 79.46  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 475.620 3.293   731.050 1.00 83.31  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 477.742 5.069   729.210 1.00 92.94  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 478.878 4.914   728.288 1.00 83.23  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 479.656 3.632   728.600 1.00 82.88  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 480.235 3.502   729.687 1.00 84.18  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 479.814 6.137   728.384 1.00 81.96  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 481.107 5.895   727.670 1.00 83.74  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 479.130 7.394   727.844 1.00 83.00  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 479.743 2.724   727.627 1.00 85.05  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 480.506 1.471   727.769 1.00 86.91  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 481.613 1.343   726.715 1.00 85.47  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 481.568 0.408   725.916 1.00 82.92  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 479.568 0.247   727.666 1.00 83.58  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 478.416 0.187   728.622 1.00 85.79  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 477.709 -1.164  728.457 1.00 83.61  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 476.658 -1.106  727.433 1.00 78.15  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 475.371 -0.884  727.725 1.00 82.85  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 475.012 -0.701  728.994 1.00 101.75 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 474.434 -0.831  726.781 1.00 75.83  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 482.667 2.152   726.795 1.00 84.98  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 483.709 2.059   725.780 1.00 89.49  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 484.618 0.863   726.075 1.00 91.77  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 484.937 0.567   727.226 1.00 91.56  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 484.538 3.348   725.685 1.00 93.62  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 485.399 3.473   726.823 1.00 94.23  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 483.638 4.579   725.568 1.00 93.80  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 484.983 0.139   725.022 1.00 99.09  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 486.026 -0.886  725.039 1.00 101.71 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 487.174 -0.468  724.121 1.00 104.78 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 487.018 -0.444  722.895 1.00 98.81  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 485.440 -2.248  724.681 1.00 102.74 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 486.434 -3.387  724.554 1.00 101.03 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 485.741 -4.660  724.093 1.00 105.48 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 484.649 -4.609  723.516 1.00 103.24 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 486.347 -5.811  724.388 1.00 106.58 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 488.325 -0.158  724.719 1.00 110.30 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 489.555 0.290   724.081 1.00 100.20 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 489.348 1.553   723.270 1.00 96.19  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 488.413 2.327   723.515 1.00 91.46  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 490.186 1.744   722.241 1.00 103.75 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 490.019 2.920   721.391 1.00 104.22 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 489.211 2.629   720.137 1.00 103.86 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 488.918 3.561   719.376 1.00 99.70  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 491.390 3.494   720.966 1.00 93.99  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 492.345 3.799   722.107 1.00 91.18  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 493.658 4.394   721.630 1.00 86.84  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 493.350 5.584   720.843 1.00 98.20  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 493.083 6.780   721.370 1.00 96.32  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 493.091 6.937   722.679 1.00 100.94 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 492.793 7.821   720.599 1.00 96.36  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 488.891 1.354   719.898 1.00 103.43 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 488.238 0.852   718.694 1.00 104.73 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 486.702 0.949   718.716 1.00 99.60  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 486.088 1.292   717.700 1.00 100.28 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 488.696 -0.592  718.450 1.00 107.33 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 490.205 -0.805  718.695 1.00 108.40 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 491.084 -0.429  717.484 1.00 117.33 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 490.947 0.707   716.950 1.00 115.63 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 491.909 -1.280  717.061 1.00 115.61 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 486.070 0.618   719.845 1.00 97.21  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 484.641 0.341   719.943 1.00 90.78  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 484.006 1.069   721.125 1.00 96.47  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 484.690 1.418   722.093 1.00 99.28  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 484.431 -1.178  720.055 1.00 91.57  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 483.007 -1.637  720.211 1.00 90.69  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 482.010 -1.228  719.331 1.00 89.36  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 482.673 -2.536  721.208 1.00 92.03  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 480.703 -1.675  719.471 1.00 89.94  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 481.376 -2.990  721.355 1.00 93.14  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 480.394 -2.558  720.493 1.00 91.25  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 479.107 -3.019  720.656 1.00 89.30  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 482.719 1.379   720.996 1.00 96.15  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 481.943 1.949   722.093 1.00 91.78  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 480.464 1.643   721.953 1.00 89.26  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 479.991 1.319   720.862 1.00 97.61  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 479.749 1.636   723.076 1.00 85.27  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 478.293 1.501   723.077 1.00 80.97  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 477.788 2.709   723.857 1.00 83.60  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 478.314 2.994   724.934 1.00 87.90  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 477.830 0.184   723.716 1.00 78.43  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 478.379 -1.090  723.030 1.00 82.25  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 477.761 -2.404  723.582 1.00 87.60  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 476.891 -2.333  724.475 1.00 88.75  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 478.173 -3.516  723.166 1.00 84.33  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 476.806 3.440   723.326 1.00 82.03  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 476.353 4.695   723.942 1.00 81.07  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 474.833 4.691   724.081 1.00 88.70  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 474.118 4.794   723.076 1.00 88.84  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 476.848 5.890   723.127 1.00 78.41  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 478.339 5.926   722.993 1.00 83.47  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 479.003 5.055   722.142 1.00 84.14  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 479.084 6.839   723.711 1.00 88.72  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 480.386 5.074   722.037 1.00 86.20  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 480.467 6.881   723.590 1.00 88.64  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 481.116 5.993   722.753 1.00 87.89  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 474.340 4.647   725.356 1.00 88.88  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 472.918 4.502   725.687 1.00 82.37  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 472.338 5.833   726.154 1.00 79.93  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 473.038 6.653   726.763 1.00 82.13  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 472.673 3.404   726.746 1.00 72.93  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 471.225 2.939   726.683 1.00 69.57  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 473.608 2.224   726.571 1.00 72.94  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 471.078 6.077   725.784 1.00 72.31  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 470.298 7.227   726.225 1.00 69.11  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? 468.939 6.666   726.628 1.00 77.92  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? 468.266 6.044   725.799 1.00 77.74  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 470.149 8.287   725.146 1.00 67.68  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 470.322 9.703   725.685 1.00 76.32  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 471.712 9.859   726.258 1.00 74.25  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 470.018 10.775  724.654 1.00 86.33  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? 468.575 6.790   727.912 1.00 88.92  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? 467.275 6.312   728.388 1.00 85.62  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? 466.733 7.125   729.560 1.00 82.21  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? 467.520 7.623   730.372 1.00 85.95  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? 467.505 4.865   728.839 1.00 78.86  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? 466.516 4.184   729.697 1.00 79.55  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? 466.905 2.723   729.782 1.00 85.38  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? 468.098 2.483   730.134 1.00 81.57  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? 466.050 1.835   729.515 1.00 80.97  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? 465.387 7.258   729.698 1.00 80.65  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? 464.320 6.952   728.737 1.00 82.52  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? 464.093 8.169   727.789 1.00 88.10  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? 464.335 9.320   728.256 1.00 77.05  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? 463.103 6.718   729.624 1.00 83.57  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? 463.311 7.661   730.728 1.00 87.04  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? 464.817 7.737   730.965 1.00 88.09  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? 463.601 7.915   726.542 1.00 89.01  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? 463.280 8.923   725.524 1.00 77.19  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? 461.835 8.771   725.039 1.00 76.82  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? 461.314 7.651   724.910 1.00 72.30  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? 464.249 8.801   724.346 1.00 81.01  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? 465.662 9.339   724.583 1.00 82.12  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? 466.683 8.739   723.642 1.00 72.90  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? 465.651 10.859  724.444 1.00 88.46  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? 461.226 9.900   724.669 1.00 75.77  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? 459.860 9.874   724.140 1.00 84.93  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? 459.724 8.955   722.925 1.00 91.40  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? 460.644 8.824   722.109 1.00 92.24  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? 459.373 11.292  723.801 1.00 85.36  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? 459.003 12.128  725.021 1.00 91.99  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? 457.734 11.589  725.724 1.00 104.02 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? 457.010 10.766  725.111 1.00 106.43 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? 457.462 11.963  726.893 1.00 105.67 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? 458.549 8.320   722.804 1.00 91.94  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? 458.308 7.351   721.731 1.00 89.20  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? 458.617 7.939   720.369 1.00 90.40  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? 458.158 9.036   720.033 1.00 92.41  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? 456.848 6.906   721.703 1.00 92.00  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? 456.597 5.813   720.661 1.00 98.74  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? 455.114 5.446   720.454 1.00 99.09  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? 454.359 6.578   719.896 1.00 101.65 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? 453.221 6.470   719.202 1.00 104.82 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? 452.682 5.267   718.970 1.00 104.83 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? 452.617 7.569   718.741 1.00 93.59  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? 459.417 7.205   719.589 1.00 91.97  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? 459.768 7.608   718.242 1.00 89.44  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? 461.011 8.461   718.152 1.00 85.61  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? 461.493 8.705   717.047 1.00 81.60  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? 461.524 8.943   719.284 1.00 90.03  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? 462.731 9.751   719.336 1.00 83.12  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? 463.986 8.903   719.311 1.00 79.89  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? 465.085 9.465   719.259 1.00 77.31  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? 462.708 10.614  720.582 1.00 79.56  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? 462.078 11.934  720.368 1.00 77.47  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? 460.700 12.046  720.327 1.00 80.57  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? 462.837 13.069  720.287 1.00 72.92  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? 460.100 13.267  720.155 1.00 76.06  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? 462.241 14.299  720.132 1.00 72.78  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? 460.873 14.399  720.068 1.00 71.19  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? 463.847 7.576   719.433 1.00 77.22  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? 465.009 6.708   719.332 1.00 75.38  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? 465.693 6.892   717.993 1.00 87.60  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? 466.902 7.148   717.913 1.00 86.14  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? 464.917 6.763   716.914 1.00 88.50  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? 465.453 6.986   715.584 1.00 75.45  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? 465.550 8.479   715.265 1.00 76.15  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? 466.451 8.877   714.531 1.00 83.78  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? 464.635 6.201   714.545 1.00 70.84  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? 463.895 5.098   715.201 1.00 74.41  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? 463.602 7.104   713.945 1.00 64.72  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? 464.721 9.347   715.860 1.00 74.31  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? 464.850 10.775  715.558 1.00 75.06  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? 466.240 11.264  715.936 1.00 75.68  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? 466.816 12.107  715.249 1.00 79.55  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? 463.780 11.618  716.253 1.00 80.96  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? 462.490 11.263  715.742 1.00 84.66  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? 464.032 13.131  716.020 1.00 71.88  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? 466.774 10.790  717.055 1.00 82.39  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? 468.170 11.093  717.361 1.00 83.80  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? 469.131 10.153  716.658 1.00 79.88  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 470.177 10.596  716.178 1.00 81.96  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? 468.441 11.003  718.865 1.00 80.48  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? 468.203 12.201  719.743 1.00 76.43  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? 468.843 11.873  721.070 1.00 86.92  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? 468.917 13.379  719.085 1.00 81.02  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? 468.820 8.854   716.644 1.00 81.39  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 469.781 7.868   716.162 1.00 82.93  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 470.194 8.019   714.707 1.00 80.90  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 471.378 7.926   714.376 1.00 83.85  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? 469.226 8.244   713.813 1.00 81.13  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 469.555 8.243   712.385 1.00 82.40  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 470.409 9.434   711.957 1.00 76.84  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 471.474 9.206   711.362 1.00 80.01  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? 468.268 8.135   711.558 1.00 85.04  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? 468.515 7.592   710.163 1.00 77.35  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? 468.967 6.442   710.007 1.00 71.74  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? 468.203 8.386   709.152 1.00 76.06  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 470.052 10.697  712.246 1.00 76.15  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 470.907 11.801  711.792 1.00 74.85  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 472.302 11.735  712.360 1.00 78.84  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 473.242 12.228  711.718 1.00 80.57  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 470.161 13.059  712.261 1.00 70.59  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? 469.264 12.599  713.275 1.00 73.98  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? 468.815 11.250  712.813 1.00 78.80  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 472.474 11.200  713.570 1.00 77.03  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 473.834 11.096  714.087 1.00 80.09  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 474.645 10.075  713.292 1.00 81.43  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 475.809 10.334  712.974 1.00 86.51  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 473.835 10.767  715.583 1.00 82.98  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 473.373 11.874  716.552 1.00 82.04  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 473.433 11.395  718.031 1.00 74.61  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 474.123 13.190  716.323 1.00 77.48  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 474.040 8.935   712.925 1.00 76.80  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 474.719 7.942   712.083 1.00 77.05  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 475.147 8.542   710.742 1.00 82.59  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 476.260 8.296   710.251 1.00 79.59  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 473.821 6.712   711.897 1.00 75.12  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 474.396 5.613   711.000 1.00 73.73  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 473.485 4.372   710.943 1.00 78.17  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 474.076 3.303   710.128 1.00 81.08  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 473.885 3.102   708.826 1.00 77.14  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 473.064 3.898   708.136 1.00 77.21  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 474.537 2.103   708.217 1.00 65.53  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 474.269 9.313   710.119 1.00 83.56  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 474.620 9.907   708.843 1.00 77.00  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 475.829 10.820  708.990 1.00 78.96  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 476.797 10.709  708.226 1.00 87.87  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 473.395 10.651  708.284 1.00 73.58  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 472.272 9.664   707.922 1.00 71.82  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 470.993 10.293  707.425 1.00 71.72  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 471.227 11.200  706.309 1.00 76.27  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 471.468 10.834  705.047 1.00 76.84  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 471.536 9.552   704.689 1.00 70.12  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 471.643 11.771  704.124 1.00 77.85  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 475.821 11.680  710.010 1.00 79.57  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 476.930 12.606  710.238 1.00 81.80  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 478.210 11.856  710.626 1.00 81.17  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 479.321 12.256  710.244 1.00 80.65  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 476.518 13.650  711.286 1.00 78.46  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 475.350 14.460  710.731 1.00 80.60  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 477.637 14.654  711.430 1.00 78.12  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 474.596 15.251  711.739 1.00 76.92  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 478.066 10.771  711.406 1.00 81.54  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 479.198 9.956   711.867 1.00 78.97  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 479.922 9.259   710.719 1.00 78.23  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 481.136 9.037   710.798 1.00 79.32  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 478.707 8.915   712.886 1.00 83.12  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 478.324 9.319   714.322 1.00 82.54  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 477.451 8.233   714.886 1.00 80.30  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 479.538 9.540   715.246 1.00 77.03  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 479.180 8.788   709.705 1.00 78.88  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 479.785 8.049   708.592 1.00 79.72  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 480.471 8.958   707.556 1.00 79.03  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 481.410 8.519   706.874 1.00 75.38  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 478.705 7.196   707.908 1.00 70.40  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 478.247 5.949   708.669 1.00 65.71  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 477.126 5.253   707.960 1.00 67.19  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 479.378 4.958   708.926 1.00 65.56  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 480.070 10.227  707.480 1.00 78.78  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 480.523 11.161  706.459 1.00 86.67  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 481.459 12.258  706.970 1.00 93.40  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 482.597 12.361  706.481 1.00 91.93  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 479.266 11.722  705.769 1.00 82.87  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 478.477 12.510  706.637 1.00 72.96  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 481.006 13.114  707.909 1.00 88.08  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 481.615 14.421  708.190 1.00 85.57  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 482.644 14.426  709.322 1.00 80.85  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 483.071 15.515  709.733 1.00 76.19  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 480.535 15.458  708.492 1.00 78.87  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 479.573 15.465  707.455 1.00 83.48  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 483.005 13.264  709.865 1.00 80.82  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 483.958 13.181  710.973 1.00 82.62  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 485.388 13.258  710.463 1.00 80.09  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 485.807 12.337  709.755 1.00 86.26  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 483.775 11.869  711.759 1.00 88.27  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 482.345 11.734  712.313 1.00 77.64  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 484.805 11.761  712.866 1.00 86.85  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 481.815 12.960  712.987 1.00 77.66  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 486.168 14.300  710.786 1.00 85.52  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 487.561 14.367  710.294 1.00 93.94  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 488.448 13.205  710.762 1.00 92.31  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 488.177 12.549  711.772 1.00 83.88  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 488.053 15.734  710.796 1.00 86.26  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 486.785 16.552  710.878 1.00 83.00  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 485.734 15.585  711.363 1.00 82.44  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 489.493 12.934  709.967 1.00 96.78  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 490.390 11.811  710.170 1.00 96.19  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 491.690 11.940  709.371 1.00 101.07 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 492.029 13.017  708.869 1.00 97.24  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 492.416 10.806  709.244 1.00 103.61 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 493.651 10.763  708.455 1.00 105.33 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 493.710 9.632   707.419 1.00 101.81 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 493.139 8.541   707.600 1.00 99.76  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 494.879 10.639  709.381 1.00 100.53 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 494.771 9.439   710.172 1.00 96.49  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 495.076 11.915  710.248 1.00 88.12  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 494.415 9.938   706.314 1.00 95.78  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 494.720 9.001   705.235 1.00 99.25  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 495.994 9.388   704.471 1.00 96.19  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 496.294 10.571  704.296 1.00 97.68  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 493.547 8.906   704.250 1.00 102.62 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 496.687 8.369   703.945 1.00 93.24  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 497.815 8.531   703.016 1.00 88.21  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 497.350 9.225   701.748 1.00 90.03  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 496.366 8.785   701.147 1.00 100.04 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 498.415 7.166   702.660 1.00 87.60  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 499.445 7.298   701.541 1.00 84.33  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 499.037 6.540   703.879 1.00 94.03  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 497.932 10.391  701.419 1.00 84.87  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 497.596 11.058  700.151 1.00 88.74  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 498.612 10.941  698.991 1.00 96.44  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 498.249 11.292  697.858 1.00 94.67  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 497.294 12.544  700.379 1.00 86.37  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 498.458 13.213  700.867 1.00 90.61  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 496.156 12.696  701.361 1.00 88.31  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 499.878 10.557  699.219 1.00 98.06  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 500.887 10.522  698.144 1.00 87.44  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 502.044 9.573   698.489 1.00 87.86  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 502.301 9.300   699.660 1.00 97.02  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 501.395 11.954  697.909 1.00 85.28  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 502.256 12.083  696.818 1.00 89.44  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 502.721 9.033   697.479 1.00 88.41  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 503.876 8.149   697.704 1.00 94.85  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 504.991 8.467   696.696 1.00 100.58 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 504.723 8.620   695.497 1.00 97.23  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 503.492 6.653   697.652 1.00 90.29  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 504.718 5.769   697.852 1.00 89.13  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 502.506 6.345   698.752 1.00 85.69  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 506.244 8.584   697.174 1.00 101.36 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 507.401 8.642   696.275 1.00 104.08 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 508.286 7.458   696.641 1.00 101.93 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 508.814 7.399   697.755 1.00 103.98 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 508.233 9.931   696.408 1.00 105.12 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 509.592 9.851   695.691 1.00 102.97 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 509.636 9.936   694.301 1.00 109.17 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 510.784 9.601   696.355 1.00 101.31 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 510.826 9.857   693.590 1.00 111.56 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 511.995 9.504   695.643 1.00 106.15 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 512.001 9.638   694.254 1.00 109.73 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 513.151 9.561   693.492 1.00 106.52 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 508.472 6.538   695.711 1.00 97.46  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 509.369 5.411   695.894 1.00 96.17  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 510.588 5.677   695.050 1.00 101.75 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 510.469 6.218   693.949 1.00 109.16 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 508.752 4.050   695.531 1.00 95.43  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 507.434 3.857   696.270 1.00 99.88  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 509.744 2.915   695.809 1.00 93.52  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 506.774 2.528   695.981 1.00 99.65  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 511.761 5.411   695.606 1.00 103.78 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 512.980 5.712   694.880 1.00 106.31 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 513.059 4.810   693.653 1.00 106.82 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 512.742 3.614   693.729 1.00 107.21 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 514.191 5.449   695.771 1.00 105.23 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 515.502 5.861   695.157 1.00 114.79 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 516.687 5.385   695.970 1.00 118.89 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 516.491 5.069   697.166 1.00 111.00 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 517.788 5.236   695.377 1.00 121.78 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 513.481 5.392   692.516 1.00 99.36  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 513.536 4.675   691.236 1.00 103.53 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 512.155 4.232   690.744 1.00 107.04 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 512.017 3.166   690.128 1.00 107.61 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 514.504 3.486   691.288 1.00 100.81 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 515.933 3.928   691.444 1.00 108.32 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 516.253 5.018   690.923 1.00 106.08 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 516.719 3.229   692.119 1.00 116.13 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 511.114 5.021   691.017 1.00 101.04 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 509.772 4.721   690.522 1.00 97.95  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 509.119 5.977   689.954 1.00 98.20  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 509.059 7.013   690.630 1.00 100.56 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 508.894 4.111   691.624 1.00 96.25  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 507.436 4.171   691.240 1.00 95.48  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 509.295 2.695   691.845 1.00 98.43  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 508.775 5.928   688.665 1.00 92.58  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 508.221 7.083   687.976 1.00 94.97  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 506.691 7.175   688.022 1.00 93.57  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 506.150 8.279   687.830 1.00 89.67  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 508.688 7.085   686.525 1.00 100.21 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 510.196 7.185   686.302 1.00 98.21  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 510.506 6.783   684.864 1.00 95.98  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 510.701 8.596   686.614 1.00 103.49 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 505.984 6.068   688.297 1.00 91.13  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 504.516 6.041   688.236 1.00 93.75  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 503.973 4.767   688.886 1.00 88.74  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 504.732 3.856   689.238 1.00 86.71  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 504.010 6.067   686.792 1.00 94.02  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 504.555 4.945   685.958 1.00 91.30  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 504.162 3.632   686.132 1.00 88.34  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 505.412 4.942   684.910 1.00 91.71  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 504.785 2.863   685.260 1.00 85.11  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 505.543 3.635   684.499 1.00 93.85  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 502.624 4.691   688.979 1.00 83.36  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 501.965 3.630   689.764 1.00 88.83  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 502.150 2.217   689.196 1.00 87.86  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 502.056 1.236   689.946 1.00 88.20  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 500.456 3.904   689.958 1.00 85.67  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 499.780 2.817   690.884 1.00 89.54  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 498.415 3.201   691.500 1.00 94.24  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 497.897 4.316   691.244 1.00 96.25  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 497.875 2.383   692.291 1.00 93.02  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 502.381 2.071   687.896 1.00 90.23  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 502.380 0.744   687.281 1.00 91.43  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 503.741 0.065   687.286 1.00 92.32  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 503.895 -0.982  686.650 1.00 95.28  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 501.784 0.838   685.872 1.00 85.45  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 500.418 1.488   685.867 1.00 83.95  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 500.279 2.860   685.637 1.00 83.47  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 499.283 0.753   686.172 1.00 83.07  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 499.034 3.481   685.662 1.00 76.55  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 498.030 1.371   686.210 1.00 83.15  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 497.910 2.737   685.950 1.00 81.71  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 504.709 0.612   688.020 1.00 90.00  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 506.047 0.041   688.126 1.00 89.28  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 506.059 -1.240  688.976 1.00 83.74  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 505.028 -1.734  689.441 1.00 87.53  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 506.997 1.087   688.716 1.00 92.74  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 507.055 2.277   687.925 1.00 100.01 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 507.245 -1.840  689.082 1.00 82.97  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 507.462 -3.050  689.865 1.00 89.04  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 508.921 -2.969  690.357 1.00 100.09 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 509.791 -2.492  689.614 1.00 104.06 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 507.136 -4.291  689.018 1.00 86.21  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 507.655 -5.479  689.627 1.00 87.32  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 507.748 -4.114  687.615 1.00 88.31  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 509.193 -3.407  691.583 1.00 98.64  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 510.489 -3.208  692.254 1.00 99.55  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 511.253 -4.528  692.307 1.00 100.13 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 510.682 -5.542  692.731 1.00 97.48  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 510.344 -2.632  693.681 1.00 108.04 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 509.389 -1.435  693.736 1.00 103.22 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 511.741 -2.273  694.252 1.00 104.65 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 510.058 -0.152  693.357 1.00 103.50 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 512.522 -4.564  691.863 1.00 106.02 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 513.325 -5.796  691.974 1.00 100.74 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 513.510 -6.180  693.431 1.00 99.83  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 513.695 -5.317  694.296 1.00 103.00 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 514.665 -5.419  691.322 1.00 91.93  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 514.363 -4.231  690.459 1.00 95.91  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 513.275 -3.482  691.194 1.00 103.94 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 513.331 -7.473  693.722 1.00 98.96  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 513.450 -7.961  695.079 1.00 103.16 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 512.153 -7.958  695.858 1.00 104.22 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 512.036 -8.684  696.851 1.00 106.18 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 511.161 -7.192  695.406 1.00 103.91 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 509.877 -7.066  696.076 1.00 95.78  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 508.885 -7.981  695.374 1.00 96.93  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 508.833 -8.047  694.137 1.00 104.04 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 509.402 -5.598  696.017 1.00 94.04  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 508.086 -5.424  696.726 1.00 93.18  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 510.455 -4.665  696.595 1.00 91.67  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 508.068 -8.662  696.167 1.00 92.02  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 507.062 -9.564  695.624 1.00 94.54  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 505.877 -8.778  695.082 1.00 94.45  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 505.406 -9.010  693.957 1.00 95.86  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 506.614 -10.548 696.706 1.00 83.81  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 505.642 -11.588 696.238 1.00 81.17  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 505.135 -12.394 697.401 1.00 87.15  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 504.256 -13.543 696.951 1.00 91.57  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 503.452 -14.118 698.071 1.00 92.52  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 505.436 -7.805  695.860 1.00 90.11  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 504.271 -7.006  695.537 1.00 94.41  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 504.600 -5.980  694.455 1.00 85.61  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 505.713 -5.451  694.402 1.00 87.31  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 503.744 -6.312  696.812 1.00 92.66  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 502.986 -7.188  697.895 1.00 85.03  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 503.880 -7.963  698.893 1.00 89.81  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 503.366 -8.578  699.869 1.00 92.00  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 505.102 -7.970  698.708 1.00 95.98  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 503.663 -5.798  693.528 1.00 78.88  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 503.713 -4.697  692.570 1.00 84.92  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 503.350 -3.379  693.251 1.00 88.83  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 502.743 -3.364  694.329 1.00 89.65  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 502.690 -4.905  691.460 1.00 88.86  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 501.305 -5.247  692.017 1.00 97.00  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 500.485 -4.294  692.179 1.00 90.24  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 501.055 -6.445  692.330 1.00 99.83  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 503.744 -2.260  692.620 1.00 82.89  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 503.471 -0.940  693.207 1.00 85.47  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 501.973 -0.700  693.432 1.00 89.97  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 501.588 0.028   694.362 1.00 87.08  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 504.115 0.183   692.395 1.00 77.39  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 503.703 1.546   692.980 1.00 79.88  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 505.607 0.016   692.488 1.00 83.56  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 501.112 -1.223  692.550 1.00 88.22  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 499.670 -1.062  692.742 1.00 87.37  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 499.250 -1.639  694.088 1.00 91.40  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 498.461 -1.031  694.828 1.00 90.40  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 498.885 -1.677  691.573 1.00 81.43  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 497.412 -1.608  691.836 1.00 82.74  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 499.135 -0.836  690.362 1.00 85.64  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 499.740 -2.841  694.405 1.00 89.38  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 499.447 -3.472  695.693 1.00 87.10  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 500.092 -2.725  696.858 1.00 90.53  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 499.509 -2.637  697.947 1.00 89.66  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 499.894 -4.934  695.665 1.00 85.99  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 499.661 -5.712  696.940 1.00 81.77  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 499.767 -7.219  696.730 1.00 83.04  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 499.322 -7.968  697.630 1.00 80.32  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 500.241 -7.658  695.650 1.00 81.83  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 501.299 -2.190  696.654 1.00 91.60  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 501.986 -1.455  697.717 1.00 89.78  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 501.165 -0.244  698.155 1.00 88.71  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 500.886 -0.060  699.348 1.00 89.98  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 503.395 -1.047  697.251 1.00 88.80  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 504.281 -2.296  697.114 1.00 88.21  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 503.999 0.014   698.188 1.00 88.58  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 504.312 -3.150  698.342 1.00 87.71  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 500.689 0.545   697.187 1.00 84.50  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 499.855 1.705   697.487 1.00 82.33  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 498.531 1.253   698.081 1.00 88.45  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 497.902 1.981   698.858 1.00 90.67  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 499.681 2.545   696.218 1.00 79.69  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 501.029 3.174   695.883 1.00 91.51  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 498.709 3.651   696.439 1.00 73.47  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 501.042 3.963   694.625 1.00 94.34  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 498.017 0.117   697.614 1.00 89.19  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 496.806 -0.463  698.193 1.00 88.43  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 496.974 -0.798  699.691 1.00 94.86  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 496.015 -0.685  700.474 1.00 92.60  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 496.403 -1.690  697.376 1.00 83.59  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 494.948 -1.750  696.900 1.00 76.02  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 494.477 -0.451  696.223 1.00 73.72  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 494.759 -2.935  696.015 1.00 71.64  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 498.177 -1.248  700.100 1.00 92.96  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 498.450 -1.519  701.515 1.00 87.85  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 498.638 -0.238  702.313 1.00 91.47  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 498.179 -0.143  703.456 1.00 100.71 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 499.682 -2.408  701.666 1.00 86.28  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 499.470 -3.782  701.090 1.00 88.26  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 498.332 -4.206  700.895 1.00 86.22  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 500.563 -4.478  700.780 1.00 84.70  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 499.302 0.759   701.734 1.00 88.79  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 499.459 2.045   702.407 1.00 90.25  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 498.131 2.772   702.600 1.00 91.69  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 498.054 3.690   703.422 1.00 94.28  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 500.414 2.940   701.613 1.00 88.59  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 501.839 2.394   701.557 1.00 89.36  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 502.660 3.076   700.447 1.00 82.51  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 502.525 2.428   702.938 1.00 99.20  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 497.100 2.424   701.826 1.00 92.76  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 495.779 3.021   701.989 1.00 95.08  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 495.062 2.536   703.251 1.00 101.24 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 494.049 3.132   703.644 1.00 100.56 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 495.002 2.785   700.699 1.00 92.61  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 493.978 3.847   700.416 1.00 98.21  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 493.372 3.616   699.047 1.00 99.42  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 492.591 2.316   698.982 1.00 100.22 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 491.936 2.174   697.647 1.00 102.17 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 495.551 1.465   703.880 1.00 100.14 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 494.981 0.943   705.116 1.00 102.51 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 495.680 1.497   706.346 1.00 106.51 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 495.234 1.225   707.472 1.00 106.83 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 495.063 -0.593  705.147 1.00 99.15  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 494.231 -1.277  704.091 1.00 104.11 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 492.760 -0.863  704.169 1.00 111.06 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 492.236 -0.719  705.305 1.00 119.66 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 492.137 -0.647  703.104 1.00 112.50 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 496.735 2.296   706.149 1.00 102.13 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 497.530 2.804   707.258 1.00 99.33  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 496.718 3.844   708.024 1.00 103.05 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 496.245 4.828   707.431 1.00 101.86 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 498.820 3.423   706.733 1.00 93.08  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 499.864 3.800   707.772 1.00 92.49  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 500.424 2.481   708.308 1.00 90.41  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 500.962 4.729   707.231 1.00 88.66  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 496.570 3.635   709.335 1.00 97.15  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 495.853 4.554   710.210 1.00 97.96  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 496.879 5.334   711.027 1.00 99.73  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 497.581 4.754   711.865 1.00 103.51 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 494.884 3.794   711.124 1.00 101.72 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 494.019 4.781   711.927 1.00 103.64 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 494.053 2.832   710.309 1.00 105.26 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 496.934 6.650   710.853 1.00 93.00  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 497.978 7.454   711.475 1.00 94.05  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 497.312 8.532   712.296 1.00 102.29 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 496.715 9.458   711.727 1.00 100.21 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 498.931 8.077   710.446 1.00 99.44  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 499.954 8.968   711.148 1.00 97.33  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 499.635 6.986   709.646 1.00 100.47 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 497.524 8.473   713.623 1.00 107.45 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 496.915 9.384   714.588 1.00 98.83  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 497.832 10.568  714.873 1.00 98.38  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 499.015 10.382  715.173 1.00 98.46  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 496.631 8.639   715.892 1.00 94.31  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 496.082 9.538   717.011 1.00 103.40 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 496.065 8.844   718.395 1.00 99.24  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 495.495 9.711   719.428 1.00 99.00  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 495.503 9.435   720.729 1.00 99.20  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 496.066 8.314   721.164 1.00 103.07 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 494.967 10.288  721.597 1.00 90.27  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 497.286 11.786  714.758 1.00 99.18  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 498.020 13.003  715.089 1.00 98.69  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 497.693 13.388  716.530 1.00 112.65 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 496.526 13.640  716.863 1.00 114.96 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 497.653 14.169  714.171 1.00 94.33  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 498.093 14.004  712.733 1.00 110.73 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 498.637 12.812  712.263 1.00 105.94 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 497.948 15.065  711.835 1.00 111.20 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 499.029 12.698  710.923 1.00 103.48 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 498.341 14.963  710.502 1.00 101.44 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 498.885 13.784  710.047 1.00 99.11  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 498.713 13.384  717.398 1.00 111.46 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 498.487 13.763  718.785 1.00 92.92  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 498.298 15.271  718.913 1.00 96.15  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 497.354 15.730  719.559 1.00 103.76 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 499.647 13.276  719.645 1.00 85.64  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 499.588 11.768  719.914 1.00 89.22  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 498.164 11.382  720.210 1.00 97.88  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 500.178 10.871  718.840 1.00 95.96  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 499.070 16.041  718.168 1.00 97.18  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 498.956 17.493  718.186 1.00 99.33  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 497.841 17.958  717.255 1.00 104.75 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 497.925 17.732  716.042 1.00 111.20 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 500.292 18.116  717.780 1.00 104.68 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 500.288 19.646  717.832 1.00 105.18 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 499.275 20.300  717.560 1.00 101.23 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 501.443 20.222  718.165 1.00 106.23 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 496.795 18.605  717.774 1.00 103.98 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 495.677 19.043  716.912 1.00 110.70 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 496.061 20.068  715.855 1.00 111.93 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 495.310 20.241  714.885 1.00 112.05 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 494.672 19.635  717.912 1.00 104.00 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 494.993 18.948  719.201 1.00 104.74 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 496.490 18.788  719.199 1.00 103.36 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 497.188 20.758  716.012 1.00 107.78 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 497.606 21.787  715.067 1.00 110.91 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 498.340 21.241  713.839 1.00 114.62 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 498.647 22.022  712.929 1.00 117.53 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 498.463 22.827  715.791 1.00 110.94 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 497.760 23.358  716.906 1.00 114.20 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 498.651 19.941  713.804 1.00 114.22 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 499.492 19.323  712.771 1.00 113.39 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 498.615 18.766  711.643 1.00 112.19 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 497.791 17.874  711.876 1.00 109.31 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 500.369 18.238  713.394 1.00 109.25 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 501.282 17.426  712.490 1.00 103.73 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 502.289 18.382  711.914 1.00 102.00 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 501.984 16.341  713.307 1.00 102.11 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 498.691 19.379  710.450 1.00 114.14 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 497.869 18.931  709.324 1.00 115.11 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 498.575 18.003  708.322 1.00 109.37 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 497.880 17.375  707.512 1.00 107.43 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 497.390 20.161  708.509 1.00 108.94 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 496.467 21.162  709.205 1.00 111.62 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 495.001 21.018  708.813 1.00 116.39 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 494.532 19.921  708.492 1.00 119.66 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 494.273 22.136  708.823 1.00 107.74 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 499.910 17.885  708.352 1.00 107.34 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 500.645 17.057  707.392 1.00 98.95  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 501.998 16.568  707.908 1.00 102.12 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 502.703 17.297  708.615 1.00 105.75 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 500.881 17.797  706.080 1.00 96.88  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 501.692 16.973  705.238 1.00 98.46  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 501.574 19.128  706.322 1.00 99.02  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 502.386 15.344  707.520 1.00 99.27  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 503.699 14.823  707.919 1.00 98.40  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 504.334 14.135  706.712 1.00 98.17  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 503.909 14.354  705.571 1.00 96.53  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 503.617 13.852  709.114 1.00 88.29  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 503.048 14.552  710.305 1.00 99.26  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 502.813 12.617  708.776 1.00 92.00  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 505.399 13.362  706.938 1.00 94.26  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 505.965 12.513  705.889 1.00 88.60  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 506.721 11.376  706.559 1.00 89.14  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 507.794 11.601  707.121 1.00 98.96  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 506.882 13.307  704.956 1.00 94.28  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 506.157 14.374  704.316 1.00 95.56  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 507.507 12.393  703.920 1.00 93.12  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 506.184 10.169  706.477 1.00 89.04  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 506.835 8.985   707.031 1.00 94.57  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 507.919 8.455   706.094 1.00 95.60  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 507.763 8.477   704.876 1.00 98.81  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 505.796 7.907   707.328 1.00 99.64  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 505.116 8.061   708.706 1.00 105.97 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 504.307 9.370   708.870 1.00 96.09  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 504.249 6.842   709.017 1.00 104.84 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 509.038 8.014   706.660 1.00 98.73  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 510.135 7.452   705.879 1.00 95.78  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 510.327 5.978   706.224 1.00 102.15 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 510.257 5.599   707.397 1.00 105.96 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 511.416 8.255   706.111 1.00 94.20  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 511.206 9.679   705.572 1.00 94.00  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 511.410 10.750  706.618 1.00 89.30  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 512.066 9.943   704.335 1.00 113.31 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 510.626 5.155   705.210 1.00 102.46 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 510.852 3.719   705.392 1.00 102.87 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 512.074 3.337   704.571 1.00 104.33 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 512.189 3.741   703.411 1.00 101.36 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 509.658 2.867   704.919 1.00 97.11  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 509.565 1.359   705.243 1.00 92.20  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 508.106 0.953   705.391 1.00 95.96  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 510.282 0.403   704.314 1.00 91.17  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 513.010 2.620   705.195 1.00 108.69 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 514.153 2.021   704.507 1.00 103.71 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 514.318 0.595   705.023 1.00 110.10 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 514.434 0.375   706.236 1.00 112.47 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 515.406 2.868   704.742 1.00 106.71 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 515.280 4.235   704.068 1.00 110.51 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 516.241 5.297   704.609 1.00 118.12 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 516.061 6.635   703.861 1.00 118.64 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 514.664 7.199   703.982 1.00 107.42 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 514.270 -0.376  704.116 1.00 109.31 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 514.333 -1.785  704.486 1.00 113.38 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 515.150 -2.524  703.437 1.00 111.24 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 515.269 -2.066  702.301 1.00 105.77 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 512.936 -2.398  704.643 1.00 111.80 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 515.751 -3.645  703.839 1.00 114.93 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 516.483 -4.505  702.911 1.00 111.67 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 516.397 -5.961  703.368 1.00 114.24 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 515.706 -6.290  704.340 1.00 116.23 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 517.960 -4.094  702.915 1.00 118.51 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 518.601 -4.431  704.303 1.00 131.68 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 520.108 -4.175  704.428 1.00 133.82 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 520.650 -3.324  703.680 1.00 130.33 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 520.737 -4.832  705.298 1.00 129.21 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 517.120 -6.836  702.654 1.00 110.98 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 517.303 -8.209  703.060 1.00 106.49 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 516.045 -9.038  703.083 1.00 110.12 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 514.962 -8.583  702.713 1.00 114.19 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 516.187 -10.309 703.470 1.00 113.54 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 515.023 -11.214 703.575 1.00 115.70 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 514.085 -10.878 704.744 1.00 116.04 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 514.004 -11.639 705.719 1.00 108.19 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 515.670 -12.596 703.767 1.00 114.70 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 517.068 -12.446 703.259 1.00 116.87 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 517.467 -11.032 703.560 1.00 116.51 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 513.323 -9.784  704.634 1.00 113.97 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 512.382 -9.364  705.666 1.00 114.57 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 511.018 -9.069  705.051 1.00 112.74 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 510.915 -8.688  703.881 1.00 111.43 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 512.899 -8.056  706.377 1.00 115.18 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 511.791 -7.128  706.976 1.00 111.91 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 512.288 -6.078  707.987 1.00 113.40 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 512.816 -4.842  707.215 1.00 114.91 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 513.114 -3.629  708.049 1.00 109.83 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 509.965 -9.227  705.857 1.00 107.18 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 508.625 -8.829  705.460 1.00 95.80  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 508.352 -7.493  706.130 1.00 94.72  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 507.989 -7.459  707.306 1.00 104.63 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 507.605 -9.875  705.891 1.00 91.54  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 507.851 -11.233 705.296 1.00 97.77  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 506.853 -12.280 705.767 1.00 109.10 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 505.949 -11.961 706.583 1.00 110.19 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 506.981 -13.440 705.313 1.00 121.43 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 508.394 -6.407  705.361 1.00 91.41  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 508.236 -5.071  705.932 1.00 91.46  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 506.799 -4.878  706.396 1.00 95.23  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 505.856 -5.040  705.611 1.00 100.25 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 508.644 -4.010  704.903 1.00 89.77  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 508.617 -2.609  705.491 1.00 81.11  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 510.041 -4.352  704.395 1.00 96.82  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 506.629 -4.460  707.659 1.00 92.04  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 505.330 -4.134  708.231 1.00 89.31  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 505.275 -2.635  708.498 1.00 93.20  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 506.237 -1.903  708.254 1.00 94.91  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 505.062 -4.929  709.508 1.00 89.76  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 505.364 -6.423  709.456 1.00 93.70  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 504.441 -7.224  708.539 1.00 95.50  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 504.831 -8.710  708.581 1.00 98.16  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 503.973 -9.640  707.778 1.00 103.12 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 504.139 -2.169  709.021 1.00 98.81  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 504.009 -0.732  709.250 1.00 105.19 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 504.917 -0.193  710.356 1.00 109.15 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 505.146 1.026   710.398 1.00 108.02 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 502.541 -0.395  709.541 1.00 106.45 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 505.416 -1.054  711.260 1.00 109.77 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 506.302 -0.583  712.330 1.00 104.78 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 507.579 0.052   711.755 1.00 102.49 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 508.025 1.106   712.232 1.00 95.45  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 506.608 -1.716  713.331 1.00 99.63  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 506.897 -3.115  712.753 1.00 99.27  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 506.780 -4.227  713.832 1.00 110.77 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 505.402 -4.665  714.110 1.00 111.74 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 504.795 -4.585  715.297 1.00 114.60 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 503.536 -5.007  715.435 1.00 111.99 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 505.435 -4.067  716.344 1.00 115.58 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 508.102 -0.502  710.643 1.00 103.61 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 509.449 -0.184  710.165 1.00 96.19  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 509.571 1.257   709.691 1.00 98.74  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 510.689 1.681   709.362 1.00 100.86 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 509.886 -1.159  709.059 1.00 89.68  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 509.869 -2.629  709.508 1.00 93.31  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 508.850 -3.315  709.314 1.00 91.56  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 510.911 -3.134  709.985 1.00 99.44  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 508.452 1.986   709.585 1.00 100.10 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 508.514 3.413   709.290 1.00 103.35 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 509.291 4.104   710.407 1.00 104.33 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 509.084 3.824   711.593 1.00 98.29  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 507.111 4.023   709.146 1.00 106.42 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 506.474 3.792   707.788 1.00 106.47 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 505.371 2.952   707.651 1.00 108.02 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 506.975 4.431   706.652 1.00 105.53 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 504.788 2.746   706.403 1.00 110.12 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 506.406 4.230   705.402 1.00 104.05 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 505.310 3.386   705.274 1.00 109.97 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 510.190 5.005   710.019 1.00 107.45 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 510.998 5.747   710.978 1.00 104.95 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 510.121 6.646   711.848 1.00 105.68 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 509.404 7.513   711.306 1.00 100.31 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 512.071 6.558   710.234 1.00 108.29 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 513.195 5.669   709.625 1.00 116.74 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 514.344 6.424   708.879 1.00 105.31 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 513.753 4.653   710.641 1.00 114.21 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 510.151 6.466   713.186 1.00 111.65 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 509.249 7.196   714.105 1.00 104.03 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 509.383 8.716   714.042 1.00 100.27 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 510.489 9.263   713.994 1.00 96.85  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 509.652 6.659   715.486 1.00 94.52  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 510.217 5.301   715.211 1.00 98.11  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 510.960 5.457   713.906 1.00 104.70 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 508.231 9.396   714.055 1.00 97.05  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 508.149 10.855  714.055 1.00 102.69 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 507.310 11.296  715.251 1.00 109.91 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 506.425 10.562  715.708 1.00 110.60 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 507.592 11.421  712.727 1.00 106.17 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 507.462 12.959  712.780 1.00 97.57  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 508.490 10.993  711.542 1.00 106.65 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 507.700 12.428  715.842 1.00 111.78 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 507.025 12.965  717.015 1.00 110.56 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 505.578 13.352  716.724 1.00 113.32 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 505.254 13.891  715.655 1.00 110.55 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 507.781 14.187  717.524 1.00 116.34 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 504.726 13.141  717.738 1.00 115.18 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 503.282 13.428  717.705 1.00 116.24 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 502.507 12.635  716.642 1.00 106.36 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 501.497 13.123  716.115 1.00 100.90 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 502.990 14.938  717.594 1.00 117.74 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 503.383 15.711  718.873 1.00 122.32 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 503.596 15.062  719.936 1.00 115.91 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 503.422 16.966  718.820 1.00 120.97 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 503.016 11.471  716.232 1.00 104.26 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 502.325 10.604  715.279 1.00 104.78 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 502.508 9.162   715.748 1.00 105.50 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 503.642 8.714   715.963 1.00 104.81 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 502.785 10.780  713.814 1.00 109.76 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 502.458 12.196  713.304 1.00 104.61 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 504.256 10.411  713.590 1.00 107.96 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 501.402 8.452   715.960 1.00 105.73 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 501.442 7.075   716.437 1.00 104.65 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 500.766 6.196   715.392 1.00 101.64 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 499.635 6.479   714.973 1.00 98.26  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 500.728 6.929   717.789 1.00 106.93 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 500.721 5.497   718.347 1.00 108.10 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 499.765 5.301   719.532 1.00 103.93 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 499.170 6.293   720.029 1.00 97.58  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 499.615 4.134   719.958 1.00 103.98 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 501.431 5.108   715.010 1.00 99.88  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 500.869 4.181   714.032 1.00 101.69 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 500.056 3.152   714.803 1.00 101.83 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 500.601 2.271   715.478 1.00 99.06  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 501.959 3.549   713.146 1.00 97.40  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 502.370 4.516   712.023 1.00 92.24  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 501.548 2.187   712.582 1.00 98.33  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 503.363 5.575   712.376 1.00 95.23  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 498.733 3.242   714.627 1.00 102.44 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 497.763 2.481   715.406 1.00 104.41 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 497.711 1.010   715.019 1.00 105.26 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 497.232 0.197   715.813 1.00 106.65 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 496.374 3.110   715.253 1.00 102.94 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 496.318 4.638   715.440 1.00 105.79 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 496.804 5.204   717.087 1.00 114.34 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 495.776 4.143   718.086 1.00 103.10 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 498.193 0.648   713.830 1.00 104.55 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 498.232 -0.743  713.374 1.00 106.38 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 499.630 -1.120  712.901 1.00 107.92 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 499.890 -1.253  711.698 1.00 111.25 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 497.165 -1.008  712.297 1.00 111.55 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 497.192 -0.007  711.104 1.00 100.45 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 497.756 1.087   711.184 1.00 97.91  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 496.591 -0.418  709.987 1.00 93.55  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 500.557 -1.327  713.844 1.00 105.23 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 501.950 -1.605  713.470 1.00 109.30 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 502.182 -2.991  712.883 1.00 108.43 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 503.288 -3.250  712.393 1.00 105.84 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 502.707 -1.429  714.799 1.00 107.81 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 501.648 -1.238  715.860 1.00 103.07 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 500.335 -1.617  715.260 1.00 103.21 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 501.175 -3.860  712.846 1.00 109.56 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 501.360 -5.214  712.336 1.00 111.30 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 501.035 -5.367  710.836 1.00 112.71 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 501.358 -6.414  710.241 1.00 107.77 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 500.503 -6.164  713.178 1.00 110.59 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 501.247 -7.412  713.578 1.00 112.50 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 502.215 -7.788  712.876 1.00 115.76 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 500.860 -8.013  714.599 1.00 112.80 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 500.482 -4.324  710.202 1.00 113.78 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 500.045 -4.376  708.804 1.00 106.74 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 501.190 -4.710  707.864 1.00 103.07 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 502.214 -4.025  707.864 1.00 107.13 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 499.450 -3.005  708.444 1.00 103.99 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 499.024 -2.525  707.060 1.00 98.14  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 497.613 -2.936  706.755 1.00 101.66 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 499.121 -0.995  707.043 1.00 94.40  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 500.986 -5.719  707.013 1.00 105.41 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 502.012 -6.115  706.046 1.00 102.02 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 502.116 -5.079  704.918 1.00 94.22  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 501.099 -4.566  704.441 1.00 93.92  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 501.680 -7.493  705.465 1.00 95.60  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 502.740 -8.048  704.565 1.00 100.79 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 503.660 -8.979  704.995 1.00 101.88 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 503.069 -7.759  703.279 1.00 103.80 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 504.482 -9.272  704.000 1.00 103.33 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 504.150 -8.541  702.948 1.00 98.48  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 503.352 -4.771  704.487 1.00 92.77  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 503.585 -3.789  703.416 1.00 95.64  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 504.219 -4.397  702.167 1.00 93.61  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 503.604 -4.371  701.098 1.00 96.02  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 504.410 -2.572  703.881 1.00 91.77  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 503.622 -1.757  704.886 1.00 95.75  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 504.665 -1.636  702.716 1.00 86.10  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 502.171 -1.593  704.497 1.00 95.24  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 505.434 -4.939  702.266 1.00 92.03  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 506.045 -5.600  701.114 1.00 92.64  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 506.872 -6.793  701.561 1.00 95.75  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 507.525 -6.736  702.602 1.00 105.46 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 506.953 -4.627  700.357 1.00 84.38  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 506.880 -7.862  700.770 1.00 87.52  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 507.771 -8.982  701.038 1.00 91.59  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 509.049 -8.811  700.206 1.00 99.89  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 508.999 -8.779  698.971 1.00 98.95  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 507.066 -10.312 700.743 1.00 90.70  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 506.075 -10.570 701.747 1.00 92.14  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 508.068 -11.479 700.796 1.00 93.15  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 510.189 -8.684  700.880 1.00 106.25 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 511.471 -8.503  700.218 1.00 98.19  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 512.293 -9.792  700.320 1.00 101.17 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 512.162 -10.570 701.267 1.00 101.98 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 512.209 -7.298  700.820 1.00 95.68  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 511.857 -5.954  700.156 1.00 96.47  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 510.383 -5.601  700.318 1.00 92.10  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 512.705 -4.817  700.676 1.00 96.57  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 513.155 -10.015 699.344 1.00 109.69 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 513.894 -11.263 699.201 1.00 113.46 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 515.371 -10.889 699.225 1.00 113.35 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 515.710 -9.703  699.141 1.00 108.56 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 513.473 -11.997 697.921 1.00 110.10 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 514.545 -12.205 696.904 1.00 110.19 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 513.975 -12.360 695.520 1.00 113.05 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 513.082 -11.570 695.151 1.00 111.70 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 514.395 -13.273 694.803 1.00 113.52 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 516.259 -11.883 699.365 1.00 116.22 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 517.683 -11.569 699.439 1.00 114.28 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 518.063 -10.681 698.264 1.00 108.26 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 517.910 -11.074 697.107 1.00 110.42 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 518.503 -12.864 699.422 1.00 115.68 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 519.156 -13.236 700.767 1.00 115.90 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 520.256 -12.281 701.199 1.00 120.93 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 520.472 -12.141 702.422 1.00 117.94 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 520.904 -11.669 700.321 1.00 124.57 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 518.605 -9.497  698.585 1.00 110.24 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 518.947 -8.448  697.636 1.00 105.69 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 517.857 -7.415  697.354 1.00 107.42 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 518.138 -6.414  696.683 1.00 109.49 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 516.630 -7.643  697.820 1.00 112.07 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 515.531 -6.683  697.660 1.00 109.20 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 515.677 -5.421  698.514 1.00 109.33 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 515.883 -5.514  699.731 1.00 111.53 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 515.509 -4.234  697.900 1.00 108.34 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 515.671 -2.976  698.642 1.00 111.15 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 514.363 -2.176  698.561 1.00 109.35 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 513.472 -2.502  697.776 1.00 116.54 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 516.869 -2.157  698.121 1.00 114.05 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 518.199 -2.934  698.281 1.00 123.24 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 518.609 -3.261  699.733 1.00 122.09 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 519.986 -3.785  699.854 1.00 129.27 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 520.304 -5.008  700.311 1.00 126.14 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 519.360 -5.862  700.693 1.00 123.57 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 521.575 -5.397  700.382 1.00 123.26 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 514.250 -1.105  699.372 1.00 108.11 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 513.057 -0.242  699.429 1.00 103.13 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 513.184 1.049   700.240 1.00 100.67 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 513.334 1.001   701.467 1.00 107.87 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 511.865 -1.039  699.991 1.00 103.72 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 510.502 -0.329  700.034 1.00 100.87 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 510.141 0.255   698.693 1.00 103.08 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 509.404 -1.287  700.514 1.00 92.88  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 513.116 2.199   699.574 1.00 90.38  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 513.183 3.518   700.206 1.00 94.66  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 512.013 4.389   699.760 1.00 98.15  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 511.938 4.765   698.585 1.00 100.47 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 514.505 4.222   699.876 1.00 99.33  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 514.484 5.741   700.201 1.00 106.62 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 513.803 6.196   701.120 1.00 109.45 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 515.205 6.526   699.395 1.00 111.36 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 511.101 4.732   700.677 1.00 99.61  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 509.933 5.502   700.264 1.00 97.37  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 509.624 6.598   701.269 1.00 90.01  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 510.118 6.607   702.395 1.00 95.25  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 508.686 4.639   700.030 1.00 97.19  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 508.264 3.707   701.122 1.00 101.78 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 506.770 2.869   700.523 1.00 114.34 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 506.648 1.473   701.641 1.00 104.00 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 508.829 7.553   700.791 1.00 91.48  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 508.310 8.695   701.541 1.00 99.52  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 506.794 8.740   701.354 1.00 97.55  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 506.311 9.002   700.245 1.00 100.08 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 508.952 10.016  701.084 1.00 100.05 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 510.475 10.044  700.987 1.00 99.57  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 510.976 11.383  700.431 1.00 113.40 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 510.131 12.243  700.084 1.00 107.84 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 512.208 11.581  700.345 1.00 119.54 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 506.044 8.543   702.438 1.00 85.65  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 504.588 8.564   702.408 1.00 83.99  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 504.068 9.835   703.066 1.00 86.38  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 504.309 10.057  704.256 1.00 100.52 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 504.050 7.347   703.175 1.00 84.89  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 502.538 7.383   703.271 1.00 84.05  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 504.596 6.043   702.585 1.00 89.90  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 503.300 10.638  702.329 1.00 80.05  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 502.684 11.837  702.891 1.00 81.04  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 501.297 11.496  703.419 1.00 94.05  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 500.434 11.088  702.632 1.00 94.52  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 502.610 12.965  701.880 1.00 83.85  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 501.649 14.049  702.282 1.00 83.65  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 501.935 15.293  701.478 1.00 86.18  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 500.923 16.318  701.646 1.00 83.96  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 501.008 17.523  701.098 1.00 91.66  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 502.072 17.829  700.362 1.00 94.05  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 500.036 18.417  701.280 1.00 94.25  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 501.081 11.691  704.738 1.00 101.33 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 499.800 11.457  705.422 1.00 90.60  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 499.162 12.791  705.804 1.00 92.44  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 499.821 13.634  706.426 1.00 95.00  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 500.010 10.617  706.694 1.00 84.90  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 498.712 10.465  707.418 1.00 89.46  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 500.647 9.274   706.387 1.00 85.70  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 497.869 12.971  705.477 1.00 94.79  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 497.148 14.209  705.789 1.00 97.46  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 495.861 13.996  706.584 1.00 99.26  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 495.273 12.906  706.609 1.00 96.01  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 496.813 15.001  704.516 1.00 92.97  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 498.009 15.793  703.993 1.00 95.76  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 498.200 16.957  704.423 1.00 97.03  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 498.791 15.237  703.193 1.00 97.59  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 495.415 15.104  707.188 1.00 100.61 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 494.121 15.238  707.845 1.00 100.83 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 493.166 15.908  706.877 1.00 104.95 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 493.536 16.875  706.193 1.00 100.00 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 494.211 16.053  709.132 1.00 105.22 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 492.862 16.276  709.827 1.00 109.53 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 493.030 17.162  711.079 1.00 113.83 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 493.408 16.363  712.251 1.00 115.68 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 494.562 16.486  712.912 1.00 113.97 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 495.467 17.383  712.510 1.00 111.64 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 494.816 15.704  713.966 1.00 103.08 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 491.950 15.370  706.814 1.00 105.08 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 490.912 15.846  705.914 1.00 101.86 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 489.586 15.224  706.291 1.00 101.32 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 489.468 14.514  707.299 1.00 97.14  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 488.572 15.518  705.468 1.00 100.60 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 487.217 15.029  705.703 1.00 99.21  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 486.710 14.235  704.513 1.00 96.54  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 487.056 14.495  703.356 1.00 89.12  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 486.215 16.167  705.980 1.00 92.10  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 485.092 15.654  706.859 1.00 88.60  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 486.915 17.366  706.590 1.00 96.89  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 485.879 13.242  704.824 1.00 100.55 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 485.209 12.511  703.777 1.00 95.85  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 486.143 11.652  702.960 1.00 89.56  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 487.171 11.163  703.441 1.00 90.72  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 485.734 11.430  701.706 1.00 94.98  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 486.445 10.594  700.732 1.00 98.93  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 486.925 11.472  699.564 1.00 89.56  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 486.099 11.975  698.792 1.00 85.64  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 485.515 9.463   700.264 1.00 96.31  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 485.988 8.682   699.068 1.00 89.62  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 487.026 7.762   699.183 1.00 90.63  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 485.445 8.901   697.817 1.00 88.71  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 487.490 7.038   698.069 1.00 90.44  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 485.914 8.198   696.695 1.00 97.13  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 486.937 7.269   696.826 1.00 92.29  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 487.382 6.571   695.714 1.00 92.62  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 488.236 11.687  699.430 1.00 89.29  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 488.750 12.494  698.326 1.00 92.46  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 489.582 11.600  697.401 1.00 98.36  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 490.721 11.233  697.746 1.00 97.45  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 489.572 13.692  698.818 1.00 93.54  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 490.113 14.495  697.626 1.00 88.17  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 488.730 14.587  699.707 1.00 91.37  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 489.053 11.247  696.214 1.00 98.96  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 489.750 10.363  695.255 1.00 95.32  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 491.001 10.974  694.632 1.00 89.58  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 491.070 12.182  694.395 1.00 85.96  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 488.678 10.094  694.197 1.00 99.59  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 487.849 11.348  694.219 1.00 99.13  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 487.756 11.706  695.683 1.00 95.86  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 491.930 10.089  694.230 1.00 92.47  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 493.240 10.502  693.700 1.00 90.76  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 493.175 11.521  692.568 1.00 81.08  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 493.977 12.455  692.519 1.00 75.88  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 493.989 9.266   693.196 1.00 88.42  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 492.234 11.371  691.653 1.00 89.22  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 492.110 12.346  690.576 1.00 89.50  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 491.806 13.751  691.106 1.00 93.66  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 492.261 14.742  690.524 1.00 95.04  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 491.034 11.887  689.581 1.00 86.58  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 491.139 10.410  689.103 1.00 96.01  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 490.470 9.387   690.046 1.00 102.80 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 489.274 9.066   689.836 1.00 108.47 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 491.164 8.832   690.941 1.00 100.54 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 491.083 13.845  692.232 1.00 97.60  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 490.670 15.125  692.822 1.00 94.08  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 491.821 15.921  693.439 1.00 93.56  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 491.913 17.137  693.220 1.00 90.34  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 489.574 14.873  693.851 1.00 93.54  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 488.167 14.879  693.277 1.00 95.19  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 487.740 16.271  692.870 1.00 102.38 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 486.404 16.239  692.136 1.00 105.82 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 486.496 15.527  690.836 1.00 112.69 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 492.579 15.314  694.374 1.00 95.52  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 493.620 16.073  695.089 1.00 95.96  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 494.939 16.190  694.311 1.00 97.40  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 495.574 17.253  694.330 1.00 99.41  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 493.846 15.509  696.504 1.00 91.58  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 494.384 14.106  696.574 1.00 91.57  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 495.705 13.797  696.320 1.00 89.35  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 493.797 12.942  696.960 1.00 90.87  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 495.901 12.502  696.514 1.00 86.97  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 494.758 11.959  696.895 1.00 84.48  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 495.336 15.147  693.587 1.00 101.56 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 496.568 15.181  692.782 1.00 98.45  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 497.821 15.585  693.530 1.00 101.07 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 498.681 16.286  692.976 1.00 107.52 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 497.957 15.138  694.781 1.00 101.88 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 499.051 15.557  695.661 1.00 102.51 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 500.362 14.883  695.261 1.00 101.25 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 500.482 13.650  695.291 1.00 99.50  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 498.719 15.288  697.140 1.00 95.73  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 497.587 16.201  697.639 1.00 98.01  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 499.964 15.321  698.013 1.00 96.03  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 497.125 15.887  699.100 1.00 102.00 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 501.375 15.701  694.964 1.00 100.23 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 502.713 15.234  694.613 1.00 105.45 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 503.749 16.031  695.405 1.00 108.54 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 503.821 17.261  695.285 1.00 108.32 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 502.997 15.340  693.098 1.00 106.74 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 502.166 14.447  692.142 1.00 99.16  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 502.243 14.951  690.683 1.00 94.52  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 501.818 13.885  689.661 1.00 93.59  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 502.355 14.144  688.284 1.00 93.77  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 504.536 15.324  696.233 1.00 109.62 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 505.636 15.963  696.956 1.00 111.99 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 506.813 16.298  696.029 1.00 115.92 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 507.494 17.305  696.243 1.00 123.52 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 506.087 15.058  698.112 1.00 110.54 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 505.285 15.293  699.410 1.00 115.13 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 504.540 16.305  699.492 1.00 112.22 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 505.405 14.463  700.353 1.00 108.77 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 507.084 15.474  695.017 1.00 115.97 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 508.134 15.740  694.026 1.00 116.73 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 507.597 15.308  692.646 1.00 113.97 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 506.430 14.916  692.514 1.00 108.81 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 509.466 15.087  694.449 1.00 116.33 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 509.477 13.558  694.606 1.00 109.49 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 510.891 13.044  694.937 1.00 113.92 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 511.407 13.393  696.264 1.00 119.50 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 512.701 13.337  696.605 1.00 120.38 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 513.623 12.958  695.717 1.00 112.07 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 513.082 13.663  697.837 1.00 120.13 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 508.444 15.368  691.600 1.00 110.65 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 507.961 15.129  690.233 1.00 106.56 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 507.402 13.710  690.107 1.00 104.85 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 506.332 13.499  689.519 1.00 108.20 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 509.066 15.398  689.181 1.00 102.59 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 509.528 16.871  689.134 1.00 101.87 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 508.599 14.996  687.795 1.00 95.41  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 508.484 17.874  688.614 1.00 96.31  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 508.094 12.725  690.679 1.00 101.49 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 507.750 11.308  690.569 1.00 99.58  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 506.749 10.794  691.614 1.00 99.91  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 506.621 9.573   691.771 1.00 96.54  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 509.029 10.479  690.580 1.00 103.37 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 509.875 10.706  689.326 1.00 110.27 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 509.369 11.122  688.258 1.00 108.29 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 511.177 10.474  689.459 1.00 116.63 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 506.140 11.676  692.407 1.00 104.01 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 505.148 11.285  693.417 1.00 101.74 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 503.877 10.688  692.780 1.00 96.27  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 503.407 11.162  691.741 1.00 95.72  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 504.793 12.479  694.294 1.00 100.50 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 503.290 9.684   693.437 1.00 94.44  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 502.087 8.973   693.000 1.00 92.06  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 500.881 9.400   693.842 1.00 90.48  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 500.798 9.007   695.019 1.00 94.82  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 502.258 7.456   693.155 1.00 87.26  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 503.440 6.884   692.387 1.00 86.61  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 500.962 6.767   692.813 1.00 87.24  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 503.695 5.425   692.786 1.00 80.78  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 499.910 10.162  693.302 1.00 82.89  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 498.688 10.438  694.074 1.00 90.14  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 497.939 9.154   694.449 1.00 95.11  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 497.826 8.218   693.642 1.00 88.40  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 497.875 11.347  693.143 1.00 84.39  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 498.866 12.047  692.380 1.00 83.32  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 499.984 11.043  692.132 1.00 87.01  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 497.416 9.139   695.699 1.00 97.21  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 496.716 8.007   696.323 1.00 91.68  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 495.304 8.379   696.777 1.00 86.13  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 495.042 9.527   697.156 1.00 84.19  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 497.524 7.442   697.512 1.00 87.53  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 496.817 6.238   698.124 1.00 86.74  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 498.933 7.057   697.047 1.00 94.18  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 494.378 7.430   696.613 1.00 86.19  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 493.015 7.527   697.149 1.00 100.62 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 492.981 7.689   698.688 1.00 100.99 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 493.552 6.885   699.445 1.00 96.41  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 492.205 6.309   696.699 1.00 101.78 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 491.862 6.363   695.217 1.00 105.94 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 491.668 7.498   694.700 1.00 100.60 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 491.801 5.284   694.573 1.00 111.43 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 492.264 8.715   699.152 1.00 93.30  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 492.182 9.060   700.567 1.00 94.14  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 490.812 8.762   701.178 1.00 95.85  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 489.816 9.401   700.815 1.00 90.84  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 492.516 10.543  700.736 1.00 95.04  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 490.761 7.806   702.116 1.00 92.16  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 489.584 7.625   702.964 1.00 90.14  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 489.886 8.349   704.271 1.00 94.47  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 490.525 7.791   705.181 1.00 98.01  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 489.282 6.149   703.242 1.00 84.57  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 488.014 6.024   704.041 1.00 88.84  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 489.156 5.376   701.991 1.00 83.63  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 489.345 9.557   704.427 1.00 89.82  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 489.783 10.335  705.577 1.00 94.13  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 489.053 9.838   706.812 1.00 95.26  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 489.680 9.564   707.845 1.00 92.72  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 489.538 11.832  705.366 1.00 95.21  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 490.528 12.502  704.423 1.00 99.06  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 491.901 12.470  704.678 1.00 100.22 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 490.076 13.235  703.321 1.00 97.69  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 492.813 13.113  703.819 1.00 95.75  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 490.982 13.884  702.455 1.00 94.58  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 492.346 13.825  702.710 1.00 93.82  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 487.750 9.590   706.652 1.00 93.68  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 486.813 9.301   707.721 1.00 88.02  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 487.365 8.206   708.639 1.00 93.82  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 487.701 7.103   708.159 1.00 87.02  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 485.476 8.872   707.111 1.00 89.28  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 484.558 8.404   708.092 1.00 85.65  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 487.510 8.488   709.948 1.00 101.37 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 487.967 7.462   710.907 1.00 91.70  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 486.933 6.407   711.271 1.00 84.52  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 487.321 5.384   711.845 1.00 83.16  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 488.365 8.296   712.126 1.00 82.11  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 487.438 9.474   712.045 1.00 81.16  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 487.263 9.786   710.612 1.00 87.54  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 485.649 6.644   711.007 1.00 87.54  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 484.555 5.753   711.410 1.00 89.10  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 484.436 4.557   710.458 1.00 87.32  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 484.123 4.722   709.269 1.00 84.61  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 483.235 6.536   711.480 1.00 83.33  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 482.083 5.664   711.949 1.00 76.02  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 483.414 7.766   712.356 1.00 83.90  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 484.673 3.341   710.986 1.00 82.37  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 484.516 2.120   710.190 1.00 86.20  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 483.054 1.594   710.172 1.00 84.91  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 482.558 1.222   709.095 1.00 79.03  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 485.607 1.103   710.598 1.00 80.59  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 487.102 1.720   710.384 1.00 92.16  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 487.565 2.247   708.890 1.00 98.20  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 488.894 2.961   708.839 1.00 106.58 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 489.506 3.498   707.751 1.00 113.36 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 488.949 3.438   706.541 1.00 108.57 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 490.693 4.126   707.861 1.00 105.12 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 482.316 1.594   711.302 1.00 83.59  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 480.920 1.111   711.314 1.00 82.25  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 480.088 1.814   712.397 1.00 81.40  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 480.586 2.137   713.479 1.00 85.73  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 480.841 -0.420  711.475 1.00 77.11  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 479.422 -1.013  711.525 1.00 72.84  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 479.348 -2.245  710.616 1.00 81.35  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 480.327 -3.270  710.971 1.00 90.16  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 480.103 -4.312  711.767 1.00 98.06  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 478.896 -4.494  712.316 1.00 92.12  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 481.095 -5.173  712.020 1.00 102.75 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 478.801 2.034   712.093 1.00 78.81  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 477.817 2.623   713.008 1.00 74.04  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 476.505 1.855   712.940 1.00 77.28  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 475.909 1.740   711.866 1.00 82.67  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 477.541 4.099   712.651 1.00 68.45  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 476.558 4.702   713.581 1.00 74.12  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 478.803 4.907   712.703 1.00 70.03  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 476.037 1.346   714.075 1.00 80.37  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 474.695 0.781   714.168 1.00 81.70  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 473.993 1.387   715.381 1.00 83.33  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 474.643 1.831   716.336 1.00 83.58  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 474.738 -0.758  714.267 1.00 78.50  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 472.656 1.397   715.375 1.00 85.83  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 471.954 1.792   716.598 1.00 81.23  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 470.672 0.996   716.807 1.00 85.51  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 469.888 0.793   715.870 1.00 85.93  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 471.703 3.305   716.697 1.00 73.15  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 470.688 3.837   715.769 1.00 70.76  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? 469.359 3.812   716.093 1.00 75.97  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 471.073 4.495   714.640 1.00 79.36  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? 468.419 4.345   715.256 1.00 78.65  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? 470.140 5.028   713.793 1.00 82.84  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? 468.809 4.963   714.111 1.00 79.93  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 470.515 0.518   718.046 1.00 85.88  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? 469.374 -0.241  718.533 1.00 81.58  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? 468.333 0.675   719.179 1.00 81.44  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? 468.679 1.602   719.918 1.00 82.38  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 469.880 -1.226  719.581 1.00 83.96  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? 469.039 -2.434  719.837 1.00 89.84  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? 469.335 -3.523  718.837 1.00 98.44  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 470.149 -3.335  717.903 1.00 96.02  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? 468.717 -4.695  719.042 1.00 97.18  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? 467.055 0.426   718.898 1.00 80.54  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? 465.958 1.082   719.613 1.00 82.53  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? 465.093 -0.011  720.240 1.00 85.71  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? 464.415 -0.762  719.518 1.00 83.28  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? 465.141 2.016   718.720 1.00 79.76  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? 463.906 2.445   719.458 1.00 83.09  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? 465.963 3.240   718.399 1.00 75.32  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? 465.080 -0.065  721.587 1.00 87.49  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? 464.392 -1.075  722.391 1.00 84.68  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? 463.306 -0.442  723.260 1.00 86.57  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? 463.390 0.733   723.646 1.00 82.56  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? 465.430 -1.792  723.260 1.00 84.90  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? 466.441 -2.551  722.401 1.00 92.49  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? 467.695 -2.986  723.149 1.00 98.78  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? 467.742 -4.161  723.590 1.00 98.59  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? 468.613 -2.124  723.312 1.00 94.08  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? 462.336 -1.271  723.656 1.00 91.00  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? 461.221 -0.799  724.475 1.00 93.69  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? 461.637 -0.543  725.929 1.00 92.13  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? 462.410 -1.308  726.514 1.00 87.48  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? 460.110 -1.852  724.447 1.00 95.13  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? 458.725 -1.246  724.516 1.00 103.10 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? 458.629 -0.015  724.742 1.00 104.64 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? 457.735 -2.009  724.360 1.00 103.43 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? 461.043 0.491   726.544 1.00 96.67  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? 461.308 0.846   727.941 1.00 95.66  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? 460.122 1.645   728.493 1.00 97.92  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? 459.209 2.028   727.751 1.00 95.14  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? 462.630 1.640   728.078 1.00 91.18  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? 463.296 1.295   729.298 1.00 88.75  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? 462.394 3.164   728.079 1.00 90.43  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? 460.074 1.762   729.829 1.00 101.65 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? 459.026 2.489   730.550 1.00 97.55  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? 459.588 3.234   731.761 1.00 98.15  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? 460.639 2.864   732.301 1.00 100.60 ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? 457.849 1.602   730.969 1.00 95.42  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? 458.151 0.438   731.880 1.00 96.90  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? 456.845 -0.371  732.073 1.00 109.42 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? 455.758 0.532   732.518 1.00 113.71 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? 454.493 0.181   732.776 1.00 110.06 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? 454.112 -1.083  732.639 1.00 114.09 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? 453.609 1.096   733.194 1.00 102.14 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? 458.919 4.348   732.120 1.00 97.39  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? 459.120 5.077   733.382 1.00 96.46  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? 458.090 4.664   734.432 1.00 103.93 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? 457.915 5.346   735.455 1.00 94.61  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? 458.999 6.584   733.169 1.00 91.73  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? 459.839 7.462   734.088 1.00 93.75  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? 461.073 6.713   734.621 1.00 88.85  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? 460.209 8.733   733.377 1.00 95.82  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? 457.361 3.594   734.139 1.00 108.76 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? 456.534 2.843   735.037 1.00 90.24  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? 455.169 3.455   735.135 1.00 95.53  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? 454.193 2.734   735.334 1.00 107.58 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? 455.056 4.690   734.680 1.00 96.58  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? 453.804 5.408   734.565 1.00 103.29 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? 453.317 5.289   733.129 1.00 110.89 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? 452.130 5.012   732.897 1.00 107.75 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? 454.032 6.866   735.029 1.00 101.35 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? 452.847 7.839   735.244 1.00 102.59 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? 452.326 8.559   733.990 1.00 112.50 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? 451.827 7.940   733.047 1.00 112.14 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? 452.476 9.889   733.974 1.00 115.98 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? 454.271 5.346   732.179 1.00 103.69 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? 454.038 5.428   730.746 1.00 94.28  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? 454.836 4.324   730.065 1.00 97.20  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? 455.900 3.924   730.548 1.00 93.73  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? 454.469 6.765   730.111 1.00 100.28 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? 455.345 7.718   730.932 1.00 102.35 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? 455.246 9.118   730.275 1.00 109.18 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? 455.215 10.305  731.135 1.00 108.34 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? 456.084 10.596  732.100 1.00 107.44 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? 457.098 9.784   732.386 1.00 104.25 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? 455.936 11.724  732.785 1.00 107.98 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? 454.312 3.851   728.925 1.00 99.61  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? 454.843 2.727   728.151 1.00 99.72  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? 455.070 3.139   726.698 1.00 100.87 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? 454.692 4.232   726.258 1.00 100.13 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? 453.938 1.486   728.169 1.00 92.65  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? 452.590 1.863   727.863 1.00 88.50  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? 454.007 0.783   729.507 1.00 94.75  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? 455.819 2.284   726.002 1.00 98.64  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? 456.241 2.480   724.614 1.00 102.45 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? 457.239 3.632   724.477 1.00 101.85 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? 457.333 4.252   723.416 1.00 96.66  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? 455.053 2.679   723.655 1.00 105.55 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? 455.378 2.230   722.194 1.00 112.15 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? 456.566 1.923   721.918 1.00 106.11 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? 454.465 2.217   721.316 1.00 110.74 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? 458.013 3.891   725.537 1.00 104.05 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? 459.147 4.812   725.521 1.00 96.46  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? 460.332 4.131   724.820 1.00 91.56  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? 460.336 2.909   724.609 1.00 89.98  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? 459.514 5.251   726.940 1.00 95.33  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? 458.618 6.261   727.668 1.00 93.79  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? 459.472 7.047   728.661 1.00 83.49  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? 457.829 7.185   726.700 1.00 96.50  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? 461.330 4.930   724.423 1.00 89.64  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? 462.433 4.432   723.592 1.00 91.18  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? 463.764 4.377   724.357 1.00 84.25  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? 464.176 5.375   724.965 1.00 83.61  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? 462.574 5.362   722.365 1.00 85.31  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? 461.611 5.013   721.189 1.00 87.47  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? 460.951 3.949   721.198 1.00 86.81  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? 461.489 5.846   720.255 1.00 89.55  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? 464.484 3.244   724.266 1.00 74.03  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? 465.844 3.175   724.802 1.00 77.57  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? 466.832 3.034   723.647 1.00 89.50  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? 466.921 1.964   723.025 1.00 90.74  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? 465.976 2.002   725.776 1.00 82.60  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? 467.394 1.466   726.074 1.00 83.17  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? 467.384 0.023   726.643 1.00 77.56  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? 468.629 -0.287  727.527 1.00 75.53  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? 469.988 -0.509  726.894 1.00 80.82  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? 467.708 4.026   723.503 1.00 86.79  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? 468.564 4.156   722.331 1.00 77.31  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 469.991 3.770   722.679 1.00 80.34  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 470.573 4.313   723.621 1.00 81.19  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? 468.492 5.585   721.787 1.00 72.54  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? 469.500 5.975   720.714 1.00 79.13  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? 469.242 5.129   719.503 1.00 78.02  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? 469.322 7.438   720.354 1.00 76.37  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 470.570 2.877   721.884 1.00 85.22  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 471.949 2.436   722.070 1.00 84.53  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 472.689 2.619   720.748 1.00 85.63  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 472.362 1.949   719.766 1.00 89.40  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 471.991 0.956   722.501 1.00 84.39  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 470.888 0.644   723.392 1.00 79.53  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 473.360 0.590   723.118 1.00 79.22  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 473.675 3.532   720.725 1.00 83.23  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 474.535 3.818   719.565 1.00 83.25  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 475.838 3.002   719.644 1.00 86.22  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 476.614 3.186   720.592 1.00 89.22  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 474.837 5.321   719.458 1.00 77.60  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 473.908 6.292   718.716 1.00 77.59  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 474.331 7.756   718.842 1.00 74.40  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 473.909 5.936   717.242 1.00 83.25  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 476.065 2.070   718.693 1.00 79.10  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 477.348 1.349   718.603 1.00 77.67  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 478.249 2.071   717.609 1.00 85.47  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 477.824 2.371   716.490 1.00 91.06  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 477.177 -0.138  718.222 1.00 68.65  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 475.937 -0.696  718.808 1.00 67.63  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 475.965 -2.131  719.343 1.00 71.82  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 475.670 -3.240  718.439 1.00 78.32  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 476.217 -4.458  718.506 1.00 83.87  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 475.845 -5.413  717.646 1.00 79.06  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 477.136 -4.732  719.427 1.00 86.18  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 479.479 2.394   718.032 1.00 83.42  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 480.391 3.213   717.231 1.00 85.20  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 481.734 2.493   717.178 1.00 89.64  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 482.309 2.194   718.234 1.00 93.79  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 480.594 4.622   717.838 1.00 82.30  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 479.327 5.483   717.846 1.00 77.58  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 481.620 5.396   717.029 1.00 82.27  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 478.529 5.395   716.623 1.00 79.13  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 482.161 2.092   715.967 1.00 82.61  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 483.493 1.542   715.690 1.00 80.92  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 484.412 2.529   714.953 1.00 86.16  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 483.956 3.256   714.065 1.00 88.15  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 483.438 0.275   714.844 1.00 75.73  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 482.835 -0.954  715.406 1.00 74.84  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 483.516 -2.031  715.862 1.00 74.97  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 481.443 -1.330  715.406 1.00 79.77  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 482.641 -3.033  716.228 1.00 83.83  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 481.363 -2.632  715.947 1.00 81.56  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 480.259 -0.686  715.031 1.00 80.30  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 480.151 -3.300  716.123 1.00 78.69  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 479.052 -1.354  715.206 1.00 78.22  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 479.011 -2.647  715.749 1.00 79.57  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 485.699 2.596   715.331 1.00 87.19  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 486.651 3.527   714.706 1.00 88.97  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 487.988 2.824   714.467 1.00 96.93  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 488.258 1.748   715.019 1.00 96.17  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 486.943 4.819   715.469 1.00 86.08  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 487.673 4.525   716.665 1.00 97.41  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 485.682 5.637   715.715 1.00 83.12  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 488.827 3.463   713.622 1.00 100.03 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 490.177 2.988   713.291 1.00 105.51 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 491.230 3.312   714.361 1.00 109.03 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 492.359 2.807   714.260 1.00 110.04 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 490.667 3.537   711.915 1.00 103.61 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 490.712 5.097   711.816 1.00 99.90  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 490.615 5.807   712.839 1.00 94.16  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 490.922 5.611   710.683 1.00 101.83 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 490.897 4.126   715.374 1.00 103.36 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 491.789 4.475   716.457 1.00 98.01  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 492.439 5.851   716.366 1.00 100.38 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 492.970 6.322   717.384 1.00 97.06  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 492.465 6.503   715.189 1.00 98.78  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 493.038 7.851   715.181 1.00 100.88 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 492.147 8.776   716.007 1.00 96.51  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 492.640 9.605   716.783 1.00 95.76  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 493.284 8.392   713.757 1.00 97.12  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 492.140 8.448   712.926 1.00 102.59 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 490.828 8.621   715.877 1.00 92.41  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 489.896 9.181   716.846 1.00 95.41  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 489.104 7.997   717.379 1.00 96.69  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 488.967 6.965   716.712 1.00 91.92  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 488.943 10.285  716.300 1.00 91.33  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 489.596 11.098  715.166 1.00 90.32  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 487.570 9.698   715.906 1.00 80.01  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 488.593 8.154   718.604 1.00 100.48 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 487.894 7.294   719.549 1.00 92.64  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 486.378 7.355   719.349 1.00 90.47  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 485.824 8.444   719.134 1.00 88.37  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 488.289 7.720   720.959 1.00 94.50  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 489.480 7.003   721.332 1.00 95.47  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 487.155 7.557   721.996 1.00 97.72  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 485.700 6.202   719.529 1.00 90.37  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 484.227 6.175   719.394 1.00 91.97  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 483.501 7.294   720.134 1.00 95.46  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 482.574 7.918   719.582 1.00 93.55  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 483.868 4.796   719.976 1.00 87.95  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 485.066 3.945   719.671 1.00 86.71  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 486.263 4.857   719.766 1.00 86.68  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 483.936 7.594   721.361 1.00 88.79  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 483.350 8.696   722.112 1.00 90.77  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 483.634 10.037  721.428 1.00 92.55  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 482.721 10.853  721.234 1.00 91.48  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 483.839 8.660   723.572 1.00 95.37  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 483.387 9.733   724.590 1.00 89.34  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 481.882 9.789   724.709 1.00 83.45  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 483.986 9.457   725.952 1.00 83.04  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 484.889 10.267  721.018 1.00 92.20  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 485.234 11.523  720.353 1.00 88.80  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 484.372 11.758  719.121 1.00 91.38  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 483.935 12.890  718.867 1.00 91.80  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 486.706 11.508  719.971 1.00 90.67  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 487.635 11.228  721.131 1.00 95.15  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 489.085 11.148  720.693 1.00 101.41 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 489.893 10.467  721.370 1.00 98.14  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 489.421 11.797  719.673 1.00 106.62 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 484.168 10.709  718.317 1.00 92.86  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 483.301 10.789  717.139 1.00 93.21  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 481.901 11.274  717.506 1.00 90.11  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 481.382 12.253  716.932 1.00 74.72  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 483.221 9.412   716.466 1.00 87.50  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 481.276 10.564  718.463 1.00 87.96  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 479.927 10.870  718.919 1.00 82.54  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 479.807 12.327  719.350 1.00 83.67  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 478.762 12.961  719.142 1.00 83.06  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 479.523 9.892   720.022 1.00 81.81  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 478.203 10.194  720.733 1.00 84.13  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 477.095 10.276  719.666 1.00 78.67  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 477.870 9.153   721.849 1.00 68.83  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 480.810 12.840  720.063 1.00 83.10  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 480.756 14.247  720.446 1.00 86.32  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 480.849 15.158  719.219 1.00 87.57  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 480.102 16.138  719.122 1.00 88.76  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 481.841 14.545  721.487 1.00 90.14  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 481.533 13.910  722.857 1.00 92.69  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 480.377 13.904  723.315 1.00 91.03  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 482.553 13.305  723.475 1.00 90.41  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 481.760 14.856  718.274 1.00 89.65  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 481.870 15.665  717.053 1.00 90.01  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 480.596 15.593  716.211 1.00 87.84  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 480.160 16.603  715.631 1.00 84.12  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 483.094 15.262  716.229 1.00 84.01  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 484.397 15.450  716.985 1.00 91.18  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 485.637 15.113  716.159 1.00 102.33 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 485.911 15.754  715.133 1.00 103.24 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 486.375 14.080  716.583 1.00 98.97  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 479.991 14.402  716.123 1.00 81.11  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 478.751 14.266  715.367 1.00 81.95  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 477.654 15.154  715.951 1.00 84.98  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 477.045 15.968  715.236 1.00 76.23  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 478.322 12.798  715.354 1.00 76.21  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 477.425 15.039  717.268 1.00 87.03  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 476.436 15.877  717.943 1.00 86.53  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 476.762 17.348  717.715 1.00 88.56  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 475.881 18.164  717.407 1.00 88.70  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 476.358 15.538  719.445 1.00 83.42  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 475.460 16.549  720.182 1.00 83.83  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 475.849 14.131  719.651 1.00 85.83  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 478.034 17.709  717.841 1.00 88.01  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 478.407 19.098  717.626 1.00 88.36  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 478.110 19.581  716.213 1.00 90.69  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 477.633 20.710  716.044 1.00 92.80  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 479.880 19.316  717.975 1.00 90.46  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 480.314 20.710  717.613 1.00 89.55  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 479.507 21.805  718.282 1.00 101.98 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 478.854 21.587  719.357 1.00 102.89 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 479.447 22.877  717.629 1.00 99.85  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 478.338 18.744  715.190 1.00 89.05  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 477.983 19.141  713.821 1.00 89.39  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 476.477 19.376  713.722 1.00 89.02  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 476.004 20.426  713.246 1.00 77.32  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 478.462 18.087  712.806 1.00 87.12  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 479.972 18.153  712.664 1.00 89.04  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 477.843 18.336  711.399 1.00 79.37  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 480.546 16.919  711.961 1.00 90.90  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 475.705 18.402  714.219 1.00 86.23  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 474.257 18.500  714.155 1.00 84.07  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 473.755 19.743  714.877 1.00 91.07  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 472.890 20.457  714.348 1.00 92.08  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 473.658 17.219  714.725 1.00 76.29  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 472.139 17.107  714.684 1.00 78.89  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 471.523 17.658  713.390 1.00 71.37  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 471.797 15.625  714.906 1.00 74.19  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 474.312 20.041  716.063 1.00 86.76  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 473.934 21.251  716.792 1.00 84.75  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 474.203 22.486  715.939 1.00 90.46  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 473.319 23.326  715.720 1.00 87.96  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 474.684 21.331  718.126 1.00 92.41  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 474.379 22.605  718.934 1.00 95.08  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 475.630 23.171  719.623 1.00 92.13  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 475.735 24.604  719.347 1.00 93.82  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 476.770 25.168  718.724 1.00 96.62  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 476.792 26.476  718.487 1.00 96.88  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 477.817 24.434  718.384 1.00 97.21  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 475.447 22.614  715.476 1.00 94.71  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 475.867 23.719  714.628 1.00 93.53  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 474.996 23.860  713.393 1.00 91.66  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 474.773 24.980  712.917 1.00 93.87  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 477.329 23.467  714.225 1.00 93.86  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 478.041 24.492  713.342 1.00 98.83  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 479.444 24.000  712.928 1.00 108.03 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 480.199 23.534  713.817 1.00 108.92 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 479.764 24.011  711.711 1.00 110.40 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 474.482 22.747  712.866 1.00 87.39  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 473.625 22.832  711.681 1.00 94.83  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 472.264 23.469  711.966 1.00 94.36  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 471.767 24.264  711.158 1.00 89.44  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 473.474 21.448  711.059 1.00 94.26  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 474.451 21.180  709.949 1.00 96.28  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 474.270 21.657  708.666 1.00 87.01  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 475.639 20.527  709.949 1.00 87.82  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 475.285 21.270  707.917 1.00 87.94  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 476.129 20.588  708.673 1.00 83.73  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 471.657 23.132  713.112 1.00 97.34  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 470.363 23.680  713.523 1.00 90.59  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 470.375 25.201  713.702 1.00 95.23  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 469.334 25.853  713.538 1.00 95.73  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 469.952 22.985  714.819 1.00 84.42  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 469.638 21.485  714.729 1.00 82.90  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 469.428 20.881  716.105 1.00 83.00  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? 468.386 21.289  713.931 1.00 79.76  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 471.534 25.773  714.054 1.00 96.35  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 471.721 27.223  714.145 1.00 93.27  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 471.303 27.988  712.887 1.00 96.68  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 470.825 29.123  712.990 1.00 96.66  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 473.185 27.527  714.460 1.00 95.71  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 473.994 27.169  713.329 1.00 102.34 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 473.649 26.721  715.671 1.00 85.35  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 471.483 27.397  711.696 1.00 101.80 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 471.292 28.079  710.404 1.00 105.32 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 469.865 28.587  710.191 1.00 104.36 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 469.619 29.328  709.228 1.00 104.22 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 471.662 27.156  709.225 1.00 100.39 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 473.088 26.632  709.250 1.00 102.39 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 474.140 27.435  709.694 1.00 103.02 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 473.386 25.337  708.800 1.00 101.66 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 475.458 26.956  709.726 1.00 108.08 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 474.705 24.845  708.816 1.00 102.78 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 475.742 25.661  709.285 1.00 107.18 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 477.053 25.198  709.325 1.00 97.88  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? 468.921 28.146  711.013 1.00 102.90 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? 467.516 28.519  710.946 1.00 105.57 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? 467.209 29.867  711.614 1.00 116.16 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? 466.035 30.239  711.726 1.00 119.45 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? 466.697 27.416  711.616 1.00 103.68 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? 466.599 26.156  710.807 1.00 96.30  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? 465.606 25.991  709.853 1.00 95.40  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? 467.517 25.131  711.004 1.00 92.42  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? 465.524 24.815  709.108 1.00 92.78  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? 467.445 23.954  710.265 1.00 91.14  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? 466.447 23.796  709.312 1.00 91.32  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? 468.213 30.576  712.129 1.00 121.33 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? 467.957 31.794  712.901 1.00 123.42 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? 467.353 32.921  712.049 1.00 124.06 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? 466.238 33.386  712.319 1.00 119.66 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 469.251 32.269  713.580 1.00 124.62 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 470.298 32.479  712.628 1.00 129.19 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? 468.063 33.347  710.987 1.00 119.90 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? 467.717 34.567  710.263 1.00 120.65 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? 466.872 34.292  709.027 1.00 117.78 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? 467.432 33.893  707.995 1.00 119.15 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 469.021 35.260  709.856 1.00 122.56 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 469.912 35.608  711.062 1.00 131.75 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? 469.424 35.810  712.184 1.00 132.63 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 471.232 35.620  710.840 1.00 130.22 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? 465.562 34.574  709.040 1.00 112.97 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? 464.697 34.277  707.887 1.00 111.62 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? 464.832 35.307  706.761 1.00 114.10 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? 465.613 36.256  706.853 1.00 116.56 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? 463.285 34.314  708.492 1.00 104.85 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? 463.472 34.422  709.966 1.00 116.13 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? 464.775 35.118  710.150 1.00 118.77 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? 464.041 35.091  705.691 1.00 105.30 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? 463.801 36.057  704.600 1.00 98.00  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? 462.572 35.685  703.740 1.00 97.85  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? 462.335 36.243  702.649 1.00 93.29  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? 465.031 36.192  703.707 1.00 102.10 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? 465.858 37.453  703.965 1.00 101.62 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? 467.263 37.163  704.497 1.00 106.23 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? 467.588 36.026  704.875 1.00 103.02 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? 468.109 38.197  704.512 1.00 102.98 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LEU B 1  6    ? 482.977 26.188  702.875 1.00 122.72 ? 6    LEU B N     1 
ATOM   1784  C  CA    . LEU B 1  6    ? 481.842 26.001  703.784 1.00 124.42 ? 6    LEU B CA    1 
ATOM   1785  C  C     . LEU B 1  6    ? 481.220 27.363  704.109 1.00 129.38 ? 6    LEU B C     1 
ATOM   1786  O  O     . LEU B 1  6    ? 481.519 27.932  705.165 1.00 128.34 ? 6    LEU B O     1 
ATOM   1787  C  CB    . LEU B 1  6    ? 482.297 25.323  705.091 1.00 113.32 ? 6    LEU B CB    1 
ATOM   1788  C  CG    . LEU B 1  6    ? 483.110 24.022  705.138 1.00 108.67 ? 6    LEU B CG    1 
ATOM   1789  C  CD1   . LEU B 1  6    ? 482.506 22.969  704.225 1.00 111.28 ? 6    LEU B CD1   1 
ATOM   1790  C  CD2   . LEU B 1  6    ? 484.590 24.259  704.801 1.00 110.47 ? 6    LEU B CD2   1 
ATOM   1791  N  N     . LYS B 1  7    ? 480.297 27.860  703.279 1.00 131.64 ? 7    LYS B N     1 
ATOM   1792  C  CA    . LYS B 1  7    ? 479.642 29.115  703.634 1.00 125.82 ? 7    LYS B CA    1 
ATOM   1793  C  C     . LYS B 1  7    ? 478.504 28.918  704.643 1.00 114.79 ? 7    LYS B C     1 
ATOM   1794  O  O     . LYS B 1  7    ? 478.256 27.822  705.158 1.00 109.05 ? 7    LYS B O     1 
ATOM   1795  C  CB    . LYS B 1  7    ? 479.129 29.799  702.362 1.00 118.42 ? 7    LYS B CB    1 
ATOM   1796  C  CG    . LYS B 1  7    ? 480.247 30.102  701.400 1.00 118.57 ? 7    LYS B CG    1 
ATOM   1797  C  CD    . LYS B 1  7    ? 481.121 31.184  702.034 1.00 127.80 ? 7    LYS B CD    1 
ATOM   1798  C  CE    . LYS B 1  7    ? 482.071 31.850  701.048 1.00 127.87 ? 7    LYS B CE    1 
ATOM   1799  N  NZ    . LYS B 1  7    ? 483.178 30.940  700.653 1.00 125.80 ? 7    LYS B NZ    1 
ATOM   1800  N  N     . ALA B 1  8    ? 477.885 30.039  705.019 1.00 112.13 ? 8    ALA B N     1 
ATOM   1801  C  CA    . ALA B 1  8    ? 476.715 30.068  705.887 1.00 108.75 ? 8    ALA B CA    1 
ATOM   1802  C  C     . ALA B 1  8    ? 475.429 29.862  705.083 1.00 106.22 ? 8    ALA B C     1 
ATOM   1803  O  O     . ALA B 1  8    ? 475.099 30.727  704.255 1.00 102.27 ? 8    ALA B O     1 
ATOM   1804  C  CB    . ALA B 1  8    ? 476.671 31.400  706.639 1.00 103.73 ? 8    ALA B CB    1 
ATOM   1805  N  N     . PRO B 1  9    ? 474.681 28.768  705.266 1.00 100.92 ? 9    PRO B N     1 
ATOM   1806  C  CA    . PRO B 1  9    ? 473.476 28.566  704.440 1.00 93.16  ? 9    PRO B CA    1 
ATOM   1807  C  C     . PRO B 1  9    ? 472.540 29.764  704.535 1.00 86.65  ? 9    PRO B C     1 
ATOM   1808  O  O     . PRO B 1  9    ? 472.461 30.410  705.571 1.00 99.21  ? 9    PRO B O     1 
ATOM   1809  C  CB    . PRO B 1  9    ? 472.848 27.312  705.044 1.00 93.00  ? 9    PRO B CB    1 
ATOM   1810  C  CG    . PRO B 1  9    ? 474.030 26.580  705.662 1.00 99.22  ? 9    PRO B CG    1 
ATOM   1811  C  CD    . PRO B 1  9    ? 474.939 27.642  706.182 1.00 96.99  ? 9    PRO B CD    1 
ATOM   1812  N  N     . VAL B 1  10   ? 471.835 30.075  703.473 1.00 83.96  ? 10   VAL B N     1 
ATOM   1813  C  CA    . VAL B 1  10   ? 470.785 31.088  703.546 1.00 85.13  ? 10   VAL B CA    1 
ATOM   1814  C  C     . VAL B 1  10   ? 469.435 30.433  703.827 1.00 95.33  ? 10   VAL B C     1 
ATOM   1815  O  O     . VAL B 1  10   ? 469.074 29.423  703.206 1.00 93.26  ? 10   VAL B O     1 
ATOM   1816  C  CB    . VAL B 1  10   ? 470.758 31.964  702.286 1.00 93.01  ? 10   VAL B CB    1 
ATOM   1817  C  CG1   . VAL B 1  10   ? 472.101 32.655  702.155 1.00 96.27  ? 10   VAL B CG1   1 
ATOM   1818  C  CG2   . VAL B 1  10   ? 470.393 31.166  701.027 1.00 99.82  ? 10   VAL B CG2   1 
ATOM   1819  N  N     . PHE B 1  11   ? 468.655 31.059  704.714 1.00 103.51 ? 11   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  11   ? 467.369 30.556  705.204 1.00 97.74  ? 11   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  11   ? 466.235 31.463  704.698 1.00 95.15  ? 11   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  11   ? 466.280 32.681  704.905 1.00 98.49  ? 11   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  11   ? 467.422 30.501  706.735 1.00 97.75  ? 11   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  11   ? 466.173 29.980  707.387 1.00 106.62 ? 11   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  11   ? 465.310 29.124  706.705 1.00 105.70 ? 11   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  11   ? 465.821 30.399  708.665 1.00 106.29 ? 11   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  11   ? 464.137 28.646  707.318 1.00 105.10 ? 11   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  11   ? 464.652 29.944  709.264 1.00 106.61 ? 11   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  11   ? 463.810 29.061  708.598 1.00 102.68 ? 11   PHE B CZ    1 
ATOM   1830  N  N     . THR B 1  12   ? 465.244 30.893  704.001 1.00 92.91  ? 12   THR B N     1 
ATOM   1831  C  CA    . THR B 1  12   ? 464.242 31.695  703.291 1.00 97.20  ? 12   THR B CA    1 
ATOM   1832  C  C     . THR B 1  12   ? 462.822 31.258  703.629 1.00 94.77  ? 12   THR B C     1 
ATOM   1833  O  O     . THR B 1  12   ? 462.529 30.059  703.642 1.00 93.92  ? 12   THR B O     1 
ATOM   1834  C  CB    . THR B 1  12   ? 464.407 31.597  701.764 1.00 92.95  ? 12   THR B CB    1 
ATOM   1835  O  OG1   . THR B 1  12   ? 465.766 31.883  701.393 1.00 92.68  ? 12   THR B OG1   1 
ATOM   1836  C  CG2   . THR B 1  12   ? 463.427 32.564  701.057 1.00 82.65  ? 12   THR B CG2   1 
ATOM   1837  N  N     . VAL B 1  13   ? 461.950 32.228  703.911 1.00 87.94  ? 13   VAL B N     1 
ATOM   1838  C  CA    . VAL B 1  13   ? 460.592 31.965  704.374 1.00 89.89  ? 13   VAL B CA    1 
ATOM   1839  C  C     . VAL B 1  13   ? 459.584 32.598  703.421 1.00 90.89  ? 13   VAL B C     1 
ATOM   1840  O  O     . VAL B 1  13   ? 459.817 33.698  702.910 1.00 94.26  ? 13   VAL B O     1 
ATOM   1841  C  CB    . VAL B 1  13   ? 460.363 32.459  705.825 1.00 94.93  ? 13   VAL B CB    1 
ATOM   1842  C  CG1   . VAL B 1  13   ? 459.010 32.020  706.334 1.00 88.94  ? 13   VAL B CG1   1 
ATOM   1843  C  CG2   . VAL B 1  13   ? 461.417 31.895  706.770 1.00 95.10  ? 13   VAL B CG2   1 
ATOM   1844  N  N     . ARG B 1  14   ? 458.505 31.867  703.122 1.00 90.62  ? 14   ARG B N     1 
ATOM   1845  C  CA    . ARG B 1  14   ? 457.363 32.377  702.360 1.00 91.97  ? 14   ARG B CA    1 
ATOM   1846  C  C     . ARG B 1  14   ? 456.105 31.935  703.098 1.00 99.69  ? 14   ARG B C     1 
ATOM   1847  O  O     . ARG B 1  14   ? 455.835 30.732  703.163 1.00 99.74  ? 14   ARG B O     1 
ATOM   1848  C  CB    . ARG B 1  14   ? 457.358 31.850  700.928 1.00 99.18  ? 14   ARG B CB    1 
ATOM   1849  C  CG    . ARG B 1  14   ? 457.424 32.936  699.838 1.00 109.64 ? 14   ARG B CG    1 
ATOM   1850  C  CD    . ARG B 1  14   ? 457.589 32.308  698.433 1.00 106.56 ? 14   ARG B CD    1 
ATOM   1851  N  NE    . ARG B 1  14   ? 458.454 31.129  698.539 1.00 108.38 ? 14   ARG B NE    1 
ATOM   1852  C  CZ    . ARG B 1  14   ? 459.597 30.938  697.888 1.00 110.92 ? 14   ARG B CZ    1 
ATOM   1853  N  NH1   . ARG B 1  14   ? 460.042 31.857  697.042 1.00 112.06 ? 14   ARG B NH1   1 
ATOM   1854  N  NH2   . ARG B 1  14   ? 460.292 29.813  698.083 1.00 106.77 ? 14   ARG B NH2   1 
ATOM   1855  N  N     . THR B 1  15   ? 455.314 32.887  703.626 1.00 107.64 ? 15   THR B N     1 
ATOM   1856  C  CA    . THR B 1  15   ? 454.170 32.576  704.492 1.00 105.30 ? 15   THR B CA    1 
ATOM   1857  C  C     . THR B 1  15   ? 452.858 33.089  703.901 1.00 108.07 ? 15   THR B C     1 
ATOM   1858  O  O     . THR B 1  15   ? 452.795 34.175  703.313 1.00 109.19 ? 15   THR B O     1 
ATOM   1859  C  CB    . THR B 1  15   ? 454.312 33.180  705.903 1.00 99.50  ? 15   THR B CB    1 
ATOM   1860  O  OG1   . THR B 1  15   ? 454.134 34.601  705.838 1.00 100.62 ? 15   THR B OG1   1 
ATOM   1861  C  CG2   . THR B 1  15   ? 455.670 32.882  706.479 1.00 98.29  ? 15   THR B CG2   1 
ATOM   1862  N  N     . GLN B 1  16   ? 451.787 32.333  704.156 1.00 107.01 ? 16   GLN B N     1 
ATOM   1863  C  CA    . GLN B 1  16   ? 450.420 32.759  703.857 1.00 112.44 ? 16   GLN B CA    1 
ATOM   1864  C  C     . GLN B 1  16   ? 449.491 32.857  705.055 1.00 116.77 ? 16   GLN B C     1 
ATOM   1865  O  O     . GLN B 1  16   ? 448.508 32.110  705.142 1.00 115.91 ? 16   GLN B O     1 
ATOM   1866  C  CB    . GLN B 1  16   ? 449.772 31.823  702.841 1.00 111.54 ? 16   GLN B CB    1 
ATOM   1867  C  CG    . GLN B 1  16   ? 450.376 31.904  701.470 1.00 123.61 ? 16   GLN B CG    1 
ATOM   1868  C  CD    . GLN B 1  16   ? 449.570 31.122  700.454 1.00 131.95 ? 16   GLN B CD    1 
ATOM   1869  O  OE1   . GLN B 1  16   ? 448.396 30.814  700.695 1.00 134.26 ? 16   GLN B OE1   1 
ATOM   1870  N  NE2   . GLN B 1  16   ? 450.174 30.835  699.293 1.00 124.89 ? 16   GLN B NE2   1 
ATOM   1871  N  N     . GLY B 1  17   ? 449.784 33.761  705.986 1.00 115.67 ? 17   GLY B N     1 
ATOM   1872  C  CA    . GLY B 1  17   ? 448.943 33.858  707.158 1.00 111.35 ? 17   GLY B CA    1 
ATOM   1873  C  C     . GLY B 1  17   ? 449.404 32.959  708.278 1.00 105.82 ? 17   GLY B C     1 
ATOM   1874  O  O     . GLY B 1  17   ? 450.610 32.710  708.425 1.00 100.29 ? 17   GLY B O     1 
ATOM   1875  N  N     . ARG B 1  18   ? 448.464 32.458  709.074 1.00 98.12  ? 18   ARG B N     1 
ATOM   1876  C  CA    . ARG B 1  18   ? 448.886 31.609  710.165 1.00 96.95  ? 18   ARG B CA    1 
ATOM   1877  C  C     . ARG B 1  18   ? 448.814 30.112  709.885 1.00 99.73  ? 18   ARG B C     1 
ATOM   1878  O  O     . ARG B 1  18   ? 449.231 29.346  710.752 1.00 104.99 ? 18   ARG B O     1 
ATOM   1879  C  CB    . ARG B 1  18   ? 448.089 31.942  711.439 1.00 99.52  ? 18   ARG B CB    1 
ATOM   1880  C  CG    . ARG B 1  18   ? 448.286 33.393  711.945 1.00 98.75  ? 18   ARG B CG    1 
ATOM   1881  C  CD    . ARG B 1  18   ? 447.450 33.748  713.190 1.00 85.07  ? 18   ARG B CD    1 
ATOM   1882  N  NE    . ARG B 1  18   ? 447.634 32.735  714.226 1.00 88.08  ? 18   ARG B NE    1 
ATOM   1883  C  CZ    . ARG B 1  18   ? 448.668 32.680  715.066 1.00 88.16  ? 18   ARG B CZ    1 
ATOM   1884  N  NH1   . ARG B 1  18   ? 448.728 31.706  715.964 1.00 90.89  ? 18   ARG B NH1   1 
ATOM   1885  N  NH2   . ARG B 1  18   ? 449.662 33.563  714.990 1.00 79.10  ? 18   ARG B NH2   1 
ATOM   1886  N  N     . GLU B 1  19   ? 448.284 29.647  708.748 1.00 99.43  ? 19   GLU B N     1 
ATOM   1887  C  CA    . GLU B 1  19   ? 448.194 28.192  708.574 1.00 101.50 ? 19   GLU B CA    1 
ATOM   1888  C  C     . GLU B 1  19   ? 449.248 27.581  707.643 1.00 104.92 ? 19   GLU B C     1 
ATOM   1889  O  O     . GLU B 1  19   ? 449.305 26.348  707.538 1.00 104.25 ? 19   GLU B O     1 
ATOM   1890  C  CB    . GLU B 1  19   ? 446.809 27.740  708.105 1.00 98.18  ? 19   GLU B CB    1 
ATOM   1891  C  CG    . GLU B 1  19   ? 445.665 28.202  708.956 1.00 97.30  ? 19   GLU B CG    1 
ATOM   1892  C  CD    . GLU B 1  19   ? 444.327 27.758  708.379 1.00 108.21 ? 19   GLU B CD    1 
ATOM   1893  O  OE1   . GLU B 1  19   ? 443.670 28.559  707.671 1.00 111.27 ? 19   GLU B OE1   1 
ATOM   1894  O  OE2   . GLU B 1  19   ? 443.948 26.583  708.613 1.00 110.95 ? 19   GLU B OE2   1 
ATOM   1895  N  N     . TYR B 1  20   ? 450.056 28.372  706.939 1.00 104.66 ? 20   TYR B N     1 
ATOM   1896  C  CA    . TYR B 1  20   ? 450.997 27.753  706.011 1.00 104.41 ? 20   TYR B CA    1 
ATOM   1897  C  C     . TYR B 1  20   ? 452.242 28.604  705.781 1.00 106.60 ? 20   TYR B C     1 
ATOM   1898  O  O     . TYR B 1  20   ? 452.170 29.829  705.631 1.00 109.82 ? 20   TYR B O     1 
ATOM   1899  C  CB    . TYR B 1  20   ? 450.346 27.440  704.661 1.00 100.04 ? 20   TYR B CB    1 
ATOM   1900  C  CG    . TYR B 1  20   ? 451.339 26.860  703.650 1.00 108.54 ? 20   TYR B CG    1 
ATOM   1901  C  CD1   . TYR B 1  20   ? 451.644 25.495  703.625 1.00 106.75 ? 20   TYR B CD1   1 
ATOM   1902  C  CD2   . TYR B 1  20   ? 451.962 27.681  702.702 1.00 108.98 ? 20   TYR B CD2   1 
ATOM   1903  C  CE1   . TYR B 1  20   ? 452.558 24.963  702.685 1.00 103.41 ? 20   TYR B CE1   1 
ATOM   1904  C  CE2   . TYR B 1  20   ? 452.868 27.163  701.759 1.00 106.65 ? 20   TYR B CE2   1 
ATOM   1905  C  CZ    . TYR B 1  20   ? 453.164 25.806  701.750 1.00 106.08 ? 20   TYR B CZ    1 
ATOM   1906  O  OH    . TYR B 1  20   ? 454.063 25.303  700.816 1.00 102.76 ? 20   TYR B OH    1 
ATOM   1907  N  N     . GLY B 1  21   ? 453.368 27.917  705.667 1.00 94.68  ? 21   GLY B N     1 
ATOM   1908  C  CA    . GLY B 1  21   ? 454.627 28.563  705.363 1.00 96.71  ? 21   GLY B CA    1 
ATOM   1909  C  C     . GLY B 1  21   ? 455.496 27.550  704.664 1.00 103.21 ? 21   GLY B C     1 
ATOM   1910  O  O     . GLY B 1  21   ? 455.330 26.338  704.839 1.00 102.26 ? 21   GLY B O     1 
ATOM   1911  N  N     . GLU B 1  22   ? 456.418 28.056  703.847 1.00 101.19 ? 22   GLU B N     1 
ATOM   1912  C  CA    . GLU B 1  22   ? 457.396 27.268  703.110 1.00 93.71  ? 22   GLU B CA    1 
ATOM   1913  C  C     . GLU B 1  22   ? 458.795 27.730  703.500 1.00 90.44  ? 22   GLU B C     1 
ATOM   1914  O  O     . GLU B 1  22   ? 459.070 28.935  703.472 1.00 93.16  ? 22   GLU B O     1 
ATOM   1915  C  CB    . GLU B 1  22   ? 457.087 27.460  701.632 1.00 97.35  ? 22   GLU B CB    1 
ATOM   1916  C  CG    . GLU B 1  22   ? 457.506 26.387  700.692 1.00 101.18 ? 22   GLU B CG    1 
ATOM   1917  C  CD    . GLU B 1  22   ? 457.254 26.837  699.280 1.00 105.67 ? 22   GLU B CD    1 
ATOM   1918  O  OE1   . GLU B 1  22   ? 456.100 27.289  699.042 1.00 99.81  ? 22   GLU B OE1   1 
ATOM   1919  O  OE2   . GLU B 1  22   ? 458.196 26.774  698.441 1.00 111.14 ? 22   GLU B OE2   1 
ATOM   1920  N  N     . PHE B 1  23   ? 459.703 26.788  703.774 1.00 83.26  ? 23   PHE B N     1 
ATOM   1921  C  CA    . PHE B 1  23   ? 461.012 27.138  704.327 1.00 86.60  ? 23   PHE B CA    1 
ATOM   1922  C  C     . PHE B 1  23   ? 462.134 26.450  703.571 1.00 90.97  ? 23   PHE B C     1 
ATOM   1923  O  O     . PHE B 1  23   ? 462.186 25.217  703.538 1.00 94.64  ? 23   PHE B O     1 
ATOM   1924  C  CB    . PHE B 1  23   ? 461.056 26.754  705.815 1.00 91.07  ? 23   PHE B CB    1 
ATOM   1925  C  CG    . PHE B 1  23   ? 459.835 27.220  706.589 1.00 98.74  ? 23   PHE B CG    1 
ATOM   1926  C  CD1   . PHE B 1  23   ? 459.777 28.501  707.126 1.00 95.11  ? 23   PHE B CD1   1 
ATOM   1927  C  CD2   . PHE B 1  23   ? 458.709 26.403  706.703 1.00 96.29  ? 23   PHE B CD2   1 
ATOM   1928  C  CE1   . PHE B 1  23   ? 458.640 28.928  707.788 1.00 92.55  ? 23   PHE B CE1   1 
ATOM   1929  C  CE2   . PHE B 1  23   ? 457.570 26.835  707.370 1.00 88.55  ? 23   PHE B CE2   1 
ATOM   1930  C  CZ    . PHE B 1  23   ? 457.536 28.090  707.902 1.00 89.88  ? 23   PHE B CZ    1 
ATOM   1931  N  N     . VAL B 1  24   ? 463.004 27.241  702.930 1.00 95.75  ? 24   VAL B N     1 
ATOM   1932  C  CA    . VAL B 1  24   ? 464.084 26.717  702.086 1.00 91.79  ? 24   VAL B CA    1 
ATOM   1933  C  C     . VAL B 1  24   ? 465.459 27.063  702.674 1.00 91.59  ? 24   VAL B C     1 
ATOM   1934  O  O     . VAL B 1  24   ? 465.785 28.244  702.839 1.00 98.43  ? 24   VAL B O     1 
ATOM   1935  C  CB    . VAL B 1  24   ? 463.971 27.248  700.652 1.00 83.72  ? 24   VAL B CB    1 
ATOM   1936  C  CG1   . VAL B 1  24   ? 465.149 26.759  699.863 1.00 92.42  ? 24   VAL B CG1   1 
ATOM   1937  C  CG2   . VAL B 1  24   ? 462.641 26.830  700.013 1.00 82.40  ? 24   VAL B CG2   1 
ATOM   1938  N  N     . LEU B 1  25   ? 466.285 26.048  702.930 1.00 88.52  ? 25   LEU B N     1 
ATOM   1939  C  CA    . LEU B 1  25   ? 467.662 26.227  703.397 1.00 88.77  ? 25   LEU B CA    1 
ATOM   1940  C  C     . LEU B 1  25   ? 468.605 25.592  702.382 1.00 91.02  ? 25   LEU B C     1 
ATOM   1941  O  O     . LEU B 1  25   ? 468.690 24.359  702.330 1.00 90.35  ? 25   LEU B O     1 
ATOM   1942  C  CB    . LEU B 1  25   ? 467.849 25.573  704.769 1.00 92.70  ? 25   LEU B CB    1 
ATOM   1943  C  CG    . LEU B 1  25   ? 469.169 25.781  705.526 1.00 97.58  ? 25   LEU B CG    1 
ATOM   1944  C  CD1   . LEU B 1  25   ? 469.451 27.270  705.712 1.00 101.79 ? 25   LEU B CD1   1 
ATOM   1945  C  CD2   . LEU B 1  25   ? 469.274 24.980  706.856 1.00 81.92  ? 25   LEU B CD2   1 
ATOM   1946  N  N     . GLU B 1  26   ? 469.401 26.405  701.671 1.00 95.91  ? 26   GLU B N     1 
ATOM   1947  C  CA    . GLU B 1  26   ? 470.416 25.909  700.730 1.00 95.04  ? 26   GLU B CA    1 
ATOM   1948  C  C     . GLU B 1  26   ? 471.565 26.900  700.615 1.00 91.81  ? 26   GLU B C     1 
ATOM   1949  O  O     . GLU B 1  26   ? 471.342 28.110  700.715 1.00 94.35  ? 26   GLU B O     1 
ATOM   1950  C  CB    . GLU B 1  26   ? 469.799 25.696  699.339 1.00 92.13  ? 26   GLU B CB    1 
ATOM   1951  C  CG    . GLU B 1  26   ? 469.367 27.008  698.720 1.00 90.80  ? 26   GLU B CG    1 
ATOM   1952  C  CD    . GLU B 1  26   ? 468.950 26.884  697.280 1.00 99.02  ? 26   GLU B CD    1 
ATOM   1953  O  OE1   . GLU B 1  26   ? 469.729 26.358  696.448 1.00 98.47  ? 26   GLU B OE1   1 
ATOM   1954  O  OE2   . GLU B 1  26   ? 467.821 27.342  696.982 1.00 102.71 ? 26   GLU B OE2   1 
ATOM   1955  N  N     . PRO B 1  27   ? 472.769 26.441  700.266 1.00 88.62  ? 27   PRO B N     1 
ATOM   1956  C  CA    . PRO B 1  27   ? 473.253 25.068  700.099 1.00 90.44  ? 27   PRO B CA    1 
ATOM   1957  C  C     . PRO B 1  27   ? 473.697 24.359  701.363 1.00 93.64  ? 27   PRO B C     1 
ATOM   1958  O  O     . PRO B 1  27   ? 474.135 25.029  702.303 1.00 99.55  ? 27   PRO B O     1 
ATOM   1959  C  CB    . PRO B 1  27   ? 474.490 25.263  699.231 1.00 96.38  ? 27   PRO B CB    1 
ATOM   1960  C  CG    . PRO B 1  27   ? 475.026 26.603  699.685 1.00 92.96  ? 27   PRO B CG    1 
ATOM   1961  C  CD    . PRO B 1  27   ? 473.808 27.437  699.951 1.00 89.49  ? 27   PRO B CD    1 
ATOM   1962  N  N     . LEU B 1  28   ? 473.578 23.023  701.370 1.00 91.04  ? 28   LEU B N     1 
ATOM   1963  C  CA    . LEU B 1  28   ? 474.070 22.159  702.438 1.00 91.81  ? 28   LEU B CA    1 
ATOM   1964  C  C     . LEU B 1  28   ? 474.994 21.121  701.826 1.00 83.33  ? 28   LEU B C     1 
ATOM   1965  O  O     . LEU B 1  28   ? 474.774 20.708  700.693 1.00 86.59  ? 28   LEU B O     1 
ATOM   1966  C  CB    . LEU B 1  28   ? 472.916 21.420  703.152 1.00 97.87  ? 28   LEU B CB    1 
ATOM   1967  C  CG    . LEU B 1  28   ? 471.717 22.048  703.891 1.00 91.57  ? 28   LEU B CG    1 
ATOM   1968  C  CD1   . LEU B 1  28   ? 470.736 20.926  704.293 1.00 80.11  ? 28   LEU B CD1   1 
ATOM   1969  C  CD2   . LEU B 1  28   ? 472.131 22.888  705.106 1.00 95.35  ? 28   LEU B CD2   1 
ATOM   1970  N  N     . GLU B 1  29   ? 475.938 20.604  702.613 1.00 85.23  ? 29   GLU B N     1 
ATOM   1971  C  CA    . GLU B 1  29   ? 476.828 19.547  702.130 1.00 88.99  ? 29   GLU B CA    1 
ATOM   1972  C  C     . GLU B 1  29   ? 476.047 18.270  701.790 1.00 90.50  ? 29   GLU B C     1 
ATOM   1973  O  O     . GLU B 1  29   ? 474.895 18.090  702.194 1.00 88.82  ? 29   GLU B O     1 
ATOM   1974  C  CB    . GLU B 1  29   ? 477.928 19.235  703.140 1.00 90.51  ? 29   GLU B CB    1 
ATOM   1975  C  CG    . GLU B 1  29   ? 479.088 18.451  702.503 1.00 104.51 ? 29   GLU B CG    1 
ATOM   1976  C  CD    . GLU B 1  29   ? 480.316 18.342  703.395 1.00 121.34 ? 29   GLU B CD    1 
ATOM   1977  O  OE1   . GLU B 1  29   ? 480.304 17.509  704.348 1.00 112.58 ? 29   GLU B OE1   1 
ATOM   1978  O  OE2   . GLU B 1  29   ? 481.300 19.076  703.116 1.00 125.37 ? 29   GLU B OE2   1 
ATOM   1979  N  N     . ARG B 1  30   ? 476.658 17.422  700.952 1.00 92.24  ? 30   ARG B N     1 
ATOM   1980  C  CA    . ARG B 1  30   ? 475.990 16.229  700.429 1.00 90.74  ? 30   ARG B CA    1 
ATOM   1981  C  C     . ARG B 1  30   ? 475.461 15.341  701.561 1.00 91.20  ? 30   ARG B C     1 
ATOM   1982  O  O     . ARG B 1  30   ? 476.224 14.886  702.425 1.00 87.81  ? 30   ARG B O     1 
ATOM   1983  C  CB    . ARG B 1  30   ? 476.953 15.419  699.579 1.00 81.15  ? 30   ARG B CB    1 
ATOM   1984  C  CG    . ARG B 1  30   ? 476.347 14.155  699.051 1.00 81.37  ? 30   ARG B CG    1 
ATOM   1985  C  CD    . ARG B 1  30   ? 477.417 13.323  698.387 1.00 91.42  ? 30   ARG B CD    1 
ATOM   1986  N  NE    . ARG B 1  30   ? 478.228 12.685  699.426 1.00 94.82  ? 30   ARG B NE    1 
ATOM   1987  C  CZ    . ARG B 1  30   ? 479.242 11.848  699.209 1.00 91.78  ? 30   ARG B CZ    1 
ATOM   1988  N  NH1   . ARG B 1  30   ? 479.608 11.521  697.972 1.00 77.89  ? 30   ARG B NH1   1 
ATOM   1989  N  NH2   . ARG B 1  30   ? 479.881 11.327  700.252 1.00 97.84  ? 30   ARG B NH2   1 
ATOM   1990  N  N     . GLY B 1  31   ? 474.156 15.033  701.500 1.00 89.30  ? 31   GLY B N     1 
ATOM   1991  C  CA    . GLY B 1  31   ? 473.472 14.148  702.425 1.00 89.90  ? 31   GLY B CA    1 
ATOM   1992  C  C     . GLY B 1  31   ? 472.682 14.862  703.515 1.00 88.22  ? 31   GLY B C     1 
ATOM   1993  O  O     . GLY B 1  31   ? 471.781 14.260  704.117 1.00 81.94  ? 31   GLY B O     1 
ATOM   1994  N  N     . PHE B 1  32   ? 473.026 16.115  703.809 1.00 87.42  ? 32   PHE B N     1 
ATOM   1995  C  CA    . PHE B 1  32   ? 472.445 16.833  704.935 1.00 82.76  ? 32   PHE B CA    1 
ATOM   1996  C  C     . PHE B 1  32   ? 471.000 17.262  704.707 1.00 79.63  ? 32   PHE B C     1 
ATOM   1997  O  O     . PHE B 1  32   ? 470.311 17.584  705.673 1.00 81.78  ? 32   PHE B O     1 
ATOM   1998  C  CB    . PHE B 1  32   ? 473.369 17.987  705.312 1.00 83.71  ? 32   PHE B CB    1 
ATOM   1999  C  CG    . PHE B 1  32   ? 474.381 17.573  706.322 1.00 86.29  ? 32   PHE B CG    1 
ATOM   2000  C  CD1   . PHE B 1  32   ? 475.588 17.021  705.921 1.00 83.24  ? 32   PHE B CD1   1 
ATOM   2001  C  CD2   . PHE B 1  32   ? 474.107 17.687  707.678 1.00 88.59  ? 32   PHE B CD2   1 
ATOM   2002  C  CE1   . PHE B 1  32   ? 476.512 16.586  706.843 1.00 79.97  ? 32   PHE B CE1   1 
ATOM   2003  C  CE2   . PHE B 1  32   ? 475.039 17.275  708.617 1.00 92.24  ? 32   PHE B CE2   1 
ATOM   2004  C  CZ    . PHE B 1  32   ? 476.250 16.719  708.192 1.00 90.72  ? 32   PHE B CZ    1 
ATOM   2005  N  N     . GLY B 1  33   ? 470.522 17.287  703.469 1.00 84.42  ? 33   GLY B N     1 
ATOM   2006  C  CA    . GLY B 1  33   ? 469.124 17.633  703.240 1.00 85.03  ? 33   GLY B CA    1 
ATOM   2007  C  C     . GLY B 1  33   ? 468.155 16.711  703.959 1.00 78.66  ? 33   GLY B C     1 
ATOM   2008  O  O     . GLY B 1  33   ? 467.158 17.162  704.517 1.00 72.88  ? 33   GLY B O     1 
ATOM   2009  N  N     . VAL B 1  34   ? 468.388 15.398  703.871 1.00 80.22  ? 34   VAL B N     1 
ATOM   2010  C  CA    . VAL B 1  34   ? 467.528 14.435  704.556 1.00 72.71  ? 34   VAL B CA    1 
ATOM   2011  C  C     . VAL B 1  34   ? 467.936 14.258  706.019 1.00 81.50  ? 34   VAL B C     1 
ATOM   2012  O  O     . VAL B 1  34   ? 467.122 13.794  706.836 1.00 85.48  ? 34   VAL B O     1 
ATOM   2013  C  CB    . VAL B 1  34   ? 467.531 13.101  703.781 1.00 76.63  ? 34   VAL B CB    1 
ATOM   2014  C  CG1   . VAL B 1  34   ? 467.888 13.344  702.305 1.00 85.96  ? 34   VAL B CG1   1 
ATOM   2015  C  CG2   . VAL B 1  34   ? 468.433 12.038  704.409 1.00 71.82  ? 34   VAL B CG2   1 
ATOM   2016  N  N     . THR B 1  35   ? 469.187 14.589  706.373 1.00 80.74  ? 35   THR B N     1 
ATOM   2017  C  CA    . THR B 1  35   ? 469.622 14.491  707.766 1.00 74.09  ? 35   THR B CA    1 
ATOM   2018  C  C     . THR B 1  35   ? 468.891 15.498  708.641 1.00 73.83  ? 35   THR B C     1 
ATOM   2019  O  O     . THR B 1  35   ? 468.522 15.175  709.766 1.00 78.90  ? 35   THR B O     1 
ATOM   2020  C  CB    . THR B 1  35   ? 471.146 14.642  707.907 1.00 79.69  ? 35   THR B CB    1 
ATOM   2021  O  OG1   . THR B 1  35   ? 471.803 13.443  707.456 1.00 80.62  ? 35   THR B OG1   1 
ATOM   2022  C  CG2   . THR B 1  35   ? 471.556 14.931  709.357 1.00 73.55  ? 35   THR B CG2   1 
ATOM   2023  N  N     . LEU B 1  36   ? 468.670 16.723  708.163 1.00 72.44  ? 36   LEU B N     1 
ATOM   2024  C  CA    . LEU B 1  36   ? 467.831 17.620  708.953 1.00 69.40  ? 36   LEU B CA    1 
ATOM   2025  C  C     . LEU B 1  36   ? 466.340 17.385  708.746 1.00 70.36  ? 36   LEU B C     1 
ATOM   2026  O  O     . LEU B 1  36   ? 465.580 17.309  709.711 1.00 81.91  ? 36   LEU B O     1 
ATOM   2027  C  CB    . LEU B 1  36   ? 468.136 19.065  708.593 1.00 66.00  ? 36   LEU B CB    1 
ATOM   2028  C  CG    . LEU B 1  36   ? 469.578 19.457  708.773 1.00 70.28  ? 36   LEU B CG    1 
ATOM   2029  C  CD1   . LEU B 1  36   ? 469.693 20.939  708.488 1.00 76.93  ? 36   LEU B CD1   1 
ATOM   2030  C  CD2   . LEU B 1  36   ? 469.992 19.083  710.160 1.00 73.52  ? 36   LEU B CD2   1 
ATOM   2031  N  N     . GLY B 1  37   ? 465.897 17.241  707.515 1.00 68.42  ? 37   GLY B N     1 
ATOM   2032  C  CA    . GLY B 1  37   ? 464.465 17.195  707.278 1.00 74.28  ? 37   GLY B CA    1 
ATOM   2033  C  C     . GLY B 1  37   ? 463.757 16.032  707.958 1.00 75.84  ? 37   GLY B C     1 
ATOM   2034  O  O     . GLY B 1  37   ? 462.715 16.207  708.591 1.00 77.53  ? 37   GLY B O     1 
ATOM   2035  N  N     . ASN B 1  38   ? 464.327 14.836  707.877 1.00 74.65  ? 38   ASN B N     1 
ATOM   2036  C  CA    . ASN B 1  38   ? 463.615 13.696  708.439 1.00 72.26  ? 38   ASN B CA    1 
ATOM   2037  C  C     . ASN B 1  38   ? 463.455 13.834  709.942 1.00 76.93  ? 38   ASN B C     1 
ATOM   2038  O  O     . ASN B 1  38   ? 462.329 13.642  710.436 1.00 77.57  ? 38   ASN B O     1 
ATOM   2039  C  CB    . ASN B 1  38   ? 464.300 12.404  708.002 1.00 78.06  ? 38   ASN B CB    1 
ATOM   2040  C  CG    . ASN B 1  38   ? 463.303 11.303  707.755 1.00 86.81  ? 38   ASN B CG    1 
ATOM   2041  O  OD1   . ASN B 1  38   ? 463.009 10.993  706.586 1.00 85.88  ? 38   ASN B OD1   1 
ATOM   2042  N  ND2   . ASN B 1  38   ? 462.766 10.695  708.840 1.00 77.80  ? 38   ASN B ND2   1 
ATOM   2043  N  N     . PRO B 1  39   ? 464.500 14.116  710.728 1.00 79.93  ? 39   PRO B N     1 
ATOM   2044  C  CA    . PRO B 1  39   ? 464.273 14.297  712.177 1.00 73.79  ? 39   PRO B CA    1 
ATOM   2045  C  C     . PRO B 1  39   ? 463.320 15.440  712.480 1.00 72.60  ? 39   PRO B C     1 
ATOM   2046  O  O     . PRO B 1  39   ? 462.425 15.275  713.320 1.00 78.63  ? 39   PRO B O     1 
ATOM   2047  C  CB    . PRO B 1  39   ? 465.681 14.539  712.725 1.00 73.24  ? 39   PRO B CB    1 
ATOM   2048  C  CG    . PRO B 1  39   ? 466.574 13.879  711.725 1.00 74.26  ? 39   PRO B CG    1 
ATOM   2049  C  CD    . PRO B 1  39   ? 465.930 14.052  710.394 1.00 78.60  ? 39   PRO B CD    1 
ATOM   2050  N  N     . LEU B 1  40   ? 463.497 16.605  711.847 1.00 67.44  ? 40   LEU B N     1 
ATOM   2051  C  CA    . LEU B 1  40   ? 462.570 17.716  712.077 1.00 69.71  ? 40   LEU B CA    1 
ATOM   2052  C  C     . LEU B 1  40   ? 461.125 17.316  711.762 1.00 68.95  ? 40   LEU B C     1 
ATOM   2053  O  O     . LEU B 1  40   ? 460.189 17.799  712.400 1.00 70.72  ? 40   LEU B O     1 
ATOM   2054  C  CB    . LEU B 1  40   ? 462.982 18.968  711.312 1.00 75.61  ? 40   LEU B CB    1 
ATOM   2055  C  CG    . LEU B 1  40   ? 464.298 19.573  711.837 1.00 74.42  ? 40   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B 1  40   ? 464.543 21.002  711.321 1.00 77.13  ? 40   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B 1  40   ? 464.423 19.502  713.334 1.00 79.11  ? 40   LEU B CD2   1 
ATOM   2058  N  N     . ARG B 1  41   ? 460.909 16.541  710.704 1.00 70.83  ? 41   ARG B N     1 
ATOM   2059  C  CA    . ARG B 1  41   ? 459.544 16.124  710.375 1.00 73.90  ? 41   ARG B CA    1 
ATOM   2060  C  C     . ARG B 1  41   ? 458.946 15.238  711.489 1.00 75.27  ? 41   ARG B C     1 
ATOM   2061  O  O     . ARG B 1  41   ? 457.770 15.393  711.866 1.00 71.24  ? 41   ARG B O     1 
ATOM   2062  C  CB    . ARG B 1  41   ? 459.536 15.385  709.021 1.00 65.59  ? 41   ARG B CB    1 
ATOM   2063  C  CG    . ARG B 1  41   ? 458.194 14.822  708.680 1.00 63.78  ? 41   ARG B CG    1 
ATOM   2064  C  CD    . ARG B 1  41   ? 458.143 14.062  707.417 1.00 58.82  ? 41   ARG B CD    1 
ATOM   2065  N  NE    . ARG B 1  41   ? 456.760 13.635  707.107 1.00 62.29  ? 41   ARG B NE    1 
ATOM   2066  C  CZ    . ARG B 1  41   ? 456.163 12.490  707.461 1.00 59.14  ? 41   ARG B CZ    1 
ATOM   2067  N  NH1   . ARG B 1  41   ? 456.827 11.548  708.147 1.00 63.49  ? 41   ARG B NH1   1 
ATOM   2068  N  NH2   . ARG B 1  41   ? 454.890 12.278  707.095 1.00 42.62  ? 41   ARG B NH2   1 
ATOM   2069  N  N     . ARG B 1  42   ? 459.734 14.281  712.006 1.00 71.35  ? 42   ARG B N     1 
ATOM   2070  C  CA    . ARG B 1  42   ? 459.242 13.409  713.067 1.00 70.17  ? 42   ARG B CA    1 
ATOM   2071  C  C     . ARG B 1  42   ? 458.824 14.239  714.271 1.00 72.64  ? 42   ARG B C     1 
ATOM   2072  O  O     . ARG B 1  42   ? 457.784 13.992  714.885 1.00 74.79  ? 42   ARG B O     1 
ATOM   2073  C  CB    . ARG B 1  42   ? 460.317 12.399  713.480 1.00 70.95  ? 42   ARG B CB    1 
ATOM   2074  C  CG    . ARG B 1  42   ? 460.618 11.373  712.431 1.00 64.88  ? 42   ARG B CG    1 
ATOM   2075  C  CD    . ARG B 1  42   ? 461.698 10.364  712.827 1.00 68.25  ? 42   ARG B CD    1 
ATOM   2076  N  NE    . ARG B 1  42   ? 461.305 9.348   713.806 1.00 65.51  ? 42   ARG B NE    1 
ATOM   2077  C  CZ    . ARG B 1  42   ? 460.683 8.213   713.451 1.00 69.89  ? 42   ARG B CZ    1 
ATOM   2078  N  NH1   . ARG B 1  42   ? 460.424 7.975   712.184 1.00 78.57  ? 42   ARG B NH1   1 
ATOM   2079  N  NH2   . ARG B 1  42   ? 460.341 7.285   714.326 1.00 72.80  ? 42   ARG B NH2   1 
ATOM   2080  N  N     . ILE B 1  43   ? 459.634 15.235  714.608 1.00 69.85  ? 43   ILE B N     1 
ATOM   2081  C  CA    . ILE B 1  43   ? 459.363 16.101  715.744 1.00 67.89  ? 43   ILE B CA    1 
ATOM   2082  C  C     . ILE B 1  43   ? 458.116 16.944  715.503 1.00 70.31  ? 43   ILE B C     1 
ATOM   2083  O  O     . ILE B 1  43   ? 457.223 17.007  716.349 1.00 76.39  ? 43   ILE B O     1 
ATOM   2084  C  CB    . ILE B 1  43   ? 460.603 16.963  716.013 1.00 68.63  ? 43   ILE B CB    1 
ATOM   2085  C  CG1   . ILE B 1  43   ? 461.739 16.059  716.525 1.00 70.06  ? 43   ILE B CG1   1 
ATOM   2086  C  CG2   . ILE B 1  43   ? 460.267 18.142  716.897 1.00 66.82  ? 43   ILE B CG2   1 
ATOM   2087  C  CD1   . ILE B 1  43   ? 463.091 16.736  716.620 1.00 70.22  ? 43   ILE B CD1   1 
ATOM   2088  N  N     . LEU B 1  44   ? 458.038 17.611  714.354 1.00 71.70  ? 44   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1  44   ? 456.890 18.460  714.028 1.00 74.15  ? 44   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1  44   ? 455.552 17.734  714.129 1.00 76.37  ? 44   LEU B C     1 
ATOM   2091  O  O     . LEU B 1  44   ? 454.514 18.365  714.362 1.00 79.68  ? 44   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1  44   ? 457.030 18.969  712.599 1.00 76.52  ? 44   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1  44   ? 458.000 20.105  712.310 1.00 77.87  ? 44   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1  44   ? 458.333 20.093  710.815 1.00 74.96  ? 44   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1  44   ? 457.456 21.440  712.778 1.00 77.40  ? 44   LEU B CD2   1 
ATOM   2096  N  N     . LEU B 1  45   ? 455.540 16.433  713.862 1.00 75.53  ? 45   LEU B N     1 
ATOM   2097  C  CA    . LEU B 1  45   ? 454.356 15.582  713.969 1.00 78.12  ? 45   LEU B CA    1 
ATOM   2098  C  C     . LEU B 1  45   ? 454.069 15.014  715.370 1.00 74.16  ? 45   LEU B C     1 
ATOM   2099  O  O     . LEU B 1  45   ? 452.901 14.885  715.743 1.00 71.83  ? 45   LEU B O     1 
ATOM   2100  C  CB    . LEU B 1  45   ? 454.485 14.457  712.942 1.00 79.01  ? 45   LEU B CB    1 
ATOM   2101  C  CG    . LEU B 1  45   ? 454.389 14.940  711.490 1.00 73.63  ? 45   LEU B CG    1 
ATOM   2102  C  CD1   . LEU B 1  45   ? 454.609 13.778  710.556 1.00 62.89  ? 45   LEU B CD1   1 
ATOM   2103  C  CD2   . LEU B 1  45   ? 453.025 15.602  711.229 1.00 72.88  ? 45   LEU B CD2   1 
ATOM   2104  N  N     . SER B 1  46   ? 455.089 14.550  716.102 1.00 74.35  ? 46   SER B N     1 
ATOM   2105  C  CA    . SER B 1  46   ? 454.938 13.886  717.403 1.00 76.50  ? 46   SER B CA    1 
ATOM   2106  C  C     . SER B 1  46   ? 454.891 14.854  718.597 1.00 76.21  ? 46   SER B C     1 
ATOM   2107  O  O     . SER B 1  46   ? 454.187 14.588  719.574 1.00 75.21  ? 46   SER B O     1 
ATOM   2108  C  CB    . SER B 1  46   ? 456.042 12.822  717.613 1.00 79.50  ? 46   SER B CB    1 
ATOM   2109  O  OG    . SER B 1  46   ? 457.357 13.336  717.810 1.00 76.70  ? 46   SER B OG    1 
ATOM   2110  N  N     . SER B 1  47   ? 455.771 15.854  718.622 1.00 76.23  ? 47   SER B N     1 
ATOM   2111  C  CA    . SER B 1  47   ? 456.030 16.677  719.794 1.00 69.21  ? 47   SER B CA    1 
ATOM   2112  C  C     . SER B 1  47   ? 455.472 18.098  719.836 1.00 70.93  ? 47   SER B C     1 
ATOM   2113  O  O     . SER B 1  47   ? 455.869 18.824  720.738 1.00 79.97  ? 47   SER B O     1 
ATOM   2114  C  CB    . SER B 1  47   ? 457.533 16.746  720.019 1.00 74.27  ? 47   SER B CB    1 
ATOM   2115  O  OG    . SER B 1  47   ? 457.992 15.443  720.333 1.00 80.86  ? 47   SER B OG    1 
ATOM   2116  N  N     . ILE B 1  48   ? 454.754 18.612  718.846 1.00 77.27  ? 48   ILE B N     1 
ATOM   2117  C  CA    . ILE B 1  48   ? 454.364 20.021  719.030 1.00 79.23  ? 48   ILE B CA    1 
ATOM   2118  C  C     . ILE B 1  48   ? 453.133 20.172  719.914 1.00 86.07  ? 48   ILE B C     1 
ATOM   2119  O  O     . ILE B 1  48   ? 452.066 19.683  719.514 1.00 91.88  ? 48   ILE B O     1 
ATOM   2120  C  CB    . ILE B 1  48   ? 454.134 20.738  717.691 1.00 84.51  ? 48   ILE B CB    1 
ATOM   2121  C  CG1   . ILE B 1  48   ? 455.417 20.663  716.864 1.00 84.54  ? 48   ILE B CG1   1 
ATOM   2122  C  CG2   . ILE B 1  48   ? 453.657 22.182  717.912 1.00 77.96  ? 48   ILE B CG2   1 
ATOM   2123  C  CD1   . ILE B 1  48   ? 456.578 21.462  717.481 1.00 82.63  ? 48   ILE B CD1   1 
ATOM   2124  N  N     . PRO B 1  49   ? 453.230 20.872  721.069 1.00 89.64  ? 49   PRO B N     1 
ATOM   2125  C  CA    . PRO B 1  49   ? 452.098 21.005  722.016 1.00 76.89  ? 49   PRO B CA    1 
ATOM   2126  C  C     . PRO B 1  49   ? 450.893 21.757  721.456 1.00 79.40  ? 49   PRO B C     1 
ATOM   2127  O  O     . PRO B 1  49   ? 451.003 22.909  721.017 1.00 78.76  ? 49   PRO B O     1 
ATOM   2128  C  CB    . PRO B 1  49   ? 452.728 21.749  723.199 1.00 78.03  ? 49   PRO B CB    1 
ATOM   2129  C  CG    . PRO B 1  49   ? 453.794 22.573  722.611 1.00 76.86  ? 49   PRO B CG    1 
ATOM   2130  C  CD    . PRO B 1  49   ? 454.391 21.666  721.530 1.00 88.41  ? 49   PRO B CD    1 
ATOM   2131  N  N     . GLY B 1  50   ? 449.714 21.157  721.625 1.00 77.88  ? 50   GLY B N     1 
ATOM   2132  C  CA    . GLY B 1  50   ? 448.466 21.695  721.105 1.00 83.61  ? 50   GLY B CA    1 
ATOM   2133  C  C     . GLY B 1  50   ? 447.271 21.244  721.926 1.00 91.83  ? 50   GLY B C     1 
ATOM   2134  O  O     . GLY B 1  50   ? 447.448 20.668  723.003 1.00 87.52  ? 50   GLY B O     1 
ATOM   2135  N  N     . THR B 1  51   ? 446.050 21.540  721.476 1.00 93.77  ? 51   THR B N     1 
ATOM   2136  C  CA    . THR B 1  51   ? 444.849 21.208  722.231 1.00 83.71  ? 51   THR B CA    1 
ATOM   2137  C  C     . THR B 1  51   ? 443.894 20.358  721.393 1.00 83.63  ? 51   THR B C     1 
ATOM   2138  O  O     . THR B 1  51   ? 443.835 20.497  720.165 1.00 95.21  ? 51   THR B O     1 
ATOM   2139  C  CB    . THR B 1  51   ? 444.144 22.497  722.658 1.00 87.63  ? 51   THR B CB    1 
ATOM   2140  O  OG1   . THR B 1  51   ? 443.268 22.916  721.601 1.00 94.59  ? 51   THR B OG1   1 
ATOM   2141  C  CG2   . THR B 1  51   ? 445.154 23.612  722.934 1.00 85.38  ? 51   THR B CG2   1 
ATOM   2142  N  N     . ALA B 1  52   ? 443.085 19.536  722.072 1.00 78.65  ? 52   ALA B N     1 
ATOM   2143  C  CA    . ALA B 1  52   ? 442.159 18.631  721.392 1.00 78.43  ? 52   ALA B CA    1 
ATOM   2144  C  C     . ALA B 1  52   ? 440.920 18.322  722.235 1.00 86.56  ? 52   ALA B C     1 
ATOM   2145  O  O     . ALA B 1  52   ? 440.974 18.322  723.471 1.00 87.09  ? 52   ALA B O     1 
ATOM   2146  C  CB    . ALA B 1  52   ? 442.851 17.313  721.052 1.00 77.04  ? 52   ALA B CB    1 
ATOM   2147  N  N     . VAL B 1  53   ? 439.823 17.982  721.553 1.00 84.41  ? 53   VAL B N     1 
ATOM   2148  C  CA    . VAL B 1  53   ? 438.605 17.510  722.213 1.00 74.71  ? 53   VAL B CA    1 
ATOM   2149  C  C     . VAL B 1  53   ? 438.801 16.041  722.590 1.00 77.01  ? 53   VAL B C     1 
ATOM   2150  O  O     . VAL B 1  53   ? 438.788 15.164  721.721 1.00 81.17  ? 53   VAL B O     1 
ATOM   2151  C  CB    . VAL B 1  53   ? 437.394 17.688  721.284 1.00 72.98  ? 53   VAL B CB    1 
ATOM   2152  C  CG1   . VAL B 1  53   ? 436.158 16.883  721.738 1.00 72.14  ? 53   VAL B CG1   1 
ATOM   2153  C  CG2   . VAL B 1  53   ? 437.065 19.155  721.141 1.00 73.09  ? 53   VAL B CG2   1 
ATOM   2154  N  N     . THR B 1  54   ? 438.872 15.752  723.899 1.00 78.04  ? 54   THR B N     1 
ATOM   2155  C  CA    . THR B 1  54   ? 439.061 14.372  724.350 1.00 82.65  ? 54   THR B CA    1 
ATOM   2156  C  C     . THR B 1  54   ? 437.785 13.667  724.804 1.00 86.32  ? 54   THR B C     1 
ATOM   2157  O  O     . THR B 1  54   ? 437.786 12.427  724.867 1.00 85.01  ? 54   THR B O     1 
ATOM   2158  C  CB    . THR B 1  54   ? 440.077 14.294  725.500 1.00 82.87  ? 54   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  54   ? 439.700 15.189  726.539 1.00 85.53  ? 54   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  54   ? 441.436 14.715  725.014 1.00 87.70  ? 54   THR B CG2   1 
ATOM   2161  N  N     . SER B 1  55   ? 436.710 14.396  725.132 1.00 85.51  ? 55   SER B N     1 
ATOM   2162  C  CA    . SER B 1  55   ? 435.513 13.729  725.635 1.00 81.47  ? 55   SER B CA    1 
ATOM   2163  C  C     . SER B 1  55   ? 434.293 14.620  725.431 1.00 79.61  ? 55   SER B C     1 
ATOM   2164  O  O     . SER B 1  55   ? 434.385 15.853  725.495 1.00 77.81  ? 55   SER B O     1 
ATOM   2165  C  CB    . SER B 1  55   ? 435.668 13.350  727.105 1.00 81.27  ? 55   SER B CB    1 
ATOM   2166  O  OG    . SER B 1  55   ? 434.889 12.196  727.374 1.00 87.26  ? 55   SER B OG    1 
ATOM   2167  N  N     . VAL B 1  56   ? 433.144 13.982  725.203 1.00 77.77  ? 56   VAL B N     1 
ATOM   2168  C  CA    . VAL B 1  56   ? 431.897 14.708  724.975 1.00 86.06  ? 56   VAL B CA    1 
ATOM   2169  C  C     . VAL B 1  56   ? 430.727 13.966  725.630 1.00 93.06  ? 56   VAL B C     1 
ATOM   2170  O  O     . VAL B 1  56   ? 430.634 12.737  725.513 1.00 91.83  ? 56   VAL B O     1 
ATOM   2171  C  CB    . VAL B 1  56   ? 431.642 14.897  723.461 1.00 91.67  ? 56   VAL B CB    1 
ATOM   2172  C  CG1   . VAL B 1  56   ? 431.475 13.542  722.750 1.00 91.22  ? 56   VAL B CG1   1 
ATOM   2173  C  CG2   . VAL B 1  56   ? 430.435 15.805  723.193 1.00 92.26  ? 56   VAL B CG2   1 
ATOM   2174  N  N     . TYR B 1  57   ? 429.874 14.712  726.373 1.00 89.33  ? 57   TYR B N     1 
ATOM   2175  C  CA    . TYR B 1  57   ? 428.588 14.253  726.920 1.00 89.50  ? 57   TYR B CA    1 
ATOM   2176  C  C     . TYR B 1  57   ? 427.443 15.051  726.312 1.00 88.37  ? 57   TYR B C     1 
ATOM   2177  O  O     . TYR B 1  57   ? 427.450 16.284  726.384 1.00 86.52  ? 57   TYR B O     1 
ATOM   2178  C  CB    . TYR B 1  57   ? 428.557 14.370  728.454 1.00 101.64 ? 57   TYR B CB    1 
ATOM   2179  C  CG    . TYR B 1  57   ? 427.181 14.144  729.117 1.00 100.13 ? 57   TYR B CG    1 
ATOM   2180  C  CD1   . TYR B 1  57   ? 426.623 12.865  729.302 1.00 101.86 ? 57   TYR B CD1   1 
ATOM   2181  C  CD2   . TYR B 1  57   ? 426.457 15.240  729.591 1.00 95.02  ? 57   TYR B CD2   1 
ATOM   2182  C  CE1   . TYR B 1  57   ? 425.354 12.708  729.919 1.00 101.83 ? 57   TYR B CE1   1 
ATOM   2183  C  CE2   . TYR B 1  57   ? 425.214 15.096  730.194 1.00 103.45 ? 57   TYR B CE2   1 
ATOM   2184  C  CZ    . TYR B 1  57   ? 424.658 13.842  730.364 1.00 105.45 ? 57   TYR B CZ    1 
ATOM   2185  O  OH    . TYR B 1  57   ? 423.413 13.771  730.981 1.00 100.98 ? 57   TYR B OH    1 
ATOM   2186  N  N     . ILE B 1  58   ? 426.479 14.346  725.698 1.00 89.72  ? 58   ILE B N     1 
ATOM   2187  C  CA    . ILE B 1  58   ? 425.251 14.916  725.122 1.00 97.51  ? 58   ILE B CA    1 
ATOM   2188  C  C     . ILE B 1  58   ? 424.039 14.319  725.826 1.00 104.42 ? 58   ILE B C     1 
ATOM   2189  O  O     . ILE B 1  58   ? 423.922 13.087  725.907 1.00 103.50 ? 58   ILE B O     1 
ATOM   2190  C  CB    . ILE B 1  58   ? 425.130 14.722  723.599 1.00 100.04 ? 58   ILE B CB    1 
ATOM   2191  C  CG1   . ILE B 1  58   ? 426.385 15.208  722.862 1.00 100.30 ? 58   ILE B CG1   1 
ATOM   2192  C  CG2   . ILE B 1  58   ? 423.912 15.468  723.079 1.00 104.02 ? 58   ILE B CG2   1 
ATOM   2193  C  CD1   . ILE B 1  58   ? 426.377 14.880  721.373 1.00 97.61  ? 58   ILE B CD1   1 
ATOM   2194  N  N     . GLU B 1  59   ? 423.089 15.184  726.228 1.00 103.46 ? 59   GLU B N     1 
ATOM   2195  C  CA    . GLU B 1  59   ? 422.106 14.859  727.258 1.00 107.58 ? 59   GLU B CA    1 
ATOM   2196  C  C     . GLU B 1  59   ? 421.468 13.489  727.092 1.00 110.40 ? 59   GLU B C     1 
ATOM   2197  O  O     . GLU B 1  59   ? 421.758 12.579  727.875 1.00 117.36 ? 59   GLU B O     1 
ATOM   2198  C  CB    . GLU B 1  59   ? 420.963 15.900  727.252 1.00 110.38 ? 59   GLU B CB    1 
ATOM   2199  C  CG    . GLU B 1  59   ? 419.870 15.750  728.371 1.00 104.79 ? 59   GLU B CG    1 
ATOM   2200  C  CD    . GLU B 1  59   ? 419.884 16.791  729.482 1.00 107.33 ? 59   GLU B CD    1 
ATOM   2201  O  OE1   . GLU B 1  59   ? 420.804 17.633  729.531 1.00 109.27 ? 59   GLU B OE1   1 
ATOM   2202  O  OE2   . GLU B 1  59   ? 418.946 16.759  730.317 1.00 109.86 ? 59   GLU B OE2   1 
ATOM   2203  N  N     . ASP B 1  60   ? 420.621 13.312  726.092 1.00 105.98 ? 60   ASP B N     1 
ATOM   2204  C  CA    . ASP B 1  60   ? 419.881 12.054  725.946 1.00 114.88 ? 60   ASP B CA    1 
ATOM   2205  C  C     . ASP B 1  60   ? 420.556 11.054  725.010 1.00 113.92 ? 60   ASP B C     1 
ATOM   2206  O  O     . ASP B 1  60   ? 419.880 10.374  724.220 1.00 113.00 ? 60   ASP B O     1 
ATOM   2207  C  CB    . ASP B 1  60   ? 418.435 12.343  725.542 1.00 122.41 ? 60   ASP B CB    1 
ATOM   2208  C  CG    . ASP B 1  60   ? 417.634 13.056  726.667 1.00 120.75 ? 60   ASP B CG    1 
ATOM   2209  O  OD1   . ASP B 1  60   ? 417.776 12.659  727.858 1.00 113.61 ? 60   ASP B OD1   1 
ATOM   2210  O  OD2   . ASP B 1  60   ? 416.888 14.026  726.359 1.00 118.78 ? 60   ASP B OD2   1 
ATOM   2211  N  N     . VAL B 1  61   ? 421.879 10.902  725.087 1.00 109.75 ? 61   VAL B N     1 
ATOM   2212  C  CA    . VAL B 1  61   ? 422.591 10.034  724.161 1.00 107.05 ? 61   VAL B CA    1 
ATOM   2213  C  C     . VAL B 1  61   ? 423.404 9.028   724.962 1.00 103.08 ? 61   VAL B C     1 
ATOM   2214  O  O     . VAL B 1  61   ? 424.321 9.412   725.704 1.00 94.08  ? 61   VAL B O     1 
ATOM   2215  C  CB    . VAL B 1  61   ? 423.514 10.856  723.254 1.00 106.02 ? 61   VAL B CB    1 
ATOM   2216  C  CG1   . VAL B 1  61   ? 424.398 9.933   722.419 1.00 108.09 ? 61   VAL B CG1   1 
ATOM   2217  C  CG2   . VAL B 1  61   ? 422.709 11.846  722.410 1.00 103.91 ? 61   VAL B CG2   1 
ATOM   2218  N  N     . LEU B 1  62   ? 423.114 7.733   724.740 1.00 102.48 ? 62   LEU B N     1 
ATOM   2219  C  CA    . LEU B 1  62   ? 423.761 6.637   725.468 1.00 109.53 ? 62   LEU B CA    1 
ATOM   2220  C  C     . LEU B 1  62   ? 425.154 6.294   724.935 1.00 110.98 ? 62   LEU B C     1 
ATOM   2221  O  O     . LEU B 1  62   ? 426.109 6.181   725.720 1.00 107.44 ? 62   LEU B O     1 
ATOM   2222  C  CB    . LEU B 1  62   ? 422.842 5.404   725.498 1.00 108.77 ? 62   LEU B CB    1 
ATOM   2223  C  CG    . LEU B 1  62   ? 421.411 5.655   726.017 1.00 108.21 ? 62   LEU B CG    1 
ATOM   2224  C  CD1   . LEU B 1  62   ? 420.620 4.350   726.150 1.00 100.20 ? 62   LEU B CD1   1 
ATOM   2225  C  CD2   . LEU B 1  62   ? 421.426 6.420   727.363 1.00 96.75  ? 62   LEU B CD2   1 
ATOM   2226  N  N     . HIS B 1  63   ? 425.311 6.137   723.612 1.00 112.77 ? 63   HIS B N     1 
ATOM   2227  C  CA    . HIS B 1  63   ? 426.612 5.760   723.063 1.00 103.29 ? 63   HIS B CA    1 
ATOM   2228  C  C     . HIS B 1  63   ? 426.894 6.521   721.763 1.00 100.46 ? 63   HIS B C     1 
ATOM   2229  O  O     . HIS B 1  63   ? 426.098 7.354   721.314 1.00 99.09  ? 63   HIS B O     1 
ATOM   2230  C  CB    . HIS B 1  63   ? 426.641 4.225   722.903 1.00 106.67 ? 63   HIS B CB    1 
ATOM   2231  C  CG    . HIS B 1  63   ? 425.468 3.663   722.137 1.00 114.46 ? 63   HIS B CG    1 
ATOM   2232  N  ND1   . HIS B 1  63   ? 425.360 3.720   720.760 1.00 108.25 ? 63   HIS B ND1   1 
ATOM   2233  C  CD2   . HIS B 1  63   ? 424.320 3.082   722.576 1.00 115.35 ? 63   HIS B CD2   1 
ATOM   2234  C  CE1   . HIS B 1  63   ? 424.220 3.161   720.385 1.00 112.72 ? 63   HIS B CE1   1 
ATOM   2235  N  NE2   . HIS B 1  63   ? 423.565 2.777   721.468 1.00 117.73 ? 63   HIS B NE2   1 
ATOM   2236  N  N     . GLU B 1  64   ? 428.050 6.207   721.154 1.00 107.64 ? 64   GLU B N     1 
ATOM   2237  C  CA    . GLU B 1  64   ? 428.599 6.986   720.030 1.00 102.36 ? 64   GLU B CA    1 
ATOM   2238  C  C     . GLU B 1  64   ? 427.782 6.838   718.741 1.00 97.03  ? 64   GLU B C     1 
ATOM   2239  O  O     . GLU B 1  64   ? 427.662 7.790   717.960 1.00 91.89  ? 64   GLU B O     1 
ATOM   2240  C  CB    . GLU B 1  64   ? 430.084 6.594   719.833 1.00 101.39 ? 64   GLU B CB    1 
ATOM   2241  C  CG    . GLU B 1  64   ? 430.910 7.382   718.769 1.00 106.23 ? 64   GLU B CG    1 
ATOM   2242  C  CD    . GLU B 1  64   ? 432.430 7.043   718.747 1.00 102.06 ? 64   GLU B CD    1 
ATOM   2243  O  OE1   . GLU B 1  64   ? 432.944 6.341   719.649 1.00 99.18  ? 64   GLU B OE1   1 
ATOM   2244  O  OE2   . GLU B 1  64   ? 433.123 7.517   717.823 1.00 105.21 ? 64   GLU B OE2   1 
ATOM   2245  N  N     . PHE B 1  65   ? 427.180 5.673   718.536 1.00 97.68  ? 65   PHE B N     1 
ATOM   2246  C  CA    . PHE B 1  65   ? 426.443 5.314   717.334 1.00 97.03  ? 65   PHE B CA    1 
ATOM   2247  C  C     . PHE B 1  65   ? 424.945 5.592   717.395 1.00 96.53  ? 65   PHE B C     1 
ATOM   2248  O  O     . PHE B 1  65   ? 424.209 5.165   716.503 1.00 90.29  ? 65   PHE B O     1 
ATOM   2249  C  CB    . PHE B 1  65   ? 426.768 3.857   717.034 1.00 105.43 ? 65   PHE B CB    1 
ATOM   2250  C  CG    . PHE B 1  65   ? 428.254 3.625   716.887 1.00 107.70 ? 65   PHE B CG    1 
ATOM   2251  C  CD1   . PHE B 1  65   ? 429.070 4.648   716.383 1.00 105.74 ? 65   PHE B CD1   1 
ATOM   2252  C  CD2   . PHE B 1  65   ? 428.852 2.462   717.341 1.00 109.87 ? 65   PHE B CD2   1 
ATOM   2253  C  CE1   . PHE B 1  65   ? 430.434 4.489   716.253 1.00 99.48  ? 65   PHE B CE1   1 
ATOM   2254  C  CE2   . PHE B 1  65   ? 430.233 2.295   717.227 1.00 114.18 ? 65   PHE B CE2   1 
ATOM   2255  C  CZ    . PHE B 1  65   ? 431.023 3.314   716.679 1.00 106.22 ? 65   PHE B CZ    1 
ATOM   2256  N  N     . SER B 1  66   ? 424.467 6.213   718.462 1.00 106.97 ? 66   SER B N     1 
ATOM   2257  C  CA    . SER B 1  66   ? 423.072 6.620   718.533 1.00 109.83 ? 66   SER B CA    1 
ATOM   2258  C  C     . SER B 1  66   ? 422.767 7.759   717.554 1.00 106.14 ? 66   SER B C     1 
ATOM   2259  O  O     . SER B 1  66   ? 423.658 8.410   716.989 1.00 95.35  ? 66   SER B O     1 
ATOM   2260  C  CB    . SER B 1  66   ? 422.680 7.044   719.955 1.00 108.76 ? 66   SER B CB    1 
ATOM   2261  O  OG    . SER B 1  66   ? 422.903 6.010   720.905 1.00 114.11 ? 66   SER B OG    1 
ATOM   2262  N  N     . THR B 1  67   ? 421.473 7.924   717.299 1.00 113.10 ? 67   THR B N     1 
ATOM   2263  C  CA    . THR B 1  67   ? 420.931 9.031   716.528 1.00 110.81 ? 67   THR B CA    1 
ATOM   2264  C  C     . THR B 1  67   ? 420.136 9.908   717.511 1.00 113.00 ? 67   THR B C     1 
ATOM   2265  O  O     . THR B 1  67   ? 419.515 9.395   718.453 1.00 110.19 ? 67   THR B O     1 
ATOM   2266  C  CB    . THR B 1  67   ? 420.090 8.508   715.355 1.00 105.73 ? 67   THR B CB    1 
ATOM   2267  O  OG1   . THR B 1  67   ? 419.461 9.605   714.687 1.00 109.31 ? 67   THR B OG1   1 
ATOM   2268  C  CG2   . THR B 1  67   ? 419.049 7.476   715.826 1.00 100.59 ? 67   THR B CG2   1 
ATOM   2269  N  N     . ILE B 1  68   ? 420.161 11.222  717.304 1.00 109.34 ? 68   ILE B N     1 
ATOM   2270  C  CA    . ILE B 1  68   ? 419.479 12.195  718.161 1.00 102.47 ? 68   ILE B CA    1 
ATOM   2271  C  C     . ILE B 1  68   ? 418.146 12.565  717.520 1.00 108.50 ? 68   ILE B C     1 
ATOM   2272  O  O     . ILE B 1  68   ? 418.145 13.081  716.392 1.00 112.19 ? 68   ILE B O     1 
ATOM   2273  C  CB    . ILE B 1  68   ? 420.330 13.459  718.373 1.00 99.91  ? 68   ILE B CB    1 
ATOM   2274  C  CG1   . ILE B 1  68   ? 421.692 13.132  718.981 1.00 99.53  ? 68   ILE B CG1   1 
ATOM   2275  C  CG2   . ILE B 1  68   ? 419.572 14.513  719.149 1.00 100.15 ? 68   ILE B CG2   1 
ATOM   2276  C  CD1   . ILE B 1  68   ? 422.521 14.369  719.251 1.00 99.06  ? 68   ILE B CD1   1 
ATOM   2277  N  N     . PRO B 1  69   ? 417.009 12.384  718.206 1.00 112.90 ? 69   PRO B N     1 
ATOM   2278  C  CA    . PRO B 1  69   ? 415.747 12.847  717.620 1.00 111.16 ? 69   PRO B CA    1 
ATOM   2279  C  C     . PRO B 1  69   ? 415.707 14.370  717.596 1.00 108.30 ? 69   PRO B C     1 
ATOM   2280  O  O     . PRO B 1  69   ? 416.025 15.042  718.586 1.00 103.13 ? 69   PRO B O     1 
ATOM   2281  C  CB    . PRO B 1  69   ? 414.678 12.265  718.561 1.00 109.22 ? 69   PRO B CB    1 
ATOM   2282  C  CG    . PRO B 1  69   ? 415.377 11.182  719.360 1.00 103.44 ? 69   PRO B CG    1 
ATOM   2283  C  CD    . PRO B 1  69   ? 416.792 11.688  719.492 1.00 110.18 ? 69   PRO B CD    1 
ATOM   2284  N  N     . GLY B 1  70   ? 415.265 14.910  716.451 1.00 108.25 ? 70   GLY B N     1 
ATOM   2285  C  CA    . GLY B 1  70   ? 415.183 16.339  716.285 1.00 107.84 ? 70   GLY B CA    1 
ATOM   2286  C  C     . GLY B 1  70   ? 416.450 16.994  715.776 1.00 109.04 ? 70   GLY B C     1 
ATOM   2287  O  O     . GLY B 1  70   ? 416.426 18.204  715.502 1.00 108.36 ? 70   GLY B O     1 
ATOM   2288  N  N     . VAL B 1  71   ? 417.565 16.253  715.705 1.00 109.89 ? 71   VAL B N     1 
ATOM   2289  C  CA    . VAL B 1  71   ? 418.841 16.728  715.157 1.00 107.67 ? 71   VAL B CA    1 
ATOM   2290  C  C     . VAL B 1  71   ? 419.235 15.923  713.915 1.00 103.23 ? 71   VAL B C     1 
ATOM   2291  O  O     . VAL B 1  71   ? 419.246 14.686  713.953 1.00 98.26  ? 71   VAL B O     1 
ATOM   2292  C  CB    . VAL B 1  71   ? 419.959 16.662  716.213 1.00 106.11 ? 71   VAL B CB    1 
ATOM   2293  C  CG1   . VAL B 1  71   ? 421.276 17.093  715.595 1.00 103.22 ? 71   VAL B CG1   1 
ATOM   2294  C  CG2   . VAL B 1  71   ? 419.614 17.556  717.409 1.00 104.94 ? 71   VAL B CG2   1 
ATOM   2295  N  N     . LYS B 1  72   ? 419.580 16.649  712.828 1.00 109.34 ? 72   LYS B N     1 
ATOM   2296  C  CA    . LYS B 1  72   ? 419.941 16.076  711.518 1.00 102.11 ? 72   LYS B CA    1 
ATOM   2297  C  C     . LYS B 1  72   ? 421.218 15.221  711.564 1.00 96.63  ? 72   LYS B C     1 
ATOM   2298  O  O     . LYS B 1  72   ? 421.215 14.066  711.120 1.00 88.63  ? 72   LYS B O     1 
ATOM   2299  C  CB    . LYS B 1  72   ? 420.085 17.203  710.491 1.00 97.39  ? 72   LYS B CB    1 
ATOM   2300  C  CG    . LYS B 1  72   ? 420.529 16.724  709.099 1.00 112.69 ? 72   LYS B CG    1 
ATOM   2301  C  CD    . LYS B 1  72   ? 420.697 17.864  708.060 1.00 106.02 ? 72   LYS B CD    1 
ATOM   2302  C  CE    . LYS B 1  72   ? 421.972 17.683  707.241 1.00 93.37  ? 72   LYS B CE    1 
ATOM   2303  N  NZ    . LYS B 1  72   ? 423.177 18.254  707.940 1.00 95.89  ? 72   LYS B NZ    1 
ATOM   2304  N  N     . GLU B 1  73   ? 422.345 15.802  711.995 1.00 95.24  ? 73   GLU B N     1 
ATOM   2305  C  CA    . GLU B 1  73   ? 423.596 15.048  712.121 1.00 94.37  ? 73   GLU B CA    1 
ATOM   2306  C  C     . GLU B 1  73   ? 423.424 13.866  713.069 1.00 95.70  ? 73   GLU B C     1 
ATOM   2307  O  O     . GLU B 1  73   ? 422.720 13.955  714.078 1.00 100.50 ? 73   GLU B O     1 
ATOM   2308  C  CB    . GLU B 1  73   ? 424.713 15.939  712.662 1.00 95.74  ? 73   GLU B CB    1 
ATOM   2309  C  CG    . GLU B 1  73   ? 425.149 17.043  711.722 1.00 105.98 ? 73   GLU B CG    1 
ATOM   2310  C  CD    . GLU B 1  73   ? 424.239 18.256  711.783 1.00 107.56 ? 73   GLU B CD    1 
ATOM   2311  O  OE1   . GLU B 1  73   ? 423.140 18.130  712.376 1.00 104.70 ? 73   GLU B OE1   1 
ATOM   2312  O  OE2   . GLU B 1  73   ? 424.625 19.322  711.231 1.00 107.44 ? 73   GLU B OE2   1 
ATOM   2313  N  N     . ASP B 1  74   ? 424.125 12.764  712.791 1.00 96.96  ? 74   ASP B N     1 
ATOM   2314  C  CA    . ASP B 1  74   ? 424.147 11.713  713.801 1.00 92.55  ? 74   ASP B CA    1 
ATOM   2315  C  C     . ASP B 1  74   ? 425.193 12.047  714.859 1.00 89.71  ? 74   ASP B C     1 
ATOM   2316  O  O     . ASP B 1  74   ? 425.897 13.059  714.775 1.00 90.36  ? 74   ASP B O     1 
ATOM   2317  C  CB    . ASP B 1  74   ? 424.375 10.332  713.165 1.00 96.95  ? 74   ASP B CB    1 
ATOM   2318  C  CG    . ASP B 1  74   ? 425.517 10.305  712.138 1.00 97.39  ? 74   ASP B CG    1 
ATOM   2319  O  OD1   . ASP B 1  74   ? 426.693 10.141  712.559 1.00 97.04  ? 74   ASP B OD1   1 
ATOM   2320  O  OD2   . ASP B 1  74   ? 425.231 10.433  710.915 1.00 90.56  ? 74   ASP B OD2   1 
ATOM   2321  N  N     . VAL B 1  75   ? 425.282 11.204  715.891 1.00 92.27  ? 75   VAL B N     1 
ATOM   2322  C  CA    . VAL B 1  75   ? 426.200 11.513  716.986 1.00 94.29  ? 75   VAL B CA    1 
ATOM   2323  C  C     . VAL B 1  75   ? 427.639 11.514  716.485 1.00 88.86  ? 75   VAL B C     1 
ATOM   2324  O  O     . VAL B 1  75   ? 428.436 12.399  716.833 1.00 83.64  ? 75   VAL B O     1 
ATOM   2325  C  CB    . VAL B 1  75   ? 425.977 10.559  718.175 1.00 95.35  ? 75   VAL B CB    1 
ATOM   2326  C  CG1   . VAL B 1  75   ? 427.005 10.824  719.245 1.00 94.27  ? 75   VAL B CG1   1 
ATOM   2327  C  CG2   . VAL B 1  75   ? 424.588 10.771  718.761 1.00 91.54  ? 75   VAL B CG2   1 
ATOM   2328  N  N     . VAL B 1  76   ? 427.985 10.537  715.639 1.00 96.20  ? 76   VAL B N     1 
ATOM   2329  C  CA    . VAL B 1  76   ? 429.340 10.462  715.089 1.00 95.77  ? 76   VAL B CA    1 
ATOM   2330  C  C     . VAL B 1  76   ? 429.676 11.764  714.378 1.00 89.61  ? 76   VAL B C     1 
ATOM   2331  O  O     . VAL B 1  76   ? 430.765 12.332  714.553 1.00 84.05  ? 76   VAL B O     1 
ATOM   2332  C  CB    . VAL B 1  76   ? 429.503 9.250   714.154 1.00 85.10  ? 76   VAL B CB    1 
ATOM   2333  C  CG1   . VAL B 1  76   ? 430.923 9.195   713.711 1.00 84.49  ? 76   VAL B CG1   1 
ATOM   2334  C  CG2   . VAL B 1  76   ? 429.171 7.950   714.884 1.00 87.17  ? 76   VAL B CG2   1 
ATOM   2335  N  N     . GLU B 1  77   ? 428.746 12.236  713.541 1.00 86.85  ? 77   GLU B N     1 
ATOM   2336  C  CA    . GLU B 1  77   ? 428.980 13.451  712.775 1.00 87.70  ? 77   GLU B CA    1 
ATOM   2337  C  C     . GLU B 1  77   ? 429.252 14.637  713.694 1.00 89.00  ? 77   GLU B C     1 
ATOM   2338  O  O     . GLU B 1  77   ? 430.121 15.465  713.399 1.00 91.92  ? 77   GLU B O     1 
ATOM   2339  C  CB    . GLU B 1  77   ? 427.786 13.735  711.862 1.00 91.08  ? 77   GLU B CB    1 
ATOM   2340  C  CG    . GLU B 1  77   ? 427.981 13.226  710.405 1.00 97.81  ? 77   GLU B CG    1 
ATOM   2341  C  CD    . GLU B 1  77   ? 428.826 14.152  709.522 1.00 97.48  ? 77   GLU B CD    1 
ATOM   2342  O  OE1   . GLU B 1  77   ? 428.628 15.399  709.557 1.00 96.20  ? 77   GLU B OE1   1 
ATOM   2343  O  OE2   . GLU B 1  77   ? 429.708 13.614  708.805 1.00 97.72  ? 77   GLU B OE2   1 
ATOM   2344  N  N     . ILE B 1  78   ? 428.516 14.751  714.806 1.00 90.81  ? 78   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1  78   ? 428.783 15.849  715.737 1.00 91.12  ? 78   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1  78   ? 430.186 15.723  716.332 1.00 90.91  ? 78   ILE B C     1 
ATOM   2347  O  O     . ILE B 1  78   ? 430.927 16.709  716.422 1.00 91.36  ? 78   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1  78   ? 427.695 15.952  716.818 1.00 91.07  ? 78   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1  78   ? 426.308 16.042  716.175 1.00 89.18  ? 78   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1  78   ? 427.937 17.196  717.675 1.00 90.46  ? 78   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1  78   ? 425.169 15.882  717.172 1.00 91.79  ? 78   ILE B CD1   1 
ATOM   2352  N  N     . ILE B 1  79   ? 430.560 14.518  716.780 1.00 89.81  ? 79   ILE B N     1 
ATOM   2353  C  CA    . ILE B 1  79   ? 431.915 14.310  717.304 1.00 89.95  ? 79   ILE B CA    1 
ATOM   2354  C  C     . ILE B 1  79   ? 432.964 14.695  716.265 1.00 87.52  ? 79   ILE B C     1 
ATOM   2355  O  O     . ILE B 1  79   ? 433.998 15.297  716.590 1.00 85.08  ? 79   ILE B O     1 
ATOM   2356  C  CB    . ILE B 1  79   ? 432.124 12.856  717.773 1.00 89.83  ? 79   ILE B CB    1 
ATOM   2357  C  CG1   . ILE B 1  79   ? 431.278 12.529  718.999 1.00 85.30  ? 79   ILE B CG1   1 
ATOM   2358  C  CG2   . ILE B 1  79   ? 433.612 12.549  718.001 1.00 86.12  ? 79   ILE B CG2   1 
ATOM   2359  C  CD1   . ILE B 1  79   ? 431.413 11.074  719.427 1.00 88.08  ? 79   ILE B CD1   1 
ATOM   2360  N  N     . LEU B 1  80   ? 432.719 14.337  715.002 1.00 86.56  ? 80   LEU B N     1 
ATOM   2361  C  CA    . LEU B 1  80   ? 433.647 14.648  713.916 1.00 86.29  ? 80   LEU B CA    1 
ATOM   2362  C  C     . LEU B 1  80   ? 433.915 16.151  713.845 1.00 86.22  ? 80   LEU B C     1 
ATOM   2363  O  O     . LEU B 1  80   ? 435.072 16.595  713.902 1.00 82.19  ? 80   LEU B O     1 
ATOM   2364  C  CB    . LEU B 1  80   ? 433.059 14.120  712.602 1.00 80.27  ? 80   LEU B CB    1 
ATOM   2365  C  CG    . LEU B 1  80   ? 433.530 12.673  712.361 1.00 76.24  ? 80   LEU B CG    1 
ATOM   2366  C  CD1   . LEU B 1  80   ? 433.124 12.079  711.025 1.00 75.92  ? 80   LEU B CD1   1 
ATOM   2367  C  CD2   . LEU B 1  80   ? 434.991 12.407  712.701 1.00 73.07  ? 80   LEU B CD2   1 
ATOM   2368  N  N     . ASN B 1  81   ? 432.846 16.950  713.750 1.00 84.80  ? 81   ASN B N     1 
ATOM   2369  C  CA    . ASN B 1  81   ? 432.966 18.405  713.778 1.00 83.92  ? 81   ASN B CA    1 
ATOM   2370  C  C     . ASN B 1  81   ? 433.737 18.892  714.997 1.00 85.09  ? 81   ASN B C     1 
ATOM   2371  O  O     . ASN B 1  81   ? 434.485 19.873  714.918 1.00 84.62  ? 81   ASN B O     1 
ATOM   2372  C  CB    . ASN B 1  81   ? 431.573 19.026  713.736 1.00 83.06  ? 81   ASN B CB    1 
ATOM   2373  C  CG    . ASN B 1  81   ? 430.874 18.790  712.409 1.00 90.66  ? 81   ASN B CG    1 
ATOM   2374  O  OD1   . ASN B 1  81   ? 431.501 18.844  711.346 1.00 96.95  ? 81   ASN B OD1   1 
ATOM   2375  N  ND2   . ASN B 1  81   ? 429.582 18.496  712.460 1.00 91.93  ? 81   ASN B ND2   1 
ATOM   2376  N  N     . LEU B 1  82   ? 433.535 18.243  716.146 1.00 87.90  ? 82   LEU B N     1 
ATOM   2377  C  CA    . LEU B 1  82   ? 434.268 18.621  717.352 1.00 86.63  ? 82   LEU B CA    1 
ATOM   2378  C  C     . LEU B 1  82   ? 435.760 18.341  717.199 1.00 84.40  ? 82   LEU B C     1 
ATOM   2379  O  O     . LEU B 1  82   ? 436.595 19.136  717.645 1.00 82.43  ? 82   LEU B O     1 
ATOM   2380  C  CB    . LEU B 1  82   ? 433.675 17.901  718.562 1.00 87.38  ? 82   LEU B CB    1 
ATOM   2381  C  CG    . LEU B 1  82   ? 432.292 18.477  718.865 1.00 90.00  ? 82   LEU B CG    1 
ATOM   2382  C  CD1   . LEU B 1  82   ? 431.497 17.594  719.827 1.00 90.68  ? 82   LEU B CD1   1 
ATOM   2383  C  CD2   . LEU B 1  82   ? 432.452 19.909  719.397 1.00 88.78  ? 82   LEU B CD2   1 
ATOM   2384  N  N     . LYS B 1  83   ? 436.108 17.253  716.502 1.00 86.36  ? 83   LYS B N     1 
ATOM   2385  C  CA    . LYS B 1  83   ? 437.508 16.968  716.209 1.00 85.94  ? 83   LYS B CA    1 
ATOM   2386  C  C     . LYS B 1  83   ? 438.138 18.120  715.450 1.00 87.49  ? 83   LYS B C     1 
ATOM   2387  O  O     . LYS B 1  83   ? 439.341 18.386  715.598 1.00 86.84  ? 83   LYS B O     1 
ATOM   2388  C  CB    . LYS B 1  83   ? 437.698 15.663  715.431 1.00 74.93  ? 83   LYS B CB    1 
ATOM   2389  C  CG    . LYS B 1  83   ? 437.457 14.395  716.206 1.00 78.11  ? 83   LYS B CG    1 
ATOM   2390  C  CD    . LYS B 1  83   ? 437.699 13.186  715.300 1.00 77.33  ? 83   LYS B CD    1 
ATOM   2391  C  CE    . LYS B 1  83   ? 437.571 11.855  716.061 1.00 85.23  ? 83   LYS B CE    1 
ATOM   2392  N  NZ    . LYS B 1  83   ? 437.792 10.628  715.222 1.00 75.83  ? 83   LYS B NZ    1 
ATOM   2393  N  N     . GLU B 1  84   ? 437.324 18.876  714.717 1.00 86.28  ? 84   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  84   ? 437.853 19.979  713.929 1.00 91.05  ? 84   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  84   ? 438.229 21.153  714.830 1.00 88.98  ? 84   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  84   ? 439.395 21.560  714.871 1.00 88.63  ? 84   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  84   ? 436.773 20.416  712.928 1.00 92.90  ? 84   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  84   ? 436.314 19.363  711.880 1.00 94.30  ? 84   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  84   ? 437.165 19.301  710.614 1.00 95.65  ? 84   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  84   ? 438.196 20.017  710.546 1.00 97.66  ? 84   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  84   ? 436.785 18.535  709.687 1.00 92.30  ? 84   GLU B OE2   1 
ATOM   2402  N  N     . LEU B 1  85   ? 437.272 21.662  715.604 1.00 88.67  ? 85   LEU B N     1 
ATOM   2403  C  CA    . LEU B 1  85   ? 437.429 22.817  716.491 1.00 95.13  ? 85   LEU B CA    1 
ATOM   2404  C  C     . LEU B 1  85   ? 438.859 23.098  716.984 1.00 99.65  ? 85   LEU B C     1 
ATOM   2405  O  O     . LEU B 1  85   ? 439.545 22.210  717.513 1.00 102.11 ? 85   LEU B O     1 
ATOM   2406  C  CB    . LEU B 1  85   ? 436.486 22.616  717.690 1.00 94.52  ? 85   LEU B CB    1 
ATOM   2407  C  CG    . LEU B 1  85   ? 436.361 23.597  718.861 1.00 97.98  ? 85   LEU B CG    1 
ATOM   2408  C  CD1   . LEU B 1  85   ? 435.788 24.948  718.423 1.00 98.04  ? 85   LEU B CD1   1 
ATOM   2409  C  CD2   . LEU B 1  85   ? 435.503 22.971  719.946 1.00 92.94  ? 85   LEU B CD2   1 
ATOM   2410  N  N     . VAL B 1  86   ? 439.326 24.329  716.773 1.00 97.35  ? 86   VAL B N     1 
ATOM   2411  C  CA    . VAL B 1  86   ? 440.666 24.779  717.154 1.00 96.97  ? 86   VAL B CA    1 
ATOM   2412  C  C     . VAL B 1  86   ? 440.567 25.683  718.369 1.00 101.59 ? 86   VAL B C     1 
ATOM   2413  O  O     . VAL B 1  86   ? 440.124 26.832  718.251 1.00 106.58 ? 86   VAL B O     1 
ATOM   2414  C  CB    . VAL B 1  86   ? 441.371 25.509  716.009 1.00 97.35  ? 86   VAL B CB    1 
ATOM   2415  C  CG1   . VAL B 1  86   ? 442.764 25.950  716.445 1.00 96.54  ? 86   VAL B CG1   1 
ATOM   2416  C  CG2   . VAL B 1  86   ? 441.466 24.585  714.819 1.00 105.95 ? 86   VAL B CG2   1 
ATOM   2417  N  N     . VAL B 1  87   ? 441.031 25.210  719.521 1.00 100.03 ? 87   VAL B N     1 
ATOM   2418  C  CA    . VAL B 1  87   ? 440.910 25.945  720.777 1.00 98.38  ? 87   VAL B CA    1 
ATOM   2419  C  C     . VAL B 1  87   ? 442.316 26.281  721.258 1.00 98.21  ? 87   VAL B C     1 
ATOM   2420  O  O     . VAL B 1  87   ? 443.204 25.422  721.271 1.00 101.56 ? 87   VAL B O     1 
ATOM   2421  C  CB    . VAL B 1  87   ? 440.102 25.161  721.826 1.00 99.88  ? 87   VAL B CB    1 
ATOM   2422  C  CG1   . VAL B 1  87   ? 440.161 25.854  723.176 1.00 104.16 ? 87   VAL B CG1   1 
ATOM   2423  C  CG2   . VAL B 1  87   ? 438.640 25.052  721.368 1.00 94.09  ? 87   VAL B CG2   1 
ATOM   2424  N  N     . ARG B 1  88   ? 442.513 27.536  721.635 1.00 97.33  ? 88   ARG B N     1 
ATOM   2425  C  CA    . ARG B 1  88   ? 443.810 28.078  722.015 1.00 103.92 ? 88   ARG B CA    1 
ATOM   2426  C  C     . ARG B 1  88   ? 443.851 28.493  723.486 1.00 109.65 ? 88   ARG B C     1 
ATOM   2427  O  O     . ARG B 1  88   ? 443.151 29.432  723.885 1.00 106.92 ? 88   ARG B O     1 
ATOM   2428  C  CB    . ARG B 1  88   ? 444.123 29.267  721.119 1.00 106.22 ? 88   ARG B CB    1 
ATOM   2429  C  CG    . ARG B 1  88   ? 445.456 29.875  721.363 1.00 108.94 ? 88   ARG B CG    1 
ATOM   2430  C  CD    . ARG B 1  88   ? 445.632 30.983  720.390 1.00 107.96 ? 88   ARG B CD    1 
ATOM   2431  N  NE    . ARG B 1  88   ? 446.934 31.598  720.525 1.00 114.67 ? 88   ARG B NE    1 
ATOM   2432  C  CZ    . ARG B 1  88   ? 447.344 32.587  719.744 1.00 123.18 ? 88   ARG B CZ    1 
ATOM   2433  N  NH1   . ARG B 1  88   ? 446.531 33.049  718.788 1.00 116.67 ? 88   ARG B NH1   1 
ATOM   2434  N  NH2   . ARG B 1  88   ? 448.557 33.108  719.915 1.00 125.22 ? 88   ARG B NH2   1 
ATOM   2435  N  N     . PHE B 1  89   ? 444.687 27.811  724.288 1.00 112.28 ? 89   PHE B N     1 
ATOM   2436  C  CA    . PHE B 1  89   ? 444.862 28.163  725.703 1.00 102.31 ? 89   PHE B CA    1 
ATOM   2437  C  C     . PHE B 1  89   ? 445.811 29.352  725.807 1.00 104.53 ? 89   PHE B C     1 
ATOM   2438  O  O     . PHE B 1  89   ? 446.996 29.250  725.469 1.00 106.54 ? 89   PHE B O     1 
ATOM   2439  C  CB    . PHE B 1  89   ? 445.471 27.008  726.501 1.00 96.09  ? 89   PHE B CB    1 
ATOM   2440  C  CG    . PHE B 1  89   ? 444.566 25.835  726.686 1.00 91.41  ? 89   PHE B CG    1 
ATOM   2441  C  CD1   . PHE B 1  89   ? 443.235 25.883  726.283 1.00 87.91  ? 89   PHE B CD1   1 
ATOM   2442  C  CD2   . PHE B 1  89   ? 445.066 24.659  727.249 1.00 89.51  ? 89   PHE B CD2   1 
ATOM   2443  C  CE1   . PHE B 1  89   ? 442.399 24.771  726.447 1.00 88.01  ? 89   PHE B CE1   1 
ATOM   2444  C  CE2   . PHE B 1  89   ? 444.239 23.545  727.433 1.00 90.06  ? 89   PHE B CE2   1 
ATOM   2445  C  CZ    . PHE B 1  89   ? 442.902 23.598  727.030 1.00 86.02  ? 89   PHE B CZ    1 
ATOM   2446  N  N     . LEU B 1  90   ? 445.292 30.467  726.312 1.00 108.17 ? 90   LEU B N     1 
ATOM   2447  C  CA    . LEU B 1  90   ? 446.079 31.681  726.489 1.00 110.26 ? 90   LEU B CA    1 
ATOM   2448  C  C     . LEU B 1  90   ? 446.930 31.653  727.760 1.00 116.79 ? 90   LEU B C     1 
ATOM   2449  O  O     . LEU B 1  90   ? 447.990 32.296  727.807 1.00 115.38 ? 90   LEU B O     1 
ATOM   2450  C  CB    . LEU B 1  90   ? 445.107 32.859  726.537 1.00 108.62 ? 90   LEU B CB    1 
ATOM   2451  C  CG    . LEU B 1  90   ? 444.275 32.935  725.259 1.00 109.27 ? 90   LEU B CG    1 
ATOM   2452  C  CD1   . LEU B 1  90   ? 443.167 33.976  725.345 1.00 105.91 ? 90   LEU B CD1   1 
ATOM   2453  C  CD2   . LEU B 1  90   ? 445.210 33.233  724.097 1.00 115.74 ? 90   LEU B CD2   1 
ATOM   2454  N  N     . ASN B 1  91   ? 446.492 30.893  728.789 1.00 112.31 ? 91   ASN B N     1 
ATOM   2455  C  CA    . ASN B 1  91   ? 447.152 30.734  730.084 1.00 108.20 ? 91   ASN B CA    1 
ATOM   2456  C  C     . ASN B 1  91   ? 448.239 29.669  730.053 1.00 107.97 ? 91   ASN B C     1 
ATOM   2457  O  O     . ASN B 1  91   ? 447.942 28.485  729.846 1.00 110.15 ? 91   ASN B O     1 
ATOM   2458  C  CB    . ASN B 1  91   ? 446.126 30.393  731.165 1.00 113.60 ? 91   ASN B CB    1 
ATOM   2459  C  CG    . ASN B 1  91   ? 446.690 30.538  732.575 1.00 111.48 ? 91   ASN B CG    1 
ATOM   2460  O  OD1   . ASN B 1  91   ? 447.911 30.542  732.774 1.00 108.76 ? 91   ASN B OD1   1 
ATOM   2461  N  ND2   . ASN B 1  91   ? 445.798 30.692  733.557 1.00 109.85 ? 91   ASN B ND2   1 
ATOM   2462  N  N     . PRO B 1  92   ? 449.503 30.049  730.244 1.00 106.62 ? 92   PRO B N     1 
ATOM   2463  C  CA    . PRO B 1  92   ? 450.589 29.054  730.196 1.00 104.15 ? 92   PRO B CA    1 
ATOM   2464  C  C     . PRO B 1  92   ? 450.378 27.861  731.111 1.00 104.94 ? 92   PRO B C     1 
ATOM   2465  O  O     . PRO B 1  92   ? 450.909 26.782  730.824 1.00 107.07 ? 92   PRO B O     1 
ATOM   2466  C  CB    . PRO B 1  92   ? 451.823 29.867  730.609 1.00 100.02 ? 92   PRO B CB    1 
ATOM   2467  C  CG    . PRO B 1  92   ? 451.492 31.264  730.196 1.00 104.22 ? 92   PRO B CG    1 
ATOM   2468  C  CD    . PRO B 1  92   ? 450.007 31.420  730.435 1.00 105.83 ? 92   PRO B CD    1 
ATOM   2469  N  N     . SER B 1  93   ? 449.624 28.012  732.200 1.00 103.95 ? 93   SER B N     1 
ATOM   2470  C  CA    . SER B 1  93   ? 449.469 26.932  733.164 1.00 104.73 ? 93   SER B CA    1 
ATOM   2471  C  C     . SER B 1  93   ? 448.221 26.081  732.932 1.00 100.91 ? 93   SER B C     1 
ATOM   2472  O  O     . SER B 1  93   ? 448.123 24.988  733.503 1.00 101.49 ? 93   SER B O     1 
ATOM   2473  C  CB    . SER B 1  93   ? 449.340 27.538  734.579 1.00 106.47 ? 93   SER B CB    1 
ATOM   2474  O  OG    . SER B 1  93   ? 450.394 28.414  734.952 1.00 103.20 ? 93   SER B OG    1 
ATOM   2475  N  N     . LEU B 1  94   ? 447.384 26.435  731.967 1.00 100.37 ? 94   LEU B N     1 
ATOM   2476  C  CA    . LEU B 1  94   ? 446.097 25.767  731.797 1.00 98.98  ? 94   LEU B CA    1 
ATOM   2477  C  C     . LEU B 1  94   ? 446.279 24.439  731.096 1.00 96.27  ? 94   LEU B C     1 
ATOM   2478  O  O     . LEU B 1  94   ? 446.665 24.378  729.929 1.00 107.12 ? 94   LEU B O     1 
ATOM   2479  C  CB    . LEU B 1  94   ? 445.140 26.665  731.023 1.00 99.27  ? 94   LEU B CB    1 
ATOM   2480  C  CG    . LEU B 1  94   ? 443.775 26.028  730.822 1.00 96.27  ? 94   LEU B CG    1 
ATOM   2481  C  CD1   . LEU B 1  94   ? 443.225 25.553  732.139 1.00 96.28  ? 94   LEU B CD1   1 
ATOM   2482  C  CD2   . LEU B 1  94   ? 442.869 27.068  730.183 1.00 94.70  ? 94   LEU B CD2   1 
ATOM   2483  N  N     . GLN B 1  95   ? 445.987 23.373  731.803 1.00 94.26  ? 95   GLN B N     1 
ATOM   2484  C  CA    . GLN B 1  95   ? 446.166 22.045  731.258 1.00 94.27  ? 95   GLN B CA    1 
ATOM   2485  C  C     . GLN B 1  95   ? 444.875 21.360  730.816 1.00 94.03  ? 95   GLN B C     1 
ATOM   2486  O  O     . GLN B 1  95   ? 444.958 20.243  730.294 1.00 94.80  ? 95   GLN B O     1 
ATOM   2487  C  CB    . GLN B 1  95   ? 446.950 21.238  732.270 1.00 102.37 ? 95   GLN B CB    1 
ATOM   2488  C  CG    . GLN B 1  95   ? 448.348 21.795  732.283 1.00 98.51  ? 95   GLN B CG    1 
ATOM   2489  C  CD    . GLN B 1  95   ? 449.330 20.908  732.958 1.00 107.61 ? 95   GLN B CD    1 
ATOM   2490  O  OE1   . GLN B 1  95   ? 450.048 21.372  733.851 1.00 111.12 ? 95   GLN B OE1   1 
ATOM   2491  N  NE2   . GLN B 1  95   ? 449.386 19.640  732.564 1.00 104.72 ? 95   GLN B NE2   1 
ATOM   2492  N  N     . THR B 1  96   ? 443.699 21.972  731.033 1.00 90.14  ? 96   THR B N     1 
ATOM   2493  C  CA    . THR B 1  96   ? 442.405 21.382  730.636 1.00 88.76  ? 96   THR B CA    1 
ATOM   2494  C  C     . THR B 1  96   ? 441.243 22.319  730.956 1.00 82.63  ? 96   THR B C     1 
ATOM   2495  O  O     . THR B 1  96   ? 441.383 23.233  731.767 1.00 90.08  ? 96   THR B O     1 
ATOM   2496  C  CB    . THR B 1  96   ? 442.170 20.019  731.323 1.00 87.24  ? 96   THR B CB    1 
ATOM   2497  O  OG1   . THR B 1  96   ? 440.811 19.581  731.129 1.00 81.84  ? 96   THR B OG1   1 
ATOM   2498  C  CG2   . THR B 1  96   ? 442.563 20.058  732.782 1.00 87.31  ? 96   THR B CG2   1 
ATOM   2499  N  N     . VAL B 1  97   ? 440.117 22.120  730.241 1.00 77.38  ? 97   VAL B N     1 
ATOM   2500  C  CA    . VAL B 1  97   ? 438.891 22.924  730.354 1.00 82.56  ? 97   VAL B CA    1 
ATOM   2501  C  C     . VAL B 1  97   ? 437.700 22.062  729.941 1.00 86.49  ? 97   VAL B C     1 
ATOM   2502  O  O     . VAL B 1  97   ? 437.840 21.140  729.130 1.00 82.87  ? 97   VAL B O     1 
ATOM   2503  C  CB    . VAL B 1  97   ? 438.873 24.212  729.490 1.00 85.27  ? 97   VAL B CB    1 
ATOM   2504  C  CG1   . VAL B 1  97   ? 439.843 25.279  730.022 1.00 83.92  ? 97   VAL B CG1   1 
ATOM   2505  C  CG2   . VAL B 1  97   ? 439.096 23.893  728.034 1.00 89.71  ? 97   VAL B CG2   1 
ATOM   2506  N  N     . THR B 1  98   ? 436.524 22.347  730.529 1.00 91.59  ? 98   THR B N     1 
ATOM   2507  C  CA    . THR B 1  98   ? 435.234 21.814  730.060 1.00 93.77  ? 98   THR B CA    1 
ATOM   2508  C  C     . THR B 1  98   ? 434.414 22.956  729.450 1.00 93.44  ? 98   THR B C     1 
ATOM   2509  O  O     . THR B 1  98   ? 434.194 23.981  730.100 1.00 97.08  ? 98   THR B O     1 
ATOM   2510  C  CB    . THR B 1  98   ? 434.431 21.099  731.169 1.00 92.14  ? 98   THR B CB    1 
ATOM   2511  O  OG1   . THR B 1  98   ? 435.125 19.927  731.660 1.00 88.90  ? 98   THR B OG1   1 
ATOM   2512  C  CG2   . THR B 1  98   ? 433.031 20.675  730.653 1.00 86.45  ? 98   THR B CG2   1 
ATOM   2513  N  N     . LEU B 1  99   ? 434.037 22.809  728.180 1.00 97.20  ? 99   LEU B N     1 
ATOM   2514  C  CA    . LEU B 1  99   ? 433.194 23.768  727.464 1.00 97.84  ? 99   LEU B CA    1 
ATOM   2515  C  C     . LEU B 1  99   ? 431.725 23.326  727.456 1.00 96.85  ? 99   LEU B C     1 
ATOM   2516  O  O     . LEU B 1  99   ? 431.427 22.149  727.214 1.00 91.63  ? 99   LEU B O     1 
ATOM   2517  C  CB    . LEU B 1  99   ? 433.742 23.977  726.048 1.00 97.41  ? 99   LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1  99   ? 434.717 25.177  726.064 1.00 100.79 ? 99   LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1  99   ? 435.888 25.015  727.082 1.00 92.61  ? 99   LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1  99   ? 435.234 25.549  724.675 1.00 89.10  ? 99   LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1  100  ? 430.810 24.259  727.741 1.00 98.29  ? 100  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1  100  ? 429.383 23.947  727.798 1.00 100.34 ? 100  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1  100  ? 428.611 24.614  726.667 1.00 97.17  ? 100  LEU B C     1 
ATOM   2524  O  O     . LEU B 1  100  ? 428.881 25.770  726.317 1.00 97.88  ? 100  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1  100  ? 428.753 24.372  729.139 1.00 101.49 ? 100  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1  100  ? 429.156 23.746  730.481 1.00 95.62  ? 100  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1  100  ? 430.225 24.591  731.202 1.00 89.12  ? 100  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1  100  ? 427.904 23.498  731.354 1.00 100.30 ? 100  LEU B CD2   1 
ATOM   2529  N  N     . LEU B 1  101  ? 427.631 23.879  726.121 1.00 92.82  ? 101  LEU B N     1 
ATOM   2530  C  CA    . LEU B 1  101  ? 426.696 24.386  725.114 1.00 99.81  ? 101  LEU B CA    1 
ATOM   2531  C  C     . LEU B 1  101  ? 425.285 23.868  725.340 1.00 102.70 ? 101  LEU B C     1 
ATOM   2532  O  O     . LEU B 1  101  ? 425.063 22.653  725.415 1.00 101.55 ? 101  LEU B O     1 
ATOM   2533  C  CB    . LEU B 1  101  ? 427.111 24.024  723.690 1.00 105.33 ? 101  LEU B CB    1 
ATOM   2534  C  CG    . LEU B 1  101  ? 426.185 24.602  722.609 1.00 106.51 ? 101  LEU B CG    1 
ATOM   2535  C  CD1   . LEU B 1  101  ? 426.945 25.383  721.565 1.00 98.77  ? 101  LEU B CD1   1 
ATOM   2536  C  CD2   . LEU B 1  101  ? 425.360 23.491  721.940 1.00 106.31 ? 101  LEU B CD2   1 
ATOM   2537  N  N     . LYS B 1  102  ? 424.331 24.796  725.353 1.00 102.54 ? 102  LYS B N     1 
ATOM   2538  C  CA    . LYS B 1  102  ? 422.909 24.486  725.440 1.00 105.31 ? 102  LYS B CA    1 
ATOM   2539  C  C     . LYS B 1  102  ? 422.199 25.316  724.387 1.00 99.52  ? 102  LYS B C     1 
ATOM   2540  O  O     . LYS B 1  102  ? 422.442 26.522  724.300 1.00 103.88 ? 102  LYS B O     1 
ATOM   2541  C  CB    . LYS B 1  102  ? 422.325 24.847  726.825 1.00 109.60 ? 102  LYS B CB    1 
ATOM   2542  C  CG    . LYS B 1  102  ? 422.853 24.103  728.066 1.00 108.77 ? 102  LYS B CG    1 
ATOM   2543  C  CD    . LYS B 1  102  ? 421.823 24.113  729.225 1.00 113.84 ? 102  LYS B CD    1 
ATOM   2544  C  CE    . LYS B 1  102  ? 422.356 23.545  730.592 1.00 116.76 ? 102  LYS B CE    1 
ATOM   2545  N  NZ    . LYS B 1  102  ? 423.729 23.978  731.053 1.00 108.05 ? 102  LYS B NZ    1 
ATOM   2546  N  N     . ALA B 1  103  ? 421.454 24.664  723.499 1.00 97.45  ? 103  ALA B N     1 
ATOM   2547  C  CA    . ALA B 1  103  ? 420.661 25.391  722.508 1.00 99.99  ? 103  ALA B CA    1 
ATOM   2548  C  C     . ALA B 1  103  ? 419.529 24.477  722.041 1.00 102.56 ? 103  ALA B C     1 
ATOM   2549  O  O     . ALA B 1  103  ? 419.583 23.255  722.217 1.00 98.43  ? 103  ALA B O     1 
ATOM   2550  C  CB    . ALA B 1  103  ? 421.508 25.899  721.333 1.00 97.51  ? 103  ALA B CB    1 
ATOM   2551  N  N     . GLU B 1  104  ? 418.515 25.069  721.412 1.00 105.32 ? 104  GLU B N     1 
ATOM   2552  C  CA    . GLU B 1  104  ? 417.364 24.277  720.985 1.00 109.09 ? 104  GLU B CA    1 
ATOM   2553  C  C     . GLU B 1  104  ? 416.615 25.017  719.881 1.00 117.69 ? 104  GLU B C     1 
ATOM   2554  O  O     . GLU B 1  104  ? 416.999 26.118  719.463 1.00 115.27 ? 104  GLU B O     1 
ATOM   2555  C  CB    . GLU B 1  104  ? 416.426 23.966  722.157 1.00 116.10 ? 104  GLU B CB    1 
ATOM   2556  C  CG    . GLU B 1  104  ? 416.020 25.192  722.981 1.00 120.42 ? 104  GLU B CG    1 
ATOM   2557  C  CD    . GLU B 1  104  ? 414.952 24.882  724.017 1.00 122.32 ? 104  GLU B CD    1 
ATOM   2558  O  OE1   . GLU B 1  104  ? 415.312 24.591  725.185 1.00 124.98 ? 104  GLU B OE1   1 
ATOM   2559  O  OE2   . GLU B 1  104  ? 413.755 24.906  723.647 1.00 116.91 ? 104  GLU B OE2   1 
ATOM   2560  N  N     . GLY B 1  105  ? 415.506 24.403  719.443 1.00 118.12 ? 105  GLY B N     1 
ATOM   2561  C  CA    . GLY B 1  105  ? 414.613 24.951  718.449 1.00 115.90 ? 105  GLY B CA    1 
ATOM   2562  C  C     . GLY B 1  105  ? 415.274 24.959  717.088 1.00 117.56 ? 105  GLY B C     1 
ATOM   2563  O  O     . GLY B 1  105  ? 416.332 24.359  716.899 1.00 121.81 ? 105  GLY B O     1 
ATOM   2564  N  N     . PRO B 1  106  ? 414.680 25.647  716.114 1.00 122.64 ? 106  PRO B N     1 
ATOM   2565  C  CA    . PRO B 1  106  ? 415.255 25.707  714.731 1.00 126.92 ? 106  PRO B CA    1 
ATOM   2566  C  C     . PRO B 1  106  ? 416.471 26.607  714.464 1.00 126.41 ? 106  PRO B C     1 
ATOM   2567  O  O     . PRO B 1  106  ? 416.381 27.746  713.994 1.00 129.20 ? 106  PRO B O     1 
ATOM   2568  C  CB    . PRO B 1  106  ? 414.044 26.131  713.890 1.00 128.85 ? 106  PRO B CB    1 
ATOM   2569  C  CG    . PRO B 1  106  ? 413.155 26.891  714.832 1.00 130.86 ? 106  PRO B CG    1 
ATOM   2570  C  CD    . PRO B 1  106  ? 413.321 26.215  716.183 1.00 126.61 ? 106  PRO B CD    1 
ATOM   2571  N  N     . LYS B 1  107  ? 417.669 26.097  714.759 1.00 123.33 ? 107  LYS B N     1 
ATOM   2572  C  CA    . LYS B 1  107  ? 418.903 26.851  714.549 1.00 119.58 ? 107  LYS B CA    1 
ATOM   2573  C  C     . LYS B 1  107  ? 420.048 25.902  714.197 1.00 115.88 ? 107  LYS B C     1 
ATOM   2574  O  O     . LYS B 1  107  ? 420.092 24.750  714.649 1.00 115.11 ? 107  LYS B O     1 
ATOM   2575  C  CB    . LYS B 1  107  ? 419.364 27.764  715.702 1.00 112.84 ? 107  LYS B CB    1 
ATOM   2576  C  CG    . LYS B 1  107  ? 420.499 27.154  716.518 1.00 115.56 ? 107  LYS B CG    1 
ATOM   2577  C  CD    . LYS B 1  107  ? 420.930 27.972  717.712 1.00 110.39 ? 107  LYS B CD    1 
ATOM   2578  C  CE    . LYS B 1  107  ? 421.872 29.044  717.097 1.00 104.08 ? 107  LYS B CE    1 
ATOM   2579  N  NZ    . LYS B 1  107  ? 422.538 30.042  717.963 1.00 100.97 ? 107  LYS B NZ    1 
ATOM   2580  N  N     . GLU B 1  108  ? 420.951 26.394  713.340 1.00 111.23 ? 108  GLU B N     1 
ATOM   2581  C  CA    . GLU B 1  108  ? 422.185 25.690  713.000 1.00 112.62 ? 108  GLU B CA    1 
ATOM   2582  C  C     . GLU B 1  108  ? 423.277 26.188  713.947 1.00 111.43 ? 108  GLU B C     1 
ATOM   2583  O  O     . GLU B 1  108  ? 423.676 27.360  713.899 1.00 110.68 ? 108  GLU B O     1 
ATOM   2584  C  CB    . GLU B 1  108  ? 422.593 25.934  711.547 1.00 118.27 ? 108  GLU B CB    1 
ATOM   2585  C  CG    . GLU B 1  108  ? 421.676 25.357  710.472 1.00 116.93 ? 108  GLU B CG    1 
ATOM   2586  C  CD    . GLU B 1  108  ? 422.295 25.467  709.078 1.00 123.88 ? 108  GLU B CD    1 
ATOM   2587  O  OE1   . GLU B 1  108  ? 423.488 25.851  708.981 1.00 124.08 ? 108  GLU B OE1   1 
ATOM   2588  O  OE2   . GLU B 1  108  ? 421.602 25.149  708.085 1.00 129.50 ? 108  GLU B OE2   1 
ATOM   2589  N  N     . VAL B 1  109  ? 423.755 25.283  714.801 1.00 110.29 ? 109  VAL B N     1 
ATOM   2590  C  CA    . VAL B 1  109  ? 424.679 25.596  715.889 1.00 107.35 ? 109  VAL B CA    1 
ATOM   2591  C  C     . VAL B 1  109  ? 426.114 25.692  715.384 1.00 105.00 ? 109  VAL B C     1 
ATOM   2592  O  O     . VAL B 1  109  ? 426.664 24.716  714.867 1.00 100.10 ? 109  VAL B O     1 
ATOM   2593  C  CB    . VAL B 1  109  ? 424.574 24.543  716.998 1.00 103.78 ? 109  VAL B CB    1 
ATOM   2594  C  CG1   . VAL B 1  109  ? 425.419 24.958  718.190 1.00 101.00 ? 109  VAL B CG1   1 
ATOM   2595  C  CG2   . VAL B 1  109  ? 423.109 24.298  717.370 1.00 106.45 ? 109  VAL B CG2   1 
ATOM   2596  N  N     . LYS B 1  110  ? 426.738 26.853  715.590 1.00 107.05 ? 110  LYS B N     1 
ATOM   2597  C  CA    . LYS B 1  110  ? 428.137 27.105  715.277 1.00 104.47 ? 110  LYS B CA    1 
ATOM   2598  C  C     . LYS B 1  110  ? 429.045 27.012  716.517 1.00 103.66 ? 110  LYS B C     1 
ATOM   2599  O  O     . LYS B 1  110  ? 428.615 26.698  717.630 1.00 97.73  ? 110  LYS B O     1 
ATOM   2600  C  CB    . LYS B 1  110  ? 428.280 28.467  714.588 1.00 105.00 ? 110  LYS B CB    1 
ATOM   2601  C  CG    . LYS B 1  110  ? 427.529 28.714  713.257 1.00 109.10 ? 110  LYS B CG    1 
ATOM   2602  C  CD    . LYS B 1  110  ? 427.966 27.657  712.194 1.00 112.68 ? 110  LYS B CD    1 
ATOM   2603  C  CE    . LYS B 1  110  ? 427.322 27.817  710.797 1.00 115.81 ? 110  LYS B CE    1 
ATOM   2604  N  NZ    . LYS B 1  110  ? 427.757 26.763  709.810 1.00 99.12  ? 110  LYS B NZ    1 
ATOM   2605  N  N     . ALA B 1  111  ? 430.337 27.299  716.290 1.00 102.30 ? 111  ALA B N     1 
ATOM   2606  C  CA    . ALA B 1  111  ? 431.348 27.334  717.347 1.00 100.93 ? 111  ALA B CA    1 
ATOM   2607  C  C     . ALA B 1  111  ? 431.116 28.471  718.338 1.00 111.54 ? 111  ALA B C     1 
ATOM   2608  O  O     . ALA B 1  111  ? 431.456 28.335  719.521 1.00 110.78 ? 111  ALA B O     1 
ATOM   2609  C  CB    . ALA B 1  111  ? 432.744 27.430  716.747 1.00 98.63  ? 111  ALA B CB    1 
ATOM   2610  N  N     . ARG B 1  112  ? 430.637 29.634  717.863 1.00 115.75 ? 112  ARG B N     1 
ATOM   2611  C  CA    . ARG B 1  112  ? 430.549 30.811  718.733 1.00 114.05 ? 112  ARG B CA    1 
ATOM   2612  C  C     . ARG B 1  112  ? 429.674 30.535  719.957 1.00 109.84 ? 112  ARG B C     1 
ATOM   2613  O  O     . ARG B 1  112  ? 429.951 31.058  721.046 1.00 104.32 ? 112  ARG B O     1 
ATOM   2614  C  CB    . ARG B 1  112  ? 429.932 31.987  717.951 1.00 112.17 ? 112  ARG B CB    1 
ATOM   2615  C  CG    . ARG B 1  112  ? 430.430 32.199  716.505 1.00 110.69 ? 112  ARG B CG    1 
ATOM   2616  C  CD    . ARG B 1  112  ? 429.264 32.336  715.460 1.00 115.60 ? 112  ARG B CD    1 
ATOM   2617  N  NE    . ARG B 1  112  ? 428.018 32.940  715.976 1.00 123.98 ? 112  ARG B NE    1 
ATOM   2618  C  CZ    . ARG B 1  112  ? 426.818 32.337  716.046 1.00 116.60 ? 112  ARG B CZ    1 
ATOM   2619  N  NH1   . ARG B 1  112  ? 425.771 33.000  716.526 1.00 115.63 ? 112  ARG B NH1   1 
ATOM   2620  N  NH2   . ARG B 1  112  ? 426.645 31.078  715.646 1.00 109.06 ? 112  ARG B NH2   1 
ATOM   2621  N  N     . ASP B 1  113  ? 428.666 29.656  719.799 1.00 110.33 ? 113  ASP B N     1 
ATOM   2622  C  CA    . ASP B 1  113  ? 427.651 29.349  720.816 1.00 109.70 ? 113  ASP B CA    1 
ATOM   2623  C  C     . ASP B 1  113  ? 428.207 28.740  722.113 1.00 108.52 ? 113  ASP B C     1 
ATOM   2624  O  O     . ASP B 1  113  ? 427.477 28.727  723.114 1.00 112.09 ? 113  ASP B O     1 
ATOM   2625  C  CB    . ASP B 1  113  ? 426.525 28.472  720.232 1.00 106.73 ? 113  ASP B CB    1 
ATOM   2626  C  CG    . ASP B 1  113  ? 425.737 29.170  719.089 1.00 109.87 ? 113  ASP B CG    1 
ATOM   2627  O  OD1   . ASP B 1  113  ? 425.931 30.391  718.843 1.00 107.21 ? 113  ASP B OD1   1 
ATOM   2628  O  OD2   . ASP B 1  113  ? 424.883 28.494  718.460 1.00 106.48 ? 113  ASP B OD2   1 
ATOM   2629  N  N     . PHE B 1  114  ? 429.408 28.142  722.113 1.00 104.00 ? 114  PHE B N     1 
ATOM   2630  C  CA    . PHE B 1  114  ? 429.964 27.643  723.373 1.00 102.24 ? 114  PHE B CA    1 
ATOM   2631  C  C     . PHE B 1  114  ? 430.091 28.769  724.390 1.00 109.66 ? 114  PHE B C     1 
ATOM   2632  O  O     . PHE B 1  114  ? 430.568 29.864  724.065 1.00 108.30 ? 114  PHE B O     1 
ATOM   2633  C  CB    . PHE B 1  114  ? 431.333 26.989  723.169 1.00 99.05  ? 114  PHE B CB    1 
ATOM   2634  C  CG    . PHE B 1  114  ? 431.266 25.540  722.790 1.00 102.77 ? 114  PHE B CG    1 
ATOM   2635  C  CD1   . PHE B 1  114  ? 432.415 24.776  722.711 1.00 102.78 ? 114  PHE B CD1   1 
ATOM   2636  C  CD2   . PHE B 1  114  ? 430.052 24.925  722.557 1.00 102.93 ? 114  PHE B CD2   1 
ATOM   2637  C  CE1   . PHE B 1  114  ? 432.347 23.425  722.379 1.00 102.88 ? 114  PHE B CE1   1 
ATOM   2638  C  CE2   . PHE B 1  114  ? 429.977 23.571  722.221 1.00 99.57  ? 114  PHE B CE2   1 
ATOM   2639  C  CZ    . PHE B 1  114  ? 431.121 22.824  722.138 1.00 99.92  ? 114  PHE B CZ    1 
ATOM   2640  N  N     . LEU B 1  115  ? 429.734 28.465  725.654 1.00 108.52 ? 115  LEU B N     1 
ATOM   2641  C  CA    . LEU B 1  115  ? 429.780 29.473  726.707 1.00 102.88 ? 115  LEU B CA    1 
ATOM   2642  C  C     . LEU B 1  115  ? 431.202 29.946  726.941 1.00 104.97 ? 115  LEU B C     1 
ATOM   2643  O  O     . LEU B 1  115  ? 432.067 29.132  727.313 1.00 102.51 ? 115  LEU B O     1 
ATOM   2644  C  CB    . LEU B 1  115  ? 429.235 28.930  728.015 1.00 104.62 ? 115  LEU B CB    1 
ATOM   2645  C  CG    . LEU B 1  115  ? 427.758 28.587  728.144 1.00 107.69 ? 115  LEU B CG    1 
ATOM   2646  C  CD1   . LEU B 1  115  ? 427.460 28.150  729.601 1.00 107.19 ? 115  LEU B CD1   1 
ATOM   2647  C  CD2   . LEU B 1  115  ? 426.905 29.768  727.717 1.00 93.65  ? 115  LEU B CD2   1 
ATOM   2648  N  N     . PRO B 1  116  ? 431.485 31.232  726.712 1.00 106.98 ? 116  PRO B N     1 
ATOM   2649  C  CA    . PRO B 1  116  ? 432.855 31.758  726.842 1.00 107.73 ? 116  PRO B CA    1 
ATOM   2650  C  C     . PRO B 1  116  ? 433.497 31.416  728.187 1.00 102.43 ? 116  PRO B C     1 
ATOM   2651  O  O     . PRO B 1  116  ? 432.863 31.469  729.244 1.00 105.01 ? 116  PRO B O     1 
ATOM   2652  C  CB    . PRO B 1  116  ? 432.679 33.268  726.638 1.00 104.47 ? 116  PRO B CB    1 
ATOM   2653  C  CG    . PRO B 1  116  ? 431.445 33.378  725.786 1.00 102.38 ? 116  PRO B CG    1 
ATOM   2654  C  CD    . PRO B 1  116  ? 430.536 32.257  726.240 1.00 100.46 ? 116  PRO B CD    1 
ATOM   2655  N  N     . VAL B 1  117  ? 434.758 31.028  728.130 1.00 93.87  ? 117  VAL B N     1 
ATOM   2656  C  CA    . VAL B 1  117  ? 435.547 30.685  729.298 1.00 86.40  ? 117  VAL B CA    1 
ATOM   2657  C  C     . VAL B 1  117  ? 436.769 31.580  729.317 1.00 97.18  ? 117  VAL B C     1 
ATOM   2658  O  O     . VAL B 1  117  ? 437.270 31.987  728.264 1.00 100.04 ? 117  VAL B O     1 
ATOM   2659  C  CB    . VAL B 1  117  ? 435.944 29.198  729.301 1.00 86.01  ? 117  VAL B CB    1 
ATOM   2660  C  CG1   . VAL B 1  117  ? 436.797 28.866  730.517 1.00 85.55  ? 117  VAL B CG1   1 
ATOM   2661  C  CG2   . VAL B 1  117  ? 434.687 28.340  729.267 1.00 86.27  ? 117  VAL B CG2   1 
ATOM   2662  N  N     . ALA B 1  118  ? 437.154 31.996  730.519 1.00 110.73 ? 118  ALA B N     1 
ATOM   2663  C  CA    . ALA B 1  118  ? 438.282 32.901  730.690 1.00 113.44 ? 118  ALA B CA    1 
ATOM   2664  C  C     . ALA B 1  118  ? 439.550 32.219  730.193 1.00 108.42 ? 118  ALA B C     1 
ATOM   2665  O  O     . ALA B 1  118  ? 439.815 31.061  730.540 1.00 107.54 ? 118  ALA B O     1 
ATOM   2666  C  CB    . ALA B 1  118  ? 438.422 33.298  732.165 1.00 108.75 ? 118  ALA B CB    1 
ATOM   2667  N  N     . ASP B 1  119  ? 440.335 32.945  729.384 1.00 107.59 ? 119  ASP B N     1 
ATOM   2668  C  CA    . ASP B 1  119  ? 441.588 32.448  728.796 1.00 113.45 ? 119  ASP B CA    1 
ATOM   2669  C  C     . ASP B 1  119  ? 441.391 31.263  727.825 1.00 111.60 ? 119  ASP B C     1 
ATOM   2670  O  O     . ASP B 1  119  ? 442.309 30.454  727.630 1.00 109.43 ? 119  ASP B O     1 
ATOM   2671  C  CB    . ASP B 1  119  ? 442.611 32.106  729.897 1.00 116.77 ? 119  ASP B CB    1 
ATOM   2672  C  CG    . ASP B 1  119  ? 443.073 33.350  730.684 1.00 120.38 ? 119  ASP B CG    1 
ATOM   2673  O  OD1   . ASP B 1  119  ? 442.429 34.417  730.533 1.00 118.33 ? 119  ASP B OD1   1 
ATOM   2674  O  OD2   . ASP B 1  119  ? 444.035 33.246  731.496 1.00 118.02 ? 119  ASP B OD2   1 
ATOM   2675  N  N     . VAL B 1  120  ? 440.197 31.110  727.243 1.00 109.58 ? 120  VAL B N     1 
ATOM   2676  C  CA    . VAL B 1  120  ? 439.936 30.112  726.203 1.00 106.05 ? 120  VAL B CA    1 
ATOM   2677  C  C     . VAL B 1  120  ? 439.441 30.837  724.958 1.00 111.34 ? 120  VAL B C     1 
ATOM   2678  O  O     . VAL B 1  120  ? 438.311 31.351  724.931 1.00 109.61 ? 120  VAL B O     1 
ATOM   2679  C  CB    . VAL B 1  120  ? 438.924 29.048  726.648 1.00 104.87 ? 120  VAL B CB    1 
ATOM   2680  C  CG1   . VAL B 1  120  ? 438.488 28.198  725.461 1.00 100.62 ? 120  VAL B CG1   1 
ATOM   2681  C  CG2   . VAL B 1  120  ? 439.551 28.154  727.717 1.00 100.62 ? 120  VAL B CG2   1 
ATOM   2682  N  N     . GLU B 1  121  ? 440.276 30.831  723.912 1.00 116.22 ? 121  GLU B N     1 
ATOM   2683  C  CA    . GLU B 1  121  ? 440.012 31.492  722.639 1.00 111.40 ? 121  GLU B CA    1 
ATOM   2684  C  C     . GLU B 1  121  ? 439.607 30.437  721.620 1.00 108.49 ? 121  GLU B C     1 
ATOM   2685  O  O     . GLU B 1  121  ? 440.356 29.479  721.383 1.00 108.39 ? 121  GLU B O     1 
ATOM   2686  C  CB    . GLU B 1  121  ? 441.262 32.232  722.140 1.00 107.68 ? 121  GLU B CB    1 
ATOM   2687  C  CG    . GLU B 1  121  ? 441.118 32.938  720.789 1.00 107.68 ? 121  GLU B CG    1 
ATOM   2688  C  CD    . GLU B 1  121  ? 442.389 33.701  720.371 1.00 122.38 ? 121  GLU B CD    1 
ATOM   2689  O  OE1   . GLU B 1  121  ? 443.406 33.613  721.103 1.00 121.98 ? 121  GLU B OE1   1 
ATOM   2690  O  OE2   . GLU B 1  121  ? 442.375 34.389  719.314 1.00 122.85 ? 121  GLU B OE2   1 
ATOM   2691  N  N     . ILE B 1  122  ? 438.457 30.635  720.987 1.00 106.16 ? 122  ILE B N     1 
ATOM   2692  C  CA    . ILE B 1  122  ? 438.017 29.779  719.893 1.00 106.31 ? 122  ILE B CA    1 
ATOM   2693  C  C     . ILE B 1  122  ? 438.454 30.467  718.598 1.00 110.54 ? 122  ILE B C     1 
ATOM   2694  O  O     . ILE B 1  122  ? 437.909 31.511  718.214 1.00 111.03 ? 122  ILE B O     1 
ATOM   2695  C  CB    . ILE B 1  122  ? 436.503 29.498  719.950 1.00 103.28 ? 122  ILE B CB    1 
ATOM   2696  C  CG1   . ILE B 1  122  ? 436.139 28.556  721.115 1.00 98.75  ? 122  ILE B CG1   1 
ATOM   2697  C  CG2   . ILE B 1  122  ? 435.975 28.951  718.635 1.00 107.36 ? 122  ILE B CG2   1 
ATOM   2698  C  CD1   . ILE B 1  122  ? 436.090 29.203  722.512 1.00 109.32 ? 122  ILE B CD1   1 
ATOM   2699  N  N     . MET B 1  123  ? 439.428 29.850  717.909 1.00 106.91 ? 123  MET B N     1 
ATOM   2700  C  CA    . MET B 1  123  ? 440.080 30.461  716.751 1.00 100.71 ? 123  MET B CA    1 
ATOM   2701  C  C     . MET B 1  123  ? 439.169 30.492  715.546 1.00 103.66 ? 123  MET B C     1 
ATOM   2702  O  O     . MET B 1  123  ? 439.240 31.435  714.748 1.00 106.39 ? 123  MET B O     1 
ATOM   2703  C  CB    . MET B 1  123  ? 441.356 29.709  716.378 1.00 96.26  ? 123  MET B CB    1 
ATOM   2704  C  CG    . MET B 1  123  ? 442.383 29.630  717.471 1.00 106.09 ? 123  MET B CG    1 
ATOM   2705  S  SD    . MET B 1  123  ? 443.130 31.251  717.731 1.00 113.14 ? 123  MET B SD    1 
ATOM   2706  C  CE    . MET B 1  123  ? 443.939 31.440  716.141 1.00 117.90 ? 123  MET B CE    1 
ATOM   2707  N  N     . ASN B 1  124  ? 438.303 29.484  715.413 1.00 103.51 ? 124  ASN B N     1 
ATOM   2708  C  CA    . ASN B 1  124  ? 437.462 29.273  714.236 1.00 103.82 ? 124  ASN B CA    1 
ATOM   2709  C  C     . ASN B 1  124  ? 435.984 29.335  714.608 1.00 100.32 ? 124  ASN B C     1 
ATOM   2710  O  O     . ASN B 1  124  ? 435.270 28.328  714.532 1.00 99.75  ? 124  ASN B O     1 
ATOM   2711  C  CB    . ASN B 1  124  ? 437.792 27.927  713.584 1.00 102.74 ? 124  ASN B CB    1 
ATOM   2712  C  CG    . ASN B 1  124  ? 437.902 26.773  714.596 1.00 103.42 ? 124  ASN B CG    1 
ATOM   2713  O  OD1   . ASN B 1  124  ? 438.485 26.929  715.672 1.00 108.62 ? 124  ASN B OD1   1 
ATOM   2714  N  ND2   . ASN B 1  124  ? 437.340 25.614  714.246 1.00 94.88  ? 124  ASN B ND2   1 
ATOM   2715  N  N     . PRO B 1  125  ? 435.492 30.516  714.994 1.00 101.54 ? 125  PRO B N     1 
ATOM   2716  C  CA    . PRO B 1  125  ? 434.125 30.606  715.535 1.00 108.23 ? 125  PRO B CA    1 
ATOM   2717  C  C     . PRO B 1  125  ? 432.993 30.264  714.557 1.00 110.04 ? 125  PRO B C     1 
ATOM   2718  O  O     . PRO B 1  125  ? 431.883 29.956  715.027 1.00 107.15 ? 125  PRO B O     1 
ATOM   2719  C  CB    . PRO B 1  125  ? 434.028 32.078  715.963 1.00 114.19 ? 125  PRO B CB    1 
ATOM   2720  C  CG    . PRO B 1  125  ? 434.995 32.789  715.040 1.00 106.32 ? 125  PRO B CG    1 
ATOM   2721  C  CD    . PRO B 1  125  ? 436.131 31.835  714.864 1.00 104.46 ? 125  PRO B CD    1 
ATOM   2722  N  N     . ASP B 1  126  ? 433.211 30.290  713.235 1.00 105.44 ? 126  ASP B N     1 
ATOM   2723  C  CA    . ASP B 1  126  ? 432.112 30.001  712.307 1.00 108.78 ? 126  ASP B CA    1 
ATOM   2724  C  C     . ASP B 1  126  ? 431.932 28.516  712.003 1.00 104.31 ? 126  ASP B C     1 
ATOM   2725  O  O     . ASP B 1  126  ? 431.015 28.163  711.244 1.00 100.33 ? 126  ASP B O     1 
ATOM   2726  C  CB    . ASP B 1  126  ? 432.241 30.797  710.999 1.00 106.49 ? 126  ASP B CB    1 
ATOM   2727  C  CG    . ASP B 1  126  ? 431.084 31.808  710.815 1.00 119.40 ? 126  ASP B CG    1 
ATOM   2728  O  OD1   . ASP B 1  126  ? 430.394 32.133  711.821 1.00 123.74 ? 126  ASP B OD1   1 
ATOM   2729  O  OD2   . ASP B 1  126  ? 430.840 32.250  709.662 1.00 115.75 ? 126  ASP B OD2   1 
ATOM   2730  N  N     . LEU B 1  127  ? 432.753 27.649  712.602 1.00 98.31  ? 127  LEU B N     1 
ATOM   2731  C  CA    . LEU B 1  127  ? 432.653 26.215  712.367 1.00 91.86  ? 127  LEU B CA    1 
ATOM   2732  C  C     . LEU B 1  127  ? 431.298 25.656  712.767 1.00 93.77  ? 127  LEU B C     1 
ATOM   2733  O  O     . LEU B 1  127  ? 430.852 25.824  713.903 1.00 105.75 ? 127  LEU B O     1 
ATOM   2734  C  CB    . LEU B 1  127  ? 433.789 25.505  713.111 1.00 86.94  ? 127  LEU B CB    1 
ATOM   2735  C  CG    . LEU B 1  127  ? 433.756 23.983  713.267 1.00 90.05  ? 127  LEU B CG    1 
ATOM   2736  C  CD1   . LEU B 1  127  ? 433.685 23.243  711.962 1.00 100.07 ? 127  LEU B CD1   1 
ATOM   2737  C  CD2   . LEU B 1  127  ? 435.061 23.594  713.934 1.00 86.96  ? 127  LEU B CD2   1 
ATOM   2738  N  N     . HIS B 1  128  ? 430.670 24.945  711.831 1.00 90.18  ? 128  HIS B N     1 
ATOM   2739  C  CA    . HIS B 1  128  ? 429.374 24.322  712.067 1.00 94.10  ? 128  HIS B CA    1 
ATOM   2740  C  C     . HIS B 1  128  ? 429.528 23.127  713.004 1.00 99.37  ? 128  HIS B C     1 
ATOM   2741  O  O     . HIS B 1  128  ? 430.481 22.351  712.888 1.00 99.40  ? 128  HIS B O     1 
ATOM   2742  C  CB    . HIS B 1  128  ? 428.805 23.856  710.739 1.00 97.56  ? 128  HIS B CB    1 
ATOM   2743  C  CG    . HIS B 1  128  ? 427.450 23.242  710.828 1.00 97.79  ? 128  HIS B CG    1 
ATOM   2744  N  ND1   . HIS B 1  128  ? 426.376 23.887  711.394 1.00 106.18 ? 128  HIS B ND1   1 
ATOM   2745  C  CD2   . HIS B 1  128  ? 427.010 22.007  710.480 1.00 103.96 ? 128  HIS B CD2   1 
ATOM   2746  C  CE1   . HIS B 1  128  ? 425.318 23.093  711.348 1.00 110.97 ? 128  HIS B CE1   1 
ATOM   2747  N  NE2   . HIS B 1  128  ? 425.677 21.945  710.803 1.00 106.02 ? 128  HIS B NE2   1 
ATOM   2748  N  N     . ILE B 1  129  ? 428.572 22.968  713.928 1.00 105.64 ? 129  ILE B N     1 
ATOM   2749  C  CA    . ILE B 1  129  ? 428.513 21.814  714.838 1.00 102.40 ? 129  ILE B CA    1 
ATOM   2750  C  C     . ILE B 1  129  ? 427.292 20.924  714.562 1.00 104.90 ? 129  ILE B C     1 
ATOM   2751  O  O     . ILE B 1  129  ? 427.437 19.728  714.307 1.00 106.53 ? 129  ILE B O     1 
ATOM   2752  C  CB    . ILE B 1  129  ? 428.584 22.252  716.314 1.00 97.10  ? 129  ILE B CB    1 
ATOM   2753  C  CG1   . ILE B 1  129  ? 430.038 22.628  716.619 1.00 89.03  ? 129  ILE B CG1   1 
ATOM   2754  C  CG2   . ILE B 1  129  ? 428.137 21.089  717.192 1.00 95.65  ? 129  ILE B CG2   1 
ATOM   2755  C  CD1   . ILE B 1  129  ? 430.222 23.884  717.420 1.00 93.76  ? 129  ILE B CD1   1 
ATOM   2756  N  N     . ALA B 1  130  ? 426.080 21.468  714.691 1.00 104.79 ? 130  ALA B N     1 
ATOM   2757  C  CA    . ALA B 1  130  ? 424.921 20.664  714.318 1.00 108.70 ? 130  ALA B CA    1 
ATOM   2758  C  C     . ALA B 1  130  ? 423.766 21.556  713.878 1.00 109.54 ? 130  ALA B C     1 
ATOM   2759  O  O     . ALA B 1  130  ? 423.664 22.713  714.295 1.00 109.66 ? 130  ALA B O     1 
ATOM   2760  C  CB    . ALA B 1  130  ? 424.471 19.762  715.478 1.00 105.07 ? 130  ALA B CB    1 
ATOM   2761  N  N     . THR B 1  131  ? 422.899 21.001  713.022 1.00 112.80 ? 131  THR B N     1 
ATOM   2762  C  CA    . THR B 1  131  ? 421.652 21.654  712.628 1.00 114.15 ? 131  THR B CA    1 
ATOM   2763  C  C     . THR B 1  131  ? 420.558 21.041  713.494 1.00 111.76 ? 131  THR B C     1 
ATOM   2764  O  O     . THR B 1  131  ? 420.490 19.813  713.638 1.00 107.71 ? 131  THR B O     1 
ATOM   2765  C  CB    . THR B 1  131  ? 421.287 21.466  711.135 1.00 112.12 ? 131  THR B CB    1 
ATOM   2766  O  OG1   . THR B 1  131  ? 421.057 20.082  710.835 1.00 109.21 ? 131  THR B OG1   1 
ATOM   2767  C  CG2   . THR B 1  131  ? 422.392 21.972  710.190 1.00 107.27 ? 131  THR B CG2   1 
ATOM   2768  N  N     . LEU B 1  132  ? 419.746 21.892  714.111 1.00 114.33 ? 132  LEU B N     1 
ATOM   2769  C  CA    . LEU B 1  132  ? 418.651 21.465  714.971 1.00 111.70 ? 132  LEU B CA    1 
ATOM   2770  C  C     . LEU B 1  132  ? 417.315 21.831  714.339 1.00 112.86 ? 132  LEU B C     1 
ATOM   2771  O  O     . LEU B 1  132  ? 417.136 22.963  713.870 1.00 108.11 ? 132  LEU B O     1 
ATOM   2772  C  CB    . LEU B 1  132  ? 418.772 22.046  716.376 1.00 110.03 ? 132  LEU B CB    1 
ATOM   2773  C  CG    . LEU B 1  132  ? 419.681 21.241  717.309 1.00 107.71 ? 132  LEU B CG    1 
ATOM   2774  C  CD1   . LEU B 1  132  ? 421.127 21.152  716.829 1.00 110.01 ? 132  LEU B CD1   1 
ATOM   2775  C  CD2   . LEU B 1  132  ? 419.611 21.803  718.705 1.00 114.34 ? 132  LEU B CD2   1 
ATOM   2776  N  N     . GLU B 1  133  ? 416.389 20.869  714.300 1.00 113.61 ? 133  GLU B N     1 
ATOM   2777  C  CA    . GLU B 1  133  ? 415.085 21.133  713.715 1.00 119.20 ? 133  GLU B CA    1 
ATOM   2778  C  C     . GLU B 1  133  ? 414.163 21.664  714.823 1.00 120.25 ? 133  GLU B C     1 
ATOM   2779  O  O     . GLU B 1  133  ? 414.599 21.912  715.951 1.00 120.18 ? 133  GLU B O     1 
ATOM   2780  C  CB    . GLU B 1  133  ? 414.498 19.861  713.096 1.00 113.48 ? 133  GLU B CB    1 
ATOM   2781  C  CG    . GLU B 1  133  ? 415.487 18.865  712.519 1.00 110.75 ? 133  GLU B CG    1 
ATOM   2782  C  CD    . GLU B 1  133  ? 414.791 17.604  711.997 1.00 114.39 ? 133  GLU B CD    1 
ATOM   2783  O  OE1   . GLU B 1  133  ? 415.175 16.476  712.408 1.00 110.84 ? 133  GLU B OE1   1 
ATOM   2784  O  OE2   . GLU B 1  133  ? 413.843 17.744  711.190 1.00 112.25 ? 133  GLU B OE2   1 
ATOM   2785  N  N     . GLU B 1  134  ? 412.886 21.890  714.506 1.00 118.53 ? 134  GLU B N     1 
ATOM   2786  C  CA    . GLU B 1  134  ? 411.951 22.323  715.540 1.00 119.99 ? 134  GLU B CA    1 
ATOM   2787  C  C     . GLU B 1  134  ? 411.785 21.223  716.588 1.00 122.52 ? 134  GLU B C     1 
ATOM   2788  O  O     . GLU B 1  134  ? 411.381 20.098  716.266 1.00 121.19 ? 134  GLU B O     1 
ATOM   2789  C  CB    . GLU B 1  134  ? 410.612 22.726  714.933 1.00 122.13 ? 134  GLU B CB    1 
ATOM   2790  C  CG    . GLU B 1  134  ? 410.384 24.227  715.082 1.00 123.78 ? 134  GLU B CG    1 
ATOM   2791  C  CD    . GLU B 1  134  ? 410.039 24.635  716.499 1.00 125.88 ? 134  GLU B CD    1 
ATOM   2792  O  OE1   . GLU B 1  134  ? 409.910 25.853  716.759 1.00 129.05 ? 134  GLU B OE1   1 
ATOM   2793  O  OE2   . GLU B 1  134  ? 409.871 23.741  717.352 1.00 132.11 ? 134  GLU B OE2   1 
ATOM   2794  N  N     . GLY B 1  135  ? 411.989 21.582  717.858 1.00 118.48 ? 135  GLY B N     1 
ATOM   2795  C  CA    . GLY B 1  135  ? 411.862 20.640  718.955 1.00 115.81 ? 135  GLY B CA    1 
ATOM   2796  C  C     . GLY B 1  135  ? 413.052 19.722  719.125 1.00 112.03 ? 135  GLY B C     1 
ATOM   2797  O  O     . GLY B 1  135  ? 412.970 18.747  719.881 1.00 105.60 ? 135  GLY B O     1 
ATOM   2798  N  N     . GLY B 1  136  ? 414.123 19.959  718.370 1.00 119.43 ? 136  GLY B N     1 
ATOM   2799  C  CA    . GLY B 1  136  ? 415.368 19.235  718.570 1.00 118.08 ? 136  GLY B CA    1 
ATOM   2800  C  C     . GLY B 1  136  ? 416.158 19.931  719.665 1.00 113.27 ? 136  GLY B C     1 
ATOM   2801  O  O     . GLY B 1  136  ? 416.165 21.161  719.770 1.00 105.94 ? 136  GLY B O     1 
ATOM   2802  N  N     . ARG B 1  137  ? 416.836 19.134  720.489 1.00 113.76 ? 137  ARG B N     1 
ATOM   2803  C  CA    . ARG B 1  137  ? 417.480 19.733  721.648 1.00 115.54 ? 137  ARG B CA    1 
ATOM   2804  C  C     . ARG B 1  137  ? 418.900 19.213  721.859 1.00 105.27 ? 137  ARG B C     1 
ATOM   2805  O  O     . ARG B 1  137  ? 419.123 17.996  721.906 1.00 97.51  ? 137  ARG B O     1 
ATOM   2806  C  CB    . ARG B 1  137  ? 416.588 19.507  722.872 1.00 115.97 ? 137  ARG B CB    1 
ATOM   2807  C  CG    . ARG B 1  137  ? 415.317 20.352  722.742 1.00 116.28 ? 137  ARG B CG    1 
ATOM   2808  C  CD    . ARG B 1  137  ? 414.207 19.924  723.660 1.00 123.84 ? 137  ARG B CD    1 
ATOM   2809  N  NE    . ARG B 1  137  ? 414.671 20.011  725.030 1.00 131.18 ? 137  ARG B NE    1 
ATOM   2810  C  CZ    . ARG B 1  137  ? 414.547 21.116  725.755 1.00 133.86 ? 137  ARG B CZ    1 
ATOM   2811  N  NH1   . ARG B 1  137  ? 413.977 22.187  725.212 1.00 126.91 ? 137  ARG B NH1   1 
ATOM   2812  N  NH2   . ARG B 1  137  ? 414.998 21.159  727.005 1.00 140.10 ? 137  ARG B NH2   1 
ATOM   2813  N  N     . LEU B 1  138  ? 419.848 20.158  721.978 1.00 97.84  ? 138  LEU B N     1 
ATOM   2814  C  CA    . LEU B 1  138  ? 421.273 19.886  722.169 1.00 101.52 ? 138  LEU B CA    1 
ATOM   2815  C  C     . LEU B 1  138  ? 421.795 20.509  723.465 1.00 107.62 ? 138  LEU B C     1 
ATOM   2816  O  O     . LEU B 1  138  ? 421.909 21.738  723.580 1.00 105.98 ? 138  LEU B O     1 
ATOM   2817  C  CB    . LEU B 1  138  ? 422.092 20.410  720.995 1.00 104.04 ? 138  LEU B CB    1 
ATOM   2818  C  CG    . LEU B 1  138  ? 423.530 19.895  720.969 1.00 99.51  ? 138  LEU B CG    1 
ATOM   2819  C  CD1   . LEU B 1  138  ? 423.578 18.387  720.763 1.00 94.61  ? 138  LEU B CD1   1 
ATOM   2820  C  CD2   . LEU B 1  138  ? 424.325 20.641  719.917 1.00 101.56 ? 138  LEU B CD2   1 
ATOM   2821  N  N     . ASN B 1  139  ? 422.174 19.654  724.411 1.00 109.33 ? 139  ASN B N     1 
ATOM   2822  C  CA    . ASN B 1  139  ? 422.773 20.057  725.681 1.00 107.51 ? 139  ASN B CA    1 
ATOM   2823  C  C     . ASN B 1  139  ? 424.056 19.251  725.833 1.00 106.28 ? 139  ASN B C     1 
ATOM   2824  O  O     . ASN B 1  139  ? 423.992 18.022  725.975 1.00 103.51 ? 139  ASN B O     1 
ATOM   2825  C  CB    . ASN B 1  139  ? 421.814 19.797  726.849 1.00 108.97 ? 139  ASN B CB    1 
ATOM   2826  C  CG    . ASN B 1  139  ? 422.274 20.453  728.157 1.00 115.10 ? 139  ASN B CG    1 
ATOM   2827  O  OD1   . ASN B 1  139  ? 423.299 21.140  728.188 1.00 111.92 ? 139  ASN B OD1   1 
ATOM   2828  N  ND2   . ASN B 1  139  ? 421.530 20.212  729.252 1.00 113.15 ? 139  ASN B ND2   1 
ATOM   2829  N  N     . MET B 1  140  ? 425.222 19.912  725.789 1.00 102.10 ? 140  MET B N     1 
ATOM   2830  C  CA    . MET B 1  140  ? 426.436 19.103  725.852 1.00 98.89  ? 140  MET B CA    1 
ATOM   2831  C  C     . MET B 1  140  ? 427.629 19.809  726.496 1.00 92.49  ? 140  MET B C     1 
ATOM   2832  O  O     . MET B 1  140  ? 427.789 21.038  726.433 1.00 83.42  ? 140  MET B O     1 
ATOM   2833  C  CB    . MET B 1  140  ? 426.853 18.631  724.448 1.00 100.77 ? 140  MET B CB    1 
ATOM   2834  C  CG    . MET B 1  140  ? 427.425 19.745  723.566 1.00 105.77 ? 140  MET B CG    1 
ATOM   2835  S  SD    . MET B 1  140  ? 428.389 19.183  722.143 1.00 99.76  ? 140  MET B SD    1 
ATOM   2836  C  CE    . MET B 1  140  ? 427.119 18.284  721.268 1.00 97.04  ? 140  MET B CE    1 
ATOM   2837  N  N     . GLU B 1  141  ? 428.483 18.968  727.088 1.00 90.48  ? 141  GLU B N     1 
ATOM   2838  C  CA    . GLU B 1  141  ? 429.758 19.331  727.686 1.00 91.37  ? 141  GLU B CA    1 
ATOM   2839  C  C     . GLU B 1  141  ? 430.831 18.571  726.931 1.00 96.40  ? 141  GLU B C     1 
ATOM   2840  O  O     . GLU B 1  141  ? 430.739 17.340  726.814 1.00 92.94  ? 141  GLU B O     1 
ATOM   2841  C  CB    . GLU B 1  141  ? 429.804 18.927  729.160 1.00 97.85  ? 141  GLU B CB    1 
ATOM   2842  C  CG    . GLU B 1  141  ? 428.797 19.620  730.070 1.00 99.27  ? 141  GLU B CG    1 
ATOM   2843  C  CD    . GLU B 1  141  ? 428.938 19.170  731.507 1.00 105.31 ? 141  GLU B CD    1 
ATOM   2844  O  OE1   . GLU B 1  141  ? 429.730 18.225  731.767 1.00 103.47 ? 141  GLU B OE1   1 
ATOM   2845  O  OE2   . GLU B 1  141  ? 428.258 19.766  732.371 1.00 115.32 ? 141  GLU B OE2   1 
ATOM   2846  N  N     . VAL B 1  142  ? 431.845 19.300  726.444 1.00 97.18  ? 142  VAL B N     1 
ATOM   2847  C  CA    . VAL B 1  142  ? 433.024 18.766  725.760 1.00 88.51  ? 142  VAL B CA    1 
ATOM   2848  C  C     . VAL B 1  142  ? 434.281 19.077  726.576 1.00 87.19  ? 142  VAL B C     1 
ATOM   2849  O  O     . VAL B 1  142  ? 434.419 20.179  727.121 1.00 86.75  ? 142  VAL B O     1 
ATOM   2850  C  CB    . VAL B 1  142  ? 433.112 19.311  724.318 1.00 90.70  ? 142  VAL B CB    1 
ATOM   2851  C  CG1   . VAL B 1  142  ? 431.719 19.309  723.689 1.00 86.71  ? 142  VAL B CG1   1 
ATOM   2852  C  CG2   . VAL B 1  142  ? 433.718 20.724  724.273 1.00 94.81  ? 142  VAL B CG2   1 
ATOM   2853  N  N     . ARG B 1  143  ? 435.170 18.093  726.714 1.00 85.26  ? 143  ARG B N     1 
ATOM   2854  C  CA    . ARG B 1  143  ? 436.403 18.232  727.495 1.00 85.36  ? 143  ARG B CA    1 
ATOM   2855  C  C     . ARG B 1  143  ? 437.601 18.491  726.574 1.00 90.46  ? 143  ARG B C     1 
ATOM   2856  O  O     . ARG B 1  143  ? 437.833 17.727  725.629 1.00 87.26  ? 143  ARG B O     1 
ATOM   2857  C  CB    . ARG B 1  143  ? 436.659 16.999  728.357 1.00 83.06  ? 143  ARG B CB    1 
ATOM   2858  C  CG    . ARG B 1  143  ? 438.061 16.986  728.907 1.00 83.24  ? 143  ARG B CG    1 
ATOM   2859  C  CD    . ARG B 1  143  ? 438.202 16.045  730.092 1.00 86.22  ? 143  ARG B CD    1 
ATOM   2860  N  NE    . ARG B 1  143  ? 439.574 16.070  730.579 1.00 84.40  ? 143  ARG B NE    1 
ATOM   2861  C  CZ    . ARG B 1  143  ? 440.030 15.332  731.577 1.00 88.44  ? 143  ARG B CZ    1 
ATOM   2862  N  NH1   . ARG B 1  143  ? 439.217 14.484  732.215 1.00 86.70  ? 143  ARG B NH1   1 
ATOM   2863  N  NH2   . ARG B 1  143  ? 441.307 15.454  731.930 1.00 91.10  ? 143  ARG B NH2   1 
ATOM   2864  N  N     . VAL B 1  144  ? 438.308 19.607  726.792 1.00 90.91  ? 144  VAL B N     1 
ATOM   2865  C  CA    . VAL B 1  144  ? 439.425 20.043  725.943 1.00 83.71  ? 144  VAL B CA    1 
ATOM   2866  C  C     . VAL B 1  144  ? 440.731 20.083  726.745 1.00 87.11  ? 144  VAL B C     1 
ATOM   2867  O  O     . VAL B 1  144  ? 440.888 20.915  727.645 1.00 92.33  ? 144  VAL B O     1 
ATOM   2868  C  CB    . VAL B 1  144  ? 439.125 21.421  725.335 1.00 85.35  ? 144  VAL B CB    1 
ATOM   2869  C  CG1   . VAL B 1  144  ? 440.355 22.013  724.666 1.00 88.34  ? 144  VAL B CG1   1 
ATOM   2870  C  CG2   . VAL B 1  144  ? 437.969 21.304  724.360 1.00 88.32  ? 144  VAL B CG2   1 
ATOM   2871  N  N     . ASP B 1  145  ? 441.693 19.241  726.369 1.00 89.47  ? 145  ASP B N     1 
ATOM   2872  C  CA    . ASP B 1  145  ? 442.970 19.086  727.062 1.00 90.51  ? 145  ASP B CA    1 
ATOM   2873  C  C     . ASP B 1  145  ? 444.158 19.586  726.244 1.00 89.73  ? 145  ASP B C     1 
ATOM   2874  O  O     . ASP B 1  145  ? 444.095 19.697  725.010 1.00 85.43  ? 145  ASP B O     1 
ATOM   2875  C  CB    . ASP B 1  145  ? 443.199 17.632  727.434 1.00 89.78  ? 145  ASP B CB    1 
ATOM   2876  C  CG    . ASP B 1  145  ? 442.341 17.213  728.573 1.00 95.57  ? 145  ASP B CG    1 
ATOM   2877  O  OD1   . ASP B 1  145  ? 441.225 16.746  728.279 1.00 98.12  ? 145  ASP B OD1   1 
ATOM   2878  O  OD2   . ASP B 1  145  ? 442.781 17.319  729.746 1.00 99.58  ? 145  ASP B OD2   1 
ATOM   2879  N  N     . ARG B 1  146  ? 445.233 19.943  726.966 1.00 84.42  ? 146  ARG B N     1 
ATOM   2880  C  CA    . ARG B 1  146  ? 446.520 20.276  726.360 1.00 83.00  ? 146  ARG B CA    1 
ATOM   2881  C  C     . ARG B 1  146  ? 447.347 19.008  726.132 1.00 85.17  ? 146  ARG B C     1 
ATOM   2882  O  O     . ARG B 1  146  ? 447.455 18.170  727.031 1.00 81.44  ? 146  ARG B O     1 
ATOM   2883  C  CB    . ARG B 1  146  ? 447.288 21.261  727.252 1.00 81.54  ? 146  ARG B CB    1 
ATOM   2884  C  CG    . ARG B 1  146  ? 448.771 21.355  726.924 1.00 89.66  ? 146  ARG B CG    1 
ATOM   2885  C  CD    . ARG B 1  146  ? 449.543 22.408  727.726 1.00 97.39  ? 146  ARG B CD    1 
ATOM   2886  N  NE    . ARG B 1  146  ? 449.051 23.760  727.432 1.00 101.65 ? 146  ARG B NE    1 
ATOM   2887  C  CZ    . ARG B 1  146  ? 449.416 24.862  728.088 1.00 100.92 ? 146  ARG B CZ    1 
ATOM   2888  N  NH1   . ARG B 1  146  ? 450.294 24.785  729.084 1.00 101.70 ? 146  ARG B NH1   1 
ATOM   2889  N  NH2   . ARG B 1  146  ? 448.880 26.037  727.766 1.00 96.98  ? 146  ARG B NH2   1 
ATOM   2890  N  N     . GLY B 1  147  ? 447.949 18.880  724.947 1.00 89.41  ? 147  GLY B N     1 
ATOM   2891  C  CA    . GLY B 1  147  ? 448.764 17.708  724.663 1.00 88.24  ? 147  GLY B CA    1 
ATOM   2892  C  C     . GLY B 1  147  ? 449.574 17.791  723.373 1.00 89.65  ? 147  GLY B C     1 
ATOM   2893  O  O     . GLY B 1  147  ? 449.594 18.812  722.670 1.00 84.84  ? 147  GLY B O     1 
ATOM   2894  N  N     . VAL B 1  148  ? 450.215 16.662  723.047 1.00 84.60  ? 148  VAL B N     1 
ATOM   2895  C  CA    . VAL B 1  148  ? 451.021 16.520  721.843 1.00 81.80  ? 148  VAL B CA    1 
ATOM   2896  C  C     . VAL B 1  148  ? 450.673 15.224  721.134 1.00 86.48  ? 148  VAL B C     1 
ATOM   2897  O  O     . VAL B 1  148  ? 450.250 14.250  721.767 1.00 90.28  ? 148  VAL B O     1 
ATOM   2898  C  CB    . VAL B 1  148  ? 452.548 16.538  722.149 1.00 78.57  ? 148  VAL B CB    1 
ATOM   2899  C  CG1   . VAL B 1  148  ? 452.986 17.836  722.834 1.00 76.47  ? 148  VAL B CG1   1 
ATOM   2900  C  CG2   . VAL B 1  148  ? 452.983 15.293  722.941 1.00 65.08  ? 148  VAL B CG2   1 
ATOM   2901  N  N     . GLY B 1  149  ? 450.860 15.221  719.805 1.00 80.47  ? 149  GLY B N     1 
ATOM   2902  C  CA    . GLY B 1  149  ? 450.739 14.011  719.007 1.00 74.08  ? 149  GLY B CA    1 
ATOM   2903  C  C     . GLY B 1  149  ? 449.313 13.572  718.717 1.00 72.77  ? 149  GLY B C     1 
ATOM   2904  O  O     . GLY B 1  149  ? 448.417 14.398  718.510 1.00 75.52  ? 149  GLY B O     1 
ATOM   2905  N  N     . TYR B 1  150  ? 449.103 12.253  718.667 1.00 65.52  ? 150  TYR B N     1 
ATOM   2906  C  CA    . TYR B 1  150  ? 447.768 11.738  718.354 1.00 74.38  ? 150  TYR B CA    1 
ATOM   2907  C  C     . TYR B 1  150  ? 447.481 10.511  719.216 1.00 80.44  ? 150  TYR B C     1 
ATOM   2908  O  O     . TYR B 1  150  ? 448.269 9.558   719.205 1.00 80.68  ? 150  TYR B O     1 
ATOM   2909  C  CB    . TYR B 1  150  ? 447.619 11.424  716.867 1.00 72.05  ? 150  TYR B CB    1 
ATOM   2910  C  CG    . TYR B 1  150  ? 446.252 10.935  716.417 1.00 66.72  ? 150  TYR B CG    1 
ATOM   2911  C  CD1   . TYR B 1  150  ? 445.881 9.589   716.493 1.00 64.16  ? 150  TYR B CD1   1 
ATOM   2912  C  CD2   . TYR B 1  150  ? 445.370 11.831  715.811 1.00 64.21  ? 150  TYR B CD2   1 
ATOM   2913  C  CE1   . TYR B 1  150  ? 444.650 9.172   716.029 1.00 59.50  ? 150  TYR B CE1   1 
ATOM   2914  C  CE2   . TYR B 1  150  ? 444.153 11.423  715.342 1.00 59.38  ? 150  TYR B CE2   1 
ATOM   2915  C  CZ    . TYR B 1  150  ? 443.802 10.100  715.454 1.00 54.00  ? 150  TYR B CZ    1 
ATOM   2916  O  OH    . TYR B 1  150  ? 442.582 9.725   714.991 1.00 55.54  ? 150  TYR B OH    1 
ATOM   2917  N  N     . VAL B 1  151  ? 446.416 10.558  720.017 1.00 79.42  ? 151  VAL B N     1 
ATOM   2918  C  CA    . VAL B 1  151  ? 445.989 9.428   720.833 1.00 79.40  ? 151  VAL B CA    1 
ATOM   2919  C  C     . VAL B 1  151  ? 444.581 8.957   720.443 1.00 79.00  ? 151  VAL B C     1 
ATOM   2920  O  O     . VAL B 1  151  ? 443.613 9.721   720.573 1.00 71.27  ? 151  VAL B O     1 
ATOM   2921  C  CB    . VAL B 1  151  ? 446.065 9.793   722.325 1.00 83.18  ? 151  VAL B CB    1 
ATOM   2922  C  CG1   . VAL B 1  151  ? 445.777 8.551   723.217 1.00 81.43  ? 151  VAL B CG1   1 
ATOM   2923  C  CG2   . VAL B 1  151  ? 447.432 10.477  722.650 1.00 68.78  ? 151  VAL B CG2   1 
ATOM   2924  N  N     . PRO B 1  152  ? 444.418 7.722   719.914 1.00 82.66  ? 152  PRO B N     1 
ATOM   2925  C  CA    . PRO B 1  152  ? 443.069 7.215   719.589 1.00 81.88  ? 152  PRO B CA    1 
ATOM   2926  C  C     . PRO B 1  152  ? 442.227 7.175   720.852 1.00 83.77  ? 152  PRO B C     1 
ATOM   2927  O  O     . PRO B 1  152  ? 442.773 7.051   721.950 1.00 86.96  ? 152  PRO B O     1 
ATOM   2928  C  CB    . PRO B 1  152  ? 443.332 5.802   719.036 1.00 80.97  ? 152  PRO B CB    1 
ATOM   2929  C  CG    . PRO B 1  152  ? 444.731 5.461   719.441 1.00 78.97  ? 152  PRO B CG    1 
ATOM   2930  C  CD    . PRO B 1  152  ? 445.472 6.765   719.524 1.00 78.97  ? 152  PRO B CD    1 
ATOM   2931  N  N     . ALA B 1  153  ? 440.887 7.279   720.697 1.00 88.80  ? 153  ALA B N     1 
ATOM   2932  C  CA    . ALA B 1  153  ? 439.983 7.313   721.870 1.00 88.75  ? 153  ALA B CA    1 
ATOM   2933  C  C     . ALA B 1  153  ? 440.054 6.049   722.725 1.00 82.32  ? 153  ALA B C     1 
ATOM   2934  O  O     . ALA B 1  153  ? 440.324 6.116   723.928 1.00 78.70  ? 153  ALA B O     1 
ATOM   2935  C  CB    . ALA B 1  153  ? 438.529 7.530   721.433 1.00 85.08  ? 153  ALA B CB    1 
ATOM   2936  N  N     . GLU B 1  154  ? 439.962 4.886   722.090 1.00 89.50  ? 154  GLU B N     1 
ATOM   2937  C  CA    . GLU B 1  154  ? 439.935 3.592   722.755 1.00 85.63  ? 154  GLU B CA    1 
ATOM   2938  C  C     . GLU B 1  154  ? 441.242 3.322   723.515 1.00 86.39  ? 154  GLU B C     1 
ATOM   2939  O  O     . GLU B 1  154  ? 441.463 2.198   723.973 1.00 91.95  ? 154  GLU B O     1 
ATOM   2940  C  CB    . GLU B 1  154  ? 439.681 2.473   721.697 1.00 92.14  ? 154  GLU B CB    1 
ATOM   2941  C  CG    . GLU B 1  154  ? 438.361 2.542   720.781 1.00 93.87  ? 154  GLU B CG    1 
ATOM   2942  C  CD    . GLU B 1  154  ? 438.416 3.440   719.499 1.00 91.42  ? 154  GLU B CD    1 
ATOM   2943  O  OE1   . GLU B 1  154  ? 439.486 4.030   719.186 1.00 90.67  ? 154  GLU B OE1   1 
ATOM   2944  O  OE2   . GLU B 1  154  ? 437.359 3.557   718.805 1.00 88.57  ? 154  GLU B OE2   1 
ATOM   2945  N  N     . LYS B 1  155  ? 442.125 4.348   723.672 1.00 81.71  ? 155  LYS B N     1 
ATOM   2946  C  CA    . LYS B 1  155  ? 443.450 4.252   724.307 1.00 80.91  ? 155  LYS B CA    1 
ATOM   2947  C  C     . LYS B 1  155  ? 443.711 5.302   725.378 1.00 86.49  ? 155  LYS B C     1 
ATOM   2948  O  O     . LYS B 1  155  ? 444.478 5.016   726.299 1.00 94.30  ? 155  LYS B O     1 
ATOM   2949  C  CB    . LYS B 1  155  ? 444.634 4.192   723.270 1.00 83.47  ? 155  LYS B CB    1 
ATOM   2950  C  CG    . LYS B 1  155  ? 444.752 2.757   722.645 1.00 85.08  ? 155  LYS B CG    1 
ATOM   2951  C  CD    . LYS B 1  155  ? 445.688 2.558   721.441 1.00 89.37  ? 155  LYS B CD    1 
ATOM   2952  C  CE    . LYS B 1  155  ? 444.908 2.046   720.183 1.00 96.83  ? 155  LYS B CE    1 
ATOM   2953  N  NZ    . LYS B 1  155  ? 444.391 0.626   720.230 1.00 86.72  ? 155  LYS B NZ    1 
ATOM   2954  N  N     . HIS B 1  156  ? 443.220 6.542   725.238 1.00 86.17  ? 156  HIS B N     1 
ATOM   2955  C  CA    . HIS B 1  156  ? 443.451 7.444   726.375 1.00 87.29  ? 156  HIS B CA    1 
ATOM   2956  C  C     . HIS B 1  156  ? 442.434 7.149   727.482 1.00 95.17  ? 156  HIS B C     1 
ATOM   2957  O  O     . HIS B 1  156  ? 442.763 7.220   728.679 1.00 90.86  ? 156  HIS B O     1 
ATOM   2958  C  CB    . HIS B 1  156  ? 443.399 8.932   725.994 1.00 78.96  ? 156  HIS B CB    1 
ATOM   2959  C  CG    . HIS B 1  156  ? 442.085 9.389   725.438 1.00 82.52  ? 156  HIS B CG    1 
ATOM   2960  N  ND1   . HIS B 1  156  ? 440.954 9.521   726.214 1.00 86.36  ? 156  HIS B ND1   1 
ATOM   2961  C  CD2   . HIS B 1  156  ? 441.748 9.854   724.211 1.00 89.16  ? 156  HIS B CD2   1 
ATOM   2962  C  CE1   . HIS B 1  156  ? 439.957 9.973   725.473 1.00 87.90  ? 156  HIS B CE1   1 
ATOM   2963  N  NE2   . HIS B 1  156  ? 440.416 10.193  724.254 1.00 89.51  ? 156  HIS B NE2   1 
ATOM   2964  N  N     . GLY B 1  157  ? 441.201 6.799   727.088 1.00 98.01  ? 157  GLY B N     1 
ATOM   2965  C  CA    . GLY B 1  157  ? 440.122 6.431   727.991 1.00 91.33  ? 157  GLY B CA    1 
ATOM   2966  C  C     . GLY B 1  157  ? 439.736 7.408   729.081 1.00 91.06  ? 157  GLY B C     1 
ATOM   2967  O  O     . GLY B 1  157  ? 439.778 7.061   730.269 1.00 96.00  ? 157  GLY B O     1 
ATOM   2968  N  N     . ILE B 1  158  ? 439.412 8.644   728.698 1.00 85.45  ? 158  ILE B N     1 
ATOM   2969  C  CA    . ILE B 1  158  ? 438.995 9.659   729.646 1.00 83.10  ? 158  ILE B CA    1 
ATOM   2970  C  C     . ILE B 1  158  ? 437.480 9.702   729.686 1.00 90.20  ? 158  ILE B C     1 
ATOM   2971  O  O     . ILE B 1  158  ? 436.815 9.780   728.640 1.00 78.26  ? 158  ILE B O     1 
ATOM   2972  C  CB    . ILE B 1  158  ? 439.592 11.029  729.285 1.00 73.96  ? 158  ILE B CB    1 
ATOM   2973  C  CG1   . ILE B 1  158  ? 441.097 11.003  729.519 1.00 82.23  ? 158  ILE B CG1   1 
ATOM   2974  C  CG2   . ILE B 1  158  ? 438.870 12.185  729.936 1.00 78.56  ? 158  ILE B CG2   1 
ATOM   2975  C  CD1   . ILE B 1  158  ? 441.722 12.376  729.429 1.00 90.55  ? 158  ILE B CD1   1 
ATOM   2976  N  N     . LYS B 1  159  ? 436.948 9.575   730.909 1.00 101.04 ? 159  LYS B N     1 
ATOM   2977  C  CA    . LYS B 1  159  ? 435.535 9.732   731.229 1.00 93.25  ? 159  LYS B CA    1 
ATOM   2978  C  C     . LYS B 1  159  ? 435.440 10.573  732.498 1.00 99.71  ? 159  LYS B C     1 
ATOM   2979  O  O     . LYS B 1  159  ? 435.947 10.158  733.550 1.00 100.36 ? 159  LYS B O     1 
ATOM   2980  C  CB    . LYS B 1  159  ? 434.878 8.357   731.395 1.00 86.59  ? 159  LYS B CB    1 
ATOM   2981  C  CG    . LYS B 1  159  ? 434.299 7.810   730.084 1.00 90.22  ? 159  LYS B CG    1 
ATOM   2982  C  CD    . LYS B 1  159  ? 433.695 6.433   730.271 1.00 94.54  ? 159  LYS B CD    1 
ATOM   2983  C  CE    . LYS B 1  159  ? 432.170 6.478   730.283 1.00 104.31 ? 159  LYS B CE    1 
ATOM   2984  N  NZ    . LYS B 1  159  ? 431.525 5.122   730.384 1.00 105.27 ? 159  LYS B NZ    1 
ATOM   2985  N  N     . ASP B 1  160  ? 434.841 11.767  732.394 1.00 101.94 ? 160  ASP B N     1 
ATOM   2986  C  CA    . ASP B 1  160  ? 434.504 12.542  733.590 1.00 101.08 ? 160  ASP B CA    1 
ATOM   2987  C  C     . ASP B 1  160  ? 433.303 11.966  734.331 1.00 92.02  ? 160  ASP B C     1 
ATOM   2988  O  O     . ASP B 1  160  ? 433.219 12.087  735.555 1.00 99.05  ? 160  ASP B O     1 
ATOM   2989  C  CB    . ASP B 1  160  ? 434.245 14.012  733.258 1.00 102.36 ? 160  ASP B CB    1 
ATOM   2990  C  CG    . ASP B 1  160  ? 435.515 14.809  733.149 1.00 104.12 ? 160  ASP B CG    1 
ATOM   2991  O  OD1   . ASP B 1  160  ? 436.555 14.316  733.664 1.00 100.16 ? 160  ASP B OD1   1 
ATOM   2992  O  OD2   . ASP B 1  160  ? 435.449 15.936  732.583 1.00 103.61 ? 160  ASP B OD2   1 
ATOM   2993  N  N     . ARG B 1  161  ? 432.358 11.373  733.607 1.00 85.49  ? 161  ARG B N     1 
ATOM   2994  C  CA    . ARG B 1  161  ? 431.139 10.822  734.161 1.00 87.80  ? 161  ARG B CA    1 
ATOM   2995  C  C     . ARG B 1  161  ? 430.698 9.649   733.307 1.00 87.91  ? 161  ARG B C     1 
ATOM   2996  O  O     . ARG B 1  161  ? 431.319 9.328   732.303 1.00 95.99  ? 161  ARG B O     1 
ATOM   2997  C  CB    . ARG B 1  161  ? 430.037 11.867  734.148 1.00 94.43  ? 161  ARG B CB    1 
ATOM   2998  C  CG    . ARG B 1  161  ? 429.582 12.165  732.737 1.00 88.17  ? 161  ARG B CG    1 
ATOM   2999  C  CD    . ARG B 1  161  ? 428.462 13.159  732.727 1.00 91.11  ? 161  ARG B CD    1 
ATOM   3000  N  NE    . ARG B 1  161  ? 428.940 14.463  733.152 1.00 93.12  ? 161  ARG B NE    1 
ATOM   3001  C  CZ    . ARG B 1  161  ? 428.142 15.473  733.464 1.00 96.35  ? 161  ARG B CZ    1 
ATOM   3002  N  NH1   . ARG B 1  161  ? 426.820 15.315  733.407 1.00 90.69  ? 161  ARG B NH1   1 
ATOM   3003  N  NH2   . ARG B 1  161  ? 428.671 16.630  733.851 1.00 97.52  ? 161  ARG B NH2   1 
ATOM   3004  N  N     . ILE B 1  162  ? 429.591 9.023   733.687 1.00 96.55  ? 162  ILE B N     1 
ATOM   3005  C  CA    . ILE B 1  162  ? 429.072 7.961   732.842 1.00 100.72 ? 162  ILE B CA    1 
ATOM   3006  C  C     . ILE B 1  162  ? 428.453 8.583   731.595 1.00 103.76 ? 162  ILE B C     1 
ATOM   3007  O  O     . ILE B 1  162  ? 428.070 9.764   731.576 1.00 105.33 ? 162  ILE B O     1 
ATOM   3008  C  CB    . ILE B 1  162  ? 428.012 7.151   733.612 1.00 101.19 ? 162  ILE B CB    1 
ATOM   3009  C  CG1   . ILE B 1  162  ? 428.535 6.743   734.979 1.00 102.72 ? 162  ILE B CG1   1 
ATOM   3010  C  CG2   . ILE B 1  162  ? 427.542 5.930   732.825 1.00 102.45 ? 162  ILE B CG2   1 
ATOM   3011  C  CD1   . ILE B 1  162  ? 429.205 5.383   734.976 1.00 112.67 ? 162  ILE B CD1   1 
ATOM   3012  N  N     . ASN B 1  163  ? 428.364 7.777   730.533 1.00 95.93  ? 163  ASN B N     1 
ATOM   3013  C  CA    . ASN B 1  163  ? 427.839 8.215   729.237 1.00 103.04 ? 163  ASN B CA    1 
ATOM   3014  C  C     . ASN B 1  163  ? 428.721 9.219   728.477 1.00 106.69 ? 163  ASN B C     1 
ATOM   3015  O  O     . ASN B 1  163  ? 428.420 9.555   727.320 1.00 96.43  ? 163  ASN B O     1 
ATOM   3016  C  CB    . ASN B 1  163  ? 426.428 8.773   729.458 1.00 98.28  ? 163  ASN B CB    1 
ATOM   3017  C  CG    . ASN B 1  163  ? 425.416 7.674   729.745 1.00 102.70 ? 163  ASN B CG    1 
ATOM   3018  O  OD1   . ASN B 1  163  ? 425.189 6.785   728.909 1.00 97.38  ? 163  ASN B OD1   1 
ATOM   3019  N  ND2   . ASN B 1  163  ? 424.862 7.679   730.967 1.00 108.15 ? 163  ASN B ND2   1 
ATOM   3020  N  N     . ALA B 1  164  ? 429.817 9.685   729.094 1.00 105.83 ? 164  ALA B N     1 
ATOM   3021  C  CA    . ALA B 1  164  ? 430.763 10.534  728.377 1.00 98.38  ? 164  ALA B CA    1 
ATOM   3022  C  C     . ALA B 1  164  ? 431.495 9.660   727.354 1.00 100.91 ? 164  ALA B C     1 
ATOM   3023  O  O     . ALA B 1  164  ? 431.952 8.556   727.689 1.00 96.48  ? 164  ALA B O     1 
ATOM   3024  C  CB    . ALA B 1  164  ? 431.741 11.215  729.349 1.00 90.19  ? 164  ALA B CB    1 
ATOM   3025  N  N     . ILE B 1  165  ? 431.574 10.137  726.110 1.00 102.07 ? 165  ILE B N     1 
ATOM   3026  C  CA    . ILE B 1  165  ? 432.186 9.407   724.995 1.00 94.56  ? 165  ILE B CA    1 
ATOM   3027  C  C     . ILE B 1  165  ? 433.623 9.877   724.799 1.00 92.73  ? 165  ILE B C     1 
ATOM   3028  O  O     . ILE B 1  165  ? 433.854 11.097  724.707 1.00 91.27  ? 165  ILE B O     1 
ATOM   3029  C  CB    . ILE B 1  165  ? 431.425 9.563   723.674 1.00 81.52  ? 165  ILE B CB    1 
ATOM   3030  C  CG1   . ILE B 1  165  ? 429.932 9.385   723.834 1.00 87.83  ? 165  ILE B CG1   1 
ATOM   3031  C  CG2   . ILE B 1  165  ? 431.877 8.464   722.767 1.00 86.45  ? 165  ILE B CG2   1 
ATOM   3032  C  CD1   . ILE B 1  165  ? 429.178 9.555   722.533 1.00 85.10  ? 165  ILE B CD1   1 
ATOM   3033  N  N     . PRO B 1  166  ? 434.610 8.979   724.827 1.00 93.05  ? 166  PRO B N     1 
ATOM   3034  C  CA    . PRO B 1  166  ? 435.987 9.390   724.522 1.00 90.54  ? 166  PRO B CA    1 
ATOM   3035  C  C     . PRO B 1  166  ? 436.117 9.653   723.019 1.00 90.26  ? 166  PRO B C     1 
ATOM   3036  O  O     . PRO B 1  166  ? 435.572 8.911   722.192 1.00 90.03  ? 166  PRO B O     1 
ATOM   3037  C  CB    . PRO B 1  166  ? 436.824 8.180   724.955 1.00 91.24  ? 166  PRO B CB    1 
ATOM   3038  C  CG    . PRO B 1  166  ? 435.868 7.004   724.801 1.00 88.92  ? 166  PRO B CG    1 
ATOM   3039  C  CD    . PRO B 1  166  ? 434.497 7.534   725.104 1.00 89.50  ? 166  PRO B CD    1 
ATOM   3040  N  N     . VAL B 1  167  ? 436.856 10.711  722.670 1.00 91.26  ? 167  VAL B N     1 
ATOM   3041  C  CA    . VAL B 1  167  ? 437.002 11.186  721.293 1.00 86.18  ? 167  VAL B CA    1 
ATOM   3042  C  C     . VAL B 1  167  ? 438.464 11.012  720.906 1.00 84.87  ? 167  VAL B C     1 
ATOM   3043  O  O     . VAL B 1  167  ? 439.351 11.279  721.725 1.00 84.72  ? 167  VAL B O     1 
ATOM   3044  C  CB    . VAL B 1  167  ? 436.597 12.674  721.147 1.00 79.89  ? 167  VAL B CB    1 
ATOM   3045  C  CG1   . VAL B 1  167  ? 436.882 13.164  719.734 1.00 85.11  ? 167  VAL B CG1   1 
ATOM   3046  C  CG2   . VAL B 1  167  ? 435.144 12.904  721.526 1.00 79.12  ? 167  VAL B CG2   1 
ATOM   3047  N  N     . ASP B 1  168  ? 438.722 10.585  719.661 1.00 84.68  ? 168  ASP B N     1 
ATOM   3048  C  CA    . ASP B 1  168  ? 440.103 10.507  719.170 1.00 81.31  ? 168  ASP B CA    1 
ATOM   3049  C  C     . ASP B 1  168  ? 440.755 11.896  719.323 1.00 78.92  ? 168  ASP B C     1 
ATOM   3050  O  O     . ASP B 1  168  ? 440.205 12.906  718.876 1.00 80.31  ? 168  ASP B O     1 
ATOM   3051  C  CB    . ASP B 1  168  ? 440.108 10.007  717.708 1.00 78.27  ? 168  ASP B CB    1 
ATOM   3052  C  CG    . ASP B 1  168  ? 439.457 8.582   717.524 1.00 83.23  ? 168  ASP B CG    1 
ATOM   3053  O  OD1   . ASP B 1  168  ? 439.800 7.633   718.275 1.00 80.42  ? 168  ASP B OD1   1 
ATOM   3054  O  OD2   . ASP B 1  168  ? 438.584 8.409   716.631 1.00 80.64  ? 168  ASP B OD2   1 
ATOM   3055  N  N     . ALA B 1  169  ? 441.888 11.977  720.020 1.00 73.63  ? 169  ALA B N     1 
ATOM   3056  C  CA    . ALA B 1  169  ? 442.449 13.272  720.420 1.00 75.32  ? 169  ALA B CA    1 
ATOM   3057  C  C     . ALA B 1  169  ? 443.496 13.720  719.413 1.00 81.07  ? 169  ALA B C     1 
ATOM   3058  O  O     . ALA B 1  169  ? 444.600 13.171  719.383 1.00 83.85  ? 169  ALA B O     1 
ATOM   3059  C  CB    . ALA B 1  169  ? 443.069 13.198  721.814 1.00 78.37  ? 169  ALA B CB    1 
ATOM   3060  N  N     . VAL B 1  170  ? 443.185 14.758  718.635 1.00 79.99  ? 170  VAL B N     1 
ATOM   3061  C  CA    . VAL B 1  170  ? 444.119 15.290  717.642 1.00 74.34  ? 170  VAL B CA    1 
ATOM   3062  C  C     . VAL B 1  170  ? 444.775 16.519  718.264 1.00 73.02  ? 170  VAL B C     1 
ATOM   3063  O  O     . VAL B 1  170  ? 444.367 17.666  718.007 1.00 72.85  ? 170  VAL B O     1 
ATOM   3064  C  CB    . VAL B 1  170  ? 443.390 15.632  716.339 1.00 79.89  ? 170  VAL B CB    1 
ATOM   3065  C  CG1   . VAL B 1  170  ? 444.373 16.135  715.236 1.00 82.78  ? 170  VAL B CG1   1 
ATOM   3066  C  CG2   . VAL B 1  170  ? 442.494 14.461  715.866 1.00 76.49  ? 170  VAL B CG2   1 
ATOM   3067  N  N     . PHE B 1  171  ? 445.931 16.312  718.905 1.00 68.57  ? 171  PHE B N     1 
ATOM   3068  C  CA    . PHE B 1  171  ? 446.496 17.439  719.639 1.00 79.28  ? 171  PHE B CA    1 
ATOM   3069  C  C     . PHE B 1  171  ? 447.259 18.363  718.723 1.00 82.84  ? 171  PHE B C     1 
ATOM   3070  O  O     . PHE B 1  171  ? 447.012 19.580  718.696 1.00 80.48  ? 171  PHE B O     1 
ATOM   3071  C  CB    . PHE B 1  171  ? 447.472 16.971  720.723 1.00 82.50  ? 171  PHE B CB    1 
ATOM   3072  C  CG    . PHE B 1  171  ? 446.816 16.330  721.903 1.00 90.03  ? 171  PHE B CG    1 
ATOM   3073  C  CD1   . PHE B 1  171  ? 445.917 17.034  722.690 1.00 88.81  ? 171  PHE B CD1   1 
ATOM   3074  C  CD2   . PHE B 1  171  ? 447.145 15.029  722.269 1.00 89.81  ? 171  PHE B CD2   1 
ATOM   3075  C  CE1   . PHE B 1  171  ? 445.311 16.420  723.789 1.00 88.82  ? 171  PHE B CE1   1 
ATOM   3076  C  CE2   . PHE B 1  171  ? 446.545 14.423  723.364 1.00 86.98  ? 171  PHE B CE2   1 
ATOM   3077  C  CZ    . PHE B 1  171  ? 445.629 15.118  724.121 1.00 82.03  ? 171  PHE B CZ    1 
ATOM   3078  N  N     . SER B 1  172  ? 448.068 17.759  717.870 1.00 83.70  ? 172  SER B N     1 
ATOM   3079  C  CA    . SER B 1  172  ? 449.075 18.438  717.090 1.00 82.30  ? 172  SER B CA    1 
ATOM   3080  C  C     . SER B 1  172  ? 448.476 19.607  716.326 1.00 82.51  ? 172  SER B C     1 
ATOM   3081  O  O     . SER B 1  172  ? 447.460 19.433  715.629 1.00 77.75  ? 172  SER B O     1 
ATOM   3082  C  CB    . SER B 1  172  ? 449.723 17.463  716.107 1.00 90.65  ? 172  SER B CB    1 
ATOM   3083  O  OG    . SER B 1  172  ? 450.885 18.007  715.486 1.00 94.00  ? 172  SER B OG    1 
ATOM   3084  N  N     . PRO B 1  173  ? 448.973 20.822  716.549 1.00 84.26  ? 173  PRO B N     1 
ATOM   3085  C  CA    . PRO B 1  173  ? 448.542 21.942  715.710 1.00 86.88  ? 173  PRO B CA    1 
ATOM   3086  C  C     . PRO B 1  173  ? 449.042 21.758  714.269 1.00 93.01  ? 173  PRO B C     1 
ATOM   3087  O  O     . PRO B 1  173  ? 448.529 22.430  713.367 1.00 97.30  ? 173  PRO B O     1 
ATOM   3088  C  CB    . PRO B 1  173  ? 449.141 23.170  716.412 1.00 86.13  ? 173  PRO B CB    1 
ATOM   3089  C  CG    . PRO B 1  173  ? 450.348 22.627  717.133 1.00 85.07  ? 173  PRO B CG    1 
ATOM   3090  C  CD    . PRO B 1  173  ? 449.974 21.226  717.558 1.00 81.39  ? 173  PRO B CD    1 
ATOM   3091  N  N     . VAL B 1  174  ? 450.067 20.919  714.049 1.00 87.86  ? 174  VAL B N     1 
ATOM   3092  C  CA    . VAL B 1  174  ? 450.596 20.586  712.721 1.00 87.84  ? 174  VAL B CA    1 
ATOM   3093  C  C     . VAL B 1  174  ? 449.694 19.551  712.035 1.00 88.49  ? 174  VAL B C     1 
ATOM   3094  O  O     . VAL B 1  174  ? 449.502 18.446  712.560 1.00 90.09  ? 174  VAL B O     1 
ATOM   3095  C  CB    . VAL B 1  174  ? 452.040 20.058  712.825 1.00 85.33  ? 174  VAL B CB    1 
ATOM   3096  C  CG1   . VAL B 1  174  ? 452.494 19.528  711.506 1.00 84.91  ? 174  VAL B CG1   1 
ATOM   3097  C  CG2   . VAL B 1  174  ? 453.000 21.160  713.216 1.00 83.60  ? 174  VAL B CG2   1 
ATOM   3098  N  N     . ARG B 1  175  ? 449.099 19.927  710.882 1.00 86.62  ? 175  ARG B N     1 
ATOM   3099  C  CA    . ARG B 1  175  ? 448.247 19.022  710.093 1.00 89.75  ? 175  ARG B CA    1 
ATOM   3100  C  C     . ARG B 1  175  ? 449.044 18.122  709.134 1.00 94.79  ? 175  ARG B C     1 
ATOM   3101  O  O     . ARG B 1  175  ? 448.622 16.995  708.832 1.00 94.43  ? 175  ARG B O     1 
ATOM   3102  C  CB    . ARG B 1  175  ? 447.217 19.813  709.289 1.00 88.02  ? 175  ARG B CB    1 
ATOM   3103  C  CG    . ARG B 1  175  ? 446.295 20.662  710.103 1.00 91.69  ? 175  ARG B CG    1 
ATOM   3104  C  CD    . ARG B 1  175  ? 445.028 20.853  709.321 1.00 98.31  ? 175  ARG B CD    1 
ATOM   3105  N  NE    . ARG B 1  175  ? 443.987 21.467  710.125 1.00 109.99 ? 175  ARG B NE    1 
ATOM   3106  C  CZ    . ARG B 1  175  ? 442.751 21.689  709.692 1.00 115.50 ? 175  ARG B CZ    1 
ATOM   3107  N  NH1   . ARG B 1  175  ? 442.406 21.338  708.447 1.00 107.69 ? 175  ARG B NH1   1 
ATOM   3108  N  NH2   . ARG B 1  175  ? 441.861 22.248  710.515 1.00 117.74 ? 175  ARG B NH2   1 
ATOM   3109  N  N     . ARG B 1  176  ? 450.116 18.644  708.542 1.00 91.13  ? 176  ARG B N     1 
ATOM   3110  C  CA    . ARG B 1  176  ? 450.949 17.879  707.629 1.00 84.53  ? 176  ARG B CA    1 
ATOM   3111  C  C     . ARG B 1  176  ? 452.333 18.509  707.579 1.00 83.45  ? 176  ARG B C     1 
ATOM   3112  O  O     . ARG B 1  176  ? 452.486 19.728  707.694 1.00 81.21  ? 176  ARG B O     1 
ATOM   3113  C  CB    . ARG B 1  176  ? 450.358 17.751  706.212 1.00 87.67  ? 176  ARG B CB    1 
ATOM   3114  C  CG    . ARG B 1  176  ? 451.309 16.945  705.242 1.00 95.32  ? 176  ARG B CG    1 
ATOM   3115  C  CD    . ARG B 1  176  ? 450.635 16.117  704.157 1.00 93.12  ? 176  ARG B CD    1 
ATOM   3116  N  NE    . ARG B 1  176  ? 450.113 16.914  703.048 1.00 96.54  ? 176  ARG B NE    1 
ATOM   3117  C  CZ    . ARG B 1  176  ? 450.644 16.999  701.827 1.00 96.43  ? 176  ARG B CZ    1 
ATOM   3118  N  NH1   . ARG B 1  176  ? 451.763 16.339  701.499 1.00 94.75  ? 176  ARG B NH1   1 
ATOM   3119  N  NH2   . ARG B 1  176  ? 450.026 17.756  700.927 1.00 91.26  ? 176  ARG B NH2   1 
ATOM   3120  N  N     . VAL B 1  177  ? 453.326 17.652  707.360 1.00 82.97  ? 177  VAL B N     1 
ATOM   3121  C  CA    . VAL B 1  177  ? 454.679 18.062  707.034 1.00 82.80  ? 177  VAL B CA    1 
ATOM   3122  C  C     . VAL B 1  177  ? 455.096 17.225  705.846 1.00 88.06  ? 177  VAL B C     1 
ATOM   3123  O  O     . VAL B 1  177  ? 455.116 15.988  705.933 1.00 85.78  ? 177  VAL B O     1 
ATOM   3124  C  CB    . VAL B 1  177  ? 455.664 17.831  708.183 1.00 76.29  ? 177  VAL B CB    1 
ATOM   3125  C  CG1   . VAL B 1  177  ? 457.091 18.159  707.729 1.00 72.74  ? 177  VAL B CG1   1 
ATOM   3126  C  CG2   . VAL B 1  177  ? 455.286 18.689  709.321 1.00 77.90  ? 177  VAL B CG2   1 
ATOM   3127  N  N     . ALA B 1  178  ? 455.450 17.908  704.750 1.00 89.25  ? 178  ALA B N     1 
ATOM   3128  C  CA    . ALA B 1  178  ? 456.018 17.311  703.551 1.00 85.43  ? 178  ALA B CA    1 
ATOM   3129  C  C     . ALA B 1  178  ? 457.313 18.066  703.287 1.00 85.75  ? 178  ALA B C     1 
ATOM   3130  O  O     . ALA B 1  178  ? 457.330 19.302  703.309 1.00 82.35  ? 178  ALA B O     1 
ATOM   3131  C  CB    . ALA B 1  178  ? 455.054 17.398  702.364 1.00 79.98  ? 178  ALA B CB    1 
ATOM   3132  N  N     . PHE B 1  179  ? 458.381 17.329  702.999 1.00 86.15  ? 179  PHE B N     1 
ATOM   3133  C  CA    . PHE B 1  179  ? 459.659 17.930  702.668 1.00 85.27  ? 179  PHE B CA    1 
ATOM   3134  C  C     . PHE B 1  179  ? 460.218 17.233  701.436 1.00 92.88  ? 179  PHE B C     1 
ATOM   3135  O  O     . PHE B 1  179  ? 460.005 16.030  701.238 1.00 88.74  ? 179  PHE B O     1 
ATOM   3136  C  CB    . PHE B 1  179  ? 460.619 17.901  703.904 1.00 81.44  ? 179  PHE B CB    1 
ATOM   3137  C  CG    . PHE B 1  179  ? 461.463 16.645  704.062 1.00 85.07  ? 179  PHE B CG    1 
ATOM   3138  C  CD1   . PHE B 1  179  ? 462.776 16.594  703.586 1.00 85.52  ? 179  PHE B CD1   1 
ATOM   3139  C  CD2   . PHE B 1  179  ? 460.972 15.535  704.741 1.00 82.75  ? 179  PHE B CD2   1 
ATOM   3140  C  CE1   . PHE B 1  179  ? 463.578 15.438  703.767 1.00 78.60  ? 179  PHE B CE1   1 
ATOM   3141  C  CE2   . PHE B 1  179  ? 461.770 14.372  704.919 1.00 80.85  ? 179  PHE B CE2   1 
ATOM   3142  C  CZ    . PHE B 1  179  ? 463.068 14.332  704.434 1.00 76.32  ? 179  PHE B CZ    1 
ATOM   3143  N  N     . GLN B 1  180  ? 460.938 18.020  700.615 1.00 99.40  ? 180  GLN B N     1 
ATOM   3144  C  CA    . GLN B 1  180  ? 461.529 17.598  699.345 1.00 97.37  ? 180  GLN B CA    1 
ATOM   3145  C  C     . GLN B 1  180  ? 462.970 18.099  699.289 1.00 95.85  ? 180  GLN B C     1 
ATOM   3146  O  O     . GLN B 1  180  ? 463.218 19.297  699.458 1.00 96.68  ? 180  GLN B O     1 
ATOM   3147  C  CB    . GLN B 1  180  ? 460.686 18.179  698.196 1.00 100.48 ? 180  GLN B CB    1 
ATOM   3148  C  CG    . GLN B 1  180  ? 460.898 17.637  696.792 1.00 101.53 ? 180  GLN B CG    1 
ATOM   3149  C  CD    . GLN B 1  180  ? 459.560 17.536  696.023 1.00 106.54 ? 180  GLN B CD    1 
ATOM   3150  O  OE1   . GLN B 1  180  ? 458.508 17.994  696.502 1.00 106.53 ? 180  GLN B OE1   1 
ATOM   3151  N  NE2   . GLN B 1  180  ? 459.599 16.931  694.836 1.00 104.46 ? 180  GLN B NE2   1 
ATOM   3152  N  N     . VAL B 1  181  ? 463.905 17.192  698.988 1.00 97.43  ? 181  VAL B N     1 
ATOM   3153  C  CA    . VAL B 1  181  ? 465.336 17.485  698.825 1.00 97.83  ? 181  VAL B CA    1 
ATOM   3154  C  C     . VAL B 1  181  ? 465.715 17.469  697.342 1.00 100.05 ? 181  VAL B C     1 
ATOM   3155  O  O     . VAL B 1  181  ? 465.328 16.557  696.600 1.00 102.24 ? 181  VAL B O     1 
ATOM   3156  C  CB    . VAL B 1  181  ? 466.178 16.486  699.635 1.00 93.35  ? 181  VAL B CB    1 
ATOM   3157  C  CG1   . VAL B 1  181  ? 467.645 16.850  699.554 1.00 92.88  ? 181  VAL B CG1   1 
ATOM   3158  C  CG2   . VAL B 1  181  ? 465.686 16.467  701.069 1.00 83.96  ? 181  VAL B CG2   1 
ATOM   3159  N  N     . GLU B 1  182  ? 466.508 18.457  696.915 1.00 96.12  ? 182  GLU B N     1 
ATOM   3160  C  CA    . GLU B 1  182  ? 466.966 18.509  695.533 1.00 93.08  ? 182  GLU B CA    1 
ATOM   3161  C  C     . GLU B 1  182  ? 468.445 18.844  695.418 1.00 99.21  ? 182  GLU B C     1 
ATOM   3162  O  O     . GLU B 1  182  ? 469.006 19.517  696.284 1.00 98.85  ? 182  GLU B O     1 
ATOM   3163  C  CB    . GLU B 1  182  ? 466.212 19.636  694.820 1.00 90.62  ? 182  GLU B CB    1 
ATOM   3164  C  CG    . GLU B 1  182  ? 464.710 19.632  695.065 1.00 102.55 ? 182  GLU B CG    1 
ATOM   3165  C  CD    . GLU B 1  182  ? 464.037 20.950  694.689 1.00 106.97 ? 182  GLU B CD    1 
ATOM   3166  O  OE1   . GLU B 1  182  ? 464.651 21.747  693.943 1.00 101.56 ? 182  GLU B OE1   1 
ATOM   3167  O  OE2   . GLU B 1  182  ? 462.902 21.197  695.176 1.00 110.73 ? 182  GLU B OE2   1 
ATOM   3168  N  N     . ASP B 1  183  ? 469.081 18.331  694.355 1.00 104.60 ? 183  ASP B N     1 
ATOM   3169  C  CA    . ASP B 1  183  ? 470.501 18.584  694.124 1.00 101.34 ? 183  ASP B CA    1 
ATOM   3170  C  C     . ASP B 1  183  ? 470.717 20.059  693.758 1.00 89.82  ? 183  ASP B C     1 
ATOM   3171  O  O     . ASP B 1  183  ? 469.851 20.703  693.165 1.00 81.46  ? 183  ASP B O     1 
ATOM   3172  C  CB    . ASP B 1  183  ? 471.049 17.700  692.985 1.00 109.48 ? 183  ASP B CB    1 
ATOM   3173  C  CG    . ASP B 1  183  ? 471.481 16.290  693.448 1.00 114.27 ? 183  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B 1  183  ? 471.359 15.341  692.625 1.00 108.10 ? 183  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B 1  183  ? 471.914 16.128  694.621 1.00 113.73 ? 183  ASP B OD2   1 
ATOM   3176  N  N     . THR B 1  184  ? 471.846 20.625  694.178 1.00 91.74  ? 184  THR B N     1 
ATOM   3177  C  CA    . THR B 1  184  ? 472.133 22.012  693.826 1.00 91.98  ? 184  THR B CA    1 
ATOM   3178  C  C     . THR B 1  184  ? 473.642 22.216  693.825 1.00 98.59  ? 184  THR B C     1 
ATOM   3179  O  O     . THR B 1  184  ? 474.377 21.484  694.496 1.00 96.58  ? 184  THR B O     1 
ATOM   3180  C  CB    . THR B 1  184  ? 471.473 23.011  694.761 1.00 90.98  ? 184  THR B CB    1 
ATOM   3181  O  OG1   . THR B 1  184  ? 471.423 24.283  694.100 1.00 90.09  ? 184  THR B OG1   1 
ATOM   3182  C  CG2   . THR B 1  184  ? 472.296 23.133  696.055 1.00 91.19  ? 184  THR B CG2   1 
ATOM   3183  N  N     . ARG B 1  185  ? 474.095 23.278  693.135 1.00 102.16 ? 185  ARG B N     1 
ATOM   3184  C  CA    . ARG B 1  185  ? 475.526 23.525  692.944 1.00 106.87 ? 185  ARG B CA    1 
ATOM   3185  C  C     . ARG B 1  185  ? 475.899 24.967  693.267 1.00 106.44 ? 185  ARG B C     1 
ATOM   3186  O  O     . ARG B 1  185  ? 475.165 25.900  692.917 1.00 108.11 ? 185  ARG B O     1 
ATOM   3187  C  CB    . ARG B 1  185  ? 476.032 23.216  691.513 1.00 116.31 ? 185  ARG B CB    1 
ATOM   3188  C  CG    . ARG B 1  185  ? 475.509 24.104  690.397 1.00 117.96 ? 185  ARG B CG    1 
ATOM   3189  C  CD    . ARG B 1  185  ? 476.217 23.742  689.106 1.00 115.05 ? 185  ARG B CD    1 
ATOM   3190  N  NE    . ARG B 1  185  ? 476.159 24.830  688.133 1.00 119.05 ? 185  ARG B NE    1 
ATOM   3191  C  CZ    . ARG B 1  185  ? 477.086 25.788  688.033 1.00 124.61 ? 185  ARG B CZ    1 
ATOM   3192  N  NH1   . ARG B 1  185  ? 478.151 25.798  688.850 1.00 120.86 ? 185  ARG B NH1   1 
ATOM   3193  N  NH2   . ARG B 1  185  ? 476.950 26.739  687.111 1.00 121.46 ? 185  ARG B NH2   1 
ATOM   3194  N  N     . LEU B 1  186  ? 477.030 25.137  693.971 1.00 109.34 ? 186  LEU B N     1 
ATOM   3195  C  CA    . LEU B 1  186  ? 477.691 26.432  694.159 1.00 115.41 ? 186  LEU B CA    1 
ATOM   3196  C  C     . LEU B 1  186  ? 479.051 26.377  693.462 1.00 118.09 ? 186  LEU B C     1 
ATOM   3197  O  O     . LEU B 1  186  ? 479.973 25.712  693.955 1.00 114.82 ? 186  LEU B O     1 
ATOM   3198  C  CB    . LEU B 1  186  ? 477.860 26.770  695.645 1.00 111.55 ? 186  LEU B CB    1 
ATOM   3199  C  CG    . LEU B 1  186  ? 477.965 28.245  696.075 1.00 112.00 ? 186  LEU B CG    1 
ATOM   3200  C  CD1   . LEU B 1  186  ? 479.140 28.445  697.051 1.00 100.34 ? 186  LEU B CD1   1 
ATOM   3201  C  CD2   . LEU B 1  186  ? 478.058 29.228  694.874 1.00 116.54 ? 186  LEU B CD2   1 
ATOM   3202  N  N     . GLY B 1  187  ? 479.183 27.105  692.336 1.00 121.47 ? 187  GLY B N     1 
ATOM   3203  C  CA    . GLY B 1  187  ? 480.435 27.094  691.583 1.00 124.63 ? 187  GLY B CA    1 
ATOM   3204  C  C     . GLY B 1  187  ? 480.781 25.706  691.059 1.00 121.58 ? 187  GLY B C     1 
ATOM   3205  O  O     . GLY B 1  187  ? 480.066 25.135  690.215 1.00 110.25 ? 187  GLY B O     1 
ATOM   3206  N  N     . GLN B 1  188  ? 481.955 25.212  691.495 1.00 122.89 ? 188  GLN B N     1 
ATOM   3207  C  CA    . GLN B 1  188  ? 482.492 23.910  691.090 1.00 123.20 ? 188  GLN B CA    1 
ATOM   3208  C  C     . GLN B 1  188  ? 481.839 22.716  691.816 1.00 129.84 ? 188  GLN B C     1 
ATOM   3209  O  O     . GLN B 1  188  ? 481.812 21.615  691.247 1.00 127.12 ? 188  GLN B O     1 
ATOM   3210  C  CB    . GLN B 1  188  ? 484.016 23.884  691.307 1.00 120.91 ? 188  GLN B CB    1 
ATOM   3211  C  CG    . GLN B 1  188  ? 484.527 23.070  692.544 1.00 127.01 ? 188  GLN B CG    1 
ATOM   3212  C  CD    . GLN B 1  188  ? 484.404 23.806  693.909 1.00 131.34 ? 188  GLN B CD    1 
ATOM   3213  O  OE1   . GLN B 1  188  ? 483.734 24.837  694.024 1.00 133.79 ? 188  GLN B OE1   1 
ATOM   3214  N  NE2   . GLN B 1  188  ? 485.064 23.267  694.938 1.00 125.54 ? 188  GLN B NE2   1 
ATOM   3215  N  N     . ARG B 1  189  ? 481.361 22.872  693.071 1.00 130.32 ? 189  ARG B N     1 
ATOM   3216  C  CA    . ARG B 1  189  ? 480.744 21.760  693.806 1.00 121.25 ? 189  ARG B CA    1 
ATOM   3217  C  C     . ARG B 1  189  ? 479.283 21.596  693.367 1.00 116.50 ? 189  ARG B C     1 
ATOM   3218  O  O     . ARG B 1  189  ? 478.481 22.521  693.552 1.00 110.36 ? 189  ARG B O     1 
ATOM   3219  C  CB    . ARG B 1  189  ? 480.801 21.991  695.323 1.00 120.03 ? 189  ARG B CB    1 
ATOM   3220  C  CG    . ARG B 1  189  ? 482.180 22.182  696.001 1.00 125.74 ? 189  ARG B CG    1 
ATOM   3221  C  CD    . ARG B 1  189  ? 482.003 22.353  697.546 1.00 129.63 ? 189  ARG B CD    1 
ATOM   3222  N  NE    . ARG B 1  189  ? 483.177 22.884  698.257 1.00 135.66 ? 189  ARG B NE    1 
ATOM   3223  C  CZ    . ARG B 1  189  ? 483.440 22.676  699.552 1.00 133.67 ? 189  ARG B CZ    1 
ATOM   3224  N  NH1   . ARG B 1  189  ? 484.524 23.209  700.121 1.00 126.25 ? 189  ARG B NH1   1 
ATOM   3225  N  NH2   . ARG B 1  189  ? 482.618 21.934  700.287 1.00 132.16 ? 189  ARG B NH2   1 
ATOM   3226  N  N     . THR B 1  190  ? 478.942 20.450  692.744 1.00 116.03 ? 190  THR B N     1 
ATOM   3227  C  CA    . THR B 1  190  ? 477.567 20.155  692.302 1.00 117.64 ? 190  THR B CA    1 
ATOM   3228  C  C     . THR B 1  190  ? 476.762 19.174  693.170 1.00 115.62 ? 190  THR B C     1 
ATOM   3229  O  O     . THR B 1  190  ? 475.616 18.864  692.797 1.00 115.21 ? 190  THR B O     1 
ATOM   3230  C  CB    . THR B 1  190  ? 477.533 19.649  690.856 1.00 113.69 ? 190  THR B CB    1 
ATOM   3231  O  OG1   . THR B 1  190  ? 478.160 18.361  690.771 1.00 116.37 ? 190  THR B OG1   1 
ATOM   3232  C  CG2   . THR B 1  190  ? 478.189 20.653  689.933 1.00 115.33 ? 190  THR B CG2   1 
ATOM   3233  N  N     . ASP B 1  191  ? 477.333 18.578  694.222 1.00 105.30 ? 191  ASP B N     1 
ATOM   3234  C  CA    . ASP B 1  191  ? 476.611 17.503  694.895 1.00 100.37 ? 191  ASP B CA    1 
ATOM   3235  C  C     . ASP B 1  191  ? 475.765 18.003  696.090 1.00 100.47 ? 191  ASP B C     1 
ATOM   3236  O  O     . ASP B 1  191  ? 475.237 17.189  696.868 1.00 97.43  ? 191  ASP B O     1 
ATOM   3237  C  CB    . ASP B 1  191  ? 477.597 16.414  695.317 1.00 98.44  ? 191  ASP B CB    1 
ATOM   3238  C  CG    . ASP B 1  191  ? 477.058 15.003  695.040 1.00 104.65 ? 191  ASP B CG    1 
ATOM   3239  O  OD1   . ASP B 1  191  ? 475.821 14.862  694.861 1.00 108.69 ? 191  ASP B OD1   1 
ATOM   3240  O  OD2   . ASP B 1  191  ? 477.865 14.036  695.021 1.00 97.57  ? 191  ASP B OD2   1 
ATOM   3241  N  N     . LEU B 1  192  ? 475.657 19.320  696.260 1.00 97.87  ? 192  LEU B N     1 
ATOM   3242  C  CA    . LEU B 1  192  ? 475.075 19.935  697.444 1.00 91.59  ? 192  LEU B CA    1 
ATOM   3243  C  C     . LEU B 1  192  ? 473.550 19.719  697.505 1.00 93.89  ? 192  LEU B C     1 
ATOM   3244  O  O     . LEU B 1  192  ? 472.896 19.383  696.513 1.00 96.11  ? 192  LEU B O     1 
ATOM   3245  C  CB    . LEU B 1  192  ? 475.468 21.416  697.483 1.00 86.58  ? 192  LEU B CB    1 
ATOM   3246  C  CG    . LEU B 1  192  ? 477.012 21.591  697.412 1.00 90.74  ? 192  LEU B CG    1 
ATOM   3247  C  CD1   . LEU B 1  192  ? 477.467 23.044  697.557 1.00 88.62  ? 192  LEU B CD1   1 
ATOM   3248  C  CD2   . LEU B 1  192  ? 477.840 20.657  698.333 1.00 84.00  ? 192  LEU B CD2   1 
ATOM   3249  N  N     . ASP B 1  193  ? 472.987 19.905  698.703 1.00 94.28  ? 193  ASP B N     1 
ATOM   3250  C  CA    . ASP B 1  193  ? 471.569 19.689  698.982 1.00 91.42  ? 193  ASP B CA    1 
ATOM   3251  C  C     . ASP B 1  193  ? 470.813 21.017  699.110 1.00 90.70  ? 193  ASP B C     1 
ATOM   3252  O  O     . ASP B 1  193  ? 471.351 22.000  699.633 1.00 92.87  ? 193  ASP B O     1 
ATOM   3253  C  CB    . ASP B 1  193  ? 471.388 18.905  700.294 1.00 89.09  ? 193  ASP B CB    1 
ATOM   3254  C  CG    . ASP B 1  193  ? 471.475 17.378  700.126 1.00 95.11  ? 193  ASP B CG    1 
ATOM   3255  O  OD1   . ASP B 1  193  ? 472.318 16.751  700.808 1.00 91.76  ? 193  ASP B OD1   1 
ATOM   3256  O  OD2   . ASP B 1  193  ? 470.703 16.793  699.337 1.00 106.44 ? 193  ASP B OD2   1 
ATOM   3257  N  N     . LYS B 1  194  ? 469.560 21.046  698.645 1.00 82.72  ? 194  LYS B N     1 
ATOM   3258  C  CA    . LYS B 1  194  ? 468.652 22.171  698.856 1.00 79.27  ? 194  LYS B CA    1 
ATOM   3259  C  C     . LYS B 1  194  ? 467.380 21.638  699.505 1.00 95.00  ? 194  LYS B C     1 
ATOM   3260  O  O     . LYS B 1  194  ? 466.655 20.841  698.893 1.00 96.86  ? 194  LYS B O     1 
ATOM   3261  C  CB    . LYS B 1  194  ? 468.293 22.894  697.568 1.00 81.04  ? 194  LYS B CB    1 
ATOM   3262  C  CG    . LYS B 1  194  ? 467.140 23.887  697.757 1.00 84.45  ? 194  LYS B CG    1 
ATOM   3263  C  CD    . LYS B 1  194  ? 466.699 24.496  696.432 1.00 87.56  ? 194  LYS B CD    1 
ATOM   3264  C  CE    . LYS B 1  194  ? 465.442 25.334  696.538 1.00 77.83  ? 194  LYS B CE    1 
ATOM   3265  N  NZ    . LYS B 1  194  ? 464.407 24.791  695.615 1.00 78.24  ? 194  LYS B NZ    1 
ATOM   3266  N  N     . LEU B 1  195  ? 467.082 22.116  700.718 1.00 96.34  ? 195  LEU B N     1 
ATOM   3267  C  CA    . LEU B 1  195  ? 465.975 21.619  701.527 1.00 88.36  ? 195  LEU B CA    1 
ATOM   3268  C  C     . LEU B 1  195  ? 464.780 22.569  701.473 1.00 89.32  ? 195  LEU B C     1 
ATOM   3269  O  O     . LEU B 1  195  ? 464.927 23.776  701.687 1.00 91.38  ? 195  LEU B O     1 
ATOM   3270  C  CB    . LEU B 1  195  ? 466.436 21.389  702.971 1.00 83.53  ? 195  LEU B CB    1 
ATOM   3271  C  CG    . LEU B 1  195  ? 465.385 20.977  704.009 1.00 82.30  ? 195  LEU B CG    1 
ATOM   3272  C  CD1   . LEU B 1  195  ? 464.579 19.741  703.621 1.00 82.38  ? 195  LEU B CD1   1 
ATOM   3273  C  CD2   . LEU B 1  195  ? 466.105 20.733  705.311 1.00 73.90  ? 195  LEU B CD2   1 
ATOM   3274  N  N     . THR B 1  196  ? 463.620 22.026  701.110 1.00 87.95  ? 196  THR B N     1 
ATOM   3275  C  CA    . THR B 1  196  ? 462.349 22.736  701.067 1.00 85.08  ? 196  THR B CA    1 
ATOM   3276  C  C     . THR B 1  196  ? 461.394 22.038  702.012 1.00 89.02  ? 196  THR B C     1 
ATOM   3277  O  O     . THR B 1  196  ? 461.196 20.825  701.900 1.00 93.08  ? 196  THR B O     1 
ATOM   3278  C  CB    . THR B 1  196  ? 461.772 22.823  699.646 1.00 87.64  ? 196  THR B CB    1 
ATOM   3279  O  OG1   . THR B 1  196  ? 462.502 23.798  698.895 1.00 81.67  ? 196  THR B OG1   1 
ATOM   3280  C  CG2   . THR B 1  196  ? 460.272 23.155  699.626 1.00 89.74  ? 196  THR B CG2   1 
ATOM   3281  N  N     . LEU B 1  197  ? 460.873 22.795  702.983 1.00 92.78  ? 197  LEU B N     1 
ATOM   3282  C  CA    . LEU B 1  197  ? 459.996 22.321  704.051 1.00 86.22  ? 197  LEU B CA    1 
ATOM   3283  C  C     . LEU B 1  197  ? 458.629 22.975  703.933 1.00 88.36  ? 197  LEU B C     1 
ATOM   3284  O  O     . LEU B 1  197  ? 458.526 24.196  703.776 1.00 91.16  ? 197  LEU B O     1 
ATOM   3285  C  CB    . LEU B 1  197  ? 460.557 22.629  705.443 1.00 78.80  ? 197  LEU B CB    1 
ATOM   3286  C  CG    . LEU B 1  197  ? 461.007 21.412  706.214 1.00 80.20  ? 197  LEU B CG    1 
ATOM   3287  C  CD1   . LEU B 1  197  ? 461.169 21.705  707.694 1.00 76.29  ? 197  LEU B CD1   1 
ATOM   3288  C  CD2   . LEU B 1  197  ? 459.883 20.445  706.040 1.00 87.86  ? 197  LEU B CD2   1 
ATOM   3289  N  N     . ARG B 1  198  ? 457.587 22.159  703.992 1.00 85.56  ? 198  ARG B N     1 
ATOM   3290  C  CA    . ARG B 1  198  ? 456.215 22.628  703.884 1.00 85.93  ? 198  ARG B CA    1 
ATOM   3291  C  C     . ARG B 1  198  ? 455.503 22.206  705.162 1.00 90.79  ? 198  ARG B C     1 
ATOM   3292  O  O     . ARG B 1  198  ? 455.482 21.012  705.491 1.00 89.56  ? 198  ARG B O     1 
ATOM   3293  C  CB    . ARG B 1  198  ? 455.597 22.026  702.619 1.00 91.72  ? 198  ARG B CB    1 
ATOM   3294  C  CG    . ARG B 1  198  ? 456.352 22.527  701.362 1.00 93.51  ? 198  ARG B CG    1 
ATOM   3295  C  CD    . ARG B 1  198  ? 455.669 22.350  699.990 1.00 90.59  ? 198  ARG B CD    1 
ATOM   3296  N  NE    . ARG B 1  198  ? 455.331 20.954  699.681 1.00 98.29  ? 198  ARG B NE    1 
ATOM   3297  C  CZ    . ARG B 1  198  ? 456.185 20.096  699.091 1.00 106.44 ? 198  ARG B CZ    1 
ATOM   3298  N  NH1   . ARG B 1  198  ? 455.814 18.834  698.837 1.00 97.14  ? 198  ARG B NH1   1 
ATOM   3299  N  NH2   . ARG B 1  198  ? 457.430 20.491  698.765 1.00 102.97 ? 198  ARG B NH2   1 
ATOM   3300  N  N     . ILE B 1  199  ? 454.962 23.189  705.900 1.00 93.38  ? 199  ILE B N     1 
ATOM   3301  C  CA    . ILE B 1  199  ? 454.295 22.974  707.187 1.00 82.81  ? 199  ILE B CA    1 
ATOM   3302  C  C     . ILE B 1  199  ? 452.884 23.564  707.139 1.00 85.98  ? 199  ILE B C     1 
ATOM   3303  O  O     . ILE B 1  199  ? 452.716 24.756  706.861 1.00 89.20  ? 199  ILE B O     1 
ATOM   3304  C  CB    . ILE B 1  199  ? 455.102 23.594  708.341 1.00 82.41  ? 199  ILE B CB    1 
ATOM   3305  C  CG1   . ILE B 1  199  ? 456.599 23.314  708.177 1.00 82.76  ? 199  ILE B CG1   1 
ATOM   3306  C  CG2   . ILE B 1  199  ? 454.643 23.004  709.637 1.00 89.72  ? 199  ILE B CG2   1 
ATOM   3307  C  CD1   . ILE B 1  199  ? 457.352 23.131  709.476 1.00 75.61  ? 199  ILE B CD1   1 
ATOM   3308  N  N     . TRP B 1  200  ? 451.887 22.768  707.523 1.00 84.08  ? 200  TRP B N     1 
ATOM   3309  C  CA    . TRP B 1  200  ? 450.487 23.199  707.602 1.00 95.18  ? 200  TRP B CA    1 
ATOM   3310  C  C     . TRP B 1  200  ? 449.994 23.143  709.050 1.00 100.28 ? 200  TRP B C     1 
ATOM   3311  O  O     . TRP B 1  200  ? 450.037 22.076  709.677 1.00 98.25  ? 200  TRP B O     1 
ATOM   3312  C  CB    . TRP B 1  200  ? 449.579 22.298  706.753 1.00 93.76  ? 200  TRP B CB    1 
ATOM   3313  C  CG    . TRP B 1  200  ? 449.646 22.374  705.260 1.00 96.25  ? 200  TRP B CG    1 
ATOM   3314  C  CD1   . TRP B 1  200  ? 448.837 23.106  704.431 1.00 97.24  ? 200  TRP B CD1   1 
ATOM   3315  C  CD2   . TRP B 1  200  ? 450.571 21.680  704.408 1.00 99.94  ? 200  TRP B CD2   1 
ATOM   3316  N  NE1   . TRP B 1  200  ? 449.204 22.900  703.118 1.00 95.84  ? 200  TRP B NE1   1 
ATOM   3317  C  CE2   . TRP B 1  200  ? 450.267 22.033  703.085 1.00 89.85  ? 200  TRP B CE2   1 
ATOM   3318  C  CE3   . TRP B 1  200  ? 451.634 20.793  704.643 1.00 96.96  ? 200  TRP B CE3   1 
ATOM   3319  C  CZ2   . TRP B 1  200  ? 450.967 21.526  702.017 1.00 85.67  ? 200  TRP B CZ2   1 
ATOM   3320  C  CZ3   . TRP B 1  200  ? 452.335 20.304  703.572 1.00 87.18  ? 200  TRP B CZ3   1 
ATOM   3321  C  CH2   . TRP B 1  200  ? 451.998 20.666  702.281 1.00 88.24  ? 200  TRP B CH2   1 
ATOM   3322  N  N     . THR B 1  201  ? 449.540 24.275  709.599 1.00 95.30  ? 201  THR B N     1 
ATOM   3323  C  CA    . THR B 1  201  ? 448.968 24.210  710.937 1.00 93.29  ? 201  THR B CA    1 
ATOM   3324  C  C     . THR B 1  201  ? 447.475 24.562  710.895 1.00 101.22 ? 201  THR B C     1 
ATOM   3325  O  O     . THR B 1  201  ? 446.921 24.878  709.830 1.00 104.45 ? 201  THR B O     1 
ATOM   3326  C  CB    . THR B 1  201  ? 449.739 25.116  711.900 1.00 93.26  ? 201  THR B CB    1 
ATOM   3327  O  OG1   . THR B 1  201  ? 449.342 26.473  711.699 1.00 97.46  ? 201  THR B OG1   1 
ATOM   3328  C  CG2   . THR B 1  201  ? 451.266 24.980  711.701 1.00 86.69  ? 201  THR B CG2   1 
ATOM   3329  N  N     . ASP B 1  202  ? 446.821 24.496  712.075 1.00 95.84  ? 202  ASP B N     1 
ATOM   3330  C  CA    . ASP B 1  202  ? 445.397 24.804  712.225 1.00 97.90  ? 202  ASP B CA    1 
ATOM   3331  C  C     . ASP B 1  202  ? 445.159 26.260  712.616 1.00 95.85  ? 202  ASP B C     1 
ATOM   3332  O  O     . ASP B 1  202  ? 444.001 26.664  712.776 1.00 91.05  ? 202  ASP B O     1 
ATOM   3333  C  CB    . ASP B 1  202  ? 444.699 23.866  713.257 1.00 100.71 ? 202  ASP B CB    1 
ATOM   3334  C  CG    . ASP B 1  202  ? 445.329 23.898  714.694 1.00 102.40 ? 202  ASP B CG    1 
ATOM   3335  O  OD1   . ASP B 1  202  ? 445.979 24.891  715.082 1.00 100.64 ? 202  ASP B OD1   1 
ATOM   3336  O  OD2   . ASP B 1  202  ? 445.154 22.915  715.461 1.00 100.76 ? 202  ASP B OD2   1 
ATOM   3337  N  N     . GLY B 1  203  ? 446.222 27.067  712.707 1.00 93.70  ? 203  GLY B N     1 
ATOM   3338  C  CA    . GLY B 1  203  ? 446.126 28.477  713.002 1.00 95.39  ? 203  GLY B CA    1 
ATOM   3339  C  C     . GLY B 1  203  ? 446.456 28.842  714.436 1.00 99.81  ? 203  GLY B C     1 
ATOM   3340  O  O     . GLY B 1  203  ? 446.746 30.017  714.705 1.00 97.75  ? 203  GLY B O     1 
ATOM   3341  N  N     . SER B 1  204  ? 446.372 27.881  715.370 1.00 101.61 ? 204  SER B N     1 
ATOM   3342  C  CA    . SER B 1  204  ? 446.741 28.149  716.761 1.00 98.84  ? 204  SER B CA    1 
ATOM   3343  C  C     . SER B 1  204  ? 448.246 28.397  716.893 1.00 96.08  ? 204  SER B C     1 
ATOM   3344  O  O     . SER B 1  204  ? 448.678 29.453  717.372 1.00 98.67  ? 204  SER B O     1 
ATOM   3345  C  CB    . SER B 1  204  ? 446.317 26.977  717.655 1.00 95.64  ? 204  SER B CB    1 
ATOM   3346  O  OG    . SER B 1  204  ? 446.962 25.771  717.278 1.00 88.78  ? 204  SER B OG    1 
ATOM   3347  N  N     . VAL B 1  205  ? 449.067 27.451  716.439 1.00 92.85  ? 205  VAL B N     1 
ATOM   3348  C  CA    . VAL B 1  205  ? 450.499 27.687  716.313 1.00 91.20  ? 205  VAL B CA    1 
ATOM   3349  C  C     . VAL B 1  205  ? 450.748 28.040  714.851 1.00 95.08  ? 205  VAL B C     1 
ATOM   3350  O  O     . VAL B 1  205  ? 450.118 27.474  713.947 1.00 92.04  ? 205  VAL B O     1 
ATOM   3351  C  CB    . VAL B 1  205  ? 451.340 26.474  716.757 1.00 84.27  ? 205  VAL B CB    1 
ATOM   3352  C  CG1   . VAL B 1  205  ? 452.825 26.824  716.709 1.00 82.22  ? 205  VAL B CG1   1 
ATOM   3353  C  CG2   . VAL B 1  205  ? 450.928 25.987  718.117 1.00 92.49  ? 205  VAL B CG2   1 
ATOM   3354  N  N     . THR B 1  206  ? 451.561 29.043  714.624 1.00 96.52  ? 206  THR B N     1 
ATOM   3355  C  CA    . THR B 1  206  ? 451.937 29.478  713.289 1.00 90.76  ? 206  THR B CA    1 
ATOM   3356  C  C     . THR B 1  206  ? 453.019 28.567  712.686 1.00 94.55  ? 206  THR B C     1 
ATOM   3357  O  O     . THR B 1  206  ? 453.813 27.969  713.425 1.00 91.46  ? 206  THR B O     1 
ATOM   3358  C  CB    . THR B 1  206  ? 452.363 30.945  713.332 1.00 94.15  ? 206  THR B CB    1 
ATOM   3359  O  OG1   . THR B 1  206  ? 451.496 31.682  712.462 1.00 95.72  ? 206  THR B OG1   1 
ATOM   3360  C  CG2   . THR B 1  206  ? 453.828 31.165  712.948 1.00 96.34  ? 206  THR B CG2   1 
ATOM   3361  N  N     . PRO B 1  207  ? 453.035 28.400  711.344 1.00 98.59  ? 207  PRO B N     1 
ATOM   3362  C  CA    . PRO B 1  207  ? 454.023 27.486  710.745 1.00 88.86  ? 207  PRO B CA    1 
ATOM   3363  C  C     . PRO B 1  207  ? 455.463 27.815  711.111 1.00 90.00  ? 207  PRO B C     1 
ATOM   3364  O  O     . PRO B 1  207  ? 456.206 26.915  711.534 1.00 89.48  ? 207  PRO B O     1 
ATOM   3365  C  CB    . PRO B 1  207  ? 453.762 27.657  709.244 1.00 89.62  ? 207  PRO B CB    1 
ATOM   3366  C  CG    . PRO B 1  207  ? 452.359 28.055  709.138 1.00 86.62  ? 207  PRO B CG    1 
ATOM   3367  C  CD    . PRO B 1  207  ? 452.139 28.956  710.307 1.00 97.65  ? 207  PRO B CD    1 
ATOM   3368  N  N     . LEU B 1  208  ? 455.869 29.089  711.021 1.00 88.27  ? 208  LEU B N     1 
ATOM   3369  C  CA    . LEU B 1  208  ? 457.222 29.446  711.444 1.00 85.89  ? 208  LEU B CA    1 
ATOM   3370  C  C     . LEU B 1  208  ? 457.429 29.148  712.927 1.00 93.02  ? 208  LEU B C     1 
ATOM   3371  O  O     . LEU B 1  208  ? 458.480 28.620  713.321 1.00 91.00  ? 208  LEU B O     1 
ATOM   3372  C  CB    . LEU B 1  208  ? 457.521 30.905  711.085 1.00 76.04  ? 208  LEU B CB    1 
ATOM   3373  C  CG    . LEU B 1  208  ? 458.873 31.466  711.538 1.00 78.05  ? 208  LEU B CG    1 
ATOM   3374  C  CD1   . LEU B 1  208  ? 460.025 30.528  711.261 1.00 79.72  ? 208  LEU B CD1   1 
ATOM   3375  C  CD2   . LEU B 1  208  ? 459.121 32.809  710.813 1.00 85.22  ? 208  LEU B CD2   1 
ATOM   3376  N  N     . GLU B 1  209  ? 456.415 29.430  713.755 1.00 91.60  ? 209  GLU B N     1 
ATOM   3377  C  CA    . GLU B 1  209  ? 456.507 29.115  715.176 1.00 91.50  ? 209  GLU B CA    1 
ATOM   3378  C  C     . GLU B 1  209  ? 456.732 27.623  715.355 1.00 92.12  ? 209  GLU B C     1 
ATOM   3379  O  O     . GLU B 1  209  ? 457.630 27.203  716.096 1.00 91.54  ? 209  GLU B O     1 
ATOM   3380  C  CB    . GLU B 1  209  ? 455.243 29.548  715.931 1.00 91.90  ? 209  GLU B CB    1 
ATOM   3381  C  CG    . GLU B 1  209  ? 455.104 31.048  716.213 1.00 93.94  ? 209  GLU B CG    1 
ATOM   3382  C  CD    . GLU B 1  209  ? 453.689 31.410  716.678 1.00 98.46  ? 209  GLU B CD    1 
ATOM   3383  O  OE1   . GLU B 1  209  ? 453.362 32.613  716.719 1.00 100.32 ? 209  GLU B OE1   1 
ATOM   3384  O  OE2   . GLU B 1  209  ? 452.932 30.495  717.093 1.00 95.88  ? 209  GLU B OE2   1 
ATOM   3385  N  N     . ALA B 1  210  ? 455.909 26.810  714.674 1.00 87.34  ? 210  ALA B N     1 
ATOM   3386  C  CA    . ALA B 1  210  ? 456.011 25.357  714.761 1.00 79.49  ? 210  ALA B CA    1 
ATOM   3387  C  C     . ALA B 1  210  ? 457.415 24.851  714.468 1.00 87.60  ? 210  ALA B C     1 
ATOM   3388  O  O     . ALA B 1  210  ? 457.935 24.004  715.203 1.00 90.28  ? 210  ALA B O     1 
ATOM   3389  C  CB    . ALA B 1  210  ? 455.009 24.714  713.808 1.00 73.84  ? 210  ALA B CB    1 
ATOM   3390  N  N     . LEU B 1  211  ? 458.036 25.329  713.382 1.00 87.45  ? 211  LEU B N     1 
ATOM   3391  C  CA    . LEU B 1  211  ? 459.404 24.906  713.074 1.00 87.53  ? 211  LEU B CA    1 
ATOM   3392  C  C     . LEU B 1  211  ? 460.379 25.237  714.210 1.00 91.29  ? 211  LEU B C     1 
ATOM   3393  O  O     . LEU B 1  211  ? 461.085 24.355  714.725 1.00 87.57  ? 211  LEU B O     1 
ATOM   3394  C  CB    . LEU B 1  211  ? 459.869 25.525  711.746 1.00 83.79  ? 211  LEU B CB    1 
ATOM   3395  C  CG    . LEU B 1  211  ? 461.327 25.297  711.286 1.00 77.17  ? 211  LEU B CG    1 
ATOM   3396  C  CD1   . LEU B 1  211  ? 461.663 23.824  711.172 1.00 71.64  ? 211  LEU B CD1   1 
ATOM   3397  C  CD2   . LEU B 1  211  ? 461.650 26.052  709.970 1.00 79.38  ? 211  LEU B CD2   1 
ATOM   3398  N  N     . ASN B 1  212  ? 460.404 26.503  714.636 1.00 91.36  ? 212  ASN B N     1 
ATOM   3399  C  CA    . ASN B 1  212  ? 461.323 26.913  715.690 1.00 91.64  ? 212  ASN B CA    1 
ATOM   3400  C  C     . ASN B 1  212  ? 461.185 26.064  716.942 1.00 91.33  ? 212  ASN B C     1 
ATOM   3401  O  O     . ASN B 1  212  ? 462.194 25.703  717.559 1.00 93.63  ? 212  ASN B O     1 
ATOM   3402  C  CB    . ASN B 1  212  ? 461.153 28.406  715.956 1.00 90.60  ? 212  ASN B CB    1 
ATOM   3403  C  CG    . ASN B 1  212  ? 461.694 29.243  714.798 1.00 99.39  ? 212  ASN B CG    1 
ATOM   3404  O  OD1   . ASN B 1  212  ? 460.991 30.077  714.220 1.00 96.86  ? 212  ASN B OD1   1 
ATOM   3405  N  ND2   . ASN B 1  212  ? 462.968 29.012  714.452 1.00 101.24 ? 212  ASN B ND2   1 
ATOM   3406  N  N     . GLN B 1  213  ? 459.956 25.708  717.325 1.00 90.55  ? 213  GLN B N     1 
ATOM   3407  C  CA    . GLN B 1  213  ? 459.803 24.835  718.490 1.00 94.81  ? 213  GLN B CA    1 
ATOM   3408  C  C     . GLN B 1  213  ? 460.477 23.486  718.225 1.00 89.04  ? 213  GLN B C     1 
ATOM   3409  O  O     . GLN B 1  213  ? 461.221 22.964  719.074 1.00 83.91  ? 213  GLN B O     1 
ATOM   3410  C  CB    . GLN B 1  213  ? 458.308 24.660  718.842 1.00 92.89  ? 213  GLN B CB    1 
ATOM   3411  C  CG    . GLN B 1  213  ? 457.584 25.938  719.412 1.00 91.09  ? 213  GLN B CG    1 
ATOM   3412  C  CD    . GLN B 1  213  ? 456.105 25.715  719.816 1.00 82.35  ? 213  GLN B CD    1 
ATOM   3413  O  OE1   . GLN B 1  213  ? 455.732 24.646  720.295 1.00 79.85  ? 213  GLN B OE1   1 
ATOM   3414  N  NE2   . GLN B 1  213  ? 455.265 26.721  719.579 1.00 78.44  ? 213  GLN B NE2   1 
ATOM   3415  N  N     . ALA B 1  214  ? 460.296 22.964  717.008 1.00 85.56  ? 214  ALA B N     1 
ATOM   3416  C  CA    . ALA B 1  214  ? 460.873 21.683  716.611 1.00 85.87  ? 214  ALA B CA    1 
ATOM   3417  C  C     . ALA B 1  214  ? 462.401 21.732  716.634 1.00 87.48  ? 214  ALA B C     1 
ATOM   3418  O  O     . ALA B 1  214  ? 463.061 20.788  717.100 1.00 82.77  ? 214  ALA B O     1 
ATOM   3419  C  CB    . ALA B 1  214  ? 460.338 21.280  715.233 1.00 80.86  ? 214  ALA B CB    1 
ATOM   3420  N  N     . VAL B 1  215  ? 462.980 22.782  716.042 1.00 83.46  ? 215  VAL B N     1 
ATOM   3421  C  CA    . VAL B 1  215  ? 464.431 22.958  716.059 1.00 83.43  ? 215  VAL B CA    1 
ATOM   3422  C  C     . VAL B 1  215  ? 464.958 23.053  717.495 1.00 88.82  ? 215  VAL B C     1 
ATOM   3423  O  O     . VAL B 1  215  ? 465.988 22.449  717.845 1.00 81.79  ? 215  VAL B O     1 
ATOM   3424  C  CB    . VAL B 1  215  ? 464.793 24.213  715.233 1.00 89.47  ? 215  VAL B CB    1 
ATOM   3425  C  CG1   . VAL B 1  215  ? 466.286 24.569  715.354 1.00 90.09  ? 215  VAL B CG1   1 
ATOM   3426  C  CG2   . VAL B 1  215  ? 464.372 24.044  713.761 1.00 89.79  ? 215  VAL B CG2   1 
ATOM   3427  N  N     . GLU B 1  216  ? 464.236 23.788  718.355 1.00 95.20  ? 216  GLU B N     1 
ATOM   3428  C  CA    . GLU B 1  216  ? 464.614 23.945  719.761 1.00 89.55  ? 216  GLU B CA    1 
ATOM   3429  C  C     . GLU B 1  216  ? 464.648 22.593  720.485 1.00 85.15  ? 216  GLU B C     1 
ATOM   3430  O  O     . GLU B 1  216  ? 465.650 22.244  721.124 1.00 86.61  ? 216  GLU B O     1 
ATOM   3431  C  CB    . GLU B 1  216  ? 463.631 24.909  720.444 1.00 91.29  ? 216  GLU B CB    1 
ATOM   3432  C  CG    . GLU B 1  216  ? 463.752 25.115  721.986 1.00 95.61  ? 216  GLU B CG    1 
ATOM   3433  C  CD    . GLU B 1  216  ? 465.115 25.678  722.450 1.00 98.44  ? 216  GLU B CD    1 
ATOM   3434  O  OE1   . GLU B 1  216  ? 466.125 24.942  722.463 1.00 98.61  ? 216  GLU B OE1   1 
ATOM   3435  O  OE2   . GLU B 1  216  ? 465.147 26.855  722.899 1.00 97.51  ? 216  GLU B OE2   1 
ATOM   3436  N  N     . ILE B 1  217  ? 463.572 21.797  720.354 1.00 76.49  ? 217  ILE B N     1 
ATOM   3437  C  CA    . ILE B 1  217  ? 463.521 20.457  720.952 1.00 76.22  ? 217  ILE B CA    1 
ATOM   3438  C  C     . ILE B 1  217  ? 464.766 19.640  720.611 1.00 84.89  ? 217  ILE B C     1 
ATOM   3439  O  O     . ILE B 1  217  ? 465.357 18.980  721.483 1.00 78.36  ? 217  ILE B O     1 
ATOM   3440  C  CB    . ILE B 1  217  ? 462.254 19.712  720.493 1.00 67.40  ? 217  ILE B CB    1 
ATOM   3441  C  CG1   . ILE B 1  217  ? 460.992 20.381  721.021 1.00 65.12  ? 217  ILE B CG1   1 
ATOM   3442  C  CG2   . ILE B 1  217  ? 462.314 18.211  720.891 1.00 60.02  ? 217  ILE B CG2   1 
ATOM   3443  C  CD1   . ILE B 1  217  ? 459.695 19.679  720.572 1.00 68.04  ? 217  ILE B CD1   1 
ATOM   3444  N  N     . LEU B 1  218  ? 465.172 19.663  719.328 1.00 85.24  ? 218  LEU B N     1 
ATOM   3445  C  CA    . LEU B 1  218  ? 466.308 18.854  718.874 1.00 87.72  ? 218  LEU B CA    1 
ATOM   3446  C  C     . LEU B 1  218  ? 467.613 19.294  719.539 1.00 92.44  ? 218  LEU B C     1 
ATOM   3447  O  O     . LEU B 1  218  ? 468.410 18.449  719.989 1.00 90.14  ? 218  LEU B O     1 
ATOM   3448  C  CB    . LEU B 1  218  ? 466.420 18.898  717.339 1.00 88.98  ? 218  LEU B CB    1 
ATOM   3449  C  CG    . LEU B 1  218  ? 467.374 17.953  716.558 1.00 81.59  ? 218  LEU B CG    1 
ATOM   3450  C  CD1   . LEU B 1  218  ? 467.123 16.460  716.807 1.00 77.35  ? 218  LEU B CD1   1 
ATOM   3451  C  CD2   . LEU B 1  218  ? 467.286 18.218  715.083 1.00 73.96  ? 218  LEU B CD2   1 
ATOM   3452  N  N     . ARG B 1  219  ? 467.837 20.610  719.636 1.00 89.46  ? 219  ARG B N     1 
ATOM   3453  C  CA    . ARG B 1  219  ? 469.044 21.086  720.301 1.00 91.28  ? 219  ARG B CA    1 
ATOM   3454  C  C     . ARG B 1  219  ? 469.127 20.550  721.722 1.00 96.05  ? 219  ARG B C     1 
ATOM   3455  O  O     . ARG B 1  219  ? 470.170 20.016  722.135 1.00 93.28  ? 219  ARG B O     1 
ATOM   3456  C  CB    . ARG B 1  219  ? 469.064 22.610  720.322 1.00 87.61  ? 219  ARG B CB    1 
ATOM   3457  C  CG    . ARG B 1  219  ? 470.335 23.145  720.937 1.00 92.70  ? 219  ARG B CG    1 
ATOM   3458  C  CD    . ARG B 1  219  ? 470.127 24.576  721.385 1.00 96.04  ? 219  ARG B CD    1 
ATOM   3459  N  NE    . ARG B 1  219  ? 468.941 24.729  722.231 1.00 90.97  ? 219  ARG B NE    1 
ATOM   3460  C  CZ    . ARG B 1  219  ? 468.884 24.439  723.529 1.00 92.89  ? 219  ARG B CZ    1 
ATOM   3461  N  NH1   . ARG B 1  219  ? 469.953 23.970  724.171 1.00 97.59  ? 219  ARG B NH1   1 
ATOM   3462  N  NH2   . ARG B 1  219  ? 467.747 24.625  724.189 1.00 87.35  ? 219  ARG B NH2   1 
ATOM   3463  N  N     . GLU B 1  220  ? 468.016 20.672  722.471 1.00 93.10  ? 220  GLU B N     1 
ATOM   3464  C  CA    . GLU B 1  220  ? 467.920 20.167  723.838 1.00 90.82  ? 220  GLU B CA    1 
ATOM   3465  C  C     . GLU B 1  220  ? 468.291 18.688  723.913 1.00 94.98  ? 220  GLU B C     1 
ATOM   3466  O  O     . GLU B 1  220  ? 469.025 18.253  724.816 1.00 93.03  ? 220  GLU B O     1 
ATOM   3467  C  CB    . GLU B 1  220  ? 466.496 20.373  724.377 1.00 95.18  ? 220  GLU B CB    1 
ATOM   3468  C  CG    . GLU B 1  220  ? 466.330 19.922  725.868 1.00 105.65 ? 220  GLU B CG    1 
ATOM   3469  C  CD    . GLU B 1  220  ? 464.936 20.172  726.485 1.00 105.04 ? 220  GLU B CD    1 
ATOM   3470  O  OE1   . GLU B 1  220  ? 464.048 20.765  725.815 1.00 97.75  ? 220  GLU B OE1   1 
ATOM   3471  O  OE2   . GLU B 1  220  ? 464.751 19.781  727.668 1.00 106.70 ? 220  GLU B OE2   1 
ATOM   3472  N  N     . HIS B 1  221  ? 467.740 17.891  722.994 1.00 89.54  ? 221  HIS B N     1 
ATOM   3473  C  CA    . HIS B 1  221  ? 468.054 16.470  722.964 1.00 88.35  ? 221  HIS B CA    1 
ATOM   3474  C  C     . HIS B 1  221  ? 469.536 16.207  722.730 1.00 93.07  ? 221  HIS B C     1 
ATOM   3475  O  O     . HIS B 1  221  ? 470.060 15.173  723.176 1.00 91.20  ? 221  HIS B O     1 
ATOM   3476  C  CB    . HIS B 1  221  ? 467.251 15.804  721.872 1.00 89.86  ? 221  HIS B CB    1 
ATOM   3477  C  CG    . HIS B 1  221  ? 465.940 15.272  722.333 1.00 87.85  ? 221  HIS B CG    1 
ATOM   3478  N  ND1   . HIS B 1  221  ? 465.783 13.980  722.786 1.00 87.24  ? 221  HIS B ND1   1 
ATOM   3479  C  CD2   . HIS B 1  221  ? 464.709 15.836  722.344 1.00 81.45  ? 221  HIS B CD2   1 
ATOM   3480  C  CE1   . HIS B 1  221  ? 464.514 13.782  723.094 1.00 88.93  ? 221  HIS B CE1   1 
ATOM   3481  N  NE2   . HIS B 1  221  ? 463.842 14.891  722.832 1.00 86.05  ? 221  HIS B NE2   1 
ATOM   3482  N  N     . LEU B 1  222  ? 470.225 17.120  722.025 1.00 90.18  ? 222  LEU B N     1 
ATOM   3483  C  CA    . LEU B 1  222  ? 471.659 16.955  721.810 1.00 92.31  ? 222  LEU B CA    1 
ATOM   3484  C  C     . LEU B 1  222  ? 472.454 17.142  723.101 1.00 94.89  ? 222  LEU B C     1 
ATOM   3485  O  O     . LEU B 1  222  ? 473.542 16.561  723.251 1.00 95.94  ? 222  LEU B O     1 
ATOM   3486  C  CB    . LEU B 1  222  ? 472.129 17.932  720.738 1.00 95.39  ? 222  LEU B CB    1 
ATOM   3487  C  CG    . LEU B 1  222  ? 471.594 17.524  719.368 1.00 90.00  ? 222  LEU B CG    1 
ATOM   3488  C  CD1   . LEU B 1  222  ? 472.187 18.414  718.332 1.00 85.21  ? 222  LEU B CD1   1 
ATOM   3489  C  CD2   . LEU B 1  222  ? 471.912 16.063  719.075 1.00 88.08  ? 222  LEU B CD2   1 
ATOM   3490  N  N     . THR B 1  223  ? 471.948 17.969  724.024 1.00 95.77  ? 223  THR B N     1 
ATOM   3491  C  CA    . THR B 1  223  ? 472.585 18.151  725.323 1.00 88.62  ? 223  THR B CA    1 
ATOM   3492  C  C     . THR B 1  223  ? 472.568 16.894  726.186 1.00 85.25  ? 223  THR B C     1 
ATOM   3493  O  O     . THR B 1  223  ? 473.354 16.816  727.135 1.00 87.14  ? 223  THR B O     1 
ATOM   3494  C  CB    . THR B 1  223  ? 471.907 19.287  726.064 1.00 83.83  ? 223  THR B CB    1 
ATOM   3495  O  OG1   . THR B 1  223  ? 470.560 18.892  726.337 1.00 85.41  ? 223  THR B OG1   1 
ATOM   3496  C  CG2   . THR B 1  223  ? 471.938 20.580  725.240 1.00 88.03  ? 223  THR B CG2   1 
ATOM   3497  N  N     . TYR B 1  224  ? 471.729 15.895  725.868 1.00 83.43  ? 224  TYR B N     1 
ATOM   3498  C  CA    . TYR B 1  224  ? 471.626 14.701  726.713 1.00 85.96  ? 224  TYR B CA    1 
ATOM   3499  C  C     . TYR B 1  224  ? 472.868 13.851  726.656 1.00 85.74  ? 224  TYR B C     1 
ATOM   3500  O  O     . TYR B 1  224  ? 472.942 12.814  727.331 1.00 74.92  ? 224  TYR B O     1 
ATOM   3501  C  CB    . TYR B 1  224  ? 470.401 13.863  726.346 1.00 82.22  ? 224  TYR B CB    1 
ATOM   3502  C  CG    . TYR B 1  224  ? 469.111 14.595  726.638 1.00 93.13  ? 224  TYR B CG    1 
ATOM   3503  C  CD1   . TYR B 1  224  ? 469.091 15.683  727.510 1.00 93.70  ? 224  TYR B CD1   1 
ATOM   3504  C  CD2   . TYR B 1  224  ? 467.919 14.239  726.020 1.00 99.27  ? 224  TYR B CD2   1 
ATOM   3505  C  CE1   . TYR B 1  224  ? 467.915 16.383  727.774 1.00 94.19  ? 224  TYR B CE1   1 
ATOM   3506  C  CE2   . TYR B 1  224  ? 466.725 14.937  726.284 1.00 93.56  ? 224  TYR B CE2   1 
ATOM   3507  C  CZ    . TYR B 1  224  ? 466.739 16.004  727.157 1.00 92.19  ? 224  TYR B CZ    1 
ATOM   3508  O  OH    . TYR B 1  224  ? 465.579 16.691  727.415 1.00 94.36  ? 224  TYR B OH    1 
ATOM   3509  N  N     . PHE B 1  225  ? 473.826 14.275  725.839 1.00 93.94  ? 225  PHE B N     1 
ATOM   3510  C  CA    . PHE B 1  225  ? 475.124 13.628  725.707 1.00 95.93  ? 225  PHE B CA    1 
ATOM   3511  C  C     . PHE B 1  225  ? 476.188 14.267  726.620 1.00 101.36 ? 225  PHE B C     1 
ATOM   3512  O  O     . PHE B 1  225  ? 477.293 14.604  726.180 1.00 99.06  ? 225  PHE B O     1 
ATOM   3513  C  CB    . PHE B 1  225  ? 475.490 13.675  724.224 1.00 89.10  ? 225  PHE B CB    1 
ATOM   3514  C  CG    . PHE B 1  225  ? 474.561 12.820  723.352 1.00 87.25  ? 225  PHE B CG    1 
ATOM   3515  C  CD1   . PHE B 1  225  ? 474.659 11.428  723.334 1.00 79.44  ? 225  PHE B CD1   1 
ATOM   3516  C  CD2   . PHE B 1  225  ? 473.495 13.410  722.658 1.00 88.15  ? 225  PHE B CD2   1 
ATOM   3517  C  CE1   . PHE B 1  225  ? 473.774 10.653  722.562 1.00 73.08  ? 225  PHE B CE1   1 
ATOM   3518  C  CE2   . PHE B 1  225  ? 472.595 12.633  721.891 1.00 81.45  ? 225  PHE B CE2   1 
ATOM   3519  C  CZ    . PHE B 1  225  ? 472.734 11.258  721.855 1.00 72.05  ? 225  PHE B CZ    1 
ATOM   3520  N  N     . SER B 1  226  ? 475.843 14.416  727.926 1.00 104.33 ? 226  SER B N     1 
ATOM   3521  C  CA    . SER B 1  226  ? 476.660 15.082  728.959 1.00 108.18 ? 226  SER B CA    1 
ATOM   3522  C  C     . SER B 1  226  ? 477.119 14.115  730.066 1.00 106.75 ? 226  SER B C     1 
ATOM   3523  O  O     . SER B 1  226  ? 478.028 13.306  729.853 1.00 109.90 ? 226  SER B O     1 
ATOM   3524  C  CB    . SER B 1  226  ? 475.914 16.268  729.586 1.00 107.92 ? 226  SER B CB    1 
ATOM   3525  O  OG    . SER B 1  226  ? 474.658 15.879  730.118 1.00 113.20 ? 226  SER B OG    1 
ATOM   3526  N  N     . ASN B 1  227  ? 476.541 14.225  731.275 1.00 107.16 ? 227  ASN B N     1 
ATOM   3527  C  CA    . ASN B 1  227  ? 477.060 13.514  732.444 1.00 110.09 ? 227  ASN B CA    1 
ATOM   3528  C  C     . ASN B 1  227  ? 476.953 12.025  732.111 1.00 107.40 ? 227  ASN B C     1 
ATOM   3529  O  O     . ASN B 1  227  ? 475.839 11.511  731.931 1.00 104.65 ? 227  ASN B O     1 
ATOM   3530  C  CB    . ASN B 1  227  ? 476.270 13.890  733.711 1.00 110.05 ? 227  ASN B CB    1 
ATOM   3531  C  CG    . ASN B 1  227  ? 476.681 13.068  734.946 1.00 116.64 ? 227  ASN B CG    1 
ATOM   3532  O  OD1   . ASN B 1  227  ? 476.463 11.850  735.010 1.00 117.91 ? 227  ASN B OD1   1 
ATOM   3533  N  ND2   . ASN B 1  227  ? 477.255 13.742  735.940 1.00 120.14 ? 227  ASN B ND2   1 
ATOM   3534  N  N     . PRO B 1  228  ? 478.084 11.309  731.956 1.00 108.44 ? 228  PRO B N     1 
ATOM   3535  C  CA    . PRO B 1  228  ? 478.016 9.851   731.733 1.00 104.93 ? 228  PRO B CA    1 
ATOM   3536  C  C     . PRO B 1  228  ? 477.808 8.907   732.927 1.00 98.65  ? 228  PRO B C     1 
ATOM   3537  O  O     . PRO B 1  228  ? 477.328 9.289   734.003 1.00 90.84  ? 228  PRO B O     1 
ATOM   3538  C  CB    . PRO B 1  228  ? 479.351 9.578   731.021 1.00 103.60 ? 228  PRO B CB    1 
ATOM   3539  C  CG    . PRO B 1  228  ? 480.309 10.570  731.640 1.00 108.31 ? 228  PRO B CG    1 
ATOM   3540  C  CD    . PRO B 1  228  ? 479.477 11.795  732.035 1.00 110.13 ? 228  PRO B CD    1 
ATOM   3541  N  N     . GLN B 1  229  ? 478.144 7.632   732.663 1.00 99.42  ? 229  GLN B N     1 
ATOM   3542  C  CA    . GLN B 1  229  ? 478.173 6.474   733.585 1.00 101.95 ? 229  GLN B CA    1 
ATOM   3543  C  C     . GLN B 1  229  ? 478.684 5.231   732.798 1.00 88.57  ? 229  GLN B C     1 
ATOM   3544  O  O     . GLN B 1  229  ? 479.510 4.422   733.256 1.00 73.13  ? 229  GLN B O     1 
ATOM   3545  C  CB    . GLN B 1  229  ? 476.766 6.215   734.189 1.00 101.39 ? 229  GLN B CB    1 
ATOM   3546  C  CG    . GLN B 1  229  ? 476.585 5.012   735.185 1.00 103.26 ? 229  GLN B CG    1 
ATOM   3547  C  CD    . GLN B 1  229  ? 477.394 5.093   736.495 1.00 111.38 ? 229  GLN B CD    1 
ATOM   3548  O  OE1   . GLN B 1  229  ? 477.481 6.157   737.116 1.00 117.18 ? 229  GLN B OE1   1 
ATOM   3549  N  NE2   . GLN B 1  229  ? 477.942 3.948   736.942 1.00 101.86 ? 229  GLN B NE2   1 
ATOM   3550  N  N     . MET C 2  1    ? 488.985 -19.615 703.300 1.00 107.99 ? 1    MET C N     1 
ATOM   3551  C  CA    . MET C 2  1    ? 487.741 -20.251 703.737 1.00 106.81 ? 1    MET C CA    1 
ATOM   3552  C  C     . MET C 2  1    ? 487.491 -21.672 703.157 1.00 110.68 ? 1    MET C C     1 
ATOM   3553  O  O     . MET C 2  1    ? 488.082 -22.087 702.138 1.00 112.34 ? 1    MET C O     1 
ATOM   3554  C  CB    . MET C 2  1    ? 486.540 -19.342 703.399 1.00 104.21 ? 1    MET C CB    1 
ATOM   3555  C  CG    . MET C 2  1    ? 486.043 -19.359 701.928 1.00 108.33 ? 1    MET C CG    1 
ATOM   3556  S  SD    . MET C 2  1    ? 487.110 -18.649 700.624 1.00 127.99 ? 1    MET C SD    1 
ATOM   3557  C  CE    . MET C 2  1    ? 487.358 -16.983 701.271 1.00 110.35 ? 1    MET C CE    1 
ATOM   3558  N  N     . GLU C 2  2    ? 486.595 -22.392 703.834 1.00 105.61 ? 2    GLU C N     1 
ATOM   3559  C  CA    . GLU C 2  2    ? 486.196 -23.745 703.460 1.00 104.03 ? 2    GLU C CA    1 
ATOM   3560  C  C     . GLU C 2  2    ? 485.402 -23.693 702.147 1.00 100.96 ? 2    GLU C C     1 
ATOM   3561  O  O     . GLU C 2  2    ? 484.756 -22.690 701.824 1.00 98.40  ? 2    GLU C O     1 
ATOM   3562  C  CB    . GLU C 2  2    ? 485.401 -24.416 704.601 1.00 102.31 ? 2    GLU C CB    1 
ATOM   3563  C  CG    . GLU C 2  2    ? 485.101 -25.926 704.390 1.00 106.33 ? 2    GLU C CG    1 
ATOM   3564  C  CD    . GLU C 2  2    ? 484.117 -26.528 705.408 1.00 109.92 ? 2    GLU C CD    1 
ATOM   3565  O  OE1   . GLU C 2  2    ? 483.832 -25.866 706.438 1.00 105.32 ? 2    GLU C OE1   1 
ATOM   3566  O  OE2   . GLU C 2  2    ? 483.626 -27.664 705.159 1.00 109.97 ? 2    GLU C OE2   1 
ATOM   3567  N  N     . ILE C 2  3    ? 485.515 -24.755 701.351 1.00 100.66 ? 3    ILE C N     1 
ATOM   3568  C  CA    . ILE C 2  3    ? 484.769 -24.897 700.101 1.00 97.07  ? 3    ILE C CA    1 
ATOM   3569  C  C     . ILE C 2  3    ? 483.952 -26.176 700.199 1.00 96.19  ? 3    ILE C C     1 
ATOM   3570  O  O     . ILE C 2  3    ? 484.506 -27.283 700.182 1.00 104.51 ? 3    ILE C O     1 
ATOM   3571  C  CB    . ILE C 2  3    ? 485.700 -24.946 698.870 1.00 99.49  ? 3    ILE C CB    1 
ATOM   3572  C  CG1   . ILE C 2  3    ? 486.689 -23.772 698.852 1.00 101.36 ? 3    ILE C CG1   1 
ATOM   3573  C  CG2   . ILE C 2  3    ? 484.914 -24.998 697.574 1.00 91.69  ? 3    ILE C CG2   1 
ATOM   3574  C  CD1   . ILE C 2  3    ? 486.083 -22.440 698.423 1.00 95.09  ? 3    ILE C CD1   1 
ATOM   3575  N  N     . LYS C 2  4    ? 482.628 -26.025 700.230 1.00 93.64  ? 4    LYS C N     1 
ATOM   3576  C  CA    . LYS C 2  4    ? 481.689 -27.135 700.389 1.00 99.99  ? 4    LYS C CA    1 
ATOM   3577  C  C     . LYS C 2  4    ? 481.124 -27.499 699.026 1.00 94.49  ? 4    LYS C C     1 
ATOM   3578  O  O     . LYS C 2  4    ? 480.592 -26.645 698.309 1.00 92.81  ? 4    LYS C O     1 
ATOM   3579  C  CB    . LYS C 2  4    ? 480.531 -26.832 701.349 1.00 90.96  ? 4    LYS C CB    1 
ATOM   3580  C  CG    . LYS C 2  4    ? 479.663 -28.092 701.552 1.00 90.33  ? 4    LYS C CG    1 
ATOM   3581  C  CD    . LYS C 2  4    ? 478.570 -27.986 702.608 1.00 102.30 ? 4    LYS C CD    1 
ATOM   3582  C  CE    . LYS C 2  4    ? 477.893 -29.363 702.855 1.00 102.91 ? 4    LYS C CE    1 
ATOM   3583  N  NZ    . LYS C 2  4    ? 478.610 -30.545 702.254 1.00 101.44 ? 4    LYS C NZ    1 
ATOM   3584  N  N     . ARG C 2  5    ? 481.332 -28.736 698.628 1.00 87.07  ? 5    ARG C N     1 
ATOM   3585  C  CA    . ARG C 2  5    ? 480.854 -29.181 697.342 1.00 89.85  ? 5    ARG C CA    1 
ATOM   3586  C  C     . ARG C 2  5    ? 479.643 -30.098 697.461 1.00 87.99  ? 5    ARG C C     1 
ATOM   3587  O  O     . ARG C 2  5    ? 479.615 -31.004 698.294 1.00 99.57  ? 5    ARG C O     1 
ATOM   3588  C  CB    . ARG C 2  5    ? 482.028 -29.834 696.621 1.00 100.38 ? 5    ARG C CB    1 
ATOM   3589  C  CG    . ARG C 2  5    ? 482.661 -31.045 697.292 1.00 103.41 ? 5    ARG C CG    1 
ATOM   3590  C  CD    . ARG C 2  5    ? 483.769 -31.474 696.357 1.00 103.65 ? 5    ARG C CD    1 
ATOM   3591  N  NE    . ARG C 2  5    ? 483.278 -31.615 694.986 1.00 103.32 ? 5    ARG C NE    1 
ATOM   3592  C  CZ    . ARG C 2  5    ? 483.889 -31.080 693.933 1.00 103.08 ? 5    ARG C CZ    1 
ATOM   3593  N  NH1   . ARG C 2  5    ? 485.005 -30.375 694.124 1.00 103.25 ? 5    ARG C NH1   1 
ATOM   3594  N  NH2   . ARG C 2  5    ? 483.397 -31.250 692.704 1.00 94.58  ? 5    ARG C NH2   1 
ATOM   3595  N  N     . PHE C 2  6    ? 478.645 -29.842 696.640 1.00 82.42  ? 6    PHE C N     1 
ATOM   3596  C  CA    . PHE C 2  6    ? 477.434 -30.627 696.576 1.00 84.25  ? 6    PHE C CA    1 
ATOM   3597  C  C     . PHE C 2  6    ? 477.568 -31.587 695.402 1.00 95.98  ? 6    PHE C C     1 
ATOM   3598  O  O     . PHE C 2  6    ? 478.573 -31.608 694.685 1.00 96.80  ? 6    PHE C O     1 
ATOM   3599  C  CB    . PHE C 2  6    ? 476.189 -29.751 696.417 1.00 87.80  ? 6    PHE C CB    1 
ATOM   3600  C  CG    . PHE C 2  6    ? 476.006 -28.741 697.499 1.00 90.78  ? 6    PHE C CG    1 
ATOM   3601  C  CD1   . PHE C 2  6    ? 476.498 -27.455 697.365 1.00 88.61  ? 6    PHE C CD1   1 
ATOM   3602  C  CD2   . PHE C 2  6    ? 475.279 -29.061 698.638 1.00 97.58  ? 6    PHE C CD2   1 
ATOM   3603  C  CE1   . PHE C 2  6    ? 476.309 -26.513 698.367 1.00 87.11  ? 6    PHE C CE1   1 
ATOM   3604  C  CE2   . PHE C 2  6    ? 475.094 -28.134 699.647 1.00 92.93  ? 6    PHE C CE2   1 
ATOM   3605  C  CZ    . PHE C 2  6    ? 475.614 -26.856 699.510 1.00 89.37  ? 6    PHE C CZ    1 
ATOM   3606  N  N     . GLY C 2  7    ? 476.542 -32.402 695.219 1.00 103.58 ? 7    GLY C N     1 
ATOM   3607  C  CA    . GLY C 2  7    ? 476.394 -33.242 694.049 1.00 97.38  ? 7    GLY C CA    1 
ATOM   3608  C  C     . GLY C 2  7    ? 476.927 -34.643 694.244 1.00 102.33 ? 7    GLY C C     1 
ATOM   3609  O  O     . GLY C 2  7    ? 478.015 -34.854 694.797 1.00 101.58 ? 7    GLY C O     1 
ATOM   3610  N  N     . ARG C 2  8    ? 476.182 -35.602 693.699 1.00 106.10 ? 8    ARG C N     1 
ATOM   3611  C  CA    . ARG C 2  8    ? 476.475 -37.021 693.817 1.00 110.41 ? 8    ARG C CA    1 
ATOM   3612  C  C     . ARG C 2  8    ? 477.121 -37.630 692.576 1.00 108.68 ? 8    ARG C C     1 
ATOM   3613  O  O     . ARG C 2  8    ? 477.561 -38.788 692.622 1.00 104.92 ? 8    ARG C O     1 
ATOM   3614  C  CB    . ARG C 2  8    ? 475.149 -37.737 694.104 1.00 109.67 ? 8    ARG C CB    1 
ATOM   3615  C  CG    . ARG C 2  8    ? 474.049 -36.738 694.530 1.00 110.26 ? 8    ARG C CG    1 
ATOM   3616  C  CD    . ARG C 2  8    ? 472.865 -37.399 695.224 1.00 117.13 ? 8    ARG C CD    1 
ATOM   3617  N  NE    . ARG C 2  8    ? 472.427 -38.581 694.485 1.00 126.47 ? 8    ARG C NE    1 
ATOM   3618  C  CZ    . ARG C 2  8    ? 472.613 -39.841 694.879 1.00 127.61 ? 8    ARG C CZ    1 
ATOM   3619  N  NH1   . ARG C 2  8    ? 473.230 -40.103 696.031 1.00 122.67 ? 8    ARG C NH1   1 
ATOM   3620  N  NH2   . ARG C 2  8    ? 472.180 -40.841 694.110 1.00 121.55 ? 8    ARG C NH2   1 
ATOM   3621  N  N     . ILE C 2  9    ? 477.239 -36.865 691.497 1.00 112.31 ? 9    ILE C N     1 
ATOM   3622  C  CA    . ILE C 2  9    ? 477.750 -37.388 690.234 1.00 111.81 ? 9    ILE C CA    1 
ATOM   3623  C  C     . ILE C 2  9    ? 479.265 -37.538 690.271 1.00 113.98 ? 9    ILE C C     1 
ATOM   3624  O  O     . ILE C 2  9    ? 479.995 -36.592 690.595 1.00 112.32 ? 9    ILE C O     1 
ATOM   3625  C  CB    . ILE C 2  9    ? 477.300 -36.540 689.034 1.00 104.67 ? 9    ILE C CB    1 
ATOM   3626  C  CG1   . ILE C 2  9    ? 475.799 -36.727 688.802 1.00 103.04 ? 9    ILE C CG1   1 
ATOM   3627  C  CG2   . ILE C 2  9    ? 478.008 -37.007 687.785 1.00 102.18 ? 9    ILE C CG2   1 
ATOM   3628  C  CD1   . ILE C 2  9    ? 475.280 -36.186 687.502 1.00 97.17  ? 9    ILE C CD1   1 
ATOM   3629  N  N     . ARG C 2  10   ? 479.727 -38.751 689.999 1.00 113.16 ? 10   ARG C N     1 
ATOM   3630  C  CA    . ARG C 2  10   ? 481.141 -39.071 689.922 1.00 111.34 ? 10   ARG C CA    1 
ATOM   3631  C  C     . ARG C 2  10   ? 481.428 -39.030 688.426 1.00 117.96 ? 10   ARG C C     1 
ATOM   3632  O  O     . ARG C 2  10   ? 480.836 -39.800 687.660 1.00 121.17 ? 10   ARG C O     1 
ATOM   3633  C  CB    . ARG C 2  10   ? 481.421 -40.454 690.510 1.00 111.30 ? 10   ARG C CB    1 
ATOM   3634  C  CG    . ARG C 2  10   ? 482.867 -40.766 690.893 1.00 115.55 ? 10   ARG C CG    1 
ATOM   3635  C  CD    . ARG C 2  10   ? 483.520 -41.696 689.855 1.00 119.88 ? 10   ARG C CD    1 
ATOM   3636  N  NE    . ARG C 2  10   ? 482.844 -42.999 689.727 1.00 127.08 ? 10   ARG C NE    1 
ATOM   3637  C  CZ    . ARG C 2  10   ? 483.283 -44.021 688.980 1.00 124.95 ? 10   ARG C CZ    1 
ATOM   3638  N  NH1   . ARG C 2  10   ? 482.589 -45.159 688.925 1.00 122.19 ? 10   ARG C NH1   1 
ATOM   3639  N  NH2   . ARG C 2  10   ? 484.422 -43.918 688.296 1.00 118.65 ? 10   ARG C NH2   1 
ATOM   3640  N  N     . GLU C 2  11   ? 482.278 -38.108 687.991 1.00 115.99 ? 11   GLU C N     1 
ATOM   3641  C  CA    . GLU C 2  11   ? 482.576 -37.991 686.568 1.00 101.61 ? 11   GLU C CA    1 
ATOM   3642  C  C     . GLU C 2  11   ? 483.767 -38.874 686.262 1.00 98.42  ? 11   GLU C C     1 
ATOM   3643  O  O     . GLU C 2  11   ? 484.894 -38.585 686.682 1.00 94.68  ? 11   GLU C O     1 
ATOM   3644  C  CB    . GLU C 2  11   ? 482.779 -36.527 686.214 1.00 99.39  ? 11   GLU C CB    1 
ATOM   3645  C  CG    . GLU C 2  11   ? 481.503 -35.808 686.581 1.00 104.95 ? 11   GLU C CG    1 
ATOM   3646  C  CD    . GLU C 2  11   ? 481.571 -34.310 686.534 1.00 113.04 ? 11   GLU C CD    1 
ATOM   3647  O  OE1   . GLU C 2  11   ? 482.659 -33.746 686.252 1.00 115.91 ? 11   GLU C OE1   1 
ATOM   3648  O  OE2   . GLU C 2  11   ? 480.498 -33.706 686.776 1.00 111.77 ? 11   GLU C OE2   1 
ATOM   3649  N  N     . VAL C 2  12   ? 483.513 -39.921 685.468 1.00 104.16 ? 12   VAL C N     1 
ATOM   3650  C  CA    . VAL C 2  12   ? 484.526 -40.933 685.198 1.00 104.99 ? 12   VAL C CA    1 
ATOM   3651  C  C     . VAL C 2  12   ? 485.702 -40.402 684.406 1.00 97.05  ? 12   VAL C C     1 
ATOM   3652  O  O     . VAL C 2  12   ? 486.767 -41.020 684.445 1.00 103.06 ? 12   VAL C O     1 
ATOM   3653  C  CB    . VAL C 2  12   ? 483.931 -42.128 684.434 1.00 103.85 ? 12   VAL C CB    1 
ATOM   3654  C  CG1   . VAL C 2  12   ? 482.961 -42.876 685.334 1.00 112.02 ? 12   VAL C CG1   1 
ATOM   3655  C  CG2   . VAL C 2  12   ? 483.314 -41.698 683.111 1.00 100.84 ? 12   VAL C CG2   1 
ATOM   3656  N  N     . ILE C 2  13   ? 485.539 -39.329 683.636 1.00 94.86  ? 13   ILE C N     1 
ATOM   3657  C  CA    . ILE C 2  13   ? 486.668 -38.793 682.876 1.00 95.85  ? 13   ILE C CA    1 
ATOM   3658  C  C     . ILE C 2  13   ? 486.687 -37.280 683.051 1.00 91.50  ? 13   ILE C C     1 
ATOM   3659  O  O     . ILE C 2  13   ? 485.625 -36.655 683.161 1.00 92.82  ? 13   ILE C O     1 
ATOM   3660  C  CB    . ILE C 2  13   ? 486.641 -39.189 681.383 1.00 97.52  ? 13   ILE C CB    1 
ATOM   3661  C  CG1   . ILE C 2  13   ? 485.328 -38.797 680.700 1.00 101.45 ? 13   ILE C CG1   1 
ATOM   3662  C  CG2   . ILE C 2  13   ? 486.974 -40.682 681.174 1.00 89.88  ? 13   ILE C CG2   1 
ATOM   3663  C  CD1   . ILE C 2  13   ? 485.385 -38.978 679.165 1.00 96.84  ? 13   ILE C CD1   1 
ATOM   3664  N  N     . PRO C 2  14   ? 487.855 -36.657 683.080 1.00 88.82  ? 14   PRO C N     1 
ATOM   3665  C  CA    . PRO C 2  14   ? 487.928 -35.196 683.101 1.00 93.76  ? 14   PRO C CA    1 
ATOM   3666  C  C     . PRO C 2  14   ? 487.651 -34.626 681.712 1.00 93.57  ? 14   PRO C C     1 
ATOM   3667  O  O     . PRO C 2  14   ? 487.535 -35.349 680.720 1.00 90.59  ? 14   PRO C O     1 
ATOM   3668  C  CB    . PRO C 2  14   ? 489.364 -34.916 683.559 1.00 89.93  ? 14   PRO C CB    1 
ATOM   3669  C  CG    . PRO C 2  14   ? 490.117 -36.056 683.028 1.00 90.18  ? 14   PRO C CG    1 
ATOM   3670  C  CD    . PRO C 2  14   ? 489.194 -37.262 683.135 1.00 90.83  ? 14   PRO C CD    1 
ATOM   3671  N  N     . LEU C 2  15   ? 487.392 -33.325 681.696 1.00 92.29  ? 15   LEU C N     1 
ATOM   3672  C  CA    . LEU C 2  15   ? 487.258 -32.572 680.459 1.00 87.49  ? 15   LEU C CA    1 
ATOM   3673  C  C     . LEU C 2  15   ? 488.524 -32.774 679.612 1.00 93.21  ? 15   LEU C C     1 
ATOM   3674  O  O     . LEU C 2  15   ? 489.629 -32.801 680.172 1.00 93.00  ? 15   LEU C O     1 
ATOM   3675  C  CB    . LEU C 2  15   ? 487.066 -31.100 680.847 1.00 87.95  ? 15   LEU C CB    1 
ATOM   3676  C  CG    . LEU C 2  15   ? 485.755 -30.322 680.712 1.00 84.15  ? 15   LEU C CG    1 
ATOM   3677  C  CD1   . LEU C 2  15   ? 484.590 -31.177 681.118 1.00 81.01  ? 15   LEU C CD1   1 
ATOM   3678  C  CD2   . LEU C 2  15   ? 485.810 -29.150 681.676 1.00 74.66  ? 15   LEU C CD2   1 
ATOM   3679  N  N     . PRO C 2  16   ? 488.415 -32.927 678.279 1.00 92.34  ? 16   PRO C N     1 
ATOM   3680  C  CA    . PRO C 2  16   ? 489.624 -33.098 677.409 1.00 84.26  ? 16   PRO C CA    1 
ATOM   3681  C  C     . PRO C 2  16   ? 490.461 -31.831 677.401 1.00 88.60  ? 16   PRO C C     1 
ATOM   3682  O  O     . PRO C 2  16   ? 489.993 -30.795 677.898 1.00 89.37  ? 16   PRO C O     1 
ATOM   3683  C  CB    . PRO C 2  16   ? 489.025 -33.371 676.025 1.00 86.29  ? 16   PRO C CB    1 
ATOM   3684  C  CG    . PRO C 2  16   ? 487.620 -33.783 676.279 1.00 85.83  ? 16   PRO C CG    1 
ATOM   3685  C  CD    . PRO C 2  16   ? 487.177 -33.020 677.488 1.00 87.82  ? 16   PRO C CD    1 
ATOM   3686  N  N     . PRO C 2  17   ? 491.699 -31.848 676.881 1.00 93.47  ? 17   PRO C N     1 
ATOM   3687  C  CA    . PRO C 2  17   ? 492.431 -30.563 676.762 1.00 87.60  ? 17   PRO C CA    1 
ATOM   3688  C  C     . PRO C 2  17   ? 491.599 -29.622 675.912 1.00 85.82  ? 17   PRO C C     1 
ATOM   3689  O  O     . PRO C 2  17   ? 491.271 -29.924 674.767 1.00 86.13  ? 17   PRO C O     1 
ATOM   3690  C  CB    . PRO C 2  17   ? 493.738 -30.951 676.073 1.00 87.36  ? 17   PRO C CB    1 
ATOM   3691  C  CG    . PRO C 2  17   ? 493.882 -32.448 676.330 1.00 93.90  ? 17   PRO C CG    1 
ATOM   3692  C  CD    . PRO C 2  17   ? 492.476 -32.990 676.362 1.00 92.61  ? 17   PRO C CD    1 
ATOM   3693  N  N     . LEU C 2  18   ? 491.295 -28.449 676.474 1.00 92.80  ? 18   LEU C N     1 
ATOM   3694  C  CA    . LEU C 2  18   ? 490.216 -27.636 675.903 1.00 89.32  ? 18   LEU C CA    1 
ATOM   3695  C  C     . LEU C 2  18   ? 490.602 -26.940 674.602 1.00 83.68  ? 18   LEU C C     1 
ATOM   3696  O  O     . LEU C 2  18   ? 489.730 -26.750 673.747 1.00 83.59  ? 18   LEU C O     1 
ATOM   3697  C  CB    . LEU C 2  18   ? 489.680 -26.647 676.951 1.00 83.73  ? 18   LEU C CB    1 
ATOM   3698  C  CG    . LEU C 2  18   ? 488.916 -27.356 678.090 1.00 81.19  ? 18   LEU C CG    1 
ATOM   3699  C  CD1   . LEU C 2  18   ? 488.395 -26.378 679.117 1.00 81.73  ? 18   LEU C CD1   1 
ATOM   3700  C  CD2   . LEU C 2  18   ? 487.780 -28.234 677.586 1.00 85.04  ? 18   LEU C CD2   1 
ATOM   3701  N  N     . THR C 2  19   ? 491.879 -26.580 674.416 1.00 81.32  ? 19   THR C N     1 
ATOM   3702  C  CA    . THR C 2  19   ? 492.331 -25.970 673.170 1.00 81.37  ? 19   THR C CA    1 
ATOM   3703  C  C     . THR C 2  19   ? 492.861 -27.004 672.193 1.00 77.40  ? 19   THR C C     1 
ATOM   3704  O  O     . THR C 2  19   ? 493.511 -26.625 671.226 1.00 80.91  ? 19   THR C O     1 
ATOM   3705  C  CB    . THR C 2  19   ? 493.421 -24.906 673.400 1.00 86.32  ? 19   THR C CB    1 
ATOM   3706  O  OG1   . THR C 2  19   ? 494.500 -25.445 674.173 1.00 99.81  ? 19   THR C OG1   1 
ATOM   3707  C  CG2   . THR C 2  19   ? 492.845 -23.726 674.189 1.00 78.93  ? 19   THR C CG2   1 
ATOM   3708  N  N     . GLU C 2  20   ? 492.704 -28.297 672.493 1.00 81.46  ? 20   GLU C N     1 
ATOM   3709  C  CA    . GLU C 2  20   ? 493.239 -29.357 671.639 1.00 83.07  ? 20   GLU C CA    1 
ATOM   3710  C  C     . GLU C 2  20   ? 492.704 -29.300 670.213 1.00 90.57  ? 20   GLU C C     1 
ATOM   3711  O  O     . GLU C 2  20   ? 493.401 -29.710 669.272 1.00 93.43  ? 20   GLU C O     1 
ATOM   3712  C  CB    . GLU C 2  20   ? 492.914 -30.734 672.221 1.00 85.35  ? 20   GLU C CB    1 
ATOM   3713  C  CG    . GLU C 2  20   ? 491.538 -31.250 671.767 1.00 88.23  ? 20   GLU C CG    1 
ATOM   3714  C  CD    . GLU C 2  20   ? 491.253 -32.696 672.164 1.00 97.28  ? 20   GLU C CD    1 
ATOM   3715  O  OE1   . GLU C 2  20   ? 492.190 -33.524 672.095 1.00 96.22  ? 20   GLU C OE1   1 
ATOM   3716  O  OE2   . GLU C 2  20   ? 490.079 -33.007 672.508 1.00 96.46  ? 20   GLU C OE2   1 
ATOM   3717  N  N     . ILE C 2  21   ? 491.488 -28.784 670.020 1.00 87.29  ? 21   ILE C N     1 
ATOM   3718  C  CA    . ILE C 2  21   ? 490.936 -28.693 668.668 1.00 82.91  ? 21   ILE C CA    1 
ATOM   3719  C  C     . ILE C 2  21   ? 491.834 -27.837 667.781 1.00 83.35  ? 21   ILE C C     1 
ATOM   3720  O  O     . ILE C 2  21   ? 491.932 -28.062 666.567 1.00 86.72  ? 21   ILE C O     1 
ATOM   3721  C  CB    . ILE C 2  21   ? 489.494 -28.156 668.713 1.00 79.40  ? 21   ILE C CB    1 
ATOM   3722  C  CG1   . ILE C 2  21   ? 488.849 -28.185 667.329 1.00 79.88  ? 21   ILE C CG1   1 
ATOM   3723  C  CG2   . ILE C 2  21   ? 489.495 -26.734 669.212 1.00 80.79  ? 21   ILE C CG2   1 
ATOM   3724  C  CD1   . ILE C 2  21   ? 487.432 -27.658 667.297 1.00 72.55  ? 21   ILE C CD1   1 
ATOM   3725  N  N     . GLN C 2  22   ? 492.517 -26.861 668.369 1.00 81.61  ? 22   GLN C N     1 
ATOM   3726  C  CA    . GLN C 2  22   ? 493.448 -26.013 667.640 1.00 82.49  ? 22   GLN C CA    1 
ATOM   3727  C  C     . GLN C 2  22   ? 494.825 -26.674 667.566 1.00 83.26  ? 22   GLN C C     1 
ATOM   3728  O  O     . GLN C 2  22   ? 495.367 -26.845 666.470 1.00 81.78  ? 22   GLN C O     1 
ATOM   3729  C  CB    . GLN C 2  22   ? 493.521 -24.638 668.314 1.00 80.78  ? 22   GLN C CB    1 
ATOM   3730  C  CG    . GLN C 2  22   ? 492.215 -23.823 668.166 1.00 77.31  ? 22   GLN C CG    1 
ATOM   3731  C  CD    . GLN C 2  22   ? 491.996 -23.160 666.833 1.00 81.05  ? 22   GLN C CD    1 
ATOM   3732  O  OE1   . GLN C 2  22   ? 492.901 -22.549 666.242 1.00 84.13  ? 22   GLN C OE1   1 
ATOM   3733  N  NE2   . GLN C 2  22   ? 490.764 -23.274 666.341 1.00 79.04  ? 22   GLN C NE2   1 
ATOM   3734  N  N     . VAL C 2  23   ? 495.452 -26.913 668.727 1.00 77.66  ? 23   VAL C N     1 
ATOM   3735  C  CA    . VAL C 2  23   ? 496.810 -27.465 668.778 1.00 83.46  ? 23   VAL C CA    1 
ATOM   3736  C  C     . VAL C 2  23   ? 496.939 -28.741 667.948 1.00 87.27  ? 23   VAL C C     1 
ATOM   3737  O  O     . VAL C 2  23   ? 497.834 -28.862 667.100 1.00 83.77  ? 23   VAL C O     1 
ATOM   3738  C  CB    . VAL C 2  23   ? 497.248 -27.705 670.234 1.00 86.27  ? 23   VAL C CB    1 
ATOM   3739  C  CG1   . VAL C 2  23   ? 498.515 -28.563 670.266 1.00 96.38  ? 23   VAL C CG1   1 
ATOM   3740  C  CG2   . VAL C 2  23   ? 497.531 -26.380 670.935 1.00 88.80  ? 23   VAL C CG2   1 
ATOM   3741  N  N     . GLU C 2  24   ? 496.058 -29.721 668.190 1.00 85.46  ? 24   GLU C N     1 
ATOM   3742  C  CA    . GLU C 2  24   ? 496.176 -31.006 667.491 1.00 88.80  ? 24   GLU C CA    1 
ATOM   3743  C  C     . GLU C 2  24   ? 495.941 -30.913 665.987 1.00 89.46  ? 24   GLU C C     1 
ATOM   3744  O  O     . GLU C 2  24   ? 496.579 -31.643 665.219 1.00 93.81  ? 24   GLU C O     1 
ATOM   3745  C  CB    . GLU C 2  24   ? 495.226 -32.039 668.095 1.00 87.36  ? 24   GLU C CB    1 
ATOM   3746  C  CG    . GLU C 2  24   ? 495.805 -32.700 669.297 1.00 89.74  ? 24   GLU C CG    1 
ATOM   3747  C  CD    . GLU C 2  24   ? 497.240 -33.127 669.005 1.00 103.66 ? 24   GLU C CD    1 
ATOM   3748  O  OE1   . GLU C 2  24   ? 498.165 -32.685 669.733 1.00 109.26 ? 24   GLU C OE1   1 
ATOM   3749  O  OE2   . GLU C 2  24   ? 497.447 -33.849 667.991 1.00 102.13 ? 24   GLU C OE2   1 
ATOM   3750  N  N     . SER C 2  25   ? 495.029 -30.049 665.545 1.00 87.70  ? 25   SER C N     1 
ATOM   3751  C  CA    . SER C 2  25   ? 494.768 -29.905 664.115 1.00 81.60  ? 25   SER C CA    1 
ATOM   3752  C  C     . SER C 2  25   ? 496.012 -29.424 663.353 1.00 83.67  ? 25   SER C C     1 
ATOM   3753  O  O     . SER C 2  25   ? 496.390 -30.010 662.335 1.00 85.09  ? 25   SER C O     1 
ATOM   3754  C  CB    . SER C 2  25   ? 493.574 -28.965 663.927 1.00 79.46  ? 25   SER C CB    1 
ATOM   3755  O  OG    . SER C 2  25   ? 493.457 -28.497 662.601 1.00 82.88  ? 25   SER C OG    1 
ATOM   3756  N  N     . TYR C 2  26   ? 496.645 -28.335 663.813 1.00 83.95  ? 26   TYR C N     1 
ATOM   3757  C  CA    . TYR C 2  26   ? 497.809 -27.779 663.114 1.00 80.62  ? 26   TYR C CA    1 
ATOM   3758  C  C     . TYR C 2  26   ? 499.059 -28.644 663.268 1.00 87.24  ? 26   TYR C C     1 
ATOM   3759  O  O     . TYR C 2  26   ? 499.847 -28.778 662.324 1.00 89.79  ? 26   TYR C O     1 
ATOM   3760  C  CB    . TYR C 2  26   ? 498.118 -26.393 663.662 1.00 78.82  ? 26   TYR C CB    1 
ATOM   3761  C  CG    . TYR C 2  26   ? 498.726 -25.380 662.727 1.00 76.09  ? 26   TYR C CG    1 
ATOM   3762  C  CD1   . TYR C 2  26   ? 498.068 -24.943 661.585 1.00 80.97  ? 26   TYR C CD1   1 
ATOM   3763  C  CD2   . TYR C 2  26   ? 499.988 -24.848 663.004 1.00 81.75  ? 26   TYR C CD2   1 
ATOM   3764  C  CE1   . TYR C 2  26   ? 498.654 -23.975 660.741 1.00 80.19  ? 26   TYR C CE1   1 
ATOM   3765  C  CE2   . TYR C 2  26   ? 500.581 -23.897 662.168 1.00 79.43  ? 26   TYR C CE2   1 
ATOM   3766  C  CZ    . TYR C 2  26   ? 499.906 -23.466 661.053 1.00 75.16  ? 26   TYR C CZ    1 
ATOM   3767  O  OH    . TYR C 2  26   ? 500.491 -22.531 660.257 1.00 73.98  ? 26   TYR C OH    1 
ATOM   3768  N  N     . ARG C 2  27   ? 499.285 -29.212 664.452 1.00 87.84  ? 27   ARG C N     1 
ATOM   3769  C  CA    . ARG C 2  27   ? 500.443 -30.082 664.620 1.00 88.54  ? 27   ARG C CA    1 
ATOM   3770  C  C     . ARG C 2  27   ? 500.368 -31.224 663.608 1.00 89.11  ? 27   ARG C C     1 
ATOM   3771  O  O     . ARG C 2  27   ? 501.386 -31.602 663.018 1.00 91.32  ? 27   ARG C O     1 
ATOM   3772  C  CB    . ARG C 2  27   ? 500.548 -30.535 666.073 1.00 99.21  ? 27   ARG C CB    1 
ATOM   3773  C  CG    . ARG C 2  27   ? 501.949 -30.931 666.537 1.00 100.43 ? 27   ARG C CG    1 
ATOM   3774  C  CD    . ARG C 2  27   ? 501.858 -31.635 667.889 1.00 104.01 ? 27   ARG C CD    1 
ATOM   3775  N  NE    . ARG C 2  27   ? 500.796 -32.630 667.793 1.00 109.51 ? 27   ARG C NE    1 
ATOM   3776  C  CZ    . ARG C 2  27   ? 500.906 -33.777 667.126 1.00 109.21 ? 27   ARG C CZ    1 
ATOM   3777  N  NH1   . ARG C 2  27   ? 502.036 -34.077 666.496 1.00 109.71 ? 27   ARG C NH1   1 
ATOM   3778  N  NH2   . ARG C 2  27   ? 499.881 -34.620 667.070 1.00 109.18 ? 27   ARG C NH2   1 
ATOM   3779  N  N     . ARG C 2  28   ? 499.165 -31.804 663.427 1.00 87.28  ? 28   ARG C N     1 
ATOM   3780  C  CA    . ARG C 2  28   ? 498.947 -32.865 662.436 1.00 87.73  ? 28   ARG C CA    1 
ATOM   3781  C  C     . ARG C 2  28   ? 499.210 -32.391 660.999 1.00 90.04  ? 28   ARG C C     1 
ATOM   3782  O  O     . ARG C 2  28   ? 499.673 -33.169 660.158 1.00 92.18  ? 28   ARG C O     1 
ATOM   3783  C  CB    . ARG C 2  28   ? 497.519 -33.427 662.541 1.00 87.70  ? 28   ARG C CB    1 
ATOM   3784  C  CG    . ARG C 2  28   ? 497.208 -34.424 661.391 1.00 101.01 ? 28   ARG C CG    1 
ATOM   3785  C  CD    . ARG C 2  28   ? 495.737 -34.897 661.206 1.00 104.69 ? 28   ARG C CD    1 
ATOM   3786  N  NE    . ARG C 2  28   ? 495.142 -35.508 662.388 1.00 116.72 ? 28   ARG C NE    1 
ATOM   3787  C  CZ    . ARG C 2  28   ? 495.137 -36.824 662.605 1.00 119.37 ? 28   ARG C CZ    1 
ATOM   3788  N  NH1   . ARG C 2  28   ? 495.691 -37.634 661.699 1.00 110.82 ? 28   ARG C NH1   1 
ATOM   3789  N  NH2   . ARG C 2  28   ? 494.582 -37.331 663.715 1.00 118.67 ? 28   ARG C NH2   1 
ATOM   3790  N  N     . ALA C 2  29   ? 498.875 -31.147 660.672 1.00 85.01  ? 29   ALA C N     1 
ATOM   3791  C  CA    . ALA C 2  29   ? 499.144 -30.662 659.318 1.00 84.10  ? 29   ALA C CA    1 
ATOM   3792  C  C     . ALA C 2  29   ? 500.642 -30.479 659.054 1.00 87.19  ? 29   ALA C C     1 
ATOM   3793  O  O     . ALA C 2  29   ? 501.136 -30.865 657.989 1.00 90.56  ? 29   ALA C O     1 
ATOM   3794  C  CB    . ALA C 2  29   ? 498.392 -29.365 659.045 1.00 89.27  ? 29   ALA C CB    1 
ATOM   3795  N  N     . LEU C 2  30   ? 501.388 -29.884 659.999 1.00 87.70  ? 30   LEU C N     1 
ATOM   3796  C  CA    . LEU C 2  30   ? 502.802 -29.603 659.738 1.00 86.40  ? 30   LEU C CA    1 
ATOM   3797  C  C     . LEU C 2  30   ? 503.701 -30.816 659.936 1.00 87.40  ? 30   LEU C C     1 
ATOM   3798  O  O     . LEU C 2  30   ? 504.608 -31.044 659.132 1.00 87.06  ? 30   LEU C O     1 
ATOM   3799  C  CB    . LEU C 2  30   ? 503.312 -28.495 660.662 1.00 80.87  ? 30   LEU C CB    1 
ATOM   3800  C  CG    . LEU C 2  30   ? 502.648 -27.134 660.596 1.00 75.69  ? 30   LEU C CG    1 
ATOM   3801  C  CD1   . LEU C 2  30   ? 503.449 -26.119 661.403 1.00 75.70  ? 30   LEU C CD1   1 
ATOM   3802  C  CD2   . LEU C 2  30   ? 502.484 -26.707 659.153 1.00 84.78  ? 30   LEU C CD2   1 
ATOM   3803  N  N     . GLN C 2  31   ? 503.403 -31.651 660.925 1.00 88.26  ? 31   GLN C N     1 
ATOM   3804  C  CA    . GLN C 2  31   ? 504.224 -32.804 661.275 1.00 86.26  ? 31   GLN C CA    1 
ATOM   3805  C  C     . GLN C 2  31   ? 505.698 -32.425 661.407 1.00 87.92  ? 31   GLN C C     1 
ATOM   3806  O  O     . GLN C 2  31   ? 506.585 -33.205 661.065 1.00 93.51  ? 31   GLN C O     1 
ATOM   3807  C  CB    . GLN C 2  31   ? 504.081 -33.897 660.219 1.00 83.94  ? 31   GLN C CB    1 
ATOM   3808  C  CG    . GLN C 2  31   ? 502.669 -34.160 659.803 1.00 86.82  ? 31   GLN C CG    1 
ATOM   3809  C  CD    . GLN C 2  31   ? 502.569 -35.198 658.714 1.00 97.43  ? 31   GLN C CD    1 
ATOM   3810  O  OE1   . GLN C 2  31   ? 502.916 -36.362 658.919 1.00 104.25 ? 31   GLN C OE1   1 
ATOM   3811  N  NE2   . GLN C 2  31   ? 502.199 -34.758 657.509 1.00 99.07  ? 31   GLN C NE2   1 
ATOM   3812  N  N     . ALA C 2  32   ? 505.971 -31.265 662.009 1.00 85.27  ? 32   ALA C N     1 
ATOM   3813  C  CA    . ALA C 2  32   ? 507.341 -30.755 662.050 1.00 81.55  ? 32   ALA C CA    1 
ATOM   3814  C  C     . ALA C 2  32   ? 508.221 -31.630 662.942 1.00 95.25  ? 32   ALA C C     1 
ATOM   3815  O  O     . ALA C 2  32   ? 509.438 -31.689 662.739 1.00 100.72 ? 32   ALA C O     1 
ATOM   3816  C  CB    . ALA C 2  32   ? 507.373 -29.298 662.504 1.00 80.78  ? 32   ALA C CB    1 
ATOM   3817  N  N     . ASP C 2  33   ? 507.661 -32.209 664.002 1.00 104.50 ? 33   ASP C N     1 
ATOM   3818  C  CA    . ASP C 2  33   ? 508.426 -33.040 664.926 1.00 106.44 ? 33   ASP C CA    1 
ATOM   3819  C  C     . ASP C 2  33   ? 508.540 -34.506 664.466 1.00 107.45 ? 33   ASP C C     1 
ATOM   3820  O  O     . ASP C 2  33   ? 509.128 -35.316 665.189 1.00 112.94 ? 33   ASP C O     1 
ATOM   3821  C  CB    . ASP C 2  33   ? 507.780 -32.997 666.332 1.00 107.04 ? 33   ASP C CB    1 
ATOM   3822  C  CG    . ASP C 2  33   ? 508.130 -31.716 667.121 1.00 115.38 ? 33   ASP C CG    1 
ATOM   3823  O  OD1   . ASP C 2  33   ? 508.434 -30.681 666.473 1.00 118.49 ? 33   ASP C OD1   1 
ATOM   3824  O  OD2   . ASP C 2  33   ? 508.110 -31.744 668.383 1.00 102.07 ? 33   ASP C OD2   1 
ATOM   3825  N  N     . VAL C 2  34   ? 507.957 -34.876 663.322 1.00 98.80  ? 34   VAL C N     1 
ATOM   3826  C  CA    . VAL C 2  34   ? 508.088 -36.199 662.690 1.00 99.51  ? 34   VAL C CA    1 
ATOM   3827  C  C     . VAL C 2  34   ? 509.210 -36.291 661.645 1.00 107.47 ? 34   VAL C C     1 
ATOM   3828  O  O     . VAL C 2  34   ? 509.290 -35.445 660.737 1.00 103.35 ? 34   VAL C O     1 
ATOM   3829  C  CB    . VAL C 2  34   ? 506.734 -36.638 662.112 1.00 92.96  ? 34   VAL C CB    1 
ATOM   3830  C  CG1   . VAL C 2  34   ? 506.862 -37.952 661.386 1.00 101.70 ? 34   VAL C CG1   1 
ATOM   3831  C  CG2   . VAL C 2  34   ? 505.749 -36.786 663.232 1.00 95.48  ? 34   VAL C CG2   1 
ATOM   3832  N  N     . PRO C 2  35   ? 510.051 -37.331 661.688 1.00 110.44 ? 35   PRO C N     1 
ATOM   3833  C  CA    . PRO C 2  35   ? 511.076 -37.538 660.634 1.00 103.44 ? 35   PRO C CA    1 
ATOM   3834  C  C     . PRO C 2  35   ? 510.455 -37.819 659.277 1.00 107.25 ? 35   PRO C C     1 
ATOM   3835  O  O     . PRO C 2  35   ? 509.564 -38.678 659.165 1.00 103.49 ? 35   PRO C O     1 
ATOM   3836  C  CB    . PRO C 2  35   ? 511.857 -38.765 661.135 1.00 101.57 ? 35   PRO C CB    1 
ATOM   3837  C  CG    . PRO C 2  35   ? 510.953 -39.420 662.114 1.00 107.57 ? 35   PRO C CG    1 
ATOM   3838  C  CD    . PRO C 2  35   ? 510.170 -38.332 662.761 1.00 111.43 ? 35   PRO C CD    1 
ATOM   3839  N  N     . PRO C 2  36   ? 510.937 -37.122 658.220 1.00 106.62 ? 36   PRO C N     1 
ATOM   3840  C  CA    . PRO C 2  36   ? 510.262 -37.145 656.910 1.00 103.44 ? 36   PRO C CA    1 
ATOM   3841  C  C     . PRO C 2  36   ? 509.839 -38.509 656.403 1.00 112.41 ? 36   PRO C C     1 
ATOM   3842  O  O     . PRO C 2  36   ? 508.737 -38.621 655.850 1.00 113.85 ? 36   PRO C O     1 
ATOM   3843  C  CB    . PRO C 2  36   ? 511.323 -36.537 655.990 1.00 101.42 ? 36   PRO C CB    1 
ATOM   3844  C  CG    . PRO C 2  36   ? 512.008 -35.546 656.829 1.00 98.07  ? 36   PRO C CG    1 
ATOM   3845  C  CD    . PRO C 2  36   ? 511.990 -36.089 658.251 1.00 104.82 ? 36   PRO C CD    1 
ATOM   3846  N  N     . GLU C 2  37   ? 510.673 -39.549 656.566 1.00 118.95 ? 37   GLU C N     1 
ATOM   3847  C  CA    . GLU C 2  37   ? 510.317 -40.864 656.030 1.00 122.19 ? 37   GLU C CA    1 
ATOM   3848  C  C     . GLU C 2  37   ? 509.117 -41.477 656.747 1.00 121.20 ? 37   GLU C C     1 
ATOM   3849  O  O     . GLU C 2  37   ? 508.416 -42.307 656.155 1.00 124.50 ? 37   GLU C O     1 
ATOM   3850  C  CB    . GLU C 2  37   ? 511.484 -41.865 656.106 1.00 121.37 ? 37   GLU C CB    1 
ATOM   3851  C  CG    . GLU C 2  37   ? 512.041 -42.171 657.501 1.00 117.33 ? 37   GLU C CG    1 
ATOM   3852  C  CD    . GLU C 2  37   ? 513.090 -41.185 658.011 1.00 120.46 ? 37   GLU C CD    1 
ATOM   3853  O  OE1   . GLU C 2  37   ? 513.597 -40.341 657.208 1.00 114.77 ? 37   GLU C OE1   1 
ATOM   3854  O  OE2   . GLU C 2  37   ? 513.386 -41.269 659.238 1.00 111.89 ? 37   GLU C OE2   1 
ATOM   3855  N  N     . LYS C 2  38   ? 508.853 -41.072 657.990 1.00 114.96 ? 38   LYS C N     1 
ATOM   3856  C  CA    . LYS C 2  38   ? 507.779 -41.642 658.790 1.00 115.75 ? 38   LYS C CA    1 
ATOM   3857  C  C     . LYS C 2  38   ? 506.481 -40.836 658.703 1.00 121.23 ? 38   LYS C C     1 
ATOM   3858  O  O     . LYS C 2  38   ? 505.512 -41.169 659.401 1.00 120.69 ? 38   LYS C O     1 
ATOM   3859  C  CB    . LYS C 2  38   ? 508.244 -41.780 660.252 1.00 108.37 ? 38   LYS C CB    1 
ATOM   3860  C  CG    . LYS C 2  38   ? 509.124 -43.017 660.543 1.00 107.66 ? 38   LYS C CG    1 
ATOM   3861  C  CD    . LYS C 2  38   ? 510.126 -42.761 661.667 1.00 98.14  ? 38   LYS C CD    1 
ATOM   3862  C  CE    . LYS C 2  38   ? 509.461 -42.594 663.011 1.00 101.19 ? 38   LYS C CE    1 
ATOM   3863  N  NZ    . LYS C 2  38   ? 510.446 -42.254 664.077 1.00 98.04  ? 38   LYS C NZ    1 
ATOM   3864  N  N     . ARG C 2  39   ? 506.423 -39.808 657.848 1.00 118.60 ? 39   ARG C N     1 
ATOM   3865  C  CA    . ARG C 2  39   ? 505.210 -39.005 657.769 1.00 113.76 ? 39   ARG C CA    1 
ATOM   3866  C  C     . ARG C 2  39   ? 504.101 -39.786 657.075 1.00 117.25 ? 39   ARG C C     1 
ATOM   3867  O  O     . ARG C 2  39   ? 504.338 -40.442 656.058 1.00 123.57 ? 39   ARG C O     1 
ATOM   3868  C  CB    . ARG C 2  39   ? 505.477 -37.689 657.012 1.00 102.12 ? 39   ARG C CB    1 
ATOM   3869  C  CG    . ARG C 2  39   ? 506.381 -36.695 657.775 1.00 101.74 ? 39   ARG C CG    1 
ATOM   3870  C  CD    . ARG C 2  39   ? 506.305 -35.233 657.260 1.00 98.99  ? 39   ARG C CD    1 
ATOM   3871  N  NE    . ARG C 2  39   ? 507.138 -34.291 658.035 1.00 93.51  ? 39   ARG C NE    1 
ATOM   3872  C  CZ    . ARG C 2  39   ? 508.253 -33.696 657.606 1.00 95.56  ? 39   ARG C CZ    1 
ATOM   3873  N  NH1   . ARG C 2  39   ? 508.708 -33.918 656.372 1.00 104.09 ? 39   ARG C NH1   1 
ATOM   3874  N  NH2   . ARG C 2  39   ? 508.915 -32.871 658.411 1.00 87.04  ? 39   ARG C NH2   1 
ATOM   3875  N  N     . GLU C 2  40   ? 502.885 -39.706 657.621 1.00 115.92 ? 40   GLU C N     1 
ATOM   3876  C  CA    . GLU C 2  40   ? 501.696 -40.208 656.939 1.00 119.61 ? 40   GLU C CA    1 
ATOM   3877  C  C     . GLU C 2  40   ? 501.265 -39.193 655.877 1.00 115.55 ? 40   GLU C C     1 
ATOM   3878  O  O     . GLU C 2  40   ? 501.677 -38.027 655.895 1.00 113.29 ? 40   GLU C O     1 
ATOM   3879  C  CB    . GLU C 2  40   ? 500.532 -40.513 657.899 1.00 122.61 ? 40   GLU C CB    1 
ATOM   3880  C  CG    . GLU C 2  40   ? 500.743 -41.625 658.958 1.00 133.17 ? 40   GLU C CG    1 
ATOM   3881  C  CD    . GLU C 2  40   ? 501.489 -41.202 660.225 1.00 131.87 ? 40   GLU C CD    1 
ATOM   3882  O  OE1   . GLU C 2  40   ? 501.275 -40.064 660.697 1.00 126.00 ? 40   GLU C OE1   1 
ATOM   3883  O  OE2   . GLU C 2  40   ? 502.256 -42.032 660.776 1.00 134.57 ? 40   GLU C OE2   1 
ATOM   3884  N  N     . ASN C 2  41   ? 500.463 -39.651 654.916 1.00 113.22 ? 41   ASN C N     1 
ATOM   3885  C  CA    . ASN C 2  41   ? 500.048 -38.783 653.806 1.00 114.21 ? 41   ASN C CA    1 
ATOM   3886  C  C     . ASN C 2  41   ? 498.788 -38.003 654.201 1.00 116.88 ? 41   ASN C C     1 
ATOM   3887  O  O     . ASN C 2  41   ? 497.656 -38.425 653.939 1.00 120.09 ? 41   ASN C O     1 
ATOM   3888  C  CB    . ASN C 2  41   ? 499.844 -39.640 652.551 1.00 128.84 ? 41   ASN C CB    1 
ATOM   3889  C  CG    . ASN C 2  41   ? 499.458 -38.832 651.304 1.00 122.76 ? 41   ASN C CG    1 
ATOM   3890  O  OD1   . ASN C 2  41   ? 499.584 -37.623 651.280 1.00 110.36 ? 41   ASN C OD1   1 
ATOM   3891  N  ND2   . ASN C 2  41   ? 499.040 -39.530 650.240 1.00 127.37 ? 41   ASN C ND2   1 
ATOM   3892  N  N     . VAL C 2  42   ? 499.005 -36.798 654.743 1.00 112.13 ? 42   VAL C N     1 
ATOM   3893  C  CA    . VAL C 2  42   ? 497.951 -35.948 655.311 1.00 101.66 ? 42   VAL C CA    1 
ATOM   3894  C  C     . VAL C 2  42   ? 498.536 -34.550 655.407 1.00 95.61  ? 42   VAL C C     1 
ATOM   3895  O  O     . VAL C 2  42   ? 499.754 -34.377 655.497 1.00 96.53  ? 42   VAL C O     1 
ATOM   3896  C  CB    . VAL C 2  42   ? 497.435 -36.393 656.707 1.00 94.30  ? 42   VAL C CB    1 
ATOM   3897  C  CG1   . VAL C 2  42   ? 496.746 -37.765 656.696 1.00 98.10  ? 42   VAL C CG1   1 
ATOM   3898  C  CG2   . VAL C 2  42   ? 498.565 -36.349 657.706 1.00 95.13  ? 42   VAL C CG2   1 
ATOM   3899  N  N     . GLY C 2  43   ? 497.659 -33.556 655.502 1.00 92.40  ? 43   GLY C N     1 
ATOM   3900  C  CA    . GLY C 2  43   ? 498.077 -32.169 655.665 1.00 94.44  ? 43   GLY C CA    1 
ATOM   3901  C  C     . GLY C 2  43   ? 499.070 -31.709 654.610 1.00 98.13  ? 43   GLY C C     1 
ATOM   3902  O  O     . GLY C 2  43   ? 498.886 -31.962 653.412 1.00 102.44 ? 43   GLY C O     1 
ATOM   3903  N  N     . ILE C 2  44   ? 500.075 -30.931 655.043 1.00 95.20  ? 44   ILE C N     1 
ATOM   3904  C  CA    . ILE C 2  44   ? 501.126 -30.453 654.134 1.00 93.93  ? 44   ILE C CA    1 
ATOM   3905  C  C     . ILE C 2  44   ? 501.712 -31.583 653.313 1.00 98.80  ? 44   ILE C C     1 
ATOM   3906  O  O     . ILE C 2  44   ? 501.896 -31.452 652.096 1.00 103.44 ? 44   ILE C O     1 
ATOM   3907  C  CB    . ILE C 2  44   ? 502.221 -29.683 654.894 1.00 94.98  ? 44   ILE C CB    1 
ATOM   3908  C  CG1   . ILE C 2  44   ? 501.675 -28.342 655.352 1.00 99.12  ? 44   ILE C CG1   1 
ATOM   3909  C  CG2   . ILE C 2  44   ? 503.414 -29.450 654.029 1.00 91.35  ? 44   ILE C CG2   1 
ATOM   3910  C  CD1   . ILE C 2  44   ? 500.800 -27.715 654.289 1.00 93.06  ? 44   ILE C CD1   1 
ATOM   3911  N  N     . GLN C 2  45   ? 502.056 -32.694 653.964 1.00 97.41  ? 45   GLN C N     1 
ATOM   3912  C  CA    . GLN C 2  45   ? 502.610 -33.810 653.206 1.00 99.83  ? 45   GLN C CA    1 
ATOM   3913  C  C     . GLN C 2  45   ? 501.697 -34.202 652.050 1.00 103.03 ? 45   GLN C C     1 
ATOM   3914  O  O     . GLN C 2  45   ? 502.136 -34.269 650.897 1.00 107.00 ? 45   GLN C O     1 
ATOM   3915  C  CB    . GLN C 2  45   ? 502.888 -35.011 654.107 1.00 105.15 ? 45   GLN C CB    1 
ATOM   3916  C  CG    . GLN C 2  45   ? 504.380 -35.187 654.363 1.00 105.90 ? 45   GLN C CG    1 
ATOM   3917  C  CD    . GLN C 2  45   ? 505.152 -35.530 653.089 1.00 104.63 ? 45   GLN C CD    1 
ATOM   3918  O  OE1   . GLN C 2  45   ? 504.821 -36.488 652.392 1.00 103.47 ? 45   GLN C OE1   1 
ATOM   3919  N  NE2   . GLN C 2  45   ? 506.203 -34.757 652.799 1.00 101.39 ? 45   GLN C NE2   1 
ATOM   3920  N  N     . ALA C 2  46   ? 500.402 -34.375 652.327 1.00 102.92 ? 46   ALA C N     1 
ATOM   3921  C  CA    . ALA C 2  46   ? 499.459 -34.779 651.287 1.00 100.48 ? 46   ALA C CA    1 
ATOM   3922  C  C     . ALA C 2  46   ? 499.367 -33.778 650.148 1.00 95.29  ? 46   ALA C C     1 
ATOM   3923  O  O     . ALA C 2  46   ? 499.101 -34.179 649.016 1.00 97.25  ? 46   ALA C O     1 
ATOM   3924  C  CB    . ALA C 2  46   ? 498.071 -35.009 651.884 1.00 104.26 ? 46   ALA C CB    1 
ATOM   3925  N  N     . ALA C 2  47   ? 499.493 -32.481 650.432 1.00 97.22  ? 47   ALA C N     1 
ATOM   3926  C  CA    . ALA C 2  47   ? 499.457 -31.468 649.374 1.00 101.78 ? 47   ALA C CA    1 
ATOM   3927  C  C     . ALA C 2  47   ? 500.602 -31.639 648.380 1.00 104.81 ? 47   ALA C C     1 
ATOM   3928  O  O     . ALA C 2  47   ? 500.405 -31.522 647.162 1.00 103.68 ? 47   ALA C O     1 
ATOM   3929  C  CB    . ALA C 2  47   ? 499.487 -30.061 649.976 1.00 98.93  ? 47   ALA C CB    1 
ATOM   3930  N  N     . PHE C 2  48   ? 501.825 -31.837 648.888 1.00 106.30 ? 48   PHE C N     1 
ATOM   3931  C  CA    . PHE C 2  48   ? 502.983 -32.039 648.012 1.00 105.07 ? 48   PHE C CA    1 
ATOM   3932  C  C     . PHE C 2  48   ? 502.796 -33.280 647.129 1.00 103.12 ? 48   PHE C C     1 
ATOM   3933  O  O     . PHE C 2  48   ? 502.939 -33.223 645.904 1.00 101.53 ? 48   PHE C O     1 
ATOM   3934  C  CB    . PHE C 2  48   ? 504.250 -32.192 648.862 1.00 100.97 ? 48   PHE C CB    1 
ATOM   3935  C  CG    . PHE C 2  48   ? 504.881 -30.884 649.293 1.00 100.95 ? 48   PHE C CG    1 
ATOM   3936  C  CD1   . PHE C 2  48   ? 505.594 -30.086 648.395 1.00 99.79  ? 48   PHE C CD1   1 
ATOM   3937  C  CD2   . PHE C 2  48   ? 504.865 -30.522 650.643 1.00 95.49  ? 48   PHE C CD2   1 
ATOM   3938  C  CE1   . PHE C 2  48   ? 506.192 -28.889 648.823 1.00 97.06  ? 48   PHE C CE1   1 
ATOM   3939  C  CE2   . PHE C 2  48   ? 505.475 -29.350 651.085 1.00 92.14  ? 48   PHE C CE2   1 
ATOM   3940  C  CZ    . PHE C 2  48   ? 506.137 -28.530 650.175 1.00 98.44  ? 48   PHE C CZ    1 
ATOM   3941  N  N     . ARG C 2  49   ? 502.419 -34.399 647.753 1.00 102.81 ? 49   ARG C N     1 
ATOM   3942  C  CA    . ARG C 2  49   ? 502.205 -35.685 647.093 1.00 103.95 ? 49   ARG C CA    1 
ATOM   3943  C  C     . ARG C 2  49   ? 501.131 -35.600 646.010 1.00 102.73 ? 49   ARG C C     1 
ATOM   3944  O  O     . ARG C 2  49   ? 501.168 -36.350 645.026 1.00 111.59 ? 49   ARG C O     1 
ATOM   3945  C  CB    . ARG C 2  49   ? 501.817 -36.668 648.204 1.00 107.35 ? 49   ARG C CB    1 
ATOM   3946  C  CG    . ARG C 2  49   ? 502.972 -36.893 649.218 1.00 112.04 ? 49   ARG C CG    1 
ATOM   3947  C  CD    . ARG C 2  49   ? 504.092 -37.849 648.832 1.00 121.83 ? 49   ARG C CD    1 
ATOM   3948  N  NE    . ARG C 2  49   ? 503.546 -39.209 648.879 1.00 135.85 ? 49   ARG C NE    1 
ATOM   3949  C  CZ    . ARG C 2  49   ? 503.129 -39.937 647.851 1.00 148.44 ? 49   ARG C CZ    1 
ATOM   3950  N  NH1   . ARG C 2  49   ? 503.193 -39.466 646.615 1.00 149.99 ? 49   ARG C NH1   1 
ATOM   3951  N  NH2   . ARG C 2  49   ? 502.645 -41.159 648.082 1.00 155.00 ? 49   ARG C NH2   1 
ATOM   3952  N  N     . GLU C 2  50   ? 500.146 -34.721 646.195 1.00 100.02 ? 50   GLU C N     1 
ATOM   3953  C  CA    . GLU C 2  50   ? 499.072 -34.494 645.226 1.00 100.29 ? 50   GLU C CA    1 
ATOM   3954  C  C     . GLU C 2  50   ? 499.539 -33.655 644.029 1.00 101.73 ? 50   GLU C C     1 
ATOM   3955  O  O     . GLU C 2  50   ? 499.147 -33.936 642.894 1.00 104.51 ? 50   GLU C O     1 
ATOM   3956  C  CB    . GLU C 2  50   ? 497.883 -33.887 645.982 1.00 113.10 ? 50   GLU C CB    1 
ATOM   3957  C  CG    . GLU C 2  50   ? 496.495 -34.493 645.652 1.00 120.21 ? 50   GLU C CG    1 
ATOM   3958  C  CD    . GLU C 2  50   ? 495.422 -34.142 646.712 1.00 116.07 ? 50   GLU C CD    1 
ATOM   3959  O  OE1   . GLU C 2  50   ? 495.518 -34.653 647.859 1.00 108.70 ? 50   GLU C OE1   1 
ATOM   3960  O  OE2   . GLU C 2  50   ? 494.477 -33.369 646.395 1.00 117.37 ? 50   GLU C OE2   1 
ATOM   3961  N  N     . THR C 2  51   ? 500.282 -32.560 644.270 1.00 102.28 ? 51   THR C N     1 
ATOM   3962  C  CA    . THR C 2  51   ? 500.712 -31.674 643.174 1.00 104.99 ? 51   THR C CA    1 
ATOM   3963  C  C     . THR C 2  51   ? 501.824 -32.289 642.304 1.00 107.95 ? 51   THR C C     1 
ATOM   3964  O  O     . THR C 2  51   ? 501.874 -32.022 641.091 1.00 109.95 ? 51   THR C O     1 
ATOM   3965  C  CB    . THR C 2  51   ? 501.156 -30.288 643.686 1.00 102.39 ? 51   THR C CB    1 
ATOM   3966  O  OG1   . THR C 2  51   ? 500.163 -29.734 644.558 1.00 100.99 ? 51   THR C OG1   1 
ATOM   3967  C  CG2   . THR C 2  51   ? 501.396 -29.308 642.524 1.00 97.57  ? 51   THR C CG2   1 
ATOM   3968  N  N     . PHE C 2  52   ? 502.719 -33.174 642.893 1.00 104.88 ? 52   PHE C N     1 
ATOM   3969  C  CA    . PHE C 2  52   ? 503.878 -33.704 642.162 1.00 104.21 ? 52   PHE C CA    1 
ATOM   3970  C  C     . PHE C 2  52   ? 503.732 -35.195 641.856 1.00 106.86 ? 52   PHE C C     1 
ATOM   3971  O  O     . PHE C 2  52   ? 503.080 -35.925 642.621 1.00 97.26  ? 52   PHE C O     1 
ATOM   3972  C  CB    . PHE C 2  52   ? 505.191 -33.541 642.955 1.00 99.89  ? 52   PHE C CB    1 
ATOM   3973  C  CG    . PHE C 2  52   ? 505.677 -32.119 643.103 1.00 101.99 ? 52   PHE C CG    1 
ATOM   3974  C  CD1   . PHE C 2  52   ? 505.282 -31.326 644.150 1.00 102.66 ? 52   PHE C CD1   1 
ATOM   3975  C  CD2   . PHE C 2  52   ? 506.536 -31.569 642.162 1.00 109.87 ? 52   PHE C CD2   1 
ATOM   3976  C  CE1   . PHE C 2  52   ? 505.754 -30.009 644.270 1.00 100.90 ? 52   PHE C CE1   1 
ATOM   3977  C  CE2   . PHE C 2  52   ? 507.002 -30.251 642.279 1.00 105.76 ? 52   PHE C CE2   1 
ATOM   3978  C  CZ    . PHE C 2  52   ? 506.613 -29.479 643.334 1.00 95.37  ? 52   PHE C CZ    1 
ATOM   3979  N  N     . PRO C 2  53   ? 504.388 -35.697 640.755 1.00 109.26 ? 53   PRO C N     1 
ATOM   3980  C  CA    . PRO C 2  53   ? 505.287 -35.030 639.776 1.00 104.01 ? 53   PRO C CA    1 
ATOM   3981  C  C     . PRO C 2  53   ? 504.630 -34.120 638.690 1.00 107.40 ? 53   PRO C C     1 
ATOM   3982  O  O     . PRO C 2  53   ? 503.535 -34.415 638.205 1.00 106.95 ? 53   PRO C O     1 
ATOM   3983  C  CB    . PRO C 2  53   ? 505.999 -36.211 639.120 1.00 105.15 ? 53   PRO C CB    1 
ATOM   3984  C  CG    . PRO C 2  53   ? 505.050 -37.327 639.237 1.00 102.98 ? 53   PRO C CG    1 
ATOM   3985  C  CD    . PRO C 2  53   ? 504.343 -37.155 640.522 1.00 103.20 ? 53   PRO C CD    1 
ATOM   3986  N  N     . ILE C 2  54   ? 505.352 -33.060 638.308 1.00 110.83 ? 54   ILE C N     1 
ATOM   3987  C  CA    . ILE C 2  54   ? 504.956 -32.075 637.289 1.00 114.95 ? 54   ILE C CA    1 
ATOM   3988  C  C     . ILE C 2  54   ? 505.468 -32.372 635.863 1.00 125.38 ? 54   ILE C C     1 
ATOM   3989  O  O     . ILE C 2  54   ? 506.668 -32.243 635.591 1.00 123.73 ? 54   ILE C O     1 
ATOM   3990  C  CB    . ILE C 2  54   ? 505.406 -30.671 637.724 1.00 110.36 ? 54   ILE C CB    1 
ATOM   3991  C  CG1   . ILE C 2  54   ? 504.835 -30.320 639.110 1.00 106.18 ? 54   ILE C CG1   1 
ATOM   3992  C  CG2   . ILE C 2  54   ? 505.079 -29.613 636.657 1.00 107.64 ? 54   ILE C CG2   1 
ATOM   3993  C  CD1   . ILE C 2  54   ? 503.337 -30.046 639.148 1.00 106.07 ? 54   ILE C CD1   1 
ATOM   3994  N  N     . GLU C 2  55   ? 504.563 -32.768 634.944 1.00 130.53 ? 55   GLU C N     1 
ATOM   3995  C  CA    . GLU C 2  55   ? 504.857 -33.303 633.607 1.00 125.50 ? 55   GLU C CA    1 
ATOM   3996  C  C     . GLU C 2  55   ? 505.045 -32.159 632.589 1.00 128.32 ? 55   GLU C C     1 
ATOM   3997  O  O     . GLU C 2  55   ? 504.709 -31.002 632.851 1.00 127.49 ? 55   GLU C O     1 
ATOM   3998  C  CB    . GLU C 2  55   ? 503.765 -34.271 633.149 1.00 122.67 ? 55   GLU C CB    1 
ATOM   3999  C  CG    . GLU C 2  55   ? 503.625 -35.457 634.068 1.00 122.28 ? 55   GLU C CG    1 
ATOM   4000  C  CD    . GLU C 2  55   ? 504.159 -36.726 633.441 1.00 130.56 ? 55   GLU C CD    1 
ATOM   4001  O  OE1   . GLU C 2  55   ? 504.043 -37.796 634.082 1.00 132.24 ? 55   GLU C OE1   1 
ATOM   4002  O  OE2   . GLU C 2  55   ? 504.649 -36.659 632.286 1.00 129.87 ? 55   GLU C OE2   1 
ATOM   4003  N  N     . GLU C 2  56   ? 505.566 -32.488 631.401 1.00 131.70 ? 56   GLU C N     1 
ATOM   4004  C  CA    . GLU C 2  56   ? 505.917 -31.434 630.431 1.00 131.94 ? 56   GLU C CA    1 
ATOM   4005  C  C     . GLU C 2  56   ? 504.736 -31.062 629.532 1.00 134.14 ? 56   GLU C C     1 
ATOM   4006  O  O     . GLU C 2  56   ? 504.643 -29.931 629.042 1.00 133.91 ? 56   GLU C O     1 
ATOM   4007  C  CB    . GLU C 2  56   ? 507.125 -31.858 629.564 1.00 131.72 ? 56   GLU C CB    1 
ATOM   4008  C  CG    . GLU C 2  56   ? 506.948 -31.748 628.028 1.00 141.31 ? 56   GLU C CG    1 
ATOM   4009  C  CD    . GLU C 2  56   ? 506.138 -32.875 627.363 1.00 141.94 ? 56   GLU C CD    1 
ATOM   4010  O  OE1   . GLU C 2  56   ? 505.181 -33.407 627.976 1.00 137.39 ? 56   GLU C OE1   1 
ATOM   4011  O  OE2   . GLU C 2  56   ? 506.449 -33.199 626.190 1.00 139.64 ? 56   GLU C OE2   1 
ATOM   4012  N  N     . LEU C 2  64   ? 510.325 -33.644 630.220 1.00 135.90 ? 64   LEU C N     1 
ATOM   4013  C  CA    . LEU C 2  64   ? 510.624 -32.907 631.456 1.00 138.39 ? 64   LEU C CA    1 
ATOM   4014  C  C     . LEU C 2  64   ? 509.730 -33.298 632.670 1.00 135.71 ? 64   LEU C C     1 
ATOM   4015  O  O     . LEU C 2  64   ? 508.506 -33.206 632.579 1.00 137.91 ? 64   LEU C O     1 
ATOM   4016  C  CB    . LEU C 2  64   ? 510.468 -31.426 631.148 1.00 137.69 ? 64   LEU C CB    1 
ATOM   4017  C  CG    . LEU C 2  64   ? 511.658 -30.803 630.449 1.00 137.06 ? 64   LEU C CG    1 
ATOM   4018  C  CD1   . LEU C 2  64   ? 511.354 -29.364 630.122 1.00 135.21 ? 64   LEU C CD1   1 
ATOM   4019  C  CD2   . LEU C 2  64   ? 512.819 -30.886 631.426 1.00 129.71 ? 64   LEU C CD2   1 
ATOM   4020  N  N     . VAL C 2  65   ? 510.326 -33.660 633.816 1.00 131.28 ? 65   VAL C N     1 
ATOM   4021  C  CA    . VAL C 2  65   ? 509.575 -34.018 635.027 1.00 124.42 ? 65   VAL C CA    1 
ATOM   4022  C  C     . VAL C 2  65   ? 510.275 -33.499 636.284 1.00 123.43 ? 65   VAL C C     1 
ATOM   4023  O  O     . VAL C 2  65   ? 511.445 -33.821 636.521 1.00 123.75 ? 65   VAL C O     1 
ATOM   4024  C  CB    . VAL C 2  65   ? 509.402 -35.552 635.137 1.00 119.29 ? 65   VAL C CB    1 
ATOM   4025  C  CG1   . VAL C 2  65   ? 508.965 -35.963 636.542 1.00 114.46 ? 65   VAL C CG1   1 
ATOM   4026  C  CG2   . VAL C 2  65   ? 508.414 -36.072 634.100 1.00 120.89 ? 65   VAL C CG2   1 
ATOM   4027  N  N     . LEU C 2  66   ? 509.548 -32.746 637.120 1.00 123.58 ? 66   LEU C N     1 
ATOM   4028  C  CA    . LEU C 2  66   ? 510.061 -32.235 638.397 1.00 117.53 ? 66   LEU C CA    1 
ATOM   4029  C  C     . LEU C 2  66   ? 509.385 -33.042 639.511 1.00 111.05 ? 66   LEU C C     1 
ATOM   4030  O  O     . LEU C 2  66   ? 508.157 -33.012 639.648 1.00 108.22 ? 66   LEU C O     1 
ATOM   4031  C  CB    . LEU C 2  66   ? 509.801 -30.734 638.535 1.00 106.80 ? 66   LEU C CB    1 
ATOM   4032  C  CG    . LEU C 2  66   ? 510.380 -30.020 639.742 1.00 100.14 ? 66   LEU C CG    1 
ATOM   4033  C  CD1   . LEU C 2  66   ? 511.815 -30.464 639.936 1.00 107.53 ? 66   LEU C CD1   1 
ATOM   4034  C  CD2   . LEU C 2  66   ? 510.333 -28.524 639.495 1.00 101.31 ? 66   LEU C CD2   1 
ATOM   4035  N  N     . ASP C 2  67   ? 510.171 -33.715 640.339 1.00 107.99 ? 67   ASP C N     1 
ATOM   4036  C  CA    . ASP C 2  67   ? 509.592 -34.634 641.300 1.00 104.64 ? 67   ASP C CA    1 
ATOM   4037  C  C     . ASP C 2  67   ? 509.906 -34.174 642.715 1.00 110.31 ? 67   ASP C C     1 
ATOM   4038  O  O     . ASP C 2  67   ? 510.938 -33.548 642.971 1.00 111.09 ? 67   ASP C O     1 
ATOM   4039  C  CB    . ASP C 2  67   ? 510.137 -36.047 641.061 1.00 111.95 ? 67   ASP C CB    1 
ATOM   4040  C  CG    . ASP C 2  67   ? 509.172 -37.128 641.479 1.00 113.97 ? 67   ASP C CG    1 
ATOM   4041  O  OD1   . ASP C 2  67   ? 509.026 -38.087 640.693 1.00 123.41 ? 67   ASP C OD1   1 
ATOM   4042  O  OD2   . ASP C 2  67   ? 508.539 -37.018 642.550 1.00 105.83 ? 67   ASP C OD2   1 
ATOM   4043  N  N     . PHE C 2  68   ? 509.000 -34.503 643.635 1.00 110.22 ? 68   PHE C N     1 
ATOM   4044  C  CA    . PHE C 2  68   ? 509.095 -34.089 645.028 1.00 103.32 ? 68   PHE C CA    1 
ATOM   4045  C  C     . PHE C 2  68   ? 509.750 -35.157 645.897 1.00 104.00 ? 68   PHE C C     1 
ATOM   4046  O  O     . PHE C 2  68   ? 509.252 -36.283 645.980 1.00 107.15 ? 68   PHE C O     1 
ATOM   4047  C  CB    . PHE C 2  68   ? 507.699 -33.773 645.547 1.00 106.37 ? 68   PHE C CB    1 
ATOM   4048  C  CG    . PHE C 2  68   ? 507.598 -33.747 647.055 1.00 108.81 ? 68   PHE C CG    1 
ATOM   4049  C  CD1   . PHE C 2  68   ? 508.054 -32.635 647.771 1.00 97.77  ? 68   PHE C CD1   1 
ATOM   4050  C  CD2   . PHE C 2  68   ? 507.028 -34.812 647.746 1.00 104.00 ? 68   PHE C CD2   1 
ATOM   4051  C  CE1   . PHE C 2  68   ? 507.963 -32.590 649.110 1.00 92.39  ? 68   PHE C CE1   1 
ATOM   4052  C  CE2   . PHE C 2  68   ? 506.928 -34.768 649.105 1.00 103.41 ? 68   PHE C CE2   1 
ATOM   4053  C  CZ    . PHE C 2  68   ? 507.398 -33.657 649.790 1.00 102.66 ? 68   PHE C CZ    1 
ATOM   4054  N  N     . LEU C 2  69   ? 510.771 -34.759 646.657 1.00 100.79 ? 69   LEU C N     1 
ATOM   4055  C  CA    . LEU C 2  69   ? 511.452 -35.685 647.558 1.00 103.41 ? 69   LEU C CA    1 
ATOM   4056  C  C     . LEU C 2  69   ? 510.899 -35.621 648.982 1.00 107.19 ? 69   LEU C C     1 
ATOM   4057  O  O     . LEU C 2  69   ? 510.349 -36.610 649.488 1.00 104.17 ? 69   LEU C O     1 
ATOM   4058  C  CB    . LEU C 2  69   ? 512.959 -35.375 647.562 1.00 105.45 ? 69   LEU C CB    1 
ATOM   4059  C  CG    . LEU C 2  69   ? 513.842 -35.853 646.406 1.00 109.73 ? 69   LEU C CG    1 
ATOM   4060  C  CD1   . LEU C 2  69   ? 515.333 -35.773 646.785 1.00 109.32 ? 69   LEU C CD1   1 
ATOM   4061  C  CD2   . LEU C 2  69   ? 513.447 -37.255 645.984 1.00 104.59 ? 69   LEU C CD2   1 
ATOM   4062  N  N     . GLU C 2  70   ? 510.998 -34.459 649.623 1.00 107.19 ? 70   GLU C N     1 
ATOM   4063  C  CA    . GLU C 2  70   ? 510.643 -34.262 651.024 1.00 98.38  ? 70   GLU C CA    1 
ATOM   4064  C  C     . GLU C 2  70   ? 510.781 -32.776 651.327 1.00 101.85 ? 70   GLU C C     1 
ATOM   4065  O  O     . GLU C 2  70   ? 511.420 -32.025 650.576 1.00 102.73 ? 70   GLU C O     1 
ATOM   4066  C  CB    . GLU C 2  70   ? 511.527 -35.114 651.955 1.00 100.11 ? 70   GLU C CB    1 
ATOM   4067  C  CG    . GLU C 2  70   ? 513.051 -35.020 651.689 1.00 104.73 ? 70   GLU C CG    1 
ATOM   4068  C  CD    . GLU C 2  70   ? 513.922 -35.425 652.891 1.00 106.86 ? 70   GLU C CD    1 
ATOM   4069  O  OE1   . GLU C 2  70   ? 513.879 -34.738 653.942 1.00 111.04 ? 70   GLU C OE1   1 
ATOM   4070  O  OE2   . GLU C 2  70   ? 514.651 -36.442 652.782 1.00 100.41 ? 70   GLU C OE2   1 
ATOM   4071  N  N     . TYR C 2  71   ? 510.152 -32.354 652.420 1.00 101.64 ? 71   TYR C N     1 
ATOM   4072  C  CA    . TYR C 2  71   ? 510.222 -30.971 652.865 1.00 99.64  ? 71   TYR C CA    1 
ATOM   4073  C  C     . TYR C 2  71   ? 510.795 -30.947 654.265 1.00 94.49  ? 71   TYR C C     1 
ATOM   4074  O  O     . TYR C 2  71   ? 510.820 -31.965 654.965 1.00 96.00  ? 71   TYR C O     1 
ATOM   4075  C  CB    . TYR C 2  71   ? 508.844 -30.267 652.844 1.00 97.83  ? 71   TYR C CB    1 
ATOM   4076  C  CG    . TYR C 2  71   ? 507.878 -30.728 653.924 1.00 100.28 ? 71   TYR C CG    1 
ATOM   4077  C  CD1   . TYR C 2  71   ? 507.889 -30.172 655.208 1.00 96.44  ? 71   TYR C CD1   1 
ATOM   4078  C  CD2   . TYR C 2  71   ? 506.951 -31.736 653.655 1.00 99.82  ? 71   TYR C CD2   1 
ATOM   4079  C  CE1   . TYR C 2  71   ? 507.000 -30.617 656.189 1.00 93.33  ? 71   TYR C CE1   1 
ATOM   4080  C  CE2   . TYR C 2  71   ? 506.064 -32.178 654.624 1.00 97.84  ? 71   TYR C CE2   1 
ATOM   4081  C  CZ    . TYR C 2  71   ? 506.089 -31.622 655.882 1.00 94.32  ? 71   TYR C CZ    1 
ATOM   4082  O  OH    . TYR C 2  71   ? 505.190 -32.088 656.813 1.00 92.49  ? 71   TYR C OH    1 
ATOM   4083  N  N     . ARG C 2  72   ? 511.254 -29.775 654.672 1.00 86.44  ? 72   ARG C N     1 
ATOM   4084  C  CA    . ARG C 2  72   ? 511.610 -29.618 656.063 1.00 97.17  ? 72   ARG C CA    1 
ATOM   4085  C  C     . ARG C 2  72   ? 511.184 -28.232 656.507 1.00 97.52  ? 72   ARG C C     1 
ATOM   4086  O  O     . ARG C 2  72   ? 511.026 -27.326 655.682 1.00 92.94  ? 72   ARG C O     1 
ATOM   4087  C  CB    . ARG C 2  72   ? 513.111 -29.835 656.323 1.00 96.35  ? 72   ARG C CB    1 
ATOM   4088  C  CG    . ARG C 2  72   ? 514.007 -28.762 655.788 1.00 96.69  ? 72   ARG C CG    1 
ATOM   4089  C  CD    . ARG C 2  72   ? 515.356 -28.843 656.481 1.00 93.83  ? 72   ARG C CD    1 
ATOM   4090  N  NE    . ARG C 2  72   ? 516.284 -27.859 655.945 1.00 91.12  ? 72   ARG C NE    1 
ATOM   4091  C  CZ    . ARG C 2  72   ? 516.565 -26.718 656.568 1.00 95.38  ? 72   ARG C CZ    1 
ATOM   4092  N  NH1   . ARG C 2  72   ? 516.007 -26.451 657.740 1.00 101.30 ? 72   ARG C NH1   1 
ATOM   4093  N  NH2   . ARG C 2  72   ? 517.411 -25.849 656.039 1.00 102.31 ? 72   ARG C NH2   1 
ATOM   4094  N  N     . LEU C 2  73   ? 510.937 -28.100 657.813 1.00 94.89  ? 73   LEU C N     1 
ATOM   4095  C  CA    . LEU C 2  73   ? 510.619 -26.825 658.439 1.00 94.88  ? 73   LEU C CA    1 
ATOM   4096  C  C     . LEU C 2  73   ? 511.763 -26.396 659.344 1.00 95.55  ? 73   LEU C C     1 
ATOM   4097  O  O     . LEU C 2  73   ? 512.311 -27.219 660.085 1.00 95.51  ? 73   LEU C O     1 
ATOM   4098  C  CB    . LEU C 2  73   ? 509.325 -26.879 659.253 1.00 96.76  ? 73   LEU C CB    1 
ATOM   4099  C  CG    . LEU C 2  73   ? 507.970 -26.983 658.538 1.00 97.93  ? 73   LEU C CG    1 
ATOM   4100  C  CD1   . LEU C 2  73   ? 506.881 -27.437 659.521 1.00 87.94  ? 73   LEU C CD1   1 
ATOM   4101  C  CD2   . LEU C 2  73   ? 507.580 -25.663 657.857 1.00 90.76  ? 73   LEU C CD2   1 
ATOM   4102  N  N     . GLY C 2  74   ? 512.214 -25.155 659.177 1.00 96.99  ? 74   GLY C N     1 
ATOM   4103  C  CA    . GLY C 2  74   ? 513.261 -24.639 660.025 1.00 97.11  ? 74   GLY C CA    1 
ATOM   4104  C  C     . GLY C 2  74   ? 512.698 -24.198 661.368 1.00 100.97 ? 74   GLY C C     1 
ATOM   4105  O  O     . GLY C 2  74   ? 511.539 -24.437 661.715 1.00 98.62  ? 74   GLY C O     1 
ATOM   4106  N  N     . GLU C 2  75   ? 513.544 -23.551 662.125 1.00 99.25  ? 75   GLU C N     1 
ATOM   4107  C  CA    . GLU C 2  75   ? 513.188 -22.947 663.392 1.00 93.71  ? 75   GLU C CA    1 
ATOM   4108  C  C     . GLU C 2  75   ? 512.793 -21.488 663.176 1.00 91.93  ? 75   GLU C C     1 
ATOM   4109  O  O     . GLU C 2  75   ? 513.202 -20.870 662.188 1.00 89.53  ? 75   GLU C O     1 
ATOM   4110  C  CB    . GLU C 2  75   ? 514.322 -23.147 664.381 1.00 96.47  ? 75   GLU C CB    1 
ATOM   4111  C  CG    . GLU C 2  75   ? 514.465 -24.658 664.538 1.00 99.22  ? 75   GLU C CG    1 
ATOM   4112  C  CD    . GLU C 2  75   ? 513.413 -25.297 665.462 1.00 123.27 ? 75   GLU C CD    1 
ATOM   4113  O  OE1   . GLU C 2  75   ? 512.965 -26.419 665.099 1.00 126.24 ? 75   GLU C OE1   1 
ATOM   4114  O  OE2   . GLU C 2  75   ? 513.055 -24.721 666.534 1.00 126.61 ? 75   GLU C OE2   1 
ATOM   4115  N  N     . PRO C 2  76   ? 511.991 -20.895 664.058 1.00 91.55  ? 76   PRO C N     1 
ATOM   4116  C  CA    . PRO C 2  76   ? 511.589 -19.490 663.852 1.00 87.85  ? 76   PRO C CA    1 
ATOM   4117  C  C     . PRO C 2  76   ? 512.754 -18.526 663.960 1.00 87.80  ? 76   PRO C C     1 
ATOM   4118  O  O     . PRO C 2  76   ? 513.574 -18.629 664.886 1.00 88.08  ? 76   PRO C O     1 
ATOM   4119  C  CB    . PRO C 2  76   ? 510.584 -19.235 664.983 1.00 88.83  ? 76   PRO C CB    1 
ATOM   4120  C  CG    . PRO C 2  76   ? 510.227 -20.582 665.521 1.00 93.14  ? 76   PRO C CG    1 
ATOM   4121  C  CD    . PRO C 2  76   ? 511.396 -21.472 665.274 1.00 91.25  ? 76   PRO C CD    1 
ATOM   4122  N  N     . PRO C 2  77   ? 512.859 -17.588 663.004 1.00 87.49  ? 77   PRO C N     1 
ATOM   4123  C  CA    . PRO C 2  77   ? 513.921 -16.564 663.049 1.00 85.33  ? 77   PRO C CA    1 
ATOM   4124  C  C     . PRO C 2  77   ? 513.876 -15.719 664.304 1.00 93.14  ? 77   PRO C C     1 
ATOM   4125  O  O     . PRO C 2  77   ? 514.915 -15.195 664.733 1.00 89.19  ? 77   PRO C O     1 
ATOM   4126  C  CB    . PRO C 2  77   ? 513.651 -15.712 661.803 1.00 87.57  ? 77   PRO C CB    1 
ATOM   4127  C  CG    . PRO C 2  77   ? 512.818 -16.565 660.910 1.00 93.99  ? 77   PRO C CG    1 
ATOM   4128  C  CD    . PRO C 2  77   ? 512.003 -17.438 661.817 1.00 91.93  ? 77   PRO C CD    1 
ATOM   4129  N  N     . PHE C 2  78   ? 512.675 -15.507 664.858 1.00 97.72  ? 78   PHE C N     1 
ATOM   4130  C  CA    . PHE C 2  78   ? 512.479 -14.685 666.040 1.00 93.70  ? 78   PHE C CA    1 
ATOM   4131  C  C     . PHE C 2  78   ? 511.479 -15.354 666.973 1.00 94.92  ? 78   PHE C C     1 
ATOM   4132  O  O     . PHE C 2  78   ? 510.531 -16.003 666.500 1.00 95.72  ? 78   PHE C O     1 
ATOM   4133  C  CB    . PHE C 2  78   ? 512.015 -13.281 665.641 1.00 95.75  ? 78   PHE C CB    1 
ATOM   4134  C  CG    . PHE C 2  78   ? 512.923 -12.636 664.629 1.00 98.93  ? 78   PHE C CG    1 
ATOM   4135  C  CD1   . PHE C 2  78   ? 512.694 -12.805 663.269 1.00 93.42  ? 78   PHE C CD1   1 
ATOM   4136  C  CD2   . PHE C 2  78   ? 514.064 -11.957 665.036 1.00 94.74  ? 78   PHE C CD2   1 
ATOM   4137  C  CE1   . PHE C 2  78   ? 513.533 -12.251 662.356 1.00 90.15  ? 78   PHE C CE1   1 
ATOM   4138  C  CE2   . PHE C 2  78   ? 514.910 -11.414 664.124 1.00 91.26  ? 78   PHE C CE2   1 
ATOM   4139  C  CZ    . PHE C 2  78   ? 514.643 -11.559 662.777 1.00 92.62  ? 78   PHE C CZ    1 
ATOM   4140  N  N     . PRO C 2  79   ? 511.679 -15.220 668.318 1.00 96.46  ? 79   PRO C N     1 
ATOM   4141  C  CA    . PRO C 2  79   ? 510.750 -15.826 669.293 1.00 96.09  ? 79   PRO C CA    1 
ATOM   4142  C  C     . PRO C 2  79   ? 509.403 -15.124 669.375 1.00 99.20  ? 79   PRO C C     1 
ATOM   4143  O  O     . PRO C 2  79   ? 509.244 -14.044 668.792 1.00 97.38  ? 79   PRO C O     1 
ATOM   4144  C  CB    . PRO C 2  79   ? 511.513 -15.700 670.611 1.00 99.96  ? 79   PRO C CB    1 
ATOM   4145  C  CG    . PRO C 2  79   ? 512.402 -14.475 670.383 1.00 100.82 ? 79   PRO C CG    1 
ATOM   4146  C  CD    . PRO C 2  79   ? 512.795 -14.501 668.964 1.00 89.86  ? 79   PRO C CD    1 
ATOM   4147  N  N     . GLN C 2  80   ? 508.458 -15.667 670.163 1.00 99.65  ? 80   GLN C N     1 
ATOM   4148  C  CA    . GLN C 2  80   ? 507.090 -15.147 670.108 1.00 95.66  ? 80   GLN C CA    1 
ATOM   4149  C  C     . GLN C 2  80   ? 507.039 -13.705 670.605 1.00 96.29  ? 80   GLN C C     1 
ATOM   4150  O  O     . GLN C 2  80   ? 506.487 -12.821 669.930 1.00 94.07  ? 80   GLN C O     1 
ATOM   4151  C  CB    . GLN C 2  80   ? 506.121 -16.067 670.877 1.00 81.33  ? 80   GLN C CB    1 
ATOM   4152  C  CG    . GLN C 2  80   ? 506.172 -17.524 670.394 1.00 78.50  ? 80   GLN C CG    1 
ATOM   4153  C  CD    . GLN C 2  80   ? 505.346 -18.533 671.211 1.00 82.03  ? 80   GLN C CD    1 
ATOM   4154  O  OE1   . GLN C 2  80   ? 504.508 -18.171 672.052 1.00 83.73  ? 80   GLN C OE1   1 
ATOM   4155  N  NE2   . GLN C 2  80   ? 505.583 -19.822 670.948 1.00 77.74  ? 80   GLN C NE2   1 
ATOM   4156  N  N     . ASP C 2  81   ? 507.605 -13.449 671.784 1.00 103.28 ? 81   ASP C N     1 
ATOM   4157  C  CA    . ASP C 2  81   ? 507.619 -12.095 672.331 1.00 103.93 ? 81   ASP C CA    1 
ATOM   4158  C  C     . ASP C 2  81   ? 508.212 -11.093 671.338 1.00 97.43  ? 81   ASP C C     1 
ATOM   4159  O  O     . ASP C 2  81   ? 507.609 -10.052 671.048 1.00 94.56  ? 81   ASP C O     1 
ATOM   4160  C  CB    . ASP C 2  81   ? 508.387 -12.073 673.673 1.00 107.85 ? 81   ASP C CB    1 
ATOM   4161  C  CG    . ASP C 2  81   ? 509.280 -13.345 673.909 1.00 114.13 ? 81   ASP C CG    1 
ATOM   4162  O  OD1   . ASP C 2  81   ? 508.767 -14.496 673.799 1.00 112.41 ? 81   ASP C OD1   1 
ATOM   4163  O  OD2   . ASP C 2  81   ? 510.505 -13.197 674.179 1.00 109.69 ? 81   ASP C OD2   1 
ATOM   4164  N  N     . GLU C 2  82   ? 509.336 -11.450 670.718 1.00 98.01  ? 82   GLU C N     1 
ATOM   4165  C  CA    . GLU C 2  82   ? 509.985 -10.546 669.766 1.00 102.05 ? 82   GLU C CA    1 
ATOM   4166  C  C     . GLU C 2  82   ? 509.103 -10.215 668.569 1.00 100.97 ? 82   GLU C C     1 
ATOM   4167  O  O     . GLU C 2  82   ? 509.094 -9.072  668.094 1.00 98.46  ? 82   GLU C O     1 
ATOM   4168  C  CB    . GLU C 2  82   ? 511.305 -11.141 669.290 1.00 101.91 ? 82   GLU C CB    1 
ATOM   4169  C  CG    . GLU C 2  82   ? 511.974 -10.283 668.250 1.00 102.96 ? 82   GLU C CG    1 
ATOM   4170  C  CD    . GLU C 2  82   ? 513.467 -10.259 668.430 1.00 109.50 ? 82   GLU C CD    1 
ATOM   4171  O  OE1   . GLU C 2  82   ? 513.955 -10.925 669.386 1.00 103.48 ? 82   GLU C OE1   1 
ATOM   4172  O  OE2   . GLU C 2  82   ? 514.140 -9.579  667.611 1.00 113.68 ? 82   GLU C OE2   1 
ATOM   4173  N  N     . CYS C 2  83   ? 508.414 -11.219 668.026 1.00 103.31 ? 83   CYS C N     1 
ATOM   4174  C  CA    . CYS C 2  83   ? 507.517 -11.006 666.892 1.00 97.01  ? 83   CYS C CA    1 
ATOM   4175  C  C     . CYS C 2  83   ? 506.425 -9.985  667.219 1.00 96.78  ? 83   CYS C C     1 
ATOM   4176  O  O     . CYS C 2  83   ? 506.185 -9.052  666.437 1.00 87.57  ? 83   CYS C O     1 
ATOM   4177  C  CB    . CYS C 2  83   ? 506.927 -12.346 666.441 1.00 94.04  ? 83   CYS C CB    1 
ATOM   4178  S  SG    . CYS C 2  83   ? 508.130 -13.474 665.652 1.00 108.61 ? 83   CYS C SG    1 
ATOM   4179  N  N     . ARG C 2  84   ? 505.776 -10.131 668.393 1.00 93.55  ? 84   ARG C N     1 
ATOM   4180  C  CA    . ARG C 2  84   ? 504.715 -9.208  668.798 1.00 90.03  ? 84   ARG C CA    1 
ATOM   4181  C  C     . ARG C 2  84   ? 505.224 -7.770  668.869 1.00 92.69  ? 84   ARG C C     1 
ATOM   4182  O  O     . ARG C 2  84   ? 504.551 -6.832  668.414 1.00 89.98  ? 84   ARG C O     1 
ATOM   4183  C  CB    . ARG C 2  84   ? 504.179 -9.602  670.179 1.00 94.98  ? 84   ARG C CB    1 
ATOM   4184  C  CG    . ARG C 2  84   ? 503.453 -10.927 670.268 1.00 92.92  ? 84   ARG C CG    1 
ATOM   4185  C  CD    . ARG C 2  84   ? 502.906 -11.206 671.670 1.00 79.28  ? 84   ARG C CD    1 
ATOM   4186  N  NE    . ARG C 2  84   ? 502.243 -12.507 671.714 1.00 73.12  ? 84   ARG C NE    1 
ATOM   4187  C  CZ    . ARG C 2  84   ? 502.748 -13.569 672.353 1.00 81.62  ? 84   ARG C CZ    1 
ATOM   4188  N  NH1   . ARG C 2  84   ? 503.912 -13.480 673.006 1.00 82.19  ? 84   ARG C NH1   1 
ATOM   4189  N  NH2   . ARG C 2  84   ? 502.095 -14.729 672.343 1.00 80.56  ? 84   ARG C NH2   1 
ATOM   4190  N  N     . GLU C 2  85   ? 506.428 -7.593  669.410 1.00 91.45  ? 85   GLU C N     1 
ATOM   4191  C  CA    . GLU C 2  85   ? 507.070 -6.286  669.506 1.00 93.67  ? 85   GLU C CA    1 
ATOM   4192  C  C     . GLU C 2  85   ? 507.251 -5.569  668.164 1.00 101.14 ? 85   GLU C C     1 
ATOM   4193  O  O     . GLU C 2  85   ? 506.788 -4.433  667.992 1.00 100.27 ? 85   GLU C O     1 
ATOM   4194  C  CB    . GLU C 2  85   ? 508.432 -6.515  670.170 1.00 95.47  ? 85   GLU C CB    1 
ATOM   4195  C  CG    . GLU C 2  85   ? 509.497 -5.459  669.880 1.00 100.74 ? 85   GLU C CG    1 
ATOM   4196  C  CD    . GLU C 2  85   ? 509.454 -4.224  670.704 1.00 110.99 ? 85   GLU C CD    1 
ATOM   4197  O  OE1   . GLU C 2  85   ? 508.474 -4.018  671.461 1.00 118.68 ? 85   GLU C OE1   1 
ATOM   4198  O  OE2   . GLU C 2  85   ? 510.428 -3.449  670.562 1.00 109.10 ? 85   GLU C OE2   1 
ATOM   4199  N  N     . LYS C 2  86   ? 507.814 -6.255  667.169 1.00 100.99 ? 86   LYS C N     1 
ATOM   4200  C  CA    . LYS C 2  86   ? 508.300 -5.631  665.938 1.00 98.43  ? 86   LYS C CA    1 
ATOM   4201  C  C     . LYS C 2  86   ? 507.299 -5.654  664.792 1.00 101.65 ? 86   LYS C C     1 
ATOM   4202  O  O     . LYS C 2  86   ? 507.685 -5.401  663.641 1.00 99.24  ? 86   LYS C O     1 
ATOM   4203  C  CB    . LYS C 2  86   ? 509.636 -6.271  665.531 1.00 94.27  ? 86   LYS C CB    1 
ATOM   4204  C  CG    . LYS C 2  86   ? 510.714 -5.946  666.567 1.00 101.76 ? 86   LYS C CG    1 
ATOM   4205  C  CD    . LYS C 2  86   ? 512.135 -6.396  666.243 1.00 107.14 ? 86   LYS C CD    1 
ATOM   4206  C  CE    . LYS C 2  86   ? 513.068 -5.992  667.405 1.00 113.77 ? 86   LYS C CE    1 
ATOM   4207  N  NZ    . LYS C 2  86   ? 514.526 -6.207  667.155 1.00 115.03 ? 86   LYS C NZ    1 
ATOM   4208  N  N     . ASP C 2  87   ? 506.059 -6.065  665.059 1.00 99.91  ? 87   ASP C N     1 
ATOM   4209  C  CA    . ASP C 2  87   ? 505.015 -6.167  664.035 1.00 96.73  ? 87   ASP C CA    1 
ATOM   4210  C  C     . ASP C 2  87   ? 505.458 -7.175  662.974 1.00 92.52  ? 87   ASP C C     1 
ATOM   4211  O  O     . ASP C 2  87   ? 505.360 -6.930  661.769 1.00 94.58  ? 87   ASP C O     1 
ATOM   4212  C  CB    . ASP C 2  87   ? 504.651 -4.795  663.418 1.00 93.75  ? 87   ASP C CB    1 
ATOM   4213  C  CG    . ASP C 2  87   ? 503.796 -3.882  664.387 1.00 112.41 ? 87   ASP C CG    1 
ATOM   4214  O  OD1   . ASP C 2  87   ? 504.191 -2.700  664.592 1.00 114.20 ? 87   ASP C OD1   1 
ATOM   4215  O  OD2   . ASP C 2  87   ? 502.773 -4.339  664.990 1.00 109.77 ? 87   ASP C OD2   1 
ATOM   4216  N  N     . LEU C 2  88   ? 505.992 -8.308  663.454 1.00 94.80  ? 88   LEU C N     1 
ATOM   4217  C  CA    . LEU C 2  88   ? 506.507 -9.409  662.647 1.00 94.42  ? 88   LEU C CA    1 
ATOM   4218  C  C     . LEU C 2  88   ? 505.561 -10.595 662.777 1.00 87.71  ? 88   LEU C C     1 
ATOM   4219  O  O     . LEU C 2  88   ? 504.923 -10.783 663.814 1.00 90.62  ? 88   LEU C O     1 
ATOM   4220  C  CB    . LEU C 2  88   ? 507.903 -9.845  663.122 1.00 94.74  ? 88   LEU C CB    1 
ATOM   4221  C  CG    . LEU C 2  88   ? 508.993 -8.768  663.159 1.00 90.94  ? 88   LEU C CG    1 
ATOM   4222  C  CD1   . LEU C 2  88   ? 510.365 -9.394  663.362 1.00 92.80  ? 88   LEU C CD1   1 
ATOM   4223  C  CD2   . LEU C 2  88   ? 508.936 -7.865  661.943 1.00 83.28  ? 88   LEU C CD2   1 
ATOM   4224  N  N     . THR C 2  89   ? 505.514 -11.426 661.747 1.00 84.13  ? 89   THR C N     1 
ATOM   4225  C  CA    . THR C 2  89   ? 504.795 -12.688 661.816 1.00 84.90  ? 89   THR C CA    1 
ATOM   4226  C  C     . THR C 2  89   ? 505.657 -13.801 662.404 1.00 87.37  ? 89   THR C C     1 
ATOM   4227  O  O     . THR C 2  89   ? 506.824 -13.951 662.031 1.00 91.32  ? 89   THR C O     1 
ATOM   4228  C  CB    . THR C 2  89   ? 504.278 -13.092 660.444 1.00 84.30  ? 89   THR C CB    1 
ATOM   4229  O  OG1   . THR C 2  89   ? 503.268 -12.159 660.042 1.00 81.67  ? 89   THR C OG1   1 
ATOM   4230  C  CG2   . THR C 2  89   ? 503.647 -14.496 660.536 1.00 80.37  ? 89   THR C CG2   1 
ATOM   4231  N  N     . TYR C 2  90   ? 505.088 -14.550 663.356 1.00 87.40  ? 90   TYR C N     1 
ATOM   4232  C  CA    . TYR C 2  90   ? 505.745 -15.708 663.961 1.00 87.44  ? 90   TYR C CA    1 
ATOM   4233  C  C     . TYR C 2  90   ? 505.598 -16.900 663.007 1.00 90.38  ? 90   TYR C C     1 
ATOM   4234  O  O     . TYR C 2  90   ? 504.487 -17.400 662.793 1.00 92.77  ? 90   TYR C O     1 
ATOM   4235  C  CB    . TYR C 2  90   ? 505.119 -16.007 665.327 1.00 81.78  ? 90   TYR C CB    1 
ATOM   4236  C  CG    . TYR C 2  90   ? 505.731 -17.181 666.061 1.00 86.00  ? 90   TYR C CG    1 
ATOM   4237  C  CD1   . TYR C 2  90   ? 507.064 -17.151 666.491 1.00 87.80  ? 90   TYR C CD1   1 
ATOM   4238  C  CD2   . TYR C 2  90   ? 504.990 -18.337 666.292 1.00 81.49  ? 90   TYR C CD2   1 
ATOM   4239  C  CE1   . TYR C 2  90   ? 507.638 -18.239 667.151 1.00 84.03  ? 90   TYR C CE1   1 
ATOM   4240  C  CE2   . TYR C 2  90   ? 505.551 -19.427 666.948 1.00 84.28  ? 90   TYR C CE2   1 
ATOM   4241  C  CZ    . TYR C 2  90   ? 506.876 -19.377 667.370 1.00 87.51  ? 90   TYR C CZ    1 
ATOM   4242  O  OH    . TYR C 2  90   ? 507.412 -20.473 668.022 1.00 93.52  ? 90   TYR C OH    1 
ATOM   4243  N  N     . GLN C 2  91   ? 506.716 -17.391 662.471 1.00 93.84  ? 91   GLN C N     1 
ATOM   4244  C  CA    . GLN C 2  91   ? 506.714 -18.285 661.314 1.00 87.53  ? 91   GLN C CA    1 
ATOM   4245  C  C     . GLN C 2  91   ? 508.035 -19.048 661.243 1.00 88.22  ? 91   GLN C C     1 
ATOM   4246  O  O     . GLN C 2  91   ? 509.015 -18.673 661.891 1.00 94.44  ? 91   GLN C O     1 
ATOM   4247  C  CB    . GLN C 2  91   ? 506.465 -17.477 660.033 1.00 77.79  ? 91   GLN C CB    1 
ATOM   4248  C  CG    . GLN C 2  91   ? 507.409 -16.270 659.919 1.00 82.30  ? 91   GLN C CG    1 
ATOM   4249  C  CD    . GLN C 2  91   ? 507.159 -15.351 658.701 1.00 94.46  ? 91   GLN C CD    1 
ATOM   4250  O  OE1   . GLN C 2  91   ? 506.067 -15.329 658.098 1.00 93.48  ? 91   GLN C OE1   1 
ATOM   4251  N  NE2   . GLN C 2  91   ? 508.159 -14.514 658.399 1.00 92.05  ? 91   GLN C NE2   1 
ATOM   4252  N  N     . ALA C 2  92   ? 508.048 -20.143 660.461 1.00 86.64  ? 92   ALA C N     1 
ATOM   4253  C  CA    . ALA C 2  92   ? 509.260 -20.940 660.227 1.00 89.29  ? 92   ALA C CA    1 
ATOM   4254  C  C     . ALA C 2  92   ? 509.628 -20.967 658.745 1.00 92.22  ? 92   ALA C C     1 
ATOM   4255  O  O     . ALA C 2  92   ? 508.729 -21.019 657.897 1.00 90.97  ? 92   ALA C O     1 
ATOM   4256  C  CB    . ALA C 2  92   ? 509.063 -22.385 660.701 1.00 87.55  ? 92   ALA C CB    1 
ATOM   4257  N  N     . PRO C 2  93   ? 510.925 -20.956 658.395 1.00 99.73  ? 93   PRO C N     1 
ATOM   4258  C  CA    . PRO C 2  93   ? 511.317 -21.125 656.978 1.00 98.50  ? 93   PRO C CA    1 
ATOM   4259  C  C     . PRO C 2  93   ? 511.028 -22.541 656.485 1.00 93.52  ? 93   PRO C C     1 
ATOM   4260  O  O     . PRO C 2  93   ? 511.353 -23.523 657.162 1.00 91.86  ? 93   PRO C O     1 
ATOM   4261  C  CB    . PRO C 2  93   ? 512.821 -20.801 656.980 1.00 94.28  ? 93   PRO C CB    1 
ATOM   4262  C  CG    . PRO C 2  93   ? 513.275 -21.071 658.360 1.00 94.08  ? 93   PRO C CG    1 
ATOM   4263  C  CD    . PRO C 2  93   ? 512.097 -20.669 659.245 1.00 99.79  ? 93   PRO C CD    1 
ATOM   4264  N  N     . LEU C 2  94   ? 510.401 -22.639 655.306 1.00 86.42  ? 94   LEU C N     1 
ATOM   4265  C  CA    . LEU C 2  94   ? 510.103 -23.913 654.650 1.00 89.48  ? 94   LEU C CA    1 
ATOM   4266  C  C     . LEU C 2  94   ? 511.023 -24.171 653.453 1.00 101.49 ? 94   LEU C C     1 
ATOM   4267  O  O     . LEU C 2  94   ? 511.154 -23.322 652.561 1.00 104.10 ? 94   LEU C O     1 
ATOM   4268  C  CB    . LEU C 2  94   ? 508.628 -23.971 654.221 1.00 83.71  ? 94   LEU C CB    1 
ATOM   4269  C  CG    . LEU C 2  94   ? 508.141 -25.179 653.397 1.00 88.55  ? 94   LEU C CG    1 
ATOM   4270  C  CD1   . LEU C 2  94   ? 508.075 -26.435 654.268 1.00 88.76  ? 94   LEU C CD1   1 
ATOM   4271  C  CD2   . LEU C 2  94   ? 506.765 -24.925 652.739 1.00 74.69  ? 94   LEU C CD2   1 
ATOM   4272  N  N     . TYR C 2  95   ? 511.631 -25.357 653.414 1.00 97.67  ? 95   TYR C N     1 
ATOM   4273  C  CA    . TYR C 2  95   ? 512.448 -25.759 652.284 1.00 96.81  ? 95   TYR C CA    1 
ATOM   4274  C  C     . TYR C 2  95   ? 511.877 -27.051 651.699 1.00 101.11 ? 95   TYR C C     1 
ATOM   4275  O  O     . TYR C 2  95   ? 511.264 -27.850 652.417 1.00 103.76 ? 95   TYR C O     1 
ATOM   4276  C  CB    . TYR C 2  95   ? 513.893 -25.979 652.732 1.00 98.22  ? 95   TYR C CB    1 
ATOM   4277  C  CG    . TYR C 2  95   ? 514.521 -24.816 653.478 1.00 93.94  ? 95   TYR C CG    1 
ATOM   4278  C  CD1   . TYR C 2  95   ? 515.099 -23.748 652.804 1.00 101.30 ? 95   TYR C CD1   1 
ATOM   4279  C  CD2   . TYR C 2  95   ? 514.617 -24.838 654.850 1.00 93.36  ? 95   TYR C CD2   1 
ATOM   4280  C  CE1   . TYR C 2  95   ? 515.699 -22.708 653.483 1.00 97.14  ? 95   TYR C CE1   1 
ATOM   4281  C  CE2   . TYR C 2  95   ? 515.219 -23.812 655.539 1.00 96.37  ? 95   TYR C CE2   1 
ATOM   4282  C  CZ    . TYR C 2  95   ? 515.761 -22.749 654.853 1.00 99.23  ? 95   TYR C CZ    1 
ATOM   4283  O  OH    . TYR C 2  95   ? 516.356 -21.724 655.556 1.00 106.59 ? 95   TYR C OH    1 
ATOM   4284  N  N     . ALA C 2  96   ? 512.098 -27.281 650.402 1.00 99.45  ? 96   ALA C N     1 
ATOM   4285  C  CA    . ALA C 2  96   ? 511.675 -28.534 649.779 1.00 100.90 ? 96   ALA C CA    1 
ATOM   4286  C  C     . ALA C 2  96   ? 512.758 -29.090 648.866 1.00 106.43 ? 96   ALA C C     1 
ATOM   4287  O  O     . ALA C 2  96   ? 513.210 -28.407 647.939 1.00 108.84 ? 96   ALA C O     1 
ATOM   4288  C  CB    . ALA C 2  96   ? 510.375 -28.336 648.991 1.00 102.09 ? 96   ALA C CB    1 
ATOM   4289  N  N     . ARG C 2  97   ? 513.099 -30.362 649.073 1.00 104.37 ? 97   ARG C N     1 
ATOM   4290  C  CA    . ARG C 2  97   ? 514.026 -31.071 648.193 1.00 109.14 ? 97   ARG C CA    1 
ATOM   4291  C  C     . ARG C 2  97   ? 513.327 -31.610 646.948 1.00 107.49 ? 97   ARG C C     1 
ATOM   4292  O  O     . ARG C 2  97   ? 512.370 -32.389 647.035 1.00 100.16 ? 97   ARG C O     1 
ATOM   4293  C  CB    . ARG C 2  97   ? 514.743 -32.192 648.941 1.00 112.04 ? 97   ARG C CB    1 
ATOM   4294  C  CG    . ARG C 2  97   ? 516.262 -31.941 649.075 1.00 113.42 ? 97   ARG C CG    1 
ATOM   4295  C  CD    . ARG C 2  97   ? 516.905 -32.993 649.956 1.00 115.28 ? 97   ARG C CD    1 
ATOM   4296  N  NE    . ARG C 2  97   ? 516.768 -32.555 651.354 1.00 121.31 ? 97   ARG C NE    1 
ATOM   4297  C  CZ    . ARG C 2  97   ? 517.194 -33.232 652.420 1.00 118.99 ? 97   ARG C CZ    1 
ATOM   4298  N  NH1   . ARG C 2  97   ? 517.799 -34.398 652.260 1.00 117.04 ? 97   ARG C NH1   1 
ATOM   4299  N  NH2   . ARG C 2  97   ? 516.992 -32.751 653.648 1.00 111.97 ? 97   ARG C NH2   1 
ATOM   4300  N  N     . LEU C 2  98   ? 513.790 -31.150 645.794 1.00 110.30 ? 98   LEU C N     1 
ATOM   4301  C  CA    . LEU C 2  98   ? 513.252 -31.502 644.492 1.00 113.19 ? 98   LEU C CA    1 
ATOM   4302  C  C     . LEU C 2  98   ? 514.349 -32.106 643.607 1.00 118.46 ? 98   LEU C C     1 
ATOM   4303  O  O     . LEU C 2  98   ? 515.505 -31.671 643.649 1.00 121.66 ? 98   LEU C O     1 
ATOM   4304  C  CB    . LEU C 2  98   ? 512.635 -30.253 643.830 1.00 114.56 ? 98   LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2  98   ? 511.520 -29.542 644.600 1.00 105.67 ? 98   LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2  98   ? 511.010 -28.314 643.839 1.00 99.60  ? 98   LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2  98   ? 510.404 -30.545 644.793 1.00 99.79  ? 98   LEU C CD2   1 
ATOM   4308  N  N     . GLN C 2  99   ? 513.996 -33.127 642.819 1.00 119.85 ? 99   GLN C N     1 
ATOM   4309  C  CA    . GLN C 2  99   ? 514.892 -33.681 641.806 1.00 117.93 ? 99   GLN C CA    1 
ATOM   4310  C  C     . GLN C 2  99   ? 514.278 -33.423 640.433 1.00 115.97 ? 99   GLN C C     1 
ATOM   4311  O  O     . GLN C 2  99   ? 513.147 -33.835 640.156 1.00 113.59 ? 99   GLN C O     1 
ATOM   4312  C  CB    . GLN C 2  99   ? 515.152 -35.179 642.019 1.00 116.48 ? 99   GLN C CB    1 
ATOM   4313  C  CG    . GLN C 2  99   ? 513.920 -36.065 641.826 1.00 121.05 ? 99   GLN C CG    1 
ATOM   4314  C  CD    . GLN C 2  99   ? 514.204 -37.558 641.916 1.00 128.40 ? 99   GLN C CD    1 
ATOM   4315  O  OE1   . GLN C 2  99   ? 513.871 -38.316 640.995 1.00 133.73 ? 99   GLN C OE1   1 
ATOM   4316  N  NE2   . GLN C 2  99   ? 514.850 -37.985 643.006 1.00 121.28 ? 99   GLN C NE2   1 
ATOM   4317  N  N     . LEU C 2  100  ? 515.038 -32.739 639.580 1.00 125.56 ? 100  LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  100  ? 514.688 -32.530 638.177 1.00 127.11 ? 100  LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  100  ? 515.085 -33.720 637.307 1.00 126.06 ? 100  LEU C C     1 
ATOM   4320  O  O     . LEU C 2  100  ? 516.233 -34.170 637.335 1.00 126.62 ? 100  LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  100  ? 515.371 -31.271 637.641 1.00 121.96 ? 100  LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  100  ? 515.062 -30.893 636.198 1.00 113.91 ? 100  LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  100  ? 513.562 -30.766 636.005 1.00 115.96 ? 100  LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  100  ? 515.780 -29.608 635.834 1.00 114.27 ? 100  LEU C CD2   1 
ATOM   4325  N  N     . ILE C 2  101  ? 514.144 -34.208 636.515 1.00 125.60 ? 101  ILE C N     1 
ATOM   4326  C  CA    . ILE C 2  101  ? 514.373 -35.320 635.607 1.00 126.62 ? 101  ILE C CA    1 
ATOM   4327  C  C     . ILE C 2  101  ? 514.014 -34.771 634.235 1.00 137.09 ? 101  ILE C C     1 
ATOM   4328  O  O     . ILE C 2  101  ? 513.054 -34.003 634.087 1.00 135.09 ? 101  ILE C O     1 
ATOM   4329  C  CB    . ILE C 2  101  ? 513.575 -36.602 635.950 1.00 120.24 ? 101  ILE C CB    1 
ATOM   4330  C  CG1   . ILE C 2  101  ? 513.700 -36.967 637.432 1.00 123.08 ? 101  ILE C CG1   1 
ATOM   4331  C  CG2   . ILE C 2  101  ? 514.087 -37.771 635.139 1.00 120.07 ? 101  ILE C CG2   1 
ATOM   4332  C  CD1   . ILE C 2  101  ? 512.817 -38.135 637.864 1.00 120.01 ? 101  ILE C CD1   1 
ATOM   4333  N  N     . HIS C 2  102  ? 514.826 -35.107 633.247 1.00 146.98 ? 102  HIS C N     1 
ATOM   4334  C  CA    . HIS C 2  102  ? 514.546 -34.802 631.852 1.00 147.50 ? 102  HIS C CA    1 
ATOM   4335  C  C     . HIS C 2  102  ? 513.963 -36.039 631.162 1.00 149.34 ? 102  HIS C C     1 
ATOM   4336  O  O     . HIS C 2  102  ? 514.660 -37.049 630.992 1.00 143.42 ? 102  HIS C O     1 
ATOM   4337  C  CB    . HIS C 2  102  ? 515.844 -34.316 631.209 1.00 144.67 ? 102  HIS C CB    1 
ATOM   4338  C  CG    . HIS C 2  102  ? 515.648 -33.399 630.044 1.00 153.74 ? 102  HIS C CG    1 
ATOM   4339  N  ND1   . HIS C 2  102  ? 516.658 -32.596 629.560 1.00 156.74 ? 102  HIS C ND1   1 
ATOM   4340  C  CD2   . HIS C 2  102  ? 514.569 -33.166 629.256 1.00 155.92 ? 102  HIS C CD2   1 
ATOM   4341  C  CE1   . HIS C 2  102  ? 516.209 -31.903 628.527 1.00 156.60 ? 102  HIS C CE1   1 
ATOM   4342  N  NE2   . HIS C 2  102  ? 514.944 -32.230 628.321 1.00 155.02 ? 102  HIS C NE2   1 
ATOM   4343  N  N     . LYS C 2  103  ? 512.665 -35.972 630.801 1.00 151.06 ? 103  LYS C N     1 
ATOM   4344  C  CA    . LYS C 2  103  ? 512.001 -37.131 630.199 1.00 154.01 ? 103  LYS C CA    1 
ATOM   4345  C  C     . LYS C 2  103  ? 512.618 -37.454 628.841 1.00 157.18 ? 103  LYS C C     1 
ATOM   4346  O  O     . LYS C 2  103  ? 512.596 -38.616 628.408 1.00 155.30 ? 103  LYS C O     1 
ATOM   4347  C  CB    . LYS C 2  103  ? 510.476 -36.913 630.073 1.00 146.81 ? 103  LYS C CB    1 
ATOM   4348  C  CG    . LYS C 2  103  ? 509.860 -37.038 628.650 1.00 146.79 ? 103  LYS C CG    1 
ATOM   4349  C  CD    . LYS C 2  103  ? 508.633 -36.152 628.416 1.00 138.62 ? 103  LYS C CD    1 
ATOM   4350  C  CE    . LYS C 2  103  ? 508.246 -36.120 626.936 1.00 134.67 ? 103  LYS C CE    1 
ATOM   4351  N  NZ    . LYS C 2  103  ? 507.476 -37.343 626.542 1.00 122.54 ? 103  LYS C NZ    1 
ATOM   4352  N  N     . ASP C 2  104  ? 513.124 -36.428 628.142 1.00 158.63 ? 104  ASP C N     1 
ATOM   4353  C  CA    . ASP C 2  104  ? 513.843 -36.622 626.881 1.00 155.99 ? 104  ASP C CA    1 
ATOM   4354  C  C     . ASP C 2  104  ? 515.234 -37.257 627.094 1.00 152.25 ? 104  ASP C C     1 
ATOM   4355  O  O     . ASP C 2  104  ? 515.526 -38.323 626.540 1.00 143.95 ? 104  ASP C O     1 
ATOM   4356  C  CB    . ASP C 2  104  ? 513.934 -35.269 626.150 1.00 158.18 ? 104  ASP C CB    1 
ATOM   4357  C  CG    . ASP C 2  104  ? 512.567 -34.526 626.070 1.00 161.18 ? 104  ASP C CG    1 
ATOM   4358  O  OD1   . ASP C 2  104  ? 511.504 -35.193 626.041 1.00 160.05 ? 104  ASP C OD1   1 
ATOM   4359  O  OD2   . ASP C 2  104  ? 512.556 -33.267 626.037 1.00 158.81 ? 104  ASP C OD2   1 
ATOM   4360  N  N     . THR C 2  105  ? 516.119 -36.598 627.871 1.00 155.03 ? 105  THR C N     1 
ATOM   4361  C  CA    . THR C 2  105  ? 517.518 -37.011 628.117 1.00 148.80 ? 105  THR C CA    1 
ATOM   4362  C  C     . THR C 2  105  ? 517.698 -38.180 629.101 1.00 147.51 ? 105  THR C C     1 
ATOM   4363  O  O     . THR C 2  105  ? 517.722 -39.354 628.713 1.00 137.43 ? 105  THR C O     1 
ATOM   4364  C  CB    . THR C 2  105  ? 518.365 -35.816 628.618 1.00 143.55 ? 105  THR C CB    1 
ATOM   4365  O  OG1   . THR C 2  105  ? 518.257 -34.716 627.709 1.00 138.87 ? 105  THR C OG1   1 
ATOM   4366  C  CG2   . THR C 2  105  ? 519.852 -36.187 628.753 1.00 130.81 ? 105  THR C CG2   1 
ATOM   4367  N  N     . GLY C 2  106  ? 517.870 -37.835 630.384 1.00 152.91 ? 106  GLY C N     1 
ATOM   4368  C  CA    . GLY C 2  106  ? 518.218 -38.724 631.481 1.00 151.63 ? 106  GLY C CA    1 
ATOM   4369  C  C     . GLY C 2  106  ? 518.778 -37.903 632.635 1.00 153.06 ? 106  GLY C C     1 
ATOM   4370  O  O     . GLY C 2  106  ? 518.893 -38.381 633.771 1.00 148.74 ? 106  GLY C O     1 
ATOM   4371  N  N     . LEU C 2  107  ? 519.090 -36.636 632.324 1.00 154.00 ? 107  LEU C N     1 
ATOM   4372  C  CA    . LEU C 2  107  ? 519.683 -35.669 633.251 1.00 149.64 ? 107  LEU C CA    1 
ATOM   4373  C  C     . LEU C 2  107  ? 518.914 -35.568 634.564 1.00 144.13 ? 107  LEU C C     1 
ATOM   4374  O  O     . LEU C 2  107  ? 517.680 -35.565 634.578 1.00 142.23 ? 107  LEU C O     1 
ATOM   4375  C  CB    . LEU C 2  107  ? 519.708 -34.289 632.558 1.00 150.12 ? 107  LEU C CB    1 
ATOM   4376  C  CG    . LEU C 2  107  ? 519.929 -32.928 633.246 1.00 145.33 ? 107  LEU C CG    1 
ATOM   4377  C  CD1   . LEU C 2  107  ? 521.237 -32.262 632.794 1.00 136.02 ? 107  LEU C CD1   1 
ATOM   4378  C  CD2   . LEU C 2  107  ? 518.724 -31.994 633.008 1.00 130.52 ? 107  LEU C CD2   1 
ATOM   4379  N  N     . ILE C 2  108  ? 519.658 -35.538 635.678 1.00 142.24 ? 108  ILE C N     1 
ATOM   4380  C  CA    . ILE C 2  108  ? 519.088 -35.370 637.022 1.00 142.67 ? 108  ILE C CA    1 
ATOM   4381  C  C     . ILE C 2  108  ? 519.904 -34.316 637.781 1.00 140.96 ? 108  ILE C C     1 
ATOM   4382  O  O     . ILE C 2  108  ? 521.083 -34.538 638.085 1.00 146.79 ? 108  ILE C O     1 
ATOM   4383  C  CB    . ILE C 2  108  ? 519.026 -36.690 637.812 1.00 137.59 ? 108  ILE C CB    1 
ATOM   4384  C  CG1   . ILE C 2  108  ? 518.195 -37.738 637.059 1.00 138.11 ? 108  ILE C CG1   1 
ATOM   4385  C  CG2   . ILE C 2  108  ? 518.433 -36.455 639.192 1.00 129.86 ? 108  ILE C CG2   1 
ATOM   4386  C  CD1   . ILE C 2  108  ? 517.918 -38.996 637.858 1.00 136.14 ? 108  ILE C CD1   1 
ATOM   4387  N  N     . LYS C 2  109  ? 519.279 -33.170 638.073 1.00 135.76 ? 109  LYS C N     1 
ATOM   4388  C  CA    . LYS C 2  109  ? 519.771 -32.138 638.990 1.00 132.48 ? 109  LYS C CA    1 
ATOM   4389  C  C     . LYS C 2  109  ? 518.820 -31.997 640.179 1.00 132.97 ? 109  LYS C C     1 
ATOM   4390  O  O     . LYS C 2  109  ? 517.608 -31.844 639.990 1.00 133.41 ? 109  LYS C O     1 
ATOM   4391  C  CB    . LYS C 2  109  ? 519.983 -30.778 638.296 1.00 125.66 ? 109  LYS C CB    1 
ATOM   4392  C  CG    . LYS C 2  109  ? 520.297 -29.631 639.288 1.00 123.65 ? 109  LYS C CG    1 
ATOM   4393  C  CD    . LYS C 2  109  ? 521.552 -29.844 640.166 1.00 125.84 ? 109  LYS C CD    1 
ATOM   4394  C  CE    . LYS C 2  109  ? 521.870 -28.593 641.015 1.00 120.40 ? 109  LYS C CE    1 
ATOM   4395  N  NZ    . LYS C 2  109  ? 522.872 -28.833 642.103 1.00 108.22 ? 109  LYS C NZ    1 
ATOM   4396  N  N     . GLU C 2  110  ? 519.366 -32.048 641.400 1.00 132.11 ? 110  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2  110  ? 518.586 -32.044 642.636 1.00 122.65 ? 110  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2  110  ? 519.063 -30.925 643.550 1.00 120.87 ? 110  GLU C C     1 
ATOM   4399  O  O     . GLU C 2  110  ? 520.269 -30.750 643.756 1.00 126.81 ? 110  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2  110  ? 518.759 -33.379 643.360 1.00 118.92 ? 110  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2  110  ? 518.188 -33.449 644.747 1.00 119.32 ? 110  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2  110  ? 518.488 -34.788 645.393 1.00 118.45 ? 110  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2  110  ? 518.700 -34.816 646.632 1.00 120.15 ? 110  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2  110  ? 518.533 -35.803 644.657 1.00 110.65 ? 110  GLU C OE2   1 
ATOM   4405  N  N     . ASP C 2  111  ? 518.122 -30.185 644.123 1.00 120.80 ? 111  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  111  ? 518.512 -29.072 644.971 1.00 125.67 ? 111  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  111  ? 517.363 -28.827 645.961 1.00 119.77 ? 111  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  111  ? 516.225 -29.244 645.733 1.00 121.06 ? 111  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  111  ? 518.875 -27.877 644.063 1.00 121.75 ? 111  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  111  ? 519.553 -26.741 644.809 1.00 129.98 ? 111  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  111  ? 520.352 -27.020 645.745 1.00 124.06 ? 111  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  111  ? 519.328 -25.573 644.411 1.00 132.79 ? 111  ASP C OD2   1 
ATOM   4413  N  N     . GLU C 2  112  ? 517.654 -28.169 647.074 1.00 107.81 ? 112  GLU C N     1 
ATOM   4414  C  CA    . GLU C 2  112  ? 516.626 -27.824 648.055 1.00 106.41 ? 112  GLU C CA    1 
ATOM   4415  C  C     . GLU C 2  112  ? 516.247 -26.352 647.897 1.00 109.97 ? 112  GLU C C     1 
ATOM   4416  O  O     . GLU C 2  112  ? 517.020 -25.469 648.281 1.00 114.70 ? 112  GLU C O     1 
ATOM   4417  C  CB    . GLU C 2  112  ? 517.130 -28.177 649.450 1.00 107.55 ? 112  GLU C CB    1 
ATOM   4418  C  CG    . GLU C 2  112  ? 516.170 -27.983 650.584 1.00 105.04 ? 112  GLU C CG    1 
ATOM   4419  C  CD    . GLU C 2  112  ? 516.876 -28.001 651.943 1.00 107.82 ? 112  GLU C CD    1 
ATOM   4420  O  OE1   . GLU C 2  112  ? 517.862 -27.247 652.141 1.00 104.37 ? 112  GLU C OE1   1 
ATOM   4421  O  OE2   . GLU C 2  112  ? 516.430 -28.774 652.820 1.00 107.60 ? 112  GLU C OE2   1 
ATOM   4422  N  N     . VAL C 2  113  ? 515.019 -26.087 647.403 1.00 106.53 ? 113  VAL C N     1 
ATOM   4423  C  CA    . VAL C 2  113  ? 514.550 -24.730 647.101 1.00 103.39 ? 113  VAL C CA    1 
ATOM   4424  C  C     . VAL C 2  113  ? 513.739 -24.139 648.250 1.00 105.92 ? 113  VAL C C     1 
ATOM   4425  O  O     . VAL C 2  113  ? 512.957 -24.835 648.916 1.00 102.40 ? 113  VAL C O     1 
ATOM   4426  C  CB    . VAL C 2  113  ? 513.706 -24.740 645.815 1.00 100.81 ? 113  VAL C CB    1 
ATOM   4427  C  CG1   . VAL C 2  113  ? 514.515 -25.252 644.694 1.00 108.92 ? 113  VAL C CG1   1 
ATOM   4428  C  CG2   . VAL C 2  113  ? 512.510 -25.652 645.984 1.00 103.99 ? 113  VAL C CG2   1 
ATOM   4429  N  N     . PHE C 2  114  ? 513.915 -22.830 648.461 1.00 106.71 ? 114  PHE C N     1 
ATOM   4430  C  CA    . PHE C 2  114  ? 513.255 -22.086 649.530 1.00 99.82  ? 114  PHE C CA    1 
ATOM   4431  C  C     . PHE C 2  114  ? 511.891 -21.590 649.058 1.00 103.11 ? 114  PHE C C     1 
ATOM   4432  O  O     . PHE C 2  114  ? 511.800 -20.847 648.071 1.00 100.42 ? 114  PHE C O     1 
ATOM   4433  C  CB    . PHE C 2  114  ? 514.126 -20.903 649.963 1.00 99.39  ? 114  PHE C CB    1 
ATOM   4434  C  CG    . PHE C 2  114  ? 513.493 -20.012 651.005 1.00 107.69 ? 114  PHE C CG    1 
ATOM   4435  C  CD1   . PHE C 2  114  ? 513.162 -20.507 652.259 1.00 105.59 ? 114  PHE C CD1   1 
ATOM   4436  C  CD2   . PHE C 2  114  ? 513.185 -18.688 650.718 1.00 110.99 ? 114  PHE C CD2   1 
ATOM   4437  C  CE1   . PHE C 2  114  ? 512.577 -19.685 653.221 1.00 101.69 ? 114  PHE C CE1   1 
ATOM   4438  C  CE2   . PHE C 2  114  ? 512.584 -17.867 651.676 1.00 109.30 ? 114  PHE C CE2   1 
ATOM   4439  C  CZ    . PHE C 2  114  ? 512.289 -18.367 652.926 1.00 104.07 ? 114  PHE C CZ    1 
ATOM   4440  N  N     . LEU C 2  115  ? 510.835 -22.029 649.747 1.00 105.53 ? 115  LEU C N     1 
ATOM   4441  C  CA    . LEU C 2  115  ? 509.453 -21.713 649.413 1.00 100.29 ? 115  LEU C CA    1 
ATOM   4442  C  C     . LEU C 2  115  ? 508.867 -20.568 650.239 1.00 106.97 ? 115  LEU C C     1 
ATOM   4443  O  O     . LEU C 2  115  ? 507.675 -20.278 650.092 1.00 111.86 ? 115  LEU C O     1 
ATOM   4444  C  CB    . LEU C 2  115  ? 508.582 -22.959 649.604 1.00 94.84  ? 115  LEU C CB    1 
ATOM   4445  C  CG    . LEU C 2  115  ? 508.946 -24.174 648.766 1.00 97.52  ? 115  LEU C CG    1 
ATOM   4446  C  CD1   . LEU C 2  115  ? 507.905 -25.294 648.863 1.00 84.14  ? 115  LEU C CD1   1 
ATOM   4447  C  CD2   . LEU C 2  115  ? 509.062 -23.676 647.338 1.00 96.13  ? 115  LEU C CD2   1 
ATOM   4448  N  N     . GLY C 2  116  ? 509.651 -19.897 651.076 1.00 104.42 ? 116  GLY C N     1 
ATOM   4449  C  CA    . GLY C 2  116  ? 509.094 -18.866 651.944 1.00 101.82 ? 116  GLY C CA    1 
ATOM   4450  C  C     . GLY C 2  116  ? 508.876 -19.383 653.355 1.00 100.22 ? 116  GLY C C     1 
ATOM   4451  O  O     . GLY C 2  116  ? 509.381 -20.439 653.744 1.00 102.08 ? 116  GLY C O     1 
ATOM   4452  N  N     . HIS C 2  117  ? 508.072 -18.643 654.123 1.00 99.12  ? 117  HIS C N     1 
ATOM   4453  C  CA    . HIS C 2  117  ? 507.812 -18.967 655.526 1.00 89.15  ? 117  HIS C CA    1 
ATOM   4454  C  C     . HIS C 2  117  ? 506.375 -19.462 655.753 1.00 82.48  ? 117  HIS C C     1 
ATOM   4455  O  O     . HIS C 2  117  ? 505.450 -19.096 655.022 1.00 82.72  ? 117  HIS C O     1 
ATOM   4456  C  CB    . HIS C 2  117  ? 508.084 -17.741 656.396 1.00 87.57  ? 117  HIS C CB    1 
ATOM   4457  C  CG    . HIS C 2  117  ? 509.518 -17.310 656.400 1.00 91.86  ? 117  HIS C CG    1 
ATOM   4458  N  ND1   . HIS C 2  117  ? 510.373 -17.547 657.456 1.00 94.08  ? 117  HIS C ND1   1 
ATOM   4459  C  CD2   . HIS C 2  117  ? 510.235 -16.616 655.482 1.00 97.02  ? 117  HIS C CD2   1 
ATOM   4460  C  CE1   . HIS C 2  117  ? 511.562 -17.037 657.182 1.00 100.05 ? 117  HIS C CE1   1 
ATOM   4461  N  NE2   . HIS C 2  117  ? 511.504 -16.465 655.990 1.00 102.66 ? 117  HIS C NE2   1 
ATOM   4462  N  N     . ILE C 2  118  ? 506.172 -20.266 656.793 1.00 79.98  ? 118  ILE C N     1 
ATOM   4463  C  CA    . ILE C 2  118  ? 504.841 -20.693 657.212 1.00 79.50  ? 118  ILE C CA    1 
ATOM   4464  C  C     . ILE C 2  118  ? 504.616 -20.265 658.659 1.00 84.85  ? 118  ILE C C     1 
ATOM   4465  O  O     . ILE C 2  118  ? 505.492 -20.480 659.499 1.00 90.16  ? 118  ILE C O     1 
ATOM   4466  C  CB    . ILE C 2  118  ? 504.660 -22.216 657.117 1.00 70.99  ? 118  ILE C CB    1 
ATOM   4467  C  CG1   . ILE C 2  118  ? 504.305 -22.656 655.742 1.00 75.95  ? 118  ILE C CG1   1 
ATOM   4468  C  CG2   . ILE C 2  118  ? 503.490 -22.656 657.959 1.00 72.55  ? 118  ILE C CG2   1 
ATOM   4469  C  CD1   . ILE C 2  118  ? 504.015 -24.127 655.785 1.00 84.39  ? 118  ILE C CD1   1 
ATOM   4470  N  N     . PRO C 2  119  ? 503.462 -19.689 658.999 1.00 77.91  ? 119  PRO C N     1 
ATOM   4471  C  CA    . PRO C 2  119  ? 503.241 -19.235 660.375 1.00 83.02  ? 119  PRO C CA    1 
ATOM   4472  C  C     . PRO C 2  119  ? 503.114 -20.407 661.364 1.00 83.92  ? 119  PRO C C     1 
ATOM   4473  O  O     . PRO C 2  119  ? 502.515 -21.443 661.053 1.00 79.95  ? 119  PRO C O     1 
ATOM   4474  C  CB    . PRO C 2  119  ? 501.937 -18.441 660.261 1.00 80.73  ? 119  PRO C CB    1 
ATOM   4475  C  CG    . PRO C 2  119  ? 501.907 -17.976 658.872 1.00 71.95  ? 119  PRO C CG    1 
ATOM   4476  C  CD    . PRO C 2  119  ? 502.465 -19.111 658.087 1.00 75.48  ? 119  PRO C CD    1 
ATOM   4477  N  N     . LEU C 2  120  ? 503.719 -20.260 662.550 1.00 79.41  ? 120  LEU C N     1 
ATOM   4478  C  CA    . LEU C 2  120  ? 503.622 -21.286 663.585 1.00 83.81  ? 120  LEU C CA    1 
ATOM   4479  C  C     . LEU C 2  120  ? 502.582 -20.916 664.640 1.00 82.26  ? 120  LEU C C     1 
ATOM   4480  O  O     . LEU C 2  120  ? 502.398 -19.733 664.961 1.00 76.93  ? 120  LEU C O     1 
ATOM   4481  C  CB    . LEU C 2  120  ? 504.968 -21.548 664.261 1.00 86.07  ? 120  LEU C CB    1 
ATOM   4482  C  CG    . LEU C 2  120  ? 506.122 -22.046 663.412 1.00 86.29  ? 120  LEU C CG    1 
ATOM   4483  C  CD1   . LEU C 2  120  ? 507.341 -22.144 664.299 1.00 89.19  ? 120  LEU C CD1   1 
ATOM   4484  C  CD2   . LEU C 2  120  ? 505.746 -23.424 662.880 1.00 81.00  ? 120  LEU C CD2   1 
ATOM   4485  N  N     . MET C 2  121  ? 501.863 -21.946 665.122 1.00 78.91  ? 121  MET C N     1 
ATOM   4486  C  CA    . MET C 2  121  ? 500.922 -21.826 666.238 1.00 80.45  ? 121  MET C CA    1 
ATOM   4487  C  C     . MET C 2  121  ? 501.629 -21.883 667.600 1.00 81.44  ? 121  MET C C     1 
ATOM   4488  O  O     . MET C 2  121  ? 502.462 -22.759 667.853 1.00 81.96  ? 121  MET C O     1 
ATOM   4489  C  CB    . MET C 2  121  ? 499.870 -22.936 666.138 1.00 75.11  ? 121  MET C CB    1 
ATOM   4490  C  CG    . MET C 2  121  ? 498.855 -22.967 667.254 1.00 78.40  ? 121  MET C CG    1 
ATOM   4491  S  SD    . MET C 2  121  ? 497.608 -24.270 667.109 1.00 82.51  ? 121  MET C SD    1 
ATOM   4492  C  CE    . MET C 2  121  ? 496.535 -23.578 665.848 1.00 76.14  ? 121  MET C CE    1 
ATOM   4493  N  N     . THR C 2  122  ? 501.230 -20.991 668.507 1.00 77.16  ? 122  THR C N     1 
ATOM   4494  C  CA    . THR C 2  122  ? 501.779 -20.971 669.852 1.00 79.50  ? 122  THR C CA    1 
ATOM   4495  C  C     . THR C 2  122  ? 501.217 -22.122 670.698 1.00 79.75  ? 122  THR C C     1 
ATOM   4496  O  O     . THR C 2  122  ? 500.426 -22.950 670.240 1.00 77.98  ? 122  THR C O     1 
ATOM   4497  C  CB    . THR C 2  122  ? 501.468 -19.628 670.501 1.00 86.71  ? 122  THR C CB    1 
ATOM   4498  O  OG1   . THR C 2  122  ? 500.045 -19.448 670.569 1.00 87.24  ? 122  THR C OG1   1 
ATOM   4499  C  CG2   . THR C 2  122  ? 502.036 -18.492 669.588 1.00 71.03  ? 122  THR C CG2   1 
ATOM   4500  N  N     . GLU C 2  123  ? 501.650 -22.182 671.962 1.00 81.38  ? 123  GLU C N     1 
ATOM   4501  C  CA    . GLU C 2  123  ? 501.228 -23.285 672.819 1.00 87.00  ? 123  GLU C CA    1 
ATOM   4502  C  C     . GLU C 2  123  ? 499.736 -23.236 673.151 1.00 87.32  ? 123  GLU C C     1 
ATOM   4503  O  O     . GLU C 2  123  ? 499.129 -24.289 673.396 1.00 88.26  ? 123  GLU C O     1 
ATOM   4504  C  CB    . GLU C 2  123  ? 502.068 -23.362 674.095 1.00 93.81  ? 123  GLU C CB    1 
ATOM   4505  C  CG    . GLU C 2  123  ? 502.115 -24.819 674.644 1.00 101.38 ? 123  GLU C CG    1 
ATOM   4506  C  CD    . GLU C 2  123  ? 502.900 -24.981 675.956 1.00 111.84 ? 123  GLU C CD    1 
ATOM   4507  O  OE1   . GLU C 2  123  ? 503.283 -26.136 676.287 1.00 111.83 ? 123  GLU C OE1   1 
ATOM   4508  O  OE2   . GLU C 2  123  ? 503.087 -23.965 676.675 1.00 108.61 ? 123  GLU C OE2   1 
ATOM   4509  N  N     . ASP C 2  124  ? 499.131 -22.042 673.214 1.00 83.78  ? 124  ASP C N     1 
ATOM   4510  C  CA    . ASP C 2  124  ? 497.738 -21.950 673.656 1.00 87.58  ? 124  ASP C CA    1 
ATOM   4511  C  C     . ASP C 2  124  ? 496.758 -22.005 672.489 1.00 85.25  ? 124  ASP C C     1 
ATOM   4512  O  O     . ASP C 2  124  ? 495.542 -21.914 672.698 1.00 84.29  ? 124  ASP C O     1 
ATOM   4513  C  CB    . ASP C 2  124  ? 497.487 -20.691 674.535 1.00 87.54  ? 124  ASP C CB    1 
ATOM   4514  C  CG    . ASP C 2  124  ? 497.724 -19.348 673.812 1.00 85.04  ? 124  ASP C CG    1 
ATOM   4515  O  OD1   . ASP C 2  124  ? 498.895 -18.937 673.627 1.00 91.26  ? 124  ASP C OD1   1 
ATOM   4516  O  OD2   . ASP C 2  124  ? 496.721 -18.653 673.516 1.00 76.47  ? 124  ASP C OD2   1 
ATOM   4517  N  N     . GLY C 2  125  ? 497.252 -22.230 671.282 1.00 83.85  ? 125  GLY C N     1 
ATOM   4518  C  CA    . GLY C 2  125  ? 496.382 -22.404 670.152 1.00 77.47  ? 125  GLY C CA    1 
ATOM   4519  C  C     . GLY C 2  125  ? 496.127 -21.170 669.334 1.00 77.28  ? 125  GLY C C     1 
ATOM   4520  O  O     . GLY C 2  125  ? 495.130 -21.139 668.606 1.00 81.09  ? 125  GLY C O     1 
ATOM   4521  N  N     . SER C 2  126  ? 496.944 -20.132 669.466 1.00 75.00  ? 126  SER C N     1 
ATOM   4522  C  CA    . SER C 2  126  ? 496.744 -18.918 668.677 1.00 77.87  ? 126  SER C CA    1 
ATOM   4523  C  C     . SER C 2  126  ? 497.933 -18.670 667.726 1.00 82.11  ? 126  SER C C     1 
ATOM   4524  O  O     . SER C 2  126  ? 498.906 -19.425 667.682 1.00 83.78  ? 126  SER C O     1 
ATOM   4525  C  CB    . SER C 2  126  ? 496.489 -17.732 669.613 1.00 81.43  ? 126  SER C CB    1 
ATOM   4526  O  OG    . SER C 2  126  ? 497.535 -17.582 670.575 1.00 87.31  ? 126  SER C OG    1 
ATOM   4527  N  N     . PHE C 2  127  ? 497.834 -17.605 666.933 1.00 75.73  ? 127  PHE C N     1 
ATOM   4528  C  CA    . PHE C 2  127  ? 498.857 -17.220 665.975 1.00 72.34  ? 127  PHE C CA    1 
ATOM   4529  C  C     . PHE C 2  127  ? 499.291 -15.780 666.203 1.00 76.80  ? 127  PHE C C     1 
ATOM   4530  O  O     . PHE C 2  127  ? 498.612 -15.005 666.876 1.00 80.84  ? 127  PHE C O     1 
ATOM   4531  C  CB    . PHE C 2  127  ? 498.368 -17.385 664.544 1.00 78.14  ? 127  PHE C CB    1 
ATOM   4532  C  CG    . PHE C 2  127  ? 498.172 -18.816 664.114 1.00 81.63  ? 127  PHE C CG    1 
ATOM   4533  C  CD1   . PHE C 2  127  ? 499.262 -19.597 663.756 1.00 81.32  ? 127  PHE C CD1   1 
ATOM   4534  C  CD2   . PHE C 2  127  ? 496.899 -19.380 664.048 1.00 80.73  ? 127  PHE C CD2   1 
ATOM   4535  C  CE1   . PHE C 2  127  ? 499.077 -20.913 663.332 1.00 81.94  ? 127  PHE C CE1   1 
ATOM   4536  C  CE2   . PHE C 2  127  ? 496.707 -20.702 663.630 1.00 77.04  ? 127  PHE C CE2   1 
ATOM   4537  C  CZ    . PHE C 2  127  ? 497.791 -21.467 663.278 1.00 77.07  ? 127  PHE C CZ    1 
ATOM   4538  N  N     . ILE C 2  128  ? 500.468 -15.443 665.686 1.00 77.10  ? 128  ILE C N     1 
ATOM   4539  C  CA    . ILE C 2  128  ? 500.961 -14.068 665.659 1.00 77.47  ? 128  ILE C CA    1 
ATOM   4540  C  C     . ILE C 2  128  ? 501.180 -13.673 664.201 1.00 84.49  ? 128  ILE C C     1 
ATOM   4541  O  O     . ILE C 2  128  ? 501.985 -14.303 663.500 1.00 88.69  ? 128  ILE C O     1 
ATOM   4542  C  CB    . ILE C 2  128  ? 502.246 -13.890 666.482 1.00 77.70  ? 128  ILE C CB    1 
ATOM   4543  C  CG1   . ILE C 2  128  ? 501.989 -14.347 667.932 1.00 76.16  ? 128  ILE C CG1   1 
ATOM   4544  C  CG2   . ILE C 2  128  ? 502.738 -12.425 666.387 1.00 72.04  ? 128  ILE C CG2   1 
ATOM   4545  C  CD1   . ILE C 2  128  ? 503.236 -14.538 668.814 1.00 76.88  ? 128  ILE C CD1   1 
ATOM   4546  N  N     . ILE C 2  129  ? 500.352 -12.765 663.695 1.00 82.80  ? 129  ILE C N     1 
ATOM   4547  C  CA    . ILE C 2  129  ? 500.373 -12.345 662.295 1.00 77.77  ? 129  ILE C CA    1 
ATOM   4548  C  C     . ILE C 2  129  ? 500.590 -10.839 662.256 1.00 84.95  ? 129  ILE C C     1 
ATOM   4549  O  O     . ILE C 2  129  ? 499.714 -10.081 662.689 1.00 90.62  ? 129  ILE C O     1 
ATOM   4550  C  CB    . ILE C 2  129  ? 499.084 -12.706 661.556 1.00 70.49  ? 129  ILE C CB    1 
ATOM   4551  C  CG1   . ILE C 2  129  ? 498.780 -14.206 661.680 1.00 74.24  ? 129  ILE C CG1   1 
ATOM   4552  C  CG2   . ILE C 2  129  ? 499.090 -12.092 660.169 1.00 77.02  ? 129  ILE C CG2   1 
ATOM   4553  C  CD1   . ILE C 2  129  ? 499.791 -15.138 661.094 1.00 72.18  ? 129  ILE C CD1   1 
ATOM   4554  N  N     . ASN C 2  130  ? 501.757 -10.396 661.794 1.00 87.68  ? 130  ASN C N     1 
ATOM   4555  C  CA    . ASN C 2  130  ? 502.095 -8.969  661.814 1.00 88.47  ? 130  ASN C CA    1 
ATOM   4556  C  C     . ASN C 2  130  ? 501.978 -8.337  663.206 1.00 90.46  ? 130  ASN C C     1 
ATOM   4557  O  O     . ASN C 2  130  ? 501.439 -7.236  663.357 1.00 91.86  ? 130  ASN C O     1 
ATOM   4558  C  CB    . ASN C 2  130  ? 501.216 -8.196  660.837 1.00 89.12  ? 130  ASN C CB    1 
ATOM   4559  C  CG    . ASN C 2  130  ? 501.541 -8.481  659.408 1.00 98.04  ? 130  ASN C CG    1 
ATOM   4560  O  OD1   . ASN C 2  130  ? 500.655 -8.881  658.648 1.00 99.46  ? 130  ASN C OD1   1 
ATOM   4561  N  ND2   . ASN C 2  130  ? 502.807 -8.285  659.016 1.00 104.91 ? 130  ASN C ND2   1 
ATOM   4562  N  N     . GLY C 2  131  ? 502.392 -9.050  664.253 1.00 86.89  ? 131  GLY C N     1 
ATOM   4563  C  CA    . GLY C 2  131  ? 502.430 -8.438  665.568 1.00 89.77  ? 131  GLY C CA    1 
ATOM   4564  C  C     . GLY C 2  131  ? 501.175 -8.587  666.395 1.00 90.71  ? 131  GLY C C     1 
ATOM   4565  O  O     . GLY C 2  131  ? 501.207 -8.299  667.599 1.00 88.72  ? 131  GLY C O     1 
ATOM   4566  N  N     . ALA C 2  132  ? 500.058 -8.951  665.771 1.00 91.06  ? 132  ALA C N     1 
ATOM   4567  C  CA    . ALA C 2  132  ? 498.779 -9.092  666.450 1.00 79.88  ? 132  ALA C CA    1 
ATOM   4568  C  C     . ALA C 2  132  ? 498.467 -10.572 666.629 1.00 75.30  ? 132  ALA C C     1 
ATOM   4569  O  O     . ALA C 2  132  ? 498.695 -11.379 665.732 1.00 79.62  ? 132  ALA C O     1 
ATOM   4570  C  CB    . ALA C 2  132  ? 497.671 -8.411  665.654 1.00 81.76  ? 132  ALA C CB    1 
ATOM   4571  N  N     . ASP C 2  133  ? 497.925 -10.921 667.773 1.00 72.87  ? 133  ASP C N     1 
ATOM   4572  C  CA    . ASP C 2  133  ? 497.582 -12.301 668.060 1.00 70.16  ? 133  ASP C CA    1 
ATOM   4573  C  C     . ASP C 2  133  ? 496.271 -12.602 667.308 1.00 69.67  ? 133  ASP C C     1 
ATOM   4574  O  O     . ASP C 2  133  ? 495.402 -11.734 667.239 1.00 71.77  ? 133  ASP C O     1 
ATOM   4575  C  CB    . ASP C 2  133  ? 497.437 -12.482 669.580 1.00 82.83  ? 133  ASP C CB    1 
ATOM   4576  C  CG    . ASP C 2  133  ? 498.781 -12.840 670.297 1.00 81.62  ? 133  ASP C CG    1 
ATOM   4577  O  OD1   . ASP C 2  133  ? 499.773 -12.069 670.169 1.00 72.54  ? 133  ASP C OD1   1 
ATOM   4578  O  OD2   . ASP C 2  133  ? 498.858 -13.910 670.955 1.00 83.66  ? 133  ASP C OD2   1 
ATOM   4579  N  N     . ARG C 2  134  ? 496.170 -13.749 666.619 1.00 73.96  ? 134  ARG C N     1 
ATOM   4580  C  CA    . ARG C 2  134  ? 494.964 -14.125 665.848 1.00 72.37  ? 134  ARG C CA    1 
ATOM   4581  C  C     . ARG C 2  134  ? 494.462 -15.550 666.134 1.00 73.94  ? 134  ARG C C     1 
ATOM   4582  O  O     . ARG C 2  134  ? 495.200 -16.395 666.646 1.00 84.05  ? 134  ARG C O     1 
ATOM   4583  C  CB    . ARG C 2  134  ? 495.207 -13.989 664.350 1.00 76.94  ? 134  ARG C CB    1 
ATOM   4584  C  CG    . ARG C 2  134  ? 495.461 -12.568 663.913 1.00 79.66  ? 134  ARG C CG    1 
ATOM   4585  C  CD    . ARG C 2  134  ? 495.415 -12.431 662.399 1.00 76.40  ? 134  ARG C CD    1 
ATOM   4586  N  NE    . ARG C 2  134  ? 494.846 -11.126 662.124 1.00 82.42  ? 134  ARG C NE    1 
ATOM   4587  C  CZ    . ARG C 2  134  ? 493.597 -10.978 661.690 1.00 84.49  ? 134  ARG C CZ    1 
ATOM   4588  N  NH1   . ARG C 2  134  ? 492.849 -12.057 661.459 1.00 70.52  ? 134  ARG C NH1   1 
ATOM   4589  N  NH2   . ARG C 2  134  ? 493.090 -9.768  661.489 1.00 95.84  ? 134  ARG C NH2   1 
ATOM   4590  N  N     . VAL C 2  135  ? 493.167 -15.802 665.869 1.00 62.73  ? 135  VAL C N     1 
ATOM   4591  C  CA    . VAL C 2  135  ? 492.556 -17.132 666.018 1.00 69.70  ? 135  VAL C CA    1 
ATOM   4592  C  C     . VAL C 2  135  ? 491.943 -17.586 664.702 1.00 70.52  ? 135  VAL C C     1 
ATOM   4593  O  O     . VAL C 2  135  ? 491.232 -16.801 664.068 1.00 73.98  ? 135  VAL C O     1 
ATOM   4594  C  CB    . VAL C 2  135  ? 491.486 -17.129 667.136 1.00 75.16  ? 135  VAL C CB    1 
ATOM   4595  C  CG1   . VAL C 2  135  ? 490.680 -18.425 667.143 1.00 74.71  ? 135  VAL C CG1   1 
ATOM   4596  C  CG2   . VAL C 2  135  ? 492.140 -16.929 668.505 1.00 72.96  ? 135  VAL C CG2   1 
ATOM   4597  N  N     . ILE C 2  136  ? 492.107 -18.874 664.344 1.00 72.42  ? 136  ILE C N     1 
ATOM   4598  C  CA    . ILE C 2  136  ? 491.400 -19.469 663.188 1.00 78.59  ? 136  ILE C CA    1 
ATOM   4599  C  C     . ILE C 2  136  ? 490.172 -20.264 663.650 1.00 74.59  ? 136  ILE C C     1 
ATOM   4600  O  O     . ILE C 2  136  ? 490.301 -21.323 664.278 1.00 75.92  ? 136  ILE C O     1 
ATOM   4601  C  CB    . ILE C 2  136  ? 492.335 -20.360 662.337 1.00 78.60  ? 136  ILE C CB    1 
ATOM   4602  C  CG1   . ILE C 2  136  ? 493.618 -19.635 661.944 1.00 71.17  ? 136  ILE C CG1   1 
ATOM   4603  C  CG2   . ILE C 2  136  ? 491.669 -20.882 661.056 1.00 69.38  ? 136  ILE C CG2   1 
ATOM   4604  C  CD1   . ILE C 2  136  ? 493.348 -18.425 661.156 1.00 69.70  ? 136  ILE C CD1   1 
ATOM   4605  N  N     . VAL C 2  137  ? 488.974 -19.766 663.316 1.00 69.13  ? 137  VAL C N     1 
ATOM   4606  C  CA    . VAL C 2  137  ? 487.715 -20.392 663.732 1.00 74.24  ? 137  VAL C CA    1 
ATOM   4607  C  C     . VAL C 2  137  ? 487.362 -21.569 662.834 1.00 70.44  ? 137  VAL C C     1 
ATOM   4608  O  O     . VAL C 2  137  ? 487.282 -21.416 661.616 1.00 76.59  ? 137  VAL C O     1 
ATOM   4609  C  CB    . VAL C 2  137  ? 486.567 -19.368 663.770 1.00 75.56  ? 137  VAL C CB    1 
ATOM   4610  C  CG1   . VAL C 2  137  ? 485.244 -20.077 663.974 1.00 72.94  ? 137  VAL C CG1   1 
ATOM   4611  C  CG2   . VAL C 2  137  ? 486.759 -18.411 664.927 1.00 73.06  ? 137  VAL C CG2   1 
ATOM   4612  N  N     . SER C 2  138  ? 487.057 -22.713 663.441 1.00 70.50  ? 138  SER C N     1 
ATOM   4613  C  CA    . SER C 2  138  ? 486.599 -23.901 662.719 1.00 70.96  ? 138  SER C CA    1 
ATOM   4614  C  C     . SER C 2  138  ? 485.311 -23.614 661.925 1.00 72.96  ? 138  SER C C     1 
ATOM   4615  O  O     . SER C 2  138  ? 484.548 -22.699 662.239 1.00 76.95  ? 138  SER C O     1 
ATOM   4616  C  CB    . SER C 2  138  ? 486.353 -25.046 663.702 1.00 77.21  ? 138  SER C CB    1 
ATOM   4617  O  OG    . SER C 2  138  ? 487.333 -25.070 664.737 1.00 91.19  ? 138  SER C OG    1 
ATOM   4618  N  N     . GLN C 2  139  ? 485.119 -24.335 660.824 1.00 74.40  ? 139  GLN C N     1 
ATOM   4619  C  CA    . GLN C 2  139  ? 483.972 -24.131 659.945 1.00 78.42  ? 139  GLN C CA    1 
ATOM   4620  C  C     . GLN C 2  139  ? 483.151 -25.415 659.825 1.00 80.69  ? 139  GLN C C     1 
ATOM   4621  O  O     . GLN C 2  139  ? 483.686 -26.460 659.439 1.00 84.84  ? 139  GLN C O     1 
ATOM   4622  C  CB    . GLN C 2  139  ? 484.437 -23.653 658.557 1.00 81.44  ? 139  GLN C CB    1 
ATOM   4623  C  CG    . GLN C 2  139  ? 483.349 -23.646 657.474 1.00 83.55  ? 139  GLN C CG    1 
ATOM   4624  C  CD    . GLN C 2  139  ? 483.855 -23.221 656.093 1.00 92.04  ? 139  GLN C CD    1 
ATOM   4625  O  OE1   . GLN C 2  139  ? 484.206 -24.061 655.247 1.00 91.71  ? 139  GLN C OE1   1 
ATOM   4626  N  NE2   . GLN C 2  139  ? 483.878 -21.911 655.856 1.00 93.63  ? 139  GLN C NE2   1 
ATOM   4627  N  N     . ILE C 2  140  ? 481.858 -25.352 660.194 1.00 78.91  ? 140  ILE C N     1 
ATOM   4628  C  CA    . ILE C 2  140  ? 480.940 -26.474 659.976 1.00 80.79  ? 140  ILE C CA    1 
ATOM   4629  C  C     . ILE C 2  140  ? 480.461 -26.419 658.517 1.00 82.12  ? 140  ILE C C     1 
ATOM   4630  O  O     . ILE C 2  140  ? 480.236 -25.327 657.969 1.00 84.84  ? 140  ILE C O     1 
ATOM   4631  C  CB    . ILE C 2  140  ? 479.775 -26.421 661.004 1.00 76.00  ? 140  ILE C CB    1 
ATOM   4632  C  CG1   . ILE C 2  140  ? 478.960 -27.716 661.027 1.00 74.72  ? 140  ILE C CG1   1 
ATOM   4633  C  CG2   . ILE C 2  140  ? 478.858 -25.228 660.787 1.00 79.29  ? 140  ILE C CG2   1 
ATOM   4634  C  CD1   . ILE C 2  140  ? 478.192 -27.931 662.267 1.00 62.05  ? 140  ILE C CD1   1 
ATOM   4635  N  N     . HIS C 2  141  ? 480.237 -27.585 657.886 1.00 74.96  ? 141  HIS C N     1 
ATOM   4636  C  CA    . HIS C 2  141  ? 479.719 -27.608 656.513 1.00 79.88  ? 141  HIS C CA    1 
ATOM   4637  C  C     . HIS C 2  141  ? 479.174 -28.994 656.220 1.00 80.62  ? 141  HIS C C     1 
ATOM   4638  O  O     . HIS C 2  141  ? 479.319 -29.909 657.028 1.00 82.36  ? 141  HIS C O     1 
ATOM   4639  C  CB    . HIS C 2  141  ? 480.828 -27.263 655.503 1.00 86.03  ? 141  HIS C CB    1 
ATOM   4640  C  CG    . HIS C 2  141  ? 481.849 -28.358 655.311 1.00 88.85  ? 141  HIS C CG    1 
ATOM   4641  N  ND1   . HIS C 2  141  ? 482.375 -28.680 654.075 1.00 86.90  ? 141  HIS C ND1   1 
ATOM   4642  C  CD2   . HIS C 2  141  ? 482.361 -29.268 656.179 1.00 83.21  ? 141  HIS C CD2   1 
ATOM   4643  C  CE1   . HIS C 2  141  ? 483.219 -29.690 654.206 1.00 85.99  ? 141  HIS C CE1   1 
ATOM   4644  N  NE2   . HIS C 2  141  ? 483.219 -30.073 655.470 1.00 81.69  ? 141  HIS C NE2   1 
ATOM   4645  N  N     . ARG C 2  142  ? 478.573 -29.156 655.038 1.00 86.06  ? 142  ARG C N     1 
ATOM   4646  C  CA    . ARG C 2  142  ? 478.072 -30.471 654.646 1.00 93.43  ? 142  ARG C CA    1 
ATOM   4647  C  C     . ARG C 2  142  ? 479.233 -31.410 654.316 1.00 92.58  ? 142  ARG C C     1 
ATOM   4648  O  O     . ARG C 2  142  ? 480.082 -31.099 653.474 1.00 94.04  ? 142  ARG C O     1 
ATOM   4649  C  CB    . ARG C 2  142  ? 477.101 -30.377 653.467 1.00 96.32  ? 142  ARG C CB    1 
ATOM   4650  C  CG    . ARG C 2  142  ? 475.860 -29.566 653.780 1.00 97.92  ? 142  ARG C CG    1 
ATOM   4651  C  CD    . ARG C 2  142  ? 474.821 -29.716 652.685 1.00 103.84 ? 142  ARG C CD    1 
ATOM   4652  N  NE    . ARG C 2  142  ? 474.420 -31.117 652.519 1.00 107.71 ? 142  ARG C NE    1 
ATOM   4653  C  CZ    . ARG C 2  142  ? 473.645 -31.580 651.534 1.00 107.59 ? 142  ARG C CZ    1 
ATOM   4654  N  NH1   . ARG C 2  142  ? 473.170 -30.759 650.603 1.00 102.97 ? 142  ARG C NH1   1 
ATOM   4655  N  NH2   . ARG C 2  142  ? 473.333 -32.870 651.483 1.00 104.94 ? 142  ARG C NH2   1 
ATOM   4656  N  N     . SER C 2  143  ? 479.216 -32.589 654.935 1.00 89.11  ? 143  SER C N     1 
ATOM   4657  C  CA    . SER C 2  143  ? 480.212 -33.619 654.672 1.00 90.59  ? 143  SER C CA    1 
ATOM   4658  C  C     . SER C 2  143  ? 480.111 -34.132 653.238 1.00 96.33  ? 143  SER C C     1 
ATOM   4659  O  O     . SER C 2  143  ? 479.005 -34.253 652.702 1.00 96.72  ? 143  SER C O     1 
ATOM   4660  C  CB    . SER C 2  143  ? 480.012 -34.778 655.654 1.00 91.18  ? 143  SER C CB    1 
ATOM   4661  O  OG    . SER C 2  143  ? 480.609 -35.980 655.200 1.00 94.11  ? 143  SER C OG    1 
ATOM   4662  N  N     . PRO C 2  144  ? 481.244 -34.353 652.561 1.00 97.07  ? 144  PRO C N     1 
ATOM   4663  C  CA    . PRO C 2  144  ? 481.195 -35.053 651.274 1.00 98.93  ? 144  PRO C CA    1 
ATOM   4664  C  C     . PRO C 2  144  ? 480.624 -36.455 651.436 1.00 100.29 ? 144  PRO C C     1 
ATOM   4665  O  O     . PRO C 2  144  ? 480.724 -37.073 652.495 1.00 102.95 ? 144  PRO C O     1 
ATOM   4666  C  CB    . PRO C 2  144  ? 482.666 -35.106 650.859 1.00 100.12 ? 144  PRO C CB    1 
ATOM   4667  C  CG    . PRO C 2  144  ? 483.241 -33.879 651.472 1.00 96.17  ? 144  PRO C CG    1 
ATOM   4668  C  CD    . PRO C 2  144  ? 482.560 -33.731 652.794 1.00 92.71  ? 144  PRO C CD    1 
ATOM   4669  N  N     . GLY C 2  145  ? 480.135 -36.998 650.336 1.00 103.32 ? 145  GLY C N     1 
ATOM   4670  C  CA    . GLY C 2  145  ? 479.484 -38.294 650.337 1.00 104.03 ? 145  GLY C CA    1 
ATOM   4671  C  C     . GLY C 2  145  ? 478.380 -38.324 649.290 1.00 110.75 ? 145  GLY C C     1 
ATOM   4672  O  O     . GLY C 2  145  ? 478.331 -37.472 648.395 1.00 109.17 ? 145  GLY C O     1 
ATOM   4673  N  N     . VAL C 2  146  ? 477.484 -39.306 649.429 1.00 107.13 ? 146  VAL C N     1 
ATOM   4674  C  CA    . VAL C 2  146  ? 476.332 -39.454 648.539 1.00 111.16 ? 146  VAL C CA    1 
ATOM   4675  C  C     . VAL C 2  146  ? 475.057 -39.403 649.373 1.00 114.42 ? 146  VAL C C     1 
ATOM   4676  O  O     . VAL C 2  146  ? 474.864 -40.235 650.274 1.00 111.21 ? 146  VAL C O     1 
ATOM   4677  C  CB    . VAL C 2  146  ? 476.390 -40.746 647.717 1.00 112.22 ? 146  VAL C CB    1 
ATOM   4678  C  CG1   . VAL C 2  146  ? 475.063 -40.969 647.029 1.00 114.00 ? 146  VAL C CG1   1 
ATOM   4679  C  CG2   . VAL C 2  146  ? 477.490 -40.673 646.696 1.00 113.65 ? 146  VAL C CG2   1 
ATOM   4680  N  N     . TYR C 2  147  ? 474.191 -38.426 649.078 1.00 115.71 ? 147  TYR C N     1 
ATOM   4681  C  CA    . TYR C 2  147  ? 472.973 -38.192 649.844 1.00 115.38 ? 147  TYR C CA    1 
ATOM   4682  C  C     . TYR C 2  147  ? 471.749 -38.404 648.955 1.00 118.38 ? 147  TYR C C     1 
ATOM   4683  O  O     . TYR C 2  147  ? 471.794 -38.174 647.741 1.00 115.78 ? 147  TYR C O     1 
ATOM   4684  C  CB    . TYR C 2  147  ? 472.966 -36.766 650.411 1.00 111.71 ? 147  TYR C CB    1 
ATOM   4685  C  CG    . TYR C 2  147  ? 474.145 -36.471 651.310 1.00 109.33 ? 147  TYR C CG    1 
ATOM   4686  C  CD1   . TYR C 2  147  ? 474.195 -36.951 652.615 1.00 105.85 ? 147  TYR C CD1   1 
ATOM   4687  C  CD2   . TYR C 2  147  ? 475.224 -35.719 650.839 1.00 109.51 ? 147  TYR C CD2   1 
ATOM   4688  C  CE1   . TYR C 2  147  ? 475.287 -36.683 653.432 1.00 103.25 ? 147  TYR C CE1   1 
ATOM   4689  C  CE2   . TYR C 2  147  ? 476.319 -35.445 651.644 1.00 105.20 ? 147  TYR C CE2   1 
ATOM   4690  C  CZ    . TYR C 2  147  ? 476.345 -35.928 652.940 1.00 103.59 ? 147  TYR C CZ    1 
ATOM   4691  O  OH    . TYR C 2  147  ? 477.435 -35.659 653.743 1.00 101.83 ? 147  TYR C OH    1 
ATOM   4692  N  N     . PHE C 2  148  ? 470.625 -38.772 649.575 1.00 120.39 ? 148  PHE C N     1 
ATOM   4693  C  CA    . PHE C 2  148  ? 469.365 -38.914 648.855 1.00 119.91 ? 148  PHE C CA    1 
ATOM   4694  C  C     . PHE C 2  148  ? 468.288 -38.111 649.567 1.00 119.72 ? 148  PHE C C     1 
ATOM   4695  O  O     . PHE C 2  148  ? 467.930 -38.432 650.705 1.00 117.95 ? 148  PHE C O     1 
ATOM   4696  C  CB    . PHE C 2  148  ? 468.942 -40.379 648.791 1.00 124.07 ? 148  PHE C CB    1 
ATOM   4697  C  CG    . PHE C 2  148  ? 469.978 -41.287 648.205 1.00 125.48 ? 148  PHE C CG    1 
ATOM   4698  C  CD1   . PHE C 2  148  ? 470.965 -41.839 649.022 1.00 120.97 ? 148  PHE C CD1   1 
ATOM   4699  C  CD2   . PHE C 2  148  ? 469.986 -41.575 646.844 1.00 127.79 ? 148  PHE C CD2   1 
ATOM   4700  C  CE1   . PHE C 2  148  ? 471.931 -42.677 648.498 1.00 122.54 ? 148  PHE C CE1   1 
ATOM   4701  C  CE2   . PHE C 2  148  ? 470.953 -42.414 646.299 1.00 125.02 ? 148  PHE C CE2   1 
ATOM   4702  C  CZ    . PHE C 2  148  ? 471.930 -42.967 647.129 1.00 126.32 ? 148  PHE C CZ    1 
ATOM   4703  N  N     . THR C 2  149  ? 467.772 -37.073 648.910 1.00 121.25 ? 149  THR C N     1 
ATOM   4704  C  CA    . THR C 2  149  ? 466.743 -36.251 649.526 1.00 121.03 ? 149  THR C CA    1 
ATOM   4705  C  C     . THR C 2  149  ? 465.462 -36.338 648.699 1.00 125.53 ? 149  THR C C     1 
ATOM   4706  O  O     . THR C 2  149  ? 465.524 -36.618 647.503 1.00 132.49 ? 149  THR C O     1 
ATOM   4707  C  CB    . THR C 2  149  ? 467.180 -34.787 649.669 1.00 120.52 ? 149  THR C CB    1 
ATOM   4708  O  OG1   . THR C 2  149  ? 466.336 -34.142 650.627 1.00 128.60 ? 149  THR C OG1   1 
ATOM   4709  C  CG2   . THR C 2  149  ? 467.096 -34.047 648.344 1.00 119.24 ? 149  THR C CG2   1 
ATOM   4710  N  N     . PRO C 2  150  ? 464.290 -36.164 649.305 1.00 123.59 ? 150  PRO C N     1 
ATOM   4711  C  CA    . PRO C 2  150  ? 463.052 -36.153 648.515 1.00 127.47 ? 150  PRO C CA    1 
ATOM   4712  C  C     . PRO C 2  150  ? 462.948 -34.929 647.619 1.00 133.66 ? 150  PRO C C     1 
ATOM   4713  O  O     . PRO C 2  150  ? 463.250 -33.807 648.038 1.00 131.50 ? 150  PRO C O     1 
ATOM   4714  C  CB    . PRO C 2  150  ? 461.954 -36.177 649.575 1.00 122.45 ? 150  PRO C CB    1 
ATOM   4715  C  CG    . PRO C 2  150  ? 462.604 -36.786 650.756 1.00 124.49 ? 150  PRO C CG    1 
ATOM   4716  C  CD    . PRO C 2  150  ? 464.011 -36.295 650.737 1.00 123.11 ? 150  PRO C CD    1 
ATOM   4717  N  N     . ASP C 2  151  ? 462.499 -35.162 646.381 1.00 136.72 ? 151  ASP C N     1 
ATOM   4718  C  CA    . ASP C 2  151  ? 462.258 -34.117 645.386 1.00 136.55 ? 151  ASP C CA    1 
ATOM   4719  C  C     . ASP C 2  151  ? 460.978 -33.395 645.777 1.00 138.41 ? 151  ASP C C     1 
ATOM   4720  O  O     . ASP C 2  151  ? 459.912 -34.024 645.801 1.00 137.98 ? 151  ASP C O     1 
ATOM   4721  C  CB    . ASP C 2  151  ? 462.169 -34.709 643.949 1.00 144.73 ? 151  ASP C CB    1 
ATOM   4722  C  CG    . ASP C 2  151  ? 461.932 -33.628 642.830 1.00 153.06 ? 151  ASP C CG    1 
ATOM   4723  O  OD1   . ASP C 2  151  ? 462.103 -32.413 643.084 1.00 154.44 ? 151  ASP C OD1   1 
ATOM   4724  O  OD2   . ASP C 2  151  ? 461.634 -34.005 641.662 1.00 147.96 ? 151  ASP C OD2   1 
ATOM   4725  N  N     . PRO C 2  152  ? 461.047 -32.111 646.144 1.00 142.82 ? 152  PRO C N     1 
ATOM   4726  C  CA    . PRO C 2  152  ? 459.855 -31.394 646.631 1.00 144.03 ? 152  PRO C CA    1 
ATOM   4727  C  C     . PRO C 2  152  ? 458.712 -31.362 645.634 1.00 147.95 ? 152  PRO C C     1 
ATOM   4728  O  O     . PRO C 2  152  ? 457.541 -31.407 646.036 1.00 148.52 ? 152  PRO C O     1 
ATOM   4729  C  CB    . PRO C 2  152  ? 460.388 -29.981 646.918 1.00 138.28 ? 152  PRO C CB    1 
ATOM   4730  C  CG    . PRO C 2  152  ? 461.659 -29.878 646.122 1.00 137.15 ? 152  PRO C CG    1 
ATOM   4731  C  CD    . PRO C 2  152  ? 462.242 -31.253 646.142 1.00 137.46 ? 152  PRO C CD    1 
ATOM   4732  N  N     . ALA C 2  153  ? 459.021 -31.299 644.338 1.00 151.06 ? 153  ALA C N     1 
ATOM   4733  C  CA    . ALA C 2  153  ? 457.984 -31.213 643.315 1.00 154.04 ? 153  ALA C CA    1 
ATOM   4734  C  C     . ALA C 2  153  ? 457.169 -32.503 643.214 1.00 156.20 ? 153  ALA C C     1 
ATOM   4735  O  O     . ALA C 2  153  ? 455.937 -32.467 643.313 1.00 157.23 ? 153  ALA C O     1 
ATOM   4736  C  CB    . ALA C 2  153  ? 458.616 -30.874 641.961 1.00 153.16 ? 153  ALA C CB    1 
ATOM   4737  N  N     . ARG C 2  154  ? 457.816 -33.655 643.032 1.00 156.04 ? 154  ARG C N     1 
ATOM   4738  C  CA    . ARG C 2  154  ? 457.023 -34.864 642.836 1.00 153.36 ? 154  ARG C CA    1 
ATOM   4739  C  C     . ARG C 2  154  ? 457.040 -35.730 644.094 1.00 149.49 ? 154  ARG C C     1 
ATOM   4740  O  O     . ARG C 2  154  ? 458.052 -36.388 644.380 1.00 150.13 ? 154  ARG C O     1 
ATOM   4741  C  CB    . ARG C 2  154  ? 457.576 -35.616 641.618 1.00 154.81 ? 154  ARG C CB    1 
ATOM   4742  C  CG    . ARG C 2  154  ? 457.658 -34.633 640.411 1.00 156.68 ? 154  ARG C CG    1 
ATOM   4743  C  CD    . ARG C 2  154  ? 458.923 -34.730 639.532 1.00 158.28 ? 154  ARG C CD    1 
ATOM   4744  N  NE    . ARG C 2  154  ? 459.224 -36.073 639.042 1.00 162.90 ? 154  ARG C NE    1 
ATOM   4745  C  CZ    . ARG C 2  154  ? 458.575 -36.658 638.035 1.00 159.06 ? 154  ARG C CZ    1 
ATOM   4746  N  NH1   . ARG C 2  154  ? 457.584 -36.011 637.418 1.00 149.11 ? 154  ARG C NH1   1 
ATOM   4747  N  NH2   . ARG C 2  154  ? 458.901 -37.879 637.633 1.00 158.46 ? 154  ARG C NH2   1 
ATOM   4748  N  N     . PRO C 2  155  ? 455.907 -35.784 644.851 1.00 148.35 ? 155  PRO C N     1 
ATOM   4749  C  CA    . PRO C 2  155  ? 455.873 -36.449 646.172 1.00 153.53 ? 155  PRO C CA    1 
ATOM   4750  C  C     . PRO C 2  155  ? 456.259 -37.924 646.228 1.00 153.67 ? 155  PRO C C     1 
ATOM   4751  O  O     . PRO C 2  155  ? 456.185 -38.526 647.306 1.00 150.38 ? 155  PRO C O     1 
ATOM   4752  C  CB    . PRO C 2  155  ? 454.416 -36.250 646.631 1.00 154.48 ? 155  PRO C CB    1 
ATOM   4753  C  CG    . PRO C 2  155  ? 453.661 -35.773 645.420 1.00 155.31 ? 155  PRO C CG    1 
ATOM   4754  C  CD    . PRO C 2  155  ? 454.660 -35.055 644.570 1.00 147.40 ? 155  PRO C CD    1 
ATOM   4755  N  N     . GLY C 2  156  ? 456.627 -38.537 645.106 1.00 149.26 ? 156  GLY C N     1 
ATOM   4756  C  CA    . GLY C 2  156  ? 456.941 -39.951 645.145 1.00 147.64 ? 156  GLY C CA    1 
ATOM   4757  C  C     . GLY C 2  156  ? 458.287 -40.263 644.525 1.00 151.51 ? 156  GLY C C     1 
ATOM   4758  O  O     . GLY C 2  156  ? 458.648 -41.434 644.359 1.00 150.06 ? 156  GLY C O     1 
ATOM   4759  N  N     . ARG C 2  157  ? 459.059 -39.218 644.224 1.00 153.63 ? 157  ARG C N     1 
ATOM   4760  C  CA    . ARG C 2  157  ? 460.341 -39.345 643.545 1.00 153.73 ? 157  ARG C CA    1 
ATOM   4761  C  C     . ARG C 2  157  ? 461.426 -38.705 644.415 1.00 150.17 ? 157  ARG C C     1 
ATOM   4762  O  O     . ARG C 2  157  ? 461.132 -37.949 645.350 1.00 145.11 ? 157  ARG C O     1 
ATOM   4763  C  CB    . ARG C 2  157  ? 460.281 -38.713 642.132 1.00 149.27 ? 157  ARG C CB    1 
ATOM   4764  C  CG    . ARG C 2  157  ? 459.315 -39.450 641.185 1.00 145.53 ? 157  ARG C CG    1 
ATOM   4765  C  CD    . ARG C 2  157  ? 459.589 -40.955 641.227 1.00 145.45 ? 157  ARG C CD    1 
ATOM   4766  N  NE    . ARG C 2  157  ? 458.548 -41.781 640.611 1.00 147.19 ? 157  ARG C NE    1 
ATOM   4767  C  CZ    . ARG C 2  157  ? 458.514 -42.137 639.328 1.00 150.31 ? 157  ARG C CZ    1 
ATOM   4768  N  NH1   . ARG C 2  157  ? 459.465 -41.740 638.486 1.00 151.21 ? 157  ARG C NH1   1 
ATOM   4769  N  NH2   . ARG C 2  157  ? 457.523 -42.903 638.886 1.00 144.19 ? 157  ARG C NH2   1 
ATOM   4770  N  N     . TYR C 2  158  ? 462.692 -39.026 644.119 1.00 150.07 ? 158  TYR C N     1 
ATOM   4771  C  CA    . TYR C 2  158  ? 463.813 -38.554 644.934 1.00 143.34 ? 158  TYR C CA    1 
ATOM   4772  C  C     . TYR C 2  158  ? 464.986 -38.095 644.058 1.00 141.07 ? 158  TYR C C     1 
ATOM   4773  O  O     . TYR C 2  158  ? 465.148 -38.534 642.913 1.00 141.13 ? 158  TYR C O     1 
ATOM   4774  C  CB    . TYR C 2  158  ? 464.260 -39.659 645.916 1.00 137.68 ? 158  TYR C CB    1 
ATOM   4775  C  CG    . TYR C 2  158  ? 463.162 -40.149 646.849 1.00 138.43 ? 158  TYR C CG    1 
ATOM   4776  C  CD1   . TYR C 2  158  ? 462.244 -41.117 646.446 1.00 142.34 ? 158  TYR C CD1   1 
ATOM   4777  C  CD2   . TYR C 2  158  ? 463.051 -39.646 648.136 1.00 139.84 ? 158  TYR C CD2   1 
ATOM   4778  C  CE1   . TYR C 2  158  ? 461.238 -41.564 647.306 1.00 143.69 ? 158  TYR C CE1   1 
ATOM   4779  C  CE2   . TYR C 2  158  ? 462.051 -40.084 649.003 1.00 143.63 ? 158  TYR C CE2   1 
ATOM   4780  C  CZ    . TYR C 2  158  ? 461.149 -41.045 648.591 1.00 145.45 ? 158  TYR C CZ    1 
ATOM   4781  O  OH    . TYR C 2  158  ? 460.162 -41.471 649.470 1.00 134.86 ? 158  TYR C OH    1 
ATOM   4782  N  N     . ILE C 2  159  ? 465.820 -37.213 644.626 1.00 132.65 ? 159  ILE C N     1 
ATOM   4783  C  CA    . ILE C 2  159  ? 467.058 -36.751 644.001 1.00 124.38 ? 159  ILE C CA    1 
ATOM   4784  C  C     . ILE C 2  159  ? 468.252 -37.271 644.792 1.00 125.34 ? 159  ILE C C     1 
ATOM   4785  O  O     . ILE C 2  159  ? 468.314 -37.122 646.020 1.00 124.35 ? 159  ILE C O     1 
ATOM   4786  C  CB    . ILE C 2  159  ? 467.131 -35.212 643.918 1.00 122.91 ? 159  ILE C CB    1 
ATOM   4787  C  CG1   . ILE C 2  159  ? 465.855 -34.598 643.339 1.00 129.61 ? 159  ILE C CG1   1 
ATOM   4788  C  CG2   . ILE C 2  159  ? 468.355 -34.772 643.114 1.00 128.56 ? 159  ILE C CG2   1 
ATOM   4789  C  CD1   . ILE C 2  159  ? 466.062 -33.204 642.725 1.00 130.25 ? 159  ILE C CD1   1 
ATOM   4790  N  N     . ALA C 2  160  ? 469.194 -37.888 644.086 1.00 129.20 ? 160  ALA C N     1 
ATOM   4791  C  CA    . ALA C 2  160  ? 470.473 -38.304 644.648 1.00 125.07 ? 160  ALA C CA    1 
ATOM   4792  C  C     . ALA C 2  160  ? 471.509 -37.241 644.276 1.00 125.12 ? 160  ALA C C     1 
ATOM   4793  O  O     . ALA C 2  160  ? 471.633 -36.885 643.096 1.00 123.00 ? 160  ALA C O     1 
ATOM   4794  C  CB    . ALA C 2  160  ? 470.887 -39.687 644.145 1.00 118.14 ? 160  ALA C CB    1 
ATOM   4795  N  N     . SER C 2  161  ? 472.173 -36.664 645.281 1.00 123.28 ? 161  SER C N     1 
ATOM   4796  C  CA    . SER C 2  161  ? 473.172 -35.614 645.081 1.00 118.88 ? 161  SER C CA    1 
ATOM   4797  C  C     . SER C 2  161  ? 474.538 -36.124 645.534 1.00 118.37 ? 161  SER C C     1 
ATOM   4798  O  O     . SER C 2  161  ? 474.675 -36.630 646.656 1.00 114.10 ? 161  SER C O     1 
ATOM   4799  C  CB    . SER C 2  161  ? 472.797 -34.308 645.792 1.00 115.94 ? 161  SER C CB    1 
ATOM   4800  O  OG    . SER C 2  161  ? 471.397 -34.078 645.765 1.00 123.26 ? 161  SER C OG    1 
ATOM   4801  N  N     . ILE C 2  162  ? 475.525 -36.069 644.636 1.00 121.22 ? 162  ILE C N     1 
ATOM   4802  C  CA    . ILE C 2  162  ? 476.900 -36.425 644.973 1.00 117.78 ? 162  ILE C CA    1 
ATOM   4803  C  C     . ILE C 2  162  ? 477.690 -35.136 645.177 1.00 115.18 ? 162  ILE C C     1 
ATOM   4804  O  O     . ILE C 2  162  ? 478.016 -34.434 644.210 1.00 111.11 ? 162  ILE C O     1 
ATOM   4805  C  CB    . ILE C 2  162  ? 477.528 -37.280 643.863 1.00 112.90 ? 162  ILE C CB    1 
ATOM   4806  C  CG1   . ILE C 2  162  ? 476.792 -38.621 643.768 1.00 112.70 ? 162  ILE C CG1   1 
ATOM   4807  C  CG2   . ILE C 2  162  ? 479.035 -37.465 644.108 1.00 109.29 ? 162  ILE C CG2   1 
ATOM   4808  C  CD1   . ILE C 2  162  ? 477.288 -39.546 642.694 1.00 108.50 ? 162  ILE C CD1   1 
ATOM   4809  N  N     . ILE C 2  163  ? 478.055 -34.852 646.426 1.00 113.96 ? 163  ILE C N     1 
ATOM   4810  C  CA    . ILE C 2  163  ? 478.716 -33.601 646.769 1.00 114.86 ? 163  ILE C CA    1 
ATOM   4811  C  C     . ILE C 2  163  ? 480.118 -33.955 647.253 1.00 107.40 ? 163  ILE C C     1 
ATOM   4812  O  O     . ILE C 2  163  ? 480.266 -34.762 648.176 1.00 104.47 ? 163  ILE C O     1 
ATOM   4813  C  CB    . ILE C 2  163  ? 477.958 -32.752 647.808 1.00 109.90 ? 163  ILE C CB    1 
ATOM   4814  C  CG1   . ILE C 2  163  ? 476.528 -32.487 647.344 1.00 108.40 ? 163  ILE C CG1   1 
ATOM   4815  C  CG2   . ILE C 2  163  ? 478.569 -31.345 647.873 1.00 109.06 ? 163  ILE C CG2   1 
ATOM   4816  C  CD1   . ILE C 2  163  ? 475.632 -31.921 648.405 1.00 102.57 ? 163  ILE C CD1   1 
ATOM   4817  N  N     . PRO C 2  164  ? 481.164 -33.416 646.625 1.00 101.21 ? 164  PRO C N     1 
ATOM   4818  C  CA    . PRO C 2  164  ? 482.551 -33.615 647.081 1.00 101.90 ? 164  PRO C CA    1 
ATOM   4819  C  C     . PRO C 2  164  ? 483.018 -32.525 648.036 1.00 101.60 ? 164  PRO C C     1 
ATOM   4820  O  O     . PRO C 2  164  ? 482.225 -31.638 648.370 1.00 103.18 ? 164  PRO C O     1 
ATOM   4821  C  CB    . PRO C 2  164  ? 483.339 -33.588 645.775 1.00 105.19 ? 164  PRO C CB    1 
ATOM   4822  C  CG    . PRO C 2  164  ? 482.582 -32.549 644.966 1.00 111.23 ? 164  PRO C CG    1 
ATOM   4823  C  CD    . PRO C 2  164  ? 481.107 -32.686 645.350 1.00 106.11 ? 164  PRO C CD    1 
ATOM   4824  N  N     . LEU C 2  165  ? 484.289 -32.546 648.456 1.00 100.78 ? 165  LEU C N     1 
ATOM   4825  C  CA    . LEU C 2  165  ? 484.791 -31.459 649.289 1.00 98.18  ? 165  LEU C CA    1 
ATOM   4826  C  C     . LEU C 2  165  ? 484.714 -30.143 648.518 1.00 99.54  ? 165  LEU C C     1 
ATOM   4827  O  O     . LEU C 2  165  ? 484.810 -30.133 647.288 1.00 103.13 ? 165  LEU C O     1 
ATOM   4828  C  CB    . LEU C 2  165  ? 486.243 -31.710 649.685 1.00 93.71  ? 165  LEU C CB    1 
ATOM   4829  C  CG    . LEU C 2  165  ? 486.671 -32.911 650.523 1.00 92.83  ? 165  LEU C CG    1 
ATOM   4830  C  CD1   . LEU C 2  165  ? 488.143 -33.090 650.268 1.00 100.58 ? 165  LEU C CD1   1 
ATOM   4831  C  CD2   . LEU C 2  165  ? 486.438 -32.733 652.010 1.00 89.42  ? 165  LEU C CD2   1 
ATOM   4832  N  N     . PRO C 2  166  ? 484.541 -29.024 649.225 1.00 101.42 ? 166  PRO C N     1 
ATOM   4833  C  CA    . PRO C 2  166  ? 484.460 -27.703 648.570 1.00 105.90 ? 166  PRO C CA    1 
ATOM   4834  C  C     . PRO C 2  166  ? 485.617 -27.366 647.637 1.00 104.48 ? 166  PRO C C     1 
ATOM   4835  O  O     . PRO C 2  166  ? 486.792 -27.533 647.984 1.00 104.29 ? 166  PRO C O     1 
ATOM   4836  C  CB    . PRO C 2  166  ? 484.392 -26.733 649.756 1.00 102.49 ? 166  PRO C CB    1 
ATOM   4837  C  CG    . PRO C 2  166  ? 483.718 -27.528 650.837 1.00 106.01 ? 166  PRO C CG    1 
ATOM   4838  C  CD    . PRO C 2  166  ? 484.198 -28.957 650.656 1.00 103.16 ? 166  PRO C CD    1 
ATOM   4839  N  N     . LYS C 2  167  ? 485.265 -26.842 646.455 1.00 97.34  ? 167  LYS C N     1 
ATOM   4840  C  CA    . LYS C 2  167  ? 486.167 -26.380 645.403 1.00 97.71  ? 167  LYS C CA    1 
ATOM   4841  C  C     . LYS C 2  167  ? 486.936 -27.533 644.765 1.00 103.18 ? 167  LYS C C     1 
ATOM   4842  O  O     . LYS C 2  167  ? 487.823 -27.291 643.940 1.00 105.63 ? 167  LYS C O     1 
ATOM   4843  C  CB    . LYS C 2  167  ? 487.099 -25.250 645.861 1.00 96.80  ? 167  LYS C CB    1 
ATOM   4844  C  CG    . LYS C 2  167  ? 486.279 -23.982 646.116 1.00 101.67 ? 167  LYS C CG    1 
ATOM   4845  C  CD    . LYS C 2  167  ? 486.711 -22.769 645.327 1.00 103.36 ? 167  LYS C CD    1 
ATOM   4846  C  CE    . LYS C 2  167  ? 485.472 -21.959 644.959 1.00 123.72 ? 167  LYS C CE    1 
ATOM   4847  N  NZ    . LYS C 2  167  ? 485.788 -20.662 644.305 1.00 139.90 ? 167  LYS C NZ    1 
ATOM   4848  N  N     . ARG C 2  168  ? 486.671 -28.774 645.177 1.00 104.28 ? 168  ARG C N     1 
ATOM   4849  C  CA    . ARG C 2  168  ? 487.310 -29.982 644.668 1.00 103.57 ? 168  ARG C CA    1 
ATOM   4850  C  C     . ARG C 2  168  ? 486.377 -30.767 643.733 1.00 106.39 ? 168  ARG C C     1 
ATOM   4851  O  O     . ARG C 2  168  ? 486.586 -31.965 643.523 1.00 106.13 ? 168  ARG C O     1 
ATOM   4852  C  CB    . ARG C 2  168  ? 487.734 -30.895 645.822 1.00 102.54 ? 168  ARG C CB    1 
ATOM   4853  C  CG    . ARG C 2  168  ? 488.576 -30.273 646.946 1.00 109.41 ? 168  ARG C CG    1 
ATOM   4854  C  CD    . ARG C 2  168  ? 490.047 -30.584 646.807 1.00 107.52 ? 168  ARG C CD    1 
ATOM   4855  N  NE    . ARG C 2  168  ? 490.548 -30.029 645.562 1.00 112.51 ? 168  ARG C NE    1 
ATOM   4856  C  CZ    . ARG C 2  168  ? 491.737 -30.308 645.054 1.00 114.16 ? 168  ARG C CZ    1 
ATOM   4857  N  NH1   . ARG C 2  168  ? 492.542 -31.148 645.696 1.00 112.66 ? 168  ARG C NH1   1 
ATOM   4858  N  NH2   . ARG C 2  168  ? 492.112 -29.749 643.908 1.00 110.21 ? 168  ARG C NH2   1 
ATOM   4859  N  N     . GLY C 2  169  ? 485.349 -30.127 643.175 1.00 107.24 ? 169  GLY C N     1 
ATOM   4860  C  CA    . GLY C 2  169  ? 484.519 -30.765 642.182 1.00 104.96 ? 169  GLY C CA    1 
ATOM   4861  C  C     . GLY C 2  169  ? 483.126 -30.167 642.104 1.00 113.45 ? 169  GLY C C     1 
ATOM   4862  O  O     . GLY C 2  169  ? 482.716 -29.357 642.945 1.00 117.69 ? 169  GLY C O     1 
ATOM   4863  N  N     . PRO C 2  170  ? 482.370 -30.574 641.086 1.00 113.50 ? 170  PRO C N     1 
ATOM   4864  C  CA    . PRO C 2  170  ? 481.004 -30.073 640.894 1.00 116.26 ? 170  PRO C CA    1 
ATOM   4865  C  C     . PRO C 2  170  ? 479.963 -30.753 641.776 1.00 118.40 ? 170  PRO C C     1 
ATOM   4866  O  O     . PRO C 2  170  ? 480.135 -31.878 642.256 1.00 112.90 ? 170  PRO C O     1 
ATOM   4867  C  CB    . PRO C 2  170  ? 480.748 -30.382 639.423 1.00 114.90 ? 170  PRO C CB    1 
ATOM   4868  C  CG    . PRO C 2  170  ? 481.444 -31.707 639.251 1.00 108.74 ? 170  PRO C CG    1 
ATOM   4869  C  CD    . PRO C 2  170  ? 482.671 -31.670 640.146 1.00 107.13 ? 170  PRO C CD    1 
ATOM   4870  N  N     . TRP C 2  171  ? 478.818 -30.075 641.897 1.00 122.80 ? 171  TRP C N     1 
ATOM   4871  C  CA    . TRP C 2  171  ? 477.675 -30.649 642.589 1.00 126.85 ? 171  TRP C CA    1 
ATOM   4872  C  C     . TRP C 2  171  ? 476.952 -31.452 641.502 1.00 122.72 ? 171  TRP C C     1 
ATOM   4873  O  O     . TRP C 2  171  ? 476.871 -31.008 640.353 1.00 123.49 ? 171  TRP C O     1 
ATOM   4874  C  CB    . TRP C 2  171  ? 476.823 -29.440 643.048 1.00 132.18 ? 171  TRP C CB    1 
ATOM   4875  C  CG    . TRP C 2  171  ? 477.416 -28.468 644.130 1.00 134.63 ? 171  TRP C CG    1 
ATOM   4876  C  CD1   . TRP C 2  171  ? 478.564 -28.631 644.868 1.00 130.94 ? 171  TRP C CD1   1 
ATOM   4877  C  CD2   . TRP C 2  171  ? 477.139 -27.035 644.197 1.00 140.92 ? 171  TRP C CD2   1 
ATOM   4878  N  NE1   . TRP C 2  171  ? 478.858 -27.478 645.570 1.00 132.55 ? 171  TRP C NE1   1 
ATOM   4879  C  CE2   . TRP C 2  171  ? 478.026 -26.474 645.147 1.00 138.01 ? 171  TRP C CE2   1 
ATOM   4880  C  CE3   . TRP C 2  171  ? 476.177 -26.197 643.598 1.00 135.21 ? 171  TRP C CE3   1 
ATOM   4881  C  CZ2   . TRP C 2  171  ? 477.971 -25.121 645.521 1.00 133.63 ? 171  TRP C CZ2   1 
ATOM   4882  C  CZ3   . TRP C 2  171  ? 476.122 -24.855 643.978 1.00 134.79 ? 171  TRP C CZ3   1 
ATOM   4883  C  CH2   . TRP C 2  171  ? 477.016 -24.335 644.929 1.00 135.58 ? 171  TRP C CH2   1 
ATOM   4884  N  N     . ILE C 2  172  ? 476.462 -32.654 641.852 1.00 122.61 ? 172  ILE C N     1 
ATOM   4885  C  CA    . ILE C 2  172  ? 475.641 -33.510 640.986 1.00 120.99 ? 172  ILE C CA    1 
ATOM   4886  C  C     . ILE C 2  172  ? 474.204 -33.728 641.480 1.00 126.63 ? 172  ILE C C     1 
ATOM   4887  O  O     . ILE C 2  172  ? 473.995 -34.007 642.664 1.00 127.60 ? 172  ILE C O     1 
ATOM   4888  C  CB    . ILE C 2  172  ? 476.359 -34.857 640.781 1.00 117.51 ? 172  ILE C CB    1 
ATOM   4889  C  CG1   . ILE C 2  172  ? 477.481 -34.695 639.747 1.00 110.12 ? 172  ILE C CG1   1 
ATOM   4890  C  CG2   . ILE C 2  172  ? 475.375 -35.927 640.396 1.00 121.90 ? 172  ILE C CG2   1 
ATOM   4891  C  CD1   . ILE C 2  172  ? 478.128 -36.008 639.311 1.00 95.50  ? 172  ILE C CD1   1 
ATOM   4892  N  N     . ASP C 2  173  ? 473.215 -33.625 640.576 1.00 127.51 ? 173  ASP C N     1 
ATOM   4893  C  CA    . ASP C 2  173  ? 471.812 -33.975 640.856 1.00 131.50 ? 173  ASP C CA    1 
ATOM   4894  C  C     . ASP C 2  173  ? 471.335 -35.077 639.897 1.00 132.64 ? 173  ASP C C     1 
ATOM   4895  O  O     . ASP C 2  173  ? 471.497 -34.948 638.677 1.00 128.33 ? 173  ASP C O     1 
ATOM   4896  C  CB    . ASP C 2  173  ? 470.869 -32.754 640.772 1.00 135.43 ? 173  ASP C CB    1 
ATOM   4897  C  CG    . ASP C 2  173  ? 470.747 -31.968 642.094 1.00 133.79 ? 173  ASP C CG    1 
ATOM   4898  O  OD1   . ASP C 2  173  ? 471.520 -32.220 643.048 1.00 133.56 ? 173  ASP C OD1   1 
ATOM   4899  O  OD2   . ASP C 2  173  ? 469.858 -31.082 642.163 1.00 131.28 ? 173  ASP C OD2   1 
ATOM   4900  N  N     . LEU C 2  174  ? 470.780 -36.168 640.436 1.00 134.11 ? 174  LEU C N     1 
ATOM   4901  C  CA    . LEU C 2  174  ? 470.162 -37.243 639.631 1.00 131.82 ? 174  LEU C CA    1 
ATOM   4902  C  C     . LEU C 2  174  ? 468.626 -37.247 639.606 1.00 135.60 ? 174  LEU C C     1 
ATOM   4903  O  O     . LEU C 2  174  ? 468.026 -38.294 639.889 1.00 133.18 ? 174  LEU C O     1 
ATOM   4904  C  CB    . LEU C 2  174  ? 470.681 -38.607 640.068 1.00 123.42 ? 174  LEU C CB    1 
ATOM   4905  C  CG    . LEU C 2  174  ? 471.880 -39.123 639.278 1.00 118.12 ? 174  LEU C CG    1 
ATOM   4906  C  CD1   . LEU C 2  174  ? 472.885 -38.033 639.007 1.00 116.43 ? 174  LEU C CD1   1 
ATOM   4907  C  CD2   . LEU C 2  174  ? 472.519 -40.279 640.039 1.00 116.65 ? 174  LEU C CD2   1 
ATOM   4908  N  N     . GLU C 2  175  ? 467.961 -36.141 639.247 1.00 137.51 ? 175  GLU C N     1 
ATOM   4909  C  CA    . GLU C 2  175  ? 466.499 -36.092 639.279 1.00 136.37 ? 175  GLU C CA    1 
ATOM   4910  C  C     . GLU C 2  175  ? 465.954 -37.103 638.270 1.00 142.74 ? 175  GLU C C     1 
ATOM   4911  O  O     . GLU C 2  175  ? 466.586 -37.372 637.244 1.00 143.22 ? 175  GLU C O     1 
ATOM   4912  C  CB    . GLU C 2  175  ? 465.994 -34.680 638.931 1.00 133.77 ? 175  GLU C CB    1 
ATOM   4913  C  CG    . GLU C 2  175  ? 464.474 -34.471 639.092 1.00 138.93 ? 175  GLU C CG    1 
ATOM   4914  C  CD    . GLU C 2  175  ? 464.039 -33.007 638.979 1.00 141.55 ? 175  GLU C CD    1 
ATOM   4915  O  OE1   . GLU C 2  175  ? 464.920 -32.120 638.942 1.00 139.47 ? 175  GLU C OE1   1 
ATOM   4916  O  OE2   . GLU C 2  175  ? 462.812 -32.745 638.923 1.00 141.46 ? 175  GLU C OE2   1 
ATOM   4917  N  N     . VAL C 2  176  ? 464.784 -37.683 638.552 1.00 146.55 ? 176  VAL C N     1 
ATOM   4918  C  CA    . VAL C 2  176  ? 464.089 -38.529 637.574 1.00 151.19 ? 176  VAL C CA    1 
ATOM   4919  C  C     . VAL C 2  176  ? 462.942 -37.719 636.954 1.00 154.58 ? 176  VAL C C     1 
ATOM   4920  O  O     . VAL C 2  176  ? 461.911 -37.480 637.594 1.00 157.81 ? 176  VAL C O     1 
ATOM   4921  C  CB    . VAL C 2  176  ? 463.590 -39.840 638.209 1.00 142.00 ? 176  VAL C CB    1 
ATOM   4922  C  CG1   . VAL C 2  176  ? 462.809 -40.673 637.200 1.00 141.07 ? 176  VAL C CG1   1 
ATOM   4923  C  CG2   . VAL C 2  176  ? 464.763 -40.652 638.756 1.00 130.15 ? 176  VAL C CG2   1 
ATOM   4924  N  N     . GLU C 2  177  ? 463.110 -37.355 635.674 1.00 151.14 ? 177  GLU C N     1 
ATOM   4925  C  CA    . GLU C 2  177  ? 462.223 -36.449 634.932 1.00 156.78 ? 177  GLU C CA    1 
ATOM   4926  C  C     . GLU C 2  177  ? 460.827 -37.038 634.681 1.00 160.59 ? 177  GLU C C     1 
ATOM   4927  O  O     . GLU C 2  177  ? 460.614 -38.247 634.837 1.00 157.79 ? 177  GLU C O     1 
ATOM   4928  C  CB    . GLU C 2  177  ? 462.864 -36.102 633.577 1.00 156.54 ? 177  GLU C CB    1 
ATOM   4929  C  CG    . GLU C 2  177  ? 463.071 -34.613 633.203 1.00 151.95 ? 177  GLU C CG    1 
ATOM   4930  C  CD    . GLU C 2  177  ? 463.753 -33.782 634.264 1.00 149.09 ? 177  GLU C CD    1 
ATOM   4931  O  OE1   . GLU C 2  177  ? 463.122 -32.815 634.740 1.00 155.03 ? 177  GLU C OE1   1 
ATOM   4932  O  OE2   . GLU C 2  177  ? 464.915 -34.080 634.611 1.00 145.58 ? 177  GLU C OE2   1 
ATOM   4933  N  N     . PRO C 2  178  ? 459.826 -36.172 634.408 1.00 164.18 ? 178  PRO C N     1 
ATOM   4934  C  CA    . PRO C 2  178  ? 458.475 -36.676 634.075 1.00 165.35 ? 178  PRO C CA    1 
ATOM   4935  C  C     . PRO C 2  178  ? 458.415 -37.677 632.906 1.00 163.04 ? 178  PRO C C     1 
ATOM   4936  O  O     . PRO C 2  178  ? 457.522 -38.540 632.896 1.00 161.11 ? 178  PRO C O     1 
ATOM   4937  C  CB    . PRO C 2  178  ? 457.693 -35.387 633.746 1.00 159.75 ? 178  PRO C CB    1 
ATOM   4938  C  CG    . PRO C 2  178  ? 458.723 -34.289 633.613 1.00 151.82 ? 178  PRO C CG    1 
ATOM   4939  C  CD    . PRO C 2  178  ? 459.826 -34.701 634.543 1.00 158.62 ? 178  PRO C CD    1 
ATOM   4940  N  N     . ASN C 2  179  ? 459.319 -37.581 631.915 1.00 161.23 ? 179  ASN C N     1 
ATOM   4941  C  CA    . ASN C 2  179  ? 459.326 -38.517 630.786 1.00 159.07 ? 179  ASN C CA    1 
ATOM   4942  C  C     . ASN C 2  179  ? 459.714 -39.952 631.163 1.00 156.40 ? 179  ASN C C     1 
ATOM   4943  O  O     . ASN C 2  179  ? 459.542 -40.853 630.334 1.00 156.15 ? 179  ASN C O     1 
ATOM   4944  C  CB    . ASN C 2  179  ? 460.215 -37.969 629.650 1.00 156.49 ? 179  ASN C CB    1 
ATOM   4945  C  CG    . ASN C 2  179  ? 461.665 -37.732 630.065 1.00 155.13 ? 179  ASN C CG    1 
ATOM   4946  O  OD1   . ASN C 2  179  ? 462.164 -38.319 631.024 1.00 150.52 ? 179  ASN C OD1   1 
ATOM   4947  N  ND2   . ASN C 2  179  ? 462.349 -36.857 629.324 1.00 153.21 ? 179  ASN C ND2   1 
ATOM   4948  N  N     . GLY C 2  180  ? 460.270 -40.186 632.351 1.00 155.08 ? 180  GLY C N     1 
ATOM   4949  C  CA    . GLY C 2  180  ? 460.583 -41.519 632.837 1.00 151.64 ? 180  GLY C CA    1 
ATOM   4950  C  C     . GLY C 2  180  ? 462.050 -41.891 632.826 1.00 151.56 ? 180  GLY C C     1 
ATOM   4951  O  O     . GLY C 2  180  ? 462.416 -42.894 633.459 1.00 144.18 ? 180  GLY C O     1 
ATOM   4952  N  N     . VAL C 2  181  ? 462.909 -41.106 632.119 1.00 154.13 ? 181  VAL C N     1 
ATOM   4953  C  CA    . VAL C 2  181  ? 464.350 -41.347 632.019 1.00 151.79 ? 181  VAL C CA    1 
ATOM   4954  C  C     . VAL C 2  181  ? 465.087 -40.653 633.166 1.00 151.60 ? 181  VAL C C     1 
ATOM   4955  O  O     . VAL C 2  181  ? 464.719 -39.548 633.590 1.00 151.79 ? 181  VAL C O     1 
ATOM   4956  C  CB    . VAL C 2  181  ? 464.884 -40.914 630.633 1.00 145.52 ? 181  VAL C CB    1 
ATOM   4957  C  CG1   . VAL C 2  181  ? 465.058 -39.406 630.536 1.00 145.90 ? 181  VAL C CG1   1 
ATOM   4958  C  CG2   . VAL C 2  181  ? 466.201 -41.637 630.307 1.00 143.06 ? 181  VAL C CG2   1 
ATOM   4959  N  N     . VAL C 2  182  ? 466.136 -41.304 633.671 1.00 150.68 ? 182  VAL C N     1 
ATOM   4960  C  CA    . VAL C 2  182  ? 466.896 -40.804 634.817 1.00 142.76 ? 182  VAL C CA    1 
ATOM   4961  C  C     . VAL C 2  182  ? 467.956 -39.812 634.321 1.00 140.84 ? 182  VAL C C     1 
ATOM   4962  O  O     . VAL C 2  182  ? 468.831 -40.160 633.520 1.00 135.07 ? 182  VAL C O     1 
ATOM   4963  C  CB    . VAL C 2  182  ? 467.509 -41.963 635.625 1.00 137.89 ? 182  VAL C CB    1 
ATOM   4964  C  CG1   . VAL C 2  182  ? 468.104 -43.041 634.719 1.00 136.35 ? 182  VAL C CG1   1 
ATOM   4965  C  CG2   . VAL C 2  182  ? 468.520 -41.455 636.626 1.00 141.06 ? 182  VAL C CG2   1 
ATOM   4966  N  N     . SER C 2  183  ? 467.853 -38.562 634.780 1.00 141.73 ? 183  SER C N     1 
ATOM   4967  C  CA    . SER C 2  183  ? 468.665 -37.433 634.334 1.00 136.85 ? 183  SER C CA    1 
ATOM   4968  C  C     . SER C 2  183  ? 469.774 -37.100 635.331 1.00 135.99 ? 183  SER C C     1 
ATOM   4969  O  O     . SER C 2  183  ? 469.621 -37.254 636.547 1.00 138.10 ? 183  SER C O     1 
ATOM   4970  C  CB    . SER C 2  183  ? 467.794 -36.193 634.096 1.00 136.53 ? 183  SER C CB    1 
ATOM   4971  O  OG    . SER C 2  183  ? 467.341 -35.615 635.312 1.00 139.47 ? 183  SER C OG    1 
ATOM   4972  N  N     . MET C 2  184  ? 470.899 -36.643 634.791 1.00 129.77 ? 184  MET C N     1 
ATOM   4973  C  CA    . MET C 2  184  ? 472.056 -36.199 635.560 1.00 126.63 ? 184  MET C CA    1 
ATOM   4974  C  C     . MET C 2  184  ? 472.311 -34.705 635.376 1.00 129.11 ? 184  MET C C     1 
ATOM   4975  O  O     . MET C 2  184  ? 472.398 -34.224 634.242 1.00 129.36 ? 184  MET C O     1 
ATOM   4976  C  CB    . MET C 2  184  ? 473.275 -37.002 635.135 1.00 120.97 ? 184  MET C CB    1 
ATOM   4977  C  CG    . MET C 2  184  ? 474.563 -36.482 635.641 1.00 121.04 ? 184  MET C CG    1 
ATOM   4978  S  SD    . MET C 2  184  ? 475.738 -37.820 635.596 1.00 124.71 ? 184  MET C SD    1 
ATOM   4979  C  CE    . MET C 2  184  ? 477.228 -36.891 635.283 1.00 113.23 ? 184  MET C CE    1 
ATOM   4980  N  N     . LYS C 2  185  ? 472.511 -33.997 636.496 1.00 133.16 ? 185  LYS C N     1 
ATOM   4981  C  CA    . LYS C 2  185  ? 472.710 -32.544 636.557 1.00 129.97 ? 185  LYS C CA    1 
ATOM   4982  C  C     . LYS C 2  185  ? 474.134 -32.224 637.014 1.00 130.35 ? 185  LYS C C     1 
ATOM   4983  O  O     . LYS C 2  185  ? 474.541 -32.629 638.111 1.00 130.21 ? 185  LYS C O     1 
ATOM   4984  C  CB    . LYS C 2  185  ? 471.686 -31.896 637.495 1.00 126.09 ? 185  LYS C CB    1 
ATOM   4985  C  CG    . LYS C 2  185  ? 471.610 -30.370 637.435 1.00 127.85 ? 185  LYS C CG    1 
ATOM   4986  C  CD    . LYS C 2  185  ? 470.702 -29.806 638.535 1.00 129.27 ? 185  LYS C CD    1 
ATOM   4987  C  CE    . LYS C 2  185  ? 469.371 -30.563 638.627 1.00 127.73 ? 185  LYS C CE    1 
ATOM   4988  N  NZ    . LYS C 2  185  ? 468.185 -29.769 638.216 1.00 126.05 ? 185  LYS C NZ    1 
ATOM   4989  N  N     . VAL C 2  186  ? 474.889 -31.513 636.159 1.00 133.18 ? 186  VAL C N     1 
ATOM   4990  C  CA    . VAL C 2  186  ? 476.289 -31.124 636.381 1.00 134.55 ? 186  VAL C CA    1 
ATOM   4991  C  C     . VAL C 2  186  ? 476.487 -29.684 635.915 1.00 139.30 ? 186  VAL C C     1 
ATOM   4992  O  O     . VAL C 2  186  ? 476.252 -29.361 634.744 1.00 136.19 ? 186  VAL C O     1 
ATOM   4993  C  CB    . VAL C 2  186  ? 477.280 -32.033 635.628 1.00 131.56 ? 186  VAL C CB    1 
ATOM   4994  C  CG1   . VAL C 2  186  ? 478.706 -31.552 635.851 1.00 128.63 ? 186  VAL C CG1   1 
ATOM   4995  C  CG2   . VAL C 2  186  ? 477.127 -33.473 636.064 1.00 130.82 ? 186  VAL C CG2   1 
ATOM   4996  N  N     . ASN C 2  187  ? 476.995 -28.843 636.823 1.00 143.64 ? 187  ASN C N     1 
ATOM   4997  C  CA    . ASN C 2  187  ? 477.213 -27.413 636.584 1.00 144.28 ? 187  ASN C CA    1 
ATOM   4998  C  C     . ASN C 2  187  ? 475.910 -26.781 636.117 1.00 142.92 ? 187  ASN C C     1 
ATOM   4999  O  O     . ASN C 2  187  ? 475.880 -25.990 635.169 1.00 137.96 ? 187  ASN C O     1 
ATOM   5000  C  CB    . ASN C 2  187  ? 478.328 -27.136 635.564 1.00 137.51 ? 187  ASN C CB    1 
ATOM   5001  C  CG    . ASN C 2  187  ? 479.700 -27.539 636.058 1.00 139.18 ? 187  ASN C CG    1 
ATOM   5002  O  OD1   . ASN C 2  187  ? 480.426 -28.265 635.374 1.00 137.56 ? 187  ASN C OD1   1 
ATOM   5003  N  ND2   . ASN C 2  187  ? 480.076 -27.050 637.239 1.00 137.79 ? 187  ASN C ND2   1 
ATOM   5004  N  N     . LYS C 2  188  ? 474.815 -27.172 636.775 1.00 145.21 ? 188  LYS C N     1 
ATOM   5005  C  CA    . LYS C 2  188  ? 473.473 -26.655 636.530 1.00 143.91 ? 188  LYS C CA    1 
ATOM   5006  C  C     . LYS C 2  188  ? 472.885 -27.074 635.153 1.00 146.38 ? 188  LYS C C     1 
ATOM   5007  O  O     . LYS C 2  188  ? 471.711 -26.759 634.896 1.00 146.03 ? 188  LYS C O     1 
ATOM   5008  C  CB    . LYS C 2  188  ? 473.388 -25.166 636.931 1.00 140.29 ? 188  LYS C CB    1 
ATOM   5009  C  CG    . LYS C 2  188  ? 473.847 -25.116 638.464 1.00 144.51 ? 188  LYS C CG    1 
ATOM   5010  C  CD    . LYS C 2  188  ? 473.708 -23.826 639.333 1.00 141.42 ? 188  LYS C CD    1 
ATOM   5011  C  CE    . LYS C 2  188  ? 474.511 -23.971 640.680 1.00 137.92 ? 188  LYS C CE    1 
ATOM   5012  N  NZ    . LYS C 2  188  ? 475.369 -22.842 641.165 1.00 134.20 ? 188  LYS C NZ    1 
ATOM   5013  N  N     . ARG C 2  189  ? 473.640 -27.798 634.283 1.00 143.37 ? 189  ARG C N     1 
ATOM   5014  C  CA    . ARG C 2  189  ? 473.165 -28.318 632.984 1.00 139.06 ? 189  ARG C CA    1 
ATOM   5015  C  C     . ARG C 2  189  ? 472.708 -29.773 633.122 1.00 138.41 ? 189  ARG C C     1 
ATOM   5016  O  O     . ARG C 2  189  ? 473.395 -30.589 633.743 1.00 138.94 ? 189  ARG C O     1 
ATOM   5017  C  CB    . ARG C 2  189  ? 474.240 -28.301 631.889 1.00 136.17 ? 189  ARG C CB    1 
ATOM   5018  C  CG    . ARG C 2  189  ? 474.735 -26.967 631.378 1.00 141.79 ? 189  ARG C CG    1 
ATOM   5019  C  CD    . ARG C 2  189  ? 475.732 -27.220 630.238 1.00 136.20 ? 189  ARG C CD    1 
ATOM   5020  N  NE    . ARG C 2  189  ? 476.590 -26.074 629.938 1.00 140.10 ? 189  ARG C NE    1 
ATOM   5021  C  CZ    . ARG C 2  189  ? 477.060 -25.793 628.721 1.00 144.32 ? 189  ARG C CZ    1 
ATOM   5022  N  NH1   . ARG C 2  189  ? 476.748 -26.577 627.698 1.00 143.98 ? 189  ARG C NH1   1 
ATOM   5023  N  NH2   . ARG C 2  189  ? 477.842 -24.736 628.517 1.00 140.08 ? 189  ARG C NH2   1 
ATOM   5024  N  N     . LYS C 2  190  ? 471.603 -30.123 632.447 1.00 136.89 ? 190  LYS C N     1 
ATOM   5025  C  CA    . LYS C 2  190  ? 471.052 -31.479 632.447 1.00 133.43 ? 190  LYS C CA    1 
ATOM   5026  C  C     . LYS C 2  190  ? 471.124 -32.174 631.086 1.00 132.03 ? 190  LYS C C     1 
ATOM   5027  O  O     . LYS C 2  190  ? 471.055 -31.536 630.033 1.00 128.98 ? 190  LYS C O     1 
ATOM   5028  C  CB    . LYS C 2  190  ? 469.584 -31.439 632.922 1.00 125.24 ? 190  LYS C CB    1 
ATOM   5029  C  CG    . LYS C 2  190  ? 469.315 -32.161 634.239 1.00 129.23 ? 190  LYS C CG    1 
ATOM   5030  C  CD    . LYS C 2  190  ? 467.850 -32.095 634.688 1.00 129.81 ? 190  LYS C CD    1 
ATOM   5031  C  CE    . LYS C 2  190  ? 467.724 -32.564 636.147 1.00 135.54 ? 190  LYS C CE    1 
ATOM   5032  N  NZ    . LYS C 2  190  ? 466.451 -32.189 636.835 1.00 136.98 ? 190  LYS C NZ    1 
ATOM   5033  N  N     . PHE C 2  191  ? 471.276 -33.501 631.138 1.00 129.61 ? 191  PHE C N     1 
ATOM   5034  C  CA    . PHE C 2  191  ? 471.204 -34.384 629.980 1.00 128.33 ? 191  PHE C CA    1 
ATOM   5035  C  C     . PHE C 2  191  ? 470.722 -35.742 630.471 1.00 131.05 ? 191  PHE C C     1 
ATOM   5036  O  O     . PHE C 2  191  ? 470.608 -35.965 631.683 1.00 131.51 ? 191  PHE C O     1 
ATOM   5037  C  CB    . PHE C 2  191  ? 472.577 -34.532 629.324 1.00 129.39 ? 191  PHE C CB    1 
ATOM   5038  C  CG    . PHE C 2  191  ? 473.596 -35.120 630.243 1.00 130.29 ? 191  PHE C CG    1 
ATOM   5039  C  CD1   . PHE C 2  191  ? 474.229 -34.345 631.201 1.00 127.27 ? 191  PHE C CD1   1 
ATOM   5040  C  CD2   . PHE C 2  191  ? 473.908 -36.468 630.157 1.00 132.05 ? 191  PHE C CD2   1 
ATOM   5041  C  CE1   . PHE C 2  191  ? 475.153 -34.908 632.056 1.00 129.85 ? 191  PHE C CE1   1 
ATOM   5042  C  CE2   . PHE C 2  191  ? 474.831 -37.041 631.001 1.00 132.79 ? 191  PHE C CE2   1 
ATOM   5043  C  CZ    . PHE C 2  191  ? 475.459 -36.260 631.955 1.00 132.87 ? 191  PHE C CZ    1 
ATOM   5044  N  N     . PRO C 2  192  ? 470.438 -36.686 629.559 1.00 136.25 ? 192  PRO C N     1 
ATOM   5045  C  CA    . PRO C 2  192  ? 470.076 -38.047 630.012 1.00 135.63 ? 192  PRO C CA    1 
ATOM   5046  C  C     . PRO C 2  192  ? 471.275 -38.819 630.570 1.00 130.96 ? 192  PRO C C     1 
ATOM   5047  O  O     . PRO C 2  192  ? 472.331 -38.904 629.937 1.00 127.46 ? 192  PRO C O     1 
ATOM   5048  C  CB    . PRO C 2  192  ? 469.514 -38.708 628.744 1.00 129.75 ? 192  PRO C CB    1 
ATOM   5049  C  CG    . PRO C 2  192  ? 469.043 -37.571 627.906 1.00 124.72 ? 192  PRO C CG    1 
ATOM   5050  C  CD    . PRO C 2  192  ? 470.036 -36.464 628.154 1.00 129.21 ? 192  PRO C CD    1 
ATOM   5051  N  N     . LEU C 2  193  ? 471.084 -39.420 631.754 1.00 130.09 ? 193  LEU C N     1 
ATOM   5052  C  CA    . LEU C 2  193  ? 472.164 -40.169 632.399 1.00 131.95 ? 193  LEU C CA    1 
ATOM   5053  C  C     . LEU C 2  193  ? 472.610 -41.391 631.606 1.00 132.65 ? 193  LEU C C     1 
ATOM   5054  O  O     . LEU C 2  193  ? 473.762 -41.820 631.738 1.00 130.28 ? 193  LEU C O     1 
ATOM   5055  C  CB    . LEU C 2  193  ? 471.713 -40.639 633.789 1.00 127.89 ? 193  LEU C CB    1 
ATOM   5056  C  CG    . LEU C 2  193  ? 472.649 -41.551 634.599 1.00 122.39 ? 193  LEU C CG    1 
ATOM   5057  C  CD1   . LEU C 2  193  ? 473.979 -40.898 634.942 1.00 119.46 ? 193  LEU C CD1   1 
ATOM   5058  C  CD2   . LEU C 2  193  ? 471.956 -42.108 635.838 1.00 122.38 ? 193  LEU C CD2   1 
ATOM   5059  N  N     . VAL C 2  194  ? 471.737 -41.950 630.768 1.00 136.85 ? 194  VAL C N     1 
ATOM   5060  C  CA    . VAL C 2  194  ? 472.094 -43.154 630.018 1.00 136.46 ? 194  VAL C CA    1 
ATOM   5061  C  C     . VAL C 2  194  ? 473.348 -42.919 629.184 1.00 134.72 ? 194  VAL C C     1 
ATOM   5062  O  O     . VAL C 2  194  ? 474.225 -43.788 629.097 1.00 131.52 ? 194  VAL C O     1 
ATOM   5063  C  CB    . VAL C 2  194  ? 470.901 -43.623 629.156 1.00 139.88 ? 194  VAL C CB    1 
ATOM   5064  C  CG1   . VAL C 2  194  ? 470.089 -42.424 628.619 1.00 140.78 ? 194  VAL C CG1   1 
ATOM   5065  C  CG2   . VAL C 2  194  ? 471.335 -44.579 628.047 1.00 136.98 ? 194  VAL C CG2   1 
ATOM   5066  N  N     . LEU C 2  195  ? 473.478 -41.719 628.607 1.00 136.03 ? 195  LEU C N     1 
ATOM   5067  C  CA    . LEU C 2  195  ? 474.622 -41.401 627.752 1.00 138.27 ? 195  LEU C CA    1 
ATOM   5068  C  C     . LEU C 2  195  ? 475.941 -41.552 628.506 1.00 135.31 ? 195  LEU C C     1 
ATOM   5069  O  O     . LEU C 2  195  ? 476.920 -42.094 627.971 1.00 131.98 ? 195  LEU C O     1 
ATOM   5070  C  CB    . LEU C 2  195  ? 474.452 -39.995 627.155 1.00 137.06 ? 195  LEU C CB    1 
ATOM   5071  C  CG    . LEU C 2  195  ? 475.547 -39.355 626.292 1.00 135.94 ? 195  LEU C CG    1 
ATOM   5072  C  CD1   . LEU C 2  195  ? 475.879 -40.253 625.115 1.00 140.09 ? 195  LEU C CD1   1 
ATOM   5073  C  CD2   . LEU C 2  195  ? 475.078 -37.995 625.766 1.00 134.06 ? 195  LEU C CD2   1 
ATOM   5074  N  N     . LEU C 2  196  ? 476.003 -41.021 629.730 1.00 131.41 ? 196  LEU C N     1 
ATOM   5075  C  CA    . LEU C 2  196  ? 477.212 -41.159 630.537 1.00 130.25 ? 196  LEU C CA    1 
ATOM   5076  C  C     . LEU C 2  196  ? 477.508 -42.618 630.875 1.00 128.01 ? 196  LEU C C     1 
ATOM   5077  O  O     . LEU C 2  196  ? 478.674 -43.027 630.943 1.00 126.08 ? 196  LEU C O     1 
ATOM   5078  C  CB    . LEU C 2  196  ? 477.082 -40.335 631.821 1.00 131.76 ? 196  LEU C CB    1 
ATOM   5079  C  CG    . LEU C 2  196  ? 478.308 -40.188 632.744 1.00 127.60 ? 196  LEU C CG    1 
ATOM   5080  C  CD1   . LEU C 2  196  ? 478.304 -41.232 633.862 1.00 124.84 ? 196  LEU C CD1   1 
ATOM   5081  C  CD2   . LEU C 2  196  ? 479.625 -40.249 631.986 1.00 123.15 ? 196  LEU C CD2   1 
ATOM   5082  N  N     . LEU C 2  197  ? 476.467 -43.407 631.139 1.00 129.67 ? 197  LEU C N     1 
ATOM   5083  C  CA    . LEU C 2  197  ? 476.667 -44.829 631.409 1.00 135.32 ? 197  LEU C CA    1 
ATOM   5084  C  C     . LEU C 2  197  ? 477.369 -45.556 630.255 1.00 134.49 ? 197  LEU C C     1 
ATOM   5085  O  O     . LEU C 2  197  ? 478.266 -46.378 630.488 1.00 132.13 ? 197  LEU C O     1 
ATOM   5086  C  CB    . LEU C 2  197  ? 475.316 -45.473 631.743 1.00 135.78 ? 197  LEU C CB    1 
ATOM   5087  C  CG    . LEU C 2  197  ? 474.745 -45.059 633.096 1.00 122.78 ? 197  LEU C CG    1 
ATOM   5088  C  CD1   . LEU C 2  197  ? 473.375 -45.641 633.298 1.00 123.00 ? 197  LEU C CD1   1 
ATOM   5089  C  CD2   . LEU C 2  197  ? 475.694 -45.568 634.152 1.00 121.00 ? 197  LEU C CD2   1 
ATOM   5090  N  N     . ARG C 2  198  ? 477.021 -45.225 629.004 1.00 132.20 ? 198  ARG C N     1 
ATOM   5091  C  CA    . ARG C 2  198  ? 477.660 -45.885 627.865 1.00 133.66 ? 198  ARG C CA    1 
ATOM   5092  C  C     . ARG C 2  198  ? 479.152 -45.565 627.804 1.00 131.37 ? 198  ARG C C     1 
ATOM   5093  O  O     . ARG C 2  198  ? 479.972 -46.469 627.601 1.00 132.05 ? 198  ARG C O     1 
ATOM   5094  C  CB    . ARG C 2  198  ? 476.958 -45.478 626.551 1.00 135.90 ? 198  ARG C CB    1 
ATOM   5095  C  CG    . ARG C 2  198  ? 477.387 -46.218 625.221 1.00 139.57 ? 198  ARG C CG    1 
ATOM   5096  C  CD    . ARG C 2  198  ? 477.227 -47.771 625.223 1.00 141.63 ? 198  ARG C CD    1 
ATOM   5097  N  NE    . ARG C 2  198  ? 477.659 -48.419 623.968 1.00 144.95 ? 198  ARG C NE    1 
ATOM   5098  C  CZ    . ARG C 2  198  ? 477.164 -49.560 623.475 1.00 144.97 ? 198  ARG C CZ    1 
ATOM   5099  N  NH1   . ARG C 2  198  ? 477.628 -50.061 622.333 1.00 142.25 ? 198  ARG C NH1   1 
ATOM   5100  N  NH2   . ARG C 2  198  ? 476.180 -50.190 624.099 1.00 144.57 ? 198  ARG C NH2   1 
ATOM   5101  N  N     . VAL C 2  199  ? 479.530 -44.324 628.139 1.00 127.63 ? 199  VAL C N     1 
ATOM   5102  C  CA    . VAL C 2  199  ? 480.942 -43.938 628.166 1.00 123.54 ? 199  VAL C CA    1 
ATOM   5103  C  C     . VAL C 2  199  ? 481.736 -44.802 629.142 1.00 125.13 ? 199  VAL C C     1 
ATOM   5104  O  O     . VAL C 2  199  ? 482.945 -45.007 628.969 1.00 124.42 ? 199  VAL C O     1 
ATOM   5105  C  CB    . VAL C 2  199  ? 481.050 -42.439 628.493 1.00 114.06 ? 199  VAL C CB    1 
ATOM   5106  C  CG1   . VAL C 2  199  ? 482.508 -41.989 628.492 1.00 107.62 ? 199  VAL C CG1   1 
ATOM   5107  C  CG2   . VAL C 2  199  ? 480.162 -41.620 627.561 1.00 115.71 ? 199  VAL C CG2   1 
ATOM   5108  N  N     . LEU C 2  200  ? 481.100 -45.266 630.212 1.00 127.40 ? 200  LEU C N     1 
ATOM   5109  C  CA    . LEU C 2  200  ? 481.784 -46.125 631.167 1.00 130.14 ? 200  LEU C CA    1 
ATOM   5110  C  C     . LEU C 2  200  ? 481.975 -47.523 630.597 1.00 130.79 ? 200  LEU C C     1 
ATOM   5111  O  O     . LEU C 2  200  ? 482.675 -48.345 631.203 1.00 129.19 ? 200  LEU C O     1 
ATOM   5112  C  CB    . LEU C 2  200  ? 480.978 -46.181 632.464 1.00 131.58 ? 200  LEU C CB    1 
ATOM   5113  C  CG    . LEU C 2  200  ? 480.875 -44.855 633.213 1.00 125.06 ? 200  LEU C CG    1 
ATOM   5114  C  CD1   . LEU C 2  200  ? 479.779 -44.937 634.250 1.00 127.20 ? 200  LEU C CD1   1 
ATOM   5115  C  CD2   . LEU C 2  200  ? 482.207 -44.541 633.873 1.00 120.15 ? 200  LEU C CD2   1 
ATOM   5116  N  N     . GLY C 2  201  ? 481.363 -47.789 629.445 1.00 131.02 ? 201  GLY C N     1 
ATOM   5117  C  CA    . GLY C 2  201  ? 481.479 -49.050 628.751 1.00 134.15 ? 201  GLY C CA    1 
ATOM   5118  C  C     . GLY C 2  201  ? 480.321 -49.967 629.057 1.00 133.17 ? 201  GLY C C     1 
ATOM   5119  O  O     . GLY C 2  201  ? 480.405 -51.170 628.784 1.00 132.54 ? 201  GLY C O     1 
ATOM   5120  N  N     . TYR C 2  202  ? 479.236 -49.421 629.592 1.00 134.50 ? 202  TYR C N     1 
ATOM   5121  C  CA    . TYR C 2  202  ? 478.048 -50.188 629.928 1.00 142.60 ? 202  TYR C CA    1 
ATOM   5122  C  C     . TYR C 2  202  ? 477.223 -50.507 628.688 1.00 140.94 ? 202  TYR C C     1 
ATOM   5123  O  O     . TYR C 2  202  ? 477.166 -49.724 627.736 1.00 135.08 ? 202  TYR C O     1 
ATOM   5124  C  CB    . TYR C 2  202  ? 477.178 -49.437 630.950 1.00 137.95 ? 202  TYR C CB    1 
ATOM   5125  C  CG    . TYR C 2  202  ? 477.705 -49.482 632.366 1.00 131.91 ? 202  TYR C CG    1 
ATOM   5126  C  CD1   . TYR C 2  202  ? 478.728 -50.358 632.715 1.00 135.83 ? 202  TYR C CD1   1 
ATOM   5127  C  CD2   . TYR C 2  202  ? 477.184 -48.659 633.347 1.00 128.21 ? 202  TYR C CD2   1 
ATOM   5128  C  CE1   . TYR C 2  202  ? 479.225 -50.407 633.991 1.00 127.39 ? 202  TYR C CE1   1 
ATOM   5129  C  CE2   . TYR C 2  202  ? 477.676 -48.706 634.632 1.00 129.78 ? 202  TYR C CE2   1 
ATOM   5130  C  CZ    . TYR C 2  202  ? 478.697 -49.587 634.940 1.00 125.67 ? 202  TYR C CZ    1 
ATOM   5131  O  OH    . TYR C 2  202  ? 479.205 -49.653 636.204 1.00 131.27 ? 202  TYR C OH    1 
ATOM   5132  N  N     . ASP C 2  203  ? 476.619 -51.690 628.701 1.00 143.50 ? 203  ASP C N     1 
ATOM   5133  C  CA    . ASP C 2  203  ? 475.723 -52.166 627.664 1.00 146.19 ? 203  ASP C CA    1 
ATOM   5134  C  C     . ASP C 2  203  ? 474.338 -52.385 628.260 1.00 148.78 ? 203  ASP C C     1 
ATOM   5135  O  O     . ASP C 2  203  ? 474.181 -52.518 629.474 1.00 152.06 ? 203  ASP C O     1 
ATOM   5136  C  CB    . ASP C 2  203  ? 476.240 -53.471 627.047 1.00 149.92 ? 203  ASP C CB    1 
ATOM   5137  C  CG    . ASP C 2  203  ? 475.669 -53.728 625.669 1.00 152.49 ? 203  ASP C CG    1 
ATOM   5138  O  OD1   . ASP C 2  203  ? 476.119 -53.079 624.694 1.00 153.65 ? 203  ASP C OD1   1 
ATOM   5139  O  OD2   . ASP C 2  203  ? 474.769 -54.589 625.566 1.00 154.67 ? 203  ASP C OD2   1 
ATOM   5140  N  N     . GLN C 2  204  ? 473.330 -52.404 627.381 1.00 150.29 ? 204  GLN C N     1 
ATOM   5141  C  CA    . GLN C 2  204  ? 471.932 -52.539 627.794 1.00 148.27 ? 204  GLN C CA    1 
ATOM   5142  C  C     . GLN C 2  204  ? 471.722 -53.734 628.720 1.00 150.15 ? 204  GLN C C     1 
ATOM   5143  O  O     . GLN C 2  204  ? 470.854 -53.695 629.601 1.00 150.24 ? 204  GLN C O     1 
ATOM   5144  C  CB    . GLN C 2  204  ? 471.029 -52.623 626.569 1.00 146.17 ? 204  GLN C CB    1 
ATOM   5145  C  CG    . GLN C 2  204  ? 469.573 -52.554 626.929 1.00 146.52 ? 204  GLN C CG    1 
ATOM   5146  C  CD    . GLN C 2  204  ? 468.674 -52.316 625.735 1.00 152.91 ? 204  GLN C CD    1 
ATOM   5147  O  OE1   . GLN C 2  204  ? 469.143 -52.146 624.606 1.00 155.76 ? 204  GLN C OE1   1 
ATOM   5148  N  NE2   . GLN C 2  204  ? 467.368 -52.270 625.983 1.00 152.90 ? 204  GLN C NE2   1 
ATOM   5149  N  N     . GLU C 2  205  ? 472.486 -54.808 628.506 1.00 154.43 ? 205  GLU C N     1 
ATOM   5150  C  CA    . GLU C 2  205  ? 472.412 -56.013 629.334 1.00 156.85 ? 205  GLU C CA    1 
ATOM   5151  C  C     . GLU C 2  205  ? 472.770 -55.725 630.796 1.00 155.92 ? 205  GLU C C     1 
ATOM   5152  O  O     . GLU C 2  205  ? 472.074 -56.181 631.710 1.00 156.60 ? 205  GLU C O     1 
ATOM   5153  C  CB    . GLU C 2  205  ? 473.323 -57.097 628.739 1.00 160.88 ? 205  GLU C CB    1 
ATOM   5154  C  CG    . GLU C 2  205  ? 474.812 -56.704 628.640 1.00 161.18 ? 205  GLU C CG    1 
ATOM   5155  C  CD    . GLU C 2  205  ? 475.676 -57.246 629.782 1.00 167.84 ? 205  GLU C CD    1 
ATOM   5156  O  OE1   . GLU C 2  205  ? 475.126 -57.592 630.858 1.00 164.93 ? 205  GLU C OE1   1 
ATOM   5157  O  OE2   . GLU C 2  205  ? 476.917 -57.292 629.606 1.00 167.14 ? 205  GLU C OE2   1 
ATOM   5158  N  N     . THR C 2  206  ? 473.889 -55.028 631.040 1.00 156.97 ? 206  THR C N     1 
ATOM   5159  C  CA    . THR C 2  206  ? 474.340 -54.771 632.410 1.00 154.60 ? 206  THR C CA    1 
ATOM   5160  C  C     . THR C 2  206  ? 473.293 -53.997 633.200 1.00 152.63 ? 206  THR C C     1 
ATOM   5161  O  O     . THR C 2  206  ? 472.994 -54.338 634.351 1.00 150.06 ? 206  THR C O     1 
ATOM   5162  C  CB    . THR C 2  206  ? 475.663 -53.987 632.407 1.00 153.56 ? 206  THR C CB    1 
ATOM   5163  O  OG1   . THR C 2  206  ? 476.526 -54.444 631.352 1.00 151.54 ? 206  THR C OG1   1 
ATOM   5164  C  CG2   . THR C 2  206  ? 476.365 -54.022 633.774 1.00 148.55 ? 206  THR C CG2   1 
ATOM   5165  N  N     . LEU C 2  207  ? 472.731 -52.942 632.597 1.00 151.86 ? 207  LEU C N     1 
ATOM   5166  C  CA    . LEU C 2  207  ? 471.713 -52.142 633.274 1.00 151.84 ? 207  LEU C CA    1 
ATOM   5167  C  C     . LEU C 2  207  ? 470.421 -52.938 633.492 1.00 154.77 ? 207  LEU C C     1 
ATOM   5168  O  O     . LEU C 2  207  ? 469.758 -52.791 634.530 1.00 154.20 ? 207  LEU C O     1 
ATOM   5169  C  CB    . LEU C 2  207  ? 471.450 -50.884 632.440 1.00 144.96 ? 207  LEU C CB    1 
ATOM   5170  C  CG    . LEU C 2  207  ? 472.682 -49.984 632.194 1.00 141.96 ? 207  LEU C CG    1 
ATOM   5171  C  CD1   . LEU C 2  207  ? 472.302 -48.662 631.555 1.00 139.30 ? 207  LEU C CD1   1 
ATOM   5172  C  CD2   . LEU C 2  207  ? 473.565 -49.751 633.418 1.00 139.56 ? 207  LEU C CD2   1 
ATOM   5173  N  N     . ALA C 2  208  ? 470.020 -53.751 632.509 1.00 153.05 ? 208  ALA C N     1 
ATOM   5174  C  CA    . ALA C 2  208  ? 468.833 -54.589 632.665 1.00 148.90 ? 208  ALA C CA    1 
ATOM   5175  C  C     . ALA C 2  208  ? 469.014 -55.654 633.752 1.00 149.14 ? 208  ALA C C     1 
ATOM   5176  O  O     . ALA C 2  208  ? 468.160 -55.808 634.631 1.00 149.39 ? 208  ALA C O     1 
ATOM   5177  C  CB    . ALA C 2  208  ? 468.466 -55.236 631.329 1.00 144.91 ? 208  ALA C CB    1 
ATOM   5178  N  N     . ARG C 2  209  ? 470.124 -56.412 633.692 1.00 151.77 ? 209  ARG C N     1 
ATOM   5179  C  CA    . ARG C 2  209  ? 470.378 -57.495 634.651 1.00 153.25 ? 209  ARG C CA    1 
ATOM   5180  C  C     . ARG C 2  209  ? 470.641 -56.988 636.068 1.00 152.01 ? 209  ARG C C     1 
ATOM   5181  O  O     . ARG C 2  209  ? 470.250 -57.640 637.044 1.00 152.51 ? 209  ARG C O     1 
ATOM   5182  C  CB    . ARG C 2  209  ? 471.569 -58.359 634.215 1.00 156.87 ? 209  ARG C CB    1 
ATOM   5183  C  CG    . ARG C 2  209  ? 472.908 -57.827 634.712 1.00 156.34 ? 209  ARG C CG    1 
ATOM   5184  C  CD    . ARG C 2  209  ? 474.059 -58.786 634.531 1.00 159.15 ? 209  ARG C CD    1 
ATOM   5185  N  NE    . ARG C 2  209  ? 475.070 -58.507 635.553 1.00 159.32 ? 209  ARG C NE    1 
ATOM   5186  C  CZ    . ARG C 2  209  ? 476.101 -57.685 635.409 1.00 159.05 ? 209  ARG C CZ    1 
ATOM   5187  N  NH1   . ARG C 2  209  ? 476.283 -57.039 634.268 1.00 160.29 ? 209  ARG C NH1   1 
ATOM   5188  N  NH2   . ARG C 2  209  ? 476.945 -57.507 636.418 1.00 156.26 ? 209  ARG C NH2   1 
ATOM   5189  N  N     . GLU C 2  210  ? 471.328 -55.851 636.203 1.00 151.15 ? 210  GLU C N     1 
ATOM   5190  C  CA    . GLU C 2  210  ? 471.697 -55.344 637.522 1.00 150.96 ? 210  GLU C CA    1 
ATOM   5191  C  C     . GLU C 2  210  ? 470.462 -54.816 638.231 1.00 149.66 ? 210  GLU C C     1 
ATOM   5192  O  O     . GLU C 2  210  ? 470.166 -55.194 639.373 1.00 146.58 ? 210  GLU C O     1 
ATOM   5193  C  CB    . GLU C 2  210  ? 472.777 -54.269 637.408 1.00 147.32 ? 210  GLU C CB    1 
ATOM   5194  C  CG    . GLU C 2  210  ? 473.741 -54.258 638.585 1.00 144.65 ? 210  GLU C CG    1 
ATOM   5195  C  CD    . GLU C 2  210  ? 474.540 -55.551 638.678 1.00 142.87 ? 210  GLU C CD    1 
ATOM   5196  O  OE1   . GLU C 2  210  ? 474.957 -56.065 637.625 1.00 142.97 ? 210  GLU C OE1   1 
ATOM   5197  O  OE2   . GLU C 2  210  ? 474.742 -56.063 639.797 1.00 142.82 ? 210  GLU C OE2   1 
ATOM   5198  N  N     . LEU C 2  211  ? 469.734 -53.939 637.555 1.00 147.45 ? 211  LEU C N     1 
ATOM   5199  C  CA    . LEU C 2  211  ? 468.634 -53.189 638.121 1.00 148.16 ? 211  LEU C CA    1 
ATOM   5200  C  C     . LEU C 2  211  ? 467.365 -53.947 637.743 1.00 149.11 ? 211  LEU C C     1 
ATOM   5201  O  O     . LEU C 2  211  ? 466.854 -54.733 638.554 1.00 142.87 ? 211  LEU C O     1 
ATOM   5202  C  CB    . LEU C 2  211  ? 468.645 -51.771 637.543 1.00 145.18 ? 211  LEU C CB    1 
ATOM   5203  C  CG    . LEU C 2  211  ? 469.828 -50.846 637.848 1.00 143.72 ? 211  LEU C CG    1 
ATOM   5204  C  CD1   . LEU C 2  211  ? 470.977 -51.049 636.890 1.00 142.03 ? 211  LEU C CD1   1 
ATOM   5205  C  CD2   . LEU C 2  211  ? 469.367 -49.418 637.716 1.00 139.32 ? 211  LEU C CD2   1 
ATOM   5206  N  N     . GLY C 2  212  ? 466.902 -53.774 636.499 1.00 148.57 ? 212  GLY C N     1 
ATOM   5207  C  CA    . GLY C 2  212  ? 465.626 -54.254 635.974 1.00 144.39 ? 212  GLY C CA    1 
ATOM   5208  C  C     . GLY C 2  212  ? 464.472 -54.597 636.904 1.00 143.95 ? 212  GLY C C     1 
ATOM   5209  O  O     . GLY C 2  212  ? 463.309 -54.465 636.503 1.00 141.22 ? 212  GLY C O     1 
ATOM   5210  N  N     . ALA C 2  213  ? 464.774 -55.019 638.141 1.00 142.86 ? 213  ALA C N     1 
ATOM   5211  C  CA    . ALA C 2  213  ? 463.769 -55.495 639.088 1.00 140.15 ? 213  ALA C CA    1 
ATOM   5212  C  C     . ALA C 2  213  ? 462.610 -54.518 639.247 1.00 147.60 ? 213  ALA C C     1 
ATOM   5213  O  O     . ALA C 2  213  ? 461.509 -54.921 639.648 1.00 147.95 ? 213  ALA C O     1 
ATOM   5214  C  CB    . ALA C 2  213  ? 464.429 -55.760 640.442 1.00 135.27 ? 213  ALA C CB    1 
ATOM   5215  N  N     . TYR C 2  214  ? 462.842 -53.242 638.947 1.00 148.42 ? 214  TYR C N     1 
ATOM   5216  C  CA    . TYR C 2  214  ? 461.851 -52.183 639.065 1.00 145.81 ? 214  TYR C CA    1 
ATOM   5217  C  C     . TYR C 2  214  ? 461.316 -51.967 637.662 1.00 146.29 ? 214  TYR C C     1 
ATOM   5218  O  O     . TYR C 2  214  ? 462.029 -51.457 636.793 1.00 141.76 ? 214  TYR C O     1 
ATOM   5219  C  CB    . TYR C 2  214  ? 462.498 -50.931 639.648 1.00 142.75 ? 214  TYR C CB    1 
ATOM   5220  C  CG    . TYR C 2  214  ? 463.596 -51.367 640.567 1.00 141.31 ? 214  TYR C CG    1 
ATOM   5221  C  CD1   . TYR C 2  214  ? 463.318 -51.754 641.867 1.00 136.92 ? 214  TYR C CD1   1 
ATOM   5222  C  CD2   . TYR C 2  214  ? 464.910 -51.465 640.113 1.00 142.22 ? 214  TYR C CD2   1 
ATOM   5223  C  CE1   . TYR C 2  214  ? 464.318 -52.207 642.703 1.00 137.12 ? 214  TYR C CE1   1 
ATOM   5224  C  CE2   . TYR C 2  214  ? 465.919 -51.919 640.941 1.00 141.43 ? 214  TYR C CE2   1 
ATOM   5225  C  CZ    . TYR C 2  214  ? 465.618 -52.285 642.239 1.00 139.36 ? 214  TYR C CZ    1 
ATOM   5226  O  OH    . TYR C 2  214  ? 466.618 -52.730 643.079 1.00 133.49 ? 214  TYR C OH    1 
ATOM   5227  N  N     . GLY C 2  215  ? 460.069 -52.375 637.443 1.00 151.72 ? 215  GLY C N     1 
ATOM   5228  C  CA    . GLY C 2  215  ? 459.590 -52.717 636.119 1.00 156.16 ? 215  GLY C CA    1 
ATOM   5229  C  C     . GLY C 2  215  ? 459.698 -51.498 635.238 1.00 159.47 ? 215  GLY C C     1 
ATOM   5230  O  O     . GLY C 2  215  ? 460.346 -51.539 634.185 1.00 152.38 ? 215  GLY C O     1 
ATOM   5231  N  N     . GLU C 2  216  ? 459.054 -50.408 635.657 1.00 161.82 ? 216  GLU C N     1 
ATOM   5232  C  CA    . GLU C 2  216  ? 458.902 -49.252 634.791 1.00 161.42 ? 216  GLU C CA    1 
ATOM   5233  C  C     . GLU C 2  216  ? 460.079 -48.292 634.903 1.00 160.53 ? 216  GLU C C     1 
ATOM   5234  O  O     . GLU C 2  216  ? 460.241 -47.432 634.026 1.00 163.30 ? 216  GLU C O     1 
ATOM   5235  C  CB    . GLU C 2  216  ? 457.606 -48.496 635.110 1.00 159.31 ? 216  GLU C CB    1 
ATOM   5236  C  CG    . GLU C 2  216  ? 456.335 -49.315 634.980 1.00 161.10 ? 216  GLU C CG    1 
ATOM   5237  C  CD    . GLU C 2  216  ? 455.099 -48.438 634.950 1.00 162.06 ? 216  GLU C CD    1 
ATOM   5238  O  OE1   . GLU C 2  216  ? 455.217 -47.270 634.514 1.00 156.73 ? 216  GLU C OE1   1 
ATOM   5239  O  OE2   . GLU C 2  216  ? 454.020 -48.909 635.372 1.00 158.70 ? 216  GLU C OE2   1 
ATOM   5240  N  N     . LEU C 2  217  ? 460.908 -48.403 635.952 1.00 156.30 ? 217  LEU C N     1 
ATOM   5241  C  CA    . LEU C 2  217  ? 461.945 -47.390 636.094 1.00 151.95 ? 217  LEU C CA    1 
ATOM   5242  C  C     . LEU C 2  217  ? 463.173 -47.737 635.254 1.00 154.13 ? 217  LEU C C     1 
ATOM   5243  O  O     . LEU C 2  217  ? 463.692 -46.878 634.530 1.00 156.55 ? 217  LEU C O     1 
ATOM   5244  C  CB    . LEU C 2  217  ? 462.330 -47.239 637.571 1.00 148.89 ? 217  LEU C CB    1 
ATOM   5245  C  CG    . LEU C 2  217  ? 461.194 -47.227 638.597 1.00 146.49 ? 217  LEU C CG    1 
ATOM   5246  C  CD1   . LEU C 2  217  ? 461.731 -47.583 639.980 1.00 134.37 ? 217  LEU C CD1   1 
ATOM   5247  C  CD2   . LEU C 2  217  ? 460.448 -45.891 638.597 1.00 140.39 ? 217  LEU C CD2   1 
ATOM   5248  N  N     . VAL C 2  218  ? 463.626 -49.000 635.305 1.00 153.40 ? 218  VAL C N     1 
ATOM   5249  C  CA    . VAL C 2  218  ? 464.838 -49.405 634.583 1.00 148.58 ? 218  VAL C CA    1 
ATOM   5250  C  C     . VAL C 2  218  ? 464.660 -49.295 633.071 1.00 145.13 ? 218  VAL C C     1 
ATOM   5251  O  O     . VAL C 2  218  ? 465.600 -48.946 632.347 1.00 140.39 ? 218  VAL C O     1 
ATOM   5252  C  CB    . VAL C 2  218  ? 465.287 -50.809 635.015 1.00 142.18 ? 218  VAL C CB    1 
ATOM   5253  C  CG1   . VAL C 2  218  ? 466.774 -50.940 634.828 1.00 136.39 ? 218  VAL C CG1   1 
ATOM   5254  C  CG2   . VAL C 2  218  ? 464.969 -50.984 636.481 1.00 142.10 ? 218  VAL C CG2   1 
ATOM   5255  N  N     . GLN C 2  219  ? 463.460 -49.615 632.570 1.00 149.47 ? 219  GLN C N     1 
ATOM   5256  C  CA    . GLN C 2  219  ? 463.169 -49.471 631.141 1.00 154.53 ? 219  GLN C CA    1 
ATOM   5257  C  C     . GLN C 2  219  ? 463.102 -48.010 630.695 1.00 154.35 ? 219  GLN C C     1 
ATOM   5258  O  O     . GLN C 2  219  ? 463.373 -47.714 629.521 1.00 149.63 ? 219  GLN C O     1 
ATOM   5259  C  CB    . GLN C 2  219  ? 461.870 -50.207 630.779 1.00 154.40 ? 219  GLN C CB    1 
ATOM   5260  C  CG    . GLN C 2  219  ? 462.072 -51.656 630.286 1.00 146.60 ? 219  GLN C CG    1 
ATOM   5261  C  CD    . GLN C 2  219  ? 460.811 -52.263 629.672 1.00 144.26 ? 219  GLN C CD    1 
ATOM   5262  O  OE1   . GLN C 2  219  ? 460.368 -51.845 628.600 1.00 144.74 ? 219  GLN C OE1   1 
ATOM   5263  N  NE2   . GLN C 2  219  ? 460.246 -53.267 630.336 1.00 141.94 ? 219  GLN C NE2   1 
ATOM   5264  N  N     . GLY C 2  220  ? 462.708 -47.096 631.588 1.00 154.13 ? 220  GLY C N     1 
ATOM   5265  C  CA    . GLY C 2  220  ? 462.711 -45.676 631.263 1.00 156.04 ? 220  GLY C CA    1 
ATOM   5266  C  C     . GLY C 2  220  ? 464.093 -45.062 631.084 1.00 153.04 ? 220  GLY C C     1 
ATOM   5267  O  O     . GLY C 2  220  ? 464.224 -44.058 630.373 1.00 148.51 ? 220  GLY C O     1 
ATOM   5268  N  N     . LEU C 2  221  ? 465.132 -45.676 631.656 1.00 148.30 ? 221  LEU C N     1 
ATOM   5269  C  CA    . LEU C 2  221  ? 466.501 -45.216 631.454 1.00 144.50 ? 221  LEU C CA    1 
ATOM   5270  C  C     . LEU C 2  221  ? 467.048 -45.619 630.096 1.00 150.02 ? 221  LEU C C     1 
ATOM   5271  O  O     . LEU C 2  221  ? 467.986 -44.977 629.611 1.00 151.03 ? 221  LEU C O     1 
ATOM   5272  C  CB    . LEU C 2  221  ? 467.439 -45.737 632.552 1.00 145.23 ? 221  LEU C CB    1 
ATOM   5273  C  CG    . LEU C 2  221  ? 468.221 -47.040 632.371 1.00 141.69 ? 221  LEU C CG    1 
ATOM   5274  C  CD1   . LEU C 2  221  ? 469.617 -46.647 632.006 1.00 142.31 ? 221  LEU C CD1   1 
ATOM   5275  C  CD2   . LEU C 2  221  ? 468.263 -47.878 633.640 1.00 143.09 ? 221  LEU C CD2   1 
ATOM   5276  N  N     . MET C 2  222  ? 466.470 -46.656 629.480 1.00 154.72 ? 222  MET C N     1 
ATOM   5277  C  CA    . MET C 2  222  ? 466.964 -47.265 628.244 1.00 152.36 ? 222  MET C CA    1 
ATOM   5278  C  C     . MET C 2  222  ? 466.627 -46.377 627.045 1.00 149.89 ? 222  MET C C     1 
ATOM   5279  O  O     . MET C 2  222  ? 465.452 -46.094 626.775 1.00 146.91 ? 222  MET C O     1 
ATOM   5280  C  CB    . MET C 2  222  ? 466.335 -48.652 628.104 1.00 146.35 ? 222  MET C CB    1 
ATOM   5281  C  CG    . MET C 2  222  ? 466.759 -49.585 629.237 1.00 147.93 ? 222  MET C CG    1 
ATOM   5282  S  SD    . MET C 2  222  ? 467.125 -51.297 628.845 1.00 147.89 ? 222  MET C SD    1 
ATOM   5283  C  CE    . MET C 2  222  ? 467.562 -51.924 630.467 1.00 142.52 ? 222  MET C CE    1 
ATOM   5284  N  N     . ASP C 2  223  ? 467.665 -45.958 626.314 1.00 148.03 ? 223  ASP C N     1 
ATOM   5285  C  CA    . ASP C 2  223  ? 467.513 -45.179 625.088 1.00 152.28 ? 223  ASP C CA    1 
ATOM   5286  C  C     . ASP C 2  223  ? 468.377 -45.773 623.981 1.00 153.54 ? 223  ASP C C     1 
ATOM   5287  O  O     . ASP C 2  223  ? 469.603 -45.861 624.120 1.00 149.98 ? 223  ASP C O     1 
ATOM   5288  C  CB    . ASP C 2  223  ? 467.878 -43.706 625.351 1.00 150.95 ? 223  ASP C CB    1 
ATOM   5289  C  CG    . ASP C 2  223  ? 467.669 -42.802 624.134 1.00 148.33 ? 223  ASP C CG    1 
ATOM   5290  O  OD1   . ASP C 2  223  ? 468.596 -42.656 623.304 1.00 143.25 ? 223  ASP C OD1   1 
ATOM   5291  O  OD2   . ASP C 2  223  ? 466.567 -42.230 624.010 1.00 151.01 ? 223  ASP C OD2   1 
ATOM   5292  N  N     . GLU C 2  224  ? 467.705 -46.233 622.912 1.00 155.74 ? 224  GLU C N     1 
ATOM   5293  C  CA    . GLU C 2  224  ? 468.327 -46.981 621.816 1.00 149.95 ? 224  GLU C CA    1 
ATOM   5294  C  C     . GLU C 2  224  ? 469.395 -46.172 621.077 1.00 149.61 ? 224  GLU C C     1 
ATOM   5295  O  O     . GLU C 2  224  ? 470.470 -46.698 620.763 1.00 149.91 ? 224  GLU C O     1 
ATOM   5296  C  CB    . GLU C 2  224  ? 467.253 -47.470 620.839 1.00 146.83 ? 224  GLU C CB    1 
ATOM   5297  C  CG    . GLU C 2  224  ? 466.229 -46.413 620.441 1.00 149.46 ? 224  GLU C CG    1 
ATOM   5298  C  CD    . GLU C 2  224  ? 465.097 -46.278 621.446 1.00 153.20 ? 224  GLU C CD    1 
ATOM   5299  O  OE1   . GLU C 2  224  ? 464.692 -47.309 622.030 1.00 152.89 ? 224  GLU C OE1   1 
ATOM   5300  O  OE2   . GLU C 2  224  ? 464.626 -45.139 621.665 1.00 152.94 ? 224  GLU C OE2   1 
ATOM   5301  N  N     . SER C 2  225  ? 469.101 -44.900 620.755 1.00 148.00 ? 225  SER C N     1 
ATOM   5302  C  CA    . SER C 2  225  ? 470.036 -44.082 619.976 1.00 147.44 ? 225  SER C CA    1 
ATOM   5303  C  C     . SER C 2  225  ? 471.417 -44.030 620.631 1.00 150.71 ? 225  SER C C     1 
ATOM   5304  O  O     . SER C 2  225  ? 472.442 -43.965 619.938 1.00 149.80 ? 225  SER C O     1 
ATOM   5305  C  CB    . SER C 2  225  ? 469.461 -42.674 619.764 1.00 143.66 ? 225  SER C CB    1 
ATOM   5306  O  OG    . SER C 2  225  ? 469.135 -42.027 620.982 1.00 145.52 ? 225  SER C OG    1 
ATOM   5307  N  N     . VAL C 2  226  ? 471.454 -43.995 621.967 1.00 153.15 ? 226  VAL C N     1 
ATOM   5308  C  CA    . VAL C 2  226  ? 472.710 -43.963 622.720 1.00 152.63 ? 226  VAL C CA    1 
ATOM   5309  C  C     . VAL C 2  226  ? 473.478 -45.283 622.576 1.00 151.84 ? 226  VAL C C     1 
ATOM   5310  O  O     . VAL C 2  226  ? 474.711 -45.289 622.462 1.00 151.96 ? 226  VAL C O     1 
ATOM   5311  C  CB    . VAL C 2  226  ? 472.435 -43.624 624.200 1.00 146.74 ? 226  VAL C CB    1 
ATOM   5312  C  CG1   . VAL C 2  226  ? 473.701 -43.793 625.039 1.00 137.73 ? 226  VAL C CG1   1 
ATOM   5313  C  CG2   . VAL C 2  226  ? 471.873 -42.205 624.335 1.00 143.69 ? 226  VAL C CG2   1 
ATOM   5314  N  N     . PHE C 2  227  ? 472.769 -46.422 622.597 1.00 148.54 ? 227  PHE C N     1 
ATOM   5315  C  CA    . PHE C 2  227  ? 473.425 -47.722 622.451 1.00 146.34 ? 227  PHE C CA    1 
ATOM   5316  C  C     . PHE C 2  227  ? 474.047 -47.928 621.072 1.00 148.51 ? 227  PHE C C     1 
ATOM   5317  O  O     . PHE C 2  227  ? 475.002 -48.705 620.943 1.00 146.87 ? 227  PHE C O     1 
ATOM   5318  C  CB    . PHE C 2  227  ? 472.407 -48.827 622.728 1.00 143.37 ? 227  PHE C CB    1 
ATOM   5319  C  CG    . PHE C 2  227  ? 472.029 -48.945 624.174 1.00 148.72 ? 227  PHE C CG    1 
ATOM   5320  C  CD1   . PHE C 2  227  ? 472.954 -49.350 625.120 1.00 146.36 ? 227  PHE C CD1   1 
ATOM   5321  C  CD2   . PHE C 2  227  ? 470.751 -48.603 624.595 1.00 148.93 ? 227  PHE C CD2   1 
ATOM   5322  C  CE1   . PHE C 2  227  ? 472.599 -49.438 626.452 1.00 144.47 ? 227  PHE C CE1   1 
ATOM   5323  C  CE2   . PHE C 2  227  ? 470.390 -48.684 625.927 1.00 143.81 ? 227  PHE C CE2   1 
ATOM   5324  C  CZ    . PHE C 2  227  ? 471.312 -49.106 626.855 1.00 144.67 ? 227  PHE C CZ    1 
ATOM   5325  N  N     . ALA C 2  228  ? 473.502 -47.284 620.033 1.00 151.43 ? 228  ALA C N     1 
ATOM   5326  C  CA    . ALA C 2  228  ? 473.998 -47.371 618.656 1.00 151.95 ? 228  ALA C CA    1 
ATOM   5327  C  C     . ALA C 2  228  ? 475.403 -46.796 618.450 1.00 153.60 ? 228  ALA C C     1 
ATOM   5328  O  O     . ALA C 2  228  ? 475.665 -46.188 617.404 1.00 153.95 ? 228  ALA C O     1 
ATOM   5329  C  CB    . ALA C 2  228  ? 473.021 -46.669 617.705 1.00 145.05 ? 228  ALA C CB    1 
ATOM   5330  N  N     . MET C 2  229  ? 476.310 -46.973 619.413 1.00 152.39 ? 229  MET C N     1 
ATOM   5331  C  CA    . MET C 2  229  ? 477.653 -46.413 619.304 1.00 150.00 ? 229  MET C CA    1 
ATOM   5332  C  C     . MET C 2  229  ? 478.546 -46.996 620.390 1.00 148.88 ? 229  MET C C     1 
ATOM   5333  O  O     . MET C 2  229  ? 478.121 -47.128 621.540 1.00 148.11 ? 229  MET C O     1 
ATOM   5334  C  CB    . MET C 2  229  ? 477.589 -44.877 619.383 1.00 151.53 ? 229  MET C CB    1 
ATOM   5335  C  CG    . MET C 2  229  ? 477.061 -44.324 620.707 1.00 150.44 ? 229  MET C CG    1 
ATOM   5336  S  SD    . MET C 2  229  ? 476.612 -42.569 620.631 1.00 156.06 ? 229  MET C SD    1 
ATOM   5337  C  CE    . MET C 2  229  ? 475.475 -42.578 619.244 1.00 149.70 ? 229  MET C CE    1 
ATOM   5338  N  N     . ARG C 2  230  ? 479.781 -47.338 620.017 1.00 148.69 ? 230  ARG C N     1 
ATOM   5339  C  CA    . ARG C 2  230  ? 480.743 -47.883 620.969 1.00 149.05 ? 230  ARG C CA    1 
ATOM   5340  C  C     . ARG C 2  230  ? 481.133 -46.808 621.995 1.00 146.37 ? 230  ARG C C     1 
ATOM   5341  O  O     . ARG C 2  230  ? 480.851 -45.624 621.792 1.00 146.24 ? 230  ARG C O     1 
ATOM   5342  C  CB    . ARG C 2  230  ? 481.946 -48.460 620.214 1.00 145.61 ? 230  ARG C CB    1 
ATOM   5343  C  CG    . ARG C 2  230  ? 482.377 -47.666 618.986 1.00 150.52 ? 230  ARG C CG    1 
ATOM   5344  C  CD    . ARG C 2  230  ? 483.697 -48.177 618.422 1.00 148.13 ? 230  ARG C CD    1 
ATOM   5345  N  NE    . ARG C 2  230  ? 483.705 -48.162 616.961 1.00 146.93 ? 230  ARG C NE    1 
ATOM   5346  C  CZ    . ARG C 2  230  ? 483.991 -47.089 616.232 1.00 152.65 ? 230  ARG C CZ    1 
ATOM   5347  N  NH1   . ARG C 2  230  ? 483.979 -47.152 614.902 1.00 152.84 ? 230  ARG C NH1   1 
ATOM   5348  N  NH2   . ARG C 2  230  ? 484.274 -45.945 616.841 1.00 150.00 ? 230  ARG C NH2   1 
ATOM   5349  N  N     . PRO C 2  231  ? 481.739 -47.203 623.131 1.00 141.11 ? 231  PRO C N     1 
ATOM   5350  C  CA    . PRO C 2  231  ? 482.049 -46.214 624.188 1.00 138.15 ? 231  PRO C CA    1 
ATOM   5351  C  C     . PRO C 2  231  ? 482.774 -44.944 623.746 1.00 139.31 ? 231  PRO C C     1 
ATOM   5352  O  O     . PRO C 2  231  ? 482.663 -43.927 624.443 1.00 131.68 ? 231  PRO C O     1 
ATOM   5353  C  CB    . PRO C 2  231  ? 482.918 -47.027 625.159 1.00 135.85 ? 231  PRO C CB    1 
ATOM   5354  C  CG    . PRO C 2  231  ? 482.384 -48.411 625.048 1.00 139.56 ? 231  PRO C CG    1 
ATOM   5355  C  CD    . PRO C 2  231  ? 481.980 -48.585 623.596 1.00 141.70 ? 231  PRO C CD    1 
ATOM   5356  N  N     . GLU C 2  232  ? 483.534 -44.965 622.645 1.00 141.51 ? 232  GLU C N     1 
ATOM   5357  C  CA    . GLU C 2  232  ? 484.248 -43.763 622.204 1.00 138.82 ? 232  GLU C CA    1 
ATOM   5358  C  C     . GLU C 2  232  ? 483.302 -42.734 621.580 1.00 139.59 ? 232  GLU C C     1 
ATOM   5359  O  O     . GLU C 2  232  ? 483.439 -41.527 621.815 1.00 134.14 ? 232  GLU C O     1 
ATOM   5360  C  CB    . GLU C 2  232  ? 485.378 -44.097 621.239 1.00 142.02 ? 232  GLU C CB    1 
ATOM   5361  C  CG    . GLU C 2  232  ? 486.152 -42.830 620.880 1.00 149.51 ? 232  GLU C CG    1 
ATOM   5362  C  CD    . GLU C 2  232  ? 487.274 -43.057 619.889 1.00 156.36 ? 232  GLU C CD    1 
ATOM   5363  O  OE1   . GLU C 2  232  ? 487.460 -44.215 619.441 1.00 157.94 ? 232  GLU C OE1   1 
ATOM   5364  O  OE2   . GLU C 2  232  ? 487.982 -42.071 619.582 1.00 151.59 ? 232  GLU C OE2   1 
ATOM   5365  N  N     . GLU C 2  233  ? 482.408 -43.188 620.688 1.00 144.58 ? 233  GLU C N     1 
ATOM   5366  C  CA    . GLU C 2  233  ? 481.439 -42.289 620.056 1.00 145.39 ? 233  GLU C CA    1 
ATOM   5367  C  C     . GLU C 2  233  ? 480.499 -41.646 621.067 1.00 140.99 ? 233  GLU C C     1 
ATOM   5368  O  O     . GLU C 2  233  ? 480.081 -40.499 620.871 1.00 140.37 ? 233  GLU C O     1 
ATOM   5369  C  CB    . GLU C 2  233  ? 480.617 -43.022 618.983 1.00 150.71 ? 233  GLU C CB    1 
ATOM   5370  C  CG    . GLU C 2  233  ? 481.397 -43.957 618.044 1.00 155.02 ? 233  GLU C CG    1 
ATOM   5371  C  CD    . GLU C 2  233  ? 481.084 -43.706 616.557 1.00 163.58 ? 233  GLU C CD    1 
ATOM   5372  O  OE1   . GLU C 2  233  ? 480.091 -42.999 616.251 1.00 162.35 ? 233  GLU C OE1   1 
ATOM   5373  O  OE2   . GLU C 2  233  ? 481.840 -44.213 615.694 1.00 166.70 ? 233  GLU C OE2   1 
ATOM   5374  N  N     . ALA C 2  234  ? 480.135 -42.364 622.134 1.00 144.93 ? 234  ALA C N     1 
ATOM   5375  C  CA    . ALA C 2  234  ? 479.236 -41.804 623.145 1.00 143.18 ? 234  ALA C CA    1 
ATOM   5376  C  C     . ALA C 2  234  ? 479.923 -40.694 623.941 1.00 140.43 ? 234  ALA C C     1 
ATOM   5377  O  O     . ALA C 2  234  ? 479.255 -39.766 624.418 1.00 137.70 ? 234  ALA C O     1 
ATOM   5378  C  CB    . ALA C 2  234  ? 478.723 -42.907 624.073 1.00 139.85 ? 234  ALA C CB    1 
ATOM   5379  N  N     . LEU C 2  235  ? 481.250 -40.786 624.101 1.00 137.52 ? 235  LEU C N     1 
ATOM   5380  C  CA    . LEU C 2  235  ? 482.011 -39.767 624.820 1.00 131.47 ? 235  LEU C CA    1 
ATOM   5381  C  C     . LEU C 2  235  ? 482.038 -38.463 624.034 1.00 133.45 ? 235  LEU C C     1 
ATOM   5382  O  O     . LEU C 2  235  ? 481.877 -37.378 624.608 1.00 127.22 ? 235  LEU C O     1 
ATOM   5383  C  CB    . LEU C 2  235  ? 483.438 -40.284 625.058 1.00 126.41 ? 235  LEU C CB    1 
ATOM   5384  C  CG    . LEU C 2  235  ? 484.606 -39.457 625.620 1.00 122.52 ? 235  LEU C CG    1 
ATOM   5385  C  CD1   . LEU C 2  235  ? 484.274 -38.856 626.959 1.00 124.28 ? 235  LEU C CD1   1 
ATOM   5386  C  CD2   . LEU C 2  235  ? 485.875 -40.299 625.736 1.00 122.58 ? 235  LEU C CD2   1 
ATOM   5387  N  N     . ILE C 2  236  ? 482.246 -38.557 622.715 1.00 139.05 ? 236  ILE C N     1 
ATOM   5388  C  CA    . ILE C 2  236  ? 482.230 -37.385 621.836 1.00 140.00 ? 236  ILE C CA    1 
ATOM   5389  C  C     . ILE C 2  236  ? 480.837 -36.736 621.819 1.00 138.19 ? 236  ILE C C     1 
ATOM   5390  O  O     . ILE C 2  236  ? 480.707 -35.503 621.791 1.00 136.46 ? 236  ILE C O     1 
ATOM   5391  C  CB    . ILE C 2  236  ? 482.725 -37.778 620.421 1.00 135.12 ? 236  ILE C CB    1 
ATOM   5392  C  CG1   . ILE C 2  236  ? 484.228 -38.116 620.445 1.00 129.74 ? 236  ILE C CG1   1 
ATOM   5393  C  CG2   . ILE C 2  236  ? 482.516 -36.640 619.425 1.00 132.06 ? 236  ILE C CG2   1 
ATOM   5394  C  CD1   . ILE C 2  236  ? 484.823 -38.538 619.110 1.00 130.06 ? 236  ILE C CD1   1 
ATOM   5395  N  N     . ARG C 2  237  ? 479.781 -37.558 621.785 1.00 136.42 ? 237  ARG C N     1 
ATOM   5396  C  CA    . ARG C 2  237  ? 478.402 -37.060 621.765 1.00 136.04 ? 237  ARG C CA    1 
ATOM   5397  C  C     . ARG C 2  237  ? 478.066 -36.206 622.995 1.00 137.81 ? 237  ARG C C     1 
ATOM   5398  O  O     . ARG C 2  237  ? 477.456 -35.137 622.871 1.00 137.70 ? 237  ARG C O     1 
ATOM   5399  C  CB    . ARG C 2  237  ? 477.461 -38.265 621.634 1.00 138.46 ? 237  ARG C CB    1 
ATOM   5400  C  CG    . ARG C 2  237  ? 475.988 -38.102 622.027 1.00 146.39 ? 237  ARG C CG    1 
ATOM   5401  C  CD    . ARG C 2  237  ? 475.126 -39.026 621.131 1.00 149.04 ? 237  ARG C CD    1 
ATOM   5402  N  NE    . ARG C 2  237  ? 473.694 -39.006 621.435 1.00 150.68 ? 237  ARG C NE    1 
ATOM   5403  C  CZ    . ARG C 2  237  ? 472.776 -39.686 620.751 1.00 146.40 ? 237  ARG C CZ    1 
ATOM   5404  N  NH1   . ARG C 2  237  ? 471.496 -39.613 621.093 1.00 146.75 ? 237  ARG C NH1   1 
ATOM   5405  N  NH2   . ARG C 2  237  ? 473.136 -40.452 619.731 1.00 145.32 ? 237  ARG C NH2   1 
ATOM   5406  N  N     . LEU C 2  238  ? 478.405 -36.697 624.197 1.00 139.50 ? 238  LEU C N     1 
ATOM   5407  C  CA    . LEU C 2  238  ? 478.191 -35.965 625.457 1.00 136.79 ? 238  LEU C CA    1 
ATOM   5408  C  C     . LEU C 2  238  ? 478.960 -34.637 625.539 1.00 135.56 ? 238  LEU C C     1 
ATOM   5409  O  O     . LEU C 2  238  ? 478.435 -33.641 626.058 1.00 129.46 ? 238  LEU C O     1 
ATOM   5410  C  CB    . LEU C 2  238  ? 478.540 -36.852 626.660 1.00 133.23 ? 238  LEU C CB    1 
ATOM   5411  C  CG    . LEU C 2  238  ? 478.321 -36.239 628.060 1.00 127.76 ? 238  LEU C CG    1 
ATOM   5412  C  CD1   . LEU C 2  238  ? 476.879 -35.797 628.274 1.00 130.85 ? 238  LEU C CD1   1 
ATOM   5413  C  CD2   . LEU C 2  238  ? 478.764 -37.178 629.182 1.00 117.68 ? 238  LEU C CD2   1 
ATOM   5414  N  N     . PHE C 2  239  ? 480.220 -34.622 625.080 1.00 134.08 ? 239  PHE C N     1 
ATOM   5415  C  CA    . PHE C 2  239  ? 481.047 -33.414 625.139 1.00 131.36 ? 239  PHE C CA    1 
ATOM   5416  C  C     . PHE C 2  239  ? 480.420 -32.254 624.373 1.00 135.84 ? 239  PHE C C     1 
ATOM   5417  O  O     . PHE C 2  239  ? 480.515 -31.097 624.802 1.00 134.76 ? 239  PHE C O     1 
ATOM   5418  C  CB    . PHE C 2  239  ? 482.437 -33.735 624.574 1.00 128.64 ? 239  PHE C CB    1 
ATOM   5419  C  CG    . PHE C 2  239  ? 483.418 -32.579 624.607 1.00 132.15 ? 239  PHE C CG    1 
ATOM   5420  C  CD1   . PHE C 2  239  ? 484.316 -32.445 625.648 1.00 128.05 ? 239  PHE C CD1   1 
ATOM   5421  C  CD2   . PHE C 2  239  ? 483.433 -31.621 623.595 1.00 137.51 ? 239  PHE C CD2   1 
ATOM   5422  C  CE1   . PHE C 2  239  ? 485.223 -31.390 625.675 1.00 130.44 ? 239  PHE C CE1   1 
ATOM   5423  C  CE2   . PHE C 2  239  ? 484.331 -30.558 623.622 1.00 137.04 ? 239  PHE C CE2   1 
ATOM   5424  C  CZ    . PHE C 2  239  ? 485.227 -30.445 624.662 1.00 134.09 ? 239  PHE C CZ    1 
ATOM   5425  N  N     . THR C 2  240  ? 479.769 -32.541 623.241 1.00 137.29 ? 240  THR C N     1 
ATOM   5426  C  CA    . THR C 2  240  ? 479.110 -31.490 622.468 1.00 137.77 ? 240  THR C CA    1 
ATOM   5427  C  C     . THR C 2  240  ? 477.944 -30.874 623.243 1.00 136.72 ? 240  THR C C     1 
ATOM   5428  O  O     . THR C 2  240  ? 477.610 -29.699 623.036 1.00 132.91 ? 240  THR C O     1 
ATOM   5429  C  CB    . THR C 2  240  ? 478.627 -32.052 621.119 1.00 140.03 ? 240  THR C CB    1 
ATOM   5430  O  OG1   . THR C 2  240  ? 477.698 -33.123 621.342 1.00 139.77 ? 240  THR C OG1   1 
ATOM   5431  C  CG2   . THR C 2  240  ? 479.805 -32.577 620.274 1.00 133.38 ? 240  THR C CG2   1 
ATOM   5432  N  N     . LEU C 2  241  ? 477.339 -31.646 624.155 1.00 138.64 ? 241  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  241  ? 476.279 -31.131 625.021 1.00 139.72 ? 241  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  241  ? 476.825 -30.168 626.076 1.00 141.54 ? 241  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  241  ? 476.171 -29.169 626.405 1.00 141.90 ? 241  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  241  ? 475.557 -32.305 625.694 1.00 135.21 ? 241  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  241  ? 474.549 -33.133 624.893 1.00 134.85 ? 241  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  241  ? 473.873 -34.168 625.782 1.00 131.56 ? 241  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  241  ? 473.513 -32.229 624.240 1.00 137.87 ? 241  LEU C CD2   1 
ATOM   5440  N  N     . LEU C 2  242  ? 477.975 -30.498 626.681 1.00 140.68 ? 242  LEU C N     1 
ATOM   5441  C  CA    . LEU C 2  242  ? 478.556 -29.703 627.768 1.00 138.00 ? 242  LEU C CA    1 
ATOM   5442  C  C     . LEU C 2  242  ? 479.340 -28.472 627.306 1.00 139.17 ? 242  LEU C C     1 
ATOM   5443  O  O     . LEU C 2  242  ? 479.389 -27.472 628.032 1.00 137.91 ? 242  LEU C O     1 
ATOM   5444  C  CB    . LEU C 2  242  ? 479.433 -30.581 628.652 1.00 128.98 ? 242  LEU C CB    1 
ATOM   5445  C  CG    . LEU C 2  242  ? 478.632 -31.761 629.182 1.00 128.27 ? 242  LEU C CG    1 
ATOM   5446  C  CD1   . LEU C 2  242  ? 479.484 -32.573 630.117 1.00 122.38 ? 242  LEU C CD1   1 
ATOM   5447  C  CD2   . LEU C 2  242  ? 477.371 -31.258 629.883 1.00 125.98 ? 242  LEU C CD2   1 
ATOM   5448  N  N     . ARG C 2  243  ? 480.013 -28.519 626.157 1.00 141.06 ? 243  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  243  ? 480.807 -27.380 625.691 1.00 142.91 ? 243  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  243  ? 480.491 -26.973 624.253 1.00 142.39 ? 243  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  243  ? 481.264 -27.279 623.333 1.00 142.27 ? 243  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  243  ? 482.295 -27.692 625.834 1.00 137.50 ? 243  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  243  ? 482.778 -27.470 627.234 1.00 132.89 ? 243  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  243  ? 484.276 -27.526 627.307 1.00 135.92 ? 243  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  243  ? 484.850 -26.226 626.978 1.00 139.59 ? 243  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  243  ? 484.773 -25.172 627.784 1.00 139.78 ? 243  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  243  ? 484.140 -25.278 628.950 1.00 138.83 ? 243  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  243  ? 485.321 -24.016 627.431 1.00 133.76 ? 243  ARG C NH2   1 
ATOM   5459  N  N     . PRO C 2  244  ? 479.360 -26.298 624.016 1.00 140.80 ? 244  PRO C N     1 
ATOM   5460  C  CA    . PRO C 2  244  ? 479.037 -25.907 622.637 1.00 138.56 ? 244  PRO C CA    1 
ATOM   5461  C  C     . PRO C 2  244  ? 480.126 -25.017 622.045 1.00 138.07 ? 244  PRO C C     1 
ATOM   5462  O  O     . PRO C 2  244  ? 480.698 -24.163 622.727 1.00 135.33 ? 244  PRO C O     1 
ATOM   5463  C  CB    . PRO C 2  244  ? 477.711 -25.149 622.788 1.00 136.02 ? 244  PRO C CB    1 
ATOM   5464  C  CG    . PRO C 2  244  ? 477.119 -25.664 624.074 1.00 135.73 ? 244  PRO C CG    1 
ATOM   5465  C  CD    . PRO C 2  244  ? 478.300 -25.905 624.964 1.00 137.39 ? 244  PRO C CD    1 
ATOM   5466  N  N     . GLY C 2  245  ? 480.398 -25.221 620.752 1.00 143.23 ? 245  GLY C N     1 
ATOM   5467  C  CA    . GLY C 2  245  ? 481.368 -24.444 620.007 1.00 143.22 ? 245  GLY C CA    1 
ATOM   5468  C  C     . GLY C 2  245  ? 482.819 -24.897 620.096 1.00 146.89 ? 245  GLY C C     1 
ATOM   5469  O  O     . GLY C 2  245  ? 483.608 -24.546 619.208 1.00 151.73 ? 245  GLY C O     1 
ATOM   5470  N  N     . ASP C 2  246  ? 483.190 -25.704 621.102 1.00 145.82 ? 246  ASP C N     1 
ATOM   5471  C  CA    . ASP C 2  246  ? 484.547 -26.258 621.199 1.00 146.59 ? 246  ASP C CA    1 
ATOM   5472  C  C     . ASP C 2  246  ? 484.649 -27.547 620.383 1.00 147.21 ? 246  ASP C C     1 
ATOM   5473  O  O     . ASP C 2  246  ? 483.908 -28.503 620.661 1.00 144.37 ? 246  ASP C O     1 
ATOM   5474  C  CB    . ASP C 2  246  ? 484.911 -26.500 622.668 1.00 147.79 ? 246  ASP C CB    1 
ATOM   5475  C  CG    . ASP C 2  246  ? 486.393 -26.834 622.883 1.00 148.64 ? 246  ASP C CG    1 
ATOM   5476  O  OD1   . ASP C 2  246  ? 486.792 -28.005 622.703 1.00 148.67 ? 246  ASP C OD1   1 
ATOM   5477  O  OD2   . ASP C 2  246  ? 487.162 -25.913 623.246 1.00 145.99 ? 246  ASP C OD2   1 
ATOM   5478  N  N     . PRO C 2  247  ? 485.532 -27.613 619.380 1.00 151.99 ? 247  PRO C N     1 
ATOM   5479  C  CA    . PRO C 2  247  ? 485.665 -28.835 618.529 1.00 150.73 ? 247  PRO C CA    1 
ATOM   5480  C  C     . PRO C 2  247  ? 485.976 -30.086 619.335 1.00 145.04 ? 247  PRO C C     1 
ATOM   5481  O  O     . PRO C 2  247  ? 486.936 -30.114 620.124 1.00 142.94 ? 247  PRO C O     1 
ATOM   5482  C  CB    . PRO C 2  247  ? 486.815 -28.478 617.565 1.00 151.82 ? 247  PRO C CB    1 
ATOM   5483  C  CG    . PRO C 2  247  ? 487.512 -27.279 618.189 1.00 151.49 ? 247  PRO C CG    1 
ATOM   5484  C  CD    . PRO C 2  247  ? 486.430 -26.532 618.932 1.00 149.34 ? 247  PRO C CD    1 
ATOM   5485  N  N     . PRO C 2  248  ? 485.199 -31.172 619.123 1.00 142.28 ? 248  PRO C N     1 
ATOM   5486  C  CA    . PRO C 2  248  ? 485.249 -32.379 619.978 1.00 140.55 ? 248  PRO C CA    1 
ATOM   5487  C  C     . PRO C 2  248  ? 486.403 -33.330 619.648 1.00 143.07 ? 248  PRO C C     1 
ATOM   5488  O  O     . PRO C 2  248  ? 486.209 -34.534 619.426 1.00 142.43 ? 248  PRO C O     1 
ATOM   5489  C  CB    . PRO C 2  248  ? 483.878 -33.025 619.711 1.00 136.49 ? 248  PRO C CB    1 
ATOM   5490  C  CG    . PRO C 2  248  ? 483.081 -32.025 618.887 1.00 135.48 ? 248  PRO C CG    1 
ATOM   5491  C  CD    . PRO C 2  248  ? 484.091 -31.229 618.156 1.00 137.59 ? 248  PRO C CD    1 
ATOM   5492  N  N     . LYS C 2  249  ? 487.632 -32.804 619.670 1.00 141.04 ? 249  LYS C N     1 
ATOM   5493  C  CA    . LYS C 2  249  ? 488.822 -33.638 619.508 1.00 140.11 ? 249  LYS C CA    1 
ATOM   5494  C  C     . LYS C 2  249  ? 488.918 -34.693 620.606 1.00 138.58 ? 249  LYS C C     1 
ATOM   5495  O  O     . LYS C 2  249  ? 488.637 -34.410 621.773 1.00 135.19 ? 249  LYS C O     1 
ATOM   5496  C  CB    . LYS C 2  249  ? 490.093 -32.780 619.526 1.00 137.98 ? 249  LYS C CB    1 
ATOM   5497  C  CG    . LYS C 2  249  ? 491.275 -33.455 618.836 1.00 137.77 ? 249  LYS C CG    1 
ATOM   5498  C  CD    . LYS C 2  249  ? 492.442 -32.523 618.576 1.00 138.04 ? 249  LYS C CD    1 
ATOM   5499  C  CE    . LYS C 2  249  ? 493.601 -33.306 617.971 1.00 133.01 ? 249  LYS C CE    1 
ATOM   5500  N  NZ    . LYS C 2  249  ? 494.865 -32.531 617.920 1.00 126.81 ? 249  LYS C NZ    1 
ATOM   5501  N  N     . ARG C 2  250  ? 489.280 -35.930 620.214 1.00 140.61 ? 250  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  250  ? 489.242 -37.066 621.145 1.00 142.61 ? 250  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  250  ? 490.167 -36.879 622.354 1.00 141.61 ? 250  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  250  ? 489.814 -37.295 623.463 1.00 141.35 ? 250  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  250  ? 489.591 -38.374 620.427 1.00 146.69 ? 250  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  250  ? 489.412 -39.647 621.283 1.00 137.67 ? 250  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  250  ? 490.814 -40.210 621.551 1.00 139.01 ? 250  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  250  ? 490.876 -41.407 622.384 1.00 139.98 ? 250  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  250  ? 492.010 -41.868 622.912 1.00 141.20 ? 250  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  250  ? 493.151 -41.223 622.685 1.00 136.63 ? 250  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  250  ? 492.010 -42.963 623.665 1.00 136.83 ? 250  ARG C NH2   1 
ATOM   5512  N  N     . ASP C 2  251  ? 491.400 -36.378 622.158 1.00 141.88 ? 251  ASP C N     1 
ATOM   5513  C  CA    . ASP C 2  251  ? 492.236 -36.101 623.333 1.00 137.74 ? 251  ASP C CA    1 
ATOM   5514  C  C     . ASP C 2  251  ? 491.677 -34.940 624.174 1.00 136.46 ? 251  ASP C C     1 
ATOM   5515  O  O     . ASP C 2  251  ? 491.822 -34.938 625.403 1.00 135.87 ? 251  ASP C O     1 
ATOM   5516  C  CB    . ASP C 2  251  ? 493.717 -35.887 622.974 1.00 135.99 ? 251  ASP C CB    1 
ATOM   5517  C  CG    . ASP C 2  251  ? 493.939 -35.109 621.698 1.00 141.90 ? 251  ASP C CG    1 
ATOM   5518  O  OD1   . ASP C 2  251  ? 493.042 -34.367 621.247 1.00 143.38 ? 251  ASP C OD1   1 
ATOM   5519  O  OD2   . ASP C 2  251  ? 495.054 -35.235 621.151 1.00 146.04 ? 251  ASP C OD2   1 
ATOM   5520  N  N     . LYS C 2  252  ? 491.110 -33.905 623.528 1.00 136.17 ? 252  LYS C N     1 
ATOM   5521  C  CA    . LYS C 2  252  ? 490.475 -32.801 624.262 1.00 133.89 ? 252  LYS C CA    1 
ATOM   5522  C  C     . LYS C 2  252  ? 489.268 -33.248 625.099 1.00 135.46 ? 252  LYS C C     1 
ATOM   5523  O  O     . LYS C 2  252  ? 489.129 -32.832 626.256 1.00 132.33 ? 252  LYS C O     1 
ATOM   5524  C  CB    . LYS C 2  252  ? 490.054 -31.693 623.288 1.00 133.76 ? 252  LYS C CB    1 
ATOM   5525  C  CG    . LYS C 2  252  ? 491.080 -30.562 623.127 1.00 138.09 ? 252  LYS C CG    1 
ATOM   5526  C  CD    . LYS C 2  252  ? 490.415 -29.223 622.785 1.00 142.65 ? 252  LYS C CD    1 
ATOM   5527  C  CE    . LYS C 2  252  ? 491.393 -28.049 622.892 1.00 133.86 ? 252  LYS C CE    1 
ATOM   5528  N  NZ    . LYS C 2  252  ? 490.686 -26.735 622.897 1.00 127.18 ? 252  LYS C NZ    1 
ATOM   5529  N  N     . ALA C 2  253  ? 488.392 -34.099 624.545 1.00 134.77 ? 253  ALA C N     1 
ATOM   5530  C  CA    . ALA C 2  253  ? 487.218 -34.563 625.292 1.00 125.46 ? 253  ALA C CA    1 
ATOM   5531  C  C     . ALA C 2  253  ? 487.617 -35.411 626.493 1.00 127.59 ? 253  ALA C C     1 
ATOM   5532  O  O     . ALA C 2  253  ? 487.103 -35.206 627.598 1.00 126.48 ? 253  ALA C O     1 
ATOM   5533  C  CB    . ALA C 2  253  ? 486.263 -35.338 624.391 1.00 123.36 ? 253  ALA C CB    1 
ATOM   5534  N  N     . VAL C 2  254  ? 488.509 -36.391 626.287 1.00 127.68 ? 254  VAL C N     1 
ATOM   5535  C  CA    . VAL C 2  254  ? 489.021 -37.207 627.394 1.00 129.56 ? 254  VAL C CA    1 
ATOM   5536  C  C     . VAL C 2  254  ? 489.557 -36.306 628.503 1.00 130.88 ? 254  VAL C C     1 
ATOM   5537  O  O     . VAL C 2  254  ? 489.262 -36.510 629.688 1.00 128.93 ? 254  VAL C O     1 
ATOM   5538  C  CB    . VAL C 2  254  ? 490.077 -38.214 626.901 1.00 126.67 ? 254  VAL C CB    1 
ATOM   5539  C  CG1   . VAL C 2  254  ? 490.725 -38.934 628.093 1.00 125.61 ? 254  VAL C CG1   1 
ATOM   5540  C  CG2   . VAL C 2  254  ? 489.420 -39.238 625.985 1.00 125.66 ? 254  VAL C CG2   1 
ATOM   5541  N  N     . ALA C 2  255  ? 490.392 -35.326 628.134 1.00 130.52 ? 255  ALA C N     1 
ATOM   5542  C  CA    . ALA C 2  255  ? 490.972 -34.401 629.110 1.00 130.73 ? 255  ALA C CA    1 
ATOM   5543  C  C     . ALA C 2  255  ? 489.885 -33.705 629.945 1.00 129.30 ? 255  ALA C C     1 
ATOM   5544  O  O     . ALA C 2  255  ? 489.989 -33.633 631.178 1.00 122.61 ? 255  ALA C O     1 
ATOM   5545  C  CB    . ALA C 2  255  ? 491.856 -33.379 628.393 1.00 128.74 ? 255  ALA C CB    1 
ATOM   5546  N  N     . TYR C 2  256  ? 488.843 -33.166 629.290 1.00 127.54 ? 256  TYR C N     1 
ATOM   5547  C  CA    . TYR C 2  256  ? 487.786 -32.457 630.018 1.00 122.57 ? 256  TYR C CA    1 
ATOM   5548  C  C     . TYR C 2  256  ? 487.049 -33.382 630.984 1.00 122.64 ? 256  TYR C C     1 
ATOM   5549  O  O     . TYR C 2  256  ? 486.957 -33.100 632.186 1.00 121.06 ? 256  TYR C O     1 
ATOM   5550  C  CB    . TYR C 2  256  ? 486.774 -31.881 629.020 1.00 120.26 ? 256  TYR C CB    1 
ATOM   5551  C  CG    . TYR C 2  256  ? 485.644 -31.105 629.658 1.00 116.54 ? 256  TYR C CG    1 
ATOM   5552  C  CD1   . TYR C 2  256  ? 484.438 -31.730 629.944 1.00 109.66 ? 256  TYR C CD1   1 
ATOM   5553  C  CD2   . TYR C 2  256  ? 485.752 -29.740 629.907 1.00 121.54 ? 256  TYR C CD2   1 
ATOM   5554  C  CE1   . TYR C 2  256  ? 483.394 -31.035 630.516 1.00 117.09 ? 256  TYR C CE1   1 
ATOM   5555  C  CE2   . TYR C 2  256  ? 484.703 -29.029 630.473 1.00 120.86 ? 256  TYR C CE2   1 
ATOM   5556  C  CZ    . TYR C 2  256  ? 483.526 -29.685 630.776 1.00 121.31 ? 256  TYR C CZ    1 
ATOM   5557  O  OH    . TYR C 2  256  ? 482.474 -29.002 631.351 1.00 122.23 ? 256  TYR C OH    1 
ATOM   5558  N  N     . VAL C 2  257  ? 486.543 -34.510 630.476 1.00 123.14 ? 257  VAL C N     1 
ATOM   5559  C  CA    . VAL C 2  257  ? 485.807 -35.469 631.302 1.00 117.61 ? 257  VAL C CA    1 
ATOM   5560  C  C     . VAL C 2  257  ? 486.694 -36.098 632.379 1.00 119.03 ? 257  VAL C C     1 
ATOM   5561  O  O     . VAL C 2  257  ? 486.253 -36.270 633.523 1.00 120.03 ? 257  VAL C O     1 
ATOM   5562  C  CB    . VAL C 2  257  ? 485.095 -36.511 630.424 1.00 109.95 ? 257  VAL C CB    1 
ATOM   5563  C  CG1   . VAL C 2  257  ? 484.803 -37.748 631.211 1.00 106.86 ? 257  VAL C CG1   1 
ATOM   5564  C  CG2   . VAL C 2  257  ? 483.771 -35.917 629.987 1.00 93.06  ? 257  VAL C CG2   1 
ATOM   5565  N  N     . TYR C 2  258  ? 487.942 -36.464 632.045 1.00 117.58 ? 258  TYR C N     1 
ATOM   5566  C  CA    . TYR C 2  258  ? 488.851 -36.989 633.073 1.00 117.82 ? 258  TYR C CA    1 
ATOM   5567  C  C     . TYR C 2  258  ? 489.060 -35.998 634.214 1.00 120.66 ? 258  TYR C C     1 
ATOM   5568  O  O     . TYR C 2  258  ? 488.923 -36.357 635.395 1.00 119.41 ? 258  TYR C O     1 
ATOM   5569  C  CB    . TYR C 2  258  ? 490.210 -37.327 632.477 1.00 113.83 ? 258  TYR C CB    1 
ATOM   5570  C  CG    . TYR C 2  258  ? 491.240 -37.826 633.485 1.00 108.63 ? 258  TYR C CG    1 
ATOM   5571  C  CD1   . TYR C 2  258  ? 492.286 -37.006 633.915 1.00 104.67 ? 258  TYR C CD1   1 
ATOM   5572  C  CD2   . TYR C 2  258  ? 491.231 -39.152 633.916 1.00 108.81 ? 258  TYR C CD2   1 
ATOM   5573  C  CE1   . TYR C 2  258  ? 493.252 -37.474 634.801 1.00 103.72 ? 258  TYR C CE1   1 
ATOM   5574  C  CE2   . TYR C 2  258  ? 492.200 -39.632 634.790 1.00 107.83 ? 258  TYR C CE2   1 
ATOM   5575  C  CZ    . TYR C 2  258  ? 493.205 -38.790 635.232 1.00 105.65 ? 258  TYR C CZ    1 
ATOM   5576  O  OH    . TYR C 2  258  ? 494.160 -39.269 636.104 1.00 103.53 ? 258  TYR C OH    1 
ATOM   5577  N  N     . GLY C 2  259  ? 489.382 -34.739 633.885 1.00 120.99 ? 259  GLY C N     1 
ATOM   5578  C  CA    . GLY C 2  259  ? 489.638 -33.755 634.930 1.00 122.05 ? 259  GLY C CA    1 
ATOM   5579  C  C     . GLY C 2  259  ? 488.420 -33.488 635.785 1.00 115.92 ? 259  GLY C C     1 
ATOM   5580  O  O     . GLY C 2  259  ? 488.538 -33.230 636.985 1.00 112.75 ? 259  GLY C O     1 
ATOM   5581  N  N     . LEU C 2  260  ? 487.238 -33.588 635.190 1.00 115.68 ? 260  LEU C N     1 
ATOM   5582  C  CA    . LEU C 2  260  ? 485.994 -33.348 635.901 1.00 116.24 ? 260  LEU C CA    1 
ATOM   5583  C  C     . LEU C 2  260  ? 485.552 -34.549 636.736 1.00 112.24 ? 260  LEU C C     1 
ATOM   5584  O  O     . LEU C 2  260  ? 484.874 -34.354 637.753 1.00 110.56 ? 260  LEU C O     1 
ATOM   5585  C  CB    . LEU C 2  260  ? 484.907 -32.910 634.913 1.00 113.98 ? 260  LEU C CB    1 
ATOM   5586  C  CG    . LEU C 2  260  ? 484.863 -31.375 634.748 1.00 118.22 ? 260  LEU C CG    1 
ATOM   5587  C  CD1   . LEU C 2  260  ? 486.071 -30.783 633.989 1.00 110.03 ? 260  LEU C CD1   1 
ATOM   5588  C  CD2   . LEU C 2  260  ? 483.539 -30.912 634.124 1.00 118.81 ? 260  LEU C CD2   1 
ATOM   5589  N  N     . ILE C 2  261  ? 485.886 -35.786 636.336 1.00 109.40 ? 261  ILE C N     1 
ATOM   5590  C  CA    . ILE C 2  261  ? 485.252 -36.936 636.979 1.00 107.32 ? 261  ILE C CA    1 
ATOM   5591  C  C     . ILE C 2  261  ? 486.286 -37.864 637.618 1.00 111.81 ? 261  ILE C C     1 
ATOM   5592  O  O     . ILE C 2  261  ? 486.177 -38.204 638.799 1.00 113.22 ? 261  ILE C O     1 
ATOM   5593  C  CB    . ILE C 2  261  ? 484.395 -37.733 635.975 1.00 105.89 ? 261  ILE C CB    1 
ATOM   5594  C  CG1   . ILE C 2  261  ? 482.929 -37.384 636.146 1.00 100.81 ? 261  ILE C CG1   1 
ATOM   5595  C  CG2   . ILE C 2  261  ? 484.467 -39.238 636.240 1.00 104.31 ? 261  ILE C CG2   1 
ATOM   5596  C  CD1   . ILE C 2  261  ? 482.651 -35.915 635.843 1.00 99.04  ? 261  ILE C CD1   1 
ATOM   5597  N  N     . ALA C 2  262  ? 487.239 -38.359 636.830 1.00 115.26 ? 262  ALA C N     1 
ATOM   5598  C  CA    . ALA C 2  262  ? 488.156 -39.389 637.310 1.00 116.87 ? 262  ALA C CA    1 
ATOM   5599  C  C     . ALA C 2  262  ? 489.486 -38.888 637.874 1.00 113.35 ? 262  ALA C C     1 
ATOM   5600  O  O     . ALA C 2  262  ? 490.211 -39.697 638.470 1.00 110.26 ? 262  ALA C O     1 
ATOM   5601  C  CB    . ALA C 2  262  ? 488.442 -40.383 636.177 1.00 115.85 ? 262  ALA C CB    1 
ATOM   5602  N  N     . ASP C 2  263  ? 489.830 -37.591 637.723 1.00 110.55 ? 263  ASP C N     1 
ATOM   5603  C  CA    . ASP C 2  263  ? 491.166 -37.135 638.121 1.00 112.43 ? 263  ASP C CA    1 
ATOM   5604  C  C     . ASP C 2  263  ? 491.397 -36.949 639.619 1.00 115.20 ? 263  ASP C C     1 
ATOM   5605  O  O     . ASP C 2  263  ? 490.843 -36.015 640.218 1.00 116.22 ? 263  ASP C O     1 
ATOM   5606  C  CB    . ASP C 2  263  ? 491.451 -35.794 637.412 1.00 113.79 ? 263  ASP C CB    1 
ATOM   5607  C  CG    . ASP C 2  263  ? 492.942 -35.393 637.424 1.00 116.66 ? 263  ASP C CG    1 
ATOM   5608  O  OD1   . ASP C 2  263  ? 493.745 -36.005 638.163 1.00 119.01 ? 263  ASP C OD1   1 
ATOM   5609  O  OD2   . ASP C 2  263  ? 493.313 -34.454 636.677 1.00 113.93 ? 263  ASP C OD2   1 
ATOM   5610  N  N     . PRO C 2  264  ? 492.242 -37.794 640.265 1.00 113.10 ? 264  PRO C N     1 
ATOM   5611  C  CA    . PRO C 2  264  ? 492.516 -37.597 641.696 1.00 113.96 ? 264  PRO C CA    1 
ATOM   5612  C  C     . PRO C 2  264  ? 493.378 -36.361 641.934 1.00 114.09 ? 264  PRO C C     1 
ATOM   5613  O  O     . PRO C 2  264  ? 494.311 -36.390 642.744 1.00 117.41 ? 264  PRO C O     1 
ATOM   5614  C  CB    . PRO C 2  264  ? 493.225 -38.895 642.107 1.00 114.00 ? 264  PRO C CB    1 
ATOM   5615  C  CG    . PRO C 2  264  ? 493.835 -39.389 640.862 1.00 112.81 ? 264  PRO C CG    1 
ATOM   5616  C  CD    . PRO C 2  264  ? 492.881 -39.019 639.755 1.00 111.74 ? 264  PRO C CD    1 
ATOM   5617  N  N     . ARG C 2  265  ? 493.113 -35.287 641.195 1.00 110.04 ? 265  ARG C N     1 
ATOM   5618  C  CA    . ARG C 2  265  ? 493.797 -34.016 641.391 1.00 110.98 ? 265  ARG C CA    1 
ATOM   5619  C  C     . ARG C 2  265  ? 492.770 -32.897 641.257 1.00 112.54 ? 265  ARG C C     1 
ATOM   5620  O  O     . ARG C 2  265  ? 492.808 -31.916 642.008 1.00 112.50 ? 265  ARG C O     1 
ATOM   5621  C  CB    . ARG C 2  265  ? 494.956 -33.859 640.405 1.00 114.23 ? 265  ARG C CB    1 
ATOM   5622  C  CG    . ARG C 2  265  ? 496.266 -34.554 640.838 1.00 117.66 ? 265  ARG C CG    1 
ATOM   5623  C  CD    . ARG C 2  265  ? 497.483 -33.987 640.068 1.00 120.82 ? 265  ARG C CD    1 
ATOM   5624  N  NE    . ARG C 2  265  ? 498.587 -34.939 639.891 1.00 112.75 ? 265  ARG C NE    1 
ATOM   5625  C  CZ    . ARG C 2  265  ? 499.779 -34.626 639.377 1.00 109.36 ? 265  ARG C CZ    1 
ATOM   5626  N  NH1   . ARG C 2  265  ? 500.050 -33.380 638.981 1.00 104.90 ? 265  ARG C NH1   1 
ATOM   5627  N  NH2   . ARG C 2  265  ? 500.711 -35.563 639.266 1.00 111.72 ? 265  ARG C NH2   1 
ATOM   5628  N  N     . ARG C 2  266  ? 491.887 -33.004 640.257 1.00 111.96 ? 266  ARG C N     1 
ATOM   5629  C  CA    . ARG C 2  266  ? 490.844 -32.007 640.039 1.00 108.89 ? 266  ARG C CA    1 
ATOM   5630  C  C     . ARG C 2  266  ? 489.517 -32.374 640.710 1.00 100.62 ? 266  ARG C C     1 
ATOM   5631  O  O     . ARG C 2  266  ? 488.633 -31.514 640.809 1.00 98.38  ? 266  ARG C O     1 
ATOM   5632  C  CB    . ARG C 2  266  ? 490.653 -31.771 638.536 1.00 108.63 ? 266  ARG C CB    1 
ATOM   5633  N  N     . TYR C 2  267  ? 489.341 -33.633 641.123 1.00 98.63  ? 267  TYR C N     1 
ATOM   5634  C  CA    . TYR C 2  267  ? 488.138 -34.116 641.808 1.00 103.18 ? 267  TYR C CA    1 
ATOM   5635  C  C     . TYR C 2  267  ? 488.537 -34.879 643.065 1.00 108.88 ? 267  TYR C C     1 
ATOM   5636  O  O     . TYR C 2  267  ? 489.177 -35.938 642.977 1.00 106.97 ? 267  TYR C O     1 
ATOM   5637  C  CB    . TYR C 2  267  ? 487.237 -34.990 640.938 1.00 103.70 ? 267  TYR C CB    1 
ATOM   5638  C  CG    . TYR C 2  267  ? 485.872 -35.230 641.574 1.00 98.37  ? 267  TYR C CG    1 
ATOM   5639  C  CD1   . TYR C 2  267  ? 485.659 -36.331 642.405 1.00 102.13 ? 267  TYR C CD1   1 
ATOM   5640  C  CD2   . TYR C 2  267  ? 484.808 -34.364 641.354 1.00 102.62 ? 267  TYR C CD2   1 
ATOM   5641  C  CE1   . TYR C 2  267  ? 484.430 -36.563 643.002 1.00 103.93 ? 267  TYR C CE1   1 
ATOM   5642  C  CE2   . TYR C 2  267  ? 483.561 -34.592 641.939 1.00 108.47 ? 267  TYR C CE2   1 
ATOM   5643  C  CZ    . TYR C 2  267  ? 483.376 -35.696 642.765 1.00 107.46 ? 267  TYR C CZ    1 
ATOM   5644  O  OH    . TYR C 2  267  ? 482.144 -35.924 643.358 1.00 104.75 ? 267  TYR C OH    1 
ATOM   5645  N  N     . ASP C 2  268  ? 488.142 -34.355 644.230 1.00 107.31 ? 268  ASP C N     1 
ATOM   5646  C  CA    . ASP C 2  268  ? 488.450 -34.974 645.513 1.00 102.35 ? 268  ASP C CA    1 
ATOM   5647  C  C     . ASP C 2  268  ? 487.176 -35.163 646.321 1.00 103.01 ? 268  ASP C C     1 
ATOM   5648  O  O     . ASP C 2  268  ? 486.541 -34.182 646.724 1.00 104.96 ? 268  ASP C O     1 
ATOM   5649  C  CB    . ASP C 2  268  ? 489.409 -34.094 646.319 1.00 104.77 ? 268  ASP C CB    1 
ATOM   5650  C  CG    . ASP C 2  268  ? 490.303 -34.887 647.252 1.00 106.19 ? 268  ASP C CG    1 
ATOM   5651  O  OD1   . ASP C 2  268  ? 490.036 -36.090 647.469 1.00 102.68 ? 268  ASP C OD1   1 
ATOM   5652  O  OD2   . ASP C 2  268  ? 491.237 -34.273 647.819 1.00 106.11 ? 268  ASP C OD2   1 
ATOM   5653  N  N     . LEU C 2  269  ? 486.762 -36.416 646.491 1.00 106.89 ? 269  LEU C N     1 
ATOM   5654  C  CA    . LEU C 2  269  ? 485.802 -36.727 647.537 1.00 102.15 ? 269  LEU C CA    1 
ATOM   5655  C  C     . LEU C 2  269  ? 486.600 -36.664 648.836 1.00 101.36 ? 269  LEU C C     1 
ATOM   5656  O  O     . LEU C 2  269  ? 487.825 -36.761 648.827 1.00 107.97 ? 269  LEU C O     1 
ATOM   5657  C  CB    . LEU C 2  269  ? 485.161 -38.097 647.285 1.00 99.44  ? 269  LEU C CB    1 
ATOM   5658  C  CG    . LEU C 2  269  ? 483.642 -38.248 647.382 1.00 95.22  ? 269  LEU C CG    1 
ATOM   5659  C  CD1   . LEU C 2  269  ? 483.014 -37.163 646.548 1.00 99.76  ? 269  LEU C CD1   1 
ATOM   5660  C  CD2   . LEU C 2  269  ? 483.194 -39.572 646.808 1.00 84.70  ? 269  LEU C CD2   1 
ATOM   5661  N  N     . GLY C 2  270  ? 485.947 -36.508 649.949 1.00 100.59 ? 270  GLY C N     1 
ATOM   5662  C  CA    . GLY C 2  270  ? 486.713 -36.520 651.181 1.00 109.57 ? 270  GLY C CA    1 
ATOM   5663  C  C     . GLY C 2  270  ? 487.291 -37.885 651.546 1.00 109.68 ? 270  GLY C C     1 
ATOM   5664  O  O     . GLY C 2  270  ? 487.016 -38.914 650.925 1.00 109.04 ? 270  GLY C O     1 
ATOM   5665  N  N     . GLU C 2  271  ? 488.140 -37.877 652.580 1.00 108.76 ? 271  GLU C N     1 
ATOM   5666  C  CA    . GLU C 2  271  ? 488.385 -39.127 653.290 1.00 109.07 ? 271  GLU C CA    1 
ATOM   5667  C  C     . GLU C 2  271  ? 487.119 -39.535 654.015 1.00 110.79 ? 271  GLU C C     1 
ATOM   5668  O  O     . GLU C 2  271  ? 486.804 -40.728 654.122 1.00 109.48 ? 271  GLU C O     1 
ATOM   5669  C  CB    . GLU C 2  271  ? 489.572 -39.020 654.241 1.00 106.34 ? 271  GLU C CB    1 
ATOM   5670  C  CG    . GLU C 2  271  ? 489.981 -40.376 654.814 1.00 107.38 ? 271  GLU C CG    1 
ATOM   5671  C  CD    . GLU C 2  271  ? 490.547 -41.325 653.777 1.00 121.98 ? 271  GLU C CD    1 
ATOM   5672  O  OE1   . GLU C 2  271  ? 491.211 -40.853 652.827 1.00 127.89 ? 271  GLU C OE1   1 
ATOM   5673  O  OE2   . GLU C 2  271  ? 490.326 -42.556 653.915 1.00 123.87 ? 271  GLU C OE2   1 
ATOM   5674  N  N     . ALA C 2  272  ? 486.388 -38.542 654.523 1.00 106.67 ? 272  ALA C N     1 
ATOM   5675  C  CA    . ALA C 2  272  ? 485.078 -38.808 655.094 1.00 106.92 ? 272  ALA C CA    1 
ATOM   5676  C  C     . ALA C 2  272  ? 484.091 -39.164 653.989 1.00 107.11 ? 272  ALA C C     1 
ATOM   5677  O  O     . ALA C 2  272  ? 483.232 -40.036 654.172 1.00 103.45 ? 272  ALA C O     1 
ATOM   5678  C  CB    . ALA C 2  272  ? 484.597 -37.595 655.886 1.00 112.83 ? 272  ALA C CB    1 
ATOM   5679  N  N     . GLY C 2  273  ? 484.244 -38.534 652.816 1.00 108.35 ? 273  GLY C N     1 
ATOM   5680  C  CA    . GLY C 2  273  ? 483.414 -38.880 651.666 1.00 109.03 ? 273  GLY C CA    1 
ATOM   5681  C  C     . GLY C 2  273  ? 483.556 -40.345 651.280 1.00 112.31 ? 273  GLY C C     1 
ATOM   5682  O  O     . GLY C 2  273  ? 482.563 -41.018 650.981 1.00 112.12 ? 273  GLY C O     1 
ATOM   5683  N  N     . ARG C 2  274  ? 484.798 -40.831 651.175 1.00 109.55 ? 274  ARG C N     1 
ATOM   5684  C  CA    . ARG C 2  274  ? 485.003 -42.253 650.912 1.00 111.56 ? 274  ARG C CA    1 
ATOM   5685  C  C     . ARG C 2  274  ? 484.293 -43.127 651.958 1.00 117.37 ? 274  ARG C C     1 
ATOM   5686  O  O     . ARG C 2  274  ? 483.520 -44.024 651.596 1.00 118.69 ? 274  ARG C O     1 
ATOM   5687  C  CB    . ARG C 2  274  ? 486.505 -42.558 650.873 1.00 115.02 ? 274  ARG C CB    1 
ATOM   5688  C  CG    . ARG C 2  274  ? 486.839 -44.039 650.814 1.00 118.60 ? 274  ARG C CG    1 
ATOM   5689  C  CD    . ARG C 2  274  ? 488.231 -44.236 651.419 1.00 125.80 ? 274  ARG C CD    1 
ATOM   5690  N  NE    . ARG C 2  274  ? 488.850 -45.528 651.135 1.00 133.04 ? 274  ARG C NE    1 
ATOM   5691  C  CZ    . ARG C 2  274  ? 488.893 -46.522 652.026 1.00 129.84 ? 274  ARG C CZ    1 
ATOM   5692  N  NH1   . ARG C 2  274  ? 488.361 -46.352 653.231 1.00 122.58 ? 274  ARG C NH1   1 
ATOM   5693  N  NH2   . ARG C 2  274  ? 489.465 -47.682 651.724 1.00 131.14 ? 274  ARG C NH2   1 
ATOM   5694  N  N     . TYR C 2  275  ? 484.486 -42.847 653.264 1.00 110.37 ? 275  TYR C N     1 
ATOM   5695  C  CA    . TYR C 2  275  ? 483.810 -43.665 654.277 1.00 108.77 ? 275  TYR C CA    1 
ATOM   5696  C  C     . TYR C 2  275  ? 482.299 -43.583 654.175 1.00 113.80 ? 275  TYR C C     1 
ATOM   5697  O  O     . TYR C 2  275  ? 481.613 -44.611 654.244 1.00 117.24 ? 275  TYR C O     1 
ATOM   5698  C  CB    . TYR C 2  275  ? 484.209 -43.246 655.707 1.00 113.17 ? 275  TYR C CB    1 
ATOM   5699  C  CG    . TYR C 2  275  ? 483.437 -43.983 656.852 1.00 119.24 ? 275  TYR C CG    1 
ATOM   5700  C  CD1   . TYR C 2  275  ? 483.754 -45.288 657.255 1.00 119.02 ? 275  TYR C CD1   1 
ATOM   5701  C  CD2   . TYR C 2  275  ? 482.360 -43.353 657.508 1.00 116.88 ? 275  TYR C CD2   1 
ATOM   5702  C  CE1   . TYR C 2  275  ? 483.032 -45.933 658.282 1.00 115.90 ? 275  TYR C CE1   1 
ATOM   5703  C  CE2   . TYR C 2  275  ? 481.637 -43.989 658.522 1.00 119.21 ? 275  TYR C CE2   1 
ATOM   5704  C  CZ    . TYR C 2  275  ? 481.978 -45.275 658.909 1.00 121.50 ? 275  TYR C CZ    1 
ATOM   5705  O  OH    . TYR C 2  275  ? 481.263 -45.898 659.920 1.00 123.17 ? 275  TYR C OH    1 
ATOM   5706  N  N     . LYS C 2  276  ? 481.755 -42.378 654.000 1.00 111.56 ? 276  LYS C N     1 
ATOM   5707  C  CA    . LYS C 2  276  ? 480.303 -42.259 653.940 1.00 109.58 ? 276  LYS C CA    1 
ATOM   5708  C  C     . LYS C 2  276  ? 479.732 -42.956 652.709 1.00 109.64 ? 276  LYS C C     1 
ATOM   5709  O  O     . LYS C 2  276  ? 478.665 -43.583 652.786 1.00 102.46 ? 276  LYS C O     1 
ATOM   5710  C  CB    . LYS C 2  276  ? 479.920 -40.780 653.989 1.00 105.72 ? 276  LYS C CB    1 
ATOM   5711  C  CG    . LYS C 2  276  ? 480.106 -40.131 655.395 1.00 108.15 ? 276  LYS C CG    1 
ATOM   5712  C  CD    . LYS C 2  276  ? 479.071 -40.520 656.431 1.00 102.64 ? 276  LYS C CD    1 
ATOM   5713  C  CE    . LYS C 2  276  ? 477.736 -40.054 655.918 1.00 103.08 ? 276  LYS C CE    1 
ATOM   5714  N  NZ    . LYS C 2  276  ? 477.845 -38.618 655.523 1.00 93.84  ? 276  LYS C NZ    1 
ATOM   5715  N  N     . ALA C 2  277  ? 480.433 -42.848 651.568 1.00 112.63 ? 277  ALA C N     1 
ATOM   5716  C  CA    . ALA C 2  277  ? 480.031 -43.531 650.337 1.00 110.86 ? 277  ALA C CA    1 
ATOM   5717  C  C     . ALA C 2  277  ? 480.108 -45.051 650.459 1.00 110.64 ? 277  ALA C C     1 
ATOM   5718  O  O     . ALA C 2  277  ? 479.190 -45.767 650.033 1.00 108.17 ? 277  ALA C O     1 
ATOM   5719  C  CB    . ALA C 2  277  ? 480.891 -43.037 649.180 1.00 106.04 ? 277  ALA C CB    1 
ATOM   5720  N  N     . GLU C 2  278  ? 481.253 -45.561 650.923 1.00 110.58 ? 278  GLU C N     1 
ATOM   5721  C  CA    . GLU C 2  278  ? 481.418 -47.000 651.130 1.00 116.07 ? 278  GLU C CA    1 
ATOM   5722  C  C     . GLU C 2  278  ? 480.359 -47.580 652.068 1.00 119.21 ? 278  GLU C C     1 
ATOM   5723  O  O     . GLU C 2  278  ? 479.877 -48.704 651.859 1.00 117.36 ? 278  GLU C O     1 
ATOM   5724  C  CB    . GLU C 2  278  ? 482.830 -47.285 651.645 1.00 117.10 ? 278  GLU C CB    1 
ATOM   5725  C  CG    . GLU C 2  278  ? 483.882 -47.083 650.560 1.00 119.16 ? 278  GLU C CG    1 
ATOM   5726  C  CD    . GLU C 2  278  ? 485.295 -47.279 651.053 1.00 124.43 ? 278  GLU C CD    1 
ATOM   5727  O  OE1   . GLU C 2  278  ? 485.481 -47.440 652.280 1.00 128.58 ? 278  GLU C OE1   1 
ATOM   5728  O  OE2   . GLU C 2  278  ? 486.218 -47.262 650.212 1.00 124.25 ? 278  GLU C OE2   1 
ATOM   5729  N  N     . GLU C 2  279  ? 480.018 -46.836 653.132 1.00 120.91 ? 279  GLU C N     1 
ATOM   5730  C  CA    . GLU C 2  279  ? 479.085 -47.285 654.163 1.00 112.87 ? 279  GLU C CA    1 
ATOM   5731  C  C     . GLU C 2  279  ? 477.633 -47.211 653.686 1.00 115.06 ? 279  GLU C C     1 
ATOM   5732  O  O     . GLU C 2  279  ? 476.844 -48.127 653.953 1.00 113.89 ? 279  GLU C O     1 
ATOM   5733  C  CB    . GLU C 2  279  ? 479.299 -46.429 655.423 1.00 111.29 ? 279  GLU C CB    1 
ATOM   5734  C  CG    . GLU C 2  279  ? 478.634 -46.856 656.742 1.00 124.94 ? 279  GLU C CG    1 
ATOM   5735  C  CD    . GLU C 2  279  ? 478.976 -48.276 657.209 1.00 130.59 ? 279  GLU C CD    1 
ATOM   5736  O  OE1   . GLU C 2  279  ? 478.964 -49.227 656.391 1.00 127.00 ? 279  GLU C OE1   1 
ATOM   5737  O  OE2   . GLU C 2  279  ? 479.266 -48.432 658.424 1.00 128.79 ? 279  GLU C OE2   1 
ATOM   5738  N  N     . LYS C 2  280  ? 477.285 -46.142 652.947 1.00 112.69 ? 280  LYS C N     1 
ATOM   5739  C  CA    . LYS C 2  280  ? 475.911 -45.920 652.486 1.00 110.70 ? 280  LYS C CA    1 
ATOM   5740  C  C     . LYS C 2  280  ? 475.500 -46.852 651.354 1.00 115.27 ? 280  LYS C C     1 
ATOM   5741  O  O     . LYS C 2  280  ? 474.433 -47.477 651.415 1.00 114.37 ? 280  LYS C O     1 
ATOM   5742  C  CB    . LYS C 2  280  ? 475.748 -44.465 652.032 1.00 108.81 ? 280  LYS C CB    1 
ATOM   5743  C  CG    . LYS C 2  280  ? 474.344 -44.084 651.535 1.00 113.40 ? 280  LYS C CG    1 
ATOM   5744  C  CD    . LYS C 2  280  ? 473.318 -44.171 652.644 1.00 120.97 ? 280  LYS C CD    1 
ATOM   5745  C  CE    . LYS C 2  280  ? 471.978 -43.557 652.256 1.00 122.97 ? 280  LYS C CE    1 
ATOM   5746  N  NZ    . LYS C 2  280  ? 471.013 -43.634 653.413 1.00 128.04 ? 280  LYS C NZ    1 
ATOM   5747  N  N     . LEU C 2  281  ? 476.330 -46.964 650.311 1.00 116.87 ? 281  LEU C N     1 
ATOM   5748  C  CA    . LEU C 2  281  ? 475.961 -47.744 649.133 1.00 117.76 ? 281  LEU C CA    1 
ATOM   5749  C  C     . LEU C 2  281  ? 476.380 -49.197 649.226 1.00 119.30 ? 281  LEU C C     1 
ATOM   5750  O  O     . LEU C 2  281  ? 476.043 -49.981 648.326 1.00 120.82 ? 281  LEU C O     1 
ATOM   5751  C  CB    . LEU C 2  281  ? 476.541 -47.136 647.842 1.00 117.10 ? 281  LEU C CB    1 
ATOM   5752  C  CG    . LEU C 2  281  ? 476.432 -45.641 647.540 1.00 114.97 ? 281  LEU C CG    1 
ATOM   5753  C  CD1   . LEU C 2  281  ? 477.400 -45.216 646.447 1.00 112.08 ? 281  LEU C CD1   1 
ATOM   5754  C  CD2   . LEU C 2  281  ? 475.004 -45.363 647.098 1.00 115.13 ? 281  LEU C CD2   1 
ATOM   5755  N  N     . GLY C 2  282  ? 477.136 -49.559 650.257 1.00 118.62 ? 282  GLY C N     1 
ATOM   5756  C  CA    . GLY C 2  282  ? 477.599 -50.919 650.409 1.00 121.19 ? 282  GLY C CA    1 
ATOM   5757  C  C     . GLY C 2  282  ? 478.524 -51.336 649.286 1.00 120.67 ? 282  GLY C C     1 
ATOM   5758  O  O     . GLY C 2  282  ? 478.334 -52.392 648.673 1.00 120.09 ? 282  GLY C O     1 
ATOM   5759  N  N     . ILE C 2  283  ? 479.530 -50.509 649.007 1.00 120.88 ? 283  ILE C N     1 
ATOM   5760  C  CA    . ILE C 2  283  ? 480.536 -50.779 647.993 1.00 116.00 ? 283  ILE C CA    1 
ATOM   5761  C  C     . ILE C 2  283  ? 481.867 -50.418 648.637 1.00 113.29 ? 283  ILE C C     1 
ATOM   5762  O  O     . ILE C 2  283  ? 481.900 -49.949 649.776 1.00 121.30 ? 283  ILE C O     1 
ATOM   5763  C  CB    . ILE C 2  283  ? 480.274 -49.983 646.694 1.00 114.64 ? 283  ILE C CB    1 
ATOM   5764  C  CG1   . ILE C 2  283  ? 480.573 -48.499 646.881 1.00 113.59 ? 283  ILE C CG1   1 
ATOM   5765  C  CG2   . ILE C 2  283  ? 478.803 -50.118 646.250 1.00 107.63 ? 283  ILE C CG2   1 
ATOM   5766  C  CD1   . ILE C 2  283  ? 480.345 -47.680 645.612 1.00 112.15 ? 283  ILE C CD1   1 
ATOM   5767  N  N     . ARG C 2  284  ? 482.976 -50.618 647.942 1.00 114.09 ? 284  ARG C N     1 
ATOM   5768  C  CA    . ARG C 2  284  ? 484.219 -50.189 648.565 1.00 121.74 ? 284  ARG C CA    1 
ATOM   5769  C  C     . ARG C 2  284  ? 484.942 -49.351 647.511 1.00 123.21 ? 284  ARG C C     1 
ATOM   5770  O  O     . ARG C 2  284  ? 485.037 -49.777 646.353 1.00 118.93 ? 284  ARG C O     1 
ATOM   5771  C  CB    . ARG C 2  284  ? 485.006 -51.409 649.077 1.00 121.61 ? 284  ARG C CB    1 
ATOM   5772  C  CG    . ARG C 2  284  ? 484.633 -51.708 650.594 1.00 125.78 ? 284  ARG C CG    1 
ATOM   5773  C  CD    . ARG C 2  284  ? 485.639 -52.185 651.664 1.00 133.63 ? 284  ARG C CD    1 
ATOM   5774  N  NE    . ARG C 2  284  ? 486.697 -51.242 652.017 1.00 143.74 ? 284  ARG C NE    1 
ATOM   5775  C  CZ    . ARG C 2  284  ? 486.616 -50.424 653.074 1.00 142.27 ? 284  ARG C CZ    1 
ATOM   5776  N  NH1   . ARG C 2  284  ? 487.609 -49.582 653.353 1.00 142.73 ? 284  ARG C NH1   1 
ATOM   5777  N  NH2   . ARG C 2  284  ? 485.558 -50.482 653.888 1.00 133.99 ? 284  ARG C NH2   1 
ATOM   5778  N  N     . LEU C 2  285  ? 485.390 -48.146 647.866 1.00 124.82 ? 285  LEU C N     1 
ATOM   5779  C  CA    . LEU C 2  285  ? 486.058 -47.275 646.897 1.00 122.88 ? 285  LEU C CA    1 
ATOM   5780  C  C     . LEU C 2  285  ? 487.580 -47.450 646.882 1.00 124.29 ? 285  LEU C C     1 
ATOM   5781  O  O     . LEU C 2  285  ? 488.232 -47.444 647.936 1.00 120.30 ? 285  LEU C O     1 
ATOM   5782  C  CB    . LEU C 2  285  ? 485.690 -45.818 647.185 1.00 121.51 ? 285  LEU C CB    1 
ATOM   5783  C  CG    . LEU C 2  285  ? 484.550 -45.207 646.362 1.00 116.99 ? 285  LEU C CG    1 
ATOM   5784  C  CD1   . LEU C 2  285  ? 485.033 -44.979 644.952 1.00 120.08 ? 285  LEU C CD1   1 
ATOM   5785  C  CD2   . LEU C 2  285  ? 483.325 -46.090 646.347 1.00 109.25 ? 285  LEU C CD2   1 
ATOM   5786  N  N     . SER C 2  286  ? 488.140 -47.588 645.662 1.00 125.58 ? 286  SER C N     1 
ATOM   5787  C  CA    . SER C 2  286  ? 489.589 -47.674 645.453 1.00 124.41 ? 286  SER C CA    1 
ATOM   5788  C  C     . SER C 2  286  ? 490.284 -46.327 645.610 1.00 121.77 ? 286  SER C C     1 
ATOM   5789  O  O     . SER C 2  286  ? 491.510 -46.281 645.762 1.00 120.07 ? 286  SER C O     1 
ATOM   5790  C  CB    . SER C 2  286  ? 489.895 -48.266 644.070 1.00 123.55 ? 286  SER C CB    1 
ATOM   5791  O  OG    . SER C 2  286  ? 489.471 -47.419 643.012 1.00 122.55 ? 286  SER C OG    1 
ATOM   5792  N  N     . GLY C 2  287  ? 489.532 -45.239 645.558 1.00 123.39 ? 287  GLY C N     1 
ATOM   5793  C  CA    . GLY C 2  287  ? 490.115 -43.927 645.707 1.00 118.60 ? 287  GLY C CA    1 
ATOM   5794  C  C     . GLY C 2  287  ? 489.030 -42.909 645.962 1.00 118.93 ? 287  GLY C C     1 
ATOM   5795  O  O     . GLY C 2  287  ? 487.857 -43.245 646.140 1.00 119.35 ? 287  GLY C O     1 
ATOM   5796  N  N     . ARG C 2  288  ? 489.423 -41.652 645.884 1.00 112.64 ? 288  ARG C N     1 
ATOM   5797  C  CA    . ARG C 2  288  ? 488.526 -40.555 646.190 1.00 110.50 ? 288  ARG C CA    1 
ATOM   5798  C  C     . ARG C 2  288  ? 487.848 -39.988 644.951 1.00 110.75 ? 288  ARG C C     1 
ATOM   5799  O  O     . ARG C 2  288  ? 487.322 -38.873 644.998 1.00 106.51 ? 288  ARG C O     1 
ATOM   5800  C  CB    . ARG C 2  288  ? 489.249 -39.497 647.021 1.00 107.65 ? 288  ARG C CB    1 
ATOM   5801  C  CG    . ARG C 2  288  ? 489.629 -40.086 648.382 1.00 109.62 ? 288  ARG C CG    1 
ATOM   5802  C  CD    . ARG C 2  288  ? 489.930 -38.999 649.395 1.00 117.41 ? 288  ARG C CD    1 
ATOM   5803  N  NE    . ARG C 2  288  ? 491.086 -38.166 649.077 1.00 122.06 ? 288  ARG C NE    1 
ATOM   5804  C  CZ    . ARG C 2  288  ? 492.314 -38.394 649.538 1.00 124.40 ? 288  ARG C CZ    1 
ATOM   5805  N  NH1   . ARG C 2  288  ? 492.538 -39.427 650.352 1.00 120.59 ? 288  ARG C NH1   1 
ATOM   5806  N  NH2   . ARG C 2  288  ? 493.313 -37.580 649.200 1.00 121.57 ? 288  ARG C NH2   1 
ATOM   5807  N  N     . THR C 2  289  ? 487.904 -40.699 643.829 1.00 115.51 ? 289  THR C N     1 
ATOM   5808  C  CA    . THR C 2  289  ? 487.293 -40.217 642.602 1.00 114.79 ? 289  THR C CA    1 
ATOM   5809  C  C     . THR C 2  289  ? 486.071 -41.054 642.234 1.00 112.99 ? 289  THR C C     1 
ATOM   5810  O  O     . THR C 2  289  ? 485.927 -42.216 642.635 1.00 110.93 ? 289  THR C O     1 
ATOM   5811  C  CB    . THR C 2  289  ? 488.288 -40.263 641.432 1.00 116.40 ? 289  THR C CB    1 
ATOM   5812  O  OG1   . THR C 2  289  ? 489.037 -41.489 641.469 1.00 118.09 ? 289  THR C OG1   1 
ATOM   5813  C  CG2   . THR C 2  289  ? 489.269 -39.095 641.545 1.00 112.34 ? 289  THR C CG2   1 
ATOM   5814  N  N     . LEU C 2  290  ? 485.182 -40.417 641.461 1.00 112.10 ? 290  LEU C N     1 
ATOM   5815  C  CA    . LEU C 2  290  ? 483.942 -41.048 641.023 1.00 112.57 ? 290  LEU C CA    1 
ATOM   5816  C  C     . LEU C 2  290  ? 484.173 -42.100 639.940 1.00 120.41 ? 290  LEU C C     1 
ATOM   5817  O  O     . LEU C 2  290  ? 483.398 -43.063 639.847 1.00 116.54 ? 290  LEU C O     1 
ATOM   5818  C  CB    . LEU C 2  290  ? 482.972 -39.989 640.509 1.00 106.84 ? 290  LEU C CB    1 
ATOM   5819  C  CG    . LEU C 2  290  ? 482.644 -38.897 641.517 1.00 108.38 ? 290  LEU C CG    1 
ATOM   5820  C  CD1   . LEU C 2  290  ? 481.559 -37.947 640.997 1.00 103.99 ? 290  LEU C CD1   1 
ATOM   5821  C  CD2   . LEU C 2  290  ? 482.275 -39.496 642.884 1.00 114.75 ? 290  LEU C CD2   1 
ATOM   5822  N  N     . ALA C 2  291  ? 485.254 -41.969 639.155 1.00 124.12 ? 291  ALA C N     1 
ATOM   5823  C  CA    . ALA C 2  291  ? 485.606 -42.983 638.167 1.00 123.71 ? 291  ALA C CA    1 
ATOM   5824  C  C     . ALA C 2  291  ? 487.121 -43.039 637.989 1.00 126.91 ? 291  ALA C C     1 
ATOM   5825  O  O     . ALA C 2  291  ? 487.881 -42.311 638.642 1.00 121.43 ? 291  ALA C O     1 
ATOM   5826  C  CB    . ALA C 2  291  ? 484.920 -42.706 636.821 1.00 111.64 ? 291  ALA C CB    1 
ATOM   5827  N  N     . ARG C 2  292  ? 487.544 -43.949 637.103 1.00 133.82 ? 292  ARG C N     1 
ATOM   5828  C  CA    . ARG C 2  292  ? 488.940 -44.215 636.776 1.00 129.55 ? 292  ARG C CA    1 
ATOM   5829  C  C     . ARG C 2  292  ? 489.203 -44.182 635.268 1.00 131.25 ? 292  ARG C C     1 
ATOM   5830  O  O     . ARG C 2  292  ? 488.302 -44.374 634.441 1.00 127.63 ? 292  ARG C O     1 
ATOM   5831  C  CB    . ARG C 2  292  ? 489.350 -45.571 637.369 1.00 126.03 ? 292  ARG C CB    1 
ATOM   5832  C  CG    . ARG C 2  292  ? 489.456 -45.560 638.894 1.00 130.74 ? 292  ARG C CG    1 
ATOM   5833  C  CD    . ARG C 2  292  ? 489.681 -46.958 639.377 1.00 132.22 ? 292  ARG C CD    1 
ATOM   5834  N  NE    . ARG C 2  292  ? 488.633 -47.802 638.818 1.00 136.33 ? 292  ARG C NE    1 
ATOM   5835  C  CZ    . ARG C 2  292  ? 488.560 -49.118 638.966 1.00 137.16 ? 292  ARG C CZ    1 
ATOM   5836  N  NH1   . ARG C 2  292  ? 489.496 -49.766 639.658 1.00 132.05 ? 292  ARG C NH1   1 
ATOM   5837  N  NH2   . ARG C 2  292  ? 487.544 -49.781 638.417 1.00 133.34 ? 292  ARG C NH2   1 
ATOM   5838  N  N     . PHE C 2  293  ? 490.476 -43.945 634.925 1.00 135.56 ? 293  PHE C N     1 
ATOM   5839  C  CA    . PHE C 2  293  ? 491.016 -44.152 633.581 1.00 130.87 ? 293  PHE C CA    1 
ATOM   5840  C  C     . PHE C 2  293  ? 491.959 -45.352 633.672 1.00 131.43 ? 293  PHE C C     1 
ATOM   5841  O  O     . PHE C 2  293  ? 493.061 -45.249 634.231 1.00 128.20 ? 293  PHE C O     1 
ATOM   5842  C  CB    . PHE C 2  293  ? 491.743 -42.895 633.087 1.00 121.17 ? 293  PHE C CB    1 
ATOM   5843  C  CG    . PHE C 2  293  ? 492.093 -42.907 631.616 1.00 126.01 ? 293  PHE C CG    1 
ATOM   5844  C  CD1   . PHE C 2  293  ? 491.166 -42.535 630.652 1.00 128.82 ? 293  PHE C CD1   1 
ATOM   5845  C  CD2   . PHE C 2  293  ? 493.377 -43.245 631.201 1.00 130.52 ? 293  PHE C CD2   1 
ATOM   5846  C  CE1   . PHE C 2  293  ? 491.506 -42.534 629.296 1.00 128.97 ? 293  PHE C CE1   1 
ATOM   5847  C  CE2   . PHE C 2  293  ? 493.723 -43.247 629.844 1.00 129.84 ? 293  PHE C CE2   1 
ATOM   5848  C  CZ    . PHE C 2  293  ? 492.786 -42.891 628.897 1.00 128.38 ? 293  PHE C CZ    1 
ATOM   5849  N  N     . GLU C 2  294  ? 491.513 -46.495 633.142 1.00 132.38 ? 294  GLU C N     1 
ATOM   5850  C  CA    . GLU C 2  294  ? 492.240 -47.750 633.292 1.00 134.49 ? 294  GLU C CA    1 
ATOM   5851  C  C     . GLU C 2  294  ? 492.173 -48.531 631.982 1.00 138.71 ? 294  GLU C C     1 
ATOM   5852  O  O     . GLU C 2  294  ? 491.079 -48.800 631.465 1.00 136.31 ? 294  GLU C O     1 
ATOM   5853  C  CB    . GLU C 2  294  ? 491.643 -48.556 634.456 1.00 131.76 ? 294  GLU C CB    1 
ATOM   5854  C  CG    . GLU C 2  294  ? 492.175 -49.952 634.683 1.00 129.73 ? 294  GLU C CG    1 
ATOM   5855  C  CD    . GLU C 2  294  ? 491.523 -50.594 635.898 1.00 134.79 ? 294  GLU C CD    1 
ATOM   5856  O  OE1   . GLU C 2  294  ? 491.492 -49.950 636.970 1.00 132.29 ? 294  GLU C OE1   1 
ATOM   5857  O  OE2   . GLU C 2  294  ? 491.011 -51.728 635.777 1.00 138.29 ? 294  GLU C OE2   1 
ATOM   5858  N  N     . ASP C 2  295  ? 493.347 -48.957 631.498 1.00 135.52 ? 295  ASP C N     1 
ATOM   5859  C  CA    . ASP C 2  295  ? 493.496 -49.712 630.249 1.00 134.22 ? 295  ASP C CA    1 
ATOM   5860  C  C     . ASP C 2  295  ? 492.892 -48.977 629.040 1.00 133.19 ? 295  ASP C C     1 
ATOM   5861  O  O     . ASP C 2  295  ? 492.413 -49.602 628.086 1.00 131.17 ? 295  ASP C O     1 
ATOM   5862  C  CB    . ASP C 2  295  ? 492.927 -51.125 630.418 1.00 132.06 ? 295  ASP C CB    1 
ATOM   5863  C  CG    . ASP C 2  295  ? 493.594 -51.877 631.586 1.00 134.34 ? 295  ASP C CG    1 
ATOM   5864  O  OD1   . ASP C 2  295  ? 492.924 -52.713 632.235 1.00 141.58 ? 295  ASP C OD1   1 
ATOM   5865  O  OD2   . ASP C 2  295  ? 494.777 -51.588 631.894 1.00 121.83 ? 295  ASP C OD2   1 
ATOM   5866  N  N     . GLY C 2  296  ? 492.986 -47.639 629.055 1.00 128.90 ? 296  GLY C N     1 
ATOM   5867  C  CA    . GLY C 2  296  ? 492.594 -46.767 627.965 1.00 127.05 ? 296  GLY C CA    1 
ATOM   5868  C  C     . GLY C 2  296  ? 491.150 -46.280 627.974 1.00 132.98 ? 296  GLY C C     1 
ATOM   5869  O  O     . GLY C 2  296  ? 490.854 -45.276 627.311 1.00 128.89 ? 296  GLY C O     1 
ATOM   5870  N  N     . GLU C 2  297  ? 490.243 -46.940 628.700 1.00 138.83 ? 297  GLU C N     1 
ATOM   5871  C  CA    . GLU C 2  297  ? 488.829 -46.544 628.759 1.00 136.91 ? 297  GLU C CA    1 
ATOM   5872  C  C     . GLU C 2  297  ? 488.480 -46.181 630.211 1.00 136.47 ? 297  GLU C C     1 
ATOM   5873  O  O     . GLU C 2  297  ? 489.316 -46.277 631.117 1.00 134.30 ? 297  GLU C O     1 
ATOM   5874  C  CB    . GLU C 2  297  ? 487.896 -47.614 628.167 1.00 136.88 ? 297  GLU C CB    1 
ATOM   5875  C  CG    . GLU C 2  297  ? 487.886 -48.998 628.817 1.00 140.58 ? 297  GLU C CG    1 
ATOM   5876  C  CD    . GLU C 2  297  ? 486.863 -49.930 628.154 1.00 140.04 ? 297  GLU C CD    1 
ATOM   5877  O  OE1   . GLU C 2  297  ? 487.203 -51.111 627.895 1.00 130.28 ? 297  GLU C OE1   1 
ATOM   5878  O  OE2   . GLU C 2  297  ? 485.729 -49.468 627.867 1.00 136.77 ? 297  GLU C OE2   1 
ATOM   5879  N  N     . PHE C 2  298  ? 487.230 -45.775 630.442 1.00 139.30 ? 298  PHE C N     1 
ATOM   5880  C  CA    . PHE C 2  298  ? 486.746 -45.412 631.776 1.00 134.34 ? 298  PHE C CA    1 
ATOM   5881  C  C     . PHE C 2  298  ? 486.037 -46.563 632.489 1.00 132.38 ? 298  PHE C C     1 
ATOM   5882  O  O     . PHE C 2  298  ? 485.192 -47.243 631.897 1.00 138.38 ? 298  PHE C O     1 
ATOM   5883  C  CB    . PHE C 2  298  ? 485.779 -44.231 631.674 1.00 127.12 ? 298  PHE C CB    1 
ATOM   5884  C  CG    . PHE C 2  298  ? 486.458 -42.906 631.457 1.00 122.63 ? 298  PHE C CG    1 
ATOM   5885  C  CD1   . PHE C 2  298  ? 487.590 -42.558 632.175 1.00 125.09 ? 298  PHE C CD1   1 
ATOM   5886  C  CD2   . PHE C 2  298  ? 485.932 -41.987 630.560 1.00 115.65 ? 298  PHE C CD2   1 
ATOM   5887  C  CE1   . PHE C 2  298  ? 488.210 -41.328 631.976 1.00 121.15 ? 298  PHE C CE1   1 
ATOM   5888  C  CE2   . PHE C 2  298  ? 486.537 -40.753 630.367 1.00 115.99 ? 298  PHE C CE2   1 
ATOM   5889  C  CZ    . PHE C 2  298  ? 487.676 -40.423 631.075 1.00 115.19 ? 298  PHE C CZ    1 
ATOM   5890  N  N     . LYS C 2  299  ? 486.341 -46.754 633.776 1.00 128.20 ? 299  LYS C N     1 
ATOM   5891  C  CA    . LYS C 2  299  ? 485.682 -47.797 634.562 1.00 134.04 ? 299  LYS C CA    1 
ATOM   5892  C  C     . LYS C 2  299  ? 484.984 -47.180 635.778 1.00 135.63 ? 299  LYS C C     1 
ATOM   5893  O  O     . LYS C 2  299  ? 485.637 -46.618 636.669 1.00 127.45 ? 299  LYS C O     1 
ATOM   5894  C  CB    . LYS C 2  299  ? 486.697 -48.855 634.994 1.00 132.86 ? 299  LYS C CB    1 
ATOM   5895  C  CG    . LYS C 2  299  ? 487.165 -49.737 633.856 1.00 133.39 ? 299  LYS C CG    1 
ATOM   5896  C  CD    . LYS C 2  299  ? 488.296 -50.645 634.293 1.00 135.01 ? 299  LYS C CD    1 
ATOM   5897  C  CE    . LYS C 2  299  ? 488.653 -51.637 633.197 1.00 134.34 ? 299  LYS C CE    1 
ATOM   5898  N  NZ    . LYS C 2  299  ? 489.744 -52.552 633.626 1.00 136.40 ? 299  LYS C NZ    1 
ATOM   5899  N  N     . ASP C 2  300  ? 483.670 -47.407 635.859 1.00 135.76 ? 300  ASP C N     1 
ATOM   5900  C  CA    . ASP C 2  300  ? 482.789 -46.845 636.884 1.00 128.74 ? 300  ASP C CA    1 
ATOM   5901  C  C     . ASP C 2  300  ? 483.066 -47.382 638.288 1.00 127.10 ? 300  ASP C C     1 
ATOM   5902  O  O     . ASP C 2  300  ? 483.496 -48.525 638.470 1.00 130.21 ? 300  ASP C O     1 
ATOM   5903  C  CB    . ASP C 2  300  ? 481.326 -47.097 636.503 1.00 127.90 ? 300  ASP C CB    1 
ATOM   5904  C  CG    . ASP C 2  300  ? 480.344 -46.432 637.461 1.00 124.28 ? 300  ASP C CG    1 
ATOM   5905  O  OD1   . ASP C 2  300  ? 480.591 -45.279 637.874 1.00 121.60 ? 300  ASP C OD1   1 
ATOM   5906  O  OD2   . ASP C 2  300  ? 479.302 -47.046 637.767 1.00 122.44 ? 300  ASP C OD2   1 
ATOM   5907  N  N     . GLU C 2  301  ? 482.805 -46.527 639.290 1.00 124.02 ? 301  GLU C N     1 
ATOM   5908  C  CA    . GLU C 2  301  ? 482.944 -46.865 640.707 1.00 120.34 ? 301  GLU C CA    1 
ATOM   5909  C  C     . GLU C 2  301  ? 481.665 -46.523 641.467 1.00 116.39 ? 301  GLU C C     1 
ATOM   5910  O  O     . GLU C 2  301  ? 481.034 -47.385 642.090 1.00 113.07 ? 301  GLU C O     1 
ATOM   5911  C  CB    . GLU C 2  301  ? 484.121 -46.099 641.319 1.00 115.85 ? 301  GLU C CB    1 
ATOM   5912  C  CG    . GLU C 2  301  ? 485.472 -46.663 640.959 1.00 123.45 ? 301  GLU C CG    1 
ATOM   5913  C  CD    . GLU C 2  301  ? 486.464 -46.555 642.083 1.00 124.70 ? 301  GLU C CD    1 
ATOM   5914  O  OE1   . GLU C 2  301  ? 486.792 -47.602 642.689 1.00 120.79 ? 301  GLU C OE1   1 
ATOM   5915  O  OE2   . GLU C 2  301  ? 486.900 -45.416 642.362 1.00 128.52 ? 301  GLU C OE2   1 
ATOM   5916  N  N     . VAL C 2  302  ? 481.306 -45.246 641.431 1.00 118.02 ? 302  VAL C N     1 
ATOM   5917  C  CA    . VAL C 2  302  ? 480.210 -44.675 642.213 1.00 116.84 ? 302  VAL C CA    1 
ATOM   5918  C  C     . VAL C 2  302  ? 478.889 -44.716 641.441 1.00 117.58 ? 302  VAL C C     1 
ATOM   5919  O  O     . VAL C 2  302  ? 477.866 -45.157 641.970 1.00 119.11 ? 302  VAL C O     1 
ATOM   5920  C  CB    . VAL C 2  302  ? 480.582 -43.242 642.668 1.00 108.98 ? 302  VAL C CB    1 
ATOM   5921  C  CG1   . VAL C 2  302  ? 479.442 -42.597 643.424 1.00 101.88 ? 302  VAL C CG1   1 
ATOM   5922  C  CG2   . VAL C 2  302  ? 481.827 -43.283 643.559 1.00 104.03 ? 302  VAL C CG2   1 
ATOM   5923  N  N     . PHE C 2  303  ? 478.886 -44.173 640.219 1.00 116.75 ? 303  PHE C N     1 
ATOM   5924  C  CA    . PHE C 2  303  ? 477.662 -43.919 639.452 1.00 116.35 ? 303  PHE C CA    1 
ATOM   5925  C  C     . PHE C 2  303  ? 476.658 -45.075 639.441 1.00 120.17 ? 303  PHE C C     1 
ATOM   5926  O  O     . PHE C 2  303  ? 475.452 -44.853 639.606 1.00 118.89 ? 303  PHE C O     1 
ATOM   5927  C  CB    . PHE C 2  303  ? 478.078 -43.560 638.027 1.00 114.69 ? 303  PHE C CB    1 
ATOM   5928  C  CG    . PHE C 2  303  ? 478.786 -42.260 637.950 1.00 111.70 ? 303  PHE C CG    1 
ATOM   5929  C  CD1   . PHE C 2  303  ? 480.162 -42.209 638.035 1.00 110.28 ? 303  PHE C CD1   1 
ATOM   5930  C  CD2   . PHE C 2  303  ? 478.078 -41.086 637.750 1.00 110.86 ? 303  PHE C CD2   1 
ATOM   5931  C  CE1   . PHE C 2  303  ? 480.819 -41.004 637.983 1.00 109.70 ? 303  PHE C CE1   1 
ATOM   5932  C  CE2   . PHE C 2  303  ? 478.726 -39.875 637.684 1.00 107.59 ? 303  PHE C CE2   1 
ATOM   5933  C  CZ    . PHE C 2  303  ? 480.102 -39.834 637.799 1.00 108.56 ? 303  PHE C CZ    1 
ATOM   5934  N  N     . LEU C 2  304  ? 477.108 -46.301 639.156 1.00 124.17 ? 304  LEU C N     1 
ATOM   5935  C  CA    . LEU C 2  304  ? 476.107 -47.370 639.118 1.00 123.31 ? 304  LEU C CA    1 
ATOM   5936  C  C     . LEU C 2  304  ? 475.546 -47.684 640.512 1.00 117.81 ? 304  LEU C C     1 
ATOM   5937  O  O     . LEU C 2  304  ? 474.325 -47.814 640.647 1.00 121.22 ? 304  LEU C O     1 
ATOM   5938  C  CB    . LEU C 2  304  ? 476.616 -48.632 638.412 1.00 123.37 ? 304  LEU C CB    1 
ATOM   5939  C  CG    . LEU C 2  304  ? 475.462 -49.630 638.235 1.00 124.69 ? 304  LEU C CG    1 
ATOM   5940  C  CD1   . LEU C 2  304  ? 474.341 -49.050 637.356 1.00 119.32 ? 304  LEU C CD1   1 
ATOM   5941  C  CD2   . LEU C 2  304  ? 475.986 -50.913 637.641 1.00 133.11 ? 304  LEU C CD2   1 
ATOM   5942  N  N     . PRO C 2  305  ? 476.373 -47.796 641.569 1.00 111.69 ? 305  PRO C N     1 
ATOM   5943  C  CA    . PRO C 2  305  ? 475.798 -47.961 642.921 1.00 117.81 ? 305  PRO C CA    1 
ATOM   5944  C  C     . PRO C 2  305  ? 474.876 -46.823 643.344 1.00 118.91 ? 305  PRO C C     1 
ATOM   5945  O  O     . PRO C 2  305  ? 473.900 -47.066 644.066 1.00 118.84 ? 305  PRO C O     1 
ATOM   5946  C  CB    . PRO C 2  305  ? 477.042 -48.061 643.815 1.00 117.63 ? 305  PRO C CB    1 
ATOM   5947  C  CG    . PRO C 2  305  ? 478.053 -48.699 642.933 1.00 113.99 ? 305  PRO C CG    1 
ATOM   5948  C  CD    . PRO C 2  305  ? 477.810 -48.137 641.560 1.00 112.46 ? 305  PRO C CD    1 
ATOM   5949  N  N     . THR C 2  306  ? 475.168 -45.589 642.935 1.00 116.76 ? 306  THR C N     1 
ATOM   5950  C  CA    . THR C 2  306  ? 474.305 -44.462 643.271 1.00 114.97 ? 306  THR C CA    1 
ATOM   5951  C  C     . THR C 2  306  ? 472.984 -44.548 642.505 1.00 116.04 ? 306  THR C C     1 
ATOM   5952  O  O     . THR C 2  306  ? 471.922 -44.222 643.048 1.00 119.25 ? 306  THR C O     1 
ATOM   5953  C  CB    . THR C 2  306  ? 475.052 -43.153 643.001 1.00 112.92 ? 306  THR C CB    1 
ATOM   5954  O  OG1   . THR C 2  306  ? 476.206 -43.083 643.855 1.00 107.13 ? 306  THR C OG1   1 
ATOM   5955  C  CG2   . THR C 2  306  ? 474.156 -41.925 643.149 1.00 114.18 ? 306  THR C CG2   1 
ATOM   5956  N  N     . LEU C 2  307  ? 473.036 -44.946 641.229 1.00 121.06 ? 307  LEU C N     1 
ATOM   5957  C  CA    . LEU C 2  307  ? 471.819 -45.161 640.444 1.00 121.02 ? 307  LEU C CA    1 
ATOM   5958  C  C     . LEU C 2  307  ? 471.018 -46.325 641.025 1.00 123.75 ? 307  LEU C C     1 
ATOM   5959  O  O     . LEU C 2  307  ? 469.781 -46.294 641.052 1.00 127.41 ? 307  LEU C O     1 
ATOM   5960  C  CB    . LEU C 2  307  ? 472.161 -45.426 638.974 1.00 113.17 ? 307  LEU C CB    1 
ATOM   5961  C  CG    . LEU C 2  307  ? 470.939 -45.768 638.121 1.00 120.13 ? 307  LEU C CG    1 
ATOM   5962  C  CD1   . LEU C 2  307  ? 469.970 -44.588 638.152 1.00 122.31 ? 307  LEU C CD1   1 
ATOM   5963  C  CD2   . LEU C 2  307  ? 471.290 -46.143 636.684 1.00 128.49 ? 307  LEU C CD2   1 
ATOM   5964  N  N     . ARG C 2  308  ? 471.725 -47.390 641.421 1.00 122.51 ? 308  ARG C N     1 
ATOM   5965  C  CA    . ARG C 2  308  ? 471.122 -48.575 642.031 1.00 119.40 ? 308  ARG C CA    1 
ATOM   5966  C  C     . ARG C 2  308  ? 470.381 -48.235 643.326 1.00 125.61 ? 308  ARG C C     1 
ATOM   5967  O  O     . ARG C 2  308  ? 469.247 -48.685 643.536 1.00 126.28 ? 308  ARG C O     1 
ATOM   5968  C  CB    . ARG C 2  308  ? 472.251 -49.602 642.230 1.00 116.34 ? 308  ARG C CB    1 
ATOM   5969  C  CG    . ARG C 2  308  ? 471.931 -51.061 642.499 1.00 112.80 ? 308  ARG C CG    1 
ATOM   5970  C  CD    . ARG C 2  308  ? 471.797 -51.307 643.971 1.00 120.50 ? 308  ARG C CD    1 
ATOM   5971  N  NE    . ARG C 2  308  ? 472.860 -50.606 644.685 1.00 124.20 ? 308  ARG C NE    1 
ATOM   5972  C  CZ    . ARG C 2  308  ? 472.814 -50.279 645.975 1.00 127.80 ? 308  ARG C CZ    1 
ATOM   5973  N  NH1   . ARG C 2  308  ? 471.750 -50.595 646.706 1.00 126.27 ? 308  ARG C NH1   1 
ATOM   5974  N  NH2   . ARG C 2  308  ? 473.833 -49.634 646.535 1.00 124.68 ? 308  ARG C NH2   1 
ATOM   5975  N  N     . TYR C 2  309  ? 470.990 -47.425 644.198 1.00 127.50 ? 309  TYR C N     1 
ATOM   5976  C  CA    . TYR C 2  309  ? 470.330 -47.067 645.452 1.00 124.58 ? 309  TYR C CA    1 
ATOM   5977  C  C     . TYR C 2  309  ? 469.078 -46.221 645.190 1.00 126.48 ? 309  TYR C C     1 
ATOM   5978  O  O     . TYR C 2  309  ? 468.046 -46.431 645.829 1.00 135.12 ? 309  TYR C O     1 
ATOM   5979  C  CB    . TYR C 2  309  ? 471.316 -46.323 646.368 1.00 123.78 ? 309  TYR C CB    1 
ATOM   5980  C  CG    . TYR C 2  309  ? 470.961 -46.242 647.863 1.00 128.59 ? 309  TYR C CG    1 
ATOM   5981  C  CD1   . TYR C 2  309  ? 471.683 -46.992 648.801 1.00 126.68 ? 309  TYR C CD1   1 
ATOM   5982  C  CD2   . TYR C 2  309  ? 469.914 -45.440 648.336 1.00 127.70 ? 309  TYR C CD2   1 
ATOM   5983  C  CE1   . TYR C 2  309  ? 471.391 -46.940 650.166 1.00 125.40 ? 309  TYR C CE1   1 
ATOM   5984  C  CE2   . TYR C 2  309  ? 469.612 -45.378 649.708 1.00 129.50 ? 309  TYR C CE2   1 
ATOM   5985  C  CZ    . TYR C 2  309  ? 470.355 -46.137 650.618 1.00 129.97 ? 309  TYR C CZ    1 
ATOM   5986  O  OH    . TYR C 2  309  ? 470.072 -46.101 651.975 1.00 122.66 ? 309  TYR C OH    1 
ATOM   5987  N  N     . LEU C 2  310  ? 469.147 -45.268 644.248 1.00 124.56 ? 310  LEU C N     1 
ATOM   5988  C  CA    . LEU C 2  310  ? 467.996 -44.418 643.918 1.00 123.12 ? 310  LEU C CA    1 
ATOM   5989  C  C     . LEU C 2  310  ? 466.786 -45.213 643.431 1.00 128.15 ? 310  LEU C C     1 
ATOM   5990  O  O     . LEU C 2  310  ? 465.654 -44.944 643.850 1.00 131.15 ? 310  LEU C O     1 
ATOM   5991  C  CB    . LEU C 2  310  ? 468.396 -43.375 642.868 1.00 124.00 ? 310  LEU C CB    1 
ATOM   5992  C  CG    . LEU C 2  310  ? 467.290 -42.559 642.171 1.00 124.66 ? 310  LEU C CG    1 
ATOM   5993  C  CD1   . LEU C 2  310  ? 466.402 -41.823 643.161 1.00 126.01 ? 310  LEU C CD1   1 
ATOM   5994  C  CD2   . LEU C 2  310  ? 467.862 -41.582 641.120 1.00 124.38 ? 310  LEU C CD2   1 
ATOM   5995  N  N     . PHE C 2  311  ? 466.980 -46.123 642.470 1.00 130.83 ? 311  PHE C N     1 
ATOM   5996  C  CA    . PHE C 2  311  ? 465.843 -46.917 641.998 1.00 136.41 ? 311  PHE C CA    1 
ATOM   5997  C  C     . PHE C 2  311  ? 465.260 -47.773 643.121 1.00 137.02 ? 311  PHE C C     1 
ATOM   5998  O  O     . PHE C 2  311  ? 464.035 -47.835 643.288 1.00 136.90 ? 311  PHE C O     1 
ATOM   5999  C  CB    . PHE C 2  311  ? 466.231 -47.772 640.782 1.00 138.58 ? 311  PHE C CB    1 
ATOM   6000  C  CG    . PHE C 2  311  ? 466.195 -47.018 639.466 1.00 139.34 ? 311  PHE C CG    1 
ATOM   6001  C  CD1   . PHE C 2  311  ? 465.682 -45.725 639.395 1.00 140.93 ? 311  PHE C CD1   1 
ATOM   6002  C  CD2   . PHE C 2  311  ? 466.655 -47.606 638.301 1.00 141.49 ? 311  PHE C CD2   1 
ATOM   6003  C  CE1   . PHE C 2  311  ? 465.646 -45.024 638.189 1.00 139.94 ? 311  PHE C CE1   1 
ATOM   6004  C  CE2   . PHE C 2  311  ? 466.627 -46.915 637.092 1.00 143.00 ? 311  PHE C CE2   1 
ATOM   6005  C  CZ    . PHE C 2  311  ? 466.119 -45.620 637.038 1.00 141.37 ? 311  PHE C CZ    1 
ATOM   6006  N  N     . ALA C 2  312  ? 466.128 -48.438 643.902 1.00 137.20 ? 312  ALA C N     1 
ATOM   6007  C  CA    . ALA C 2  312  ? 465.679 -49.276 645.020 1.00 141.73 ? 312  ALA C CA    1 
ATOM   6008  C  C     . ALA C 2  312  ? 464.912 -48.459 646.058 1.00 142.26 ? 312  ALA C C     1 
ATOM   6009  O  O     . ALA C 2  312  ? 464.050 -48.997 646.767 1.00 139.90 ? 312  ALA C O     1 
ATOM   6010  C  CB    . ALA C 2  312  ? 466.867 -49.995 645.660 1.00 136.05 ? 312  ALA C CB    1 
ATOM   6011  N  N     . LEU C 2  313  ? 465.277 -47.184 646.219 1.00 144.93 ? 313  LEU C N     1 
ATOM   6012  C  CA    . LEU C 2  313  ? 464.585 -46.306 647.155 1.00 141.71 ? 313  LEU C CA    1 
ATOM   6013  C  C     . LEU C 2  313  ? 463.204 -45.931 646.618 1.00 142.97 ? 313  LEU C C     1 
ATOM   6014  O  O     . LEU C 2  313  ? 462.208 -46.007 647.347 1.00 147.10 ? 313  LEU C O     1 
ATOM   6015  C  CB    . LEU C 2  313  ? 465.423 -45.047 647.395 1.00 140.78 ? 313  LEU C CB    1 
ATOM   6016  C  CG    . LEU C 2  313  ? 464.926 -43.972 648.360 1.00 144.17 ? 313  LEU C CG    1 
ATOM   6017  C  CD1   . LEU C 2  313  ? 464.713 -44.540 649.769 1.00 140.15 ? 313  LEU C CD1   1 
ATOM   6018  C  CD2   . LEU C 2  313  ? 465.866 -42.766 648.342 1.00 136.57 ? 313  LEU C CD2   1 
ATOM   6019  N  N     . THR C 2  314  ? 463.124 -45.537 645.334 1.00 138.59 ? 314  THR C N     1 
ATOM   6020  C  CA    . THR C 2  314  ? 461.831 -45.175 644.746 1.00 142.04 ? 314  THR C CA    1 
ATOM   6021  C  C     . THR C 2  314  ? 460.840 -46.340 644.841 1.00 145.18 ? 314  THR C C     1 
ATOM   6022  O  O     . THR C 2  314  ? 459.633 -46.131 645.032 1.00 145.77 ? 314  THR C O     1 
ATOM   6023  C  CB    . THR C 2  314  ? 462.017 -44.677 643.307 1.00 132.83 ? 314  THR C CB    1 
ATOM   6024  O  OG1   . THR C 2  314  ? 462.888 -43.535 643.316 1.00 123.45 ? 314  THR C OG1   1 
ATOM   6025  C  CG2   . THR C 2  314  ? 460.676 -44.253 642.701 1.00 132.88 ? 314  THR C CG2   1 
ATOM   6026  N  N     . ALA C 2  315  ? 461.325 -47.573 644.657 1.00 143.40 ? 315  ALA C N     1 
ATOM   6027  C  CA    . ALA C 2  315  ? 460.489 -48.765 644.765 1.00 141.91 ? 315  ALA C CA    1 
ATOM   6028  C  C     . ALA C 2  315  ? 460.098 -49.128 646.201 1.00 137.85 ? 315  ALA C C     1 
ATOM   6029  O  O     . ALA C 2  315  ? 459.209 -49.965 646.375 1.00 143.27 ? 315  ALA C O     1 
ATOM   6030  C  CB    . ALA C 2  315  ? 461.201 -49.958 644.118 1.00 140.22 ? 315  ALA C CB    1 
ATOM   6031  N  N     . GLY C 2  316  ? 460.709 -48.532 647.225 1.00 133.22 ? 316  GLY C N     1 
ATOM   6032  C  CA    . GLY C 2  316  ? 460.342 -48.855 648.599 1.00 138.64 ? 316  GLY C CA    1 
ATOM   6033  C  C     . GLY C 2  316  ? 460.983 -50.119 649.143 1.00 140.32 ? 316  GLY C C     1 
ATOM   6034  O  O     . GLY C 2  316  ? 460.415 -50.782 650.025 1.00 134.21 ? 316  GLY C O     1 
ATOM   6035  N  N     . VAL C 2  317  ? 462.168 -50.452 648.650 1.00 141.08 ? 317  VAL C N     1 
ATOM   6036  C  CA    . VAL C 2  317  ? 462.953 -51.625 649.062 1.00 143.51 ? 317  VAL C CA    1 
ATOM   6037  C  C     . VAL C 2  317  ? 463.459 -51.446 650.495 1.00 140.00 ? 317  VAL C C     1 
ATOM   6038  O  O     . VAL C 2  317  ? 463.896 -50.340 650.860 1.00 140.35 ? 317  VAL C O     1 
ATOM   6039  C  CB    . VAL C 2  317  ? 464.112 -51.852 648.084 1.00 140.15 ? 317  VAL C CB    1 
ATOM   6040  C  CG1   . VAL C 2  317  ? 465.042 -52.964 648.576 1.00 138.94 ? 317  VAL C CG1   1 
ATOM   6041  C  CG2   . VAL C 2  317  ? 463.573 -52.148 646.692 1.00 130.91 ? 317  VAL C CG2   1 
ATOM   6042  N  N     . PRO C 2  318  ? 463.313 -52.451 651.365 1.00 141.09 ? 318  PRO C N     1 
ATOM   6043  C  CA    . PRO C 2  318  ? 463.841 -52.348 652.741 1.00 144.03 ? 318  PRO C CA    1 
ATOM   6044  C  C     . PRO C 2  318  ? 465.340 -52.056 652.777 1.00 143.94 ? 318  PRO C C     1 
ATOM   6045  O  O     . PRO C 2  318  ? 466.123 -52.628 652.013 1.00 146.49 ? 318  PRO C O     1 
ATOM   6046  C  CB    . PRO C 2  318  ? 463.542 -53.728 653.336 1.00 138.88 ? 318  PRO C CB    1 
ATOM   6047  C  CG    . PRO C 2  318  ? 462.375 -54.192 652.566 1.00 141.26 ? 318  PRO C CG    1 
ATOM   6048  C  CD    . PRO C 2  318  ? 462.539 -53.686 651.164 1.00 139.72 ? 318  PRO C CD    1 
ATOM   6049  N  N     . GLY C 2  319  ? 465.739 -51.182 653.705 1.00 139.81 ? 319  GLY C N     1 
ATOM   6050  C  CA    . GLY C 2  319  ? 467.127 -50.802 653.885 1.00 137.72 ? 319  GLY C CA    1 
ATOM   6051  C  C     . GLY C 2  319  ? 467.528 -49.515 653.189 1.00 136.50 ? 319  GLY C C     1 
ATOM   6052  O  O     . GLY C 2  319  ? 468.720 -49.175 653.188 1.00 132.71 ? 319  GLY C O     1 
ATOM   6053  N  N     . HIS C 2  320  ? 466.580 -48.808 652.569 1.00 137.28 ? 320  HIS C N     1 
ATOM   6054  C  CA    . HIS C 2  320  ? 466.850 -47.563 651.861 1.00 137.78 ? 320  HIS C CA    1 
ATOM   6055  C  C     . HIS C 2  320  ? 466.027 -46.447 652.495 1.00 141.42 ? 320  HIS C C     1 
ATOM   6056  O  O     . HIS C 2  320  ? 464.796 -46.551 652.570 1.00 143.51 ? 320  HIS C O     1 
ATOM   6057  C  CB    . HIS C 2  320  ? 466.473 -47.700 650.377 1.00 139.28 ? 320  HIS C CB    1 
ATOM   6058  C  CG    . HIS C 2  320  ? 467.260 -48.741 649.639 1.00 138.96 ? 320  HIS C CG    1 
ATOM   6059  N  ND1   . HIS C 2  320  ? 467.224 -50.079 649.975 1.00 140.27 ? 320  HIS C ND1   1 
ATOM   6060  C  CD2   . HIS C 2  320  ? 468.064 -48.651 648.554 1.00 134.50 ? 320  HIS C CD2   1 
ATOM   6061  C  CE1   . HIS C 2  320  ? 467.997 -50.761 649.151 1.00 136.92 ? 320  HIS C CE1   1 
ATOM   6062  N  NE2   . HIS C 2  320  ? 468.520 -49.918 648.280 1.00 136.61 ? 320  HIS C NE2   1 
ATOM   6063  N  N     . GLU C 2  321  ? 466.703 -45.381 652.931 1.00 139.92 ? 321  GLU C N     1 
ATOM   6064  C  CA    . GLU C 2  321  ? 466.093 -44.258 653.639 1.00 131.44 ? 321  GLU C CA    1 
ATOM   6065  C  C     . GLU C 2  321  ? 466.561 -42.947 653.009 1.00 125.22 ? 321  GLU C C     1 
ATOM   6066  O  O     . GLU C 2  321  ? 467.593 -42.902 652.333 1.00 128.40 ? 321  GLU C O     1 
ATOM   6067  C  CB    . GLU C 2  321  ? 466.368 -44.311 655.135 1.00 125.24 ? 321  GLU C CB    1 
ATOM   6068  C  CG    . GLU C 2  321  ? 467.795 -44.206 655.533 1.00 124.64 ? 321  GLU C CG    1 
ATOM   6069  C  CD    . GLU C 2  321  ? 467.917 -44.388 657.016 1.00 128.14 ? 321  GLU C CD    1 
ATOM   6070  O  OE1   . GLU C 2  321  ? 466.902 -44.174 657.727 1.00 119.19 ? 321  GLU C OE1   1 
ATOM   6071  O  OE2   . GLU C 2  321  ? 469.015 -44.759 657.470 1.00 137.81 ? 321  GLU C OE2   1 
ATOM   6072  N  N     . VAL C 2  322  ? 465.806 -41.867 653.231 1.00 114.98 ? 322  VAL C N     1 
ATOM   6073  C  CA    . VAL C 2  322  ? 466.344 -40.546 652.910 1.00 115.42 ? 322  VAL C CA    1 
ATOM   6074  C  C     . VAL C 2  322  ? 467.285 -40.092 654.024 1.00 114.57 ? 322  VAL C C     1 
ATOM   6075  O  O     . VAL C 2  322  ? 467.251 -40.600 655.144 1.00 117.09 ? 322  VAL C O     1 
ATOM   6076  C  CB    . VAL C 2  322  ? 465.205 -39.526 652.677 1.00 114.86 ? 322  VAL C CB    1 
ATOM   6077  C  CG1   . VAL C 2  322  ? 465.661 -38.079 652.908 1.00 109.25 ? 322  VAL C CG1   1 
ATOM   6078  C  CG2   . VAL C 2  322  ? 464.652 -39.670 651.282 1.00 117.88 ? 322  VAL C CG2   1 
ATOM   6079  N  N     . ASP C 2  323  ? 468.211 -39.196 653.679 1.00 117.33 ? 323  ASP C N     1 
ATOM   6080  C  CA    . ASP C 2  323  ? 469.177 -38.664 654.633 1.00 114.57 ? 323  ASP C CA    1 
ATOM   6081  C  C     . ASP C 2  323  ? 468.774 -37.260 655.072 1.00 114.29 ? 323  ASP C C     1 
ATOM   6082  O  O     . ASP C 2  323  ? 468.355 -36.432 654.249 1.00 113.02 ? 323  ASP C O     1 
ATOM   6083  C  CB    . ASP C 2  323  ? 470.590 -38.648 654.055 1.00 110.50 ? 323  ASP C CB    1 
ATOM   6084  C  CG    . ASP C 2  323  ? 471.094 -40.027 653.759 1.00 117.12 ? 323  ASP C CG    1 
ATOM   6085  O  OD1   . ASP C 2  323  ? 471.352 -40.772 654.733 1.00 119.40 ? 323  ASP C OD1   1 
ATOM   6086  O  OD2   . ASP C 2  323  ? 471.218 -40.361 652.558 1.00 120.72 ? 323  ASP C OD2   1 
ATOM   6087  N  N     . ASP C 2  324  ? 468.843 -37.033 656.380 1.00 107.87 ? 324  ASP C N     1 
ATOM   6088  C  CA    . ASP C 2  324  ? 468.622 -35.734 656.993 1.00 100.06 ? 324  ASP C CA    1 
ATOM   6089  C  C     . ASP C 2  324  ? 469.944 -34.971 656.920 1.00 101.26 ? 324  ASP C C     1 
ATOM   6090  O  O     . ASP C 2  324  ? 470.954 -35.438 657.461 1.00 101.73 ? 324  ASP C O     1 
ATOM   6091  C  CB    . ASP C 2  324  ? 468.126 -35.905 658.432 1.00 102.98 ? 324  ASP C CB    1 
ATOM   6092  C  CG    . ASP C 2  324  ? 467.709 -34.580 659.086 1.00 103.39 ? 324  ASP C CG    1 
ATOM   6093  O  OD1   . ASP C 2  324  ? 468.496 -34.042 659.902 1.00 97.86  ? 324  ASP C OD1   1 
ATOM   6094  O  OD2   . ASP C 2  324  ? 466.580 -34.095 658.804 1.00 101.05 ? 324  ASP C OD2   1 
ATOM   6095  N  N     . ILE C 2  325  ? 469.974 -33.838 656.206 1.00 100.23 ? 325  ILE C N     1 
ATOM   6096  C  CA    . ILE C 2  325  ? 471.256 -33.191 655.909 1.00 99.69  ? 325  ILE C CA    1 
ATOM   6097  C  C     . ILE C 2  325  ? 471.783 -32.339 657.056 1.00 95.01  ? 325  ILE C C     1 
ATOM   6098  O  O     . ILE C 2  325  ? 472.960 -31.957 657.027 1.00 95.23  ? 325  ILE C O     1 
ATOM   6099  C  CB    . ILE C 2  325  ? 471.256 -32.208 654.715 1.00 102.38 ? 325  ILE C CB    1 
ATOM   6100  C  CG1   . ILE C 2  325  ? 470.608 -30.869 655.092 1.00 101.46 ? 325  ILE C CG1   1 
ATOM   6101  C  CG2   . ILE C 2  325  ? 470.508 -32.783 653.522 1.00 100.15 ? 325  ILE C CG2   1 
ATOM   6102  C  CD1   . ILE C 2  325  ? 470.852 -29.760 654.070 1.00 99.18  ? 325  ILE C CD1   1 
ATOM   6103  N  N     . ASP C 2  326  ? 470.983 -32.077 658.093 1.00 94.08  ? 326  ASP C N     1 
ATOM   6104  C  CA    . ASP C 2  326  ? 471.451 -31.332 659.256 1.00 93.03  ? 326  ASP C CA    1 
ATOM   6105  C  C     . ASP C 2  326  ? 471.892 -32.218 660.408 1.00 88.48  ? 326  ASP C C     1 
ATOM   6106  O  O     . ASP C 2  326  ? 472.415 -31.697 661.408 1.00 81.21  ? 326  ASP C O     1 
ATOM   6107  C  CB    . ASP C 2  326  ? 470.322 -30.420 659.752 1.00 94.89  ? 326  ASP C CB    1 
ATOM   6108  C  CG    . ASP C 2  326  ? 469.926 -29.373 658.730 1.00 99.89  ? 326  ASP C CG    1 
ATOM   6109  O  OD1   . ASP C 2  326  ? 470.761 -28.486 658.443 1.00 101.15 ? 326  ASP C OD1   1 
ATOM   6110  O  OD2   . ASP C 2  326  ? 468.794 -29.460 658.192 1.00 98.39  ? 326  ASP C OD2   1 
ATOM   6111  N  N     . HIS C 2  327  ? 471.750 -33.537 660.261 1.00 87.34  ? 327  HIS C N     1 
ATOM   6112  C  CA    . HIS C 2  327  ? 472.263 -34.492 661.238 1.00 85.62  ? 327  HIS C CA    1 
ATOM   6113  C  C     . HIS C 2  327  ? 473.764 -34.328 661.378 1.00 79.46  ? 327  HIS C C     1 
ATOM   6114  O  O     . HIS C 2  327  ? 474.474 -34.224 660.379 1.00 90.14  ? 327  HIS C O     1 
ATOM   6115  C  CB    . HIS C 2  327  ? 471.934 -35.912 660.769 1.00 88.88  ? 327  HIS C CB    1 
ATOM   6116  C  CG    . HIS C 2  327  ? 472.086 -36.980 661.817 1.00 91.26  ? 327  HIS C CG    1 
ATOM   6117  N  ND1   . HIS C 2  327  ? 473.305 -37.519 662.175 1.00 90.41  ? 327  HIS C ND1   1 
ATOM   6118  C  CD2   . HIS C 2  327  ? 471.150 -37.669 662.519 1.00 86.91  ? 327  HIS C CD2   1 
ATOM   6119  C  CE1   . HIS C 2  327  ? 473.116 -38.464 663.083 1.00 89.97  ? 327  HIS C CE1   1 
ATOM   6120  N  NE2   . HIS C 2  327  ? 471.819 -38.577 663.306 1.00 91.56  ? 327  HIS C NE2   1 
ATOM   6121  N  N     . LEU C 2  328  ? 474.265 -34.382 662.607 1.00 78.16  ? 328  LEU C N     1 
ATOM   6122  C  CA    . LEU C 2  328  ? 475.677 -34.079 662.827 1.00 80.58  ? 328  LEU C CA    1 
ATOM   6123  C  C     . LEU C 2  328  ? 476.588 -35.250 662.454 1.00 83.01  ? 328  LEU C C     1 
ATOM   6124  O  O     . LEU C 2  328  ? 477.800 -35.169 662.709 1.00 78.62  ? 328  LEU C O     1 
ATOM   6125  C  CB    . LEU C 2  328  ? 475.926 -33.678 664.285 1.00 79.31  ? 328  LEU C CB    1 
ATOM   6126  C  CG    . LEU C 2  328  ? 475.672 -32.251 664.765 1.00 75.99  ? 328  LEU C CG    1 
ATOM   6127  C  CD1   . LEU C 2  328  ? 476.235 -32.122 666.143 1.00 78.90  ? 328  LEU C CD1   1 
ATOM   6128  C  CD2   . LEU C 2  328  ? 476.296 -31.218 663.871 1.00 69.37  ? 328  LEU C CD2   1 
ATOM   6129  N  N     . GLY C 2  329  ? 476.004 -36.363 661.970 1.00 85.84  ? 329  GLY C N     1 
ATOM   6130  C  CA    . GLY C 2  329  ? 476.766 -37.420 661.311 1.00 90.64  ? 329  GLY C CA    1 
ATOM   6131  C  C     . GLY C 2  329  ? 477.088 -37.126 659.851 1.00 92.34  ? 329  GLY C C     1 
ATOM   6132  O  O     . GLY C 2  329  ? 478.100 -37.619 659.325 1.00 88.29  ? 329  GLY C O     1 
ATOM   6133  N  N     . ASN C 2  330  ? 476.209 -36.372 659.170 1.00 86.30  ? 330  ASN C N     1 
ATOM   6134  C  CA    . ASN C 2  330  ? 476.373 -35.969 657.778 1.00 84.03  ? 330  ASN C CA    1 
ATOM   6135  C  C     . ASN C 2  330  ? 476.920 -34.546 657.669 1.00 85.71  ? 330  ASN C C     1 
ATOM   6136  O  O     . ASN C 2  330  ? 477.036 -34.012 656.564 1.00 89.79  ? 330  ASN C O     1 
ATOM   6137  C  CB    . ASN C 2  330  ? 475.053 -36.089 656.997 1.00 84.89  ? 330  ASN C CB    1 
ATOM   6138  C  CG    . ASN C 2  330  ? 474.400 -37.470 657.129 1.00 94.43  ? 330  ASN C CG    1 
ATOM   6139  O  OD1   . ASN C 2  330  ? 475.081 -38.498 657.128 1.00 97.59  ? 330  ASN C OD1   1 
ATOM   6140  N  ND2   . ASN C 2  330  ? 473.066 -37.498 657.143 1.00 98.77  ? 330  ASN C ND2   1 
ATOM   6141  N  N     . ARG C 2  331  ? 477.245 -33.921 658.796 1.00 83.29  ? 331  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2  331  ? 477.812 -32.584 658.862 1.00 77.49  ? 331  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2  331  ? 479.124 -32.668 659.624 1.00 74.87  ? 331  ARG C C     1 
ATOM   6144  O  O     . ARG C 2  331  ? 479.177 -33.246 660.710 1.00 85.94  ? 331  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2  331  ? 476.907 -31.591 659.577 1.00 73.89  ? 331  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2  331  ? 476.621 -30.401 658.742 1.00 80.90  ? 331  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2  331  ? 475.340 -29.689 659.071 1.00 79.42  ? 331  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2  331  ? 475.669 -28.663 660.064 1.00 81.07  ? 331  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2  331  ? 475.003 -27.522 660.225 1.00 87.49  ? 331  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2  331  ? 475.375 -26.653 661.161 1.00 87.90  ? 331  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2  331  ? 473.964 -27.249 659.452 1.00 87.76  ? 331  ARG C NH2   1 
ATOM   6152  N  N     . ARG C 2  332  ? 480.171 -32.106 659.072 1.00 69.85  ? 332  ARG C N     1 
ATOM   6153  C  CA    . ARG C 2  332  ? 481.500 -32.256 659.630 1.00 74.89  ? 332  ARG C CA    1 
ATOM   6154  C  C     . ARG C 2  332  ? 482.142 -30.884 659.812 1.00 79.08  ? 332  ARG C C     1 
ATOM   6155  O  O     . ARG C 2  332  ? 481.655 -29.872 659.298 1.00 79.51  ? 332  ARG C O     1 
ATOM   6156  C  CB    . ARG C 2  332  ? 482.348 -33.193 658.745 1.00 83.07  ? 332  ARG C CB    1 
ATOM   6157  C  CG    . ARG C 2  332  ? 482.694 -32.621 657.364 1.00 83.89  ? 332  ARG C CG    1 
ATOM   6158  C  CD    . ARG C 2  332  ? 483.505 -33.578 656.553 1.00 78.19  ? 332  ARG C CD    1 
ATOM   6159  N  NE    . ARG C 2  332  ? 484.819 -33.695 657.166 1.00 80.99  ? 332  ARG C NE    1 
ATOM   6160  C  CZ    . ARG C 2  332  ? 485.848 -32.915 656.846 1.00 79.20  ? 332  ARG C CZ    1 
ATOM   6161  N  NH1   . ARG C 2  332  ? 485.688 -31.963 655.925 1.00 75.43  ? 332  ARG C NH1   1 
ATOM   6162  N  NH2   . ARG C 2  332  ? 487.023 -33.071 657.458 1.00 69.45  ? 332  ARG C NH2   1 
ATOM   6163  N  N     . ILE C 2  333  ? 483.186 -30.855 660.644 1.00 79.59  ? 333  ILE C N     1 
ATOM   6164  C  CA    . ILE C 2  333  ? 483.924 -29.643 660.995 1.00 76.21  ? 333  ILE C CA    1 
ATOM   6165  C  C     . ILE C 2  333  ? 485.218 -29.560 660.205 1.00 83.35  ? 333  ILE C C     1 
ATOM   6166  O  O     . ILE C 2  333  ? 486.000 -30.517 660.219 1.00 85.25  ? 333  ILE C O     1 
ATOM   6167  C  CB    . ILE C 2  333  ? 484.259 -29.611 662.485 1.00 78.04  ? 333  ILE C CB    1 
ATOM   6168  C  CG1   . ILE C 2  333  ? 483.009 -29.885 663.339 1.00 81.76  ? 333  ILE C CG1   1 
ATOM   6169  C  CG2   . ILE C 2  333  ? 484.961 -28.287 662.769 1.00 76.79  ? 333  ILE C CG2   1 
ATOM   6170  C  CD1   . ILE C 2  333  ? 481.887 -28.890 663.152 1.00 79.96  ? 333  ILE C CD1   1 
ATOM   6171  N  N     . ARG C 2  334  ? 485.514 -28.376 659.624 1.00 82.67  ? 334  ARG C N     1 
ATOM   6172  C  CA    . ARG C 2  334  ? 486.808 -28.114 658.987 1.00 76.46  ? 334  ARG C CA    1 
ATOM   6173  C  C     . ARG C 2  334  ? 487.689 -27.286 659.933 1.00 72.68  ? 334  ARG C C     1 
ATOM   6174  O  O     . ARG C 2  334  ? 487.591 -26.056 659.943 1.00 71.50  ? 334  ARG C O     1 
ATOM   6175  C  CB    . ARG C 2  334  ? 486.642 -27.345 657.670 1.00 79.72  ? 334  ARG C CB    1 
ATOM   6176  C  CG    . ARG C 2  334  ? 485.757 -27.905 656.542 1.00 81.66  ? 334  ARG C CG    1 
ATOM   6177  C  CD    . ARG C 2  334  ? 486.575 -27.752 655.233 1.00 85.22  ? 334  ARG C CD    1 
ATOM   6178  N  NE    . ARG C 2  334  ? 486.681 -26.405 654.669 1.00 88.57  ? 334  ARG C NE    1 
ATOM   6179  C  CZ    . ARG C 2  334  ? 486.996 -26.160 653.393 1.00 94.57  ? 334  ARG C CZ    1 
ATOM   6180  N  NH1   . ARG C 2  334  ? 487.233 -27.177 652.572 1.00 86.94  ? 334  ARG C NH1   1 
ATOM   6181  N  NH2   . ARG C 2  334  ? 487.085 -24.907 652.931 1.00 94.97  ? 334  ARG C NH2   1 
ATOM   6182  N  N     . THR C 2  335  ? 488.705 -27.927 660.530 1.00 65.66  ? 335  THR C N     1 
ATOM   6183  C  CA    . THR C 2  335  ? 489.553 -27.322 661.553 1.00 69.16  ? 335  THR C CA    1 
ATOM   6184  C  C     . THR C 2  335  ? 490.724 -26.532 660.955 1.00 69.62  ? 335  THR C C     1 
ATOM   6185  O  O     . THR C 2  335  ? 490.803 -26.359 659.744 1.00 78.88  ? 335  THR C O     1 
ATOM   6186  C  CB    . THR C 2  335  ? 489.980 -28.414 662.534 1.00 75.55  ? 335  THR C CB    1 
ATOM   6187  O  OG1   . THR C 2  335  ? 490.313 -29.612 661.823 1.00 64.45  ? 335  THR C OG1   1 
ATOM   6188  C  CG2   . THR C 2  335  ? 488.874 -28.694 663.547 1.00 81.85  ? 335  THR C CG2   1 
ATOM   6189  N  N     . VAL C 2  336  ? 491.554 -25.911 661.813 1.00 68.54  ? 336  VAL C N     1 
ATOM   6190  C  CA    . VAL C 2  336  ? 492.652 -25.040 661.347 1.00 67.80  ? 336  VAL C CA    1 
ATOM   6191  C  C     . VAL C 2  336  ? 493.517 -25.705 660.291 1.00 80.14  ? 336  VAL C C     1 
ATOM   6192  O  O     . VAL C 2  336  ? 493.810 -25.119 659.239 1.00 85.07  ? 336  VAL C O     1 
ATOM   6193  C  CB    . VAL C 2  336  ? 493.550 -24.590 662.505 1.00 71.13  ? 336  VAL C CB    1 
ATOM   6194  C  CG1   . VAL C 2  336  ? 494.176 -23.273 662.134 1.00 63.68  ? 336  VAL C CG1   1 
ATOM   6195  C  CG2   . VAL C 2  336  ? 492.804 -24.572 663.843 1.00 81.01  ? 336  VAL C CG2   1 
ATOM   6196  N  N     . GLY C 2  337  ? 494.003 -26.912 660.585 1.00 82.12  ? 337  GLY C N     1 
ATOM   6197  C  CA    . GLY C 2  337  ? 494.885 -27.586 659.641 1.00 83.12  ? 337  GLY C CA    1 
ATOM   6198  C  C     . GLY C 2  337  ? 494.247 -27.723 658.274 1.00 80.06  ? 337  GLY C C     1 
ATOM   6199  O  O     . GLY C 2  337  ? 494.858 -27.415 657.249 1.00 79.43  ? 337  GLY C O     1 
ATOM   6200  N  N     . GLU C 2  338  ? 492.995 -28.175 658.249 1.00 77.93  ? 338  GLU C N     1 
ATOM   6201  C  CA    . GLU C 2  338  ? 492.307 -28.374 656.986 1.00 78.12  ? 338  GLU C CA    1 
ATOM   6202  C  C     . GLU C 2  338  ? 492.110 -27.048 656.238 1.00 80.28  ? 338  GLU C C     1 
ATOM   6203  O  O     . GLU C 2  338  ? 492.286 -26.990 655.013 1.00 81.98  ? 338  GLU C O     1 
ATOM   6204  C  CB    . GLU C 2  338  ? 490.991 -29.091 657.242 1.00 68.91  ? 338  GLU C CB    1 
ATOM   6205  C  CG    . GLU C 2  338  ? 490.245 -29.310 655.982 1.00 78.96  ? 338  GLU C CG    1 
ATOM   6206  C  CD    . GLU C 2  338  ? 489.104 -30.272 656.139 1.00 85.20  ? 338  GLU C CD    1 
ATOM   6207  O  OE1   . GLU C 2  338  ? 489.047 -30.997 657.175 1.00 75.36  ? 338  GLU C OE1   1 
ATOM   6208  O  OE2   . GLU C 2  338  ? 488.295 -30.333 655.178 1.00 93.78  ? 338  GLU C OE2   1 
ATOM   6209  N  N     . LEU C 2  339  ? 491.716 -25.976 656.943 1.00 78.85  ? 339  LEU C N     1 
ATOM   6210  C  CA    . LEU C 2  339  ? 491.510 -24.695 656.259 1.00 80.75  ? 339  LEU C CA    1 
ATOM   6211  C  C     . LEU C 2  339  ? 492.804 -24.197 655.665 1.00 78.82  ? 339  LEU C C     1 
ATOM   6212  O  O     . LEU C 2  339  ? 492.830 -23.757 654.513 1.00 80.26  ? 339  LEU C O     1 
ATOM   6213  C  CB    . LEU C 2  339  ? 490.917 -23.621 657.169 1.00 78.78  ? 339  LEU C CB    1 
ATOM   6214  C  CG    . LEU C 2  339  ? 489.595 -23.946 657.843 1.00 81.60  ? 339  LEU C CG    1 
ATOM   6215  C  CD1   . LEU C 2  339  ? 489.264 -22.906 658.897 1.00 71.00  ? 339  LEU C CD1   1 
ATOM   6216  C  CD2   . LEU C 2  339  ? 488.533 -23.989 656.724 1.00 76.59  ? 339  LEU C CD2   1 
ATOM   6217  N  N     . MET C 2  340  ? 493.852 -24.131 656.484 1.00 78.37  ? 340  MET C N     1 
ATOM   6218  C  CA    . MET C 2  340  ? 495.175 -23.758 655.987 1.00 85.66  ? 340  MET C CA    1 
ATOM   6219  C  C     . MET C 2  340  ? 495.640 -24.676 654.839 1.00 88.45  ? 340  MET C C     1 
ATOM   6220  O  O     . MET C 2  340  ? 496.211 -24.202 653.840 1.00 87.09  ? 340  MET C O     1 
ATOM   6221  C  CB    . MET C 2  340  ? 496.193 -23.771 657.130 1.00 86.87  ? 340  MET C CB    1 
ATOM   6222  C  CG    . MET C 2  340  ? 497.608 -23.415 656.649 1.00 89.72  ? 340  MET C CG    1 
ATOM   6223  S  SD    . MET C 2  340  ? 498.533 -24.830 655.975 1.00 84.51  ? 340  MET C SD    1 
ATOM   6224  C  CE    . MET C 2  340  ? 500.215 -24.391 656.469 1.00 81.25  ? 340  MET C CE    1 
ATOM   6225  N  N     . THR C 2  341  ? 495.469 -26.004 654.988 1.00 87.38  ? 341  THR C N     1 
ATOM   6226  C  CA    . THR C 2  341  ? 495.909 -26.913 653.925 1.00 83.16  ? 341  THR C CA    1 
ATOM   6227  C  C     . THR C 2  341  ? 495.190 -26.653 652.606 1.00 78.38  ? 341  THR C C     1 
ATOM   6228  O  O     . THR C 2  341  ? 495.830 -26.644 651.561 1.00 83.52  ? 341  THR C O     1 
ATOM   6229  C  CB    . THR C 2  341  ? 495.709 -28.366 654.344 1.00 84.60  ? 341  THR C CB    1 
ATOM   6230  O  OG1   . THR C 2  341  ? 496.567 -28.665 655.451 1.00 86.41  ? 341  THR C OG1   1 
ATOM   6231  C  CG2   . THR C 2  341  ? 496.034 -29.293 653.184 1.00 87.21  ? 341  THR C CG2   1 
ATOM   6232  N  N     . ASP C 2  342  ? 493.901 -26.322 652.634 1.00 78.60  ? 342  ASP C N     1 
ATOM   6233  C  CA    . ASP C 2  342  ? 493.225 -25.962 651.391 1.00 80.79  ? 342  ASP C CA    1 
ATOM   6234  C  C     . ASP C 2  342  ? 493.900 -24.763 650.736 1.00 82.52  ? 342  ASP C C     1 
ATOM   6235  O  O     . ASP C 2  342  ? 494.061 -24.726 649.511 1.00 90.66  ? 342  ASP C O     1 
ATOM   6236  C  CB    . ASP C 2  342  ? 491.730 -25.734 651.581 1.00 87.79  ? 342  ASP C CB    1 
ATOM   6237  C  CG    . ASP C 2  342  ? 490.905 -26.785 650.846 1.00 90.86  ? 342  ASP C CG    1 
ATOM   6238  O  OD1   . ASP C 2  342  ? 491.210 -27.992 651.023 1.00 92.36  ? 342  ASP C OD1   1 
ATOM   6239  O  OD2   . ASP C 2  342  ? 490.016 -26.409 650.042 1.00 86.39  ? 342  ASP C OD2   1 
ATOM   6240  N  N     . GLN C 2  343  ? 494.166 -23.711 651.502 1.00 77.30  ? 343  GLN C N     1 
ATOM   6241  C  CA    . GLN C 2  343  ? 494.873 -22.580 650.915 1.00 79.32  ? 343  GLN C CA    1 
ATOM   6242  C  C     . GLN C 2  343  ? 496.282 -22.961 650.503 1.00 87.07  ? 343  GLN C C     1 
ATOM   6243  O  O     . GLN C 2  343  ? 496.816 -22.411 649.529 1.00 90.26  ? 343  GLN C O     1 
ATOM   6244  C  CB    . GLN C 2  343  ? 494.932 -21.405 651.868 1.00 81.20  ? 343  GLN C CB    1 
ATOM   6245  C  CG    . GLN C 2  343  ? 493.641 -20.667 651.983 1.00 87.35  ? 343  GLN C CG    1 
ATOM   6246  C  CD    . GLN C 2  343  ? 493.009 -20.467 650.642 1.00 89.93  ? 343  GLN C CD    1 
ATOM   6247  O  OE1   . GLN C 2  343  ? 492.182 -21.274 650.203 1.00 94.44  ? 343  GLN C OE1   1 
ATOM   6248  N  NE2   . GLN C 2  343  ? 493.434 -19.412 649.946 1.00 85.91  ? 343  GLN C NE2   1 
ATOM   6249  N  N     . PHE C 2  344  ? 496.932 -23.844 651.267 1.00 84.15  ? 344  PHE C N     1 
ATOM   6250  C  CA    . PHE C 2  344  ? 498.261 -24.314 650.867 1.00 88.46  ? 344  PHE C CA    1 
ATOM   6251  C  C     . PHE C 2  344  ? 498.204 -25.027 649.511 1.00 87.52  ? 344  PHE C C     1 
ATOM   6252  O  O     . PHE C 2  344  ? 499.061 -24.810 648.649 1.00 86.52  ? 344  PHE C O     1 
ATOM   6253  C  CB    . PHE C 2  344  ? 498.850 -25.232 651.935 1.00 86.43  ? 344  PHE C CB    1 
ATOM   6254  C  CG    . PHE C 2  344  ? 500.315 -25.533 651.745 1.00 85.93  ? 344  PHE C CG    1 
ATOM   6255  C  CD1   . PHE C 2  344  ? 500.749 -26.636 651.027 1.00 90.18  ? 344  PHE C CD1   1 
ATOM   6256  C  CD2   . PHE C 2  344  ? 501.266 -24.721 652.376 1.00 82.40  ? 344  PHE C CD2   1 
ATOM   6257  C  CE1   . PHE C 2  344  ? 502.118 -26.897 650.902 1.00 93.58  ? 344  PHE C CE1   1 
ATOM   6258  C  CE2   . PHE C 2  344  ? 502.628 -24.971 652.262 1.00 85.39  ? 344  PHE C CE2   1 
ATOM   6259  C  CZ    . PHE C 2  344  ? 503.062 -26.060 651.528 1.00 89.73  ? 344  PHE C CZ    1 
ATOM   6260  N  N     . ARG C 2  345  ? 497.206 -25.902 649.325 1.00 87.72  ? 345  ARG C N     1 
ATOM   6261  C  CA    . ARG C 2  345  ? 497.044 -26.655 648.083 1.00 82.01  ? 345  ARG C CA    1 
ATOM   6262  C  C     . ARG C 2  345  ? 496.830 -25.732 646.892 1.00 85.14  ? 345  ARG C C     1 
ATOM   6263  O  O     . ARG C 2  345  ? 497.370 -25.974 645.804 1.00 84.42  ? 345  ARG C O     1 
ATOM   6264  C  CB    . ARG C 2  345  ? 495.868 -27.614 648.238 1.00 79.90  ? 345  ARG C CB    1 
ATOM   6265  C  CG    . ARG C 2  345  ? 495.446 -28.341 647.010 1.00 86.94  ? 345  ARG C CG    1 
ATOM   6266  C  CD    . ARG C 2  345  ? 494.436 -29.436 647.348 1.00 101.89 ? 345  ARG C CD    1 
ATOM   6267  N  NE    . ARG C 2  345  ? 494.943 -30.468 648.269 1.00 107.92 ? 345  ARG C NE    1 
ATOM   6268  C  CZ    . ARG C 2  345  ? 494.615 -30.596 649.560 1.00 104.90 ? 345  ARG C CZ    1 
ATOM   6269  N  NH1   . ARG C 2  345  ? 493.754 -29.757 650.133 1.00 104.06 ? 345  ARG C NH1   1 
ATOM   6270  N  NH2   . ARG C 2  345  ? 495.145 -31.582 650.289 1.00 100.20 ? 345  ARG C NH2   1 
ATOM   6271  N  N     . VAL C 2  346  ? 496.043 -24.672 647.068 1.00 87.33  ? 346  VAL C N     1 
ATOM   6272  C  CA    . VAL C 2  346  ? 495.878 -23.695 645.992 1.00 90.27  ? 346  VAL C CA    1 
ATOM   6273  C  C     . VAL C 2  346  ? 497.221 -23.041 645.650 1.00 91.53  ? 346  VAL C C     1 
ATOM   6274  O  O     . VAL C 2  346  ? 497.615 -22.970 644.481 1.00 97.29  ? 346  VAL C O     1 
ATOM   6275  C  CB    . VAL C 2  346  ? 494.801 -22.653 646.350 1.00 86.53  ? 346  VAL C CB    1 
ATOM   6276  C  CG1   . VAL C 2  346  ? 494.920 -21.451 645.424 1.00 86.64  ? 346  VAL C CG1   1 
ATOM   6277  C  CG2   . VAL C 2  346  ? 493.409 -23.269 646.238 1.00 85.00  ? 346  VAL C CG2   1 
ATOM   6278  N  N     . GLY C 2  347  ? 497.925 -22.516 646.660 1.00 89.49  ? 347  GLY C N     1 
ATOM   6279  C  CA    . GLY C 2  347  ? 499.233 -21.913 646.417 1.00 87.07  ? 347  GLY C CA    1 
ATOM   6280  C  C     . GLY C 2  347  ? 500.249 -22.828 645.752 1.00 92.62  ? 347  GLY C C     1 
ATOM   6281  O  O     . GLY C 2  347  ? 501.113 -22.353 645.013 1.00 97.58  ? 347  GLY C O     1 
ATOM   6282  N  N     . LEU C 2  348  ? 500.202 -24.138 646.042 1.00 92.42  ? 348  LEU C N     1 
ATOM   6283  C  CA    . LEU C 2  348  ? 501.133 -25.081 645.411 1.00 90.96  ? 348  LEU C CA    1 
ATOM   6284  C  C     . LEU C 2  348  ? 500.825 -25.274 643.932 1.00 94.53  ? 348  LEU C C     1 
ATOM   6285  O  O     . LEU C 2  348  ? 501.734 -25.304 643.092 1.00 89.65  ? 348  LEU C O     1 
ATOM   6286  C  CB    . LEU C 2  348  ? 501.069 -26.443 646.094 1.00 86.62  ? 348  LEU C CB    1 
ATOM   6287  C  CG    . LEU C 2  348  ? 502.402 -27.103 646.414 1.00 85.82  ? 348  LEU C CG    1 
ATOM   6288  C  CD1   . LEU C 2  348  ? 503.298 -26.096 647.153 1.00 82.25  ? 348  LEU C CD1   1 
ATOM   6289  C  CD2   . LEU C 2  348  ? 502.222 -28.423 647.173 1.00 90.96  ? 348  LEU C CD2   1 
ATOM   6290  N  N     . ALA C 2  349  ? 499.540 -25.432 643.611 1.00 97.25  ? 349  ALA C N     1 
ATOM   6291  C  CA    . ALA C 2  349  ? 499.105 -25.566 642.225 1.00 99.59  ? 349  ALA C CA    1 
ATOM   6292  C  C     . ALA C 2  349  ? 499.452 -24.331 641.395 1.00 98.38  ? 349  ALA C C     1 
ATOM   6293  O  O     . ALA C 2  349  ? 499.775 -24.461 640.207 1.00 102.69 ? 349  ALA C O     1 
ATOM   6294  C  CB    . ALA C 2  349  ? 497.610 -25.883 642.169 1.00 93.21  ? 349  ALA C CB    1 
ATOM   6295  N  N     . ARG C 2  350  ? 499.342 -23.124 641.973 1.00 89.34  ? 350  ARG C N     1 
ATOM   6296  C  CA    . ARG C 2  350  ? 499.741 -21.921 641.233 1.00 100.05 ? 350  ARG C CA    1 
ATOM   6297  C  C     . ARG C 2  350  ? 501.236 -21.917 640.892 1.00 104.54 ? 350  ARG C C     1 
ATOM   6298  O  O     . ARG C 2  350  ? 501.624 -21.585 639.760 1.00 100.24 ? 350  ARG C O     1 
ATOM   6299  C  CB    . ARG C 2  350  ? 499.381 -20.664 642.021 1.00 97.68  ? 350  ARG C CB    1 
ATOM   6300  C  CG    . ARG C 2  350  ? 497.898 -20.487 642.268 1.00 101.31 ? 350  ARG C CG    1 
ATOM   6301  C  CD    . ARG C 2  350  ? 497.423 -19.066 641.918 1.00 101.03 ? 350  ARG C CD    1 
ATOM   6302  N  NE    . ARG C 2  350  ? 495.982 -18.928 642.140 1.00 107.18 ? 350  ARG C NE    1 
ATOM   6303  C  CZ    . ARG C 2  350  ? 495.416 -18.700 643.331 1.00 105.24 ? 350  ARG C CZ    1 
ATOM   6304  N  NH1   . ARG C 2  350  ? 496.160 -18.592 644.440 1.00 90.97  ? 350  ARG C NH1   1 
ATOM   6305  N  NH2   . ARG C 2  350  ? 494.092 -18.590 643.412 1.00 99.00  ? 350  ARG C NH2   1 
ATOM   6306  N  N     . LEU C 2  351  ? 502.093 -22.248 641.868 1.00 100.26 ? 351  LEU C N     1 
ATOM   6307  C  CA    . LEU C 2  351  ? 503.533 -22.396 641.615 1.00 100.28 ? 351  LEU C CA    1 
ATOM   6308  C  C     . LEU C 2  351  ? 503.819 -23.377 640.470 1.00 100.76 ? 351  LEU C C     1 
ATOM   6309  O  O     . LEU C 2  351  ? 504.800 -23.207 639.736 1.00 102.77 ? 351  LEU C O     1 
ATOM   6310  C  CB    . LEU C 2  351  ? 504.258 -22.756 642.922 1.00 98.95  ? 351  LEU C CB    1 
ATOM   6311  C  CG    . LEU C 2  351  ? 505.755 -23.050 643.063 1.00 91.53  ? 351  LEU C CG    1 
ATOM   6312  C  CD1   . LEU C 2  351  ? 506.289 -22.451 644.366 1.00 92.70  ? 351  LEU C CD1   1 
ATOM   6313  C  CD2   . LEU C 2  351  ? 505.934 -24.530 643.132 1.00 88.06  ? 351  LEU C CD2   1 
ATOM   6314  N  N     . ALA C 2  352  ? 503.012 -24.445 640.353 1.00 101.97 ? 352  ALA C N     1 
ATOM   6315  C  CA    . ALA C 2  352  ? 503.153 -25.422 639.267 1.00 100.66 ? 352  ALA C CA    1 
ATOM   6316  C  C     . ALA C 2  352  ? 502.892 -24.786 637.898 1.00 108.00 ? 352  ALA C C     1 
ATOM   6317  O  O     . ALA C 2  352  ? 503.517 -25.174 636.904 1.00 110.83 ? 352  ALA C O     1 
ATOM   6318  C  CB    . ALA C 2  352  ? 502.230 -26.619 639.495 1.00 100.77 ? 352  ALA C CB    1 
ATOM   6319  N  N     . ARG C 2  353  ? 501.918 -23.871 637.802 1.00 105.37 ? 353  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  353  ? 501.733 -23.136 636.549 1.00 107.53 ? 353  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  353  ? 503.047 -22.472 636.106 1.00 111.45 ? 353  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  353  ? 503.412 -22.512 634.922 1.00 115.32 ? 353  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  353  ? 500.618 -22.086 636.692 1.00 107.11 ? 353  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  353  ? 500.340 -21.348 635.371 1.00 116.62 ? 353  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  353  ? 500.453 -19.806 635.474 1.00 115.84 ? 353  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  353  ? 500.556 -19.185 634.144 1.00 122.68 ? 353  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  353  ? 500.545 -17.873 633.912 1.00 121.10 ? 353  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  353  ? 500.429 -17.028 634.934 1.00 121.39 ? 353  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  353  ? 500.660 -17.405 632.663 1.00 105.47 ? 353  ARG C NH2   1 
ATOM   6330  N  N     . GLY C 2  354  ? 503.744 -21.815 637.045 1.00 110.52 ? 354  GLY C N     1 
ATOM   6331  C  CA    . GLY C 2  354  ? 505.050 -21.227 636.751 1.00 111.18 ? 354  GLY C CA    1 
ATOM   6332  C  C     . GLY C 2  354  ? 506.093 -22.237 636.287 1.00 115.40 ? 354  GLY C C     1 
ATOM   6333  O  O     . GLY C 2  354  ? 506.958 -21.912 635.467 1.00 118.38 ? 354  GLY C O     1 
ATOM   6334  N  N     . VAL C 2  355  ? 506.113 -23.423 636.910 1.00 111.12 ? 355  VAL C N     1 
ATOM   6335  C  CA    . VAL C 2  355  ? 507.022 -24.497 636.503 1.00 108.81 ? 355  VAL C CA    1 
ATOM   6336  C  C     . VAL C 2  355  ? 506.758 -24.973 635.069 1.00 116.41 ? 355  VAL C C     1 
ATOM   6337  O  O     . VAL C 2  355  ? 507.670 -24.971 634.229 1.00 122.11 ? 355  VAL C O     1 
ATOM   6338  C  CB    . VAL C 2  355  ? 506.934 -25.657 637.512 1.00 105.02 ? 355  VAL C CB    1 
ATOM   6339  C  CG1   . VAL C 2  355  ? 507.463 -26.938 636.928 1.00 105.61 ? 355  VAL C CG1   1 
ATOM   6340  C  CG2   . VAL C 2  355  ? 507.751 -25.309 638.738 1.00 104.34 ? 355  VAL C CG2   1 
ATOM   6341  N  N     . ARG C 2  356  ? 505.513 -25.372 634.754 1.00 112.93 ? 356  ARG C N     1 
ATOM   6342  C  CA    . ARG C 2  356  ? 505.206 -25.839 633.393 1.00 114.07 ? 356  ARG C CA    1 
ATOM   6343  C  C     . ARG C 2  356  ? 505.484 -24.775 632.339 1.00 118.38 ? 356  ARG C C     1 
ATOM   6344  O  O     . ARG C 2  356  ? 506.034 -25.084 631.273 1.00 121.55 ? 356  ARG C O     1 
ATOM   6345  C  CB    . ARG C 2  356  ? 503.763 -26.335 633.282 1.00 110.80 ? 356  ARG C CB    1 
ATOM   6346  C  CG    . ARG C 2  356  ? 503.380 -27.306 634.385 1.00 116.34 ? 356  ARG C CG    1 
ATOM   6347  C  CD    . ARG C 2  356  ? 501.949 -27.820 634.267 1.00 114.23 ? 356  ARG C CD    1 
ATOM   6348  N  NE    . ARG C 2  356  ? 501.597 -28.600 635.456 1.00 116.72 ? 356  ARG C NE    1 
ATOM   6349  C  CZ    . ARG C 2  356  ? 500.938 -28.093 636.510 1.00 115.72 ? 356  ARG C CZ    1 
ATOM   6350  N  NH1   . ARG C 2  356  ? 500.558 -26.815 636.511 1.00 109.37 ? 356  ARG C NH1   1 
ATOM   6351  N  NH2   . ARG C 2  356  ? 500.657 -28.855 637.572 1.00 113.99 ? 356  ARG C NH2   1 
ATOM   6352  N  N     . GLU C 2  357  ? 505.156 -23.509 632.629 1.00 118.73 ? 357  GLU C N     1 
ATOM   6353  C  CA    . GLU C 2  357  ? 505.413 -22.462 631.642 1.00 124.63 ? 357  GLU C CA    1 
ATOM   6354  C  C     . GLU C 2  357  ? 506.903 -22.196 631.464 1.00 123.60 ? 357  GLU C C     1 
ATOM   6355  O  O     . GLU C 2  357  ? 507.335 -21.835 630.360 1.00 128.50 ? 357  GLU C O     1 
ATOM   6356  C  CB    . GLU C 2  357  ? 504.699 -21.159 632.012 1.00 126.05 ? 357  GLU C CB    1 
ATOM   6357  C  CG    . GLU C 2  357  ? 504.666 -20.197 630.810 1.00 128.76 ? 357  GLU C CG    1 
ATOM   6358  C  CD    . GLU C 2  357  ? 504.161 -18.800 631.128 1.00 125.90 ? 357  GLU C CD    1 
ATOM   6359  O  OE1   . GLU C 2  357  ? 503.495 -18.596 632.180 1.00 120.54 ? 357  GLU C OE1   1 
ATOM   6360  O  OE2   . GLU C 2  357  ? 504.441 -17.912 630.285 1.00 121.83 ? 357  GLU C OE2   1 
ATOM   6361  N  N     . ARG C 2  358  ? 507.699 -22.341 632.527 1.00 120.11 ? 358  ARG C N     1 
ATOM   6362  C  CA    . ARG C 2  358  ? 509.141 -22.156 632.406 1.00 125.20 ? 358  ARG C CA    1 
ATOM   6363  C  C     . ARG C 2  358  ? 509.831 -23.358 631.753 1.00 125.48 ? 358  ARG C C     1 
ATOM   6364  O  O     . ARG C 2  358  ? 511.004 -23.236 631.367 1.00 120.72 ? 358  ARG C O     1 
ATOM   6365  C  CB    . ARG C 2  358  ? 509.756 -21.852 633.773 1.00 123.34 ? 358  ARG C CB    1 
ATOM   6366  C  CG    . ARG C 2  358  ? 510.540 -20.539 633.833 1.00 119.93 ? 358  ARG C CG    1 
ATOM   6367  C  CD    . ARG C 2  358  ? 510.856 -20.182 635.293 1.00 120.78 ? 358  ARG C CD    1 
ATOM   6368  N  NE    . ARG C 2  358  ? 509.632 -19.799 636.000 1.00 119.01 ? 358  ARG C NE    1 
ATOM   6369  C  CZ    . ARG C 2  358  ? 509.492 -18.722 636.768 1.00 111.25 ? 358  ARG C CZ    1 
ATOM   6370  N  NH1   . ARG C 2  358  ? 510.503 -17.880 636.964 1.00 110.66 ? 358  ARG C NH1   1 
ATOM   6371  N  NH2   . ARG C 2  358  ? 508.321 -18.486 637.336 1.00 106.15 ? 358  ARG C NH2   1 
ATOM   6372  N  N     . MET C 2  359  ? 509.148 -24.522 631.659 1.00 121.71 ? 359  MET C N     1 
ATOM   6373  C  CA    . MET C 2  359  ? 509.725 -25.719 631.045 1.00 123.98 ? 359  MET C CA    1 
ATOM   6374  C  C     . MET C 2  359  ? 509.566 -25.717 629.514 1.00 131.13 ? 359  MET C C     1 
ATOM   6375  O  O     . MET C 2  359  ? 509.953 -26.690 628.849 1.00 130.70 ? 359  MET C O     1 
ATOM   6376  C  CB    . MET C 2  359  ? 509.083 -26.996 631.638 1.00 119.01 ? 359  MET C CB    1 
ATOM   6377  C  CG    . MET C 2  359  ? 509.485 -27.331 633.111 1.00 118.76 ? 359  MET C CG    1 
ATOM   6378  S  SD    . MET C 2  359  ? 509.181 -29.023 633.786 1.00 114.91 ? 359  MET C SD    1 
ATOM   6379  C  CE    . MET C 2  359  ? 507.438 -29.251 633.455 1.00 121.56 ? 359  MET C CE    1 
ATOM   6380  N  N     . LEU C 2  360  ? 509.007 -24.631 628.965 1.00 131.67 ? 360  LEU C N     1 
ATOM   6381  C  CA    . LEU C 2  360  ? 508.804 -24.370 627.541 1.00 122.00 ? 360  LEU C CA    1 
ATOM   6382  C  C     . LEU C 2  360  ? 509.746 -23.260 627.088 1.00 127.18 ? 360  LEU C C     1 
ATOM   6383  O  O     . LEU C 2  360  ? 510.479 -23.450 626.115 1.00 136.71 ? 360  LEU C O     1 
ATOM   6384  C  CB    . LEU C 2  360  ? 507.333 -24.076 627.222 1.00 121.46 ? 360  LEU C CB    1 
ATOM   6385  C  CG    . LEU C 2  360  ? 506.515 -25.362 626.940 1.00 121.90 ? 360  LEU C CG    1 
ATOM   6386  C  CD1   . LEU C 2  360  ? 506.569 -26.458 628.029 1.00 110.15 ? 360  LEU C CD1   1 
ATOM   6387  C  CD2   . LEU C 2  360  ? 505.057 -25.017 626.643 1.00 128.31 ? 360  LEU C CD2   1 
ATOM   6388  N  N     . MET C 2  361  ? 509.680 -22.068 627.701 1.00 126.98 ? 361  MET C N     1 
ATOM   6389  C  CA    . MET C 2  361  ? 510.590 -20.977 627.339 1.00 132.56 ? 361  MET C CA    1 
ATOM   6390  C  C     . MET C 2  361  ? 512.026 -21.333 627.775 1.00 137.48 ? 361  MET C C     1 
ATOM   6391  O  O     . MET C 2  361  ? 512.296 -22.425 628.287 1.00 139.92 ? 361  MET C O     1 
ATOM   6392  C  CB    . MET C 2  361  ? 510.195 -19.652 628.012 1.00 131.74 ? 361  MET C CB    1 
ATOM   6393  C  CG    . MET C 2  361  ? 508.736 -19.402 628.402 1.00 130.81 ? 361  MET C CG    1 
ATOM   6394  S  SD    . MET C 2  361  ? 507.596 -19.434 627.009 1.00 140.49 ? 361  MET C SD    1 
ATOM   6395  C  CE    . MET C 2  361  ? 508.252 -18.052 626.058 1.00 112.16 ? 361  MET C CE    1 
ATOM   6396  N  N     . GLY C 2  362  ? 512.964 -20.398 627.546 1.00 136.07 ? 362  GLY C N     1 
ATOM   6397  C  CA    . GLY C 2  362  ? 514.394 -20.491 627.869 1.00 135.62 ? 362  GLY C CA    1 
ATOM   6398  C  C     . GLY C 2  362  ? 515.070 -21.849 628.023 1.00 138.37 ? 362  GLY C C     1 
ATOM   6399  O  O     . GLY C 2  362  ? 515.065 -22.431 629.108 1.00 136.01 ? 362  GLY C O     1 
ATOM   6400  N  N     . SER C 2  363  ? 515.781 -22.267 626.971 1.00 149.06 ? 363  SER C N     1 
ATOM   6401  C  CA    . SER C 2  363  ? 516.561 -23.500 626.801 1.00 151.28 ? 363  SER C CA    1 
ATOM   6402  C  C     . SER C 2  363  ? 516.091 -24.740 627.570 1.00 147.89 ? 363  SER C C     1 
ATOM   6403  O  O     . SER C 2  363  ? 516.110 -24.746 628.805 1.00 143.84 ? 363  SER C O     1 
ATOM   6404  C  CB    . SER C 2  363  ? 518.029 -23.231 627.192 1.00 147.72 ? 363  SER C CB    1 
ATOM   6405  O  OG    . SER C 2  363  ? 518.152 -22.638 628.484 1.00 138.57 ? 363  SER C OG    1 
ATOM   6406  N  N     . GLU C 2  364  ? 515.758 -25.829 626.847 1.00 150.89 ? 364  GLU C N     1 
ATOM   6407  C  CA    . GLU C 2  364  ? 515.311 -27.089 627.458 1.00 152.01 ? 364  GLU C CA    1 
ATOM   6408  C  C     . GLU C 2  364  ? 516.461 -27.906 628.040 1.00 153.00 ? 364  GLU C C     1 
ATOM   6409  O  O     . GLU C 2  364  ? 516.565 -29.103 627.745 1.00 152.23 ? 364  GLU C O     1 
ATOM   6410  C  CB    . GLU C 2  364  ? 514.518 -28.010 626.507 1.00 151.78 ? 364  GLU C CB    1 
ATOM   6411  C  CG    . GLU C 2  364  ? 513.202 -28.516 627.161 1.00 148.63 ? 364  GLU C CG    1 
ATOM   6412  C  CD    . GLU C 2  364  ? 512.406 -29.533 626.342 1.00 149.66 ? 364  GLU C CD    1 
ATOM   6413  O  OE1   . GLU C 2  364  ? 511.631 -30.298 626.964 1.00 149.01 ? 364  GLU C OE1   1 
ATOM   6414  O  OE2   . GLU C 2  364  ? 512.550 -29.583 625.103 1.00 151.12 ? 364  GLU C OE2   1 
ATOM   6415  N  N     . ASP C 2  365  ? 517.338 -27.294 628.834 1.00 151.27 ? 365  ASP C N     1 
ATOM   6416  C  CA    . ASP C 2  365  ? 518.484 -28.023 629.371 1.00 152.17 ? 365  ASP C CA    1 
ATOM   6417  C  C     . ASP C 2  365  ? 519.106 -27.265 630.533 1.00 149.71 ? 365  ASP C C     1 
ATOM   6418  O  O     . ASP C 2  365  ? 519.268 -27.826 631.627 1.00 147.80 ? 365  ASP C O     1 
ATOM   6419  C  CB    . ASP C 2  365  ? 519.538 -28.334 628.309 1.00 151.30 ? 365  ASP C CB    1 
ATOM   6420  C  CG    . ASP C 2  365  ? 520.512 -29.413 628.774 1.00 149.00 ? 365  ASP C CG    1 
ATOM   6421  O  OD1   . ASP C 2  365  ? 520.249 -30.612 628.522 1.00 146.34 ? 365  ASP C OD1   1 
ATOM   6422  O  OD2   . ASP C 2  365  ? 521.533 -29.064 629.405 1.00 148.54 ? 365  ASP C OD2   1 
ATOM   6423  N  N     . SER C 2  366  ? 519.498 -26.007 630.308 1.00 146.81 ? 366  SER C N     1 
ATOM   6424  C  CA    . SER C 2  366  ? 520.217 -25.284 631.349 1.00 143.08 ? 366  SER C CA    1 
ATOM   6425  C  C     . SER C 2  366  ? 519.169 -24.651 632.262 1.00 144.50 ? 366  SER C C     1 
ATOM   6426  O  O     . SER C 2  366  ? 518.852 -23.458 632.194 1.00 145.86 ? 366  SER C O     1 
ATOM   6427  C  CB    . SER C 2  366  ? 521.138 -24.243 630.722 1.00 139.92 ? 366  SER C CB    1 
ATOM   6428  O  OG    . SER C 2  366  ? 521.561 -23.283 631.672 1.00 138.54 ? 366  SER C OG    1 
ATOM   6429  N  N     . LEU C 2  367  ? 518.616 -25.515 633.124 1.00 140.28 ? 367  LEU C N     1 
ATOM   6430  C  CA    . LEU C 2  367  ? 517.683 -25.188 634.196 1.00 130.11 ? 367  LEU C CA    1 
ATOM   6431  C  C     . LEU C 2  367  ? 517.908 -26.225 635.292 1.00 129.76 ? 367  LEU C C     1 
ATOM   6432  O  O     . LEU C 2  367  ? 517.992 -27.424 634.997 1.00 125.15 ? 367  LEU C O     1 
ATOM   6433  C  CB    . LEU C 2  367  ? 516.213 -25.177 633.738 1.00 125.35 ? 367  LEU C CB    1 
ATOM   6434  C  CG    . LEU C 2  367  ? 515.705 -24.045 632.822 1.00 126.17 ? 367  LEU C CG    1 
ATOM   6435  C  CD1   . LEU C 2  367  ? 514.253 -24.267 632.407 1.00 120.71 ? 367  LEU C CD1   1 
ATOM   6436  C  CD2   . LEU C 2  367  ? 515.892 -22.643 633.396 1.00 123.34 ? 367  LEU C CD2   1 
ATOM   6437  N  N     . THR C 2  368  ? 518.006 -25.757 636.547 1.00 130.57 ? 368  THR C N     1 
ATOM   6438  C  CA    . THR C 2  368  ? 518.048 -26.544 637.782 1.00 123.55 ? 368  THR C CA    1 
ATOM   6439  C  C     . THR C 2  368  ? 516.673 -26.432 638.442 1.00 120.95 ? 368  THR C C     1 
ATOM   6440  O  O     . THR C 2  368  ? 515.829 -25.680 637.930 1.00 117.32 ? 368  THR C O     1 
ATOM   6441  C  CB    . THR C 2  368  ? 519.179 -26.059 638.707 1.00 122.81 ? 368  THR C CB    1 
ATOM   6442  O  OG1   . THR C 2  368  ? 519.065 -24.643 638.927 1.00 121.03 ? 368  THR C OG1   1 
ATOM   6443  C  CG2   . THR C 2  368  ? 520.559 -26.377 638.111 1.00 120.54 ? 368  THR C CG2   1 
ATOM   6444  N  N     . PRO C 2  369  ? 516.387 -27.140 639.553 1.00 121.67 ? 369  PRO C N     1 
ATOM   6445  C  CA    . PRO C 2  369  ? 515.139 -26.843 640.269 1.00 107.21 ? 369  PRO C CA    1 
ATOM   6446  C  C     . PRO C 2  369  ? 515.140 -25.498 640.946 1.00 100.88 ? 369  PRO C C     1 
ATOM   6447  O  O     . PRO C 2  369  ? 514.089 -24.858 640.961 1.00 100.35 ? 369  PRO C O     1 
ATOM   6448  C  CB    . PRO C 2  369  ? 515.043 -27.968 641.309 1.00 106.89 ? 369  PRO C CB    1 
ATOM   6449  C  CG    . PRO C 2  369  ? 515.764 -29.072 640.727 1.00 114.94 ? 369  PRO C CG    1 
ATOM   6450  C  CD    . PRO C 2  369  ? 516.936 -28.435 639.991 1.00 123.26 ? 369  PRO C CD    1 
ATOM   6451  N  N     . ALA C 2  370  ? 516.290 -24.980 641.382 1.00 101.49 ? 370  ALA C N     1 
ATOM   6452  C  CA    . ALA C 2  370  ? 516.269 -23.690 642.069 1.00 104.48 ? 370  ALA C CA    1 
ATOM   6453  C  C     . ALA C 2  370  ? 515.854 -22.522 641.158 1.00 114.76 ? 370  ALA C C     1 
ATOM   6454  O  O     . ALA C 2  370  ? 515.165 -21.600 641.615 1.00 113.80 ? 370  ALA C O     1 
ATOM   6455  C  CB    . ALA C 2  370  ? 517.641 -23.432 642.696 1.00 103.11 ? 370  ALA C CB    1 
ATOM   6456  N  N     . LYS C 2  371  ? 516.234 -22.532 639.871 1.00 123.57 ? 371  LYS C N     1 
ATOM   6457  C  CA    . LYS C 2  371  ? 515.819 -21.445 638.968 1.00 120.78 ? 371  LYS C CA    1 
ATOM   6458  C  C     . LYS C 2  371  ? 514.402 -21.636 638.429 1.00 118.58 ? 371  LYS C C     1 
ATOM   6459  O  O     . LYS C 2  371  ? 513.762 -20.658 638.021 1.00 121.33 ? 371  LYS C O     1 
ATOM   6460  C  CB    . LYS C 2  371  ? 516.829 -21.154 637.834 1.00 119.78 ? 371  LYS C CB    1 
ATOM   6461  C  CG    . LYS C 2  371  ? 517.563 -22.230 637.045 1.00 122.11 ? 371  LYS C CG    1 
ATOM   6462  C  CD    . LYS C 2  371  ? 518.305 -21.422 635.927 1.00 132.12 ? 371  LYS C CD    1 
ATOM   6463  C  CE    . LYS C 2  371  ? 519.218 -22.182 634.940 1.00 128.86 ? 371  LYS C CE    1 
ATOM   6464  N  NZ    . LYS C 2  371  ? 520.460 -22.803 635.483 1.00 125.24 ? 371  LYS C NZ    1 
ATOM   6465  N  N     . LEU C 2  372  ? 513.923 -22.880 638.401 1.00 117.84 ? 372  LEU C N     1 
ATOM   6466  C  CA    . LEU C 2  372  ? 512.642 -23.244 637.801 1.00 115.26 ? 372  LEU C CA    1 
ATOM   6467  C  C     . LEU C 2  372  ? 511.453 -22.827 638.672 1.00 114.83 ? 372  LEU C C     1 
ATOM   6468  O  O     . LEU C 2  372  ? 510.344 -22.637 638.144 1.00 110.65 ? 372  LEU C O     1 
ATOM   6469  C  CB    . LEU C 2  372  ? 512.632 -24.755 637.571 1.00 113.16 ? 372  LEU C CB    1 
ATOM   6470  C  CG    . LEU C 2  372  ? 511.719 -25.382 636.535 1.00 113.16 ? 372  LEU C CG    1 
ATOM   6471  C  CD1   . LEU C 2  372  ? 511.702 -24.499 635.292 1.00 117.15 ? 372  LEU C CD1   1 
ATOM   6472  C  CD2   . LEU C 2  372  ? 512.181 -26.817 636.223 1.00 103.49 ? 372  LEU C CD2   1 
ATOM   6473  N  N     . VAL C 2  373  ? 511.665 -22.692 639.995 1.00 115.37 ? 373  VAL C N     1 
ATOM   6474  C  CA    . VAL C 2  373  ? 510.615 -22.451 640.992 1.00 103.39 ? 373  VAL C CA    1 
ATOM   6475  C  C     . VAL C 2  373  ? 510.627 -20.980 641.403 1.00 101.44 ? 373  VAL C C     1 
ATOM   6476  O  O     . VAL C 2  373  ? 511.667 -20.439 641.809 1.00 102.57 ? 373  VAL C O     1 
ATOM   6477  C  CB    . VAL C 2  373  ? 510.816 -23.350 642.230 1.00 96.67  ? 373  VAL C CB    1 
ATOM   6478  C  CG1   . VAL C 2  373  ? 510.069 -22.808 643.412 1.00 96.39  ? 373  VAL C CG1   1 
ATOM   6479  C  CG2   . VAL C 2  373  ? 510.376 -24.780 641.954 1.00 94.07  ? 373  VAL C CG2   1 
ATOM   6480  N  N     . ASN C 2  374  ? 509.466 -20.333 641.287 1.00 98.44  ? 374  ASN C N     1 
ATOM   6481  C  CA    . ASN C 2  374  ? 509.211 -19.007 641.838 1.00 99.30  ? 374  ASN C CA    1 
ATOM   6482  C  C     . ASN C 2  374  ? 508.197 -19.222 642.944 1.00 107.19 ? 374  ASN C C     1 
ATOM   6483  O  O     . ASN C 2  374  ? 507.090 -19.699 642.678 1.00 113.81 ? 374  ASN C O     1 
ATOM   6484  C  CB    . ASN C 2  374  ? 508.631 -18.011 640.834 1.00 100.82 ? 374  ASN C CB    1 
ATOM   6485  C  CG    . ASN C 2  374  ? 508.501 -16.612 641.437 1.00 101.59 ? 374  ASN C CG    1 
ATOM   6486  O  OD1   . ASN C 2  374  ? 509.023 -16.368 642.517 1.00 103.36 ? 374  ASN C OD1   1 
ATOM   6487  N  ND2   . ASN C 2  374  ? 507.756 -15.721 640.785 1.00 97.66  ? 374  ASN C ND2   1 
ATOM   6488  N  N     . SER C 2  375  ? 508.548 -18.852 644.167 1.00 104.66 ? 375  SER C N     1 
ATOM   6489  C  CA    . SER C 2  375  ? 507.711 -19.181 645.308 1.00 98.43  ? 375  SER C CA    1 
ATOM   6490  C  C     . SER C 2  375  ? 506.626 -18.145 645.567 1.00 102.95 ? 375  SER C C     1 
ATOM   6491  O  O     . SER C 2  375  ? 505.721 -18.421 646.358 1.00 103.55 ? 375  SER C O     1 
ATOM   6492  C  CB    . SER C 2  375  ? 508.581 -19.332 646.569 1.00 103.52 ? 375  SER C CB    1 
ATOM   6493  O  OG    . SER C 2  375  ? 509.129 -18.086 646.999 1.00 100.87 ? 375  SER C OG    1 
ATOM   6494  N  N     . ARG C 2  376  ? 506.631 -17.021 644.843 1.00 106.99 ? 376  ARG C N     1 
ATOM   6495  C  CA    . ARG C 2  376  ? 505.652 -15.947 645.042 1.00 104.54 ? 376  ARG C CA    1 
ATOM   6496  C  C     . ARG C 2  376  ? 504.204 -16.405 645.124 1.00 101.74 ? 376  ARG C C     1 
ATOM   6497  O  O     . ARG C 2  376  ? 503.500 -15.951 646.042 1.00 101.27 ? 376  ARG C O     1 
ATOM   6498  C  CB    . ARG C 2  376  ? 505.801 -14.896 643.932 1.00 106.37 ? 376  ARG C CB    1 
ATOM   6499  C  CG    . ARG C 2  376  ? 507.173 -14.270 643.972 1.00 114.86 ? 376  ARG C CG    1 
ATOM   6500  C  CD    . ARG C 2  376  ? 507.522 -13.893 645.417 1.00 109.11 ? 376  ARG C CD    1 
ATOM   6501  N  NE    . ARG C 2  376  ? 508.766 -13.146 645.515 1.00 110.02 ? 376  ARG C NE    1 
ATOM   6502  C  CZ    . ARG C 2  376  ? 509.371 -12.874 646.662 1.00 112.57 ? 376  ARG C CZ    1 
ATOM   6503  N  NH1   . ARG C 2  376  ? 508.849 -13.300 647.801 1.00 116.76 ? 376  ARG C NH1   1 
ATOM   6504  N  NH2   . ARG C 2  376  ? 510.500 -12.185 646.672 1.00 116.14 ? 376  ARG C NH2   1 
ATOM   6505  N  N     . PRO C 2  377  ? 503.685 -17.247 644.220 1.00 99.08  ? 377  PRO C N     1 
ATOM   6506  C  CA    . PRO C 2  377  ? 502.296 -17.728 644.389 1.00 102.18 ? 377  PRO C CA    1 
ATOM   6507  C  C     . PRO C 2  377  ? 502.019 -18.452 645.708 1.00 95.40  ? 377  PRO C C     1 
ATOM   6508  O  O     . PRO C 2  377  ? 500.926 -18.304 646.266 1.00 88.90  ? 377  PRO C O     1 
ATOM   6509  C  CB    . PRO C 2  377  ? 502.109 -18.674 643.192 1.00 92.49  ? 377  PRO C CB    1 
ATOM   6510  C  CG    . PRO C 2  377  ? 503.465 -19.054 642.811 1.00 95.32  ? 377  PRO C CG    1 
ATOM   6511  C  CD    . PRO C 2  377  ? 504.299 -17.828 643.024 1.00 97.13  ? 377  PRO C CD    1 
ATOM   6512  N  N     . LEU C 2  378  ? 502.959 -19.265 646.199 1.00 95.04  ? 378  LEU C N     1 
ATOM   6513  C  CA    . LEU C 2  378  ? 502.744 -19.976 647.458 1.00 93.48  ? 378  LEU C CA    1 
ATOM   6514  C  C     . LEU C 2  378  ? 502.745 -19.021 648.646 1.00 92.76  ? 378  LEU C C     1 
ATOM   6515  O  O     . LEU C 2  378  ? 501.871 -19.095 649.515 1.00 90.24  ? 378  LEU C O     1 
ATOM   6516  C  CB    . LEU C 2  378  ? 503.814 -21.048 647.648 1.00 94.41  ? 378  LEU C CB    1 
ATOM   6517  C  CG    . LEU C 2  378  ? 503.621 -21.892 648.901 1.00 84.25  ? 378  LEU C CG    1 
ATOM   6518  C  CD1   . LEU C 2  378  ? 502.266 -22.512 648.806 1.00 86.98  ? 378  LEU C CD1   1 
ATOM   6519  C  CD2   . LEU C 2  378  ? 504.671 -22.959 649.018 1.00 84.73  ? 378  LEU C CD2   1 
ATOM   6520  N  N     . GLU C 2  379  ? 503.763 -18.165 648.738 1.00 93.51  ? 379  GLU C N     1 
ATOM   6521  C  CA    . GLU C 2  379  ? 503.812 -17.193 649.826 1.00 96.10  ? 379  GLU C CA    1 
ATOM   6522  C  C     . GLU C 2  379  ? 502.560 -16.327 649.864 1.00 95.91  ? 379  GLU C C     1 
ATOM   6523  O  O     . GLU C 2  379  ? 502.022 -16.061 650.942 1.00 99.77  ? 379  GLU C O     1 
ATOM   6524  C  CB    . GLU C 2  379  ? 505.053 -16.310 649.723 1.00 101.60 ? 379  GLU C CB    1 
ATOM   6525  C  CG    . GLU C 2  379  ? 506.378 -17.040 649.763 1.00 103.70 ? 379  GLU C CG    1 
ATOM   6526  C  CD    . GLU C 2  379  ? 507.544 -16.080 649.579 1.00 112.44 ? 379  GLU C CD    1 
ATOM   6527  O  OE1   . GLU C 2  379  ? 508.137 -16.064 648.461 1.00 111.96 ? 379  GLU C OE1   1 
ATOM   6528  O  OE2   . GLU C 2  379  ? 507.845 -15.334 650.548 1.00 117.64 ? 379  GLU C OE2   1 
ATOM   6529  N  N     . ALA C 2  380  ? 502.062 -15.889 648.705 1.00 96.47  ? 380  ALA C N     1 
ATOM   6530  C  CA    . ALA C 2  380  ? 500.895 -15.012 648.735 1.00 93.27  ? 380  ALA C CA    1 
ATOM   6531  C  C     . ALA C 2  380  ? 499.660 -15.743 649.243 1.00 94.55  ? 380  ALA C C     1 
ATOM   6532  O  O     . ALA C 2  380  ? 498.927 -15.199 650.073 1.00 97.87  ? 380  ALA C O     1 
ATOM   6533  C  CB    . ALA C 2  380  ? 500.616 -14.419 647.358 1.00 86.98  ? 380  ALA C CB    1 
ATOM   6534  N  N     . ALA C 2  381  ? 499.438 -16.990 648.800 1.00 92.78  ? 381  ALA C N     1 
ATOM   6535  C  CA    . ALA C 2  381  ? 498.277 -17.766 649.255 1.00 88.71  ? 381  ALA C CA    1 
ATOM   6536  C  C     . ALA C 2  381  ? 498.249 -17.975 650.762 1.00 96.94  ? 381  ALA C C     1 
ATOM   6537  O  O     . ALA C 2  381  ? 497.170 -17.940 651.371 1.00 94.57  ? 381  ALA C O     1 
ATOM   6538  C  CB    . ALA C 2  381  ? 498.243 -19.130 648.578 1.00 87.66  ? 381  ALA C CB    1 
ATOM   6539  N  N     . ILE C 2  382  ? 499.402 -18.278 651.370 1.00 99.19  ? 382  ILE C N     1 
ATOM   6540  C  CA    . ILE C 2  382  ? 499.432 -18.484 652.814 1.00 86.71  ? 382  ILE C CA    1 
ATOM   6541  C  C     . ILE C 2  382  ? 499.249 -17.154 653.529 1.00 88.05  ? 382  ILE C C     1 
ATOM   6542  O  O     . ILE C 2  382  ? 498.454 -17.034 654.470 1.00 90.37  ? 382  ILE C O     1 
ATOM   6543  C  CB    . ILE C 2  382  ? 500.753 -19.160 653.221 1.00 85.53  ? 382  ILE C CB    1 
ATOM   6544  C  CG1   . ILE C 2  382  ? 500.888 -20.522 652.553 1.00 87.42  ? 382  ILE C CG1   1 
ATOM   6545  C  CG2   . ILE C 2  382  ? 500.751 -19.422 654.692 1.00 88.67  ? 382  ILE C CG2   1 
ATOM   6546  C  CD1   . ILE C 2  382  ? 499.807 -21.483 652.931 1.00 87.22  ? 382  ILE C CD1   1 
ATOM   6547  N  N     . ARG C 2  383  ? 499.970 -16.123 653.071 1.00 91.14  ? 383  ARG C N     1 
ATOM   6548  C  CA    . ARG C 2  383  ? 499.829 -14.788 653.648 1.00 95.41  ? 383  ARG C CA    1 
ATOM   6549  C  C     . ARG C 2  383  ? 498.415 -14.259 653.453 1.00 93.70  ? 383  ARG C C     1 
ATOM   6550  O  O     . ARG C 2  383  ? 497.879 -13.577 654.333 1.00 93.08  ? 383  ARG C O     1 
ATOM   6551  C  CB    . ARG C 2  383  ? 500.885 -13.845 653.046 1.00 94.77  ? 383  ARG C CB    1 
ATOM   6552  C  CG    . ARG C 2  383  ? 500.946 -12.416 653.613 1.00 92.78  ? 383  ARG C CG    1 
ATOM   6553  C  CD    . ARG C 2  383  ? 502.192 -11.667 653.099 1.00 95.90  ? 383  ARG C CD    1 
ATOM   6554  N  NE    . ARG C 2  383  ? 502.376 -11.785 651.646 1.00 108.26 ? 383  ARG C NE    1 
ATOM   6555  C  CZ    . ARG C 2  383  ? 503.358 -12.476 651.052 1.00 105.21 ? 383  ARG C CZ    1 
ATOM   6556  N  NH1   . ARG C 2  383  ? 504.271 -13.118 651.780 1.00 107.36 ? 383  ARG C NH1   1 
ATOM   6557  N  NH2   . ARG C 2  383  ? 503.431 -12.529 649.722 1.00 92.75  ? 383  ARG C NH2   1 
ATOM   6558  N  N     . GLU C 2  384  ? 497.784 -14.621 652.330 1.00 95.59  ? 384  GLU C N     1 
ATOM   6559  C  CA    . GLU C 2  384  ? 496.415 -14.209 652.031 1.00 95.33  ? 384  GLU C CA    1 
ATOM   6560  C  C     . GLU C 2  384  ? 495.425 -14.832 653.012 1.00 92.16  ? 384  GLU C C     1 
ATOM   6561  O  O     . GLU C 2  384  ? 494.490 -14.173 653.476 1.00 93.65  ? 384  GLU C O     1 
ATOM   6562  C  CB    . GLU C 2  384  ? 496.071 -14.639 650.601 1.00 100.23 ? 384  GLU C CB    1 
ATOM   6563  C  CG    . GLU C 2  384  ? 494.776 -14.126 650.024 1.00 110.44 ? 384  GLU C CG    1 
ATOM   6564  C  CD    . GLU C 2  384  ? 494.915 -12.694 649.531 1.00 117.76 ? 384  GLU C CD    1 
ATOM   6565  O  OE1   . GLU C 2  384  ? 495.241 -11.800 650.351 1.00 116.68 ? 384  GLU C OE1   1 
ATOM   6566  O  OE2   . GLU C 2  384  ? 494.711 -12.474 648.310 1.00 123.70 ? 384  GLU C OE2   1 
ATOM   6567  N  N     . PHE C 2  385  ? 495.567 -16.132 653.264 1.00 89.65  ? 385  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2  385  ? 494.736 -16.825 654.242 1.00 84.47  ? 385  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2  385  ? 494.861 -16.252 655.644 1.00 84.98  ? 385  PHE C C     1 
ATOM   6570  O  O     . PHE C 2  385  ? 493.852 -16.046 656.332 1.00 84.17  ? 385  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2  385  ? 495.073 -18.309 654.261 1.00 85.89  ? 385  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2  385  ? 494.375 -19.086 655.354 1.00 83.27  ? 385  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2  385  ? 493.049 -19.455 655.231 1.00 83.57  ? 385  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2  385  ? 495.072 -19.503 656.468 1.00 80.73  ? 385  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2  385  ? 492.428 -20.179 656.209 1.00 76.86  ? 385  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2  385  ? 494.456 -20.231 657.431 1.00 79.32  ? 385  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2  385  ? 493.130 -20.575 657.298 1.00 76.04  ? 385  PHE C CZ    1 
ATOM   6578  N  N     . PHE C 2  386  ? 496.088 -16.096 656.137 1.00 84.54  ? 386  PHE C N     1 
ATOM   6579  C  CA    . PHE C 2  386  ? 496.206 -15.659 657.526 1.00 89.13  ? 386  PHE C CA    1 
ATOM   6580  C  C     . PHE C 2  386  ? 495.855 -14.188 657.717 1.00 89.22  ? 386  PHE C C     1 
ATOM   6581  O  O     . PHE C 2  386  ? 495.245 -13.822 658.731 1.00 84.94  ? 386  PHE C O     1 
ATOM   6582  C  CB    . PHE C 2  386  ? 497.606 -15.961 658.049 1.00 82.07  ? 386  PHE C CB    1 
ATOM   6583  C  CG    . PHE C 2  386  ? 497.753 -17.365 658.466 1.00 78.72  ? 386  PHE C CG    1 
ATOM   6584  C  CD1   . PHE C 2  386  ? 498.219 -18.301 657.576 1.00 80.26  ? 386  PHE C CD1   1 
ATOM   6585  C  CD2   . PHE C 2  386  ? 497.316 -17.780 659.694 1.00 79.42  ? 386  PHE C CD2   1 
ATOM   6586  C  CE1   . PHE C 2  386  ? 498.320 -19.623 657.937 1.00 84.67  ? 386  PHE C CE1   1 
ATOM   6587  C  CE2   . PHE C 2  386  ? 497.411 -19.106 660.059 1.00 80.51  ? 386  PHE C CE2   1 
ATOM   6588  C  CZ    . PHE C 2  386  ? 497.911 -20.032 659.178 1.00 77.37  ? 386  PHE C CZ    1 
ATOM   6589  N  N     . SER C 2  387  ? 496.302 -13.321 656.808 1.00 89.45  ? 387  SER C N     1 
ATOM   6590  C  CA    . SER C 2  387  ? 496.015 -11.902 656.959 1.00 88.16  ? 387  SER C CA    1 
ATOM   6591  C  C     . SER C 2  387  ? 494.612 -11.467 656.483 1.00 88.11  ? 387  SER C C     1 
ATOM   6592  O  O     . SER C 2  387  ? 494.228 -10.328 656.769 1.00 93.68  ? 387  SER C O     1 
ATOM   6593  C  CB    . SER C 2  387  ? 497.147 -11.099 656.307 1.00 84.67  ? 387  SER C CB    1 
ATOM   6594  O  OG    . SER C 2  387  ? 496.787 -9.751  656.100 1.00 97.60  ? 387  SER C OG    1 
ATOM   6595  N  N     . ARG C 2  388  ? 493.812 -12.307 655.764 1.00 79.67  ? 388  ARG C N     1 
ATOM   6596  C  CA    . ARG C 2  388  ? 492.583 -11.742 655.195 1.00 83.43  ? 388  ARG C CA    1 
ATOM   6597  C  C     . ARG C 2  388  ? 491.383 -12.683 655.053 1.00 80.51  ? 388  ARG C C     1 
ATOM   6598  O  O     . ARG C 2  388  ? 490.356 -12.244 654.524 1.00 81.16  ? 388  ARG C O     1 
ATOM   6599  C  CB    . ARG C 2  388  ? 492.892 -11.037 653.861 1.00 95.79  ? 388  ARG C CB    1 
ATOM   6600  C  CG    . ARG C 2  388  ? 492.385 -9.587  653.871 1.00 96.09  ? 388  ARG C CG    1 
ATOM   6601  C  CD    . ARG C 2  388  ? 493.014 -8.709  652.793 1.00 101.61 ? 388  ARG C CD    1 
ATOM   6602  N  NE    . ARG C 2  388  ? 494.442 -8.464  653.055 1.00 107.38 ? 388  ARG C NE    1 
ATOM   6603  C  CZ    . ARG C 2  388  ? 494.926 -7.565  653.922 1.00 106.84 ? 388  ARG C CZ    1 
ATOM   6604  N  NH1   . ARG C 2  388  ? 494.101 -6.802  654.649 1.00 111.85 ? 388  ARG C NH1   1 
ATOM   6605  N  NH2   . ARG C 2  388  ? 496.247 -7.431  654.066 1.00 98.43  ? 388  ARG C NH2   1 
ATOM   6606  N  N     . SER C 2  389  ? 491.486 -13.959 655.428 1.00 78.58  ? 389  SER C N     1 
ATOM   6607  C  CA    . SER C 2  389  ? 490.393 -14.938 655.370 1.00 81.58  ? 389  SER C CA    1 
ATOM   6608  C  C     . SER C 2  389  ? 489.308 -14.527 656.369 1.00 82.78  ? 389  SER C C     1 
ATOM   6609  O  O     . SER C 2  389  ? 489.557 -13.768 657.315 1.00 84.06  ? 389  SER C O     1 
ATOM   6610  C  CB    . SER C 2  389  ? 490.861 -16.376 655.689 1.00 76.84  ? 389  SER C CB    1 
ATOM   6611  O  OG    . SER C 2  389  ? 489.775 -17.318 655.802 1.00 65.72  ? 389  SER C OG    1 
ATOM   6612  N  N     . GLN C 2  390  ? 488.094 -15.032 656.188 1.00 80.55  ? 390  GLN C N     1 
ATOM   6613  C  CA    . GLN C 2  390  ? 487.048 -14.673 657.133 1.00 91.47  ? 390  GLN C CA    1 
ATOM   6614  C  C     . GLN C 2  390  ? 486.761 -15.926 657.947 1.00 91.10  ? 390  GLN C C     1 
ATOM   6615  O  O     . GLN C 2  390  ? 485.656 -16.473 657.985 1.00 97.34  ? 390  GLN C O     1 
ATOM   6616  C  CB    . GLN C 2  390  ? 485.754 -14.240 656.376 1.00 99.67  ? 390  GLN C CB    1 
ATOM   6617  C  CG    . GLN C 2  390  ? 484.558 -13.848 657.275 1.00 104.11 ? 390  GLN C CG    1 
ATOM   6618  C  CD    . GLN C 2  390  ? 483.346 -13.377 656.488 1.00 117.50 ? 390  GLN C CD    1 
ATOM   6619  O  OE1   . GLN C 2  390  ? 483.393 -12.359 655.791 1.00 128.68 ? 390  GLN C OE1   1 
ATOM   6620  N  NE2   . GLN C 2  390  ? 482.249 -14.141 656.581 1.00 109.35 ? 390  GLN C NE2   1 
ATOM   6621  N  N     . LEU C 2  391  ? 487.790 -16.274 658.716 1.00 78.25  ? 391  LEU C N     1 
ATOM   6622  C  CA    . LEU C 2  391  ? 487.864 -17.373 659.662 1.00 73.75  ? 391  LEU C CA    1 
ATOM   6623  C  C     . LEU C 2  391  ? 489.142 -17.099 660.443 1.00 78.22  ? 391  LEU C C     1 
ATOM   6624  O  O     . LEU C 2  391  ? 489.394 -17.707 661.491 1.00 80.56  ? 391  LEU C O     1 
ATOM   6625  C  CB    . LEU C 2  391  ? 487.866 -18.762 659.006 1.00 73.97  ? 391  LEU C CB    1 
ATOM   6626  C  CG    . LEU C 2  391  ? 486.536 -19.310 658.434 1.00 79.06  ? 391  LEU C CG    1 
ATOM   6627  C  CD1   . LEU C 2  391  ? 486.637 -20.704 657.786 1.00 76.20  ? 391  LEU C CD1   1 
ATOM   6628  C  CD2   . LEU C 2  391  ? 485.408 -19.245 659.440 1.00 77.12  ? 391  LEU C CD2   1 
ATOM   6629  N  N     . SER C 2  392  ? 489.973 -16.194 659.914 1.00 72.10  ? 392  SER C N     1 
ATOM   6630  C  CA    . SER C 2  392  ? 491.131 -15.687 660.638 1.00 71.87  ? 392  SER C CA    1 
ATOM   6631  C  C     . SER C 2  392  ? 490.719 -14.377 661.288 1.00 77.86  ? 392  SER C C     1 
ATOM   6632  O  O     . SER C 2  392  ? 490.596 -13.358 660.594 1.00 74.18  ? 392  SER C O     1 
ATOM   6633  C  CB    . SER C 2  392  ? 492.341 -15.466 659.736 1.00 74.50  ? 392  SER C CB    1 
ATOM   6634  O  OG    . SER C 2  392  ? 493.445 -15.005 660.511 1.00 71.41  ? 392  SER C OG    1 
ATOM   6635  N  N     . GLN C 2  393  ? 490.553 -14.401 662.623 1.00 81.55  ? 393  GLN C N     1 
ATOM   6636  C  CA    . GLN C 2  393  ? 490.025 -13.287 663.402 1.00 79.73  ? 393  GLN C CA    1 
ATOM   6637  C  C     . GLN C 2  393  ? 491.013 -12.776 664.454 1.00 77.04  ? 393  GLN C C     1 
ATOM   6638  O  O     . GLN C 2  393  ? 491.838 -13.530 664.991 1.00 72.17  ? 393  GLN C O     1 
ATOM   6639  C  CB    . GLN C 2  393  ? 488.717 -13.694 664.085 1.00 80.57  ? 393  GLN C CB    1 
ATOM   6640  C  CG    . GLN C 2  393  ? 487.627 -14.135 663.131 1.00 82.32  ? 393  GLN C CG    1 
ATOM   6641  C  CD    . GLN C 2  393  ? 486.418 -14.762 663.822 1.00 89.72  ? 393  GLN C CD    1 
ATOM   6642  O  OE1   . GLN C 2  393  ? 486.544 -15.465 664.818 1.00 91.26  ? 393  GLN C OE1   1 
ATOM   6643  N  NE2   . GLN C 2  393  ? 485.235 -14.500 663.286 1.00 93.92  ? 393  GLN C NE2   1 
ATOM   6644  N  N     . PHE C 2  394  ? 490.945 -11.462 664.691 1.00 72.43  ? 394  PHE C N     1 
ATOM   6645  C  CA    . PHE C 2  394  ? 491.649 -10.804 665.785 1.00 79.39  ? 394  PHE C CA    1 
ATOM   6646  C  C     . PHE C 2  394  ? 491.278 -11.485 667.116 1.00 84.96  ? 394  PHE C C     1 
ATOM   6647  O  O     . PHE C 2  394  ? 490.098 -11.604 667.463 1.00 85.20  ? 394  PHE C O     1 
ATOM   6648  C  CB    . PHE C 2  394  ? 491.238 -9.324  665.738 1.00 89.11  ? 394  PHE C CB    1 
ATOM   6649  C  CG    . PHE C 2  394  ? 492.188 -8.353  666.375 1.00 97.60  ? 394  PHE C CG    1 
ATOM   6650  C  CD1   . PHE C 2  394  ? 493.498 -8.247  665.951 1.00 98.84  ? 394  PHE C CD1   1 
ATOM   6651  C  CD2   . PHE C 2  394  ? 491.730 -7.453  667.337 1.00 102.22 ? 394  PHE C CD2   1 
ATOM   6652  C  CE1   . PHE C 2  394  ? 494.367 -7.287  666.539 1.00 102.84 ? 394  PHE C CE1   1 
ATOM   6653  C  CE2   . PHE C 2  394  ? 492.586 -6.498  667.915 1.00 102.05 ? 394  PHE C CE2   1 
ATOM   6654  C  CZ    . PHE C 2  394  ? 493.901 -6.418  667.521 1.00 97.60  ? 394  PHE C CZ    1 
ATOM   6655  N  N     . LYS C 2  395  ? 492.276 -11.931 667.876 1.00 79.16  ? 395  LYS C N     1 
ATOM   6656  C  CA    . LYS C 2  395  ? 491.980 -12.731 669.063 1.00 69.99  ? 395  LYS C CA    1 
ATOM   6657  C  C     . LYS C 2  395  ? 491.177 -11.948 670.075 1.00 79.95  ? 395  LYS C C     1 
ATOM   6658  O  O     . LYS C 2  395  ? 491.371 -10.741 670.262 1.00 83.96  ? 395  LYS C O     1 
ATOM   6659  C  CB    . LYS C 2  395  ? 493.275 -13.202 669.706 1.00 75.74  ? 395  LYS C CB    1 
ATOM   6660  C  CG    . LYS C 2  395  ? 493.218 -14.460 670.552 1.00 74.21  ? 395  LYS C CG    1 
ATOM   6661  C  CD    . LYS C 2  395  ? 494.067 -14.335 671.786 1.00 78.95  ? 395  LYS C CD    1 
ATOM   6662  C  CE    . LYS C 2  395  ? 495.270 -15.255 671.690 1.00 76.36  ? 395  LYS C CE    1 
ATOM   6663  N  NZ    . LYS C 2  395  ? 495.923 -15.542 672.995 1.00 85.98  ? 395  LYS C NZ    1 
ATOM   6664  N  N     . ASP C 2  396  ? 490.242 -12.643 670.710 1.00 85.14  ? 396  ASP C N     1 
ATOM   6665  C  CA    . ASP C 2  396  ? 489.471 -12.067 671.814 1.00 83.14  ? 396  ASP C CA    1 
ATOM   6666  C  C     . ASP C 2  396  ? 490.255 -12.430 673.069 1.00 79.60  ? 396  ASP C C     1 
ATOM   6667  O  O     . ASP C 2  396  ? 490.113 -13.531 673.611 1.00 72.57  ? 396  ASP C O     1 
ATOM   6668  C  CB    . ASP C 2  396  ? 488.052 -12.638 671.810 1.00 80.55  ? 396  ASP C CB    1 
ATOM   6669  C  CG    . ASP C 2  396  ? 487.161 -12.021 672.856 1.00 87.22  ? 396  ASP C CG    1 
ATOM   6670  O  OD1   . ASP C 2  396  ? 487.640 -11.188 673.663 1.00 85.94  ? 396  ASP C OD1   1 
ATOM   6671  O  OD2   . ASP C 2  396  ? 485.963 -12.390 672.860 1.00 87.36  ? 396  ASP C OD2   1 
ATOM   6672  N  N     . GLU C 2  397  ? 490.981 -11.465 673.619 1.00 77.67  ? 397  GLU C N     1 
ATOM   6673  C  CA    . GLU C 2  397  ? 491.750 -11.776 674.814 1.00 81.03  ? 397  GLU C CA    1 
ATOM   6674  C  C     . GLU C 2  397  ? 491.450 -10.746 675.882 1.00 87.27  ? 397  GLU C C     1 
ATOM   6675  O  O     . GLU C 2  397  ? 492.355 -10.236 676.549 1.00 92.07  ? 397  GLU C O     1 
ATOM   6676  C  CB    . GLU C 2  397  ? 493.259 -11.933 674.522 1.00 79.79  ? 397  GLU C CB    1 
ATOM   6677  C  CG    . GLU C 2  397  ? 493.972 -10.956 673.544 1.00 87.02  ? 397  GLU C CG    1 
ATOM   6678  C  CD    . GLU C 2  397  ? 495.541 -11.074 673.565 1.00 91.29  ? 397  GLU C CD    1 
ATOM   6679  O  OE1   . GLU C 2  397  ? 496.081 -12.067 674.138 1.00 92.42  ? 397  GLU C OE1   1 
ATOM   6680  O  OE2   . GLU C 2  397  ? 496.237 -10.160 673.038 1.00 83.87  ? 397  GLU C OE2   1 
ATOM   6681  N  N     . THR C 2  398  ? 490.151 -10.397 676.022 1.00 90.95  ? 398  THR C N     1 
ATOM   6682  C  CA    . THR C 2  398  ? 489.740 -9.451  677.058 1.00 80.74  ? 398  THR C CA    1 
ATOM   6683  C  C     . THR C 2  398  ? 490.119 -10.013 678.406 1.00 74.19  ? 398  THR C C     1 
ATOM   6684  O  O     . THR C 2  398  ? 490.774 -9.341  679.206 1.00 76.83  ? 398  THR C O     1 
ATOM   6685  C  CB    . THR C 2  398  ? 488.222 -9.240  677.005 1.00 77.39  ? 398  THR C CB    1 
ATOM   6686  O  OG1   . THR C 2  398  ? 487.803 -8.950  675.663 1.00 85.28  ? 398  THR C OG1   1 
ATOM   6687  C  CG2   . THR C 2  398  ? 487.829 -8.113  677.872 1.00 72.52  ? 398  THR C CG2   1 
ATOM   6688  N  N     . ASN C 2  399  ? 489.865 -11.302 678.585 1.00 74.22  ? 399  ASN C N     1 
ATOM   6689  C  CA    . ASN C 2  399  ? 490.232 -12.060 679.772 1.00 83.80  ? 399  ASN C CA    1 
ATOM   6690  C  C     . ASN C 2  399  ? 490.540 -13.468 679.286 1.00 81.82  ? 399  ASN C C     1 
ATOM   6691  O  O     . ASN C 2  399  ? 490.243 -13.806 678.135 1.00 74.58  ? 399  ASN C O     1 
ATOM   6692  C  CB    . ASN C 2  399  ? 489.111 -12.063 680.839 1.00 73.34  ? 399  ASN C CB    1 
ATOM   6693  C  CG    . ASN C 2  399  ? 487.847 -12.818 680.394 1.00 72.12  ? 399  ASN C CG    1 
ATOM   6694  O  OD1   . ASN C 2  399  ? 487.886 -14.018 680.102 1.00 71.05  ? 399  ASN C OD1   1 
ATOM   6695  N  ND2   . ASN C 2  399  ? 486.728 -12.109 680.331 1.00 69.06  ? 399  ASN C ND2   1 
ATOM   6696  N  N     . PRO C 2  400  ? 491.180 -14.305 680.123 1.00 83.28  ? 400  PRO C N     1 
ATOM   6697  C  CA    . PRO C 2  400  ? 491.581 -15.639 679.636 1.00 76.98  ? 400  PRO C CA    1 
ATOM   6698  C  C     . PRO C 2  400  ? 490.427 -16.434 679.072 1.00 77.69  ? 400  PRO C C     1 
ATOM   6699  O  O     . PRO C 2  400  ? 490.649 -17.194 678.123 1.00 81.50  ? 400  PRO C O     1 
ATOM   6700  C  CB    . PRO C 2  400  ? 492.190 -16.304 680.873 1.00 80.65  ? 400  PRO C CB    1 
ATOM   6701  C  CG    . PRO C 2  400  ? 492.721 -15.177 681.651 1.00 85.97  ? 400  PRO C CG    1 
ATOM   6702  C  CD    . PRO C 2  400  ? 491.760 -14.031 681.451 1.00 87.38  ? 400  PRO C CD    1 
ATOM   6703  N  N     . LEU C 2  401  ? 489.230 -16.364 679.673 1.00 73.27  ? 401  LEU C N     1 
ATOM   6704  C  CA    . LEU C 2  401  ? 488.100 -17.107 679.112 1.00 75.71  ? 401  LEU C CA    1 
ATOM   6705  C  C     . LEU C 2  401  ? 487.724 -16.611 677.701 1.00 75.39  ? 401  LEU C C     1 
ATOM   6706  O  O     . LEU C 2  401  ? 487.298 -17.409 676.857 1.00 72.21  ? 401  LEU C O     1 
ATOM   6707  C  CB    . LEU C 2  401  ? 486.879 -17.037 680.035 1.00 66.29  ? 401  LEU C CB    1 
ATOM   6708  C  CG    . LEU C 2  401  ? 485.619 -17.748 679.526 1.00 60.48  ? 401  LEU C CG    1 
ATOM   6709  C  CD1   . LEU C 2  401  ? 485.858 -19.243 679.330 1.00 59.93  ? 401  LEU C CD1   1 
ATOM   6710  C  CD2   . LEU C 2  401  ? 484.439 -17.524 680.415 1.00 68.21  ? 401  LEU C CD2   1 
ATOM   6711  N  N     . SER C 2  402  ? 487.879 -15.310 677.421 1.00 72.43  ? 402  SER C N     1 
ATOM   6712  C  CA    . SER C 2  402  ? 487.550 -14.777 676.093 1.00 76.24  ? 402  SER C CA    1 
ATOM   6713  C  C     . SER C 2  402  ? 488.224 -15.576 674.969 1.00 84.10  ? 402  SER C C     1 
ATOM   6714  O  O     . SER C 2  402  ? 487.567 -15.983 673.994 1.00 84.29  ? 402  SER C O     1 
ATOM   6715  C  CB    . SER C 2  402  ? 487.946 -13.293 676.000 1.00 80.18  ? 402  SER C CB    1 
ATOM   6716  O  OG    . SER C 2  402  ? 487.670 -12.540 677.185 1.00 78.34  ? 402  SER C OG    1 
ATOM   6717  N  N     . SER C 2  403  ? 489.557 -15.744 675.058 1.00 80.81  ? 403  SER C N     1 
ATOM   6718  C  CA    . SER C 2  403  ? 490.312 -16.459 674.031 1.00 73.82  ? 403  SER C CA    1 
ATOM   6719  C  C     . SER C 2  403  ? 490.029 -17.965 674.057 1.00 74.59  ? 403  SER C C     1 
ATOM   6720  O  O     . SER C 2  403  ? 489.979 -18.600 673.002 1.00 78.57  ? 403  SER C O     1 
ATOM   6721  C  CB    . SER C 2  403  ? 491.809 -16.160 674.176 1.00 74.67  ? 403  SER C CB    1 
ATOM   6722  O  OG    . SER C 2  403  ? 492.426 -16.909 675.214 1.00 79.33  ? 403  SER C OG    1 
ATOM   6723  N  N     . LEU C 2  404  ? 489.920 -18.581 675.240 1.00 75.03  ? 404  LEU C N     1 
ATOM   6724  C  CA    . LEU C 2  404  ? 489.560 -20.003 675.276 1.00 77.38  ? 404  LEU C CA    1 
ATOM   6725  C  C     . LEU C 2  404  ? 488.247 -20.279 674.529 1.00 76.49  ? 404  LEU C C     1 
ATOM   6726  O  O     . LEU C 2  404  ? 488.160 -21.224 673.735 1.00 75.40  ? 404  LEU C O     1 
ATOM   6727  C  CB    . LEU C 2  404  ? 489.424 -20.512 676.718 1.00 74.56  ? 404  LEU C CB    1 
ATOM   6728  C  CG    . LEU C 2  404  ? 488.967 -21.993 676.747 1.00 74.49  ? 404  LEU C CG    1 
ATOM   6729  C  CD1   . LEU C 2  404  ? 489.979 -22.978 676.153 1.00 78.13  ? 404  LEU C CD1   1 
ATOM   6730  C  CD2   . LEU C 2  404  ? 488.362 -22.496 678.046 1.00 80.56  ? 404  LEU C CD2   1 
ATOM   6731  N  N     . ARG C 2  405  ? 487.224 -19.439 674.745 1.00 76.91  ? 405  ARG C N     1 
ATOM   6732  C  CA    . ARG C 2  405  ? 485.946 -19.611 674.057 1.00 74.58  ? 405  ARG C CA    1 
ATOM   6733  C  C     . ARG C 2  405  ? 486.074 -19.355 672.564 1.00 74.76  ? 405  ARG C C     1 
ATOM   6734  O  O     . ARG C 2  405  ? 485.459 -20.063 671.749 1.00 74.57  ? 405  ARG C O     1 
ATOM   6735  C  CB    . ARG C 2  405  ? 484.884 -18.687 674.641 1.00 72.69  ? 405  ARG C CB    1 
ATOM   6736  C  CG    . ARG C 2  405  ? 483.607 -18.905 673.904 1.00 75.72  ? 405  ARG C CG    1 
ATOM   6737  C  CD    . ARG C 2  405  ? 482.647 -17.770 674.041 1.00 73.58  ? 405  ARG C CD    1 
ATOM   6738  N  NE    . ARG C 2  405  ? 483.102 -16.739 673.110 1.00 67.85  ? 405  ARG C NE    1 
ATOM   6739  C  CZ    . ARG C 2  405  ? 482.355 -15.788 672.576 1.00 65.75  ? 405  ARG C CZ    1 
ATOM   6740  N  NH1   . ARG C 2  405  ? 481.057 -15.706 672.817 1.00 68.35  ? 405  ARG C NH1   1 
ATOM   6741  N  NH2   . ARG C 2  405  ? 482.934 -14.895 671.803 1.00 72.95  ? 405  ARG C NH2   1 
ATOM   6742  N  N     . HIS C 2  406  ? 486.846 -18.328 672.198 1.00 73.96  ? 406  HIS C N     1 
ATOM   6743  C  CA    . HIS C 2  406  ? 487.036 -17.965 670.793 1.00 78.18  ? 406  HIS C CA    1 
ATOM   6744  C  C     . HIS C 2  406  ? 487.546 -19.147 669.970 1.00 72.52  ? 406  HIS C C     1 
ATOM   6745  O  O     . HIS C 2  406  ? 487.004 -19.449 668.904 1.00 68.91  ? 406  HIS C O     1 
ATOM   6746  C  CB    . HIS C 2  406  ? 488.042 -16.814 670.713 1.00 78.59  ? 406  HIS C CB    1 
ATOM   6747  C  CG    . HIS C 2  406  ? 488.052 -16.089 669.404 1.00 78.83  ? 406  HIS C CG    1 
ATOM   6748  N  ND1   . HIS C 2  406  ? 488.811 -14.955 669.190 1.00 78.14  ? 406  HIS C ND1   1 
ATOM   6749  C  CD2   . HIS C 2  406  ? 487.370 -16.308 668.259 1.00 76.38  ? 406  HIS C CD2   1 
ATOM   6750  C  CE1   . HIS C 2  406  ? 488.612 -14.523 667.960 1.00 75.08  ? 406  HIS C CE1   1 
ATOM   6751  N  NE2   . HIS C 2  406  ? 487.733 -15.319 667.379 1.00 75.19  ? 406  HIS C NE2   1 
ATOM   6752  N  N     . LYS C 2  407  ? 488.549 -19.867 670.496 1.00 73.20  ? 407  LYS C N     1 
ATOM   6753  C  CA    . LYS C 2  407  ? 489.169 -20.996 669.812 1.00 70.38  ? 407  LYS C CA    1 
ATOM   6754  C  C     . LYS C 2  407  ? 488.235 -22.189 669.630 1.00 74.96  ? 407  LYS C C     1 
ATOM   6755  O  O     . LYS C 2  407  ? 488.451 -22.985 668.700 1.00 79.89  ? 407  LYS C O     1 
ATOM   6756  C  CB    . LYS C 2  407  ? 490.445 -21.435 670.545 1.00 67.84  ? 407  LYS C CB    1 
ATOM   6757  C  CG    . LYS C 2  407  ? 491.564 -20.407 670.532 1.00 64.88  ? 407  LYS C CG    1 
ATOM   6758  C  CD    . LYS C 2  407  ? 492.438 -20.402 671.757 1.00 67.48  ? 407  LYS C CD    1 
ATOM   6759  C  CE    . LYS C 2  407  ? 493.383 -19.207 671.664 1.00 73.85  ? 407  LYS C CE    1 
ATOM   6760  N  NZ    . LYS C 2  407  ? 494.095 -18.829 672.915 1.00 81.76  ? 407  LYS C NZ    1 
ATOM   6761  N  N     . ARG C 2  408  ? 487.214 -22.344 670.477 1.00 68.72  ? 408  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2  408  ? 486.283 -23.466 670.373 1.00 70.28  ? 408  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2  408  ? 485.019 -23.105 669.593 1.00 71.99  ? 408  ARG C C     1 
ATOM   6764  O  O     . ARG C 2  408  ? 484.067 -23.897 669.572 1.00 70.81  ? 408  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2  408  ? 485.924 -24.033 671.749 1.00 72.51  ? 408  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2  408  ? 487.116 -24.187 672.683 1.00 77.31  ? 408  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2  408  ? 486.750 -24.832 674.043 1.00 78.90  ? 408  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2  408  ? 486.787 -26.296 674.086 1.00 79.40  ? 408  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2  408  ? 485.711 -27.056 674.276 1.00 79.66  ? 408  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2  408  ? 484.529 -26.477 674.440 1.00 74.95  ? 408  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2  408  ? 485.814 -28.385 674.322 1.00 79.71  ? 408  ARG C NH2   1 
ATOM   6772  N  N     . ARG C 2  409  ? 484.968 -21.929 668.967 1.00 68.25  ? 409  ARG C N     1 
ATOM   6773  C  CA    . ARG C 2  409  ? 483.780 -21.591 668.192 1.00 75.36  ? 409  ARG C CA    1 
ATOM   6774  C  C     . ARG C 2  409  ? 483.707 -22.272 666.826 1.00 78.07  ? 409  ARG C C     1 
ATOM   6775  O  O     . ARG C 2  409  ? 484.717 -22.609 666.200 1.00 78.98  ? 409  ARG C O     1 
ATOM   6776  C  CB    . ARG C 2  409  ? 483.639 -20.075 668.045 1.00 72.46  ? 409  ARG C CB    1 
ATOM   6777  C  CG    . ARG C 2  409  ? 482.797 -19.575 669.230 1.00 89.66  ? 409  ARG C CG    1 
ATOM   6778  C  CD    . ARG C 2  409  ? 481.886 -18.398 668.904 1.00 91.62  ? 409  ARG C CD    1 
ATOM   6779  N  NE    . ARG C 2  409  ? 482.676 -17.207 668.592 1.00 91.60  ? 409  ARG C NE    1 
ATOM   6780  C  CZ    . ARG C 2  409  ? 482.179 -15.971 668.585 1.00 91.50  ? 409  ARG C CZ    1 
ATOM   6781  N  NH1   . ARG C 2  409  ? 482.970 -14.939 668.305 1.00 92.17  ? 409  ARG C NH1   1 
ATOM   6782  N  NH2   . ARG C 2  409  ? 480.885 -15.767 668.851 1.00 87.71  ? 409  ARG C NH2   1 
ATOM   6783  N  N     . ILE C 2  410  ? 482.465 -22.481 666.385 1.00 76.65  ? 410  ILE C N     1 
ATOM   6784  C  CA    . ILE C 2  410  ? 482.118 -23.144 665.132 1.00 72.62  ? 410  ILE C CA    1 
ATOM   6785  C  C     . ILE C 2  410  ? 481.260 -22.207 664.300 1.00 78.10  ? 410  ILE C C     1 
ATOM   6786  O  O     . ILE C 2  410  ? 480.125 -21.901 664.687 1.00 78.55  ? 410  ILE C O     1 
ATOM   6787  C  CB    . ILE C 2  410  ? 481.347 -24.453 665.379 1.00 72.26  ? 410  ILE C CB    1 
ATOM   6788  C  CG1   . ILE C 2  410  ? 482.172 -25.464 666.171 1.00 74.12  ? 410  ILE C CG1   1 
ATOM   6789  C  CG2   . ILE C 2  410  ? 480.712 -24.991 664.112 1.00 71.08  ? 410  ILE C CG2   1 
ATOM   6790  C  CD1   . ILE C 2  410  ? 481.396 -26.709 666.463 1.00 73.27  ? 410  ILE C CD1   1 
ATOM   6791  N  N     . SER C 2  411  ? 481.736 -21.874 663.097 1.00 79.25  ? 411  SER C N     1 
ATOM   6792  C  CA    . SER C 2  411  ? 481.047 -20.947 662.214 1.00 72.75  ? 411  SER C CA    1 
ATOM   6793  C  C     . SER C 2  411  ? 480.530 -21.682 660.995 1.00 79.97  ? 411  SER C C     1 
ATOM   6794  O  O     . SER C 2  411  ? 481.236 -22.512 660.418 1.00 85.11  ? 411  SER C O     1 
ATOM   6795  C  CB    . SER C 2  411  ? 481.982 -19.832 661.754 1.00 73.01  ? 411  SER C CB    1 
ATOM   6796  O  OG    . SER C 2  411  ? 481.330 -18.976 660.819 1.00 86.39  ? 411  SER C OG    1 
ATOM   6797  N  N     . ALA C 2  412  ? 479.299 -21.369 660.600 1.00 81.22  ? 412  ALA C N     1 
ATOM   6798  C  CA    . ALA C 2  412  ? 478.729 -21.887 659.366 1.00 83.57  ? 412  ALA C CA    1 
ATOM   6799  C  C     . ALA C 2  412  ? 478.911 -20.908 658.222 1.00 91.98  ? 412  ALA C C     1 
ATOM   6800  O  O     . ALA C 2  412  ? 478.571 -21.238 657.082 1.00 97.48  ? 412  ALA C O     1 
ATOM   6801  C  CB    . ALA C 2  412  ? 477.244 -22.222 659.547 1.00 78.75  ? 412  ALA C CB    1 
ATOM   6802  N  N     . LEU C 2  413  ? 479.480 -19.729 658.506 1.00 90.87  ? 413  LEU C N     1 
ATOM   6803  C  CA    . LEU C 2  413  ? 479.766 -18.695 657.521 1.00 97.55  ? 413  LEU C CA    1 
ATOM   6804  C  C     . LEU C 2  413  ? 481.164 -18.896 656.921 1.00 98.83  ? 413  LEU C C     1 
ATOM   6805  O  O     . LEU C 2  413  ? 481.804 -19.927 657.141 1.00 99.40  ? 413  LEU C O     1 
ATOM   6806  C  CB    . LEU C 2  413  ? 479.612 -17.329 658.198 1.00 94.57  ? 413  LEU C CB    1 
ATOM   6807  C  CG    . LEU C 2  413  ? 478.284 -16.594 657.989 1.00 93.14  ? 413  LEU C CG    1 
ATOM   6808  C  CD1   . LEU C 2  413  ? 477.173 -17.439 658.491 1.00 85.16  ? 413  LEU C CD1   1 
ATOM   6809  C  CD2   . LEU C 2  413  ? 478.260 -15.237 658.674 1.00 94.93  ? 413  LEU C CD2   1 
ATOM   6810  N  N     . GLY C 2  414  ? 481.670 -17.903 656.175 1.00 97.97  ? 414  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2  414  ? 482.987 -17.985 655.570 1.00 98.85  ? 414  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2  414  ? 483.112 -18.625 654.188 1.00 108.12 ? 414  GLY C C     1 
ATOM   6813  O  O     . GLY C 2  414  ? 482.153 -19.177 653.626 1.00 106.90 ? 414  GLY C O     1 
ATOM   6814  N  N     . PRO C 2  415  ? 484.376 -18.587 653.625 1.00 110.50 ? 415  PRO C N     1 
ATOM   6815  C  CA    . PRO C 2  415  ? 484.663 -19.140 652.286 1.00 102.70 ? 415  PRO C CA    1 
ATOM   6816  C  C     . PRO C 2  415  ? 484.451 -20.631 652.064 1.00 102.80 ? 415  PRO C C     1 
ATOM   6817  O  O     . PRO C 2  415  ? 485.337 -21.443 652.373 1.00 102.15 ? 415  PRO C O     1 
ATOM   6818  C  CB    . PRO C 2  415  ? 486.145 -18.787 652.079 1.00 99.76  ? 415  PRO C CB    1 
ATOM   6819  C  CG    . PRO C 2  415  ? 486.710 -18.730 653.450 1.00 96.88  ? 415  PRO C CG    1 
ATOM   6820  C  CD    . PRO C 2  415  ? 485.610 -18.099 654.273 1.00 104.27 ? 415  PRO C CD    1 
ATOM   6821  N  N     . GLY C 2  416  ? 483.219 -20.998 651.726 1.00 101.63 ? 416  GLY C N     1 
ATOM   6822  C  CA    . GLY C 2  416  ? 482.826 -22.367 651.453 1.00 102.45 ? 416  GLY C CA    1 
ATOM   6823  C  C     . GLY C 2  416  ? 481.589 -22.726 652.242 1.00 115.35 ? 416  GLY C C     1 
ATOM   6824  O  O     . GLY C 2  416  ? 481.302 -23.909 652.480 1.00 116.09 ? 416  GLY C O     1 
ATOM   6825  N  N     . GLY C 2  417  ? 480.843 -21.700 652.641 1.00 111.33 ? 417  GLY C N     1 
ATOM   6826  C  CA    . GLY C 2  417  ? 479.704 -21.902 653.503 1.00 103.41 ? 417  GLY C CA    1 
ATOM   6827  C  C     . GLY C 2  417  ? 478.664 -20.838 653.270 1.00 111.48 ? 417  GLY C C     1 
ATOM   6828  O  O     . GLY C 2  417  ? 478.808 -20.004 652.369 1.00 117.56 ? 417  GLY C O     1 
ATOM   6829  N  N     . LEU C 2  418  ? 477.611 -20.873 654.090 1.00 110.15 ? 418  LEU C N     1 
ATOM   6830  C  CA    . LEU C 2  418  ? 476.453 -20.006 653.916 1.00 113.42 ? 418  LEU C CA    1 
ATOM   6831  C  C     . LEU C 2  418  ? 476.882 -18.535 653.869 1.00 117.58 ? 418  LEU C C     1 
ATOM   6832  O  O     . LEU C 2  418  ? 477.929 -18.151 654.406 1.00 112.50 ? 418  LEU C O     1 
ATOM   6833  C  CB    . LEU C 2  418  ? 475.437 -20.276 655.039 1.00 107.69 ? 418  LEU C CB    1 
ATOM   6834  C  CG    . LEU C 2  418  ? 474.614 -21.578 654.964 1.00 100.79 ? 418  LEU C CG    1 
ATOM   6835  C  CD1   . LEU C 2  418  ? 475.402 -22.835 655.321 1.00 90.87  ? 418  LEU C CD1   1 
ATOM   6836  C  CD2   . LEU C 2  418  ? 473.393 -21.467 655.855 1.00 108.21 ? 418  LEU C CD2   1 
ATOM   6837  N  N     . THR C 2  419  ? 476.076 -17.708 653.198 1.00 124.79 ? 419  THR C N     1 
ATOM   6838  C  CA    . THR C 2  419  ? 476.127 -16.261 653.361 1.00 130.10 ? 419  THR C CA    1 
ATOM   6839  C  C     . THR C 2  419  ? 474.989 -15.810 654.292 1.00 131.08 ? 419  THR C C     1 
ATOM   6840  O  O     . THR C 2  419  ? 474.202 -16.613 654.810 1.00 122.87 ? 419  THR C O     1 
ATOM   6841  C  CB    . THR C 2  419  ? 476.036 -15.562 651.992 1.00 126.71 ? 419  THR C CB    1 
ATOM   6842  O  OG1   . THR C 2  419  ? 476.713 -16.348 651.004 1.00 127.76 ? 419  THR C OG1   1 
ATOM   6843  C  CG2   . THR C 2  419  ? 476.656 -14.152 652.014 1.00 125.32 ? 419  THR C CG2   1 
ATOM   6844  N  N     . ARG C 2  420  ? 474.935 -14.504 654.559 1.00 135.38 ? 420  ARG C N     1 
ATOM   6845  C  CA    . ARG C 2  420  ? 473.959 -13.989 655.512 1.00 139.22 ? 420  ARG C CA    1 
ATOM   6846  C  C     . ARG C 2  420  ? 472.605 -13.936 654.833 1.00 140.06 ? 420  ARG C C     1 
ATOM   6847  O  O     . ARG C 2  420  ? 471.592 -14.417 655.360 1.00 130.72 ? 420  ARG C O     1 
ATOM   6848  C  CB    . ARG C 2  420  ? 474.360 -12.587 655.974 1.00 140.36 ? 420  ARG C CB    1 
ATOM   6849  N  N     . GLU C 2  421  ? 472.620 -13.363 653.629 1.00 141.98 ? 421  GLU C N     1 
ATOM   6850  C  CA    . GLU C 2  421  ? 471.503 -13.292 652.709 1.00 140.21 ? 421  GLU C CA    1 
ATOM   6851  C  C     . GLU C 2  421  ? 471.136 -14.663 652.133 1.00 138.71 ? 421  GLU C C     1 
ATOM   6852  O  O     . GLU C 2  421  ? 470.052 -14.803 651.556 1.00 140.85 ? 421  GLU C O     1 
ATOM   6853  C  CB    . GLU C 2  421  ? 471.893 -12.277 651.620 1.00 137.01 ? 421  GLU C CB    1 
ATOM   6854  C  CG    . GLU C 2  421  ? 472.968 -11.279 652.152 1.00 136.52 ? 421  GLU C CG    1 
ATOM   6855  C  CD    . GLU C 2  421  ? 473.484 -10.270 651.132 1.00 138.86 ? 421  GLU C CD    1 
ATOM   6856  O  OE1   . GLU C 2  421  ? 473.660 -10.631 649.942 1.00 135.45 ? 421  GLU C OE1   1 
ATOM   6857  O  OE2   . GLU C 2  421  ? 473.725 -9.110  651.543 1.00 139.30 ? 421  GLU C OE2   1 
ATOM   6858  N  N     . ARG C 2  422  ? 471.996 -15.680 652.309 1.00 135.28 ? 422  ARG C N     1 
ATOM   6859  C  CA    . ARG C 2  422  ? 471.851 -16.989 651.670 1.00 133.13 ? 422  ARG C CA    1 
ATOM   6860  C  C     . ARG C 2  422  ? 471.409 -18.097 652.644 1.00 126.30 ? 422  ARG C C     1 
ATOM   6861  O  O     . ARG C 2  422  ? 471.513 -19.280 652.297 1.00 122.80 ? 422  ARG C O     1 
ATOM   6862  C  CB    . ARG C 2  422  ? 473.170 -17.405 650.975 1.00 133.88 ? 422  ARG C CB    1 
ATOM   6863  C  CG    . ARG C 2  422  ? 473.602 -16.653 649.640 1.00 137.34 ? 422  ARG C CG    1 
ATOM   6864  C  CD    . ARG C 2  422  ? 474.639 -17.483 648.780 1.00 140.95 ? 422  ARG C CD    1 
ATOM   6865  N  NE    . ARG C 2  422  ? 475.064 -16.852 647.513 1.00 144.43 ? 422  ARG C NE    1 
ATOM   6866  C  CZ    . ARG C 2  422  ? 475.660 -17.491 646.493 1.00 148.43 ? 422  ARG C CZ    1 
ATOM   6867  N  NH1   . ARG C 2  422  ? 475.907 -18.796 646.558 1.00 148.40 ? 422  ARG C NH1   1 
ATOM   6868  N  NH2   . ARG C 2  422  ? 476.008 -16.825 645.392 1.00 146.16 ? 422  ARG C NH2   1 
ATOM   6869  N  N     . ALA C 2  423  ? 470.896 -17.752 653.837 1.00 125.85 ? 423  ALA C N     1 
ATOM   6870  C  CA    . ALA C 2  423  ? 470.769 -18.710 654.944 1.00 117.66 ? 423  ALA C CA    1 
ATOM   6871  C  C     . ALA C 2  423  ? 469.369 -18.722 655.557 1.00 114.39 ? 423  ALA C C     1 
ATOM   6872  O  O     . ALA C 2  423  ? 468.824 -17.656 655.871 1.00 108.38 ? 423  ALA C O     1 
ATOM   6873  C  CB    . ALA C 2  423  ? 471.797 -18.395 656.041 1.00 108.84 ? 423  ALA C CB    1 
ATOM   6874  N  N     . GLY C 2  424  ? 468.819 -19.938 655.790 1.00 115.90 ? 424  GLY C N     1 
ATOM   6875  C  CA    . GLY C 2  424  ? 467.473 -20.105 656.315 1.00 111.68 ? 424  GLY C CA    1 
ATOM   6876  C  C     . GLY C 2  424  ? 467.375 -21.182 657.388 1.00 108.45 ? 424  GLY C C     1 
ATOM   6877  O  O     . GLY C 2  424  ? 468.362 -21.847 657.703 1.00 108.72 ? 424  GLY C O     1 
ATOM   6878  N  N     . PHE C 2  425  ? 466.129 -21.414 657.864 1.00 107.35 ? 425  PHE C N     1 
ATOM   6879  C  CA    . PHE C 2  425  ? 465.867 -21.941 659.223 1.00 103.82 ? 425  PHE C CA    1 
ATOM   6880  C  C     . PHE C 2  425  ? 466.526 -23.287 659.550 1.00 98.37  ? 425  PHE C C     1 
ATOM   6881  O  O     . PHE C 2  425  ? 466.988 -23.494 660.682 1.00 97.05  ? 425  PHE C O     1 
ATOM   6882  C  CB    . PHE C 2  425  ? 464.365 -22.168 659.443 1.00 107.44 ? 425  PHE C CB    1 
ATOM   6883  C  CG    . PHE C 2  425  ? 463.540 -20.937 659.684 1.00 105.31 ? 425  PHE C CG    1 
ATOM   6884  C  CD1   . PHE C 2  425  ? 463.014 -20.702 660.954 1.00 103.82 ? 425  PHE C CD1   1 
ATOM   6885  C  CD2   . PHE C 2  425  ? 463.227 -20.058 658.659 1.00 105.54 ? 425  PHE C CD2   1 
ATOM   6886  C  CE1   . PHE C 2  425  ? 462.201 -19.598 661.206 1.00 103.18 ? 425  PHE C CE1   1 
ATOM   6887  C  CE2   . PHE C 2  425  ? 462.417 -18.953 658.902 1.00 104.26 ? 425  PHE C CE2   1 
ATOM   6888  C  CZ    . PHE C 2  425  ? 461.905 -18.721 660.180 1.00 103.66 ? 425  PHE C CZ    1 
ATOM   6889  N  N     . ASP C 2  426  ? 466.529 -24.233 658.609 1.00 99.89  ? 426  ASP C N     1 
ATOM   6890  C  CA    . ASP C 2  426  ? 466.989 -25.596 658.911 1.00 101.22 ? 426  ASP C CA    1 
ATOM   6891  C  C     . ASP C 2  426  ? 468.376 -25.616 659.551 1.00 99.51  ? 426  ASP C C     1 
ATOM   6892  O  O     . ASP C 2  426  ? 468.639 -26.407 660.470 1.00 93.54  ? 426  ASP C O     1 
ATOM   6893  C  CB    . ASP C 2  426  ? 466.902 -26.464 657.658 1.00 103.53 ? 426  ASP C CB    1 
ATOM   6894  C  CG    . ASP C 2  426  ? 465.453 -26.820 657.323 1.00 113.50 ? 426  ASP C CG    1 
ATOM   6895  O  OD1   . ASP C 2  426  ? 464.556 -26.035 657.738 1.00 113.21 ? 426  ASP C OD1   1 
ATOM   6896  O  OD2   . ASP C 2  426  ? 465.204 -27.875 656.681 1.00 114.02 ? 426  ASP C OD2   1 
ATOM   6897  N  N     . VAL C 2  427  ? 469.268 -24.738 659.085 1.00 98.60  ? 427  VAL C N     1 
ATOM   6898  C  CA    . VAL C 2  427  ? 470.660 -24.713 659.529 1.00 91.70  ? 427  VAL C CA    1 
ATOM   6899  C  C     . VAL C 2  427  ? 470.773 -24.071 660.890 1.00 83.67  ? 427  VAL C C     1 
ATOM   6900  O  O     . VAL C 2  427  ? 471.664 -24.424 661.662 1.00 84.63  ? 427  VAL C O     1 
ATOM   6901  C  CB    . VAL C 2  427  ? 471.572 -23.980 658.525 1.00 95.32  ? 427  VAL C CB    1 
ATOM   6902  C  CG1   . VAL C 2  427  ? 472.723 -24.859 658.136 1.00 95.41  ? 427  VAL C CG1   1 
ATOM   6903  C  CG2   . VAL C 2  427  ? 470.794 -23.542 657.263 1.00 95.59  ? 427  VAL C CG2   1 
ATOM   6904  N  N     . ARG C 2  428  ? 469.937 -23.081 661.187 1.00 84.69  ? 428  ARG C N     1 
ATOM   6905  C  CA    . ARG C 2  428  ? 470.054 -22.381 662.455 1.00 82.84  ? 428  ARG C CA    1 
ATOM   6906  C  C     . ARG C 2  428  ? 469.438 -23.149 663.620 1.00 87.55  ? 428  ARG C C     1 
ATOM   6907  O  O     . ARG C 2  428  ? 469.826 -22.918 664.770 1.00 83.50  ? 428  ARG C O     1 
ATOM   6908  C  CB    . ARG C 2  428  ? 469.381 -21.033 662.307 1.00 75.77  ? 428  ARG C CB    1 
ATOM   6909  C  CG    . ARG C 2  428  ? 469.853 -20.334 661.089 1.00 82.19  ? 428  ARG C CG    1 
ATOM   6910  C  CD    . ARG C 2  428  ? 468.990 -19.154 660.852 1.00 86.50  ? 428  ARG C CD    1 
ATOM   6911  N  NE    . ARG C 2  428  ? 469.759 -17.936 661.000 1.00 82.45  ? 428  ARG C NE    1 
ATOM   6912  C  CZ    . ARG C 2  428  ? 470.063 -17.139 659.995 1.00 83.16  ? 428  ARG C CZ    1 
ATOM   6913  N  NH1   . ARG C 2  428  ? 469.648 -17.432 658.769 1.00 96.25  ? 428  ARG C NH1   1 
ATOM   6914  N  NH2   . ARG C 2  428  ? 470.770 -16.051 660.222 1.00 82.38  ? 428  ARG C NH2   1 
ATOM   6915  N  N     . ASP C 2  429  ? 468.606 -24.147 663.338 1.00 89.21  ? 429  ASP C N     1 
ATOM   6916  C  CA    . ASP C 2  429  ? 467.919 -24.916 664.369 1.00 87.90  ? 429  ASP C CA    1 
ATOM   6917  C  C     . ASP C 2  429  ? 468.913 -25.664 665.248 1.00 85.72  ? 429  ASP C C     1 
ATOM   6918  O  O     . ASP C 2  429  ? 470.077 -25.877 664.887 1.00 82.11  ? 429  ASP C O     1 
ATOM   6919  C  CB    . ASP C 2  429  ? 466.950 -25.913 663.734 1.00 96.27  ? 429  ASP C CB    1 
ATOM   6920  C  CG    . ASP C 2  429  ? 465.509 -25.480 663.827 1.00 103.07 ? 429  ASP C CG    1 
ATOM   6921  O  OD1   . ASP C 2  429  ? 465.135 -24.869 664.859 1.00 102.73 ? 429  ASP C OD1   1 
ATOM   6922  O  OD2   . ASP C 2  429  ? 464.774 -25.709 662.836 1.00 107.06 ? 429  ASP C OD2   1 
ATOM   6923  N  N     . VAL C 2  430  ? 468.448 -26.031 666.434 1.00 84.35  ? 430  VAL C N     1 
ATOM   6924  C  CA    . VAL C 2  430  ? 469.193 -26.940 667.288 1.00 84.06  ? 430  VAL C CA    1 
ATOM   6925  C  C     . VAL C 2  430  ? 468.719 -28.336 666.922 1.00 86.71  ? 430  VAL C C     1 
ATOM   6926  O  O     . VAL C 2  430  ? 467.563 -28.688 667.179 1.00 94.91  ? 430  VAL C O     1 
ATOM   6927  C  CB    . VAL C 2  430  ? 468.977 -26.661 668.778 1.00 77.84  ? 430  VAL C CB    1 
ATOM   6928  C  CG1   . VAL C 2  430  ? 469.439 -27.854 669.588 1.00 73.65  ? 430  VAL C CG1   1 
ATOM   6929  C  CG2   . VAL C 2  430  ? 469.729 -25.419 669.199 1.00 79.80  ? 430  VAL C CG2   1 
ATOM   6930  N  N     . HIS C 2  431  ? 469.608 -29.113 666.287 1.00 83.03  ? 431  HIS C N     1 
ATOM   6931  C  CA    . HIS C 2  431  ? 469.317 -30.488 665.895 1.00 80.46  ? 431  HIS C CA    1 
ATOM   6932  C  C     . HIS C 2  431  ? 469.428 -31.434 667.096 1.00 83.18  ? 431  HIS C C     1 
ATOM   6933  O  O     . HIS C 2  431  ? 470.218 -31.221 668.030 1.00 81.82  ? 431  HIS C O     1 
ATOM   6934  C  CB    . HIS C 2  431  ? 470.265 -30.909 664.765 1.00 75.06  ? 431  HIS C CB    1 
ATOM   6935  C  CG    . HIS C 2  431  ? 469.818 -32.122 663.999 1.00 77.10  ? 431  HIS C CG    1 
ATOM   6936  N  ND1   . HIS C 2  431  ? 470.018 -33.410 664.455 1.00 75.34  ? 431  HIS C ND1   1 
ATOM   6937  C  CD2   . HIS C 2  431  ? 469.141 -32.242 662.832 1.00 77.84  ? 431  HIS C CD2   1 
ATOM   6938  C  CE1   . HIS C 2  431  ? 469.516 -34.269 663.588 1.00 74.80  ? 431  HIS C CE1   1 
ATOM   6939  N  NE2   . HIS C 2  431  ? 468.967 -33.586 662.600 1.00 78.84  ? 431  HIS C NE2   1 
ATOM   6940  N  N     . ARG C 2  432  ? 468.640 -32.512 667.052 1.00 75.24  ? 432  ARG C N     1 
ATOM   6941  C  CA    . ARG C 2  432  ? 468.696 -33.475 668.142 1.00 76.36  ? 432  ARG C CA    1 
ATOM   6942  C  C     . ARG C 2  432  ? 470.100 -34.029 668.340 1.00 77.69  ? 432  ARG C C     1 
ATOM   6943  O  O     . ARG C 2  432  ? 470.501 -34.307 669.473 1.00 86.44  ? 432  ARG C O     1 
ATOM   6944  C  CB    . ARG C 2  432  ? 467.689 -34.591 667.898 1.00 81.33  ? 432  ARG C CB    1 
ATOM   6945  C  CG    . ARG C 2  432  ? 467.879 -35.385 666.658 1.00 80.82  ? 432  ARG C CG    1 
ATOM   6946  C  CD    . ARG C 2  432  ? 466.906 -36.521 666.676 1.00 83.11  ? 432  ARG C CD    1 
ATOM   6947  N  NE    . ARG C 2  432  ? 467.058 -37.414 665.541 1.00 85.61  ? 432  ARG C NE    1 
ATOM   6948  C  CZ    . ARG C 2  432  ? 467.936 -38.412 665.538 1.00 89.90  ? 432  ARG C CZ    1 
ATOM   6949  N  NH1   . ARG C 2  432  ? 468.719 -38.600 666.594 1.00 92.22  ? 432  ARG C NH1   1 
ATOM   6950  N  NH2   . ARG C 2  432  ? 468.033 -39.218 664.494 1.00 94.43  ? 432  ARG C NH2   1 
ATOM   6951  N  N     . THR C 2  433  ? 470.874 -34.148 667.271 1.00 81.27  ? 433  THR C N     1 
ATOM   6952  C  CA    . THR C 2  433  ? 472.230 -34.666 667.375 1.00 84.00  ? 433  THR C CA    1 
ATOM   6953  C  C     . THR C 2  433  ? 473.195 -33.635 667.961 1.00 85.49  ? 433  THR C C     1 
ATOM   6954  O  O     . THR C 2  433  ? 474.389 -33.940 668.106 1.00 85.66  ? 433  THR C O     1 
ATOM   6955  C  CB    . THR C 2  433  ? 472.733 -35.185 666.020 1.00 78.44  ? 433  THR C CB    1 
ATOM   6956  O  OG1   . THR C 2  433  ? 472.736 -34.131 665.058 1.00 78.98  ? 433  THR C OG1   1 
ATOM   6957  C  CG2   . THR C 2  433  ? 471.833 -36.282 665.533 1.00 79.48  ? 433  THR C CG2   1 
ATOM   6958  N  N     . HIS C 2  434  ? 472.743 -32.396 668.207 1.00 80.03  ? 434  HIS C N     1 
ATOM   6959  C  CA    . HIS C 2  434  ? 473.628 -31.449 668.868 1.00 80.82  ? 434  HIS C CA    1 
ATOM   6960  C  C     . HIS C 2  434  ? 473.906 -31.868 670.299 1.00 84.54  ? 434  HIS C C     1 
ATOM   6961  O  O     . HIS C 2  434  ? 474.910 -31.428 670.876 1.00 87.76  ? 434  HIS C O     1 
ATOM   6962  C  CB    . HIS C 2  434  ? 473.043 -30.029 668.876 1.00 83.14  ? 434  HIS C CB    1 
ATOM   6963  C  CG    . HIS C 2  434  ? 473.122 -29.302 667.562 1.00 83.97  ? 434  HIS C CG    1 
ATOM   6964  N  ND1   . HIS C 2  434  ? 473.309 -29.940 666.352 1.00 80.10  ? 434  HIS C ND1   1 
ATOM   6965  C  CD2   . HIS C 2  434  ? 473.051 -27.977 667.280 1.00 81.24  ? 434  HIS C CD2   1 
ATOM   6966  C  CE1   . HIS C 2  434  ? 473.326 -29.045 665.381 1.00 79.59  ? 434  HIS C CE1   1 
ATOM   6967  N  NE2   . HIS C 2  434  ? 473.178 -27.846 665.918 1.00 82.19  ? 434  HIS C NE2   1 
ATOM   6968  N  N     . TYR C 2  435  ? 473.102 -32.784 670.836 1.00 81.20  ? 435  TYR C N     1 
ATOM   6969  C  CA    . TYR C 2  435  ? 473.252 -33.245 672.207 1.00 80.62  ? 435  TYR C CA    1 
ATOM   6970  C  C     . TYR C 2  435  ? 474.655 -33.753 672.494 1.00 81.00  ? 435  TYR C C     1 
ATOM   6971  O  O     . TYR C 2  435  ? 475.133 -34.700 671.870 1.00 84.90  ? 435  TYR C O     1 
ATOM   6972  C  CB    . TYR C 2  435  ? 472.212 -34.337 672.462 1.00 81.74  ? 435  TYR C CB    1 
ATOM   6973  C  CG    . TYR C 2  435  ? 472.103 -34.750 673.906 1.00 91.16  ? 435  TYR C CG    1 
ATOM   6974  C  CD1   . TYR C 2  435  ? 471.065 -34.293 674.723 1.00 89.57  ? 435  TYR C CD1   1 
ATOM   6975  C  CD2   . TYR C 2  435  ? 473.003 -35.672 674.444 1.00 92.11  ? 435  TYR C CD2   1 
ATOM   6976  C  CE1   . TYR C 2  435  ? 470.967 -34.710 676.058 1.00 88.11  ? 435  TYR C CE1   1 
ATOM   6977  C  CE2   . TYR C 2  435  ? 472.906 -36.092 675.769 1.00 91.57  ? 435  TYR C CE2   1 
ATOM   6978  C  CZ    . TYR C 2  435  ? 471.890 -35.615 676.561 1.00 88.77  ? 435  TYR C CZ    1 
ATOM   6979  O  OH    . TYR C 2  435  ? 471.827 -36.050 677.856 1.00 91.08  ? 435  TYR C OH    1 
ATOM   6980  N  N     . GLY C 2  436  ? 475.309 -33.133 673.464 1.00 80.13  ? 436  GLY C N     1 
ATOM   6981  C  CA    . GLY C 2  436  ? 476.656 -33.534 673.827 1.00 89.09  ? 436  GLY C CA    1 
ATOM   6982  C  C     . GLY C 2  436  ? 477.771 -33.096 672.889 1.00 88.44  ? 436  GLY C C     1 
ATOM   6983  O  O     . GLY C 2  436  ? 478.955 -33.319 673.217 1.00 87.04  ? 436  GLY C O     1 
ATOM   6984  N  N     . ARG C 2  437  ? 477.448 -32.443 671.768 1.00 78.63  ? 437  ARG C N     1 
ATOM   6985  C  CA    . ARG C 2  437  ? 478.444 -32.089 670.769 1.00 75.63  ? 437  ARG C CA    1 
ATOM   6986  C  C     . ARG C 2  437  ? 478.549 -30.583 670.581 1.00 80.69  ? 437  ARG C C     1 
ATOM   6987  O  O     . ARG C 2  437  ? 479.653 -30.033 670.713 1.00 80.77  ? 437  ARG C O     1 
ATOM   6988  C  CB    . ARG C 2  437  ? 478.175 -32.765 669.436 1.00 84.77  ? 437  ARG C CB    1 
ATOM   6989  C  CG    . ARG C 2  437  ? 478.337 -34.247 669.467 1.00 84.33  ? 437  ARG C CG    1 
ATOM   6990  C  CD    . ARG C 2  437  ? 477.926 -34.788 668.137 1.00 86.42  ? 437  ARG C CD    1 
ATOM   6991  N  NE    . ARG C 2  437  ? 477.885 -36.236 668.132 1.00 89.35  ? 437  ARG C NE    1 
ATOM   6992  C  CZ    . ARG C 2  437  ? 476.833 -36.924 668.551 1.00 90.94  ? 437  ARG C CZ    1 
ATOM   6993  N  NH1   . ARG C 2  437  ? 475.757 -36.285 668.981 1.00 86.55  ? 437  ARG C NH1   1 
ATOM   6994  N  NH2   . ARG C 2  437  ? 476.848 -38.242 668.528 1.00 97.38  ? 437  ARG C NH2   1 
ATOM   6995  N  N     . ILE C 2  438  ? 477.457 -29.910 670.198 1.00 77.36  ? 438  ILE C N     1 
ATOM   6996  C  CA    . ILE C 2  438  ? 477.430 -28.458 670.019 1.00 79.28  ? 438  ILE C CA    1 
ATOM   6997  C  C     . ILE C 2  438  ? 476.507 -27.865 671.075 1.00 78.02  ? 438  ILE C C     1 
ATOM   6998  O  O     . ILE C 2  438  ? 475.371 -28.316 671.235 1.00 78.53  ? 438  ILE C O     1 
ATOM   6999  C  CB    . ILE C 2  438  ? 476.960 -28.045 668.617 1.00 77.93  ? 438  ILE C CB    1 
ATOM   7000  C  CG1   . ILE C 2  438  ? 477.864 -28.611 667.532 1.00 77.28  ? 438  ILE C CG1   1 
ATOM   7001  C  CG2   . ILE C 2  438  ? 476.922 -26.554 668.523 1.00 80.44  ? 438  ILE C CG2   1 
ATOM   7002  C  CD1   . ILE C 2  438  ? 477.389 -28.242 666.144 1.00 72.95  ? 438  ILE C CD1   1 
ATOM   7003  N  N     . CYS C 2  439  ? 476.981 -26.834 671.769 1.00 75.71  ? 439  CYS C N     1 
ATOM   7004  C  CA    . CYS C 2  439  ? 476.200 -26.230 672.843 1.00 72.74  ? 439  CYS C CA    1 
ATOM   7005  C  C     . CYS C 2  439  ? 474.909 -25.605 672.340 1.00 77.49  ? 439  CYS C C     1 
ATOM   7006  O  O     . CYS C 2  439  ? 474.929 -24.882 671.325 1.00 82.85  ? 439  CYS C O     1 
ATOM   7007  C  CB    . CYS C 2  439  ? 476.991 -25.166 673.588 1.00 75.68  ? 439  CYS C CB    1 
ATOM   7008  S  SG    . CYS C 2  439  ? 476.044 -24.465 674.978 1.00 72.30  ? 439  CYS C SG    1 
ATOM   7009  N  N     . PRO C 2  440  ? 473.761 -25.955 672.944 1.00 73.50  ? 440  PRO C N     1 
ATOM   7010  C  CA    . PRO C 2  440  ? 472.469 -25.344 672.572 1.00 73.14  ? 440  PRO C CA    1 
ATOM   7011  C  C     . PRO C 2  440  ? 472.300 -23.907 673.068 1.00 73.93  ? 440  PRO C C     1 
ATOM   7012  O  O     . PRO C 2  440  ? 471.351 -23.223 672.650 1.00 77.08  ? 440  PRO C O     1 
ATOM   7013  C  CB    . PRO C 2  440  ? 471.438 -26.294 673.194 1.00 69.83  ? 440  PRO C CB    1 
ATOM   7014  C  CG    . PRO C 2  440  ? 472.138 -26.874 674.353 1.00 70.49  ? 440  PRO C CG    1 
ATOM   7015  C  CD    . PRO C 2  440  ? 473.591 -27.009 673.959 1.00 72.35  ? 440  PRO C CD    1 
ATOM   7016  N  N     . VAL C 2  441  ? 473.139 -23.457 673.993 1.00 72.08  ? 441  VAL C N     1 
ATOM   7017  C  CA    . VAL C 2  441  ? 472.988 -22.135 674.603 1.00 79.61  ? 441  VAL C CA    1 
ATOM   7018  C  C     . VAL C 2  441  ? 473.826 -21.090 673.867 1.00 75.53  ? 441  VAL C C     1 
ATOM   7019  O  O     . VAL C 2  441  ? 473.295 -20.106 673.343 1.00 71.73  ? 441  VAL C O     1 
ATOM   7020  C  CB    . VAL C 2  441  ? 473.346 -22.192 676.118 1.00 79.01  ? 441  VAL C CB    1 
ATOM   7021  C  CG1   . VAL C 2  441  ? 473.395 -20.805 676.759 1.00 69.94  ? 441  VAL C CG1   1 
ATOM   7022  C  CG2   . VAL C 2  441  ? 472.358 -23.036 676.866 1.00 75.80  ? 441  VAL C CG2   1 
ATOM   7023  N  N     . GLU C 2  442  ? 475.129 -21.338 673.711 1.00 75.05  ? 442  GLU C N     1 
ATOM   7024  C  CA    . GLU C 2  442  ? 476.062 -20.269 673.368 1.00 78.32  ? 442  GLU C CA    1 
ATOM   7025  C  C     . GLU C 2  442  ? 476.027 -20.099 671.863 1.00 74.88  ? 442  GLU C C     1 
ATOM   7026  O  O     . GLU C 2  442  ? 476.541 -20.929 671.106 1.00 71.85  ? 442  GLU C O     1 
ATOM   7027  C  CB    . GLU C 2  442  ? 477.471 -20.582 673.879 1.00 78.58  ? 442  GLU C CB    1 
ATOM   7028  C  CG    . GLU C 2  442  ? 478.416 -19.392 673.733 1.00 79.51  ? 442  GLU C CG    1 
ATOM   7029  C  CD    . GLU C 2  442  ? 479.889 -19.744 673.584 1.00 77.46  ? 442  GLU C CD    1 
ATOM   7030  O  OE1   . GLU C 2  442  ? 480.445 -19.334 672.532 1.00 85.78  ? 442  GLU C OE1   1 
ATOM   7031  O  OE2   . GLU C 2  442  ? 480.501 -20.342 674.522 1.00 69.69  ? 442  GLU C OE2   1 
ATOM   7032  N  N     . THR C 2  443  ? 475.334 -19.037 671.457 1.00 74.18  ? 443  THR C N     1 
ATOM   7033  C  CA    . THR C 2  443  ? 475.137 -18.567 670.093 1.00 78.97  ? 443  THR C CA    1 
ATOM   7034  C  C     . THR C 2  443  ? 474.897 -17.067 670.115 1.00 80.43  ? 443  THR C C     1 
ATOM   7035  O  O     . THR C 2  443  ? 474.447 -16.533 671.135 1.00 80.33  ? 443  THR C O     1 
ATOM   7036  C  CB    . THR C 2  443  ? 473.927 -19.266 669.456 1.00 77.13  ? 443  THR C CB    1 
ATOM   7037  O  OG1   . THR C 2  443  ? 473.817 -18.887 668.083 1.00 81.09  ? 443  THR C OG1   1 
ATOM   7038  C  CG2   . THR C 2  443  ? 472.656 -18.889 670.173 1.00 77.16  ? 443  THR C CG2   1 
ATOM   7039  N  N     . PRO C 2  444  ? 475.197 -16.355 669.027 1.00 80.83  ? 444  PRO C N     1 
ATOM   7040  C  CA    . PRO C 2  444  ? 474.913 -14.916 669.012 1.00 81.80  ? 444  PRO C CA    1 
ATOM   7041  C  C     . PRO C 2  444  ? 473.422 -14.666 668.905 1.00 83.07  ? 444  PRO C C     1 
ATOM   7042  O  O     . PRO C 2  444  ? 472.696 -15.382 668.212 1.00 85.06  ? 444  PRO C O     1 
ATOM   7043  C  CB    . PRO C 2  444  ? 475.636 -14.410 667.757 1.00 82.15  ? 444  PRO C CB    1 
ATOM   7044  C  CG    . PRO C 2  444  ? 476.639 -15.427 667.462 1.00 86.72  ? 444  PRO C CG    1 
ATOM   7045  C  CD    . PRO C 2  444  ? 476.034 -16.747 667.887 1.00 81.81  ? 444  PRO C CD    1 
ATOM   7046  N  N     . GLU C 2  445  ? 472.972 -13.650 669.611 1.00 86.90  ? 445  GLU C N     1 
ATOM   7047  C  CA    . GLU C 2  445  ? 471.631 -13.117 669.454 1.00 84.83  ? 445  GLU C CA    1 
ATOM   7048  C  C     . GLU C 2  445  ? 471.640 -12.173 668.255 1.00 84.86  ? 445  GLU C C     1 
ATOM   7049  O  O     . GLU C 2  445  ? 472.627 -11.476 667.997 1.00 87.10  ? 445  GLU C O     1 
ATOM   7050  C  CB    . GLU C 2  445  ? 471.201 -12.498 670.784 1.00 86.58  ? 445  GLU C CB    1 
ATOM   7051  C  CG    . GLU C 2  445  ? 471.296 -11.029 670.992 1.00 85.97  ? 445  GLU C CG    1 
ATOM   7052  C  CD    . GLU C 2  445  ? 470.786 -10.696 672.379 1.00 100.72 ? 445  GLU C CD    1 
ATOM   7053  O  OE1   . GLU C 2  445  ? 471.643 -10.660 673.299 1.00 102.82 ? 445  GLU C OE1   1 
ATOM   7054  O  OE2   . GLU C 2  445  ? 469.553 -10.522 672.572 1.00 105.98 ? 445  GLU C OE2   1 
ATOM   7055  N  N     . GLY C 2  446  ? 470.567 -12.184 667.488 1.00 87.07  ? 446  GLY C N     1 
ATOM   7056  C  CA    . GLY C 2  446  ? 470.515 -11.368 666.289 1.00 84.22  ? 446  GLY C CA    1 
ATOM   7057  C  C     . GLY C 2  446  ? 470.734 -12.183 665.027 1.00 83.70  ? 446  GLY C C     1 
ATOM   7058  O  O     . GLY C 2  446  ? 470.462 -13.387 664.974 1.00 83.59  ? 446  GLY C O     1 
ATOM   7059  N  N     . ALA C 2  447  ? 471.177 -11.485 663.969 1.00 82.83  ? 447  ALA C N     1 
ATOM   7060  C  CA    . ALA C 2  447  ? 471.219 -12.061 662.619 1.00 73.64  ? 447  ALA C CA    1 
ATOM   7061  C  C     . ALA C 2  447  ? 471.954 -13.401 662.489 1.00 73.21  ? 447  ALA C C     1 
ATOM   7062  O  O     . ALA C 2  447  ? 471.570 -14.242 661.675 1.00 72.98  ? 447  ALA C O     1 
ATOM   7063  C  CB    . ALA C 2  447  ? 471.844 -11.045 661.680 1.00 71.38  ? 447  ALA C CB    1 
ATOM   7064  N  N     . ASN C 2  448  ? 472.976 -13.636 663.288 1.00 79.10  ? 448  ASN C N     1 
ATOM   7065  C  CA    . ASN C 2  448  ? 473.790 -14.848 663.226 1.00 82.29  ? 448  ASN C CA    1 
ATOM   7066  C  C     . ASN C 2  448  ? 473.275 -16.030 664.074 1.00 84.52  ? 448  ASN C C     1 
ATOM   7067  O  O     . ASN C 2  448  ? 473.983 -17.036 664.202 1.00 84.55  ? 448  ASN C O     1 
ATOM   7068  C  CB    . ASN C 2  448  ? 475.223 -14.495 663.603 1.00 91.80  ? 448  ASN C CB    1 
ATOM   7069  C  CG    . ASN C 2  448  ? 475.950 -13.789 662.494 1.00 92.68  ? 448  ASN C CG    1 
ATOM   7070  O  OD1   . ASN C 2  448  ? 475.794 -14.122 661.323 1.00 95.45  ? 448  ASN C OD1   1 
ATOM   7071  N  ND2   . ASN C 2  448  ? 476.687 -12.757 662.849 1.00 102.27 ? 448  ASN C ND2   1 
ATOM   7072  N  N     . ILE C 2  449  ? 472.091 -15.934 664.677 1.00 81.37  ? 449  ILE C N     1 
ATOM   7073  C  CA    . ILE C 2  449  ? 471.615 -16.989 665.563 1.00 77.50  ? 449  ILE C CA    1 
ATOM   7074  C  C     . ILE C 2  449  ? 471.645 -18.341 664.863 1.00 79.15  ? 449  ILE C C     1 
ATOM   7075  O  O     . ILE C 2  449  ? 471.169 -18.491 663.734 1.00 82.15  ? 449  ILE C O     1 
ATOM   7076  C  CB    . ILE C 2  449  ? 470.197 -16.637 666.048 1.00 84.95  ? 449  ILE C CB    1 
ATOM   7077  C  CG1   . ILE C 2  449  ? 469.701 -17.568 667.177 1.00 84.64  ? 449  ILE C CG1   1 
ATOM   7078  C  CG2   . ILE C 2  449  ? 469.252 -16.499 664.857 1.00 87.06  ? 449  ILE C CG2   1 
ATOM   7079  C  CD1   . ILE C 2  449  ? 470.032 -17.122 668.579 1.00 84.75  ? 449  ILE C CD1   1 
ATOM   7080  N  N     . GLY C 2  450  ? 472.279 -19.318 665.515 1.00 80.48  ? 450  GLY C N     1 
ATOM   7081  C  CA    . GLY C 2  450  ? 472.389 -20.671 665.006 1.00 80.39  ? 450  GLY C CA    1 
ATOM   7082  C  C     . GLY C 2  450  ? 473.489 -20.960 664.007 1.00 82.85  ? 450  GLY C C     1 
ATOM   7083  O  O     . GLY C 2  450  ? 473.798 -22.142 663.791 1.00 89.50  ? 450  GLY C O     1 
ATOM   7084  N  N     . LEU C 2  451  ? 474.078 -19.938 663.371 1.00 81.00  ? 451  LEU C N     1 
ATOM   7085  C  CA    . LEU C 2  451  ? 475.180 -20.150 662.424 1.00 78.00  ? 451  LEU C CA    1 
ATOM   7086  C  C     . LEU C 2  451  ? 476.528 -20.297 663.139 1.00 81.32  ? 451  LEU C C     1 
ATOM   7087  O  O     . LEU C 2  451  ? 477.336 -21.168 662.783 1.00 81.68  ? 451  LEU C O     1 
ATOM   7088  C  CB    . LEU C 2  451  ? 475.221 -18.993 661.427 1.00 72.93  ? 451  LEU C CB    1 
ATOM   7089  C  CG    . LEU C 2  451  ? 473.874 -18.787 660.744 1.00 75.66  ? 451  LEU C CG    1 
ATOM   7090  C  CD1   . LEU C 2  451  ? 473.965 -17.740 659.708 1.00 78.09  ? 451  LEU C CD1   1 
ATOM   7091  C  CD2   . LEU C 2  451  ? 473.441 -20.078 660.086 1.00 80.16  ? 451  LEU C CD2   1 
ATOM   7092  N  N     . ILE C 2  452  ? 476.768 -19.470 664.157 1.00 79.17  ? 452  ILE C N     1 
ATOM   7093  C  CA    . ILE C 2  452  ? 477.944 -19.535 665.022 1.00 75.75  ? 452  ILE C CA    1 
ATOM   7094  C  C     . ILE C 2  452  ? 477.575 -20.158 666.371 1.00 77.89  ? 452  ILE C C     1 
ATOM   7095  O  O     . ILE C 2  452  ? 476.638 -19.706 667.039 1.00 77.39  ? 452  ILE C O     1 
ATOM   7096  C  CB    . ILE C 2  452  ? 478.567 -18.145 665.206 1.00 70.48  ? 452  ILE C CB    1 
ATOM   7097  C  CG1   . ILE C 2  452  ? 478.607 -17.417 663.879 1.00 75.12  ? 452  ILE C CG1   1 
ATOM   7098  C  CG2   . ILE C 2  452  ? 479.931 -18.220 665.825 1.00 75.37  ? 452  ILE C CG2   1 
ATOM   7099  C  CD1   . ILE C 2  452  ? 478.921 -15.961 664.041 1.00 87.65  ? 452  ILE C CD1   1 
ATOM   7100  N  N     . THR C 2  453  ? 478.281 -21.234 666.747 1.00 77.82  ? 453  THR C N     1 
ATOM   7101  C  CA    . THR C 2  453  ? 478.035 -22.016 667.960 1.00 77.81  ? 453  THR C CA    1 
ATOM   7102  C  C     . THR C 2  453  ? 479.342 -22.306 668.692 1.00 75.77  ? 453  THR C C     1 
ATOM   7103  O  O     . THR C 2  453  ? 480.366 -21.677 668.420 1.00 71.65  ? 453  THR C O     1 
ATOM   7104  C  CB    . THR C 2  453  ? 477.307 -23.328 667.674 1.00 78.48  ? 453  THR C CB    1 
ATOM   7105  O  OG1   . THR C 2  453  ? 477.805 -23.930 666.474 1.00 82.58  ? 453  THR C OG1   1 
ATOM   7106  C  CG2   . THR C 2  453  ? 475.812 -23.079 667.529 1.00 85.05  ? 453  THR C CG2   1 
ATOM   7107  N  N     . SER C 2  454  ? 479.284 -23.112 669.739 1.00 81.36  ? 454  SER C N     1 
ATOM   7108  C  CA    . SER C 2  454  ? 480.478 -23.381 670.521 1.00 78.92  ? 454  SER C CA    1 
ATOM   7109  C  C     . SER C 2  454  ? 480.559 -24.872 670.768 1.00 79.11  ? 454  SER C C     1 
ATOM   7110  O  O     . SER C 2  454  ? 479.540 -25.551 670.929 1.00 81.59  ? 454  SER C O     1 
ATOM   7111  C  CB    . SER C 2  454  ? 480.547 -22.637 671.825 1.00 72.77  ? 454  SER C CB    1 
ATOM   7112  O  OG    . SER C 2  454  ? 481.918 -22.360 672.057 1.00 74.60  ? 454  SER C OG    1 
ATOM   7113  N  N     . LEU C 2  455  ? 481.780 -25.377 670.719 1.00 81.55  ? 455  LEU C N     1 
ATOM   7114  C  CA    . LEU C 2  455  ? 482.020 -26.790 670.941 1.00 82.24  ? 455  LEU C CA    1 
ATOM   7115  C  C     . LEU C 2  455  ? 481.591 -27.177 672.346 1.00 77.47  ? 455  LEU C C     1 
ATOM   7116  O  O     . LEU C 2  455  ? 481.911 -26.479 673.310 1.00 78.97  ? 455  LEU C O     1 
ATOM   7117  C  CB    . LEU C 2  455  ? 483.517 -27.050 670.747 1.00 82.21  ? 455  LEU C CB    1 
ATOM   7118  C  CG    . LEU C 2  455  ? 484.036 -28.466 670.616 1.00 79.27  ? 455  LEU C CG    1 
ATOM   7119  C  CD1   . LEU C 2  455  ? 483.397 -29.072 669.367 1.00 68.08  ? 455  LEU C CD1   1 
ATOM   7120  C  CD2   . LEU C 2  455  ? 485.560 -28.437 670.550 1.00 71.93  ? 455  LEU C CD2   1 
ATOM   7121  N  N     . ALA C 2  456  ? 480.897 -28.312 672.467 1.00 75.16  ? 456  ALA C N     1 
ATOM   7122  C  CA    . ALA C 2  456  ? 480.506 -28.768 673.794 1.00 75.36  ? 456  ALA C CA    1 
ATOM   7123  C  C     . ALA C 2  456  ? 481.753 -29.185 674.569 1.00 79.98  ? 456  ALA C C     1 
ATOM   7124  O  O     . ALA C 2  456  ? 482.822 -29.431 673.993 1.00 81.59  ? 456  ALA C O     1 
ATOM   7125  C  CB    . ALA C 2  456  ? 479.498 -29.915 673.727 1.00 73.15  ? 456  ALA C CB    1 
ATOM   7126  N  N     . ALA C 2  457  ? 481.626 -29.192 675.898 1.00 74.57  ? 457  ALA C N     1 
ATOM   7127  C  CA    . ALA C 2  457  ? 482.802 -29.350 676.748 1.00 78.37  ? 457  ALA C CA    1 
ATOM   7128  C  C     . ALA C 2  457  ? 483.477 -30.711 676.576 1.00 81.40  ? 457  ALA C C     1 
ATOM   7129  O  O     . ALA C 2  457  ? 484.710 -30.786 676.459 1.00 83.77  ? 457  ALA C O     1 
ATOM   7130  C  CB    . ALA C 2  457  ? 482.425 -29.104 678.206 1.00 78.92  ? 457  ALA C CB    1 
ATOM   7131  N  N     . TYR C 2  458  ? 482.703 -31.795 676.521 1.00 79.61  ? 458  TYR C N     1 
ATOM   7132  C  CA    . TYR C 2  458  ? 483.344 -33.097 676.427 1.00 81.13  ? 458  TYR C CA    1 
ATOM   7133  C  C     . TYR C 2  458  ? 483.514 -33.587 675.012 1.00 85.94  ? 458  TYR C C     1 
ATOM   7134  O  O     . TYR C 2  458  ? 484.014 -34.703 674.832 1.00 87.49  ? 458  TYR C O     1 
ATOM   7135  C  CB    . TYR C 2  458  ? 482.567 -34.162 677.188 1.00 83.68  ? 458  TYR C CB    1 
ATOM   7136  C  CG    . TYR C 2  458  ? 482.947 -34.276 678.646 1.00 86.28  ? 458  TYR C CG    1 
ATOM   7137  C  CD1   . TYR C 2  458  ? 484.170 -34.814 679.025 1.00 87.01  ? 458  TYR C CD1   1 
ATOM   7138  C  CD2   . TYR C 2  458  ? 482.054 -33.904 679.646 1.00 84.16  ? 458  TYR C CD2   1 
ATOM   7139  C  CE1   . TYR C 2  458  ? 484.517 -34.933 680.365 1.00 90.50  ? 458  TYR C CE1   1 
ATOM   7140  C  CE2   . TYR C 2  458  ? 482.381 -34.022 680.980 1.00 88.13  ? 458  TYR C CE2   1 
ATOM   7141  C  CZ    . TYR C 2  458  ? 483.616 -34.539 681.345 1.00 93.57  ? 458  TYR C CZ    1 
ATOM   7142  O  OH    . TYR C 2  458  ? 483.944 -34.652 682.691 1.00 90.58  ? 458  TYR C OH    1 
ATOM   7143  N  N     . ALA C 2  459  ? 483.134 -32.787 674.017 1.00 87.77  ? 459  ALA C N     1 
ATOM   7144  C  CA    . ALA C 2  459  ? 483.195 -33.205 672.621 1.00 85.47  ? 459  ALA C CA    1 
ATOM   7145  C  C     . ALA C 2  459  ? 484.623 -33.105 672.090 1.00 86.01  ? 459  ALA C C     1 
ATOM   7146  O  O     . ALA C 2  459  ? 485.405 -32.229 672.492 1.00 86.03  ? 459  ALA C O     1 
ATOM   7147  C  CB    . ALA C 2  459  ? 482.242 -32.370 671.756 1.00 75.88  ? 459  ALA C CB    1 
ATOM   7148  N  N     . ARG C 2  460  ? 484.969 -34.031 671.194 1.00 84.50  ? 460  ARG C N     1 
ATOM   7149  C  CA    . ARG C 2  460  ? 486.195 -33.882 670.424 1.00 89.72  ? 460  ARG C CA    1 
ATOM   7150  C  C     . ARG C 2  460  ? 485.922 -34.272 668.977 1.00 88.68  ? 460  ARG C C     1 
ATOM   7151  O  O     . ARG C 2  460  ? 485.089 -35.145 668.700 1.00 85.25  ? 460  ARG C O     1 
ATOM   7152  C  CB    . ARG C 2  460  ? 487.361 -34.704 670.980 1.00 97.89  ? 460  ARG C CB    1 
ATOM   7153  C  CG    . ARG C 2  460  ? 486.988 -35.978 671.688 1.00 101.85 ? 460  ARG C CG    1 
ATOM   7154  C  CD    . ARG C 2  460  ? 488.192 -36.951 671.631 1.00 107.56 ? 460  ARG C CD    1 
ATOM   7155  N  NE    . ARG C 2  460  ? 489.420 -36.283 672.078 1.00 100.81 ? 460  ARG C NE    1 
ATOM   7156  C  CZ    . ARG C 2  460  ? 489.809 -36.260 673.354 1.00 99.36  ? 460  ARG C CZ    1 
ATOM   7157  N  NH1   . ARG C 2  460  ? 489.063 -36.859 674.287 1.00 92.35  ? 460  ARG C NH1   1 
ATOM   7158  N  NH2   . ARG C 2  460  ? 490.927 -35.636 673.706 1.00 100.10 ? 460  ARG C NH2   1 
ATOM   7159  N  N     . VAL C 2  461  ? 486.628 -33.589 668.063 1.00 91.29  ? 461  VAL C N     1 
ATOM   7160  C  CA    . VAL C 2  461  ? 486.523 -33.804 666.618 1.00 87.07  ? 461  VAL C CA    1 
ATOM   7161  C  C     . VAL C 2  461  ? 487.475 -34.927 666.189 1.00 81.91  ? 461  VAL C C     1 
ATOM   7162  O  O     . VAL C 2  461  ? 488.697 -34.817 666.365 1.00 73.79  ? 461  VAL C O     1 
ATOM   7163  C  CB    . VAL C 2  461  ? 486.860 -32.502 665.883 1.00 82.18  ? 461  VAL C CB    1 
ATOM   7164  C  CG1   . VAL C 2  461  ? 486.665 -32.670 664.391 1.00 87.30  ? 461  VAL C CG1   1 
ATOM   7165  C  CG2   . VAL C 2  461  ? 486.084 -31.330 666.487 1.00 75.10  ? 461  VAL C CG2   1 
ATOM   7166  N  N     . ASP C 2  462  ? 486.921 -35.990 665.584 1.00 80.72  ? 462  ASP C N     1 
ATOM   7167  C  CA    . ASP C 2  462  ? 487.713 -37.131 665.120 1.00 91.48  ? 462  ASP C CA    1 
ATOM   7168  C  C     . ASP C 2  462  ? 488.508 -36.825 663.823 1.00 101.50 ? 462  ASP C C     1 
ATOM   7169  O  O     . ASP C 2  462  ? 488.447 -35.734 663.243 1.00 98.65  ? 462  ASP C O     1 
ATOM   7170  C  CB    . ASP C 2  462  ? 486.831 -38.393 664.996 1.00 91.59  ? 462  ASP C CB    1 
ATOM   7171  C  CG    . ASP C 2  462  ? 485.739 -38.321 663.874 1.00 100.89 ? 462  ASP C CG    1 
ATOM   7172  O  OD1   . ASP C 2  462  ? 485.824 -37.533 662.888 1.00 98.75  ? 462  ASP C OD1   1 
ATOM   7173  O  OD2   . ASP C 2  462  ? 484.786 -39.132 663.971 1.00 102.50 ? 462  ASP C OD2   1 
ATOM   7174  N  N     . GLU C 2  463  ? 489.227 -37.847 663.336 1.00 99.47  ? 463  GLU C N     1 
ATOM   7175  C  CA    . GLU C 2  463  ? 490.142 -37.697 662.211 1.00 96.80  ? 463  GLU C CA    1 
ATOM   7176  C  C     . GLU C 2  463  ? 489.397 -37.371 660.920 1.00 100.65 ? 463  GLU C C     1 
ATOM   7177  O  O     . GLU C 2  463  ? 489.946 -36.705 660.029 1.00 94.39  ? 463  GLU C O     1 
ATOM   7178  C  CB    . GLU C 2  463  ? 490.906 -39.014 662.068 1.00 105.35 ? 463  GLU C CB    1 
ATOM   7179  C  CG    . GLU C 2  463  ? 491.638 -39.422 663.367 1.00 115.12 ? 463  GLU C CG    1 
ATOM   7180  C  CD    . GLU C 2  463  ? 492.138 -40.872 663.357 1.00 125.47 ? 463  GLU C CD    1 
ATOM   7181  O  OE1   . GLU C 2  463  ? 491.919 -41.569 662.332 1.00 125.94 ? 463  GLU C OE1   1 
ATOM   7182  O  OE2   . GLU C 2  463  ? 492.705 -41.322 664.390 1.00 121.82 ? 463  GLU C OE2   1 
ATOM   7183  N  N     . LEU C 2  464  ? 488.151 -37.839 660.803 1.00 103.99 ? 464  LEU C N     1 
ATOM   7184  C  CA    . LEU C 2  464  ? 487.305 -37.567 659.644 1.00 102.79 ? 464  LEU C CA    1 
ATOM   7185  C  C     . LEU C 2  464  ? 486.600 -36.223 659.720 1.00 102.61 ? 464  LEU C C     1 
ATOM   7186  O  O     . LEU C 2  464  ? 486.108 -35.742 658.690 1.00 96.62  ? 464  LEU C O     1 
ATOM   7187  C  CB    . LEU C 2  464  ? 486.267 -38.667 659.453 1.00 102.16 ? 464  LEU C CB    1 
ATOM   7188  C  CG    . LEU C 2  464  ? 486.892 -40.003 659.082 1.00 102.30 ? 464  LEU C CG    1 
ATOM   7189  C  CD1   . LEU C 2  464  ? 485.855 -40.859 658.367 1.00 105.98 ? 464  LEU C CD1   1 
ATOM   7190  C  CD2   . LEU C 2  464  ? 488.115 -39.772 658.201 1.00 100.15 ? 464  LEU C CD2   1 
ATOM   7191  N  N     . GLY C 2  465  ? 486.532 -35.616 660.906 1.00 96.85  ? 465  GLY C N     1 
ATOM   7192  C  CA    . GLY C 2  465  ? 485.916 -34.318 661.049 1.00 91.10  ? 465  GLY C CA    1 
ATOM   7193  C  C     . GLY C 2  465  ? 484.529 -34.304 661.645 1.00 94.85  ? 465  GLY C C     1 
ATOM   7194  O  O     . GLY C 2  465  ? 483.890 -33.246 661.633 1.00 96.57  ? 465  GLY C O     1 
ATOM   7195  N  N     . PHE C 2  466  ? 484.048 -35.431 662.173 1.00 95.33  ? 466  PHE C N     1 
ATOM   7196  C  CA    . PHE C 2  466  ? 482.747 -35.510 662.835 1.00 95.09  ? 466  PHE C CA    1 
ATOM   7197  C  C     . PHE C 2  466  ? 482.973 -35.292 664.332 1.00 94.06  ? 466  PHE C C     1 
ATOM   7198  O  O     . PHE C 2  466  ? 484.021 -35.673 664.867 1.00 93.03  ? 466  PHE C O     1 
ATOM   7199  C  CB    . PHE C 2  466  ? 482.051 -36.865 662.637 1.00 99.40  ? 466  PHE C CB    1 
ATOM   7200  C  CG    . PHE C 2  466  ? 481.831 -37.261 661.204 1.00 98.82  ? 466  PHE C CG    1 
ATOM   7201  C  CD1   . PHE C 2  466  ? 481.854 -36.324 660.185 1.00 95.87  ? 466  PHE C CD1   1 
ATOM   7202  C  CD2   . PHE C 2  466  ? 481.561 -38.593 660.891 1.00 105.46 ? 466  PHE C CD2   1 
ATOM   7203  C  CE1   . PHE C 2  466  ? 481.669 -36.712 658.858 1.00 101.58 ? 466  PHE C CE1   1 
ATOM   7204  C  CE2   . PHE C 2  466  ? 481.357 -38.993 659.573 1.00 114.18 ? 466  PHE C CE2   1 
ATOM   7205  C  CZ    . PHE C 2  466  ? 481.411 -38.049 658.551 1.00 107.71 ? 466  PHE C CZ    1 
ATOM   7206  N  N     . ILE C 2  467  ? 482.060 -34.564 664.981 1.00 94.93  ? 467  ILE C N     1 
ATOM   7207  C  CA    . ILE C 2  467  ? 482.188 -34.287 666.417 1.00 90.09  ? 467  ILE C CA    1 
ATOM   7208  C  C     . ILE C 2  467  ? 481.737 -35.512 667.203 1.00 87.70  ? 467  ILE C C     1 
ATOM   7209  O  O     . ILE C 2  467  ? 480.638 -36.035 666.977 1.00 90.33  ? 467  ILE C O     1 
ATOM   7210  C  CB    . ILE C 2  467  ? 481.344 -33.067 666.823 1.00 86.51  ? 467  ILE C CB    1 
ATOM   7211  C  CG1   . ILE C 2  467  ? 481.556 -31.883 665.886 1.00 86.26  ? 467  ILE C CG1   1 
ATOM   7212  C  CG2   . ILE C 2  467  ? 481.718 -32.620 668.219 1.00 83.85  ? 467  ILE C CG2   1 
ATOM   7213  C  CD1   . ILE C 2  467  ? 480.646 -30.728 666.212 1.00 81.25  ? 467  ILE C CD1   1 
ATOM   7214  N  N     . ARG C 2  468  ? 482.574 -35.976 668.129 1.00 84.95  ? 468  ARG C N     1 
ATOM   7215  C  CA    . ARG C 2  468  ? 482.218 -37.119 668.957 1.00 89.64  ? 468  ARG C CA    1 
ATOM   7216  C  C     . ARG C 2  468  ? 482.040 -36.710 670.415 1.00 88.01  ? 468  ARG C C     1 
ATOM   7217  O  O     . ARG C 2  468  ? 482.663 -35.753 670.893 1.00 85.06  ? 468  ARG C O     1 
ATOM   7218  C  CB    . ARG C 2  468  ? 483.235 -38.276 668.876 1.00 92.10  ? 468  ARG C CB    1 
ATOM   7219  C  CG    . ARG C 2  468  ? 483.522 -38.859 667.483 1.00 96.00  ? 468  ARG C CG    1 
ATOM   7220  C  CD    . ARG C 2  468  ? 484.667 -39.899 667.500 1.00 96.49  ? 468  ARG C CD    1 
ATOM   7221  N  NE    . ARG C 2  468  ? 484.097 -41.254 667.537 1.00 99.98  ? 468  ARG C NE    1 
ATOM   7222  C  CZ    . ARG C 2  468  ? 484.149 -42.154 666.554 1.00 102.53 ? 468  ARG C CZ    1 
ATOM   7223  N  NH1   . ARG C 2  468  ? 484.767 -41.864 665.410 1.00 103.89 ? 468  ARG C NH1   1 
ATOM   7224  N  NH2   . ARG C 2  468  ? 483.569 -43.348 666.722 1.00 98.04  ? 468  ARG C NH2   1 
ATOM   7225  N  N     . THR C 2  469  ? 481.168 -37.454 671.113 1.00 86.65  ? 469  THR C N     1 
ATOM   7226  C  CA    . THR C 2  469  ? 480.856 -37.238 672.519 1.00 87.16  ? 469  THR C CA    1 
ATOM   7227  C  C     . THR C 2  469  ? 480.918 -38.520 673.349 1.00 92.68  ? 469  THR C C     1 
ATOM   7228  O  O     . THR C 2  469  ? 480.492 -39.590 672.887 1.00 94.42  ? 469  THR C O     1 
ATOM   7229  C  CB    . THR C 2  469  ? 479.449 -36.628 672.608 1.00 85.13  ? 469  THR C CB    1 
ATOM   7230  O  OG1   . THR C 2  469  ? 479.122 -36.346 673.969 1.00 87.47  ? 469  THR C OG1   1 
ATOM   7231  C  CG2   . THR C 2  469  ? 478.404 -37.576 671.994 1.00 86.64  ? 469  THR C CG2   1 
ATOM   7232  N  N     . PRO C 2  470  ? 481.418 -38.444 674.590 1.00 93.29  ? 470  PRO C N     1 
ATOM   7233  C  CA    . PRO C 2  470  ? 481.595 -39.657 675.413 1.00 94.00  ? 470  PRO C CA    1 
ATOM   7234  C  C     . PRO C 2  470  ? 480.312 -40.185 676.054 1.00 90.15  ? 470  PRO C C     1 
ATOM   7235  O  O     . PRO C 2  470  ? 479.426 -39.421 676.437 1.00 87.49  ? 470  PRO C O     1 
ATOM   7236  C  CB    . PRO C 2  470  ? 482.597 -39.198 676.479 1.00 93.03  ? 470  PRO C CB    1 
ATOM   7237  C  CG    . PRO C 2  470  ? 482.317 -37.755 676.640 1.00 92.45  ? 470  PRO C CG    1 
ATOM   7238  C  CD    . PRO C 2  470  ? 481.967 -37.247 675.257 1.00 91.23  ? 470  PRO C CD    1 
ATOM   7239  N  N     . TYR C 2  471  ? 480.220 -41.517 676.144 1.00 89.85  ? 471  TYR C N     1 
ATOM   7240  C  CA    . TYR C 2  471  ? 479.191 -42.244 676.884 1.00 87.64  ? 471  TYR C CA    1 
ATOM   7241  C  C     . TYR C 2  471  ? 479.794 -43.450 677.592 1.00 99.27  ? 471  TYR C C     1 
ATOM   7242  O  O     . TYR C 2  471  ? 480.733 -44.072 677.085 1.00 99.54  ? 471  TYR C O     1 
ATOM   7243  C  CB    . TYR C 2  471  ? 478.056 -42.747 675.985 1.00 86.16  ? 471  TYR C CB    1 
ATOM   7244  C  CG    . TYR C 2  471  ? 477.207 -41.683 675.327 1.00 92.31  ? 471  TYR C CG    1 
ATOM   7245  C  CD1   . TYR C 2  471  ? 476.400 -40.849 676.095 1.00 95.71  ? 471  TYR C CD1   1 
ATOM   7246  C  CD2   . TYR C 2  471  ? 477.188 -41.523 673.943 1.00 94.64  ? 471  TYR C CD2   1 
ATOM   7247  C  CE1   . TYR C 2  471  ? 475.598 -39.881 675.509 1.00 94.73  ? 471  TYR C CE1   1 
ATOM   7248  C  CE2   . TYR C 2  471  ? 476.393 -40.545 673.343 1.00 95.30  ? 471  TYR C CE2   1 
ATOM   7249  C  CZ    . TYR C 2  471  ? 475.597 -39.731 674.139 1.00 96.49  ? 471  TYR C CZ    1 
ATOM   7250  O  OH    . TYR C 2  471  ? 474.794 -38.763 673.581 1.00 96.47  ? 471  TYR C OH    1 
ATOM   7251  N  N     . ARG C 2  472  ? 479.222 -43.807 678.754 1.00 105.27 ? 472  ARG C N     1 
ATOM   7252  C  CA    . ARG C 2  472  ? 479.650 -45.002 679.482 1.00 106.70 ? 472  ARG C CA    1 
ATOM   7253  C  C     . ARG C 2  472  ? 478.875 -46.235 679.019 1.00 105.88 ? 472  ARG C C     1 
ATOM   7254  O  O     . ARG C 2  472  ? 477.652 -46.195 678.850 1.00 101.81 ? 472  ARG C O     1 
ATOM   7255  C  CB    . ARG C 2  472  ? 479.481 -44.863 681.002 1.00 105.60 ? 472  ARG C CB    1 
ATOM   7256  C  CG    . ARG C 2  472  ? 480.437 -43.911 681.713 1.00 109.41 ? 472  ARG C CG    1 
ATOM   7257  C  CD    . ARG C 2  472  ? 480.787 -44.452 683.124 1.00 113.58 ? 472  ARG C CD    1 
ATOM   7258  N  NE    . ARG C 2  472  ? 479.939 -44.050 684.256 1.00 112.55 ? 472  ARG C NE    1 
ATOM   7259  C  CZ    . ARG C 2  472  ? 480.029 -44.592 685.482 1.00 121.43 ? 472  ARG C CZ    1 
ATOM   7260  N  NH1   . ARG C 2  472  ? 480.908 -45.567 685.723 1.00 119.29 ? 472  ARG C NH1   1 
ATOM   7261  N  NH2   . ARG C 2  472  ? 479.237 -44.182 686.479 1.00 118.94 ? 472  ARG C NH2   1 
ATOM   7262  N  N     . ARG C 2  473  ? 479.602 -47.329 678.805 1.00 108.21 ? 473  ARG C N     1 
ATOM   7263  C  CA    . ARG C 2  473  ? 478.971 -48.589 678.444 1.00 106.11 ? 473  ARG C CA    1 
ATOM   7264  C  C     . ARG C 2  473  ? 478.204 -49.134 679.640 1.00 110.94 ? 473  ARG C C     1 
ATOM   7265  O  O     . ARG C 2  473  ? 478.672 -49.064 680.783 1.00 114.16 ? 473  ARG C O     1 
ATOM   7266  C  CB    . ARG C 2  473  ? 480.010 -49.599 677.953 1.00 109.49 ? 473  ARG C CB    1 
ATOM   7267  C  CG    . ARG C 2  473  ? 479.413 -50.941 677.548 1.00 110.41 ? 473  ARG C CG    1 
ATOM   7268  C  CD    . ARG C 2  473  ? 480.446 -51.837 676.903 1.00 112.73 ? 473  ARG C CD    1 
ATOM   7269  N  NE    . ARG C 2  473  ? 481.094 -51.191 675.760 1.00 116.10 ? 473  ARG C NE    1 
ATOM   7270  C  CZ    . ARG C 2  473  ? 480.596 -51.166 674.525 1.00 113.90 ? 473  ARG C CZ    1 
ATOM   7271  N  NH1   . ARG C 2  473  ? 479.437 -51.755 674.256 1.00 114.46 ? 473  ARG C NH1   1 
ATOM   7272  N  NH2   . ARG C 2  473  ? 481.265 -50.558 673.553 1.00 113.82 ? 473  ARG C NH2   1 
ATOM   7273  N  N     . VAL C 2  474  ? 477.039 -49.719 679.371 1.00 110.21 ? 474  VAL C N     1 
ATOM   7274  C  CA    . VAL C 2  474  ? 476.226 -50.368 680.396 1.00 112.83 ? 474  VAL C CA    1 
ATOM   7275  C  C     . VAL C 2  474  ? 476.007 -51.807 679.950 1.00 115.78 ? 474  VAL C C     1 
ATOM   7276  O  O     . VAL C 2  474  ? 475.351 -52.042 678.928 1.00 119.09 ? 474  VAL C O     1 
ATOM   7277  C  CB    . VAL C 2  474  ? 474.869 -49.660 680.573 1.00 111.76 ? 474  VAL C CB    1 
ATOM   7278  C  CG1   . VAL C 2  474  ? 473.970 -50.422 681.559 1.00 115.41 ? 474  VAL C CG1   1 
ATOM   7279  C  CG2   . VAL C 2  474  ? 475.033 -48.190 680.931 1.00 109.21 ? 474  VAL C CG2   1 
ATOM   7280  N  N     . VAL C 2  475  ? 476.536 -52.773 680.709 1.00 119.42 ? 475  VAL C N     1 
ATOM   7281  C  CA    . VAL C 2  475  ? 476.376 -54.188 680.372 1.00 124.62 ? 475  VAL C CA    1 
ATOM   7282  C  C     . VAL C 2  475  ? 475.478 -54.842 681.422 1.00 126.78 ? 475  VAL C C     1 
ATOM   7283  O  O     . VAL C 2  475  ? 475.768 -54.779 682.626 1.00 121.21 ? 475  VAL C O     1 
ATOM   7284  C  CB    . VAL C 2  475  ? 477.743 -54.898 680.300 1.00 124.76 ? 475  VAL C CB    1 
ATOM   7285  C  CG1   . VAL C 2  475  ? 477.585 -56.334 679.813 1.00 126.89 ? 475  VAL C CG1   1 
ATOM   7286  C  CG2   . VAL C 2  475  ? 478.719 -54.130 679.421 1.00 120.41 ? 475  VAL C CG2   1 
ATOM   7287  N  N     . GLY C 2  476  ? 474.415 -55.519 680.961 1.00 124.87 ? 476  GLY C N     1 
ATOM   7288  C  CA    . GLY C 2  476  ? 473.416 -55.994 681.907 1.00 122.93 ? 476  GLY C CA    1 
ATOM   7289  C  C     . GLY C 2  476  ? 472.801 -54.758 682.528 1.00 120.24 ? 476  GLY C C     1 
ATOM   7290  O  O     . GLY C 2  476  ? 472.208 -53.915 681.837 1.00 119.43 ? 476  GLY C O     1 
ATOM   7291  N  N     . GLY C 2  477  ? 472.864 -54.675 683.856 1.00 117.00 ? 477  GLY C N     1 
ATOM   7292  C  CA    . GLY C 2  477  ? 472.524 -53.451 684.550 1.00 114.67 ? 477  GLY C CA    1 
ATOM   7293  C  C     . GLY C 2  477  ? 473.710 -52.752 685.177 1.00 114.64 ? 477  GLY C C     1 
ATOM   7294  O  O     . GLY C 2  477  ? 473.520 -51.756 685.886 1.00 119.47 ? 477  GLY C O     1 
ATOM   7295  N  N     . VAL C 2  478  ? 474.930 -53.215 684.935 1.00 114.69 ? 478  VAL C N     1 
ATOM   7296  C  CA    . VAL C 2  478  ? 476.130 -52.692 685.586 1.00 115.01 ? 478  VAL C CA    1 
ATOM   7297  C  C     . VAL C 2  478  ? 476.803 -51.703 684.628 1.00 121.52 ? 478  VAL C C     1 
ATOM   7298  O  O     . VAL C 2  478  ? 476.964 -51.988 683.432 1.00 123.73 ? 478  VAL C O     1 
ATOM   7299  C  CB    . VAL C 2  478  ? 477.065 -53.825 686.053 1.00 112.55 ? 478  VAL C CB    1 
ATOM   7300  C  CG1   . VAL C 2  478  ? 477.791 -54.507 684.887 1.00 127.85 ? 478  VAL C CG1   1 
ATOM   7301  C  CG2   . VAL C 2  478  ? 478.055 -53.289 687.060 1.00 108.18 ? 478  VAL C CG2   1 
ATOM   7302  N  N     . VAL C 2  479  ? 477.151 -50.523 685.138 1.00 119.33 ? 479  VAL C N     1 
ATOM   7303  C  CA    . VAL C 2  479  ? 477.810 -49.473 684.357 1.00 116.15 ? 479  VAL C CA    1 
ATOM   7304  C  C     . VAL C 2  479  ? 479.330 -49.608 684.422 1.00 116.22 ? 479  VAL C C     1 
ATOM   7305  O  O     . VAL C 2  479  ? 479.929 -49.471 685.496 1.00 111.96 ? 479  VAL C O     1 
ATOM   7306  C  CB    . VAL C 2  479  ? 477.378 -48.084 684.856 1.00 114.67 ? 479  VAL C CB    1 
ATOM   7307  C  CG1   . VAL C 2  479  ? 477.976 -46.994 683.986 1.00 112.18 ? 479  VAL C CG1   1 
ATOM   7308  C  CG2   . VAL C 2  479  ? 475.850 -47.974 684.924 1.00 113.70 ? 479  VAL C CG2   1 
ATOM   7309  N  N     . THR C 2  480  ? 479.959 -49.881 683.272 1.00 114.80 ? 480  THR C N     1 
ATOM   7310  C  CA    . THR C 2  480  ? 481.412 -50.011 683.272 1.00 117.92 ? 480  THR C CA    1 
ATOM   7311  C  C     . THR C 2  480  ? 482.067 -48.625 683.379 1.00 117.46 ? 480  THR C C     1 
ATOM   7312  O  O     . THR C 2  480  ? 481.406 -47.594 683.274 1.00 115.86 ? 480  THR C O     1 
ATOM   7313  C  CB    . THR C 2  480  ? 481.897 -50.703 681.990 1.00 114.53 ? 480  THR C CB    1 
ATOM   7314  O  OG1   . THR C 2  480  ? 481.335 -50.056 680.839 1.00 111.82 ? 480  THR C OG1   1 
ATOM   7315  C  CG2   . THR C 2  480  ? 481.482 -52.185 681.969 1.00 112.25 ? 480  THR C CG2   1 
ATOM   7316  N  N     . ASP C 2  481  ? 483.397 -48.603 683.522 1.00 115.83 ? 481  ASP C N     1 
ATOM   7317  C  CA    . ASP C 2  481  ? 484.170 -47.364 683.466 1.00 114.26 ? 481  ASP C CA    1 
ATOM   7318  C  C     . ASP C 2  481  ? 484.798 -47.133 682.106 1.00 115.63 ? 481  ASP C C     1 
ATOM   7319  O  O     . ASP C 2  481  ? 485.498 -46.135 681.913 1.00 112.08 ? 481  ASP C O     1 
ATOM   7320  C  CB    . ASP C 2  481  ? 485.256 -47.338 684.547 1.00 106.73 ? 481  ASP C CB    1 
ATOM   7321  C  CG    . ASP C 2  481  ? 484.700 -47.063 685.917 1.00 118.36 ? 481  ASP C CG    1 
ATOM   7322  O  OD1   . ASP C 2  481  ? 485.307 -46.239 686.633 1.00 121.85 ? 481  ASP C OD1   1 
ATOM   7323  O  OD2   . ASP C 2  481  ? 483.643 -47.638 686.272 1.00 123.49 ? 481  ASP C OD2   1 
ATOM   7324  N  N     . GLU C 2  482  ? 484.547 -48.017 681.162 1.00 113.37 ? 482  GLU C N     1 
ATOM   7325  C  CA    . GLU C 2  482  ? 485.096 -47.867 679.836 1.00 108.22 ? 482  GLU C CA    1 
ATOM   7326  C  C     . GLU C 2  482  ? 484.231 -46.832 679.122 1.00 111.36 ? 482  GLU C C     1 
ATOM   7327  O  O     . GLU C 2  482  ? 482.996 -46.907 679.169 1.00 111.06 ? 482  GLU C O     1 
ATOM   7328  C  CB    . GLU C 2  482  ? 485.088 -49.224 679.126 1.00 110.55 ? 482  GLU C CB    1 
ATOM   7329  C  CG    . GLU C 2  482  ? 484.895 -49.188 677.605 1.00 119.96 ? 482  GLU C CG    1 
ATOM   7330  C  CD    . GLU C 2  482  ? 484.386 -50.518 677.018 1.00 117.62 ? 482  GLU C CD    1 
ATOM   7331  O  OE1   . GLU C 2  482  ? 484.887 -50.931 675.930 1.00 112.59 ? 482  GLU C OE1   1 
ATOM   7332  O  OE2   . GLU C 2  482  ? 483.482 -51.130 677.639 1.00 114.41 ? 482  GLU C OE2   1 
ATOM   7333  N  N     . VAL C 2  483  ? 484.868 -45.795 678.576 1.00 109.44 ? 483  VAL C N     1 
ATOM   7334  C  CA    . VAL C 2  483  ? 484.166 -44.705 677.904 1.00 108.28 ? 483  VAL C CA    1 
ATOM   7335  C  C     . VAL C 2  483  ? 484.398 -44.835 676.398 1.00 107.80 ? 483  VAL C C     1 
ATOM   7336  O  O     . VAL C 2  483  ? 485.537 -45.016 675.943 1.00 104.56 ? 483  VAL C O     1 
ATOM   7337  C  CB    . VAL C 2  483  ? 484.605 -43.335 678.454 1.00 101.00 ? 483  VAL C CB    1 
ATOM   7338  C  CG1   . VAL C 2  483  ? 483.905 -42.221 677.723 1.00 99.45  ? 483  VAL C CG1   1 
ATOM   7339  C  CG2   . VAL C 2  483  ? 484.238 -43.262 679.908 1.00 106.75 ? 483  VAL C CG2   1 
ATOM   7340  N  N     . VAL C 2  484  ? 483.323 -44.673 675.625 1.00 103.09 ? 484  VAL C N     1 
ATOM   7341  C  CA    . VAL C 2  484  ? 483.356 -44.760 674.170 1.00 99.08  ? 484  VAL C CA    1 
ATOM   7342  C  C     . VAL C 2  484  ? 482.948 -43.411 673.591 1.00 101.83 ? 484  VAL C C     1 
ATOM   7343  O  O     . VAL C 2  484  ? 481.818 -42.950 673.814 1.00 99.90  ? 484  VAL C O     1 
ATOM   7344  C  CB    . VAL C 2  484  ? 482.398 -45.863 673.689 1.00 98.85  ? 484  VAL C CB    1 
ATOM   7345  C  CG1   . VAL C 2  484  ? 482.357 -45.927 672.195 1.00 103.45 ? 484  VAL C CG1   1 
ATOM   7346  C  CG2   . VAL C 2  484  ? 482.783 -47.203 674.289 1.00 105.72 ? 484  VAL C CG2   1 
ATOM   7347  N  N     . TYR C 2  485  ? 483.833 -42.815 672.783 1.00 95.68  ? 485  TYR C N     1 
ATOM   7348  C  CA    . TYR C 2  485  ? 483.491 -41.595 672.058 1.00 93.05  ? 485  TYR C CA    1 
ATOM   7349  C  C     . TYR C 2  485  ? 482.726 -41.945 670.780 1.00 95.46  ? 485  TYR C C     1 
ATOM   7350  O  O     . TYR C 2  485  ? 483.225 -42.694 669.933 1.00 102.58 ? 485  TYR C O     1 
ATOM   7351  C  CB    . TYR C 2  485  ? 484.749 -40.783 671.770 1.00 91.07  ? 485  TYR C CB    1 
ATOM   7352  C  CG    . TYR C 2  485  ? 485.137 -39.844 672.901 1.00 90.61  ? 485  TYR C CG    1 
ATOM   7353  C  CD1   . TYR C 2  485  ? 484.596 -38.571 672.980 1.00 89.66  ? 485  TYR C CD1   1 
ATOM   7354  C  CD2   . TYR C 2  485  ? 486.094 -40.202 673.843 1.00 92.88  ? 485  TYR C CD2   1 
ATOM   7355  C  CE1   . TYR C 2  485  ? 484.957 -37.697 673.981 1.00 92.76  ? 485  TYR C CE1   1 
ATOM   7356  C  CE2   . TYR C 2  485  ? 486.473 -39.320 674.853 1.00 93.18  ? 485  TYR C CE2   1 
ATOM   7357  C  CZ    . TYR C 2  485  ? 485.890 -38.069 674.914 1.00 95.98  ? 485  TYR C CZ    1 
ATOM   7358  O  OH    . TYR C 2  485  ? 486.227 -37.176 675.905 1.00 96.75  ? 485  TYR C OH    1 
ATOM   7359  N  N     . MET C 2  486  ? 481.513 -41.413 670.637 1.00 94.40  ? 486  MET C N     1 
ATOM   7360  C  CA    . MET C 2  486  ? 480.646 -41.767 669.524 1.00 94.07  ? 486  MET C CA    1 
ATOM   7361  C  C     . MET C 2  486  ? 480.355 -40.605 668.594 1.00 93.99  ? 486  MET C C     1 
ATOM   7362  O  O     . MET C 2  486  ? 480.297 -39.447 669.009 1.00 93.47  ? 486  MET C O     1 
ATOM   7363  C  CB    . MET C 2  486  ? 479.287 -42.307 669.984 1.00 94.99  ? 486  MET C CB    1 
ATOM   7364  C  CG    . MET C 2  486  ? 479.382 -43.610 670.692 1.00 101.26 ? 486  MET C CG    1 
ATOM   7365  S  SD    . MET C 2  486  ? 477.784 -44.282 671.099 1.00 107.70 ? 486  MET C SD    1 
ATOM   7366  C  CE    . MET C 2  486  ? 478.321 -45.931 671.509 1.00 107.74 ? 486  MET C CE    1 
ATOM   7367  N  N     . THR C 2  487  ? 480.237 -40.938 667.314 1.00 101.85 ? 487  THR C N     1 
ATOM   7368  C  CA    . THR C 2  487  ? 479.703 -40.033 666.313 1.00 97.94  ? 487  THR C CA    1 
ATOM   7369  C  C     . THR C 2  487  ? 478.179 -40.038 666.415 1.00 92.42  ? 487  THR C C     1 
ATOM   7370  O  O     . THR C 2  487  ? 477.582 -40.842 667.130 1.00 91.95  ? 487  THR C O     1 
ATOM   7371  C  CB    . THR C 2  487  ? 480.119 -40.472 664.903 1.00 96.13  ? 487  THR C CB    1 
ATOM   7372  O  OG1   . THR C 2  487  ? 479.535 -41.753 664.627 1.00 95.58  ? 487  THR C OG1   1 
ATOM   7373  C  CG2   . THR C 2  487  ? 481.639 -40.553 664.757 1.00 92.20  ? 487  THR C CG2   1 
ATOM   7374  N  N     . ALA C 2  488  ? 477.543 -39.122 665.694 1.00 93.50  ? 488  ALA C N     1 
ATOM   7375  C  CA    . ALA C 2  488  ? 476.086 -39.046 665.739 1.00 93.08  ? 488  ALA C CA    1 
ATOM   7376  C  C     . ALA C 2  488  ? 475.459 -40.273 665.081 1.00 96.87  ? 488  ALA C C     1 
ATOM   7377  O  O     . ALA C 2  488  ? 474.454 -40.799 665.570 1.00 96.61  ? 488  ALA C O     1 
ATOM   7378  C  CB    . ALA C 2  488  ? 475.597 -37.756 665.091 1.00 92.27  ? 488  ALA C CB    1 
ATOM   7379  N  N     . THR C 2  489  ? 476.031 -40.731 663.961 1.00 97.80  ? 489  THR C N     1 
ATOM   7380  C  CA    . THR C 2  489  ? 475.476 -41.877 663.246 1.00 96.67  ? 489  THR C CA    1 
ATOM   7381  C  C     . THR C 2  489  ? 475.490 -43.125 664.121 1.00 100.57 ? 489  THR C C     1 
ATOM   7382  O  O     . THR C 2  489  ? 474.506 -43.876 664.194 1.00 97.07  ? 489  THR C O     1 
ATOM   7383  C  CB    . THR C 2  489  ? 476.312 -42.150 661.990 1.00 93.93  ? 489  THR C CB    1 
ATOM   7384  O  OG1   . THR C 2  489  ? 476.452 -40.959 661.213 1.00 104.21 ? 489  THR C OG1   1 
ATOM   7385  C  CG2   . THR C 2  489  ? 475.687 -43.241 661.142 1.00 96.55  ? 489  THR C CG2   1 
ATOM   7386  N  N     . GLU C 2  490  ? 476.617 -43.362 664.783 1.00 98.74  ? 490  GLU C N     1 
ATOM   7387  C  CA    . GLU C 2  490  ? 476.759 -44.529 665.627 1.00 97.86  ? 490  GLU C CA    1 
ATOM   7388  C  C     . GLU C 2  490  ? 475.962 -44.421 666.925 1.00 107.16 ? 490  GLU C C     1 
ATOM   7389  O  O     . GLU C 2  490  ? 475.481 -45.443 667.429 1.00 112.40 ? 490  GLU C O     1 
ATOM   7390  C  CB    . GLU C 2  490  ? 478.257 -44.743 665.869 1.00 101.03 ? 490  GLU C CB    1 
ATOM   7391  C  CG    . GLU C 2  490  ? 478.657 -46.076 666.464 1.00 115.44 ? 490  GLU C CG    1 
ATOM   7392  C  CD    . GLU C 2  490  ? 480.053 -46.004 667.079 1.00 121.57 ? 490  GLU C CD    1 
ATOM   7393  O  OE1   . GLU C 2  490  ? 480.816 -45.069 666.695 1.00 115.29 ? 490  GLU C OE1   1 
ATOM   7394  O  OE2   . GLU C 2  490  ? 480.342 -46.810 668.008 1.00 119.60 ? 490  GLU C OE2   1 
ATOM   7395  N  N     . GLU C 2  491  ? 475.783 -43.207 667.469 1.00 108.03 ? 491  GLU C N     1 
ATOM   7396  C  CA    . GLU C 2  491  ? 475.000 -43.043 668.699 1.00 101.03 ? 491  GLU C CA    1 
ATOM   7397  C  C     . GLU C 2  491  ? 473.539 -43.470 668.545 1.00 98.44  ? 491  GLU C C     1 
ATOM   7398  O  O     . GLU C 2  491  ? 472.980 -44.100 669.449 1.00 97.87  ? 491  GLU C O     1 
ATOM   7399  C  CB    . GLU C 2  491  ? 475.078 -41.583 669.171 1.00 100.20 ? 491  GLU C CB    1 
ATOM   7400  C  CG    . GLU C 2  491  ? 474.155 -41.247 670.362 1.00 103.24 ? 491  GLU C CG    1 
ATOM   7401  C  CD    . GLU C 2  491  ? 474.013 -39.742 670.691 1.00 97.58  ? 491  GLU C CD    1 
ATOM   7402  O  OE1   . GLU C 2  491  ? 472.849 -39.301 670.896 1.00 96.35  ? 491  GLU C OE1   1 
ATOM   7403  O  OE2   . GLU C 2  491  ? 475.049 -39.028 670.789 1.00 86.55  ? 491  GLU C OE2   1 
ATOM   7404  N  N     . ASP C 2  492  ? 472.928 -43.212 667.384 1.00 98.48  ? 492  ASP C N     1 
ATOM   7405  C  CA    . ASP C 2  492  ? 471.512 -43.533 667.162 1.00 100.13 ? 492  ASP C CA    1 
ATOM   7406  C  C     . ASP C 2  492  ? 471.190 -45.025 667.244 1.00 107.41 ? 492  ASP C C     1 
ATOM   7407  O  O     . ASP C 2  492  ? 470.007 -45.388 667.198 1.00 107.19 ? 492  ASP C O     1 
ATOM   7408  C  CB    . ASP C 2  492  ? 471.018 -42.978 665.820 1.00 98.28  ? 492  ASP C CB    1 
ATOM   7409  C  CG    . ASP C 2  492  ? 470.706 -41.494 665.883 1.00 93.26  ? 492  ASP C CG    1 
ATOM   7410  O  OD1   . ASP C 2  492  ? 470.949 -40.881 666.938 1.00 97.83  ? 492  ASP C OD1   1 
ATOM   7411  O  OD2   . ASP C 2  492  ? 470.187 -40.941 664.898 1.00 89.81  ? 492  ASP C OD2   1 
ATOM   7412  N  N     . ARG C 2  493  ? 472.195 -45.901 667.274 1.00 113.43 ? 493  ARG C N     1 
ATOM   7413  C  CA    . ARG C 2  493  ? 471.928 -47.336 667.306 1.00 114.14 ? 493  ARG C CA    1 
ATOM   7414  C  C     . ARG C 2  493  ? 471.511 -47.784 668.717 1.00 110.42 ? 493  ARG C C     1 
ATOM   7415  O  O     . ARG C 2  493  ? 470.680 -48.690 668.850 1.00 112.62 ? 493  ARG C O     1 
ATOM   7416  C  CB    . ARG C 2  493  ? 473.163 -48.097 666.756 1.00 116.07 ? 493  ARG C CB    1 
ATOM   7417  C  CG    . ARG C 2  493  ? 473.081 -48.467 665.221 1.00 118.37 ? 493  ARG C CG    1 
ATOM   7418  C  CD    . ARG C 2  493  ? 474.289 -49.262 664.596 1.00 121.24 ? 493  ARG C CD    1 
ATOM   7419  N  NE    . ARG C 2  493  ? 474.348 -50.706 664.872 1.00 128.62 ? 493  ARG C NE    1 
ATOM   7420  C  CZ    . ARG C 2  493  ? 475.371 -51.324 665.478 1.00 137.16 ? 493  ARG C CZ    1 
ATOM   7421  N  NH1   . ARG C 2  493  ? 476.445 -50.630 665.876 1.00 136.25 ? 493  ARG C NH1   1 
ATOM   7422  N  NH2   . ARG C 2  493  ? 475.329 -52.643 665.687 1.00 132.89 ? 493  ARG C NH2   1 
ATOM   7423  N  N     . TYR C 2  494  ? 472.023 -47.138 669.775 1.00 108.67 ? 494  TYR C N     1 
ATOM   7424  C  CA    . TYR C 2  494  ? 471.907 -47.638 671.142 1.00 113.01 ? 494  TYR C CA    1 
ATOM   7425  C  C     . TYR C 2  494  ? 470.824 -46.856 671.924 1.00 110.93 ? 494  TYR C C     1 
ATOM   7426  O  O     . TYR C 2  494  ? 470.236 -45.887 671.428 1.00 109.88 ? 494  TYR C O     1 
ATOM   7427  C  CB    . TYR C 2  494  ? 473.292 -47.588 671.821 1.00 110.80 ? 494  TYR C CB    1 
ATOM   7428  C  CG    . TYR C 2  494  ? 474.415 -48.083 670.911 1.00 110.91 ? 494  TYR C CG    1 
ATOM   7429  C  CD1   . TYR C 2  494  ? 474.553 -49.433 670.600 1.00 113.48 ? 494  TYR C CD1   1 
ATOM   7430  C  CD2   . TYR C 2  494  ? 475.293 -47.190 670.307 1.00 113.44 ? 494  TYR C CD2   1 
ATOM   7431  C  CE1   . TYR C 2  494  ? 475.565 -49.888 669.724 1.00 119.18 ? 494  TYR C CE1   1 
ATOM   7432  C  CE2   . TYR C 2  494  ? 476.299 -47.633 669.433 1.00 116.88 ? 494  TYR C CE2   1 
ATOM   7433  C  CZ    . TYR C 2  494  ? 476.432 -48.982 669.145 1.00 120.77 ? 494  TYR C CZ    1 
ATOM   7434  O  OH    . TYR C 2  494  ? 477.431 -49.412 668.281 1.00 126.78 ? 494  TYR C OH    1 
ATOM   7435  N  N     . THR C 2  495  ? 470.564 -47.301 673.173 1.00 107.68 ? 495  THR C N     1 
ATOM   7436  C  CA    . THR C 2  495  ? 469.626 -46.704 674.144 1.00 105.45 ? 495  THR C CA    1 
ATOM   7437  C  C     . THR C 2  495  ? 470.428 -46.065 675.283 1.00 105.52 ? 495  THR C C     1 
ATOM   7438  O  O     . THR C 2  495  ? 471.075 -46.784 676.056 1.00 104.91 ? 495  THR C O     1 
ATOM   7439  C  CB    . THR C 2  495  ? 468.646 -47.758 674.690 1.00 100.52 ? 495  THR C CB    1 
ATOM   7440  O  OG1   . THR C 2  495  ? 467.867 -48.326 673.629 1.00 102.94 ? 495  THR C OG1   1 
ATOM   7441  C  CG2   . THR C 2  495  ? 467.698 -47.148 675.682 1.00 99.10  ? 495  THR C CG2   1 
ATOM   7442  N  N     . ILE C 2  496  ? 470.385 -44.730 675.409 1.00 102.87 ? 496  ILE C N     1 
ATOM   7443  C  CA    . ILE C 2  496  ? 471.304 -43.997 676.292 1.00 103.44 ? 496  ILE C CA    1 
ATOM   7444  C  C     . ILE C 2  496  ? 470.580 -43.388 677.495 1.00 101.53 ? 496  ILE C C     1 
ATOM   7445  O  O     . ILE C 2  496  ? 469.804 -42.437 677.347 1.00 103.26 ? 496  ILE C O     1 
ATOM   7446  C  CB    . ILE C 2  496  ? 472.003 -42.868 675.521 1.00 100.89 ? 496  ILE C CB    1 
ATOM   7447  C  CG1   . ILE C 2  496  ? 472.588 -43.379 674.211 1.00 99.66  ? 496  ILE C CG1   1 
ATOM   7448  C  CG2   . ILE C 2  496  ? 473.079 -42.226 676.383 1.00 100.23 ? 496  ILE C CG2   1 
ATOM   7449  C  CD1   . ILE C 2  496  ? 473.266 -42.289 673.452 1.00 98.19  ? 496  ILE C CD1   1 
ATOM   7450  N  N     . ALA C 2  497  ? 470.918 -43.870 678.691 1.00 97.21  ? 497  ALA C N     1 
ATOM   7451  C  CA    . ALA C 2  497  ? 470.309 -43.427 679.938 1.00 95.68  ? 497  ALA C CA    1 
ATOM   7452  C  C     . ALA C 2  497  ? 470.885 -42.077 680.345 1.00 100.83 ? 497  ALA C C     1 
ATOM   7453  O  O     . ALA C 2  497  ? 471.990 -41.702 679.927 1.00 99.23  ? 497  ALA C O     1 
ATOM   7454  C  CB    . ALA C 2  497  ? 470.531 -44.442 681.056 1.00 94.72  ? 497  ALA C CB    1 
ATOM   7455  N  N     . GLN C 2  498  ? 470.098 -41.316 681.111 1.00 95.96  ? 498  GLN C N     1 
ATOM   7456  C  CA    . GLN C 2  498  ? 470.542 -40.016 681.610 1.00 94.95  ? 498  GLN C CA    1 
ATOM   7457  C  C     . GLN C 2  498  ? 471.637 -40.140 682.674 1.00 95.27  ? 498  GLN C C     1 
ATOM   7458  O  O     . GLN C 2  498  ? 471.787 -41.163 683.346 1.00 97.69  ? 498  GLN C O     1 
ATOM   7459  C  CB    . GLN C 2  498  ? 469.375 -39.206 682.148 1.00 92.26  ? 498  GLN C CB    1 
ATOM   7460  C  CG    . GLN C 2  498  ? 468.530 -38.596 681.057 1.00 89.25  ? 498  GLN C CG    1 
ATOM   7461  C  CD    . GLN C 2  498  ? 469.279 -37.487 680.314 1.00 89.17  ? 498  GLN C CD    1 
ATOM   7462  O  OE1   . GLN C 2  498  ? 469.959 -36.640 680.925 1.00 85.54  ? 498  GLN C OE1   1 
ATOM   7463  N  NE2   . GLN C 2  498  ? 469.100 -37.448 678.996 1.00 90.22  ? 498  GLN C NE2   1 
ATOM   7464  N  N     . ALA C 2  499  ? 472.434 -39.075 682.799 1.00 91.49  ? 499  ALA C N     1 
ATOM   7465  C  CA    . ALA C 2  499  ? 473.584 -39.125 683.691 1.00 92.21  ? 499  ALA C CA    1 
ATOM   7466  C  C     . ALA C 2  499  ? 473.196 -39.114 685.157 1.00 93.98  ? 499  ALA C C     1 
ATOM   7467  O  O     . ALA C 2  499  ? 473.987 -39.560 685.991 1.00 96.58  ? 499  ALA C O     1 
ATOM   7468  C  CB    . ALA C 2  499  ? 474.517 -37.943 683.430 1.00 94.50  ? 499  ALA C CB    1 
ATOM   7469  N  N     . ASN C 2  500  ? 472.017 -38.614 685.498 1.00 96.39  ? 500  ASN C N     1 
ATOM   7470  C  CA    . ASN C 2  500  ? 471.629 -38.539 686.897 1.00 94.80  ? 500  ASN C CA    1 
ATOM   7471  C  C     . ASN C 2  500  ? 470.857 -39.761 687.373 1.00 99.67  ? 500  ASN C C     1 
ATOM   7472  O  O     . ASN C 2  500  ? 470.373 -39.740 688.506 1.00 106.53 ? 500  ASN C O     1 
ATOM   7473  C  CB    . ASN C 2  500  ? 470.774 -37.285 687.159 1.00 92.16  ? 500  ASN C CB    1 
ATOM   7474  C  CG    . ASN C 2  500  ? 469.328 -37.385 686.590 1.00 98.39  ? 500  ASN C CG    1 
ATOM   7475  O  OD1   . ASN C 2  500  ? 468.918 -38.383 685.972 1.00 98.39  ? 500  ASN C OD1   1 
ATOM   7476  N  ND2   . ASN C 2  500  ? 468.569 -36.311 686.778 1.00 95.26  ? 500  ASN C ND2   1 
ATOM   7477  N  N     . THR C 2  501  ? 470.687 -40.800 686.543 1.00 98.08  ? 501  THR C N     1 
ATOM   7478  C  CA    . THR C 2  501  ? 469.924 -41.973 686.981 1.00 103.57 ? 501  THR C CA    1 
ATOM   7479  C  C     . THR C 2  501  ? 470.557 -42.621 688.215 1.00 108.59 ? 501  THR C C     1 
ATOM   7480  O  O     . THR C 2  501  ? 471.779 -42.861 688.233 1.00 102.48 ? 501  THR C O     1 
ATOM   7481  C  CB    . THR C 2  501  ? 469.730 -43.024 685.879 1.00 101.79 ? 501  THR C CB    1 
ATOM   7482  O  OG1   . THR C 2  501  ? 470.976 -43.312 685.239 1.00 101.43 ? 501  THR C OG1   1 
ATOM   7483  C  CG2   . THR C 2  501  ? 468.633 -42.595 684.865 1.00 100.76 ? 501  THR C CG2   1 
ATOM   7484  N  N     . PRO C 2  502  ? 469.755 -42.906 689.256 1.00 108.95 ? 502  PRO C N     1 
ATOM   7485  C  CA    . PRO C 2  502  ? 470.277 -43.362 690.554 1.00 111.61 ? 502  PRO C CA    1 
ATOM   7486  C  C     . PRO C 2  502  ? 471.186 -44.584 690.455 1.00 114.87 ? 502  PRO C C     1 
ATOM   7487  O  O     . PRO C 2  502  ? 470.952 -45.502 689.664 1.00 112.08 ? 502  PRO C O     1 
ATOM   7488  C  CB    . PRO C 2  502  ? 469.002 -43.666 691.351 1.00 111.42 ? 502  PRO C CB    1 
ATOM   7489  C  CG    . PRO C 2  502  ? 467.955 -42.807 690.730 1.00 102.88 ? 502  PRO C CG    1 
ATOM   7490  C  CD    . PRO C 2  502  ? 468.284 -42.787 689.271 1.00 102.33 ? 502  PRO C CD    1 
ATOM   7491  N  N     . LEU C 2  503  ? 472.242 -44.581 691.269 1.00 116.98 ? 503  LEU C N     1 
ATOM   7492  C  CA    . LEU C 2  503  ? 473.214 -45.665 691.301 1.00 119.02 ? 503  LEU C CA    1 
ATOM   7493  C  C     . LEU C 2  503  ? 473.477 -46.071 692.745 1.00 123.68 ? 503  LEU C C     1 
ATOM   7494  O  O     . LEU C 2  503  ? 473.606 -45.217 693.631 1.00 123.43 ? 503  LEU C O     1 
ATOM   7495  C  CB    . LEU C 2  503  ? 474.547 -45.235 690.650 1.00 114.04 ? 503  LEU C CB    1 
ATOM   7496  C  CG    . LEU C 2  503  ? 474.536 -44.742 689.206 1.00 111.80 ? 503  LEU C CG    1 
ATOM   7497  C  CD1   . LEU C 2  503  ? 475.927 -44.292 688.812 1.00 114.92 ? 503  LEU C CD1   1 
ATOM   7498  C  CD2   . LEU C 2  503  ? 474.043 -45.833 688.278 1.00 111.84 ? 503  LEU C CD2   1 
ATOM   7499  N  N     . GLU C 2  504  ? 473.559 -47.384 692.970 1.00 123.32 ? 504  GLU C N     1 
ATOM   7500  C  CA    . GLU C 2  504  ? 474.144 -47.963 694.176 1.00 120.31 ? 504  GLU C CA    1 
ATOM   7501  C  C     . GLU C 2  504  ? 475.417 -48.696 693.774 1.00 120.35 ? 504  GLU C C     1 
ATOM   7502  O  O     . GLU C 2  504  ? 475.361 -49.709 693.062 1.00 119.57 ? 504  GLU C O     1 
ATOM   7503  C  CB    . GLU C 2  504  ? 473.153 -48.903 694.873 1.00 122.28 ? 504  GLU C CB    1 
ATOM   7504  C  CG    . GLU C 2  504  ? 472.389 -49.846 693.918 1.00 126.60 ? 504  GLU C CG    1 
ATOM   7505  C  CD    . GLU C 2  504  ? 471.482 -50.867 694.623 1.00 130.26 ? 504  GLU C CD    1 
ATOM   7506  O  OE1   . GLU C 2  504  ? 470.724 -50.490 695.558 1.00 119.61 ? 504  GLU C OE1   1 
ATOM   7507  O  OE2   . GLU C 2  504  ? 471.507 -52.048 694.197 1.00 130.08 ? 504  GLU C OE2   1 
ATOM   7508  N  N     . GLY C 2  505  ? 476.566 -48.132 694.138 1.00 115.76 ? 505  GLY C N     1 
ATOM   7509  C  CA    . GLY C 2  505  ? 477.797 -48.695 693.620 1.00 112.55 ? 505  GLY C CA    1 
ATOM   7510  C  C     . GLY C 2  505  ? 477.876 -48.490 692.127 1.00 111.30 ? 505  GLY C C     1 
ATOM   7511  O  O     . GLY C 2  505  ? 477.629 -47.400 691.602 1.00 112.63 ? 505  GLY C O     1 
ATOM   7512  N  N     . ASN C 2  506  ? 478.242 -49.557 691.432 1.00 110.73 ? 506  ASN C N     1 
ATOM   7513  C  CA    . ASN C 2  506  ? 478.310 -49.546 689.985 1.00 111.02 ? 506  ASN C CA    1 
ATOM   7514  C  C     . ASN C 2  506  ? 476.999 -50.024 689.343 1.00 114.81 ? 506  ASN C C     1 
ATOM   7515  O  O     . ASN C 2  506  ? 476.913 -50.115 688.114 1.00 115.37 ? 506  ASN C O     1 
ATOM   7516  C  CB    . ASN C 2  506  ? 479.504 -50.409 689.540 1.00 105.21 ? 506  ASN C CB    1 
ATOM   7517  C  CG    . ASN C 2  506  ? 480.462 -49.671 688.580 1.00 121.59 ? 506  ASN C CG    1 
ATOM   7518  O  OD1   . ASN C 2  506  ? 480.401 -48.444 688.418 1.00 125.53 ? 506  ASN C OD1   1 
ATOM   7519  N  ND2   . ASN C 2  506  ? 481.365 -50.423 687.959 1.00 124.44 ? 506  ASN C ND2   1 
ATOM   7520  N  N     . ARG C 2  507  ? 475.964 -50.279 690.141 1.00 113.71 ? 507  ARG C N     1 
ATOM   7521  C  CA    . ARG C 2  507  ? 474.693 -50.807 689.647 1.00 120.49 ? 507  ARG C CA    1 
ATOM   7522  C  C     . ARG C 2  507  ? 473.620 -49.747 689.420 1.00 120.38 ? 507  ARG C C     1 
ATOM   7523  O  O     . ARG C 2  507  ? 473.502 -48.796 690.202 1.00 120.66 ? 507  ARG C O     1 
ATOM   7524  C  CB    . ARG C 2  507  ? 474.128 -51.864 690.607 1.00 128.18 ? 507  ARG C CB    1 
ATOM   7525  C  CG    . ARG C 2  507  ? 472.678 -52.291 690.254 1.00 127.82 ? 507  ARG C CG    1 
ATOM   7526  C  CD    . ARG C 2  507  ? 472.194 -53.594 690.885 1.00 128.85 ? 507  ARG C CD    1 
ATOM   7527  N  NE    . ARG C 2  507  ? 473.025 -54.726 690.472 1.00 138.65 ? 507  ARG C NE    1 
ATOM   7528  C  CZ    . ARG C 2  507  ? 472.931 -55.323 689.279 1.00 134.58 ? 507  ARG C CZ    1 
ATOM   7529  N  NH1   . ARG C 2  507  ? 472.046 -54.893 688.377 1.00 130.02 ? 507  ARG C NH1   1 
ATOM   7530  N  NH2   . ARG C 2  507  ? 473.724 -56.350 688.978 1.00 127.59 ? 507  ARG C NH2   1 
ATOM   7531  N  N     . ILE C 2  508  ? 472.843 -49.914 688.342 1.00 115.15 ? 508  ILE C N     1 
ATOM   7532  C  CA    . ILE C 2  508  ? 471.714 -49.019 688.099 1.00 118.14 ? 508  ILE C CA    1 
ATOM   7533  C  C     . ILE C 2  508  ? 470.668 -49.341 689.159 1.00 120.45 ? 508  ILE C C     1 
ATOM   7534  O  O     . ILE C 2  508  ? 470.088 -50.434 689.151 1.00 118.81 ? 508  ILE C O     1 
ATOM   7535  C  CB    . ILE C 2  508  ? 471.154 -49.215 686.681 1.00 118.98 ? 508  ILE C CB    1 
ATOM   7536  C  CG1   . ILE C 2  508  ? 472.190 -48.785 685.626 1.00 120.89 ? 508  ILE C CG1   1 
ATOM   7537  C  CG2   . ILE C 2  508  ? 469.794 -48.527 686.506 1.00 111.95 ? 508  ILE C CG2   1 
ATOM   7538  C  CD1   . ILE C 2  508  ? 471.738 -48.957 684.185 1.00 112.80 ? 508  ILE C CD1   1 
ATOM   7539  N  N     . ALA C 2  509  ? 470.332 -48.343 689.990 1.00 122.00 ? 509  ALA C N     1 
ATOM   7540  C  CA    . ALA C 2  509  ? 469.511 -48.536 691.186 1.00 116.32 ? 509  ALA C CA    1 
ATOM   7541  C  C     . ALA C 2  509  ? 468.033 -48.213 691.012 1.00 115.35 ? 509  ALA C C     1 
ATOM   7542  O  O     . ALA C 2  509  ? 467.291 -48.295 691.995 1.00 116.88 ? 509  ALA C O     1 
ATOM   7543  C  CB    . ALA C 2  509  ? 470.075 -47.703 692.347 1.00 109.51 ? 509  ALA C CB    1 
ATOM   7544  N  N     . ALA C 2  510  ? 467.589 -47.807 689.826 1.00 111.30 ? 510  ALA C N     1 
ATOM   7545  C  CA    . ALA C 2  510  ? 466.192 -47.461 689.612 1.00 109.77 ? 510  ALA C CA    1 
ATOM   7546  C  C     . ALA C 2  510  ? 465.509 -48.546 688.791 1.00 111.20 ? 510  ALA C C     1 
ATOM   7547  O  O     . ALA C 2  510  ? 466.159 -49.262 688.025 1.00 112.72 ? 510  ALA C O     1 
ATOM   7548  C  CB    . ALA C 2  510  ? 466.043 -46.099 688.923 1.00 106.99 ? 510  ALA C CB    1 
ATOM   7549  N  N     . GLU C 2  511  ? 464.222 -48.767 689.077 1.00 118.10 ? 511  GLU C N     1 
ATOM   7550  C  CA    . GLU C 2  511  ? 463.435 -49.733 688.310 1.00 121.81 ? 511  GLU C CA    1 
ATOM   7551  C  C     . GLU C 2  511  ? 463.022 -49.141 686.970 1.00 119.97 ? 511  GLU C C     1 
ATOM   7552  O  O     . GLU C 2  511  ? 462.771 -49.880 686.007 1.00 122.32 ? 511  GLU C O     1 
ATOM   7553  C  CB    . GLU C 2  511  ? 462.238 -50.248 689.120 1.00 134.11 ? 511  GLU C CB    1 
ATOM   7554  C  CG    . GLU C 2  511  ? 461.503 -51.415 688.439 1.00 133.61 ? 511  GLU C CG    1 
ATOM   7555  C  CD    . GLU C 2  511  ? 460.910 -52.405 689.437 1.00 138.22 ? 511  GLU C CD    1 
ATOM   7556  O  OE1   . GLU C 2  511  ? 460.704 -52.021 690.613 1.00 140.36 ? 511  GLU C OE1   1 
ATOM   7557  O  OE2   . GLU C 2  511  ? 460.670 -53.573 689.046 1.00 135.12 ? 511  GLU C OE2   1 
ATOM   7558  N  N     . ARG C 2  512  ? 462.898 -47.818 686.912 1.00 118.34 ? 512  ARG C N     1 
ATOM   7559  C  CA    . ARG C 2  512  ? 462.606 -47.120 685.671 1.00 121.16 ? 512  ARG C CA    1 
ATOM   7560  C  C     . ARG C 2  512  ? 463.641 -46.009 685.506 1.00 122.48 ? 512  ARG C C     1 
ATOM   7561  O  O     . ARG C 2  512  ? 463.889 -45.244 686.451 1.00 121.41 ? 512  ARG C O     1 
ATOM   7562  C  CB    . ARG C 2  512  ? 461.190 -46.527 685.636 1.00 121.61 ? 512  ARG C CB    1 
ATOM   7563  C  CG    . ARG C 2  512  ? 460.882 -45.471 686.707 1.00 123.89 ? 512  ARG C CG    1 
ATOM   7564  C  CD    . ARG C 2  512  ? 459.727 -44.602 686.223 1.00 126.81 ? 512  ARG C CD    1 
ATOM   7565  N  NE    . ARG C 2  512  ? 458.662 -45.389 685.595 1.00 131.84 ? 512  ARG C NE    1 
ATOM   7566  C  CZ    . ARG C 2  512  ? 457.768 -44.892 684.739 1.00 127.05 ? 512  ARG C CZ    1 
ATOM   7567  N  NH1   . ARG C 2  512  ? 457.810 -43.606 684.400 1.00 122.80 ? 512  ARG C NH1   1 
ATOM   7568  N  NH2   . ARG C 2  512  ? 456.835 -45.679 684.210 1.00 125.51 ? 512  ARG C NH2   1 
ATOM   7569  N  N     . VAL C 2  513  ? 464.283 -45.962 684.320 1.00 116.60 ? 513  VAL C N     1 
ATOM   7570  C  CA    . VAL C 2  513  ? 465.340 -45.003 684.010 1.00 110.37 ? 513  VAL C CA    1 
ATOM   7571  C  C     . VAL C 2  513  ? 464.879 -44.074 682.894 1.00 103.23 ? 513  VAL C C     1 
ATOM   7572  O  O     . VAL C 2  513  ? 464.015 -44.415 682.075 1.00 95.82  ? 513  VAL C O     1 
ATOM   7573  C  CB    . VAL C 2  513  ? 466.662 -45.697 683.625 1.00 109.05 ? 513  VAL C CB    1 
ATOM   7574  C  CG1   . VAL C 2  513  ? 466.889 -46.944 684.488 1.00 107.60 ? 513  VAL C CG1   1 
ATOM   7575  C  CG2   . VAL C 2  513  ? 466.644 -46.060 682.131 1.00 103.46 ? 513  VAL C CG2   1 
ATOM   7576  N  N     . VAL C 2  514  ? 465.463 -42.878 682.887 1.00 102.01 ? 514  VAL C N     1 
ATOM   7577  C  CA    . VAL C 2  514  ? 465.183 -41.871 681.874 1.00 100.79 ? 514  VAL C CA    1 
ATOM   7578  C  C     . VAL C 2  514  ? 466.240 -41.983 680.773 1.00 97.57  ? 514  VAL C C     1 
ATOM   7579  O  O     . VAL C 2  514  ? 467.433 -41.757 681.020 1.00 95.61  ? 514  VAL C O     1 
ATOM   7580  C  CB    . VAL C 2  514  ? 465.164 -40.477 682.515 1.00 102.88 ? 514  VAL C CB    1 
ATOM   7581  C  CG1   . VAL C 2  514  ? 464.651 -39.439 681.530 1.00 105.25 ? 514  VAL C CG1   1 
ATOM   7582  C  CG2   . VAL C 2  514  ? 464.369 -40.496 683.820 1.00 87.99  ? 514  VAL C CG2   1 
ATOM   7583  N  N     . ALA C 2  515  ? 465.813 -42.290 679.549 1.00 94.36  ? 515  ALA C N     1 
ATOM   7584  C  CA    . ALA C 2  515  ? 466.772 -42.503 678.473 1.00 93.84  ? 515  ALA C CA    1 
ATOM   7585  C  C     . ALA C 2  515  ? 466.314 -41.850 677.168 1.00 97.58  ? 515  ALA C C     1 
ATOM   7586  O  O     . ALA C 2  515  ? 465.199 -41.336 677.052 1.00 98.85  ? 515  ALA C O     1 
ATOM   7587  C  CB    . ALA C 2  515  ? 467.031 -44.002 678.268 1.00 88.91  ? 515  ALA C CB    1 
ATOM   7588  N  N     . ARG C 2  516  ? 467.205 -41.915 676.168 1.00 100.10 ? 516  ARG C N     1 
ATOM   7589  C  CA    . ARG C 2  516  ? 466.997 -41.437 674.802 1.00 98.68  ? 516  ARG C CA    1 
ATOM   7590  C  C     . ARG C 2  516  ? 467.253 -42.549 673.795 1.00 100.40 ? 516  ARG C C     1 
ATOM   7591  O  O     . ARG C 2  516  ? 468.206 -43.328 673.931 1.00 100.44 ? 516  ARG C O     1 
ATOM   7592  C  CB    . ARG C 2  516  ? 467.930 -40.271 674.402 1.00 97.93  ? 516  ARG C CB    1 
ATOM   7593  C  CG    . ARG C 2  516  ? 467.738 -38.976 675.106 1.00 100.09 ? 516  ARG C CG    1 
ATOM   7594  C  CD    . ARG C 2  516  ? 468.789 -37.955 674.680 1.00 92.36  ? 516  ARG C CD    1 
ATOM   7595  N  NE    . ARG C 2  516  ? 470.147 -38.405 674.969 1.00 93.32  ? 516  ARG C NE    1 
ATOM   7596  C  CZ    . ARG C 2  516  ? 471.136 -38.382 674.078 1.00 99.27  ? 516  ARG C CZ    1 
ATOM   7597  N  NH1   . ARG C 2  516  ? 470.905 -37.929 672.846 1.00 100.69 ? 516  ARG C NH1   1 
ATOM   7598  N  NH2   . ARG C 2  516  ? 472.356 -38.806 674.411 1.00 96.54  ? 516  ARG C NH2   1 
ATOM   7599  N  N     . ARG C 2  517  ? 466.385 -42.621 672.793 1.00 97.33  ? 517  ARG C N     1 
ATOM   7600  C  CA    . ARG C 2  517  ? 466.611 -43.425 671.600 1.00 96.69  ? 517  ARG C CA    1 
ATOM   7601  C  C     . ARG C 2  517  ? 466.427 -42.490 670.414 1.00 102.18 ? 517  ARG C C     1 
ATOM   7602  O  O     . ARG C 2  517  ? 465.311 -42.014 670.169 1.00 101.24 ? 517  ARG C O     1 
ATOM   7603  C  CB    . ARG C 2  517  ? 465.662 -44.624 671.543 1.00 97.58  ? 517  ARG C CB    1 
ATOM   7604  C  CG    . ARG C 2  517  ? 466.029 -45.785 672.489 1.00 99.57  ? 517  ARG C CG    1 
ATOM   7605  C  CD    . ARG C 2  517  ? 464.905 -46.821 672.582 1.00 98.64  ? 517  ARG C CD    1 
ATOM   7606  N  NE    . ARG C 2  517  ? 465.246 -47.934 673.463 1.00 102.18 ? 517  ARG C NE    1 
ATOM   7607  C  CZ    . ARG C 2  517  ? 464.352 -48.713 674.063 1.00 106.66 ? 517  ARG C CZ    1 
ATOM   7608  N  NH1   . ARG C 2  517  ? 463.048 -48.488 673.893 1.00 107.51 ? 517  ARG C NH1   1 
ATOM   7609  N  NH2   . ARG C 2  517  ? 464.768 -49.714 674.836 1.00 103.16 ? 517  ARG C NH2   1 
ATOM   7610  N  N     . LYS C 2  518  ? 467.516 -42.251 669.668 1.00 102.03 ? 518  LYS C N     1 
ATOM   7611  C  CA    . LYS C 2  518  ? 467.547 -41.263 668.577 1.00 101.15 ? 518  LYS C CA    1 
ATOM   7612  C  C     . LYS C 2  518  ? 467.049 -39.884 669.019 1.00 102.10 ? 518  LYS C C     1 
ATOM   7613  O  O     . LYS C 2  518  ? 466.258 -39.238 668.324 1.00 98.91  ? 518  LYS C O     1 
ATOM   7614  C  CB    . LYS C 2  518  ? 466.742 -41.753 667.369 1.00 100.09 ? 518  LYS C CB    1 
ATOM   7615  C  CG    . LYS C 2  518  ? 467.306 -42.997 666.672 1.00 100.97 ? 518  LYS C CG    1 
ATOM   7616  C  CD    . LYS C 2  518  ? 466.712 -43.175 665.272 1.00 100.49 ? 518  LYS C CD    1 
ATOM   7617  C  CE    . LYS C 2  518  ? 467.260 -44.414 664.595 1.00 102.64 ? 518  LYS C CE    1 
ATOM   7618  N  NZ    . LYS C 2  518  ? 466.863 -45.653 665.335 1.00 97.84  ? 518  LYS C NZ    1 
ATOM   7619  N  N     . GLY C 2  519  ? 467.478 -39.442 670.209 1.00 103.75 ? 519  GLY C N     1 
ATOM   7620  C  CA    . GLY C 2  519  ? 467.146 -38.113 670.705 1.00 106.54 ? 519  GLY C CA    1 
ATOM   7621  C  C     . GLY C 2  519  ? 465.765 -38.003 671.319 1.00 107.85 ? 519  GLY C C     1 
ATOM   7622  O  O     . GLY C 2  519  ? 465.489 -37.023 672.031 1.00 104.06 ? 519  GLY C O     1 
ATOM   7623  N  N     . GLU C 2  520  ? 464.882 -38.954 670.995 1.00 107.55 ? 520  GLU C N     1 
ATOM   7624  C  CA    . GLU C 2  520  ? 463.501 -39.023 671.460 1.00 105.24 ? 520  GLU C CA    1 
ATOM   7625  C  C     . GLU C 2  520  ? 463.526 -39.513 672.909 1.00 100.58 ? 520  GLU C C     1 
ATOM   7626  O  O     . GLU C 2  520  ? 464.135 -40.554 673.178 1.00 98.81  ? 520  GLU C O     1 
ATOM   7627  C  CB    . GLU C 2  520  ? 462.730 -40.012 670.578 1.00 108.68 ? 520  GLU C CB    1 
ATOM   7628  C  CG    . GLU C 2  520  ? 461.184 -39.936 670.504 1.00 114.47 ? 520  GLU C CG    1 
ATOM   7629  C  CD    . GLU C 2  520  ? 460.659 -38.728 669.679 1.00 121.17 ? 520  GLU C CD    1 
ATOM   7630  O  OE1   . GLU C 2  520  ? 459.494 -38.795 669.207 1.00 119.66 ? 520  GLU C OE1   1 
ATOM   7631  O  OE2   . GLU C 2  520  ? 461.414 -37.746 669.451 1.00 119.84 ? 520  GLU C OE2   1 
ATOM   7632  N  N     . PRO C 2  521  ? 462.952 -38.779 673.873 1.00 103.85 ? 521  PRO C N     1 
ATOM   7633  C  CA    . PRO C 2  521  ? 462.958 -39.241 675.282 1.00 98.46  ? 521  PRO C CA    1 
ATOM   7634  C  C     . PRO C 2  521  ? 462.019 -40.430 675.530 1.00 96.25  ? 521  PRO C C     1 
ATOM   7635  O  O     . PRO C 2  521  ? 460.864 -40.431 675.090 1.00 94.28  ? 521  PRO C O     1 
ATOM   7636  C  CB    . PRO C 2  521  ? 462.504 -38.001 676.061 1.00 92.16  ? 521  PRO C CB    1 
ATOM   7637  C  CG    . PRO C 2  521  ? 461.708 -37.200 675.081 1.00 97.13  ? 521  PRO C CG    1 
ATOM   7638  C  CD    . PRO C 2  521  ? 462.312 -37.458 673.723 1.00 105.05 ? 521  PRO C CD    1 
ATOM   7639  N  N     . VAL C 2  522  ? 462.492 -41.410 676.317 1.00 95.21  ? 522  VAL C N     1 
ATOM   7640  C  CA    . VAL C 2  522  ? 461.785 -42.684 676.521 1.00 102.02 ? 522  VAL C CA    1 
ATOM   7641  C  C     . VAL C 2  522  ? 462.080 -43.244 677.904 1.00 103.78 ? 522  VAL C C     1 
ATOM   7642  O  O     . VAL C 2  522  ? 463.217 -43.175 678.386 1.00 104.22 ? 522  VAL C O     1 
ATOM   7643  C  CB    . VAL C 2  522  ? 462.256 -43.762 675.499 1.00 101.11 ? 522  VAL C CB    1 
ATOM   7644  C  CG1   . VAL C 2  522  ? 461.508 -45.086 675.682 1.00 105.96 ? 522  VAL C CG1   1 
ATOM   7645  C  CG2   . VAL C 2  522  ? 462.089 -43.303 674.061 1.00 104.96 ? 522  VAL C CG2   1 
ATOM   7646  N  N     . ILE C 2  523  ? 461.045 -43.857 678.515 1.00 102.30 ? 523  ILE C N     1 
ATOM   7647  C  CA    . ILE C 2  523  ? 461.170 -44.534 679.803 1.00 104.97 ? 523  ILE C CA    1 
ATOM   7648  C  C     . ILE C 2  523  ? 461.396 -46.013 679.546 1.00 104.00 ? 523  ILE C C     1 
ATOM   7649  O  O     . ILE C 2  523  ? 460.665 -46.637 678.768 1.00 105.18 ? 523  ILE C O     1 
ATOM   7650  C  CB    . ILE C 2  523  ? 459.921 -44.329 680.683 1.00 105.15 ? 523  ILE C CB    1 
ATOM   7651  C  CG1   . ILE C 2  523  ? 459.656 -42.840 680.972 1.00 103.33 ? 523  ILE C CG1   1 
ATOM   7652  C  CG2   . ILE C 2  523  ? 460.044 -45.127 681.965 1.00 105.28 ? 523  ILE C CG2   1 
ATOM   7653  C  CD1   . ILE C 2  523  ? 460.847 -42.083 681.571 1.00 100.63 ? 523  ILE C CD1   1 
ATOM   7654  N  N     . VAL C 2  524  ? 462.392 -46.579 680.216 1.00 103.61 ? 524  VAL C N     1 
ATOM   7655  C  CA    . VAL C 2  524  ? 462.897 -47.895 679.863 1.00 102.67 ? 524  VAL C CA    1 
ATOM   7656  C  C     . VAL C 2  524  ? 463.351 -48.563 681.151 1.00 107.91 ? 524  VAL C C     1 
ATOM   7657  O  O     . VAL C 2  524  ? 463.791 -47.893 682.089 1.00 111.71 ? 524  VAL C O     1 
ATOM   7658  C  CB    . VAL C 2  524  ? 464.012 -47.813 678.783 1.00 104.88 ? 524  VAL C CB    1 
ATOM   7659  C  CG1   . VAL C 2  524  ? 464.466 -46.378 678.560 1.00 107.13 ? 524  VAL C CG1   1 
ATOM   7660  C  CG2   . VAL C 2  524  ? 465.208 -48.653 679.150 1.00 107.75 ? 524  VAL C CG2   1 
ATOM   7661  N  N     . SER C 2  525  ? 463.251 -49.893 681.190 1.00 108.94 ? 525  SER C N     1 
ATOM   7662  C  CA    . SER C 2  525  ? 463.708 -50.728 682.295 1.00 110.07 ? 525  SER C CA    1 
ATOM   7663  C  C     . SER C 2  525  ? 465.223 -50.965 682.240 1.00 112.22 ? 525  SER C C     1 
ATOM   7664  O  O     . SER C 2  525  ? 465.808 -51.032 681.154 1.00 111.60 ? 525  SER C O     1 
ATOM   7665  C  CB    . SER C 2  525  ? 462.985 -52.067 682.265 1.00 110.00 ? 525  SER C CB    1 
ATOM   7666  O  OG    . SER C 2  525  ? 462.801 -52.512 680.928 1.00 105.38 ? 525  SER C OG    1 
ATOM   7667  N  N     . PRO C 2  526  ? 465.889 -51.087 683.410 1.00 112.11 ? 526  PRO C N     1 
ATOM   7668  C  CA    . PRO C 2  526  ? 467.351 -51.293 683.441 1.00 111.69 ? 526  PRO C CA    1 
ATOM   7669  C  C     . PRO C 2  526  ? 467.883 -52.433 682.558 1.00 115.06 ? 526  PRO C C     1 
ATOM   7670  O  O     . PRO C 2  526  ? 469.096 -52.492 682.306 1.00 114.69 ? 526  PRO C O     1 
ATOM   7671  C  CB    . PRO C 2  526  ? 467.636 -51.530 684.930 1.00 109.74 ? 526  PRO C CB    1 
ATOM   7672  C  CG    . PRO C 2  526  ? 466.337 -52.014 685.484 1.00 116.11 ? 526  PRO C CG    1 
ATOM   7673  C  CD    . PRO C 2  526  ? 465.301 -51.207 684.754 1.00 111.93 ? 526  PRO C CD    1 
ATOM   7674  N  N     . GLU C 2  527  ? 467.024 -53.382 682.135 1.00 117.90 ? 527  GLU C N     1 
ATOM   7675  C  CA    . GLU C 2  527  ? 467.507 -54.449 681.250 1.00 115.44 ? 527  GLU C CA    1 
ATOM   7676  C  C     . GLU C 2  527  ? 467.845 -53.934 679.845 1.00 111.73 ? 527  GLU C C     1 
ATOM   7677  O  O     . GLU C 2  527  ? 468.768 -54.455 679.210 1.00 110.24 ? 527  GLU C O     1 
ATOM   7678  C  CB    . GLU C 2  527  ? 466.439 -55.559 681.062 1.00 107.76 ? 527  GLU C CB    1 
ATOM   7679  C  CG    . GLU C 2  527  ? 466.059 -56.541 682.204 1.00 111.05 ? 527  GLU C CG    1 
ATOM   7680  C  CD    . GLU C 2  527  ? 465.139 -55.969 683.296 1.00 115.46 ? 527  GLU C CD    1 
ATOM   7681  O  OE1   . GLU C 2  527  ? 464.359 -55.034 683.003 1.00 114.84 ? 527  GLU C OE1   1 
ATOM   7682  O  OE2   . GLU C 2  527  ? 465.150 -56.509 684.432 1.00 114.26 ? 527  GLU C OE2   1 
ATOM   7683  N  N     . GLU C 2  528  ? 467.163 -52.875 679.384 1.00 112.17 ? 528  GLU C N     1 
ATOM   7684  C  CA    . GLU C 2  528  ? 467.275 -52.293 678.044 1.00 104.41 ? 528  GLU C CA    1 
ATOM   7685  C  C     . GLU C 2  528  ? 468.346 -51.208 677.898 1.00 105.18 ? 528  GLU C C     1 
ATOM   7686  O  O     . GLU C 2  528  ? 468.430 -50.598 676.822 1.00 102.43 ? 528  GLU C O     1 
ATOM   7687  C  CB    . GLU C 2  528  ? 465.913 -51.712 677.609 1.00 105.83 ? 528  GLU C CB    1 
ATOM   7688  C  CG    . GLU C 2  528  ? 464.688 -52.629 677.816 1.00 106.03 ? 528  GLU C CG    1 
ATOM   7689  C  CD    . GLU C 2  528  ? 463.353 -52.008 677.353 1.00 106.83 ? 528  GLU C CD    1 
ATOM   7690  O  OE1   . GLU C 2  528  ? 462.292 -52.415 677.880 1.00 106.45 ? 528  GLU C OE1   1 
ATOM   7691  O  OE2   . GLU C 2  528  ? 463.356 -51.130 676.456 1.00 106.47 ? 528  GLU C OE2   1 
ATOM   7692  N  N     . VAL C 2  529  ? 469.128 -50.920 678.941 1.00 107.52 ? 529  VAL C N     1 
ATOM   7693  C  CA    . VAL C 2  529  ? 470.065 -49.793 678.945 1.00 107.02 ? 529  VAL C CA    1 
ATOM   7694  C  C     . VAL C 2  529  ? 471.446 -50.187 678.422 1.00 110.18 ? 529  VAL C C     1 
ATOM   7695  O  O     . VAL C 2  529  ? 472.181 -50.933 679.076 1.00 110.43 ? 529  VAL C O     1 
ATOM   7696  C  CB    . VAL C 2  529  ? 470.177 -49.198 680.350 1.00 107.16 ? 529  VAL C CB    1 
ATOM   7697  C  CG1   . VAL C 2  529  ? 471.265 -48.135 680.389 1.00 104.68 ? 529  VAL C CG1   1 
ATOM   7698  C  CG2   . VAL C 2  529  ? 468.829 -48.590 680.743 1.00 109.27 ? 529  VAL C CG2   1 
ATOM   7699  N  N     . GLU C 2  530  ? 471.786 -49.681 677.223 1.00 107.56 ? 530  GLU C N     1 
ATOM   7700  C  CA    . GLU C 2  530  ? 473.061 -49.891 676.534 1.00 107.70 ? 530  GLU C CA    1 
ATOM   7701  C  C     . GLU C 2  530  ? 474.174 -48.893 676.905 1.00 108.44 ? 530  GLU C C     1 
ATOM   7702  O  O     . GLU C 2  530  ? 475.330 -49.304 677.066 1.00 110.29 ? 530  GLU C O     1 
ATOM   7703  C  CB    . GLU C 2  530  ? 472.819 -49.916 675.020 1.00 104.55 ? 530  GLU C CB    1 
ATOM   7704  C  CG    . GLU C 2  530  ? 471.683 -50.863 674.625 1.00 102.65 ? 530  GLU C CG    1 
ATOM   7705  C  CD    . GLU C 2  530  ? 471.392 -50.880 673.130 1.00 113.87 ? 530  GLU C CD    1 
ATOM   7706  O  OE1   . GLU C 2  530  ? 470.263 -50.497 672.736 1.00 112.43 ? 530  GLU C OE1   1 
ATOM   7707  O  OE2   . GLU C 2  530  ? 472.281 -51.282 672.342 1.00 121.09 ? 530  GLU C OE2   1 
ATOM   7708  N  N     . PHE C 2  531  ? 473.882 -47.590 677.047 1.00 103.84 ? 531  PHE C N     1 
ATOM   7709  C  CA    . PHE C 2  531  ? 474.925 -46.628 677.413 1.00 103.73 ? 531  PHE C CA    1 
ATOM   7710  C  C     . PHE C 2  531  ? 474.350 -45.612 678.413 1.00 108.87 ? 531  PHE C C     1 
ATOM   7711  O  O     . PHE C 2  531  ? 473.157 -45.641 678.736 1.00 107.82 ? 531  PHE C O     1 
ATOM   7712  C  CB    . PHE C 2  531  ? 475.495 -45.938 676.162 1.00 105.57 ? 531  PHE C CB    1 
ATOM   7713  C  CG    . PHE C 2  531  ? 476.370 -46.847 675.280 1.00 113.69 ? 531  PHE C CG    1 
ATOM   7714  C  CD1   . PHE C 2  531  ? 477.726 -47.031 675.542 1.00 111.54 ? 531  PHE C CD1   1 
ATOM   7715  C  CD2   . PHE C 2  531  ? 475.835 -47.455 674.134 1.00 112.55 ? 531  PHE C CD2   1 
ATOM   7716  C  CE1   . PHE C 2  531  ? 478.510 -47.851 674.713 1.00 108.36 ? 531  PHE C CE1   1 
ATOM   7717  C  CE2   . PHE C 2  531  ? 476.611 -48.266 673.309 1.00 107.45 ? 531  PHE C CE2   1 
ATOM   7718  C  CZ    . PHE C 2  531  ? 477.945 -48.467 673.605 1.00 109.82 ? 531  PHE C CZ    1 
ATOM   7719  N  N     . MET C 2  532  ? 475.197 -44.693 678.907 1.00 108.45 ? 532  MET C N     1 
ATOM   7720  C  CA    . MET C 2  532  ? 474.762 -43.654 679.844 1.00 99.44  ? 532  MET C CA    1 
ATOM   7721  C  C     . MET C 2  532  ? 475.614 -42.387 679.728 1.00 96.81  ? 532  MET C C     1 
ATOM   7722  O  O     . MET C 2  532  ? 476.834 -42.478 679.559 1.00 97.94  ? 532  MET C O     1 
ATOM   7723  C  CB    . MET C 2  532  ? 474.822 -44.174 681.281 1.00 93.39  ? 532  MET C CB    1 
ATOM   7724  C  CG    . MET C 2  532  ? 474.453 -43.140 682.304 1.00 97.29  ? 532  MET C CG    1 
ATOM   7725  S  SD    . MET C 2  532  ? 474.391 -43.806 683.966 1.00 98.93  ? 532  MET C SD    1 
ATOM   7726  C  CE    . MET C 2  532  ? 476.016 -43.264 684.508 1.00 105.64 ? 532  MET C CE    1 
ATOM   7727  N  N     . ASP C 2  533  ? 474.982 -41.214 679.891 1.00 93.45  ? 533  ASP C N     1 
ATOM   7728  C  CA    . ASP C 2  533  ? 475.694 -39.937 679.810 1.00 90.23  ? 533  ASP C CA    1 
ATOM   7729  C  C     . ASP C 2  533  ? 476.846 -39.896 680.811 1.00 91.25  ? 533  ASP C C     1 
ATOM   7730  O  O     . ASP C 2  533  ? 476.750 -40.423 681.923 1.00 97.31  ? 533  ASP C O     1 
ATOM   7731  C  CB    . ASP C 2  533  ? 474.768 -38.767 680.149 1.00 92.12  ? 533  ASP C CB    1 
ATOM   7732  C  CG    . ASP C 2  533  ? 473.700 -38.513 679.116 1.00 96.00  ? 533  ASP C CG    1 
ATOM   7733  O  OD1   . ASP C 2  533  ? 473.285 -39.453 678.391 1.00 94.89  ? 533  ASP C OD1   1 
ATOM   7734  O  OD2   . ASP C 2  533  ? 473.266 -37.341 679.058 1.00 95.61  ? 533  ASP C OD2   1 
ATOM   7735  N  N     . VAL C 2  534  ? 477.951 -39.269 680.412 1.00 89.31  ? 534  VAL C N     1 
ATOM   7736  C  CA    . VAL C 2  534  ? 479.083 -39.128 681.324 1.00 89.39  ? 534  VAL C CA    1 
ATOM   7737  C  C     . VAL C 2  534  ? 478.794 -38.100 682.405 1.00 89.35  ? 534  VAL C C     1 
ATOM   7738  O  O     . VAL C 2  534  ? 479.190 -38.280 683.562 1.00 94.53  ? 534  VAL C O     1 
ATOM   7739  C  CB    . VAL C 2  534  ? 480.367 -38.779 680.549 1.00 92.65  ? 534  VAL C CB    1 
ATOM   7740  C  CG1   . VAL C 2  534  ? 481.483 -38.326 681.494 1.00 86.56  ? 534  VAL C CG1   1 
ATOM   7741  C  CG2   . VAL C 2  534  ? 480.824 -39.985 679.749 1.00 100.30 ? 534  VAL C CG2   1 
ATOM   7742  N  N     . SER C 2  535  ? 478.069 -37.039 682.073 1.00 89.26  ? 535  SER C N     1 
ATOM   7743  C  CA    . SER C 2  535  ? 477.922 -35.902 682.974 1.00 89.70  ? 535  SER C CA    1 
ATOM   7744  C  C     . SER C 2  535  ? 476.921 -34.928 682.361 1.00 86.86  ? 535  SER C C     1 
ATOM   7745  O  O     . SER C 2  535  ? 476.681 -34.966 681.150 1.00 85.32  ? 535  SER C O     1 
ATOM   7746  C  CB    . SER C 2  535  ? 479.283 -35.200 683.211 1.00 87.01  ? 535  SER C CB    1 
ATOM   7747  O  OG    . SER C 2  535  ? 479.193 -33.949 683.882 1.00 83.00  ? 535  SER C OG    1 
ATOM   7748  N  N     . PRO C 2  536  ? 476.294 -34.084 683.187 1.00 89.53  ? 536  PRO C N     1 
ATOM   7749  C  CA    . PRO C 2  536  ? 475.489 -32.999 682.619 1.00 88.11  ? 536  PRO C CA    1 
ATOM   7750  C  C     . PRO C 2  536  ? 476.369 -32.002 681.888 1.00 87.09  ? 536  PRO C C     1 
ATOM   7751  O  O     . PRO C 2  536  ? 475.906 -31.355 680.938 1.00 88.03  ? 536  PRO C O     1 
ATOM   7752  C  CB    . PRO C 2  536  ? 474.812 -32.371 683.849 1.00 85.40  ? 536  PRO C CB    1 
ATOM   7753  C  CG    . PRO C 2  536  ? 474.832 -33.430 684.886 1.00 85.73  ? 536  PRO C CG    1 
ATOM   7754  C  CD    . PRO C 2  536  ? 476.102 -34.200 684.646 1.00 90.97  ? 536  PRO C CD    1 
ATOM   7755  N  N     . LYS C 2  537  ? 477.612 -31.821 682.357 1.00 82.94  ? 537  LYS C N     1 
ATOM   7756  C  CA    . LYS C 2  537  ? 478.568 -30.903 681.744 1.00 83.32  ? 537  LYS C CA    1 
ATOM   7757  C  C     . LYS C 2  537  ? 478.775 -31.170 680.242 1.00 92.73  ? 537  LYS C C     1 
ATOM   7758  O  O     . LYS C 2  537  ? 479.127 -30.248 679.485 1.00 88.82  ? 537  LYS C O     1 
ATOM   7759  C  CB    . LYS C 2  537  ? 479.871 -30.979 682.550 1.00 79.60  ? 537  LYS C CB    1 
ATOM   7760  C  CG    . LYS C 2  537  ? 479.532 -30.769 684.001 1.00 90.52  ? 537  LYS C CG    1 
ATOM   7761  C  CD    . LYS C 2  537  ? 480.647 -30.718 685.015 1.00 94.83  ? 537  LYS C CD    1 
ATOM   7762  C  CE    . LYS C 2  537  ? 479.987 -30.895 686.422 1.00 98.37  ? 537  LYS C CE    1 
ATOM   7763  N  NZ    . LYS C 2  537  ? 479.044 -29.798 686.828 1.00 85.46  ? 537  LYS C NZ    1 
ATOM   7764  N  N     . GLN C 2  538  ? 478.589 -32.419 679.785 1.00 88.79  ? 538  GLN C N     1 
ATOM   7765  C  CA    . GLN C 2  538  ? 478.915 -32.712 678.392 1.00 88.21  ? 538  GLN C CA    1 
ATOM   7766  C  C     . GLN C 2  538  ? 477.942 -32.085 677.400 1.00 87.72  ? 538  GLN C C     1 
ATOM   7767  O  O     . GLN C 2  538  ? 478.263 -32.044 676.198 1.00 91.72  ? 538  GLN C O     1 
ATOM   7768  C  CB    . GLN C 2  538  ? 478.946 -34.218 678.123 1.00 89.07  ? 538  GLN C CB    1 
ATOM   7769  C  CG    . GLN C 2  538  ? 477.585 -34.835 677.947 1.00 86.17  ? 538  GLN C CG    1 
ATOM   7770  C  CD    . GLN C 2  538  ? 477.669 -36.306 677.635 1.00 88.11  ? 538  GLN C CD    1 
ATOM   7771  O  OE1   . GLN C 2  538  ? 477.295 -37.147 678.459 1.00 95.12  ? 538  GLN C OE1   1 
ATOM   7772  N  NE2   . GLN C 2  538  ? 478.158 -36.634 676.443 1.00 84.03  ? 538  GLN C NE2   1 
ATOM   7773  N  N     . VAL C 2  539  ? 476.760 -31.649 677.861 1.00 75.90  ? 539  VAL C N     1 
ATOM   7774  C  CA    . VAL C 2  539  ? 475.757 -31.055 676.969 1.00 80.43  ? 539  VAL C CA    1 
ATOM   7775  C  C     . VAL C 2  539  ? 475.990 -29.569 676.646 1.00 74.73  ? 539  VAL C C     1 
ATOM   7776  O  O     . VAL C 2  539  ? 475.418 -29.068 675.663 1.00 72.11  ? 539  VAL C O     1 
ATOM   7777  C  CB    . VAL C 2  539  ? 474.350 -31.339 677.527 1.00 82.52  ? 539  VAL C CB    1 
ATOM   7778  C  CG1   . VAL C 2  539  ? 473.253 -30.682 676.673 1.00 78.08  ? 539  VAL C CG1   1 
ATOM   7779  C  CG2   . VAL C 2  539  ? 474.118 -32.847 677.574 1.00 84.03  ? 539  VAL C CG2   1 
ATOM   7780  N  N     . PHE C 2  540  ? 476.790 -28.837 677.431 1.00 69.15  ? 540  PHE C N     1 
ATOM   7781  C  CA    . PHE C 2  540  ? 476.861 -27.387 677.287 1.00 69.25  ? 540  PHE C CA    1 
ATOM   7782  C  C     . PHE C 2  540  ? 478.296 -26.937 677.022 1.00 72.41  ? 540  PHE C C     1 
ATOM   7783  O  O     . PHE C 2  540  ? 479.258 -27.633 677.378 1.00 76.62  ? 540  PHE C O     1 
ATOM   7784  C  CB    . PHE C 2  540  ? 476.320 -26.671 678.538 1.00 80.60  ? 540  PHE C CB    1 
ATOM   7785  C  CG    . PHE C 2  540  ? 474.954 -27.149 678.954 1.00 79.63  ? 540  PHE C CG    1 
ATOM   7786  C  CD1   . PHE C 2  540  ? 473.814 -26.431 678.627 1.00 73.45  ? 540  PHE C CD1   1 
ATOM   7787  C  CD2   . PHE C 2  540  ? 474.833 -28.274 679.779 1.00 79.30  ? 540  PHE C CD2   1 
ATOM   7788  C  CE1   . PHE C 2  540  ? 472.573 -26.883 679.022 1.00 78.04  ? 540  PHE C CE1   1 
ATOM   7789  C  CE2   . PHE C 2  540  ? 473.597 -28.732 680.197 1.00 78.35  ? 540  PHE C CE2   1 
ATOM   7790  C  CZ    . PHE C 2  540  ? 472.463 -28.035 679.825 1.00 83.62  ? 540  PHE C CZ    1 
ATOM   7791  N  N     . SER C 2  541  ? 478.431 -25.695 676.536 1.00 67.07  ? 541  SER C N     1 
ATOM   7792  C  CA    . SER C 2  541  ? 479.726 -25.109 676.200 1.00 67.90  ? 541  SER C CA    1 
ATOM   7793  C  C     . SER C 2  541  ? 480.528 -24.819 677.457 1.00 68.99  ? 541  SER C C     1 
ATOM   7794  O  O     . SER C 2  541  ? 480.143 -25.181 678.563 1.00 75.75  ? 541  SER C O     1 
ATOM   7795  C  CB    . SER C 2  541  ? 479.535 -23.823 675.402 1.00 72.91  ? 541  SER C CB    1 
ATOM   7796  O  OG    . SER C 2  541  ? 478.953 -22.802 676.198 1.00 70.23  ? 541  SER C OG    1 
ATOM   7797  N  N     . VAL C 2  542  ? 481.732 -24.282 677.293 1.00 68.02  ? 542  VAL C N     1 
ATOM   7798  C  CA    . VAL C 2  542  ? 482.490 -23.988 678.502 1.00 73.95  ? 542  VAL C CA    1 
ATOM   7799  C  C     . VAL C 2  542  ? 481.879 -22.808 679.260 1.00 77.25  ? 542  VAL C C     1 
ATOM   7800  O  O     . VAL C 2  542  ? 481.664 -22.875 680.482 1.00 73.98  ? 542  VAL C O     1 
ATOM   7801  C  CB    . VAL C 2  542  ? 483.973 -23.766 678.165 1.00 75.04  ? 542  VAL C CB    1 
ATOM   7802  C  CG1   . VAL C 2  542  ? 484.673 -23.063 679.290 1.00 70.49  ? 542  VAL C CG1   1 
ATOM   7803  C  CG2   . VAL C 2  542  ? 484.643 -25.123 677.949 1.00 80.52  ? 542  VAL C CG2   1 
ATOM   7804  N  N     . ASN C 2  543  ? 481.454 -21.775 678.539 1.00 76.66  ? 543  ASN C N     1 
ATOM   7805  C  CA    . ASN C 2  543  ? 480.858 -20.622 679.209 1.00 75.91  ? 543  ASN C CA    1 
ATOM   7806  C  C     . ASN C 2  543  ? 479.563 -20.982 679.925 1.00 71.32  ? 543  ASN C C     1 
ATOM   7807  O  O     . ASN C 2  543  ? 479.378 -20.625 681.090 1.00 74.32  ? 543  ASN C O     1 
ATOM   7808  C  CB    . ASN C 2  543  ? 480.624 -19.511 678.203 1.00 75.00  ? 543  ASN C CB    1 
ATOM   7809  C  CG    . ASN C 2  543  ? 481.907 -19.011 677.643 1.00 77.83  ? 543  ASN C CG    1 
ATOM   7810  O  OD1   . ASN C 2  543  ? 482.653 -19.793 677.046 1.00 83.50  ? 543  ASN C OD1   1 
ATOM   7811  N  ND2   . ASN C 2  543  ? 482.221 -17.734 677.875 1.00 76.21  ? 543  ASN C ND2   1 
ATOM   7812  N  N     . THR C 2  544  ? 478.682 -21.738 679.267 1.00 67.58  ? 544  THR C N     1 
ATOM   7813  C  CA    . THR C 2  544  ? 477.440 -22.156 679.906 1.00 68.60  ? 544  THR C CA    1 
ATOM   7814  C  C     . THR C 2  544  ? 477.719 -22.984 681.155 1.00 78.58  ? 544  THR C C     1 
ATOM   7815  O  O     . THR C 2  544  ? 476.983 -22.887 682.157 1.00 74.28  ? 544  THR C O     1 
ATOM   7816  C  CB    . THR C 2  544  ? 476.565 -22.933 678.918 1.00 70.21  ? 544  THR C CB    1 
ATOM   7817  O  OG1   . THR C 2  544  ? 476.374 -22.173 677.715 1.00 73.47  ? 544  THR C OG1   1 
ATOM   7818  C  CG2   . THR C 2  544  ? 475.226 -23.247 679.523 1.00 75.42  ? 544  THR C CG2   1 
ATOM   7819  N  N     . ASN C 2  545  ? 478.794 -23.772 681.133 1.00 77.30  ? 545  ASN C N     1 
ATOM   7820  C  CA    . ASN C 2  545  ? 479.105 -24.581 682.295 1.00 75.37  ? 545  ASN C CA    1 
ATOM   7821  C  C     . ASN C 2  545  ? 479.560 -23.745 683.479 1.00 74.57  ? 545  ASN C C     1 
ATOM   7822  O  O     . ASN C 2  545  ? 479.670 -24.286 684.580 1.00 76.89  ? 545  ASN C O     1 
ATOM   7823  C  CB    . ASN C 2  545  ? 480.185 -25.593 681.933 1.00 70.24  ? 545  ASN C CB    1 
ATOM   7824  C  CG    . ASN C 2  545  ? 479.617 -26.966 681.679 1.00 77.37  ? 545  ASN C CG    1 
ATOM   7825  O  OD1   . ASN C 2  545  ? 479.117 -27.618 682.587 1.00 82.45  ? 545  ASN C OD1   1 
ATOM   7826  N  ND2   . ASN C 2  545  ? 479.650 -27.396 680.427 1.00 78.65  ? 545  ASN C ND2   1 
ATOM   7827  N  N     . LEU C 2  546  ? 479.764 -22.440 683.299 1.00 75.50  ? 546  LEU C N     1 
ATOM   7828  C  CA    . LEU C 2  546  ? 480.217 -21.578 684.382 1.00 76.53  ? 546  LEU C CA    1 
ATOM   7829  C  C     . LEU C 2  546  ? 479.067 -20.902 685.117 1.00 79.05  ? 546  LEU C C     1 
ATOM   7830  O  O     . LEU C 2  546  ? 479.315 -20.126 686.059 1.00 79.54  ? 546  LEU C O     1 
ATOM   7831  C  CB    . LEU C 2  546  ? 481.188 -20.514 683.851 1.00 72.54  ? 546  LEU C CB    1 
ATOM   7832  C  CG    . LEU C 2  546  ? 482.538 -21.117 683.447 1.00 70.07  ? 546  LEU C CG    1 
ATOM   7833  C  CD1   . LEU C 2  546  ? 483.464 -20.100 682.789 1.00 67.68  ? 546  LEU C CD1   1 
ATOM   7834  C  CD2   . LEU C 2  546  ? 483.211 -21.867 684.605 1.00 73.27  ? 546  LEU C CD2   1 
ATOM   7835  N  N     . ILE C 2  547  ? 477.828 -21.224 684.742 1.00 76.04  ? 547  ILE C N     1 
ATOM   7836  C  CA    . ILE C 2  547  ? 476.639 -20.598 685.304 1.00 72.86  ? 547  ILE C CA    1 
ATOM   7837  C  C     . ILE C 2  547  ? 476.048 -21.535 686.387 1.00 75.31  ? 547  ILE C C     1 
ATOM   7838  O  O     . ILE C 2  547  ? 475.468 -22.574 686.036 1.00 67.31  ? 547  ILE C O     1 
ATOM   7839  C  CB    . ILE C 2  547  ? 475.615 -20.249 684.218 1.00 64.09  ? 547  ILE C CB    1 
ATOM   7840  C  CG1   . ILE C 2  547  ? 476.270 -19.356 683.181 1.00 67.96  ? 547  ILE C CG1   1 
ATOM   7841  C  CG2   . ILE C 2  547  ? 474.423 -19.544 684.764 1.00 64.26  ? 547  ILE C CG2   1 
ATOM   7842  C  CD1   . ILE C 2  547  ? 475.370 -19.034 682.007 1.00 66.88  ? 547  ILE C CD1   1 
ATOM   7843  N  N     . PRO C 2  548  ? 476.205 -21.199 687.671 1.00 77.24  ? 548  PRO C N     1 
ATOM   7844  C  CA    . PRO C 2  548  ? 475.642 -22.053 688.730 1.00 72.68  ? 548  PRO C CA    1 
ATOM   7845  C  C     . PRO C 2  548  ? 474.125 -21.959 688.735 1.00 72.40  ? 548  PRO C C     1 
ATOM   7846  O  O     . PRO C 2  548  ? 473.551 -20.963 688.287 1.00 66.24  ? 548  PRO C O     1 
ATOM   7847  C  CB    . PRO C 2  548  ? 476.242 -21.461 690.008 1.00 68.42  ? 548  PRO C CB    1 
ATOM   7848  C  CG    . PRO C 2  548  ? 476.499 -20.022 689.661 1.00 69.11  ? 548  PRO C CG    1 
ATOM   7849  C  CD    . PRO C 2  548  ? 476.896 -20.017 688.220 1.00 71.12  ? 548  PRO C CD    1 
ATOM   7850  N  N     . PHE C 2  549  ? 473.472 -23.039 689.202 1.00 76.19  ? 549  PHE C N     1 
ATOM   7851  C  CA    . PHE C 2  549  ? 471.999 -23.119 689.243 1.00 80.13  ? 549  PHE C CA    1 
ATOM   7852  C  C     . PHE C 2  549  ? 471.382 -22.943 687.866 1.00 74.39  ? 549  PHE C C     1 
ATOM   7853  O  O     . PHE C 2  549  ? 470.259 -22.460 687.736 1.00 76.66  ? 549  PHE C O     1 
ATOM   7854  C  CB    . PHE C 2  549  ? 471.380 -22.097 690.199 1.00 72.13  ? 549  PHE C CB    1 
ATOM   7855  C  CG    . PHE C 2  549  ? 471.849 -22.224 691.583 1.00 72.12  ? 549  PHE C CG    1 
ATOM   7856  C  CD1   . PHE C 2  549  ? 471.488 -23.349 692.328 1.00 77.65  ? 549  PHE C CD1   1 
ATOM   7857  C  CD2   . PHE C 2  549  ? 472.659 -21.250 692.151 1.00 70.68  ? 549  PHE C CD2   1 
ATOM   7858  C  CE1   . PHE C 2  549  ? 471.893 -23.493 693.632 1.00 79.13  ? 549  PHE C CE1   1 
ATOM   7859  C  CE2   . PHE C 2  549  ? 473.090 -21.380 693.456 1.00 73.80  ? 549  PHE C CE2   1 
ATOM   7860  C  CZ    . PHE C 2  549  ? 472.708 -22.512 694.201 1.00 81.23  ? 549  PHE C CZ    1 
ATOM   7861  N  N     . LEU C 2  550  ? 472.114 -23.356 686.840 1.00 77.57  ? 550  LEU C N     1 
ATOM   7862  C  CA    . LEU C 2  550  ? 471.640 -23.231 685.466 1.00 80.23  ? 550  LEU C CA    1 
ATOM   7863  C  C     . LEU C 2  550  ? 470.304 -23.938 685.267 1.00 81.41  ? 550  LEU C C     1 
ATOM   7864  O  O     . LEU C 2  550  ? 469.479 -23.474 684.472 1.00 78.33  ? 550  LEU C O     1 
ATOM   7865  C  CB    . LEU C 2  550  ? 472.684 -23.792 684.496 1.00 76.52  ? 550  LEU C CB    1 
ATOM   7866  C  CG    . LEU C 2  550  ? 472.320 -23.980 683.028 1.00 74.22  ? 550  LEU C CG    1 
ATOM   7867  C  CD1   . LEU C 2  550  ? 472.151 -22.616 682.366 1.00 75.38  ? 550  LEU C CD1   1 
ATOM   7868  C  CD2   . LEU C 2  550  ? 473.354 -24.816 682.314 1.00 78.87  ? 550  LEU C CD2   1 
ATOM   7869  N  N     . GLU C 2  551  ? 470.054 -25.033 686.014 1.00 83.58  ? 551  GLU C N     1 
ATOM   7870  C  CA    . GLU C 2  551  ? 468.800 -25.771 685.871 1.00 81.32  ? 551  GLU C CA    1 
ATOM   7871  C  C     . GLU C 2  551  ? 467.590 -24.900 686.185 1.00 78.47  ? 551  GLU C C     1 
ATOM   7872  O  O     . GLU C 2  551  ? 466.478 -25.227 685.754 1.00 75.07  ? 551  GLU C O     1 
ATOM   7873  C  CB    . GLU C 2  551  ? 468.815 -27.053 686.747 1.00 78.23  ? 551  GLU C CB    1 
ATOM   7874  C  CG    . GLU C 2  551  ? 468.945 -26.958 688.308 1.00 83.46  ? 551  GLU C CG    1 
ATOM   7875  C  CD    . GLU C 2  551  ? 470.398 -27.000 688.911 1.00 92.05  ? 551  GLU C CD    1 
ATOM   7876  O  OE1   . GLU C 2  551  ? 470.578 -27.356 690.131 1.00 88.65  ? 551  GLU C OE1   1 
ATOM   7877  O  OE2   . GLU C 2  551  ? 471.346 -26.590 688.202 1.00 87.37  ? 551  GLU C OE2   1 
ATOM   7878  N  N     . HIS C 2  552  ? 467.795 -23.784 686.888 1.00 79.30  ? 552  HIS C N     1 
ATOM   7879  C  CA    . HIS C 2  552  ? 466.747 -22.842 687.263 1.00 77.42  ? 552  HIS C CA    1 
ATOM   7880  C  C     . HIS C 2  552  ? 466.599 -21.620 686.318 1.00 77.83  ? 552  HIS C C     1 
ATOM   7881  O  O     . HIS C 2  552  ? 465.733 -20.786 686.578 1.00 84.01  ? 552  HIS C O     1 
ATOM   7882  C  CB    . HIS C 2  552  ? 466.980 -22.366 688.728 1.00 76.33  ? 552  HIS C CB    1 
ATOM   7883  C  CG    . HIS C 2  552  ? 467.087 -23.490 689.745 1.00 83.64  ? 552  HIS C CG    1 
ATOM   7884  N  ND1   . HIS C 2  552  ? 465.994 -24.188 690.228 1.00 81.37  ? 552  HIS C ND1   1 
ATOM   7885  C  CD2   . HIS C 2  552  ? 468.164 -23.995 690.405 1.00 80.18  ? 552  HIS C CD2   1 
ATOM   7886  C  CE1   . HIS C 2  552  ? 466.398 -25.100 691.100 1.00 78.41  ? 552  HIS C CE1   1 
ATOM   7887  N  NE2   . HIS C 2  552  ? 467.709 -24.999 691.233 1.00 75.04  ? 552  HIS C NE2   1 
ATOM   7888  N  N     . ASP C 2  553  ? 467.405 -21.466 685.254 1.00 77.47  ? 553  ASP C N     1 
ATOM   7889  C  CA    . ASP C 2  553  ? 467.366 -20.289 684.359 1.00 73.88  ? 553  ASP C CA    1 
ATOM   7890  C  C     . ASP C 2  553  ? 466.735 -20.525 682.989 1.00 71.56  ? 553  ASP C C     1 
ATOM   7891  O  O     . ASP C 2  553  ? 467.208 -21.389 682.242 1.00 74.39  ? 553  ASP C O     1 
ATOM   7892  C  CB    . ASP C 2  553  ? 468.774 -19.739 684.081 1.00 70.14  ? 553  ASP C CB    1 
ATOM   7893  C  CG    . ASP C 2  553  ? 469.367 -18.975 685.242 1.00 72.36  ? 553  ASP C CG    1 
ATOM   7894  O  OD1   . ASP C 2  553  ? 468.601 -18.228 685.896 1.00 73.25  ? 553  ASP C OD1   1 
ATOM   7895  O  OD2   . ASP C 2  553  ? 470.603 -19.059 685.449 1.00 70.27  ? 553  ASP C OD2   1 
ATOM   7896  N  N     . ASP C 2  554  ? 465.795 -19.647 682.592 1.00 66.57  ? 554  ASP C N     1 
ATOM   7897  C  CA    . ASP C 2  554  ? 465.269 -19.680 681.221 1.00 66.62  ? 554  ASP C CA    1 
ATOM   7898  C  C     . ASP C 2  554  ? 466.398 -19.516 680.212 1.00 71.30  ? 554  ASP C C     1 
ATOM   7899  O  O     . ASP C 2  554  ? 467.326 -18.733 680.426 1.00 72.53  ? 554  ASP C O     1 
ATOM   7900  C  CB    . ASP C 2  554  ? 464.207 -18.604 680.966 1.00 63.15  ? 554  ASP C CB    1 
ATOM   7901  C  CG    . ASP C 2  554  ? 463.737 -18.562 679.474 1.00 70.67  ? 554  ASP C CG    1 
ATOM   7902  O  OD1   . ASP C 2  554  ? 462.905 -19.423 679.071 1.00 70.74  ? 554  ASP C OD1   1 
ATOM   7903  O  OD2   . ASP C 2  554  ? 464.146 -17.637 678.717 1.00 70.10  ? 554  ASP C OD2   1 
ATOM   7904  N  N     . ALA C 2  555  ? 466.340 -20.334 679.146 1.00 70.44  ? 555  ALA C N     1 
ATOM   7905  C  CA    . ALA C 2  555  ? 467.425 -20.437 678.166 1.00 73.11  ? 555  ALA C CA    1 
ATOM   7906  C  C     . ALA C 2  555  ? 467.804 -19.099 677.521 1.00 71.93  ? 555  ALA C C     1 
ATOM   7907  O  O     . ALA C 2  555  ? 469.002 -18.798 677.359 1.00 66.14  ? 555  ALA C O     1 
ATOM   7908  C  CB    . ALA C 2  555  ? 467.019 -21.438 677.090 1.00 74.82  ? 555  ALA C CB    1 
ATOM   7909  N  N     . ASN C 2  556  ? 466.805 -18.276 677.167 1.00 66.21  ? 556  ASN C N     1 
ATOM   7910  C  CA    . ASN C 2  556  ? 467.099 -17.004 676.508 1.00 69.07  ? 556  ASN C CA    1 
ATOM   7911  C  C     . ASN C 2  556  ? 467.982 -16.120 677.380 1.00 69.32  ? 556  ASN C C     1 
ATOM   7912  O  O     . ASN C 2  556  ? 468.747 -15.300 676.864 1.00 77.22  ? 556  ASN C O     1 
ATOM   7913  C  CB    . ASN C 2  556  ? 465.797 -16.264 676.179 1.00 67.40  ? 556  ASN C CB    1 
ATOM   7914  C  CG    . ASN C 2  556  ? 464.859 -17.064 675.270 1.00 76.67  ? 556  ASN C CG    1 
ATOM   7915  O  OD1   . ASN C 2  556  ? 463.900 -17.668 675.754 1.00 87.67  ? 556  ASN C OD1   1 
ATOM   7916  N  ND2   . ASN C 2  556  ? 465.035 -16.943 673.957 1.00 73.08  ? 556  ASN C ND2   1 
ATOM   7917  N  N     . ARG C 2  557  ? 467.826 -16.210 678.693 1.00 63.40  ? 557  ARG C N     1 
ATOM   7918  C  CA    . ARG C 2  557  ? 468.665 -15.452 679.608 1.00 67.07  ? 557  ARG C CA    1 
ATOM   7919  C  C     . ARG C 2  557  ? 469.998 -16.145 679.879 1.00 70.73  ? 557  ARG C C     1 
ATOM   7920  O  O     . ARG C 2  557  ? 471.008 -15.468 680.106 1.00 74.82  ? 557  ARG C O     1 
ATOM   7921  C  CB    . ARG C 2  557  ? 467.908 -15.180 680.912 1.00 73.41  ? 557  ARG C CB    1 
ATOM   7922  C  CG    . ARG C 2  557  ? 467.920 -13.696 681.352 1.00 70.57  ? 557  ARG C CG    1 
ATOM   7923  C  CD    . ARG C 2  557  ? 467.290 -12.709 680.284 1.00 62.33  ? 557  ARG C CD    1 
ATOM   7924  N  NE    . ARG C 2  557  ? 467.716 -11.319 680.500 1.00 52.88  ? 557  ARG C NE    1 
ATOM   7925  C  CZ    . ARG C 2  557  ? 467.195 -10.255 679.895 1.00 56.03  ? 557  ARG C CZ    1 
ATOM   7926  N  NH1   . ARG C 2  557  ? 466.197 -10.397 679.014 1.00 50.99  ? 557  ARG C NH1   1 
ATOM   7927  N  NH2   . ARG C 2  557  ? 467.661 -9.041  680.202 1.00 56.07  ? 557  ARG C NH2   1 
ATOM   7928  N  N     . ALA C 2  558  ? 469.996 -17.484 679.988 1.00 70.19  ? 558  ALA C N     1 
ATOM   7929  C  CA    . ALA C 2  558  ? 471.246 -18.231 680.167 1.00 66.55  ? 558  ALA C CA    1 
ATOM   7930  C  C     . ALA C 2  558  ? 472.237 -17.918 679.071 1.00 69.67  ? 558  ALA C C     1 
ATOM   7931  O  O     . ALA C 2  558  ? 473.439 -17.767 679.324 1.00 69.66  ? 558  ALA C O     1 
ATOM   7932  C  CB    . ALA C 2  558  ? 470.993 -19.739 680.197 1.00 64.63  ? 558  ALA C CB    1 
ATOM   7933  N  N     . LEU C 2  559  ? 471.738 -17.777 677.850 1.00 71.49  ? 559  LEU C N     1 
ATOM   7934  C  CA    . LEU C 2  559  ? 472.576 -17.354 676.734 1.00 77.14  ? 559  LEU C CA    1 
ATOM   7935  C  C     . LEU C 2  559  ? 473.359 -16.085 677.076 1.00 75.39  ? 559  LEU C C     1 
ATOM   7936  O  O     . LEU C 2  559  ? 474.573 -16.016 676.850 1.00 76.04  ? 559  LEU C O     1 
ATOM   7937  C  CB    . LEU C 2  559  ? 471.700 -17.168 675.503 1.00 71.74  ? 559  LEU C CB    1 
ATOM   7938  C  CG    . LEU C 2  559  ? 472.328 -16.668 674.243 1.00 65.26  ? 559  LEU C CG    1 
ATOM   7939  C  CD1   . LEU C 2  559  ? 471.523 -17.317 673.159 1.00 69.40  ? 559  LEU C CD1   1 
ATOM   7940  C  CD2   . LEU C 2  559  ? 472.208 -15.172 674.193 1.00 72.95  ? 559  LEU C CD2   1 
ATOM   7941  N  N     . MET C 2  560  ? 472.659 -15.038 677.536 1.00 69.98  ? 560  MET C N     1 
ATOM   7942  C  CA    . MET C 2  560  ? 473.327 -13.787 677.880 1.00 69.00  ? 560  MET C CA    1 
ATOM   7943  C  C     . MET C 2  560  ? 474.383 -13.985 678.965 1.00 69.94  ? 560  MET C C     1 
ATOM   7944  O  O     . MET C 2  560  ? 475.425 -13.314 678.967 1.00 70.16  ? 560  MET C O     1 
ATOM   7945  C  CB    . MET C 2  560  ? 472.279 -12.753 678.284 1.00 62.97  ? 560  MET C CB    1 
ATOM   7946  C  CG    . MET C 2  560  ? 471.161 -12.663 677.239 1.00 67.30  ? 560  MET C CG    1 
ATOM   7947  S  SD    . MET C 2  560  ? 469.935 -11.339 677.445 1.00 68.43  ? 560  MET C SD    1 
ATOM   7948  C  CE    . MET C 2  560  ? 468.834 -11.688 676.059 1.00 72.11  ? 560  MET C CE    1 
ATOM   7949  N  N     . GLY C 2  561  ? 474.116 -14.869 679.919 1.00 70.73  ? 561  GLY C N     1 
ATOM   7950  C  CA    . GLY C 2  561  ? 475.113 -15.182 680.936 1.00 70.77  ? 561  GLY C CA    1 
ATOM   7951  C  C     . GLY C 2  561  ? 476.402 -15.729 680.349 1.00 71.15  ? 561  GLY C C     1 
ATOM   7952  O  O     . GLY C 2  561  ? 477.499 -15.332 680.743 1.00 70.04  ? 561  GLY C O     1 
ATOM   7953  N  N     . SER C 2  562  ? 476.283 -16.764 679.519 1.00 71.66  ? 562  SER C N     1 
ATOM   7954  C  CA    . SER C 2  562  ? 477.424 -17.296 678.785 1.00 72.68  ? 562  SER C CA    1 
ATOM   7955  C  C     . SER C 2  562  ? 478.198 -16.209 678.035 1.00 78.50  ? 562  SER C C     1 
ATOM   7956  O  O     . SER C 2  562  ? 479.342 -15.892 678.385 1.00 83.52  ? 562  SER C O     1 
ATOM   7957  C  CB    . SER C 2  562  ? 476.949 -18.385 677.827 1.00 71.78  ? 562  SER C CB    1 
ATOM   7958  O  OG    . SER C 2  562  ? 476.637 -19.548 678.556 1.00 72.00  ? 562  SER C OG    1 
ATOM   7959  N  N     . ASN C 2  563  ? 477.549 -15.563 677.053 1.00 75.78  ? 563  ASN C N     1 
ATOM   7960  C  CA    . ASN C 2  563  ? 478.236 -14.603 676.187 1.00 74.09  ? 563  ASN C CA    1 
ATOM   7961  C  C     . ASN C 2  563  ? 478.902 -13.481 676.964 1.00 77.78  ? 563  ASN C C     1 
ATOM   7962  O  O     . ASN C 2  563  ? 479.909 -12.931 676.502 1.00 83.05  ? 563  ASN C O     1 
ATOM   7963  C  CB    . ASN C 2  563  ? 477.278 -13.972 675.187 1.00 75.31  ? 563  ASN C CB    1 
ATOM   7964  C  CG    . ASN C 2  563  ? 476.741 -14.954 674.182 1.00 83.68  ? 563  ASN C CG    1 
ATOM   7965  O  OD1   . ASN C 2  563  ? 477.434 -15.879 673.750 1.00 86.36  ? 563  ASN C OD1   1 
ATOM   7966  N  ND2   . ASN C 2  563  ? 475.488 -14.746 673.781 1.00 85.78  ? 563  ASN C ND2   1 
ATOM   7967  N  N     . MET C 2  564  ? 478.314 -13.051 678.079 1.00 71.95  ? 564  MET C N     1 
ATOM   7968  C  CA    . MET C 2  564  ? 478.870 -11.877 678.733 1.00 73.46  ? 564  MET C CA    1 
ATOM   7969  C  C     . MET C 2  564  ? 480.119 -12.194 679.547 1.00 71.47  ? 564  MET C C     1 
ATOM   7970  O  O     . MET C 2  564  ? 480.991 -11.331 679.667 1.00 73.91  ? 564  MET C O     1 
ATOM   7971  C  CB    . MET C 2  564  ? 477.811 -11.184 679.609 1.00 71.61  ? 564  MET C CB    1 
ATOM   7972  C  CG    . MET C 2  564  ? 476.813 -10.377 678.763 1.00 71.32  ? 564  MET C CG    1 
ATOM   7973  S  SD    . MET C 2  564  ? 475.603 -9.352  679.636 1.00 65.52  ? 564  MET C SD    1 
ATOM   7974  C  CE    . MET C 2  564  ? 474.809 -10.648 680.567 1.00 75.34  ? 564  MET C CE    1 
ATOM   7975  N  N     . GLN C 2  565  ? 480.261 -13.411 680.079 1.00 70.36  ? 565  GLN C N     1 
ATOM   7976  C  CA    . GLN C 2  565  ? 481.521 -13.751 680.731 1.00 69.17  ? 565  GLN C CA    1 
ATOM   7977  C  C     . GLN C 2  565  ? 482.694 -13.528 679.801 1.00 78.32  ? 565  GLN C C     1 
ATOM   7978  O  O     . GLN C 2  565  ? 483.783 -13.142 680.245 1.00 83.49  ? 565  GLN C O     1 
ATOM   7979  C  CB    . GLN C 2  565  ? 481.477 -15.182 681.268 1.00 72.27  ? 565  GLN C CB    1 
ATOM   7980  C  CG    . GLN C 2  565  ? 480.341 -15.386 682.291 1.00 74.14  ? 565  GLN C CG    1 
ATOM   7981  C  CD    . GLN C 2  565  ? 480.415 -16.717 683.002 1.00 71.51  ? 565  GLN C CD    1 
ATOM   7982  O  OE1   . GLN C 2  565  ? 479.862 -17.711 682.518 1.00 70.13  ? 565  GLN C OE1   1 
ATOM   7983  N  NE2   . GLN C 2  565  ? 481.136 -16.761 684.135 1.00 69.04  ? 565  GLN C NE2   1 
ATOM   7984  N  N     . THR C 2  566  ? 482.481 -13.693 678.505 1.00 76.16  ? 566  THR C N     1 
ATOM   7985  C  CA    . THR C 2  566  ? 483.529 -13.348 677.563 1.00 68.21  ? 566  THR C CA    1 
ATOM   7986  C  C     . THR C 2  566  ? 483.937 -11.889 677.677 1.00 73.20  ? 566  THR C C     1 
ATOM   7987  O  O     . THR C 2  566  ? 485.104 -11.554 677.447 1.00 80.81  ? 566  THR C O     1 
ATOM   7988  C  CB    . THR C 2  566  ? 483.050 -13.660 676.169 1.00 71.96  ? 566  THR C CB    1 
ATOM   7989  O  OG1   . THR C 2  566  ? 483.233 -15.064 675.951 1.00 81.04  ? 566  THR C OG1   1 
ATOM   7990  C  CG2   . THR C 2  566  ? 483.771 -12.795 675.112 1.00 79.06  ? 566  THR C CG2   1 
ATOM   7991  N  N     . GLN C 2  567  ? 483.019 -11.021 678.099 1.00 70.41  ? 567  GLN C N     1 
ATOM   7992  C  CA    . GLN C 2  567  ? 483.233 -9.580  678.094 1.00 65.09  ? 567  GLN C CA    1 
ATOM   7993  C  C     . GLN C 2  567  ? 483.711 -9.034  679.420 1.00 67.26  ? 567  GLN C C     1 
ATOM   7994  O  O     . GLN C 2  567  ? 483.808 -7.807  679.571 1.00 66.60  ? 567  GLN C O     1 
ATOM   7995  C  CB    . GLN C 2  567  ? 481.962 -8.871  677.650 1.00 66.90  ? 567  GLN C CB    1 
ATOM   7996  C  CG    . GLN C 2  567  ? 481.430 -9.509  676.382 1.00 77.88  ? 567  GLN C CG    1 
ATOM   7997  C  CD    . GLN C 2  567  ? 480.059 -9.051  675.971 1.00 75.45  ? 567  GLN C CD    1 
ATOM   7998  O  OE1   . GLN C 2  567  ? 479.555 -8.021  676.418 1.00 68.48  ? 567  GLN C OE1   1 
ATOM   7999  N  NE2   . GLN C 2  567  ? 479.419 -9.858  675.133 1.00 84.38  ? 567  GLN C NE2   1 
ATOM   8000  N  N     . ALA C 2  568  ? 483.953 -9.901  680.400 1.00 68.79  ? 568  ALA C N     1 
ATOM   8001  C  CA    . ALA C 2  568  ? 484.376 -9.427  681.708 1.00 71.28  ? 568  ALA C CA    1 
ATOM   8002  C  C     . ALA C 2  568  ? 485.781 -8.830  681.630 1.00 70.19  ? 568  ALA C C     1 
ATOM   8003  O  O     . ALA C 2  568  ? 486.728 -9.484  681.188 1.00 76.22  ? 568  ALA C O     1 
ATOM   8004  C  CB    . ALA C 2  568  ? 484.352 -10.576 682.717 1.00 72.26  ? 568  ALA C CB    1 
ATOM   8005  N  N     . VAL C 2  569  ? 485.945 -7.654  682.212 1.00 66.96  ? 569  VAL C N     1 
ATOM   8006  C  CA    . VAL C 2  569  ? 487.203 -6.929  682.201 1.00 65.42  ? 569  VAL C CA    1 
ATOM   8007  C  C     . VAL C 2  569  ? 488.011 -7.377  683.408 1.00 73.60  ? 569  VAL C C     1 
ATOM   8008  O  O     . VAL C 2  569  ? 487.470 -7.391  684.517 1.00 82.59  ? 569  VAL C O     1 
ATOM   8009  C  CB    . VAL C 2  569  ? 486.918 -5.429  682.252 1.00 71.85  ? 569  VAL C CB    1 
ATOM   8010  C  CG1   . VAL C 2  569  ? 488.137 -4.680  682.613 1.00 78.41  ? 569  VAL C CG1   1 
ATOM   8011  C  CG2   . VAL C 2  569  ? 486.407 -4.986  680.907 1.00 78.81  ? 569  VAL C CG2   1 
ATOM   8012  N  N     . PRO C 2  570  ? 489.301 -7.688  683.263 1.00 79.31  ? 570  PRO C N     1 
ATOM   8013  C  CA    . PRO C 2  570  ? 490.119 -8.057  684.433 1.00 77.72  ? 570  PRO C CA    1 
ATOM   8014  C  C     . PRO C 2  570  ? 490.249 -6.932  685.452 1.00 80.26  ? 570  PRO C C     1 
ATOM   8015  O  O     . PRO C 2  570  ? 490.723 -5.829  685.138 1.00 78.83  ? 570  PRO C O     1 
ATOM   8016  C  CB    . PRO C 2  570  ? 491.483 -8.393  683.814 1.00 82.63  ? 570  PRO C CB    1 
ATOM   8017  C  CG    . PRO C 2  570  ? 491.187 -8.755  682.389 1.00 77.73  ? 570  PRO C CG    1 
ATOM   8018  C  CD    . PRO C 2  570  ? 490.041 -7.857  681.999 1.00 77.55  ? 570  PRO C CD    1 
ATOM   8019  N  N     . LEU C 2  571  ? 489.896 -7.253  686.706 1.00 86.77  ? 571  LEU C N     1 
ATOM   8020  C  CA    . LEU C 2  571  ? 489.869 -6.291  687.802 1.00 81.13  ? 571  LEU C CA    1 
ATOM   8021  C  C     . LEU C 2  571  ? 491.095 -6.509  688.680 1.00 80.14  ? 571  LEU C C     1 
ATOM   8022  O  O     . LEU C 2  571  ? 491.512 -7.645  688.915 1.00 78.40  ? 571  LEU C O     1 
ATOM   8023  C  CB    . LEU C 2  571  ? 488.594 -6.515  688.618 1.00 75.45  ? 571  LEU C CB    1 
ATOM   8024  C  CG    . LEU C 2  571  ? 487.353 -6.458  687.738 1.00 75.65  ? 571  LEU C CG    1 
ATOM   8025  C  CD1   . LEU C 2  571  ? 486.129 -6.932  688.418 1.00 77.93  ? 571  LEU C CD1   1 
ATOM   8026  C  CD2   . LEU C 2  571  ? 487.180 -4.983  687.473 1.00 78.12  ? 571  LEU C CD2   1 
ATOM   8027  N  N     . ILE C 2  572  ? 491.617 -5.413  689.236 1.00 76.09  ? 572  ILE C N     1 
ATOM   8028  C  CA    . ILE C 2  572  ? 492.812 -5.481  690.079 1.00 74.03  ? 572  ILE C CA    1 
ATOM   8029  C  C     . ILE C 2  572  ? 492.579 -6.284  691.358 1.00 83.32  ? 572  ILE C C     1 
ATOM   8030  O  O     . ILE C 2  572  ? 493.491 -6.967  691.847 1.00 86.13  ? 572  ILE C O     1 
ATOM   8031  C  CB    . ILE C 2  572  ? 493.338 -4.050  690.320 1.00 76.38  ? 572  ILE C CB    1 
ATOM   8032  C  CG1   . ILE C 2  572  ? 492.487 -3.272  691.306 1.00 77.85  ? 572  ILE C CG1   1 
ATOM   8033  C  CG2   . ILE C 2  572  ? 493.386 -3.263  689.016 1.00 83.02  ? 572  ILE C CG2   1 
ATOM   8034  C  CD1   . ILE C 2  572  ? 492.925 -1.815  691.379 1.00 80.07  ? 572  ILE C CD1   1 
ATOM   8035  N  N     . ARG C 2  573  ? 491.365 -6.223  691.911 1.00 80.77  ? 573  ARG C N     1 
ATOM   8036  C  CA    . ARG C 2  573  ? 490.930 -6.957  693.096 1.00 76.48  ? 573  ARG C CA    1 
ATOM   8037  C  C     . ARG C 2  573  ? 490.130 -8.231  692.774 1.00 79.38  ? 573  ARG C C     1 
ATOM   8038  O  O     . ARG C 2  573  ? 489.360 -8.692  693.632 1.00 74.51  ? 573  ARG C O     1 
ATOM   8039  C  CB    . ARG C 2  573  ? 490.094 -6.043  693.988 1.00 80.00  ? 573  ARG C CB    1 
ATOM   8040  C  CG    . ARG C 2  573  ? 490.722 -4.712  694.459 1.00 85.57  ? 573  ARG C CG    1 
ATOM   8041  C  CD    . ARG C 2  573  ? 491.831 -4.804  695.562 1.00 87.46  ? 573  ARG C CD    1 
ATOM   8042  N  NE    . ARG C 2  573  ? 491.629 -5.847  696.575 1.00 86.76  ? 573  ARG C NE    1 
ATOM   8043  C  CZ    . ARG C 2  573  ? 491.092 -5.627  697.770 1.00 78.37  ? 573  ARG C CZ    1 
ATOM   8044  N  NH1   . ARG C 2  573  ? 490.700 -4.399  698.097 1.00 68.69  ? 573  ARG C NH1   1 
ATOM   8045  N  NH2   . ARG C 2  573  ? 490.943 -6.634  698.626 1.00 75.05  ? 573  ARG C NH2   1 
ATOM   8046  N  N     . ALA C 2  574  ? 490.175 -8.709  691.522 1.00 79.50  ? 574  ALA C N     1 
ATOM   8047  C  CA    . ALA C 2  574  ? 489.280 -9.776  691.052 1.00 81.25  ? 574  ALA C CA    1 
ATOM   8048  C  C     . ALA C 2  574  ? 489.200 -10.980 691.996 1.00 78.32  ? 574  ALA C C     1 
ATOM   8049  O  O     . ALA C 2  574  ? 490.195 -11.401 692.590 1.00 80.94  ? 574  ALA C O     1 
ATOM   8050  C  CB    . ALA C 2  574  ? 489.710 -10.245 689.651 1.00 77.49  ? 574  ALA C CB    1 
ATOM   8051  N  N     . GLN C 2  575  ? 487.984 -11.507 692.167 1.00 73.33  ? 575  GLN C N     1 
ATOM   8052  C  CA    . GLN C 2  575  ? 487.753 -12.664 693.013 1.00 71.96  ? 575  GLN C CA    1 
ATOM   8053  C  C     . GLN C 2  575  ? 486.909 -13.701 692.293 1.00 70.63  ? 575  GLN C C     1 
ATOM   8054  O  O     . GLN C 2  575  ? 486.075 -13.361 691.449 1.00 69.78  ? 575  GLN C O     1 
ATOM   8055  C  CB    . GLN C 2  575  ? 487.056 -12.286 694.299 1.00 82.18  ? 575  GLN C CB    1 
ATOM   8056  C  CG    . GLN C 2  575  ? 486.600 -10.859 694.396 1.00 76.45  ? 575  GLN C CG    1 
ATOM   8057  C  CD    . GLN C 2  575  ? 485.921 -10.646 695.715 1.00 77.47  ? 575  GLN C CD    1 
ATOM   8058  O  OE1   . GLN C 2  575  ? 485.073 -9.755  695.865 1.00 81.42  ? 575  GLN C OE1   1 
ATOM   8059  N  NE2   . GLN C 2  575  ? 486.295 -11.483 696.706 1.00 72.58  ? 575  GLN C NE2   1 
ATOM   8060  N  N     . ALA C 2  576  ? 487.088 -14.965 692.674 1.00 70.66  ? 576  ALA C N     1 
ATOM   8061  C  CA    . ALA C 2  576  ? 486.213 -16.010 692.173 1.00 73.25  ? 576  ALA C CA    1 
ATOM   8062  C  C     . ALA C 2  576  ? 484.843 -15.943 692.859 1.00 82.36  ? 576  ALA C C     1 
ATOM   8063  O  O     . ALA C 2  576  ? 484.733 -15.526 694.026 1.00 80.79  ? 576  ALA C O     1 
ATOM   8064  C  CB    . ALA C 2  576  ? 486.833 -17.383 692.403 1.00 76.49  ? 576  ALA C CB    1 
ATOM   8065  N  N     . PRO C 2  577  ? 483.785 -16.391 692.174 1.00 79.07  ? 577  PRO C N     1 
ATOM   8066  C  CA    . PRO C 2  577  ? 482.439 -16.314 692.761 1.00 77.85  ? 577  PRO C CA    1 
ATOM   8067  C  C     . PRO C 2  577  ? 482.289 -17.197 693.998 1.00 76.97  ? 577  PRO C C     1 
ATOM   8068  O  O     . PRO C 2  577  ? 482.876 -18.278 694.078 1.00 81.01  ? 577  PRO C O     1 
ATOM   8069  C  CB    . PRO C 2  577  ? 481.534 -16.789 691.611 1.00 74.12  ? 577  PRO C CB    1 
ATOM   8070  C  CG    . PRO C 2  577  ? 482.418 -17.552 690.707 1.00 75.89  ? 577  PRO C CG    1 
ATOM   8071  C  CD    . PRO C 2  577  ? 483.750 -16.896 690.791 1.00 72.42  ? 577  PRO C CD    1 
ATOM   8072  N  N     . VAL C 2  578  ? 481.427 -16.771 694.940 1.00 77.99  ? 578  VAL C N     1 
ATOM   8073  C  CA    . VAL C 2  578  ? 481.234 -17.606 696.131 1.00 79.41  ? 578  VAL C CA    1 
ATOM   8074  C  C     . VAL C 2  578  ? 480.460 -18.870 695.792 1.00 80.05  ? 578  VAL C C     1 
ATOM   8075  O  O     . VAL C 2  578  ? 480.591 -19.874 696.497 1.00 87.67  ? 578  VAL C O     1 
ATOM   8076  C  CB    . VAL C 2  578  ? 480.553 -16.870 697.308 1.00 79.25  ? 578  VAL C CB    1 
ATOM   8077  C  CG1   . VAL C 2  578  ? 481.109 -15.462 697.500 1.00 82.55  ? 578  VAL C CG1   1 
ATOM   8078  C  CG2   . VAL C 2  578  ? 479.028 -16.876 697.169 1.00 80.68  ? 578  VAL C CG2   1 
ATOM   8079  N  N     . VAL C 2  579  ? 479.635 -18.859 694.747 1.00 72.35  ? 579  VAL C N     1 
ATOM   8080  C  CA    . VAL C 2  579  ? 479.019 -20.084 694.239 1.00 74.51  ? 579  VAL C CA    1 
ATOM   8081  C  C     . VAL C 2  579  ? 479.615 -20.397 692.852 1.00 80.83  ? 579  VAL C C     1 
ATOM   8082  O  O     . VAL C 2  579  ? 479.378 -19.676 691.870 1.00 78.46  ? 579  VAL C O     1 
ATOM   8083  C  CB    . VAL C 2  579  ? 477.495 -19.985 694.218 1.00 65.76  ? 579  VAL C CB    1 
ATOM   8084  C  CG1   . VAL C 2  579  ? 476.893 -21.296 693.724 1.00 64.80  ? 579  VAL C CG1   1 
ATOM   8085  C  CG2   . VAL C 2  579  ? 477.016 -19.653 695.599 1.00 73.70  ? 579  VAL C CG2   1 
ATOM   8086  N  N     . MET C 2  580  ? 480.426 -21.451 692.773 1.00 80.02  ? 580  MET C N     1 
ATOM   8087  C  CA    . MET C 2  580  ? 481.036 -21.909 691.532 1.00 75.12  ? 580  MET C CA    1 
ATOM   8088  C  C     . MET C 2  580  ? 480.379 -23.196 691.053 1.00 76.64  ? 580  MET C C     1 
ATOM   8089  O  O     . MET C 2  580  ? 479.598 -23.827 691.768 1.00 79.66  ? 580  MET C O     1 
ATOM   8090  C  CB    . MET C 2  580  ? 482.532 -22.142 691.744 1.00 76.25  ? 580  MET C CB    1 
ATOM   8091  C  CG    . MET C 2  580  ? 483.283 -20.886 692.123 1.00 80.28  ? 580  MET C CG    1 
ATOM   8092  S  SD    . MET C 2  580  ? 484.965 -21.223 692.697 1.00 92.13  ? 580  MET C SD    1 
ATOM   8093  C  CE    . MET C 2  580  ? 484.830 -22.954 693.179 1.00 84.49  ? 580  MET C CE    1 
ATOM   8094  N  N     . THR C 2  581  ? 480.726 -23.590 689.826 1.00 77.86  ? 581  THR C N     1 
ATOM   8095  C  CA    . THR C 2  581  ? 480.267 -24.845 689.234 1.00 80.47  ? 581  THR C CA    1 
ATOM   8096  C  C     . THR C 2  581  ? 481.337 -25.935 689.248 1.00 84.83  ? 581  THR C C     1 
ATOM   8097  O  O     . THR C 2  581  ? 481.047 -27.076 688.851 1.00 84.11  ? 581  THR C O     1 
ATOM   8098  C  CB    . THR C 2  581  ? 479.783 -24.612 687.792 1.00 81.11  ? 581  THR C CB    1 
ATOM   8099  O  OG1   . THR C 2  581  ? 480.905 -24.298 686.945 1.00 83.16  ? 581  THR C OG1   1 
ATOM   8100  C  CG2   . THR C 2  581  ? 478.749 -23.492 687.721 1.00 73.62  ? 581  THR C CG2   1 
ATOM   8101  N  N     . GLY C 2  582  ? 482.567 -25.601 689.664 1.00 82.79  ? 582  GLY C N     1 
ATOM   8102  C  CA    . GLY C 2  582  ? 483.669 -26.536 689.684 1.00 80.40  ? 582  GLY C CA    1 
ATOM   8103  C  C     . GLY C 2  582  ? 484.491 -26.597 688.421 1.00 87.26  ? 582  GLY C C     1 
ATOM   8104  O  O     . GLY C 2  582  ? 485.436 -27.398 688.353 1.00 93.16  ? 582  GLY C O     1 
ATOM   8105  N  N     . LEU C 2  583  ? 484.178 -25.777 687.419 1.00 84.97  ? 583  LEU C N     1 
ATOM   8106  C  CA    . LEU C 2  583  ? 484.989 -25.745 686.216 1.00 84.18  ? 583  LEU C CA    1 
ATOM   8107  C  C     . LEU C 2  583  ? 485.983 -24.601 686.209 1.00 81.49  ? 583  LEU C C     1 
ATOM   8108  O  O     . LEU C 2  583  ? 486.843 -24.562 685.333 1.00 85.84  ? 583  LEU C O     1 
ATOM   8109  C  CB    . LEU C 2  583  ? 484.083 -25.618 684.985 1.00 79.32  ? 583  LEU C CB    1 
ATOM   8110  C  CG    . LEU C 2  583  ? 484.161 -26.693 683.914 1.00 72.80  ? 583  LEU C CG    1 
ATOM   8111  C  CD1   . LEU C 2  583  ? 483.435 -27.943 684.380 1.00 76.40  ? 583  LEU C CD1   1 
ATOM   8112  C  CD2   . LEU C 2  583  ? 483.517 -26.162 682.681 1.00 74.31  ? 583  LEU C CD2   1 
ATOM   8113  N  N     . GLU C 2  584  ? 485.906 -23.692 687.176 1.00 82.50  ? 584  GLU C N     1 
ATOM   8114  C  CA    . GLU C 2  584  ? 486.645 -22.439 687.085 1.00 84.36  ? 584  GLU C CA    1 
ATOM   8115  C  C     . GLU C 2  584  ? 488.119 -22.682 687.357 1.00 87.17  ? 584  GLU C C     1 
ATOM   8116  O  O     . GLU C 2  584  ? 488.946 -21.808 687.084 1.00 88.37  ? 584  GLU C O     1 
ATOM   8117  C  CB    . GLU C 2  584  ? 486.106 -21.340 688.030 1.00 83.51  ? 584  GLU C CB    1 
ATOM   8118  C  CG    . GLU C 2  584  ? 485.160 -21.738 689.171 1.00 80.46  ? 584  GLU C CG    1 
ATOM   8119  C  CD    . GLU C 2  584  ? 483.690 -21.888 688.771 1.00 82.35  ? 584  GLU C CD    1 
ATOM   8120  O  OE1   . GLU C 2  584  ? 483.029 -20.874 688.405 1.00 74.16  ? 584  GLU C OE1   1 
ATOM   8121  O  OE2   . GLU C 2  584  ? 483.183 -23.030 688.889 1.00 84.78  ? 584  GLU C OE2   1 
ATOM   8122  N  N     . GLU C 2  585  ? 488.424 -23.786 688.038 1.00 90.42  ? 585  GLU C N     1 
ATOM   8123  C  CA    . GLU C 2  585  ? 489.793 -24.267 688.194 1.00 93.67  ? 585  GLU C CA    1 
ATOM   8124  C  C     . GLU C 2  585  ? 490.403 -24.766 686.880 1.00 95.15  ? 585  GLU C C     1 
ATOM   8125  O  O     . GLU C 2  585  ? 491.550 -24.426 686.550 1.00 91.49  ? 585  GLU C O     1 
ATOM   8126  C  CB    . GLU C 2  585  ? 489.744 -25.395 689.219 1.00 98.50  ? 585  GLU C CB    1 
ATOM   8127  C  CG    . GLU C 2  585  ? 490.269 -25.067 690.606 1.00 103.10 ? 585  GLU C CG    1 
ATOM   8128  C  CD    . GLU C 2  585  ? 489.856 -26.134 691.628 1.00 113.11 ? 585  GLU C CD    1 
ATOM   8129  O  OE1   . GLU C 2  585  ? 488.830 -26.818 691.372 1.00 121.43 ? 585  GLU C OE1   1 
ATOM   8130  O  OE2   . GLU C 2  585  ? 490.551 -26.299 692.666 1.00 110.30 ? 585  GLU C OE2   1 
ATOM   8131  N  N     . ARG C 2  586  ? 489.655 -25.578 686.121 1.00 96.37  ? 586  ARG C N     1 
ATOM   8132  C  CA    . ARG C 2  586  ? 490.185 -26.160 684.884 1.00 89.87  ? 586  ARG C CA    1 
ATOM   8133  C  C     . ARG C 2  586  ? 490.451 -25.096 683.818 1.00 89.60  ? 586  ARG C C     1 
ATOM   8134  O  O     . ARG C 2  586  ? 491.483 -25.138 683.139 1.00 91.07  ? 586  ARG C O     1 
ATOM   8135  C  CB    . ARG C 2  586  ? 489.201 -27.195 684.325 1.00 89.60  ? 586  ARG C CB    1 
ATOM   8136  C  CG    . ARG C 2  586  ? 489.686 -28.638 684.303 1.00 89.04  ? 586  ARG C CG    1 
ATOM   8137  C  CD    . ARG C 2  586  ? 491.130 -28.739 683.892 1.00 90.08  ? 586  ARG C CD    1 
ATOM   8138  N  NE    . ARG C 2  586  ? 491.302 -29.122 682.497 1.00 89.71  ? 586  ARG C NE    1 
ATOM   8139  C  CZ    . ARG C 2  586  ? 490.868 -30.246 681.942 1.00 88.06  ? 586  ARG C CZ    1 
ATOM   8140  N  NH1   . ARG C 2  586  ? 490.217 -31.170 682.646 1.00 86.93  ? 586  ARG C NH1   1 
ATOM   8141  N  NH2   . ARG C 2  586  ? 491.108 -30.442 680.656 1.00 89.37  ? 586  ARG C NH2   1 
ATOM   8142  N  N     . VAL C 2  587  ? 489.554 -24.101 683.710 1.00 91.55  ? 587  VAL C N     1 
ATOM   8143  C  CA    . VAL C 2  587  ? 489.625 -23.042 682.693 1.00 83.70  ? 587  VAL C CA    1 
ATOM   8144  C  C     . VAL C 2  587  ? 490.895 -22.222 682.838 1.00 85.84  ? 587  VAL C C     1 
ATOM   8145  O  O     . VAL C 2  587  ? 491.520 -21.844 681.842 1.00 85.26  ? 587  VAL C O     1 
ATOM   8146  C  CB    . VAL C 2  587  ? 488.372 -22.149 682.749 1.00 75.09  ? 587  VAL C CB    1 
ATOM   8147  C  CG1   . VAL C 2  587  ? 488.590 -20.870 681.972 1.00 66.45  ? 587  VAL C CG1   1 
ATOM   8148  C  CG2   . VAL C 2  587  ? 487.179 -22.904 682.209 1.00 75.48  ? 587  VAL C CG2   1 
ATOM   8149  N  N     . VAL C 2  588  ? 491.275 -21.882 684.063 1.00 84.04  ? 588  VAL C N     1 
ATOM   8150  C  CA    . VAL C 2  588  ? 492.493 -21.101 684.209 1.00 86.62  ? 588  VAL C CA    1 
ATOM   8151  C  C     . VAL C 2  588  ? 493.690 -21.910 683.727 1.00 87.52  ? 588  VAL C C     1 
ATOM   8152  O  O     . VAL C 2  588  ? 494.568 -21.396 683.018 1.00 86.04  ? 588  VAL C O     1 
ATOM   8153  C  CB    . VAL C 2  588  ? 492.662 -20.665 685.675 1.00 83.99  ? 588  VAL C CB    1 
ATOM   8154  C  CG1   . VAL C 2  588  ? 494.006 -20.003 685.881 1.00 93.19  ? 588  VAL C CG1   1 
ATOM   8155  C  CG2   . VAL C 2  588  ? 491.555 -19.703 686.061 1.00 87.82  ? 588  VAL C CG2   1 
ATOM   8156  N  N     . ARG C 2  589  ? 493.707 -23.200 684.063 1.00 86.77  ? 589  ARG C N     1 
ATOM   8157  C  CA    . ARG C 2  589  ? 494.817 -24.087 683.728 1.00 86.76  ? 589  ARG C CA    1 
ATOM   8158  C  C     . ARG C 2  589  ? 494.976 -24.329 682.221 1.00 92.24  ? 589  ARG C C     1 
ATOM   8159  O  O     . ARG C 2  589  ? 496.086 -24.211 681.681 1.00 91.91  ? 589  ARG C O     1 
ATOM   8160  C  CB    . ARG C 2  589  ? 494.617 -25.385 684.502 1.00 87.90  ? 589  ARG C CB    1 
ATOM   8161  C  CG    . ARG C 2  589  ? 495.102 -26.636 683.864 1.00 94.40  ? 589  ARG C CG    1 
ATOM   8162  C  CD    . ARG C 2  589  ? 495.225 -27.677 684.943 1.00 88.55  ? 589  ARG C CD    1 
ATOM   8163  N  NE    . ARG C 2  589  ? 496.122 -27.160 685.969 1.00 96.10  ? 589  ARG C NE    1 
ATOM   8164  C  CZ    . ARG C 2  589  ? 496.759 -27.915 686.853 1.00 96.71  ? 589  ARG C CZ    1 
ATOM   8165  N  NH1   . ARG C 2  589  ? 496.592 -29.234 686.824 1.00 90.43  ? 589  ARG C NH1   1 
ATOM   8166  N  NH2   . ARG C 2  589  ? 497.564 -27.351 687.755 1.00 92.45  ? 589  ARG C NH2   1 
ATOM   8167  N  N     . ASP C 2  590  ? 493.881 -24.646 681.516 1.00 90.00  ? 590  ASP C N     1 
ATOM   8168  C  CA    . ASP C 2  590  ? 493.960 -24.863 680.069 1.00 81.39  ? 590  ASP C CA    1 
ATOM   8169  C  C     . ASP C 2  590  ? 494.186 -23.570 679.298 1.00 82.51  ? 590  ASP C C     1 
ATOM   8170  O  O     . ASP C 2  590  ? 494.746 -23.600 678.198 1.00 92.40  ? 590  ASP C O     1 
ATOM   8171  C  CB    . ASP C 2  590  ? 492.691 -25.573 679.584 1.00 79.12  ? 590  ASP C CB    1 
ATOM   8172  C  CG    . ASP C 2  590  ? 492.645 -27.059 679.982 1.00 86.18  ? 590  ASP C CG    1 
ATOM   8173  O  OD1   . ASP C 2  590  ? 493.259 -27.460 681.002 1.00 80.31  ? 590  ASP C OD1   1 
ATOM   8174  O  OD2   . ASP C 2  590  ? 491.908 -27.821 679.307 1.00 86.18  ? 590  ASP C OD2   1 
ATOM   8175  N  N     . SER C 2  591  ? 493.750 -22.437 679.837 1.00 85.82  ? 591  SER C N     1 
ATOM   8176  C  CA    . SER C 2  591  ? 493.962 -21.165 679.156 1.00 87.34  ? 591  SER C CA    1 
ATOM   8177  C  C     . SER C 2  591  ? 495.439 -20.807 679.033 1.00 89.01  ? 591  SER C C     1 
ATOM   8178  O  O     . SER C 2  591  ? 495.822 -20.128 678.073 1.00 92.66  ? 591  SER C O     1 
ATOM   8179  C  CB    . SER C 2  591  ? 493.211 -20.043 679.864 1.00 91.10  ? 591  SER C CB    1 
ATOM   8180  O  OG    . SER C 2  591  ? 494.110 -19.309 680.676 1.00 97.90  ? 591  SER C OG    1 
ATOM   8181  N  N     . LEU C 2  592  ? 496.261 -21.127 680.044 1.00 89.63  ? 592  LEU C N     1 
ATOM   8182  C  CA    . LEU C 2  592  ? 497.726 -20.894 680.024 1.00 98.02  ? 592  LEU C CA    1 
ATOM   8183  C  C     . LEU C 2  592  ? 498.035 -19.483 680.523 1.00 103.13 ? 592  LEU C C     1 
ATOM   8184  O  O     . LEU C 2  592  ? 499.201 -19.065 680.481 1.00 110.13 ? 592  LEU C O     1 
ATOM   8185  C  CB    . LEU C 2  592  ? 498.445 -21.134 678.678 1.00 84.53  ? 592  LEU C CB    1 
ATOM   8186  C  CG    . LEU C 2  592  ? 498.985 -22.552 678.459 1.00 83.21  ? 592  LEU C CG    1 
ATOM   8187  C  CD1   . LEU C 2  592  ? 497.904 -23.610 678.378 1.00 86.73  ? 592  LEU C CD1   1 
ATOM   8188  C  CD2   . LEU C 2  592  ? 499.900 -22.614 677.247 1.00 93.74  ? 592  LEU C CD2   1 
ATOM   8189  N  N     . ALA C 2  593  ? 497.011 -18.718 680.906 1.00 97.14  ? 593  ALA C N     1 
ATOM   8190  C  CA    . ALA C 2  593  ? 497.156 -17.442 681.611 1.00 100.74 ? 593  ALA C CA    1 
ATOM   8191  C  C     . ALA C 2  593  ? 497.992 -17.484 682.896 1.00 105.92 ? 593  ALA C C     1 
ATOM   8192  O  O     . ALA C 2  593  ? 498.845 -16.607 683.102 1.00 103.64 ? 593  ALA C O     1 
ATOM   8193  C  CB    . ALA C 2  593  ? 495.768 -16.880 681.927 1.00 104.21 ? 593  ALA C CB    1 
ATOM   8194  N  N     . ALA C 2  594  ? 497.779 -18.475 683.775 1.00 108.63 ? 594  ALA C N     1 
ATOM   8195  C  CA    . ALA C 2  594  ? 498.571 -18.528 685.012 1.00 104.28 ? 594  ALA C CA    1 
ATOM   8196  C  C     . ALA C 2  594  ? 500.009 -19.065 684.860 1.00 104.81 ? 594  ALA C C     1 
ATOM   8197  O  O     . ALA C 2  594  ? 500.778 -18.521 684.056 1.00 105.97 ? 594  ALA C O     1 
ATOM   8198  C  CB    . ALA C 2  594  ? 497.793 -19.370 686.034 1.00 91.49  ? 594  ALA C CB    1 
ATOM   8199  N  N     . LEU C 2  595  ? 500.432 -20.029 685.691 1.00 103.85 ? 595  LEU C N     1 
ATOM   8200  C  CA    . LEU C 2  595  ? 501.807 -20.543 685.683 1.00 98.19  ? 595  LEU C CA    1 
ATOM   8201  C  C     . LEU C 2  595  ? 501.919 -21.664 686.719 1.00 102.84 ? 595  LEU C C     1 
ATOM   8202  O  O     . LEU C 2  595  ? 501.480 -21.490 687.861 1.00 102.38 ? 595  LEU C O     1 
ATOM   8203  C  CB    . LEU C 2  595  ? 502.801 -19.413 685.988 1.00 92.02  ? 595  LEU C CB    1 
ATOM   8204  C  CG    . LEU C 2  595  ? 504.283 -19.563 685.680 1.00 97.15  ? 595  LEU C CG    1 
ATOM   8205  C  CD1   . LEU C 2  595  ? 504.471 -19.612 684.180 1.00 106.19 ? 595  LEU C CD1   1 
ATOM   8206  C  CD2   . LEU C 2  595  ? 505.055 -18.397 686.251 1.00 96.96  ? 595  LEU C CD2   1 
ATOM   8207  N  N     . TYR C 2  596  ? 502.493 -22.813 686.343 1.00 107.08 ? 596  TYR C N     1 
ATOM   8208  C  CA    . TYR C 2  596  ? 502.611 -23.981 687.220 1.00 105.52 ? 596  TYR C CA    1 
ATOM   8209  C  C     . TYR C 2  596  ? 504.045 -24.488 687.316 1.00 109.32 ? 596  TYR C C     1 
ATOM   8210  O  O     . TYR C 2  596  ? 504.915 -24.088 686.536 1.00 119.26 ? 596  TYR C O     1 
ATOM   8211  C  CB    . TYR C 2  596  ? 501.662 -25.103 686.756 1.00 104.00 ? 596  TYR C CB    1 
ATOM   8212  C  CG    . TYR C 2  596  ? 500.230 -24.612 686.700 1.00 104.71 ? 596  TYR C CG    1 
ATOM   8213  C  CD1   . TYR C 2  596  ? 499.735 -24.009 685.556 1.00 111.24 ? 596  TYR C CD1   1 
ATOM   8214  C  CD2   . TYR C 2  596  ? 499.377 -24.726 687.802 1.00 102.25 ? 596  TYR C CD2   1 
ATOM   8215  C  CE1   . TYR C 2  596  ? 498.434 -23.529 685.501 1.00 108.03 ? 596  TYR C CE1   1 
ATOM   8216  C  CE2   . TYR C 2  596  ? 498.073 -24.254 687.748 1.00 96.81  ? 596  TYR C CE2   1 
ATOM   8217  C  CZ    . TYR C 2  596  ? 497.615 -23.656 686.588 1.00 98.38  ? 596  TYR C CZ    1 
ATOM   8218  O  OH    . TYR C 2  596  ? 496.344 -23.164 686.467 1.00 96.78  ? 596  TYR C OH    1 
ATOM   8219  N  N     . ALA C 2  597  ? 504.306 -25.305 688.345 1.00 107.15 ? 597  ALA C N     1 
ATOM   8220  C  CA    . ALA C 2  597  ? 505.634 -25.878 688.544 1.00 115.02 ? 597  ALA C CA    1 
ATOM   8221  C  C     . ALA C 2  597  ? 505.793 -27.152 687.702 1.00 125.17 ? 597  ALA C C     1 
ATOM   8222  O  O     . ALA C 2  597  ? 504.968 -28.073 687.802 1.00 119.76 ? 597  ALA C O     1 
ATOM   8223  C  CB    . ALA C 2  597  ? 505.850 -26.191 690.021 1.00 117.07 ? 597  ALA C CB    1 
ATOM   8224  N  N     . GLU C 2  598  ? 506.895 -27.225 686.928 1.00 126.66 ? 598  GLU C N     1 
ATOM   8225  C  CA    . GLU C 2  598  ? 507.162 -28.359 686.033 1.00 122.28 ? 598  GLU C CA    1 
ATOM   8226  C  C     . GLU C 2  598  ? 507.385 -29.662 686.797 1.00 128.03 ? 598  GLU C C     1 
ATOM   8227  O  O     . GLU C 2  598  ? 506.741 -30.677 686.501 1.00 129.42 ? 598  GLU C O     1 
ATOM   8228  C  CB    . GLU C 2  598  ? 508.305 -28.055 685.061 1.00 123.91 ? 598  GLU C CB    1 
ATOM   8229  C  CG    . GLU C 2  598  ? 507.915 -27.000 684.022 1.00 125.56 ? 598  GLU C CG    1 
ATOM   8230  C  CD    . GLU C 2  598  ? 508.986 -26.759 682.972 1.00 132.53 ? 598  GLU C CD    1 
ATOM   8231  O  OE1   . GLU C 2  598  ? 509.700 -27.731 682.630 1.00 132.30 ? 598  GLU C OE1   1 
ATOM   8232  O  OE2   . GLU C 2  598  ? 509.093 -25.612 682.471 1.00 131.31 ? 598  GLU C OE2   1 
ATOM   8233  N  N     . GLU C 2  599  ? 508.338 -29.683 687.732 1.00 128.46 ? 599  GLU C N     1 
ATOM   8234  C  CA    . GLU C 2  599  ? 508.588 -30.878 688.539 1.00 131.94 ? 599  GLU C CA    1 
ATOM   8235  C  C     . GLU C 2  599  ? 508.489 -30.466 690.003 1.00 128.25 ? 599  GLU C C     1 
ATOM   8236  O  O     . GLU C 2  599  ? 508.251 -29.296 690.305 1.00 126.81 ? 599  GLU C O     1 
ATOM   8237  C  CB    . GLU C 2  599  ? 509.982 -31.472 688.264 1.00 138.79 ? 599  GLU C CB    1 
ATOM   8238  C  CG    . GLU C 2  599  ? 510.061 -33.011 688.137 1.00 143.18 ? 599  GLU C CG    1 
ATOM   8239  C  CD    . GLU C 2  599  ? 509.575 -33.542 686.788 1.00 141.82 ? 599  GLU C CD    1 
ATOM   8240  O  OE1   . GLU C 2  599  ? 509.774 -32.842 685.764 1.00 136.94 ? 599  GLU C OE1   1 
ATOM   8241  O  OE2   . GLU C 2  599  ? 508.973 -34.643 686.761 1.00 142.36 ? 599  GLU C OE2   1 
ATOM   8242  N  N     . ASP C 2  600  ? 508.685 -31.419 690.920 1.00 130.88 ? 600  ASP C N     1 
ATOM   8243  C  CA    . ASP C 2  600  ? 508.733 -31.081 692.344 1.00 130.35 ? 600  ASP C CA    1 
ATOM   8244  C  C     . ASP C 2  600  ? 509.964 -30.234 692.655 1.00 131.75 ? 600  ASP C C     1 
ATOM   8245  O  O     . ASP C 2  600  ? 511.004 -30.355 692.000 1.00 135.41 ? 600  ASP C O     1 
ATOM   8246  C  CB    . ASP C 2  600  ? 508.707 -32.345 693.202 1.00 125.94 ? 600  ASP C CB    1 
ATOM   8247  C  CG    . ASP C 2  600  ? 507.435 -33.155 692.994 1.00 127.42 ? 600  ASP C CG    1 
ATOM   8248  O  OD1   . ASP C 2  600  ? 506.535 -33.099 693.860 1.00 122.10 ? 600  ASP C OD1   1 
ATOM   8249  O  OD2   . ASP C 2  600  ? 507.341 -33.858 691.957 1.00 133.79 ? 600  ASP C OD2   1 
ATOM   8250  N  N     . GLY C 2  601  ? 509.867 -29.394 693.678 1.00 121.89 ? 601  GLY C N     1 
ATOM   8251  C  CA    . GLY C 2  601  ? 511.008 -28.550 693.972 1.00 123.52 ? 601  GLY C CA    1 
ATOM   8252  C  C     . GLY C 2  601  ? 510.738 -27.566 695.085 1.00 120.32 ? 601  GLY C C     1 
ATOM   8253  O  O     . GLY C 2  601  ? 509.696 -27.594 695.739 1.00 119.82 ? 601  GLY C O     1 
ATOM   8254  N  N     . GLU C 2  602  ? 511.681 -26.647 695.237 1.00 117.94 ? 602  GLU C N     1 
ATOM   8255  C  CA    . GLU C 2  602  ? 511.616 -25.608 696.248 1.00 117.71 ? 602  GLU C CA    1 
ATOM   8256  C  C     . GLU C 2  602  ? 511.815 -24.263 695.579 1.00 113.49 ? 602  GLU C C     1 
ATOM   8257  O  O     . GLU C 2  602  ? 512.618 -24.125 694.654 1.00 115.43 ? 602  GLU C O     1 
ATOM   8258  C  CB    . GLU C 2  602  ? 512.683 -25.839 697.358 1.00 124.05 ? 602  GLU C CB    1 
ATOM   8259  C  CG    . GLU C 2  602  ? 512.639 -24.839 698.535 1.00 126.75 ? 602  GLU C CG    1 
ATOM   8260  C  CD    . GLU C 2  602  ? 513.734 -25.070 699.584 1.00 128.62 ? 602  GLU C CD    1 
ATOM   8261  O  OE1   . GLU C 2  602  ? 514.034 -26.253 699.877 1.00 128.68 ? 602  GLU C OE1   1 
ATOM   8262  O  OE2   . GLU C 2  602  ? 514.290 -24.071 700.109 1.00 124.36 ? 602  GLU C OE2   1 
ATOM   8263  N  N     . VAL C 2  603  ? 511.068 -23.275 696.044 1.00 112.15 ? 603  VAL C N     1 
ATOM   8264  C  CA    . VAL C 2  603  ? 511.116 -21.950 695.446 1.00 113.56 ? 603  VAL C CA    1 
ATOM   8265  C  C     . VAL C 2  603  ? 512.356 -21.243 695.973 1.00 106.23 ? 603  VAL C C     1 
ATOM   8266  O  O     . VAL C 2  603  ? 512.501 -21.044 697.182 1.00 104.27 ? 603  VAL C O     1 
ATOM   8267  C  CB    . VAL C 2  603  ? 509.842 -21.157 695.757 1.00 117.05 ? 603  VAL C CB    1 
ATOM   8268  C  CG1   . VAL C 2  603  ? 509.974 -19.746 695.197 1.00 114.87 ? 603  VAL C CG1   1 
ATOM   8269  C  CG2   . VAL C 2  603  ? 508.606 -21.886 695.195 1.00 112.64 ? 603  VAL C CG2   1 
ATOM   8270  N  N     . ALA C 2  604  ? 513.269 -20.897 695.067 1.00 106.43 ? 604  ALA C N     1 
ATOM   8271  C  CA    . ALA C 2  604  ? 514.492 -20.208 695.470 1.00 109.98 ? 604  ALA C CA    1 
ATOM   8272  C  C     . ALA C 2  604  ? 514.274 -18.708 695.635 1.00 105.47 ? 604  ALA C C     1 
ATOM   8273  O  O     . ALA C 2  604  ? 514.727 -18.106 696.613 1.00 101.45 ? 604  ALA C O     1 
ATOM   8274  C  CB    . ALA C 2  604  ? 515.600 -20.473 694.449 1.00 111.91 ? 604  ALA C CB    1 
ATOM   8275  N  N     . LYS C 2  605  ? 513.604 -18.086 694.678 1.00 109.25 ? 605  LYS C N     1 
ATOM   8276  C  CA    . LYS C 2  605  ? 513.426 -16.642 694.669 1.00 113.32 ? 605  LYS C CA    1 
ATOM   8277  C  C     . LYS C 2  605  ? 512.033 -16.273 694.160 1.00 112.89 ? 605  LYS C C     1 
ATOM   8278  O  O     . LYS C 2  605  ? 511.443 -16.991 693.348 1.00 109.34 ? 605  LYS C O     1 
ATOM   8279  C  CB    . LYS C 2  605  ? 514.548 -15.955 693.885 1.00 115.37 ? 605  LYS C CB    1 
ATOM   8280  C  CG    . LYS C 2  605  ? 515.897 -16.000 694.611 1.00 112.95 ? 605  LYS C CG    1 
ATOM   8281  C  CD    . LYS C 2  605  ? 516.960 -15.217 693.861 1.00 115.11 ? 605  LYS C CD    1 
ATOM   8282  C  CE    . LYS C 2  605  ? 518.279 -15.197 694.626 1.00 123.75 ? 605  LYS C CE    1 
ATOM   8283  N  NZ    . LYS C 2  605  ? 519.323 -14.378 693.926 1.00 134.03 ? 605  LYS C NZ    1 
ATOM   8284  N  N     . VAL C 2  606  ? 511.473 -15.197 694.723 1.00 112.91 ? 606  VAL C N     1 
ATOM   8285  C  CA    . VAL C 2  606  ? 510.189 -14.636 694.299 1.00 106.48 ? 606  VAL C CA    1 
ATOM   8286  C  C     . VAL C 2  606  ? 510.307 -13.117 694.191 1.00 107.04 ? 606  VAL C C     1 
ATOM   8287  O  O     . VAL C 2  606  ? 510.615 -12.445 695.181 1.00 111.60 ? 606  VAL C O     1 
ATOM   8288  C  CB    . VAL C 2  606  ? 509.058 -15.009 695.264 1.00 104.12 ? 606  VAL C CB    1 
ATOM   8289  C  CG1   . VAL C 2  606  ? 507.828 -14.194 694.934 1.00 104.41 ? 606  VAL C CG1   1 
ATOM   8290  C  CG2   . VAL C 2  606  ? 508.772 -16.488 695.190 1.00 103.11 ? 606  VAL C CG2   1 
ATOM   8291  N  N     . ASP C 2  607  ? 509.975 -12.579 693.020 1.00 106.67 ? 607  ASP C N     1 
ATOM   8292  C  CA    . ASP C 2  607  ? 510.112 -11.174 692.641 1.00 106.62 ? 607  ASP C CA    1 
ATOM   8293  C  C     . ASP C 2  607  ? 508.819 -10.652 692.017 1.00 105.05 ? 607  ASP C C     1 
ATOM   8294  O  O     . ASP C 2  607  ? 507.895 -11.414 691.716 1.00 107.64 ? 607  ASP C O     1 
ATOM   8295  C  CB    . ASP C 2  607  ? 511.242 -11.033 691.593 1.00 107.90 ? 607  ASP C CB    1 
ATOM   8296  C  CG    . ASP C 2  607  ? 511.992 -9.721  691.671 1.00 108.00 ? 607  ASP C CG    1 
ATOM   8297  O  OD1   . ASP C 2  607  ? 511.920 -9.058  692.728 1.00 104.81 ? 607  ASP C OD1   1 
ATOM   8298  O  OD2   . ASP C 2  607  ? 512.645 -9.364  690.645 1.00 106.08 ? 607  ASP C OD2   1 
ATOM   8299  N  N     . GLY C 2  608  ? 508.729 -9.327  691.862 1.00 98.92  ? 608  GLY C N     1 
ATOM   8300  C  CA    . GLY C 2  608  ? 507.647 -8.775  691.063 1.00 96.81  ? 608  GLY C CA    1 
ATOM   8301  C  C     . GLY C 2  608  ? 507.787 -9.155  689.596 1.00 100.13 ? 608  GLY C C     1 
ATOM   8302  O  O     . GLY C 2  608  ? 506.799 -9.434  688.907 1.00 97.64  ? 608  GLY C O     1 
ATOM   8303  N  N     . ASN C 2  609  ? 509.032 -9.182  689.109 1.00 104.20 ? 609  ASN C N     1 
ATOM   8304  C  CA    . ASN C 2  609  ? 509.395 -9.479  687.730 1.00 90.64  ? 609  ASN C CA    1 
ATOM   8305  C  C     . ASN C 2  609  ? 509.662 -10.954 687.455 1.00 94.97  ? 609  ASN C C     1 
ATOM   8306  O  O     . ASN C 2  609  ? 509.583 -11.361 686.290 1.00 95.68  ? 609  ASN C O     1 
ATOM   8307  C  CB    . ASN C 2  609  ? 510.625 -8.644  687.322 1.00 86.43  ? 609  ASN C CB    1 
ATOM   8308  C  CG    . ASN C 2  609  ? 510.494 -7.141  687.667 1.00 84.52  ? 609  ASN C CG    1 
ATOM   8309  O  OD1   . ASN C 2  609  ? 509.412 -6.570  687.562 1.00 82.66  ? 609  ASN C OD1   1 
ATOM   8310  N  ND2   . ASN C 2  609  ? 511.592 -6.514  688.093 1.00 81.06  ? 609  ASN C ND2   1 
ATOM   8311  N  N     . ARG C 2  610  ? 509.962 -11.776 688.465 1.00 98.75  ? 610  ARG C N     1 
ATOM   8312  C  CA    . ARG C 2  610  ? 510.342 -13.147 688.138 1.00 98.71  ? 610  ARG C CA    1 
ATOM   8313  C  C     . ARG C 2  610  ? 510.212 -14.069 689.337 1.00 98.76  ? 610  ARG C C     1 
ATOM   8314  O  O     . ARG C 2  610  ? 510.206 -13.624 690.481 1.00 103.56 ? 610  ARG C O     1 
ATOM   8315  C  CB    . ARG C 2  610  ? 511.773 -13.189 687.591 1.00 106.01 ? 610  ARG C CB    1 
ATOM   8316  C  CG    . ARG C 2  610  ? 512.882 -12.547 688.456 1.00 106.54 ? 610  ARG C CG    1 
ATOM   8317  C  CD    . ARG C 2  610  ? 513.771 -13.601 689.141 1.00 111.36 ? 610  ARG C CD    1 
ATOM   8318  N  NE    . ARG C 2  610  ? 514.812 -13.008 689.986 1.00 114.62 ? 610  ARG C NE    1 
ATOM   8319  C  CZ    . ARG C 2  610  ? 514.758 -12.889 691.311 1.00 115.19 ? 610  ARG C CZ    1 
ATOM   8320  N  NH1   . ARG C 2  610  ? 513.702 -13.330 691.996 1.00 112.25 ? 610  ARG C NH1   1 
ATOM   8321  N  NH2   . ARG C 2  610  ? 515.776 -12.325 691.953 1.00 113.16 ? 610  ARG C NH2   1 
ATOM   8322  N  N     . ILE C 2  611  ? 510.134 -15.374 689.047 1.00 98.45  ? 611  ILE C N     1 
ATOM   8323  C  CA    . ILE C 2  611  ? 510.103 -16.447 690.045 1.00 102.35 ? 611  ILE C CA    1 
ATOM   8324  C  C     . ILE C 2  611  ? 511.103 -17.508 689.614 1.00 103.46 ? 611  ILE C C     1 
ATOM   8325  O  O     . ILE C 2  611  ? 510.948 -18.100 688.543 1.00 107.41 ? 611  ILE C O     1 
ATOM   8326  C  CB    . ILE C 2  611  ? 508.701 -17.081 690.203 1.00 98.71  ? 611  ILE C CB    1 
ATOM   8327  C  CG1   . ILE C 2  611  ? 507.672 -16.078 690.714 1.00 97.96  ? 611  ILE C CG1   1 
ATOM   8328  C  CG2   . ILE C 2  611  ? 508.715 -18.341 691.087 1.00 99.80  ? 611  ILE C CG2   1 
ATOM   8329  C  CD1   . ILE C 2  611  ? 506.278 -16.647 690.715 1.00 97.86  ? 611  ILE C CD1   1 
ATOM   8330  N  N     . VAL C 2  612  ? 512.082 -17.797 690.474 1.00 109.05 ? 612  VAL C N     1 
ATOM   8331  C  CA    . VAL C 2  612  ? 513.095 -18.826 690.242 1.00 110.46 ? 612  VAL C CA    1 
ATOM   8332  C  C     . VAL C 2  612  ? 512.819 -20.032 691.137 1.00 113.03 ? 612  VAL C C     1 
ATOM   8333  O  O     . VAL C 2  612  ? 512.713 -19.895 692.364 1.00 115.30 ? 612  VAL C O     1 
ATOM   8334  C  CB    . VAL C 2  612  ? 514.509 -18.286 690.494 1.00 111.25 ? 612  VAL C CB    1 
ATOM   8335  C  CG1   . VAL C 2  612  ? 515.521 -19.367 690.168 1.00 112.28 ? 612  VAL C CG1   1 
ATOM   8336  C  CG2   . VAL C 2  612  ? 514.743 -16.996 689.705 1.00 106.55 ? 612  VAL C CG2   1 
ATOM   8337  N  N     . VAL C 2  613  ? 512.733 -21.214 690.535 1.00 113.90 ? 613  VAL C N     1 
ATOM   8338  C  CA    . VAL C 2  613  ? 512.398 -22.439 691.253 1.00 117.26 ? 613  VAL C CA    1 
ATOM   8339  C  C     . VAL C 2  613  ? 513.551 -23.428 691.116 1.00 121.01 ? 613  VAL C C     1 
ATOM   8340  O  O     . VAL C 2  613  ? 514.033 -23.679 690.006 1.00 121.52 ? 613  VAL C O     1 
ATOM   8341  C  CB    . VAL C 2  613  ? 511.080 -23.041 690.741 1.00 113.31 ? 613  VAL C CB    1 
ATOM   8342  C  CG1   . VAL C 2  613  ? 510.793 -24.348 691.434 1.00 115.02 ? 613  VAL C CG1   1 
ATOM   8343  C  CG2   . VAL C 2  613  ? 509.956 -22.058 690.988 1.00 109.48 ? 613  VAL C CG2   1 
ATOM   8344  N  N     . ARG C 2  614  ? 513.961 -24.009 692.243 1.00 121.41 ? 614  ARG C N     1 
ATOM   8345  C  CA    . ARG C 2  614  ? 514.954 -25.081 692.298 1.00 125.35 ? 614  ARG C CA    1 
ATOM   8346  C  C     . ARG C 2  614  ? 514.252 -26.431 692.403 1.00 128.28 ? 614  ARG C C     1 
ATOM   8347  O  O     . ARG C 2  614  ? 513.594 -26.718 693.411 1.00 125.62 ? 614  ARG C O     1 
ATOM   8348  C  CB    . ARG C 2  614  ? 515.874 -24.849 693.499 1.00 126.17 ? 614  ARG C CB    1 
ATOM   8349  C  CG    . ARG C 2  614  ? 516.782 -26.014 693.910 1.00 133.81 ? 614  ARG C CG    1 
ATOM   8350  C  CD    . ARG C 2  614  ? 517.792 -26.459 692.865 1.00 139.14 ? 614  ARG C CD    1 
ATOM   8351  N  NE    . ARG C 2  614  ? 518.849 -25.467 692.711 1.00 138.22 ? 614  ARG C NE    1 
ATOM   8352  C  CZ    . ARG C 2  614  ? 519.873 -25.348 693.549 1.00 139.31 ? 614  ARG C CZ    1 
ATOM   8353  N  NH1   . ARG C 2  614  ? 520.796 -24.416 693.338 1.00 130.94 ? 614  ARG C NH1   1 
ATOM   8354  N  NH2   . ARG C 2  614  ? 519.944 -26.133 694.624 1.00 138.51 ? 614  ARG C NH2   1 
ATOM   8355  N  N     . TYR C 2  615  ? 514.366 -27.250 691.351 1.00 129.37 ? 615  TYR C N     1 
ATOM   8356  C  CA    . TYR C 2  615  ? 513.683 -28.538 691.339 1.00 137.52 ? 615  TYR C CA    1 
ATOM   8357  C  C     . TYR C 2  615  ? 514.540 -29.642 691.971 1.00 146.94 ? 615  TYR C C     1 
ATOM   8358  O  O     . TYR C 2  615  ? 515.656 -29.413 692.455 1.00 148.09 ? 615  TYR C O     1 
ATOM   8359  C  CB    . TYR C 2  615  ? 513.317 -28.946 689.908 1.00 136.03 ? 615  TYR C CB    1 
ATOM   8360  C  CG    . TYR C 2  615  ? 512.178 -28.177 689.271 1.00 135.87 ? 615  TYR C CG    1 
ATOM   8361  C  CD1   . TYR C 2  615  ? 511.080 -27.766 690.026 1.00 132.66 ? 615  TYR C CD1   1 
ATOM   8362  C  CD2   . TYR C 2  615  ? 512.189 -27.879 687.908 1.00 134.03 ? 615  TYR C CD2   1 
ATOM   8363  C  CE1   . TYR C 2  615  ? 510.028 -27.066 689.447 1.00 129.02 ? 615  TYR C CE1   1 
ATOM   8364  C  CE2   . TYR C 2  615  ? 511.141 -27.176 687.319 1.00 132.43 ? 615  TYR C CE2   1 
ATOM   8365  C  CZ    . TYR C 2  615  ? 510.060 -26.773 688.098 1.00 131.48 ? 615  TYR C CZ    1 
ATOM   8366  O  OH    . TYR C 2  615  ? 509.009 -26.075 687.536 1.00 128.44 ? 615  TYR C OH    1 
ATOM   8367  N  N     . GLU C 2  616  ? 513.987 -30.867 691.978 1.00 150.00 ? 616  GLU C N     1 
ATOM   8368  C  CA    . GLU C 2  616  ? 514.740 -32.032 692.441 1.00 150.70 ? 616  GLU C CA    1 
ATOM   8369  C  C     . GLU C 2  616  ? 515.920 -32.294 691.505 1.00 151.78 ? 616  GLU C C     1 
ATOM   8370  O  O     . GLU C 2  616  ? 516.992 -32.726 691.948 1.00 151.00 ? 616  GLU C O     1 
ATOM   8371  C  CB    . GLU C 2  616  ? 513.827 -33.263 692.573 1.00 149.32 ? 616  GLU C CB    1 
ATOM   8372  C  CG    . GLU C 2  616  ? 513.156 -33.741 691.283 1.00 149.71 ? 616  GLU C CG    1 
ATOM   8373  C  CD    . GLU C 2  616  ? 512.663 -35.182 691.361 1.00 147.80 ? 616  GLU C CD    1 
ATOM   8374  O  OE1   . GLU C 2  616  ? 512.256 -35.627 692.462 1.00 143.28 ? 616  GLU C OE1   1 
ATOM   8375  O  OE2   . GLU C 2  616  ? 512.674 -35.863 690.310 1.00 144.23 ? 616  GLU C OE2   1 
ATOM   8376  N  N     . ASP C 2  617  ? 515.725 -32.039 690.198 1.00 153.95 ? 617  ASP C N     1 
ATOM   8377  C  CA    . ASP C 2  617  ? 516.761 -32.252 689.186 1.00 154.55 ? 617  ASP C CA    1 
ATOM   8378  C  C     . ASP C 2  617  ? 518.015 -31.427 689.474 1.00 151.73 ? 617  ASP C C     1 
ATOM   8379  O  O     . ASP C 2  617  ? 519.090 -31.747 688.953 1.00 151.52 ? 617  ASP C O     1 
ATOM   8380  C  CB    . ASP C 2  617  ? 516.268 -31.902 687.752 1.00 147.01 ? 617  ASP C CB    1 
ATOM   8381  C  CG    . ASP C 2  617  ? 514.737 -32.039 687.552 1.00 148.07 ? 617  ASP C CG    1 
ATOM   8382  O  OD1   . ASP C 2  617  ? 514.046 -32.674 688.382 1.00 150.49 ? 617  ASP C OD1   1 
ATOM   8383  O  OD2   . ASP C 2  617  ? 514.226 -31.506 686.534 1.00 140.14 ? 617  ASP C OD2   1 
ATOM   8384  N  N     . GLY C 2  618  ? 517.896 -30.372 690.287 1.00 148.40 ? 618  GLY C N     1 
ATOM   8385  C  CA    . GLY C 2  618  ? 518.979 -29.461 690.577 1.00 145.76 ? 618  GLY C CA    1 
ATOM   8386  C  C     . GLY C 2  618  ? 518.993 -28.230 689.693 1.00 145.65 ? 618  GLY C C     1 
ATOM   8387  O  O     . GLY C 2  618  ? 519.576 -27.208 690.083 1.00 143.40 ? 618  GLY C O     1 
ATOM   8388  N  N     . ARG C 2  619  ? 518.326 -28.289 688.538 1.00 137.88 ? 619  ARG C N     1 
ATOM   8389  C  CA    . ARG C 2  619  ? 518.261 -27.157 687.625 1.00 131.10 ? 619  ARG C CA    1 
ATOM   8390  C  C     . ARG C 2  619  ? 517.459 -26.023 688.262 1.00 132.77 ? 619  ARG C C     1 
ATOM   8391  O  O     . ARG C 2  619  ? 516.418 -26.241 688.892 1.00 134.30 ? 619  ARG C O     1 
ATOM   8392  C  CB    . ARG C 2  619  ? 517.692 -27.649 686.289 1.00 129.40 ? 619  ARG C CB    1 
ATOM   8393  C  CG    . ARG C 2  619  ? 516.349 -28.356 686.418 1.00 134.58 ? 619  ARG C CG    1 
ATOM   8394  C  CD    . ARG C 2  619  ? 515.947 -29.062 685.120 1.00 136.12 ? 619  ARG C CD    1 
ATOM   8395  N  NE    . ARG C 2  619  ? 514.584 -29.594 685.159 1.00 137.19 ? 619  ARG C NE    1 
ATOM   8396  C  CZ    . ARG C 2  619  ? 513.517 -29.029 684.613 1.00 135.02 ? 619  ARG C CZ    1 
ATOM   8397  N  NH1   . ARG C 2  619  ? 512.330 -29.621 684.733 1.00 131.06 ? 619  ARG C NH1   1 
ATOM   8398  N  NH2   . ARG C 2  619  ? 513.647 -27.931 683.881 1.00 131.40 ? 619  ARG C NH2   1 
ATOM   8399  N  N     . LEU C 2  620  ? 517.955 -24.802 688.079 1.00 126.36 ? 620  LEU C N     1 
ATOM   8400  C  CA    . LEU C 2  620  ? 517.379 -23.599 688.681 1.00 118.81 ? 620  LEU C CA    1 
ATOM   8401  C  C     . LEU C 2  620  ? 516.534 -22.834 687.661 1.00 124.22 ? 620  LEU C C     1 
ATOM   8402  O  O     . LEU C 2  620  ? 516.825 -21.682 687.310 1.00 125.98 ? 620  LEU C O     1 
ATOM   8403  C  CB    . LEU C 2  620  ? 518.505 -22.723 689.231 1.00 115.98 ? 620  LEU C CB    1 
ATOM   8404  C  CG    . LEU C 2  620  ? 518.336 -21.720 690.374 1.00 120.00 ? 620  LEU C CG    1 
ATOM   8405  C  CD1   . LEU C 2  620  ? 518.023 -22.437 691.679 1.00 127.24 ? 620  LEU C CD1   1 
ATOM   8406  C  CD2   . LEU C 2  620  ? 519.560 -20.813 690.527 1.00 112.77 ? 620  LEU C CD2   1 
ATOM   8407  N  N     . VAL C 2  621  ? 515.468 -23.504 687.190 1.00 123.02 ? 621  VAL C N     1 
ATOM   8408  C  CA    . VAL C 2  621  ? 514.587 -22.963 686.154 1.00 110.97 ? 621  VAL C CA    1 
ATOM   8409  C  C     . VAL C 2  621  ? 514.086 -21.590 686.565 1.00 112.14 ? 621  VAL C C     1 
ATOM   8410  O  O     . VAL C 2  621  ? 513.616 -21.401 687.692 1.00 118.57 ? 621  VAL C O     1 
ATOM   8411  C  CB    . VAL C 2  621  ? 513.402 -23.913 685.914 1.00 109.80 ? 621  VAL C CB    1 
ATOM   8412  C  CG1   . VAL C 2  621  ? 512.520 -23.387 684.782 1.00 108.17 ? 621  VAL C CG1   1 
ATOM   8413  C  CG2   . VAL C 2  621  ? 513.880 -25.331 685.686 1.00 116.52 ? 621  VAL C CG2   1 
ATOM   8414  N  N     . GLU C 2  622  ? 514.184 -20.622 685.662 1.00 104.98 ? 622  GLU C N     1 
ATOM   8415  C  CA    . GLU C 2  622  ? 513.720 -19.268 685.931 1.00 103.32 ? 622  GLU C CA    1 
ATOM   8416  C  C     . GLU C 2  622  ? 512.487 -19.004 685.080 1.00 108.81 ? 622  GLU C C     1 
ATOM   8417  O  O     . GLU C 2  622  ? 512.527 -19.167 683.854 1.00 113.49 ? 622  GLU C O     1 
ATOM   8418  C  CB    . GLU C 2  622  ? 514.779 -18.205 685.632 1.00 104.75 ? 622  GLU C CB    1 
ATOM   8419  C  CG    . GLU C 2  622  ? 514.192 -16.784 685.707 1.00 104.63 ? 622  GLU C CG    1 
ATOM   8420  C  CD    . GLU C 2  622  ? 515.220 -15.678 685.959 1.00 113.54 ? 622  GLU C CD    1 
ATOM   8421  O  OE1   . GLU C 2  622  ? 516.276 -15.956 686.560 1.00 120.19 ? 622  GLU C OE1   1 
ATOM   8422  O  OE2   . GLU C 2  622  ? 514.945 -14.508 685.597 1.00 111.63 ? 622  GLU C OE2   1 
ATOM   8423  N  N     . TYR C 2  623  ? 511.391 -18.622 685.734 1.00 108.71 ? 623  TYR C N     1 
ATOM   8424  C  CA    . TYR C 2  623  ? 510.156 -18.287 685.039 1.00 104.18 ? 623  TYR C CA    1 
ATOM   8425  C  C     . TYR C 2  623  ? 509.987 -16.780 685.101 1.00 100.92 ? 623  TYR C C     1 
ATOM   8426  O  O     . TYR C 2  623  ? 509.718 -16.240 686.182 1.00 103.49 ? 623  TYR C O     1 
ATOM   8427  C  CB    . TYR C 2  623  ? 508.947 -18.980 685.671 1.00 102.70 ? 623  TYR C CB    1 
ATOM   8428  C  CG    . TYR C 2  623  ? 509.029 -20.483 685.744 1.00 103.93 ? 623  TYR C CG    1 
ATOM   8429  C  CD1   . TYR C 2  623  ? 509.640 -21.125 686.803 1.00 105.40 ? 623  TYR C CD1   1 
ATOM   8430  C  CD2   . TYR C 2  623  ? 508.483 -21.261 684.735 1.00 112.84 ? 623  TYR C CD2   1 
ATOM   8431  C  CE1   . TYR C 2  623  ? 509.703 -22.511 686.859 1.00 111.53 ? 623  TYR C CE1   1 
ATOM   8432  C  CE2   . TYR C 2  623  ? 508.541 -22.636 684.776 1.00 117.60 ? 623  TYR C CE2   1 
ATOM   8433  C  CZ    . TYR C 2  623  ? 509.149 -23.259 685.837 1.00 117.65 ? 623  TYR C CZ    1 
ATOM   8434  O  OH    . TYR C 2  623  ? 509.192 -24.636 685.857 1.00 119.15 ? 623  TYR C OH    1 
ATOM   8435  N  N     . PRO C 2  624  ? 510.170 -16.060 684.005 1.00 104.36 ? 624  PRO C N     1 
ATOM   8436  C  CA    . PRO C 2  624  ? 509.877 -14.627 684.003 1.00 104.56 ? 624  PRO C CA    1 
ATOM   8437  C  C     . PRO C 2  624  ? 508.375 -14.442 683.950 1.00 108.20 ? 624  PRO C C     1 
ATOM   8438  O  O     . PRO C 2  624  ? 507.638 -15.315 683.480 1.00 109.31 ? 624  PRO C O     1 
ATOM   8439  C  CB    . PRO C 2  624  ? 510.548 -14.120 682.727 1.00 102.24 ? 624  PRO C CB    1 
ATOM   8440  C  CG    . PRO C 2  624  ? 510.458 -15.306 681.810 1.00 112.24 ? 624  PRO C CG    1 
ATOM   8441  C  CD    . PRO C 2  624  ? 510.639 -16.527 682.689 1.00 109.41 ? 624  PRO C CD    1 
ATOM   8442  N  N     . LEU C 2  625  ? 507.910 -13.339 684.519 1.00 106.48 ? 625  LEU C N     1 
ATOM   8443  C  CA    . LEU C 2  625  ? 506.483 -13.089 684.601 1.00 101.24 ? 625  LEU C CA    1 
ATOM   8444  C  C     . LEU C 2  625  ? 506.110 -11.952 683.657 1.00 99.48  ? 625  LEU C C     1 
ATOM   8445  O  O     . LEU C 2  625  ? 506.815 -10.936 683.574 1.00 95.73  ? 625  LEU C O     1 
ATOM   8446  C  CB    . LEU C 2  625  ? 506.089 -12.699 686.036 1.00 100.26 ? 625  LEU C CB    1 
ATOM   8447  C  CG    . LEU C 2  625  ? 506.341 -13.597 687.251 1.00 96.67  ? 625  LEU C CG    1 
ATOM   8448  C  CD1   . LEU C 2  625  ? 505.961 -12.857 688.522 1.00 90.87  ? 625  LEU C CD1   1 
ATOM   8449  C  CD2   . LEU C 2  625  ? 505.572 -14.903 687.140 1.00 92.04  ? 625  LEU C CD2   1 
ATOM   8450  N  N     . ARG C 2  626  ? 504.994 -12.128 682.952 1.00 98.57  ? 626  ARG C N     1 
ATOM   8451  C  CA    . ARG C 2  626  ? 504.487 -11.091 682.063 1.00 102.76 ? 626  ARG C CA    1 
ATOM   8452  C  C     . ARG C 2  626  ? 503.784 -10.061 682.931 1.00 105.87 ? 626  ARG C C     1 
ATOM   8453  O  O     . ARG C 2  626  ? 502.837 -10.400 683.652 1.00 106.49 ? 626  ARG C O     1 
ATOM   8454  C  CB    . ARG C 2  626  ? 503.566 -11.670 680.981 1.00 104.45 ? 626  ARG C CB    1 
ATOM   8455  C  CG    . ARG C 2  626  ? 503.043 -10.619 679.982 1.00 101.75 ? 626  ARG C CG    1 
ATOM   8456  C  CD    . ARG C 2  626  ? 502.328 -11.182 678.753 1.00 101.29 ? 626  ARG C CD    1 
ATOM   8457  N  NE    . ARG C 2  626  ? 503.213 -11.925 677.843 1.00 114.62 ? 626  ARG C NE    1 
ATOM   8458  C  CZ    . ARG C 2  626  ? 503.208 -13.242 677.639 1.00 116.98 ? 626  ARG C CZ    1 
ATOM   8459  N  NH1   . ARG C 2  626  ? 502.339 -14.024 678.278 1.00 113.81 ? 626  ARG C NH1   1 
ATOM   8460  N  NH2   . ARG C 2  626  ? 504.065 -13.772 676.759 1.00 110.55 ? 626  ARG C NH2   1 
ATOM   8461  N  N     . ARG C 2  627  ? 504.248 -8.810  682.877 1.00 106.33 ? 627  ARG C N     1 
ATOM   8462  C  CA    . ARG C 2  627  ? 503.753 -7.740  683.744 1.00 105.74 ? 627  ARG C CA    1 
ATOM   8463  C  C     . ARG C 2  627  ? 503.182 -6.608  682.894 1.00 100.28 ? 627  ARG C C     1 
ATOM   8464  O  O     . ARG C 2  627  ? 503.919 -5.977  682.130 1.00 101.54 ? 627  ARG C O     1 
ATOM   8465  C  CB    . ARG C 2  627  ? 504.889 -7.212  684.640 1.00 102.96 ? 627  ARG C CB    1 
ATOM   8466  C  CG    . ARG C 2  627  ? 505.210 -8.020  685.913 1.00 102.10 ? 627  ARG C CG    1 
ATOM   8467  C  CD    . ARG C 2  627  ? 503.952 -8.520  686.579 1.00 99.59  ? 627  ARG C CD    1 
ATOM   8468  N  NE    . ARG C 2  627  ? 504.051 -8.686  688.036 1.00 96.52  ? 627  ARG C NE    1 
ATOM   8469  C  CZ    . ARG C 2  627  ? 503.169 -8.216  688.925 1.00 96.34  ? 627  ARG C CZ    1 
ATOM   8470  N  NH1   . ARG C 2  627  ? 502.102 -7.529  688.544 1.00 97.31  ? 627  ARG C NH1   1 
ATOM   8471  N  NH2   . ARG C 2  627  ? 503.331 -8.463  690.216 1.00 99.78  ? 627  ARG C NH2   1 
ATOM   8472  N  N     . PHE C 2  628  ? 501.901 -6.290  683.107 1.00 95.76  ? 628  PHE C N     1 
ATOM   8473  C  CA    . PHE C 2  628  ? 501.211 -5.192  682.415 1.00 95.22  ? 628  PHE C CA    1 
ATOM   8474  C  C     . PHE C 2  628  ? 501.344 -5.205  680.884 1.00 105.67 ? 628  PHE C C     1 
ATOM   8475  O  O     . PHE C 2  628  ? 501.724 -4.198  680.276 1.00 108.56 ? 628  PHE C O     1 
ATOM   8476  C  CB    . PHE C 2  628  ? 501.690 -3.839  682.954 1.00 89.83  ? 628  PHE C CB    1 
ATOM   8477  C  CG    . PHE C 2  628  ? 501.566 -3.672  684.464 1.00 103.59 ? 628  PHE C CG    1 
ATOM   8478  C  CD1   . PHE C 2  628  ? 500.388 -3.188  685.032 1.00 96.49  ? 628  PHE C CD1   1 
ATOM   8479  C  CD2   . PHE C 2  628  ? 502.621 -4.012  685.317 1.00 107.70 ? 628  PHE C CD2   1 
ATOM   8480  C  CE1   . PHE C 2  628  ? 500.276 -3.015  686.404 1.00 95.69  ? 628  PHE C CE1   1 
ATOM   8481  C  CE2   . PHE C 2  628  ? 502.508 -3.852  686.705 1.00 99.41  ? 628  PHE C CE2   1 
ATOM   8482  C  CZ    . PHE C 2  628  ? 501.337 -3.354  687.243 1.00 98.80  ? 628  PHE C CZ    1 
ATOM   8483  N  N     . TYR C 2  629  ? 501.029 -6.341  680.232 1.00 103.46 ? 629  TYR C N     1 
ATOM   8484  C  CA    . TYR C 2  629  ? 501.097 -6.360  678.769 1.00 92.82  ? 629  TYR C CA    1 
ATOM   8485  C  C     . TYR C 2  629  ? 499.695 -6.010  678.289 1.00 88.50  ? 629  TYR C C     1 
ATOM   8486  O  O     . TYR C 2  629  ? 498.707 -6.397  678.918 1.00 88.41  ? 629  TYR C O     1 
ATOM   8487  C  CB    . TYR C 2  629  ? 501.600 -7.706  678.195 1.00 100.35 ? 629  TYR C CB    1 
ATOM   8488  C  CG    . TYR C 2  629  ? 501.458 -7.939  676.651 1.00 105.43 ? 629  TYR C CG    1 
ATOM   8489  C  CD1   . TYR C 2  629  ? 502.339 -7.316  675.766 1.00 89.13  ? 629  TYR C CD1   1 
ATOM   8490  C  CD2   . TYR C 2  629  ? 500.552 -8.870  676.106 1.00 101.67 ? 629  TYR C CD2   1 
ATOM   8491  C  CE1   . TYR C 2  629  ? 502.268 -7.530  674.412 1.00 99.67  ? 629  TYR C CE1   1 
ATOM   8492  C  CE2   . TYR C 2  629  ? 500.472 -9.094  674.729 1.00 85.07  ? 629  TYR C CE2   1 
ATOM   8493  C  CZ    . TYR C 2  629  ? 501.339 -8.417  673.882 1.00 105.40 ? 629  TYR C CZ    1 
ATOM   8494  O  OH    . TYR C 2  629  ? 501.307 -8.599  672.487 1.00 116.49 ? 629  TYR C OH    1 
ATOM   8495  N  N     . ARG C 2  630  ? 499.619 -5.274  677.179 1.00 90.56  ? 630  ARG C N     1 
ATOM   8496  C  CA    . ARG C 2  630  ? 498.364 -4.761  676.637 1.00 81.19  ? 630  ARG C CA    1 
ATOM   8497  C  C     . ARG C 2  630  ? 497.784 -5.758  675.651 1.00 80.13  ? 630  ARG C C     1 
ATOM   8498  O  O     . ARG C 2  630  ? 498.434 -6.094  674.653 1.00 93.37  ? 630  ARG C O     1 
ATOM   8499  C  CB    . ARG C 2  630  ? 498.592 -3.438  675.918 1.00 79.38  ? 630  ARG C CB    1 
ATOM   8500  C  CG    . ARG C 2  630  ? 497.357 -2.892  675.275 1.00 78.52  ? 630  ARG C CG    1 
ATOM   8501  C  CD    . ARG C 2  630  ? 497.694 -1.809  674.274 1.00 83.90  ? 630  ARG C CD    1 
ATOM   8502  N  NE    . ARG C 2  630  ? 496.480 -1.226  673.713 1.00 87.35  ? 630  ARG C NE    1 
ATOM   8503  C  CZ    . ARG C 2  630  ? 495.815 -1.731  672.680 1.00 85.23  ? 630  ARG C CZ    1 
ATOM   8504  N  NH1   . ARG C 2  630  ? 496.255 -2.835  672.084 1.00 79.36  ? 630  ARG C NH1   1 
ATOM   8505  N  NH2   . ARG C 2  630  ? 494.714 -1.124  672.244 1.00 89.82  ? 630  ARG C NH2   1 
ATOM   8506  N  N     . SER C 2  631  ? 496.590 -6.266  675.950 1.00 77.50  ? 631  SER C N     1 
ATOM   8507  C  CA    . SER C 2  631  ? 495.930 -7.199  675.050 1.00 84.87  ? 631  SER C CA    1 
ATOM   8508  C  C     . SER C 2  631  ? 495.293 -6.451  673.892 1.00 84.27  ? 631  SER C C     1 
ATOM   8509  O  O     . SER C 2  631  ? 495.258 -5.215  673.846 1.00 85.02  ? 631  SER C O     1 
ATOM   8510  C  CB    . SER C 2  631  ? 494.832 -7.983  675.753 1.00 82.24  ? 631  SER C CB    1 
ATOM   8511  O  OG    . SER C 2  631  ? 493.689 -7.151  675.852 1.00 78.10  ? 631  SER C OG    1 
ATOM   8512  N  N     . ASN C 2  632  ? 494.746 -7.229  672.963 1.00 78.30  ? 632  ASN C N     1 
ATOM   8513  C  CA    . ASN C 2  632  ? 494.111 -6.653  671.786 1.00 81.35  ? 632  ASN C CA    1 
ATOM   8514  C  C     . ASN C 2  632  ? 493.018 -5.654  672.164 1.00 84.11  ? 632  ASN C C     1 
ATOM   8515  O  O     . ASN C 2  632  ? 492.862 -4.609  671.516 1.00 89.12  ? 632  ASN C O     1 
ATOM   8516  C  CB    . ASN C 2  632  ? 493.558 -7.783  670.926 1.00 86.50  ? 632  ASN C CB    1 
ATOM   8517  C  CG    . ASN C 2  632  ? 494.615 -8.412  670.046 1.00 87.63  ? 632  ASN C CG    1 
ATOM   8518  O  OD1   . ASN C 2  632  ? 495.679 -7.827  669.813 1.00 87.52  ? 632  ASN C OD1   1 
ATOM   8519  N  ND2   . ASN C 2  632  ? 494.351 -9.635  669.592 1.00 86.06  ? 632  ASN C ND2   1 
ATOM   8520  N  N     . GLN C 2  633  ? 492.274 -5.937  673.231 1.00 85.88  ? 633  GLN C N     1 
ATOM   8521  C  CA    . GLN C 2  633  ? 491.168 -5.082  673.630 1.00 83.72  ? 633  GLN C CA    1 
ATOM   8522  C  C     . GLN C 2  633  ? 491.573 -4.069  674.696 1.00 84.98  ? 633  GLN C C     1 
ATOM   8523  O  O     . GLN C 2  633  ? 490.714 -3.344  675.212 1.00 91.69  ? 633  GLN C O     1 
ATOM   8524  C  CB    . GLN C 2  633  ? 489.997 -5.944  674.122 1.00 81.14  ? 633  GLN C CB    1 
ATOM   8525  C  CG    . GLN C 2  633  ? 489.414 -6.903  673.064 1.00 84.25  ? 633  GLN C CG    1 
ATOM   8526  C  CD    . GLN C 2  633  ? 490.286 -8.127  672.762 1.00 82.94  ? 633  GLN C CD    1 
ATOM   8527  O  OE1   . GLN C 2  633  ? 491.312 -8.347  673.393 1.00 85.82  ? 633  GLN C OE1   1 
ATOM   8528  N  NE2   . GLN C 2  633  ? 489.874 -8.919  671.785 1.00 80.30  ? 633  GLN C NE2   1 
ATOM   8529  N  N     . GLY C 2  634  ? 492.855 -4.018  675.048 1.00 81.69  ? 634  GLY C N     1 
ATOM   8530  C  CA    . GLY C 2  634  ? 493.413 -3.009  675.922 1.00 80.74  ? 634  GLY C CA    1 
ATOM   8531  C  C     . GLY C 2  634  ? 493.258 -3.306  677.393 1.00 81.35  ? 634  GLY C C     1 
ATOM   8532  O  O     . GLY C 2  634  ? 493.766 -2.542  678.222 1.00 82.31  ? 634  GLY C O     1 
ATOM   8533  N  N     . THR C 2  635  ? 492.726 -4.461  677.743 1.00 76.91  ? 635  THR C N     1 
ATOM   8534  C  CA    . THR C 2  635  ? 492.719 -4.859  679.128 1.00 76.14  ? 635  THR C CA    1 
ATOM   8535  C  C     . THR C 2  635  ? 494.112 -5.343  679.454 1.00 81.04  ? 635  THR C C     1 
ATOM   8536  O  O     . THR C 2  635  ? 494.793 -5.908  678.603 1.00 83.72  ? 635  THR C O     1 
ATOM   8537  C  CB    . THR C 2  635  ? 491.671 -5.940  679.363 1.00 78.66  ? 635  THR C CB    1 
ATOM   8538  O  OG1   . THR C 2  635  ? 491.989 -7.137  678.629 1.00 72.42  ? 635  THR C OG1   1 
ATOM   8539  C  CG2   . THR C 2  635  ? 490.361 -5.406  678.859 1.00 78.30  ? 635  THR C CG2   1 
ATOM   8540  N  N     . ALA C 2  636  ? 494.513 -5.185  680.707 1.00 86.41  ? 636  ALA C N     1 
ATOM   8541  C  CA    . ALA C 2  636  ? 495.881 -5.493  681.084 1.00 83.48  ? 636  ALA C CA    1 
ATOM   8542  C  C     . ALA C 2  636  ? 496.000 -6.974  681.392 1.00 84.87  ? 636  ALA C C     1 
ATOM   8543  O  O     . ALA C 2  636  ? 495.337 -7.486  682.293 1.00 94.79  ? 636  ALA C O     1 
ATOM   8544  C  CB    . ALA C 2  636  ? 496.278 -4.657  682.300 1.00 72.39  ? 636  ALA C CB    1 
ATOM   8545  N  N     . LEU C 2  637  ? 496.864 -7.657  680.661 1.00 84.04  ? 637  LEU C N     1 
ATOM   8546  C  CA    . LEU C 2  637  ? 497.203 -9.032  680.991 1.00 92.78  ? 637  LEU C CA    1 
ATOM   8547  C  C     . LEU C 2  637  ? 498.435 -8.913  681.865 1.00 101.87 ? 637  LEU C C     1 
ATOM   8548  O  O     . LEU C 2  637  ? 499.512 -8.532  681.383 1.00 101.11 ? 637  LEU C O     1 
ATOM   8549  C  CB    . LEU C 2  637  ? 497.469 -9.861  679.740 1.00 98.68  ? 637  LEU C CB    1 
ATOM   8550  C  CG    . LEU C 2  637  ? 496.297 -9.779  678.771 1.00 95.68  ? 637  LEU C CG    1 
ATOM   8551  C  CD1   . LEU C 2  637  ? 496.608 -10.640 677.558 1.00 86.78  ? 637  LEU C CD1   1 
ATOM   8552  C  CD2   . LEU C 2  637  ? 494.946 -10.137 679.476 1.00 85.86  ? 637  LEU C CD2   1 
ATOM   8553  N  N     . ASP C 2  638  ? 498.298 -9.294  683.136 1.00 109.25 ? 638  ASP C N     1 
ATOM   8554  C  CA    . ASP C 2  638  ? 499.444 -9.228  684.025 1.00 107.69 ? 638  ASP C CA    1 
ATOM   8555  C  C     . ASP C 2  638  ? 499.391 -10.388 685.021 1.00 102.55 ? 638  ASP C C     1 
ATOM   8556  O  O     . ASP C 2  638  ? 498.330 -10.696 685.577 1.00 100.46 ? 638  ASP C O     1 
ATOM   8557  C  CB    . ASP C 2  638  ? 499.397 -7.809  684.651 1.00 101.03 ? 638  ASP C CB    1 
ATOM   8558  C  CG    . ASP C 2  638  ? 500.282 -7.621  685.855 1.00 105.09 ? 638  ASP C CG    1 
ATOM   8559  O  OD1   . ASP C 2  638  ? 500.930 -8.580  686.318 1.00 110.88 ? 638  ASP C OD1   1 
ATOM   8560  O  OD2   . ASP C 2  638  ? 500.343 -6.460  686.327 1.00 101.90 ? 638  ASP C OD2   1 
ATOM   8561  N  N     . GLN C 2  639  ? 500.559 -11.012 685.239 1.00 101.53 ? 639  GLN C N     1 
ATOM   8562  C  CA    . GLN C 2  639  ? 500.722 -12.181 686.096 1.00 99.70  ? 639  GLN C CA    1 
ATOM   8563  C  C     . GLN C 2  639  ? 501.339 -11.763 687.424 1.00 100.48 ? 639  GLN C C     1 
ATOM   8564  O  O     . GLN C 2  639  ? 502.314 -11.005 687.450 1.00 99.86  ? 639  GLN C O     1 
ATOM   8565  C  CB    . GLN C 2  639  ? 501.623 -13.239 685.445 1.00 102.64 ? 639  GLN C CB    1 
ATOM   8566  C  CG    . GLN C 2  639  ? 501.125 -13.937 684.190 1.00 97.27  ? 639  GLN C CG    1 
ATOM   8567  C  CD    . GLN C 2  639  ? 502.235 -14.768 683.579 1.00 102.16 ? 639  GLN C CD    1 
ATOM   8568  O  OE1   . GLN C 2  639  ? 503.191 -14.226 683.010 1.00 105.10 ? 639  GLN C OE1   1 
ATOM   8569  N  NE2   . GLN C 2  639  ? 502.150 -16.092 683.747 1.00 99.01  ? 639  GLN C NE2   1 
ATOM   8570  N  N     . ARG C 2  640  ? 500.793 -12.289 688.526 1.00 100.38 ? 640  ARG C N     1 
ATOM   8571  C  CA    . ARG C 2  640  ? 501.309 -11.995 689.858 1.00 95.55  ? 640  ARG C CA    1 
ATOM   8572  C  C     . ARG C 2  640  ? 501.799 -13.220 690.636 1.00 95.96  ? 640  ARG C C     1 
ATOM   8573  O  O     . ARG C 2  640  ? 501.215 -14.298 690.514 1.00 93.00  ? 640  ARG C O     1 
ATOM   8574  C  CB    . ARG C 2  640  ? 500.261 -11.218 690.631 1.00 89.65  ? 640  ARG C CB    1 
ATOM   8575  C  CG    . ARG C 2  640  ? 500.287 -9.754  690.209 1.00 94.12  ? 640  ARG C CG    1 
ATOM   8576  C  CD    . ARG C 2  640  ? 499.182 -9.433  689.240 1.00 99.55  ? 640  ARG C CD    1 
ATOM   8577  N  NE    . ARG C 2  640  ? 497.896 -9.429  689.917 1.00 105.21 ? 640  ARG C NE    1 
ATOM   8578  C  CZ    . ARG C 2  640  ? 496.937 -10.303 689.650 1.00 101.45 ? 640  ARG C CZ    1 
ATOM   8579  N  NH1   . ARG C 2  640  ? 497.133 -11.228 688.722 1.00 97.45  ? 640  ARG C NH1   1 
ATOM   8580  N  NH2   . ARG C 2  640  ? 495.791 -10.254 690.314 1.00 103.90 ? 640  ARG C NH2   1 
ATOM   8581  N  N     . PRO C 2  641  ? 502.939 -13.100 691.340 1.00 97.13  ? 641  PRO C N     1 
ATOM   8582  C  CA    . PRO C 2  641  ? 503.502 -14.221 692.134 1.00 91.78  ? 641  PRO C CA    1 
ATOM   8583  C  C     . PRO C 2  641  ? 502.616 -14.628 693.315 1.00 95.94  ? 641  PRO C C     1 
ATOM   8584  O  O     . PRO C 2  641  ? 502.164 -13.777 694.090 1.00 93.23  ? 641  PRO C O     1 
ATOM   8585  C  CB    . PRO C 2  641  ? 504.839 -13.657 692.635 1.00 92.60  ? 641  PRO C CB    1 
ATOM   8586  C  CG    . PRO C 2  641  ? 504.629 -12.137 692.621 1.00 92.37  ? 641  PRO C CG    1 
ATOM   8587  C  CD    . PRO C 2  641  ? 503.753 -11.870 691.451 1.00 94.48  ? 641  PRO C CD    1 
ATOM   8588  N  N     . ARG C 2  642  ? 502.315 -15.929 693.419 1.00 98.32  ? 642  ARG C N     1 
ATOM   8589  C  CA    . ARG C 2  642  ? 501.537 -16.469 694.540 1.00 93.44  ? 642  ARG C CA    1 
ATOM   8590  C  C     . ARG C 2  642  ? 502.337 -17.251 695.605 1.00 101.54 ? 642  ARG C C     1 
ATOM   8591  O  O     . ARG C 2  642  ? 501.721 -17.764 696.557 1.00 102.40 ? 642  ARG C O     1 
ATOM   8592  C  CB    . ARG C 2  642  ? 500.413 -17.351 693.991 1.00 87.46  ? 642  ARG C CB    1 
ATOM   8593  C  CG    . ARG C 2  642  ? 499.262 -16.587 693.328 1.00 87.89  ? 642  ARG C CG    1 
ATOM   8594  C  CD    . ARG C 2  642  ? 498.619 -15.609 694.300 1.00 91.66  ? 642  ARG C CD    1 
ATOM   8595  N  NE    . ARG C 2  642  ? 497.687 -14.646 693.707 1.00 91.95  ? 642  ARG C NE    1 
ATOM   8596  C  CZ    . ARG C 2  642  ? 497.918 -13.338 693.569 1.00 93.93  ? 642  ARG C CZ    1 
ATOM   8597  N  NH1   . ARG C 2  642  ? 499.073 -12.800 693.970 1.00 85.60  ? 642  ARG C NH1   1 
ATOM   8598  N  NH2   . ARG C 2  642  ? 496.978 -12.560 693.031 1.00 95.32  ? 642  ARG C NH2   1 
ATOM   8599  N  N     . VAL C 2  643  ? 503.668 -17.373 695.486 1.00 101.13 ? 643  VAL C N     1 
ATOM   8600  C  CA    . VAL C 2  643  ? 504.461 -18.162 696.430 1.00 100.97 ? 643  VAL C CA    1 
ATOM   8601  C  C     . VAL C 2  643  ? 505.524 -17.271 697.069 1.00 102.83 ? 643  VAL C C     1 
ATOM   8602  O  O     . VAL C 2  643  ? 505.857 -16.200 696.561 1.00 98.42  ? 643  VAL C O     1 
ATOM   8603  C  CB    . VAL C 2  643  ? 505.106 -19.405 695.787 1.00 98.19  ? 643  VAL C CB    1 
ATOM   8604  C  CG1   . VAL C 2  643  ? 504.037 -20.340 695.261 1.00 97.82  ? 643  VAL C CG1   1 
ATOM   8605  C  CG2   . VAL C 2  643  ? 506.065 -19.008 694.701 1.00 99.42  ? 643  VAL C CG2   1 
ATOM   8606  N  N     . VAL C 2  644  ? 506.122 -17.781 698.149 1.00 106.77 ? 644  VAL C N     1 
ATOM   8607  C  CA    . VAL C 2  644  ? 507.113 -17.056 698.937 1.00 105.79 ? 644  VAL C CA    1 
ATOM   8608  C  C     . VAL C 2  644  ? 508.447 -17.794 698.900 1.00 109.98 ? 644  VAL C C     1 
ATOM   8609  O  O     . VAL C 2  644  ? 508.514 -18.983 698.557 1.00 109.78 ? 644  VAL C O     1 
ATOM   8610  C  CB    . VAL C 2  644  ? 506.643 -16.878 700.388 1.00 102.32 ? 644  VAL C CB    1 
ATOM   8611  C  CG1   . VAL C 2  644  ? 506.673 -18.236 701.085 1.00 101.06 ? 644  VAL C CG1   1 
ATOM   8612  C  CG2   . VAL C 2  644  ? 507.477 -15.794 701.118 1.00 105.71 ? 644  VAL C CG2   1 
ATOM   8613  N  N     . VAL C 2  645  ? 509.525 -17.048 699.207 1.00 109.59 ? 645  VAL C N     1 
ATOM   8614  C  CA    . VAL C 2  645  ? 510.872 -17.614 699.149 1.00 106.12 ? 645  VAL C CA    1 
ATOM   8615  C  C     . VAL C 2  645  ? 510.925 -18.828 700.062 1.00 101.26 ? 645  VAL C C     1 
ATOM   8616  O  O     . VAL C 2  645  ? 510.531 -18.761 701.230 1.00 100.67 ? 645  VAL C O     1 
ATOM   8617  C  CB    . VAL C 2  645  ? 511.919 -16.565 699.564 1.00 100.42 ? 645  VAL C CB    1 
ATOM   8618  C  CG1   . VAL C 2  645  ? 513.327 -17.068 699.280 1.00 94.98  ? 645  VAL C CG1   1 
ATOM   8619  C  CG2   . VAL C 2  645  ? 511.656 -15.208 698.900 1.00 104.75 ? 645  VAL C CG2   1 
ATOM   8620  N  N     . GLY C 2  646  ? 511.381 -19.952 699.526 1.00 103.73 ? 646  GLY C N     1 
ATOM   8621  C  CA    . GLY C 2  646  ? 511.533 -21.145 700.318 1.00 102.93 ? 646  GLY C CA    1 
ATOM   8622  C  C     . GLY C 2  646  ? 510.303 -22.021 700.391 1.00 106.19 ? 646  GLY C C     1 
ATOM   8623  O  O     . GLY C 2  646  ? 510.369 -23.091 701.011 1.00 107.43 ? 646  GLY C O     1 
ATOM   8624  N  N     . GLN C 2  647  ? 509.232 -21.684 699.675 1.00 109.25 ? 647  GLN C N     1 
ATOM   8625  C  CA    . GLN C 2  647  ? 508.016 -22.481 699.777 1.00 112.34 ? 647  GLN C CA    1 
ATOM   8626  C  C     . GLN C 2  647  ? 508.218 -23.807 699.066 1.00 114.87 ? 647  GLN C C     1 
ATOM   8627  O  O     . GLN C 2  647  ? 508.747 -23.864 697.950 1.00 115.89 ? 647  GLN C O     1 
ATOM   8628  C  CB    . GLN C 2  647  ? 506.829 -21.735 699.157 1.00 110.67 ? 647  GLN C CB    1 
ATOM   8629  C  CG    . GLN C 2  647  ? 505.561 -22.594 698.950 1.00 105.92 ? 647  GLN C CG    1 
ATOM   8630  C  CD    . GLN C 2  647  ? 504.335 -21.760 698.606 1.00 101.39 ? 647  GLN C CD    1 
ATOM   8631  O  OE1   . GLN C 2  647  ? 504.342 -20.537 698.765 1.00 100.13 ? 647  GLN C OE1   1 
ATOM   8632  N  NE2   . GLN C 2  647  ? 503.300 -22.410 698.069 1.00 96.65  ? 647  GLN C NE2   1 
ATOM   8633  N  N     . ARG C 2  648  ? 507.770 -24.877 699.717 1.00 114.41 ? 648  ARG C N     1 
ATOM   8634  C  CA    . ARG C 2  648  ? 507.878 -26.208 699.142 1.00 118.14 ? 648  ARG C CA    1 
ATOM   8635  C  C     . ARG C 2  648  ? 506.704 -26.439 698.197 1.00 117.56 ? 648  ARG C C     1 
ATOM   8636  O  O     . ARG C 2  648  ? 505.540 -26.340 698.607 1.00 115.35 ? 648  ARG C O     1 
ATOM   8637  C  CB    . ARG C 2  648  ? 507.923 -27.230 700.271 1.00 117.99 ? 648  ARG C CB    1 
ATOM   8638  C  CG    . ARG C 2  648  ? 509.198 -27.043 701.067 1.00 120.57 ? 648  ARG C CG    1 
ATOM   8639  C  CD    . ARG C 2  648  ? 510.432 -27.508 700.352 1.00 124.19 ? 648  ARG C CD    1 
ATOM   8640  N  NE    . ARG C 2  648  ? 510.881 -28.805 700.832 1.00 131.99 ? 648  ARG C NE    1 
ATOM   8641  C  CZ    . ARG C 2  648  ? 511.888 -29.483 700.296 1.00 134.97 ? 648  ARG C CZ    1 
ATOM   8642  N  NH1   . ARG C 2  648  ? 512.549 -28.982 699.250 1.00 126.22 ? 648  ARG C NH1   1 
ATOM   8643  N  NH2   . ARG C 2  648  ? 512.227 -30.662 700.807 1.00 133.42 ? 648  ARG C NH2   1 
ATOM   8644  N  N     . VAL C 2  649  ? 507.011 -26.701 696.923 1.00 117.49 ? 649  VAL C N     1 
ATOM   8645  C  CA    . VAL C 2  649  ? 506.008 -26.942 695.892 1.00 116.98 ? 649  VAL C CA    1 
ATOM   8646  C  C     . VAL C 2  649  ? 506.138 -28.356 695.317 1.00 120.63 ? 649  VAL C C     1 
ATOM   8647  O  O     . VAL C 2  649  ? 507.251 -28.862 695.129 1.00 121.64 ? 649  VAL C O     1 
ATOM   8648  C  CB    . VAL C 2  649  ? 506.197 -25.855 694.802 1.00 115.01 ? 649  VAL C CB    1 
ATOM   8649  C  CG1   . VAL C 2  649  ? 505.306 -26.073 693.631 1.00 112.75 ? 649  VAL C CG1   1 
ATOM   8650  C  CG2   . VAL C 2  649  ? 505.986 -24.455 695.382 1.00 112.37 ? 649  VAL C CG2   1 
ATOM   8651  N  N     . ARG C 2  650  ? 504.994 -28.957 694.931 1.00 124.78 ? 650  ARG C N     1 
ATOM   8652  C  CA    . ARG C 2  650  ? 504.966 -30.249 694.242 1.00 123.83 ? 650  ARG C CA    1 
ATOM   8653  C  C     . ARG C 2  650  ? 504.731 -29.993 692.745 1.00 127.57 ? 650  ARG C C     1 
ATOM   8654  O  O     . ARG C 2  650  ? 504.602 -28.845 692.313 1.00 127.76 ? 650  ARG C O     1 
ATOM   8655  C  CB    . ARG C 2  650  ? 503.923 -31.197 694.855 1.00 117.31 ? 650  ARG C CB    1 
ATOM   8656  C  CG    . ARG C 2  650  ? 504.255 -31.648 696.298 1.00 117.61 ? 650  ARG C CG    1 
ATOM   8657  C  CD    . ARG C 2  650  ? 503.495 -32.928 696.697 1.00 120.55 ? 650  ARG C CD    1 
ATOM   8658  N  NE    . ARG C 2  650  ? 504.050 -33.615 697.877 1.00 126.51 ? 650  ARG C NE    1 
ATOM   8659  C  CZ    . ARG C 2  650  ? 503.655 -33.441 699.144 1.00 130.07 ? 650  ARG C CZ    1 
ATOM   8660  N  NH1   . ARG C 2  650  ? 502.677 -32.590 699.447 1.00 118.51 ? 650  ARG C NH1   1 
ATOM   8661  N  NH2   . ARG C 2  650  ? 504.246 -34.126 700.124 1.00 129.74 ? 650  ARG C NH2   1 
ATOM   8662  N  N     . LYS C 2  651  ? 504.684 -31.057 691.930 1.00 134.87 ? 651  LYS C N     1 
ATOM   8663  C  CA    . LYS C 2  651  ? 504.454 -30.870 690.487 1.00 132.12 ? 651  LYS C CA    1 
ATOM   8664  C  C     . LYS C 2  651  ? 503.018 -30.446 690.179 1.00 128.84 ? 651  LYS C C     1 
ATOM   8665  O  O     . LYS C 2  651  ? 502.056 -31.107 690.589 1.00 127.20 ? 651  LYS C O     1 
ATOM   8666  C  CB    . LYS C 2  651  ? 504.855 -32.099 689.656 1.00 124.05 ? 651  LYS C CB    1 
ATOM   8667  C  CG    . LYS C 2  651  ? 504.499 -31.900 688.176 1.00 120.13 ? 651  LYS C CG    1 
ATOM   8668  C  CD    . LYS C 2  651  ? 504.710 -33.100 687.241 1.00 122.12 ? 651  LYS C CD    1 
ATOM   8669  C  CE    . LYS C 2  651  ? 504.467 -34.450 687.862 1.00 125.49 ? 651  LYS C CE    1 
ATOM   8670  N  NZ    . LYS C 2  651  ? 505.134 -35.477 687.000 1.00 122.37 ? 651  LYS C NZ    1 
ATOM   8671  N  N     . GLY C 2  652  ? 502.886 -29.332 689.452 1.00 123.36 ? 652  GLY C N     1 
ATOM   8672  C  CA    . GLY C 2  652  ? 501.604 -28.769 689.066 1.00 118.96 ? 652  GLY C CA    1 
ATOM   8673  C  C     . GLY C 2  652  ? 500.969 -27.789 690.034 1.00 111.58 ? 652  GLY C C     1 
ATOM   8674  O  O     . GLY C 2  652  ? 499.794 -27.443 689.852 1.00 105.88 ? 652  GLY C O     1 
ATOM   8675  N  N     . ASP C 2  653  ? 501.699 -27.342 691.055 1.00 113.81 ? 653  ASP C N     1 
ATOM   8676  C  CA    . ASP C 2  653  ? 501.223 -26.344 692.008 1.00 110.85 ? 653  ASP C CA    1 
ATOM   8677  C  C     . ASP C 2  653  ? 501.392 -24.943 691.406 1.00 99.56  ? 653  ASP C C     1 
ATOM   8678  O  O     . ASP C 2  653  ? 502.282 -24.692 690.592 1.00 99.39  ? 653  ASP C O     1 
ATOM   8679  C  CB    . ASP C 2  653  ? 501.970 -26.451 693.354 1.00 113.89 ? 653  ASP C CB    1 
ATOM   8680  C  CG    . ASP C 2  653  ? 501.386 -27.525 694.308 1.00 114.53 ? 653  ASP C CG    1 
ATOM   8681  O  OD1   . ASP C 2  653  ? 500.523 -27.198 695.154 1.00 111.55 ? 653  ASP C OD1   1 
ATOM   8682  O  OD2   . ASP C 2  653  ? 501.807 -28.703 694.221 1.00 118.79 ? 653  ASP C OD2   1 
ATOM   8683  N  N     . LEU C 2  654  ? 500.501 -24.043 691.791 1.00 97.64  ? 654  LEU C N     1 
ATOM   8684  C  CA    . LEU C 2  654  ? 500.502 -22.674 691.288 1.00 96.66  ? 654  LEU C CA    1 
ATOM   8685  C  C     . LEU C 2  654  ? 501.702 -21.835 691.739 1.00 96.13  ? 654  LEU C C     1 
ATOM   8686  O  O     . LEU C 2  654  ? 502.075 -21.839 692.911 1.00 102.86 ? 654  LEU C O     1 
ATOM   8687  C  CB    . LEU C 2  654  ? 499.205 -21.994 691.711 1.00 95.39  ? 654  LEU C CB    1 
ATOM   8688  C  CG    . LEU C 2  654  ? 499.025 -20.574 691.193 1.00 96.60  ? 654  LEU C CG    1 
ATOM   8689  C  CD1   . LEU C 2  654  ? 498.656 -20.610 689.732 1.00 99.75  ? 654  LEU C CD1   1 
ATOM   8690  C  CD2   . LEU C 2  654  ? 497.913 -19.901 691.984 1.00 96.78  ? 654  LEU C CD2   1 
ATOM   8691  N  N     . LEU C 2  655  ? 502.307 -21.120 690.785 1.00 97.02  ? 655  LEU C N     1 
ATOM   8692  C  CA    . LEU C 2  655  ? 503.414 -20.185 690.996 1.00 95.13  ? 655  LEU C CA    1 
ATOM   8693  C  C     . LEU C 2  655  ? 502.946 -18.738 690.860 1.00 92.27  ? 655  LEU C C     1 
ATOM   8694  O  O     . LEU C 2  655  ? 503.269 -17.902 691.705 1.00 90.29  ? 655  LEU C O     1 
ATOM   8695  C  CB    . LEU C 2  655  ? 504.568 -20.494 690.038 1.00 99.37  ? 655  LEU C CB    1 
ATOM   8696  C  CG    . LEU C 2  655  ? 505.256 -21.806 690.416 1.00 100.66 ? 655  LEU C CG    1 
ATOM   8697  C  CD1   . LEU C 2  655  ? 506.379 -22.144 689.455 1.00 104.90 ? 655  LEU C CD1   1 
ATOM   8698  C  CD2   . LEU C 2  655  ? 505.775 -21.700 691.843 1.00 102.58 ? 655  LEU C CD2   1 
ATOM   8699  N  N     . ALA C 2  656  ? 502.347 -18.370 689.728 1.00 94.19  ? 656  ALA C N     1 
ATOM   8700  C  CA    . ALA C 2  656  ? 501.777 -17.040 689.561 1.00 91.78  ? 656  ALA C CA    1 
ATOM   8701  C  C     . ALA C 2  656  ? 500.326 -17.145 689.089 1.00 91.90  ? 656  ALA C C     1 
ATOM   8702  O  O     . ALA C 2  656  ? 499.952 -18.085 688.385 1.00 91.44  ? 656  ALA C O     1 
ATOM   8703  C  CB    . ALA C 2  656  ? 502.592 -16.186 688.580 1.00 94.15  ? 656  ALA C CB    1 
ATOM   8704  N  N     . ASP C 2  657  ? 499.495 -16.211 689.553 1.00 95.74  ? 657  ASP C N     1 
ATOM   8705  C  CA    . ASP C 2  657  ? 498.128 -16.023 689.063 1.00 96.17  ? 657  ASP C CA    1 
ATOM   8706  C  C     . ASP C 2  657  ? 498.147 -15.151 687.808 1.00 97.48  ? 657  ASP C C     1 
ATOM   8707  O  O     . ASP C 2  657  ? 498.834 -14.121 687.778 1.00 93.84  ? 657  ASP C O     1 
ATOM   8708  C  CB    . ASP C 2  657  ? 497.235 -15.400 690.148 1.00 97.66  ? 657  ASP C CB    1 
ATOM   8709  C  CG    . ASP C 2  657  ? 496.354 -16.444 690.889 1.00 99.09  ? 657  ASP C CG    1 
ATOM   8710  O  OD1   . ASP C 2  657  ? 496.064 -17.535 690.332 1.00 94.50  ? 657  ASP C OD1   1 
ATOM   8711  O  OD2   . ASP C 2  657  ? 495.962 -16.167 692.053 1.00 99.12  ? 657  ASP C OD2   1 
ATOM   8712  N  N     . GLY C 2  658  ? 497.372 -15.544 686.782 1.00 100.24 ? 658  GLY C N     1 
ATOM   8713  C  CA    . GLY C 2  658  ? 497.204 -14.725 685.591 1.00 99.34  ? 658  GLY C CA    1 
ATOM   8714  C  C     . GLY C 2  658  ? 496.206 -13.592 685.779 1.00 97.08  ? 658  GLY C C     1 
ATOM   8715  O  O     . GLY C 2  658  ? 495.785 -13.308 686.906 1.00 100.12 ? 658  GLY C O     1 
ATOM   8716  N  N     . PRO C 2  659  ? 495.780 -12.930 684.699 1.00 95.69  ? 659  PRO C N     1 
ATOM   8717  C  CA    . PRO C 2  659  ? 494.752 -11.895 684.863 1.00 96.57  ? 659  PRO C CA    1 
ATOM   8718  C  C     . PRO C 2  659  ? 493.397 -12.539 685.124 1.00 94.79  ? 659  PRO C C     1 
ATOM   8719  O  O     . PRO C 2  659  ? 493.105 -13.640 684.645 1.00 91.31  ? 659  PRO C O     1 
ATOM   8720  C  CB    . PRO C 2  659  ? 494.756 -11.153 683.516 1.00 88.76  ? 659  PRO C CB    1 
ATOM   8721  C  CG    . PRO C 2  659  ? 495.723 -11.899 682.626 1.00 94.89  ? 659  PRO C CG    1 
ATOM   8722  C  CD    . PRO C 2  659  ? 496.040 -13.214 683.277 1.00 93.69  ? 659  PRO C CD    1 
ATOM   8723  N  N     . ALA C 2  660  ? 492.553 -11.834 685.876 1.00 89.76  ? 660  ALA C N     1 
ATOM   8724  C  CA    . ALA C 2  660  ? 491.201 -12.322 686.130 1.00 87.26  ? 660  ALA C CA    1 
ATOM   8725  C  C     . ALA C 2  660  ? 491.223 -13.768 686.623 1.00 89.56  ? 660  ALA C C     1 
ATOM   8726  O  O     . ALA C 2  660  ? 490.439 -14.614 686.180 1.00 84.84  ? 660  ALA C O     1 
ATOM   8727  C  CB    . ALA C 2  660  ? 490.329 -12.191 684.888 1.00 84.43  ? 660  ALA C CB    1 
ATOM   8728  N  N     . SER C 2  661  ? 492.186 -14.068 687.493 1.00 93.39  ? 661  SER C N     1 
ATOM   8729  C  CA    . SER C 2  661  ? 492.199 -15.322 688.231 1.00 93.64  ? 661  SER C CA    1 
ATOM   8730  C  C     . SER C 2  661  ? 492.726 -15.060 689.639 1.00 98.53  ? 661  SER C C     1 
ATOM   8731  O  O     . SER C 2  661  ? 493.629 -14.232 689.842 1.00 95.79  ? 661  SER C O     1 
ATOM   8732  C  CB    . SER C 2  661  ? 493.041 -16.390 687.510 1.00 92.59  ? 661  SER C CB    1 
ATOM   8733  O  OG    . SER C 2  661  ? 493.715 -17.247 688.418 1.00 93.85  ? 661  SER C OG    1 
ATOM   8734  N  N     . GLU C 2  662  ? 492.147 -15.785 690.602 1.00 93.97  ? 662  GLU C N     1 
ATOM   8735  C  CA    . GLU C 2  662  ? 492.447 -15.674 692.027 1.00 91.88  ? 662  GLU C CA    1 
ATOM   8736  C  C     . GLU C 2  662  ? 492.743 -17.062 692.575 1.00 98.43  ? 662  GLU C C     1 
ATOM   8737  O  O     . GLU C 2  662  ? 491.838 -17.904 692.643 1.00 97.05  ? 662  GLU C O     1 
ATOM   8738  C  CB    . GLU C 2  662  ? 491.276 -15.064 692.778 1.00 85.11  ? 662  GLU C CB    1 
ATOM   8739  C  CG    . GLU C 2  662  ? 491.501 -14.998 694.246 1.00 91.75  ? 662  GLU C CG    1 
ATOM   8740  C  CD    . GLU C 2  662  ? 490.236 -14.634 694.977 1.00 89.70  ? 662  GLU C CD    1 
ATOM   8741  O  OE1   . GLU C 2  662  ? 489.242 -15.365 694.744 1.00 88.33  ? 662  GLU C OE1   1 
ATOM   8742  O  OE2   . GLU C 2  662  ? 490.253 -13.697 695.817 1.00 83.98  ? 662  GLU C OE2   1 
ATOM   8743  N  N     . ASN C 2  663  ? 493.997 -17.290 692.990 1.00 100.72 ? 663  ASN C N     1 
ATOM   8744  C  CA    . ASN C 2  663  ? 494.428 -18.587 693.531 1.00 100.38 ? 663  ASN C CA    1 
ATOM   8745  C  C     . ASN C 2  663  ? 494.016 -19.738 692.615 1.00 102.16 ? 663  ASN C C     1 
ATOM   8746  O  O     . ASN C 2  663  ? 493.622 -20.811 693.090 1.00 96.51  ? 663  ASN C O     1 
ATOM   8747  C  CB    . ASN C 2  663  ? 493.865 -18.810 694.940 1.00 103.89 ? 663  ASN C CB    1 
ATOM   8748  C  CG    . ASN C 2  663  ? 494.304 -17.734 695.938 1.00 109.64 ? 663  ASN C CG    1 
ATOM   8749  O  OD1   . ASN C 2  663  ? 494.956 -16.740 695.566 1.00 105.39 ? 663  ASN C OD1   1 
ATOM   8750  N  ND2   . ASN C 2  663  ? 493.875 -17.892 697.203 1.00 102.73 ? 663  ASN C ND2   1 
ATOM   8751  N  N     . GLY C 2  664  ? 494.032 -19.483 691.294 1.00 103.05 ? 664  GLY C N     1 
ATOM   8752  C  CA    . GLY C 2  664  ? 493.744 -20.480 690.275 1.00 100.52 ? 664  GLY C CA    1 
ATOM   8753  C  C     . GLY C 2  664  ? 492.295 -20.635 689.826 1.00 97.68  ? 664  GLY C C     1 
ATOM   8754  O  O     . GLY C 2  664  ? 492.029 -21.459 688.935 1.00 98.50  ? 664  GLY C O     1 
ATOM   8755  N  N     . PHE C 2  665  ? 491.346 -19.909 690.414 1.00 90.81  ? 665  PHE C N     1 
ATOM   8756  C  CA    . PHE C 2  665  ? 489.957 -20.007 689.993 1.00 89.03  ? 665  PHE C CA    1 
ATOM   8757  C  C     . PHE C 2  665  ? 489.601 -18.803 689.129 1.00 90.69  ? 665  PHE C C     1 
ATOM   8758  O  O     . PHE C 2  665  ? 490.023 -17.677 689.424 1.00 90.46  ? 665  PHE C O     1 
ATOM   8759  C  CB    . PHE C 2  665  ? 489.065 -20.056 691.229 1.00 93.61  ? 665  PHE C CB    1 
ATOM   8760  C  CG    . PHE C 2  665  ? 489.219 -21.329 692.046 1.00 96.82  ? 665  PHE C CG    1 
ATOM   8761  C  CD1   . PHE C 2  665  ? 490.427 -21.592 692.700 1.00 92.92  ? 665  PHE C CD1   1 
ATOM   8762  C  CD2   . PHE C 2  665  ? 488.186 -22.256 692.158 1.00 96.81  ? 665  PHE C CD2   1 
ATOM   8763  C  CE1   . PHE C 2  665  ? 490.598 -22.731 693.452 1.00 92.98  ? 665  PHE C CE1   1 
ATOM   8764  C  CE2   . PHE C 2  665  ? 488.352 -23.407 692.917 1.00 97.12  ? 665  PHE C CE2   1 
ATOM   8765  C  CZ    . PHE C 2  665  ? 489.560 -23.636 693.571 1.00 96.99  ? 665  PHE C CZ    1 
ATOM   8766  N  N     . LEU C 2  666  ? 488.778 -19.018 688.099 1.00 86.95  ? 666  LEU C N     1 
ATOM   8767  C  CA    . LEU C 2  666  ? 488.434 -17.911 687.209 1.00 81.65  ? 666  LEU C CA    1 
ATOM   8768  C  C     . LEU C 2  666  ? 487.683 -16.814 687.975 1.00 79.73  ? 666  LEU C C     1 
ATOM   8769  O  O     . LEU C 2  666  ? 486.588 -17.039 688.496 1.00 74.97  ? 666  LEU C O     1 
ATOM   8770  C  CB    . LEU C 2  666  ? 487.641 -18.429 686.009 1.00 74.31  ? 666  LEU C CB    1 
ATOM   8771  C  CG    . LEU C 2  666  ? 487.272 -17.348 684.989 1.00 74.70  ? 666  LEU C CG    1 
ATOM   8772  C  CD1   . LEU C 2  666  ? 488.518 -16.672 684.528 1.00 71.04  ? 666  LEU C CD1   1 
ATOM   8773  C  CD2   . LEU C 2  666  ? 486.516 -17.926 683.777 1.00 64.33  ? 666  LEU C CD2   1 
ATOM   8774  N  N     . ALA C 2  667  ? 488.246 -15.604 687.963 1.00 81.41  ? 667  ALA C N     1 
ATOM   8775  C  CA    . ALA C 2  667  ? 487.673 -14.421 688.606 1.00 75.58  ? 667  ALA C CA    1 
ATOM   8776  C  C     . ALA C 2  667  ? 487.292 -13.354 687.582 1.00 78.69  ? 667  ALA C C     1 
ATOM   8777  O  O     . ALA C 2  667  ? 488.104 -12.485 687.232 1.00 75.17  ? 667  ALA C O     1 
ATOM   8778  C  CB    . ALA C 2  667  ? 488.674 -13.837 689.580 1.00 75.62  ? 667  ALA C CB    1 
ATOM   8779  N  N     . LEU C 2  668  ? 486.015 -13.322 687.216 1.00 75.35  ? 668  LEU C N     1 
ATOM   8780  C  CA    . LEU C 2  668  ? 485.557 -12.430 686.167 1.00 76.11  ? 668  LEU C CA    1 
ATOM   8781  C  C     . LEU C 2  668  ? 484.958 -11.154 686.747 1.00 74.50  ? 668  LEU C C     1 
ATOM   8782  O  O     . LEU C 2  668  ? 484.559 -10.252 686.000 1.00 74.69  ? 668  LEU C O     1 
ATOM   8783  C  CB    . LEU C 2  668  ? 484.553 -13.165 685.282 1.00 77.85  ? 668  LEU C CB    1 
ATOM   8784  C  CG    . LEU C 2  668  ? 485.247 -14.274 684.476 1.00 73.75  ? 668  LEU C CG    1 
ATOM   8785  C  CD1   . LEU C 2  668  ? 484.293 -14.950 683.509 1.00 71.83  ? 668  LEU C CD1   1 
ATOM   8786  C  CD2   . LEU C 2  668  ? 486.491 -13.797 683.781 1.00 65.04  ? 668  LEU C CD2   1 
ATOM   8787  N  N     . GLY C 2  669  ? 484.910 -11.060 688.065 1.00 77.36  ? 669  GLY C N     1 
ATOM   8788  C  CA    . GLY C 2  669  ? 484.181 -10.010 688.730 1.00 74.12  ? 669  GLY C CA    1 
ATOM   8789  C  C     . GLY C 2  669  ? 484.463 -9.999  690.222 1.00 72.03  ? 669  GLY C C     1 
ATOM   8790  O  O     . GLY C 2  669  ? 485.454 -10.549 690.703 1.00 68.01  ? 669  GLY C O     1 
ATOM   8791  N  N     . GLN C 2  670  ? 483.549 -9.407  690.961 1.00 75.27  ? 670  GLN C N     1 
ATOM   8792  C  CA    . GLN C 2  670  ? 483.667 -9.373  692.401 1.00 78.45  ? 670  GLN C CA    1 
ATOM   8793  C  C     . GLN C 2  670  ? 482.393 -9.925  693.023 1.00 76.88  ? 670  GLN C C     1 
ATOM   8794  O  O     . GLN C 2  670  ? 481.344 -9.999  692.369 1.00 75.82  ? 670  GLN C O     1 
ATOM   8795  C  CB    . GLN C 2  670  ? 483.993 -7.959  692.872 1.00 74.99  ? 670  GLN C CB    1 
ATOM   8796  C  CG    . GLN C 2  670  ? 485.470 -7.753  693.180 1.00 77.55  ? 670  GLN C CG    1 
ATOM   8797  C  CD    . GLN C 2  670  ? 485.998 -6.511  692.548 1.00 81.05  ? 670  GLN C CD    1 
ATOM   8798  O  OE1   . GLN C 2  670  ? 485.268 -5.828  691.828 1.00 85.16  ? 670  GLN C OE1   1 
ATOM   8799  N  NE2   . GLN C 2  670  ? 487.226 -6.135  692.894 1.00 78.68  ? 670  GLN C NE2   1 
ATOM   8800  N  N     . ASN C 2  671  ? 482.526 -10.359 694.284 1.00 70.75  ? 671  ASN C N     1 
ATOM   8801  C  CA    . ASN C 2  671  ? 481.411 -10.810 695.100 1.00 67.41  ? 671  ASN C CA    1 
ATOM   8802  C  C     . ASN C 2  671  ? 480.922 -9.647  695.934 1.00 69.44  ? 671  ASN C C     1 
ATOM   8803  O  O     . ASN C 2  671  ? 481.677 -9.116  696.758 1.00 74.97  ? 671  ASN C O     1 
ATOM   8804  C  CB    . ASN C 2  671  ? 481.822 -11.963 696.010 1.00 65.26  ? 671  ASN C CB    1 
ATOM   8805  C  CG    . ASN C 2  671  ? 482.268 -13.164 695.235 1.00 72.68  ? 671  ASN C CG    1 
ATOM   8806  O  OD1   . ASN C 2  671  ? 481.463 -13.803 694.570 1.00 72.09  ? 671  ASN C OD1   1 
ATOM   8807  N  ND2   . ASN C 2  671  ? 483.545 -13.498 695.325 1.00 76.22  ? 671  ASN C ND2   1 
ATOM   8808  N  N     . VAL C 2  672  ? 479.693 -9.209  695.689 1.00 58.12  ? 672  VAL C N     1 
ATOM   8809  C  CA    . VAL C 2  672  ? 479.193 -8.065  696.429 1.00 65.13  ? 672  VAL C CA    1 
ATOM   8810  C  C     . VAL C 2  672  ? 477.940 -8.456  697.214 1.00 73.39  ? 672  VAL C C     1 
ATOM   8811  O  O     . VAL C 2  672  ? 477.250 -9.431  696.893 1.00 75.58  ? 672  VAL C O     1 
ATOM   8812  C  CB    . VAL C 2  672  ? 478.920 -6.889  695.490 1.00 60.54  ? 672  VAL C CB    1 
ATOM   8813  C  CG1   . VAL C 2  672  ? 480.219 -6.325  695.011 1.00 61.93  ? 672  VAL C CG1   1 
ATOM   8814  C  CG2   . VAL C 2  672  ? 478.135 -7.398  694.319 1.00 58.06  ? 672  VAL C CG2   1 
ATOM   8815  N  N     . LEU C 2  673  ? 477.670 -7.690  698.281 1.00 69.59  ? 673  LEU C N     1 
ATOM   8816  C  CA    . LEU C 2  673  ? 476.471 -7.874  699.099 1.00 67.71  ? 673  LEU C CA    1 
ATOM   8817  C  C     . LEU C 2  673  ? 475.344 -7.103  698.435 1.00 73.68  ? 673  LEU C C     1 
ATOM   8818  O  O     . LEU C 2  673  ? 475.388 -5.869  698.386 1.00 72.72  ? 673  LEU C O     1 
ATOM   8819  C  CB    . LEU C 2  673  ? 476.688 -7.367  700.519 1.00 71.27  ? 673  LEU C CB    1 
ATOM   8820  C  CG    . LEU C 2  673  ? 475.724 -7.985  701.524 1.00 75.31  ? 673  LEU C CG    1 
ATOM   8821  C  CD1   . LEU C 2  673  ? 475.918 -9.471  701.479 1.00 76.96  ? 673  LEU C CD1   1 
ATOM   8822  C  CD2   . LEU C 2  673  ? 475.954 -7.475  702.962 1.00 72.23  ? 673  LEU C CD2   1 
ATOM   8823  N  N     . VAL C 2  674  ? 474.303 -7.812  697.991 1.00 73.87  ? 674  VAL C N     1 
ATOM   8824  C  CA    . VAL C 2  674  ? 473.246 -7.213  697.190 1.00 65.99  ? 674  VAL C CA    1 
ATOM   8825  C  C     . VAL C 2  674  ? 471.909 -7.234  697.919 1.00 64.69  ? 674  VAL C C     1 
ATOM   8826  O  O     . VAL C 2  674  ? 471.575 -8.215  698.591 1.00 68.89  ? 674  VAL C O     1 
ATOM   8827  C  CB    . VAL C 2  674  ? 473.139 -7.977  695.862 1.00 63.05  ? 674  VAL C CB    1 
ATOM   8828  C  CG1   . VAL C 2  674  ? 472.560 -9.377  696.074 1.00 62.27  ? 674  VAL C CG1   1 
ATOM   8829  C  CG2   . VAL C 2  674  ? 472.318 -7.210  694.899 1.00 71.70  ? 674  VAL C CG2   1 
ATOM   8830  N  N     . ALA C 2  675  ? 471.118 -6.174  697.738 1.00 61.33  ? 675  ALA C N     1 
ATOM   8831  C  CA    . ALA C 2  675  ? 469.736 -6.123  698.214 1.00 64.10  ? 675  ALA C CA    1 
ATOM   8832  C  C     . ALA C 2  675  ? 468.830 -6.062  696.999 1.00 63.92  ? 675  ALA C C     1 
ATOM   8833  O  O     . ALA C 2  675  ? 469.068 -5.261  696.087 1.00 66.85  ? 675  ALA C O     1 
ATOM   8834  C  CB    . ALA C 2  675  ? 469.466 -4.912  699.108 1.00 63.08  ? 675  ALA C CB    1 
ATOM   8835  N  N     . ILE C 2  676  ? 467.803 -6.901  696.987 1.00 58.54  ? 676  ILE C N     1 
ATOM   8836  C  CA    . ILE C 2  676  ? 466.874 -6.969  695.872 1.00 56.26  ? 676  ILE C CA    1 
ATOM   8837  C  C     . ILE C 2  676  ? 465.631 -6.188  696.249 1.00 58.01  ? 676  ILE C C     1 
ATOM   8838  O  O     . ILE C 2  676  ? 464.756 -6.714  696.936 1.00 63.81  ? 676  ILE C O     1 
ATOM   8839  C  CB    . ILE C 2  676  ? 466.545 -8.433  695.570 1.00 63.07  ? 676  ILE C CB    1 
ATOM   8840  C  CG1   . ILE C 2  676  ? 467.884 -9.198  695.373 1.00 62.96  ? 676  ILE C CG1   1 
ATOM   8841  C  CG2   . ILE C 2  676  ? 465.580 -8.522  694.366 1.00 59.60  ? 676  ILE C CG2   1 
ATOM   8842  C  CD1   . ILE C 2  676  ? 467.804 -10.649 694.874 1.00 49.23  ? 676  ILE C CD1   1 
ATOM   8843  N  N     . MET C 2  677  ? 465.462 -5.006  695.678 1.00 60.16  ? 677  MET C N     1 
ATOM   8844  C  CA    . MET C 2  677  ? 464.395 -4.087  696.085 1.00 62.72  ? 677  MET C CA    1 
ATOM   8845  C  C     . MET C 2  677  ? 464.393 -2.855  695.193 1.00 60.68  ? 677  MET C C     1 
ATOM   8846  O  O     . MET C 2  677  ? 465.467 -2.365  694.828 1.00 64.50  ? 677  MET C O     1 
ATOM   8847  C  CB    . MET C 2  677  ? 464.577 -3.666  697.557 1.00 59.32  ? 677  MET C CB    1 
ATOM   8848  C  CG    . MET C 2  677  ? 465.861 -2.884  697.846 1.00 59.06  ? 677  MET C CG    1 
ATOM   8849  S  SD    . MET C 2  677  ? 466.063 -2.113  699.500 1.00 63.60  ? 677  MET C SD    1 
ATOM   8850  C  CE    . MET C 2  677  ? 464.698 -0.908  699.482 1.00 60.05  ? 677  MET C CE    1 
ATOM   8851  N  N     . PRO C 2  678  ? 463.241 -2.248  694.929 1.00 55.96  ? 678  PRO C N     1 
ATOM   8852  C  CA    . PRO C 2  678  ? 463.243 -1.003  694.152 1.00 59.02  ? 678  PRO C CA    1 
ATOM   8853  C  C     . PRO C 2  678  ? 463.973 0.064   694.945 1.00 59.89  ? 678  PRO C C     1 
ATOM   8854  O  O     . PRO C 2  678  ? 464.062 -0.025  696.168 1.00 69.10  ? 678  PRO C O     1 
ATOM   8855  C  CB    . PRO C 2  678  ? 461.753 -0.676  693.992 1.00 58.61  ? 678  PRO C CB    1 
ATOM   8856  C  CG    . PRO C 2  678  ? 461.042 -1.980  694.274 1.00 56.81  ? 678  PRO C CG    1 
ATOM   8857  C  CD    . PRO C 2  678  ? 461.883 -2.704  695.258 1.00 55.19  ? 678  PRO C CD    1 
ATOM   8858  N  N     . PHE C 2  679  ? 464.603 1.018   694.254 1.00 60.16  ? 679  PHE C N     1 
ATOM   8859  C  CA    . PHE C 2  679  ? 465.119 2.180   694.978 1.00 60.52  ? 679  PHE C CA    1 
ATOM   8860  C  C     . PHE C 2  679  ? 464.811 3.468   694.214 1.00 59.84  ? 679  PHE C C     1 
ATOM   8861  O  O     . PHE C 2  679  ? 465.453 3.766   693.210 1.00 61.83  ? 679  PHE C O     1 
ATOM   8862  C  CB    . PHE C 2  679  ? 466.622 2.022   695.222 1.00 63.90  ? 679  PHE C CB    1 
ATOM   8863  C  CG    . PHE C 2  679  ? 467.184 3.017   696.217 1.00 67.37  ? 679  PHE C CG    1 
ATOM   8864  C  CD1   . PHE C 2  679  ? 467.780 4.202   695.795 1.00 62.18  ? 679  PHE C CD1   1 
ATOM   8865  C  CD2   . PHE C 2  679  ? 467.103 2.763   697.589 1.00 66.31  ? 679  PHE C CD2   1 
ATOM   8866  C  CE1   . PHE C 2  679  ? 468.275 5.113   696.715 1.00 62.82  ? 679  PHE C CE1   1 
ATOM   8867  C  CE2   . PHE C 2  679  ? 467.596 3.677   698.511 1.00 66.63  ? 679  PHE C CE2   1 
ATOM   8868  C  CZ    . PHE C 2  679  ? 468.183 4.852   698.072 1.00 62.93  ? 679  PHE C CZ    1 
ATOM   8869  N  N     . ASP C 2  680  ? 463.805 4.205   694.671 1.00 61.69  ? 680  ASP C N     1 
ATOM   8870  C  CA    . ASP C 2  680  ? 463.483 5.552   694.206 1.00 62.60  ? 680  ASP C CA    1 
ATOM   8871  C  C     . ASP C 2  680  ? 463.567 5.842   692.703 1.00 65.41  ? 680  ASP C C     1 
ATOM   8872  O  O     . ASP C 2  680  ? 463.887 6.975   692.334 1.00 67.60  ? 680  ASP C O     1 
ATOM   8873  C  CB    . ASP C 2  680  ? 464.372 6.544   694.919 1.00 67.49  ? 680  ASP C CB    1 
ATOM   8874  C  CG    . ASP C 2  680  ? 463.694 7.137   696.124 1.00 76.17  ? 680  ASP C CG    1 
ATOM   8875  O  OD1   . ASP C 2  680  ? 462.944 6.375   696.791 1.00 78.62  ? 680  ASP C OD1   1 
ATOM   8876  O  OD2   . ASP C 2  680  ? 463.900 8.339   696.416 1.00 85.03  ? 680  ASP C OD2   1 
ATOM   8877  N  N     . GLY C 2  681  ? 463.263 4.878   691.827 1.00 64.91  ? 681  GLY C N     1 
ATOM   8878  C  CA    . GLY C 2  681  ? 463.403 5.005   690.377 1.00 57.34  ? 681  GLY C CA    1 
ATOM   8879  C  C     . GLY C 2  681  ? 464.811 5.042   689.814 1.00 61.72  ? 681  GLY C C     1 
ATOM   8880  O  O     . GLY C 2  681  ? 464.964 5.109   688.592 1.00 59.97  ? 681  GLY C O     1 
ATOM   8881  N  N     . TYR C 2  682  ? 465.850 4.895   690.636 1.00 64.90  ? 682  TYR C N     1 
ATOM   8882  C  CA    . TYR C 2  682  ? 467.210 4.760   690.119 1.00 55.30  ? 682  TYR C CA    1 
ATOM   8883  C  C     . TYR C 2  682  ? 467.423 3.337   689.624 1.00 55.77  ? 682  TYR C C     1 
ATOM   8884  O  O     . TYR C 2  682  ? 468.508 2.993   689.182 1.00 63.49  ? 682  TYR C O     1 
ATOM   8885  C  CB    . TYR C 2  682  ? 468.224 5.143   691.193 1.00 54.48  ? 682  TYR C CB    1 
ATOM   8886  C  CG    . TYR C 2  682  ? 468.200 6.635   691.501 1.00 58.99  ? 682  TYR C CG    1 
ATOM   8887  C  CD1   . TYR C 2  682  ? 468.538 7.579   690.557 1.00 54.72  ? 682  TYR C CD1   1 
ATOM   8888  C  CD2   . TYR C 2  682  ? 467.749 7.091   692.745 1.00 64.02  ? 682  TYR C CD2   1 
ATOM   8889  C  CE1   . TYR C 2  682  ? 468.478 8.937   690.843 1.00 55.82  ? 682  TYR C CE1   1 
ATOM   8890  C  CE2   . TYR C 2  682  ? 467.675 8.448   693.042 1.00 61.15  ? 682  TYR C CE2   1 
ATOM   8891  C  CZ    . TYR C 2  682  ? 468.046 9.367   692.081 1.00 62.45  ? 682  TYR C CZ    1 
ATOM   8892  O  OH    . TYR C 2  682  ? 467.979 10.720  692.368 1.00 70.92  ? 682  TYR C OH    1 
ATOM   8893  N  N     . ASN C 2  683  ? 466.483 2.466   689.923 1.00 60.01  ? 683  ASN C N     1 
ATOM   8894  C  CA    . ASN C 2  683  ? 466.436 1.072   689.533 1.00 60.25  ? 683  ASN C CA    1 
ATOM   8895  C  C     . ASN C 2  683  ? 465.673 0.835   688.244 1.00 60.40  ? 683  ASN C C     1 
ATOM   8896  O  O     . ASN C 2  683  ? 465.603 -0.314  687.780 1.00 60.16  ? 683  ASN C O     1 
ATOM   8897  C  CB    . ASN C 2  683  ? 465.788 0.257   690.651 1.00 62.42  ? 683  ASN C CB    1 
ATOM   8898  C  CG    . ASN C 2  683  ? 466.811 -0.421  691.429 1.00 69.05  ? 683  ASN C CG    1 
ATOM   8899  O  OD1   . ASN C 2  683  ? 467.950 -0.505  690.924 1.00 77.84  ? 683  ASN C OD1   1 
ATOM   8900  N  ND2   . ASN C 2  683  ? 466.486 -0.936  692.622 1.00 61.71  ? 683  ASN C ND2   1 
ATOM   8901  N  N     . PHE C 2  684  ? 465.134 1.892   687.647 1.00 54.99  ? 684  PHE C N     1 
ATOM   8902  C  CA    . PHE C 2  684  ? 464.118 1.742   686.615 1.00 57.85  ? 684  PHE C CA    1 
ATOM   8903  C  C     . PHE C 2  684  ? 464.685 0.997   685.390 1.00 63.03  ? 684  PHE C C     1 
ATOM   8904  O  O     . PHE C 2  684  ? 465.791 1.294   684.901 1.00 54.47  ? 684  PHE C O     1 
ATOM   8905  C  CB    . PHE C 2  684  ? 463.640 3.147   686.230 1.00 55.50  ? 684  PHE C CB    1 
ATOM   8906  C  CG    . PHE C 2  684  ? 462.437 3.189   685.351 1.00 55.70  ? 684  PHE C CG    1 
ATOM   8907  C  CD1   . PHE C 2  684  ? 461.216 2.739   685.822 1.00 56.82  ? 684  PHE C CD1   1 
ATOM   8908  C  CD2   . PHE C 2  684  ? 462.524 3.627   684.042 1.00 63.15  ? 684  PHE C CD2   1 
ATOM   8909  C  CE1   . PHE C 2  684  ? 460.083 2.775   685.048 1.00 58.93  ? 684  PHE C CE1   1 
ATOM   8910  C  CE2   . PHE C 2  684  ? 461.383 3.644   683.216 1.00 64.38  ? 684  PHE C CE2   1 
ATOM   8911  C  CZ    . PHE C 2  684  ? 460.158 3.220   683.730 1.00 66.34  ? 684  PHE C CZ    1 
ATOM   8912  N  N     . GLU C 2  685  ? 463.909 0.027   684.894 1.00 68.48  ? 685  GLU C N     1 
ATOM   8913  C  CA    . GLU C 2  685  ? 464.174 -0.668  683.628 1.00 57.96  ? 685  GLU C CA    1 
ATOM   8914  C  C     . GLU C 2  685  ? 465.633 -1.120  683.528 1.00 53.50  ? 685  GLU C C     1 
ATOM   8915  O  O     . GLU C 2  685  ? 466.319 -0.838  682.564 1.00 59.99  ? 685  GLU C O     1 
ATOM   8916  C  CB    . GLU C 2  685  ? 463.757 0.228   682.461 1.00 54.71  ? 685  GLU C CB    1 
ATOM   8917  C  CG    . GLU C 2  685  ? 462.221 0.268   682.222 1.00 57.35  ? 685  GLU C CG    1 
ATOM   8918  C  CD    . GLU C 2  685  ? 461.666 -0.998  681.515 1.00 66.70  ? 685  GLU C CD    1 
ATOM   8919  O  OE1   . GLU C 2  685  ? 462.231 -2.100  681.755 1.00 69.73  ? 685  GLU C OE1   1 
ATOM   8920  O  OE2   . GLU C 2  685  ? 460.613 -0.901  680.800 1.00 54.70  ? 685  GLU C OE2   1 
ATOM   8921  N  N     . ASP C 2  686  ? 466.076 -1.876  684.531 1.00 57.05  ? 686  ASP C N     1 
ATOM   8922  C  CA    . ASP C 2  686  ? 467.363 -2.574  684.671 1.00 55.33  ? 686  ASP C CA    1 
ATOM   8923  C  C     . ASP C 2  686  ? 468.556 -1.744  685.119 1.00 53.64  ? 686  ASP C C     1 
ATOM   8924  O  O     . ASP C 2  686  ? 469.597 -2.353  685.444 1.00 54.03  ? 686  ASP C O     1 
ATOM   8925  C  CB    . ASP C 2  686  ? 467.794 -3.281  683.377 1.00 58.72  ? 686  ASP C CB    1 
ATOM   8926  C  CG    . ASP C 2  686  ? 466.719 -4.187  682.848 1.00 71.42  ? 686  ASP C CG    1 
ATOM   8927  O  OD1   . ASP C 2  686  ? 466.689 -5.362  683.288 1.00 77.87  ? 686  ASP C OD1   1 
ATOM   8928  O  OD2   . ASP C 2  686  ? 465.889 -3.731  682.022 1.00 75.11  ? 686  ASP C OD2   1 
ATOM   8929  N  N     . ALA C 2  687  ? 468.430 -0.438  685.305 1.00 49.76  ? 687  ALA C N     1 
ATOM   8930  C  CA    . ALA C 2  687  ? 469.562 0.296   685.856 1.00 52.46  ? 687  ALA C CA    1 
ATOM   8931  C  C     . ALA C 2  687  ? 469.922 -0.203  687.257 1.00 60.82  ? 687  ALA C C     1 
ATOM   8932  O  O     . ALA C 2  687  ? 469.113 -0.821  687.973 1.00 64.86  ? 687  ALA C O     1 
ATOM   8933  C  CB    . ALA C 2  687  ? 469.269 1.798   685.894 1.00 49.61  ? 687  ALA C CB    1 
ATOM   8934  N  N     . ILE C 2  688  ? 471.158 0.072   687.662 1.00 59.43  ? 688  ILE C N     1 
ATOM   8935  C  CA    . ILE C 2  688  ? 471.663 -0.463  688.921 1.00 64.44  ? 688  ILE C CA    1 
ATOM   8936  C  C     . ILE C 2  688  ? 472.197 0.671   689.794 1.00 65.09  ? 688  ILE C C     1 
ATOM   8937  O  O     . ILE C 2  688  ? 472.827 1.615   689.306 1.00 66.92  ? 688  ILE C O     1 
ATOM   8938  C  CB    . ILE C 2  688  ? 472.762 -1.499  688.650 1.00 59.23  ? 688  ILE C CB    1 
ATOM   8939  C  CG1   . ILE C 2  688  ? 472.187 -2.645  687.847 1.00 65.24  ? 688  ILE C CG1   1 
ATOM   8940  C  CG2   . ILE C 2  688  ? 473.311 -2.021  689.931 1.00 59.88  ? 688  ILE C CG2   1 
ATOM   8941  C  CD1   . ILE C 2  688  ? 473.203 -3.731  687.578 1.00 65.35  ? 688  ILE C CD1   1 
ATOM   8942  N  N     . VAL C 2  689  ? 471.938 0.580   691.090 1.00 61.39  ? 689  VAL C N     1 
ATOM   8943  C  CA    . VAL C 2  689  ? 472.424 1.544   692.062 1.00 62.47  ? 689  VAL C CA    1 
ATOM   8944  C  C     . VAL C 2  689  ? 473.517 0.866   692.864 1.00 68.59  ? 689  VAL C C     1 
ATOM   8945  O  O     . VAL C 2  689  ? 473.289 -0.226  693.408 1.00 65.85  ? 689  VAL C O     1 
ATOM   8946  C  CB    . VAL C 2  689  ? 471.285 2.021   692.967 1.00 60.49  ? 689  VAL C CB    1 
ATOM   8947  C  CG1   . VAL C 2  689  ? 471.812 2.969   693.948 1.00 63.89  ? 689  VAL C CG1   1 
ATOM   8948  C  CG2   . VAL C 2  689  ? 470.233 2.686   692.124 1.00 61.20  ? 689  VAL C CG2   1 
ATOM   8949  N  N     . ILE C 2  690  ? 474.649 1.561   693.062 1.00 69.15  ? 690  ILE C N     1 
ATOM   8950  C  CA    . ILE C 2  690  ? 475.784 0.961   693.762 1.00 68.52  ? 690  ILE C CA    1 
ATOM   8951  C  C     . ILE C 2  690  ? 476.242 1.865   694.894 1.00 64.52  ? 690  ILE C C     1 
ATOM   8952  O  O     . ILE C 2  690  ? 476.055 3.082   694.869 1.00 69.08  ? 690  ILE C O     1 
ATOM   8953  C  CB    . ILE C 2  690  ? 476.965 0.710   692.798 1.00 70.44  ? 690  ILE C CB    1 
ATOM   8954  C  CG1   . ILE C 2  690  ? 477.527 2.060   692.306 1.00 67.89  ? 690  ILE C CG1   1 
ATOM   8955  C  CG2   . ILE C 2  690  ? 476.489 -0.146  691.609 1.00 61.44  ? 690  ILE C CG2   1 
ATOM   8956  C  CD1   . ILE C 2  690  ? 478.972 2.011   691.770 1.00 65.43  ? 690  ILE C CD1   1 
ATOM   8957  N  N     . SER C 2  691  ? 476.923 1.264   695.861 1.00 65.23  ? 691  SER C N     1 
ATOM   8958  C  CA    . SER C 2  691  ? 477.387 2.018   697.022 1.00 72.81  ? 691  SER C CA    1 
ATOM   8959  C  C     . SER C 2  691  ? 478.739 2.642   696.732 1.00 71.48  ? 691  SER C C     1 
ATOM   8960  O  O     . SER C 2  691  ? 479.647 1.967   696.241 1.00 75.48  ? 691  SER C O     1 
ATOM   8961  C  CB    . SER C 2  691  ? 477.458 1.076   698.249 1.00 78.82  ? 691  SER C CB    1 
ATOM   8962  O  OG    . SER C 2  691  ? 478.043 1.627   699.436 1.00 79.10  ? 691  SER C OG    1 
ATOM   8963  N  N     . GLU C 2  692  ? 478.909 3.898   697.158 1.00 67.39  ? 692  GLU C N     1 
ATOM   8964  C  CA    . GLU C 2  692  ? 480.207 4.546   697.018 1.00 69.81  ? 692  GLU C CA    1 
ATOM   8965  C  C     . GLU C 2  692  ? 481.307 3.763   697.736 1.00 70.04  ? 692  GLU C C     1 
ATOM   8966  O  O     . GLU C 2  692  ? 482.487 3.957   697.445 1.00 67.88  ? 692  GLU C O     1 
ATOM   8967  C  CB    . GLU C 2  692  ? 480.104 6.010   697.474 1.00 70.22  ? 692  GLU C CB    1 
ATOM   8968  C  CG    . GLU C 2  692  ? 481.335 6.886   697.185 1.00 74.45  ? 692  GLU C CG    1 
ATOM   8969  C  CD    . GLU C 2  692  ? 481.146 8.384   697.523 1.00 77.38  ? 692  GLU C CD    1 
ATOM   8970  O  OE1   . GLU C 2  692  ? 480.632 8.710   698.618 1.00 80.27  ? 692  GLU C OE1   1 
ATOM   8971  O  OE2   . GLU C 2  692  ? 481.570 9.244   696.717 1.00 74.76  ? 692  GLU C OE2   1 
ATOM   8972  N  N     . GLU C 2  693  ? 480.947 2.894   698.678 1.00 75.80  ? 693  GLU C N     1 
ATOM   8973  C  CA    . GLU C 2  693  ? 481.930 2.022   699.327 1.00 81.38  ? 693  GLU C CA    1 
ATOM   8974  C  C     . GLU C 2  693  ? 482.720 1.173   698.333 1.00 80.06  ? 693  GLU C C     1 
ATOM   8975  O  O     . GLU C 2  693  ? 483.843 0.749   698.643 1.00 82.55  ? 693  GLU C O     1 
ATOM   8976  C  CB    . GLU C 2  693  ? 481.254 1.123   700.374 1.00 80.65  ? 693  GLU C CB    1 
ATOM   8977  C  CG    . GLU C 2  693  ? 480.907 1.896   701.602 1.00 74.59  ? 693  GLU C CG    1 
ATOM   8978  C  CD    . GLU C 2  693  ? 482.183 2.446   702.241 1.00 82.96  ? 693  GLU C CD    1 
ATOM   8979  O  OE1   . GLU C 2  693  ? 483.185 1.682   702.321 1.00 87.42  ? 693  GLU C OE1   1 
ATOM   8980  O  OE2   . GLU C 2  693  ? 482.203 3.647   702.609 1.00 79.56  ? 693  GLU C OE2   1 
ATOM   8981  N  N     . LEU C 2  694  ? 482.108 0.820   697.199 1.00 77.35  ? 694  LEU C N     1 
ATOM   8982  C  CA    . LEU C 2  694  ? 482.794 0.035   696.172 1.00 77.20  ? 694  LEU C CA    1 
ATOM   8983  C  C     . LEU C 2  694  ? 484.002 0.771   695.573 1.00 75.96  ? 694  LEU C C     1 
ATOM   8984  O  O     . LEU C 2  694  ? 485.083 0.189   695.437 1.00 78.15  ? 694  LEU C O     1 
ATOM   8985  C  CB    . LEU C 2  694  ? 481.778 -0.365  695.089 1.00 74.71  ? 694  LEU C CB    1 
ATOM   8986  C  CG    . LEU C 2  694  ? 480.775 -1.488  695.430 1.00 70.10  ? 694  LEU C CG    1 
ATOM   8987  C  CD1   . LEU C 2  694  ? 479.888 -1.830  694.250 1.00 63.87  ? 694  LEU C CD1   1 
ATOM   8988  C  CD2   . LEU C 2  694  ? 481.499 -2.745  695.908 1.00 70.63  ? 694  LEU C CD2   1 
ATOM   8989  N  N     . LEU C 2  695  ? 483.853 2.052   695.219 1.00 75.39  ? 695  LEU C N     1 
ATOM   8990  C  CA    . LEU C 2  695  ? 484.998 2.809   694.697 1.00 76.86  ? 695  LEU C CA    1 
ATOM   8991  C  C     . LEU C 2  695  ? 486.055 3.024   695.791 1.00 79.60  ? 695  LEU C C     1 
ATOM   8992  O  O     . LEU C 2  695  ? 487.260 2.972   695.526 1.00 87.38  ? 695  LEU C O     1 
ATOM   8993  C  CB    . LEU C 2  695  ? 484.558 4.159   694.103 1.00 71.97  ? 695  LEU C CB    1 
ATOM   8994  C  CG    . LEU C 2  695  ? 483.316 4.298   693.189 1.00 65.96  ? 695  LEU C CG    1 
ATOM   8995  C  CD1   . LEU C 2  695  ? 483.265 5.624   692.430 1.00 66.87  ? 695  LEU C CD1   1 
ATOM   8996  C  CD2   . LEU C 2  695  ? 482.963 3.127   692.300 1.00 66.19  ? 695  LEU C CD2   1 
ATOM   8997  N  N     . LYS C 2  696  ? 485.616 3.373   697.002 1.00 79.75  ? 696  LYS C N     1 
ATOM   8998  C  CA    . LYS C 2  696  ? 486.515 3.611   698.132 1.00 84.47  ? 696  LYS C CA    1 
ATOM   8999  C  C     . LYS C 2  696  ? 487.507 2.460   698.337 1.00 83.39  ? 696  LYS C C     1 
ATOM   9000  O  O     . LYS C 2  696  ? 488.701 2.683   698.558 1.00 83.07  ? 696  LYS C O     1 
ATOM   9001  C  CB    . LYS C 2  696  ? 485.662 3.806   699.403 1.00 85.45  ? 696  LYS C CB    1 
ATOM   9002  C  CG    . LYS C 2  696  ? 484.939 5.183   699.542 1.00 85.26  ? 696  LYS C CG    1 
ATOM   9003  C  CD    . LYS C 2  696  ? 483.904 5.178   700.678 1.00 80.59  ? 696  LYS C CD    1 
ATOM   9004  C  CE    . LYS C 2  696  ? 483.045 6.455   700.711 1.00 81.25  ? 696  LYS C CE    1 
ATOM   9005  N  NZ    . LYS C 2  696  ? 482.008 6.493   701.824 1.00 78.33  ? 696  LYS C NZ    1 
ATOM   9006  N  N     . ARG C 2  697  ? 487.024 1.217   698.280 1.00 81.92  ? 697  ARG C N     1 
ATOM   9007  C  CA    . ARG C 2  697  ? 487.864 0.039   698.461 1.00 81.49  ? 697  ARG C CA    1 
ATOM   9008  C  C     . ARG C 2  697  ? 488.359 -0.565  697.140 1.00 82.42  ? 697  ARG C C     1 
ATOM   9009  O  O     . ARG C 2  697  ? 488.824 -1.715  697.125 1.00 81.25  ? 697  ARG C O     1 
ATOM   9010  C  CB    . ARG C 2  697  ? 487.143 -1.000  699.334 1.00 84.79  ? 697  ARG C CB    1 
ATOM   9011  C  CG    . ARG C 2  697  ? 485.993 -1.827  698.760 1.00 84.37  ? 697  ARG C CG    1 
ATOM   9012  C  CD    . ARG C 2  697  ? 485.567 -2.762  699.894 1.00 83.06  ? 697  ARG C CD    1 
ATOM   9013  N  NE    . ARG C 2  697  ? 484.469 -3.692  699.634 1.00 83.21  ? 697  ARG C NE    1 
ATOM   9014  C  CZ    . ARG C 2  697  ? 483.181 -3.378  699.787 1.00 87.04  ? 697  ARG C CZ    1 
ATOM   9015  N  NH1   . ARG C 2  697  ? 482.828 -2.147  700.165 1.00 81.14  ? 697  ARG C NH1   1 
ATOM   9016  N  NH2   . ARG C 2  697  ? 482.244 -4.297  699.588 1.00 86.84  ? 697  ARG C NH2   1 
ATOM   9017  N  N     . ASP C 2  698  ? 488.163 0.143   696.021 1.00 87.61  ? 698  ASP C N     1 
ATOM   9018  C  CA    . ASP C 2  698  ? 488.694 -0.196  694.682 1.00 86.76  ? 698  ASP C CA    1 
ATOM   9019  C  C     . ASP C 2  698  ? 488.119 -1.495  694.107 1.00 85.61  ? 698  ASP C C     1 
ATOM   9020  O  O     . ASP C 2  698  ? 488.791 -2.198  693.344 1.00 86.00  ? 698  ASP C O     1 
ATOM   9021  C  CB    . ASP C 2  698  ? 490.231 -0.240  694.668 1.00 82.32  ? 698  ASP C CB    1 
ATOM   9022  C  CG    . ASP C 2  698  ? 490.852 1.067   694.155 1.00 92.19  ? 698  ASP C CG    1 
ATOM   9023  O  OD1   . ASP C 2  698  ? 490.321 1.673   693.178 1.00 90.04  ? 698  ASP C OD1   1 
ATOM   9024  O  OD2   . ASP C 2  698  ? 491.865 1.500   694.757 1.00 94.41  ? 698  ASP C OD2   1 
ATOM   9025  N  N     . PHE C 2  699  ? 486.869 -1.813  694.428 1.00 84.10  ? 699  PHE C N     1 
ATOM   9026  C  CA    . PHE C 2  699  ? 486.174 -2.868  693.718 1.00 77.36  ? 699  PHE C CA    1 
ATOM   9027  C  C     . PHE C 2  699  ? 485.751 -2.317  692.363 1.00 83.60  ? 699  PHE C C     1 
ATOM   9028  O  O     . PHE C 2  699  ? 485.492 -1.116  692.210 1.00 82.95  ? 699  PHE C O     1 
ATOM   9029  C  CB    . PHE C 2  699  ? 484.963 -3.369  694.512 1.00 74.70  ? 699  PHE C CB    1 
ATOM   9030  C  CG    . PHE C 2  699  ? 485.279 -4.504  695.477 1.00 80.81  ? 699  PHE C CG    1 
ATOM   9031  C  CD1   . PHE C 2  699  ? 486.489 -4.547  696.167 1.00 78.28  ? 699  PHE C CD1   1 
ATOM   9032  C  CD2   . PHE C 2  699  ? 484.349 -5.517  695.712 1.00 80.75  ? 699  PHE C CD2   1 
ATOM   9033  C  CE1   . PHE C 2  699  ? 486.774 -5.589  697.038 1.00 74.46  ? 699  PHE C CE1   1 
ATOM   9034  C  CE2   . PHE C 2  699  ? 484.630 -6.563  696.589 1.00 76.26  ? 699  PHE C CE2   1 
ATOM   9035  C  CZ    . PHE C 2  699  ? 485.846 -6.600  697.244 1.00 74.97  ? 699  PHE C CZ    1 
ATOM   9036  N  N     . TYR C 2  700  ? 485.769 -3.186  691.355 1.00 83.41  ? 700  TYR C N     1 
ATOM   9037  C  CA    . TYR C 2  700  ? 485.383 -2.821  689.996 1.00 77.82  ? 700  TYR C CA    1 
ATOM   9038  C  C     . TYR C 2  700  ? 486.300 -1.754  689.399 1.00 83.89  ? 700  TYR C C     1 
ATOM   9039  O  O     . TYR C 2  700  ? 485.838 -0.846  688.707 1.00 86.25  ? 700  TYR C O     1 
ATOM   9040  C  CB    . TYR C 2  700  ? 483.895 -2.432  689.889 1.00 69.53  ? 700  TYR C CB    1 
ATOM   9041  C  CG    . TYR C 2  700  ? 483.073 -3.644  690.243 1.00 69.97  ? 700  TYR C CG    1 
ATOM   9042  C  CD1   . TYR C 2  700  ? 483.001 -4.713  689.378 1.00 71.36  ? 700  TYR C CD1   1 
ATOM   9043  C  CD2   . TYR C 2  700  ? 482.328 -3.710  691.416 1.00 74.86  ? 700  TYR C CD2   1 
ATOM   9044  C  CE1   . TYR C 2  700  ? 482.274 -5.860  689.685 1.00 71.64  ? 700  TYR C CE1   1 
ATOM   9045  C  CE2   . TYR C 2  700  ? 481.574 -4.857  691.735 1.00 73.64  ? 700  TYR C CE2   1 
ATOM   9046  C  CZ    . TYR C 2  700  ? 481.556 -5.930  690.856 1.00 73.96  ? 700  TYR C CZ    1 
ATOM   9047  O  OH    . TYR C 2  700  ? 480.841 -7.082  691.128 1.00 67.84  ? 700  TYR C OH    1 
ATOM   9048  N  N     . THR C 2  701  ? 487.547 -1.693  689.850 1.00 84.09  ? 701  THR C N     1 
ATOM   9049  C  CA    . THR C 2  701  ? 488.574 -0.901  689.180 1.00 82.19  ? 701  THR C CA    1 
ATOM   9050  C  C     . THR C 2  701  ? 489.440 -1.804  688.295 1.00 84.25  ? 701  THR C C     1 
ATOM   9051  O  O     . THR C 2  701  ? 489.796 -2.926  688.671 1.00 82.59  ? 701  THR C O     1 
ATOM   9052  C  CB    . THR C 2  701  ? 489.416 -0.095  690.153 1.00 83.92  ? 701  THR C CB    1 
ATOM   9053  O  OG1   . THR C 2  701  ? 488.561 0.854   690.820 1.00 91.10  ? 701  THR C OG1   1 
ATOM   9054  C  CG2   . THR C 2  701  ? 490.544 0.608   689.406 1.00 81.41  ? 701  THR C CG2   1 
ATOM   9055  N  N     . SER C 2  702  ? 489.705 -1.347  687.083 1.00 82.93  ? 702  SER C N     1 
ATOM   9056  C  CA    . SER C 2  702  ? 490.430 -2.137  686.105 1.00 79.87  ? 702  SER C CA    1 
ATOM   9057  C  C     . SER C 2  702  ? 491.434 -1.242  685.393 1.00 82.10  ? 702  SER C C     1 
ATOM   9058  O  O     . SER C 2  702  ? 491.196 -0.040  685.225 1.00 81.24  ? 702  SER C O     1 
ATOM   9059  C  CB    . SER C 2  702  ? 489.440 -2.791  685.171 1.00 78.52  ? 702  SER C CB    1 
ATOM   9060  O  OG    . SER C 2  702  ? 488.631 -1.787  684.593 1.00 78.80  ? 702  SER C OG    1 
ATOM   9061  N  N     . ILE C 2  703  ? 492.599 -1.822  685.038 1.00 80.75  ? 703  ILE C N     1 
ATOM   9062  C  CA    . ILE C 2  703  ? 493.641 -1.095  684.308 1.00 82.08  ? 703  ILE C CA    1 
ATOM   9063  C  C     . ILE C 2  703  ? 493.486 -1.291  682.808 1.00 80.50  ? 703  ILE C C     1 
ATOM   9064  O  O     . ILE C 2  703  ? 493.310 -2.414  682.323 1.00 79.65  ? 703  ILE C O     1 
ATOM   9065  C  CB    . ILE C 2  703  ? 495.035 -1.561  684.746 1.00 78.50  ? 703  ILE C CB    1 
ATOM   9066  C  CG1   . ILE C 2  703  ? 495.213 -1.401  686.232 1.00 77.80  ? 703  ILE C CG1   1 
ATOM   9067  C  CG2   . ILE C 2  703  ? 496.086 -0.735  684.061 1.00 77.94  ? 703  ILE C CG2   1 
ATOM   9068  C  CD1   . ILE C 2  703  ? 496.600 -1.754  686.627 1.00 86.64  ? 703  ILE C CD1   1 
ATOM   9069  N  N     . HIS C 2  704  ? 493.614 -0.200  682.061 1.00 80.37  ? 704  HIS C N     1 
ATOM   9070  C  CA    . HIS C 2  704  ? 493.435 -0.259  680.623 1.00 82.12  ? 704  HIS C CA    1 
ATOM   9071  C  C     . HIS C 2  704  ? 494.546 0.526   679.934 1.00 81.99  ? 704  HIS C C     1 
ATOM   9072  O  O     . HIS C 2  704  ? 494.929 1.596   680.414 1.00 82.99  ? 704  HIS C O     1 
ATOM   9073  C  CB    . HIS C 2  704  ? 492.050 0.285   680.255 1.00 84.03  ? 704  HIS C CB    1 
ATOM   9074  C  CG    . HIS C 2  704  ? 490.933 -0.529  680.830 1.00 79.42  ? 704  HIS C CG    1 
ATOM   9075  N  ND1   . HIS C 2  704  ? 490.257 -1.490  680.112 1.00 80.52  ? 704  HIS C ND1   1 
ATOM   9076  C  CD2   . HIS C 2  704  ? 490.343 -0.486  682.047 1.00 82.59  ? 704  HIS C CD2   1 
ATOM   9077  C  CE1   . HIS C 2  704  ? 489.323 -2.032  680.874 1.00 77.23  ? 704  HIS C CE1   1 
ATOM   9078  N  NE2   . HIS C 2  704  ? 489.343 -1.428  682.047 1.00 80.40  ? 704  HIS C NE2   1 
ATOM   9079  N  N     . ILE C 2  705  ? 495.062 0.010   678.813 1.00 86.50  ? 705  ILE C N     1 
ATOM   9080  C  CA    . ILE C 2  705  ? 496.153 0.661   678.085 1.00 85.45  ? 705  ILE C CA    1 
ATOM   9081  C  C     . ILE C 2  705  ? 495.722 0.893   676.637 1.00 86.87  ? 705  ILE C C     1 
ATOM   9082  O  O     . ILE C 2  705  ? 495.212 -0.025  675.983 1.00 87.12  ? 705  ILE C O     1 
ATOM   9083  C  CB    . ILE C 2  705  ? 497.420 -0.206  678.103 1.00 78.80  ? 705  ILE C CB    1 
ATOM   9084  C  CG1   . ILE C 2  705  ? 497.668 -0.772  679.491 1.00 81.53  ? 705  ILE C CG1   1 
ATOM   9085  C  CG2   . ILE C 2  705  ? 498.600 0.645   677.781 1.00 82.22  ? 705  ILE C CG2   1 
ATOM   9086  C  CD1   . ILE C 2  705  ? 498.653 -1.909  679.483 1.00 82.41  ? 705  ILE C CD1   1 
ATOM   9087  N  N     . GLU C 2  706  ? 495.930 2.113   676.132 1.00 84.96  ? 706  GLU C N     1 
ATOM   9088  C  CA    . GLU C 2  706  ? 495.652 2.435   674.738 1.00 89.16  ? 706  GLU C CA    1 
ATOM   9089  C  C     . GLU C 2  706  ? 497.009 2.709   674.097 1.00 88.94  ? 706  GLU C C     1 
ATOM   9090  O  O     . GLU C 2  706  ? 497.845 3.387   674.701 1.00 85.16  ? 706  GLU C O     1 
ATOM   9091  C  CB    . GLU C 2  706  ? 494.718 3.652   674.614 1.00 95.59  ? 706  GLU C CB    1 
ATOM   9092  C  CG    . GLU C 2  706  ? 493.996 3.849   673.247 1.00 96.40  ? 706  GLU C CG    1 
ATOM   9093  C  CD    . GLU C 2  706  ? 493.377 2.555   672.673 1.00 105.38 ? 706  GLU C CD    1 
ATOM   9094  O  OE1   . GLU C 2  706  ? 492.617 1.870   673.410 1.00 104.77 ? 706  GLU C OE1   1 
ATOM   9095  O  OE2   . GLU C 2  706  ? 493.642 2.224   671.489 1.00 108.57 ? 706  GLU C OE2   1 
ATOM   9096  N  N     . ARG C 2  707  ? 497.188 2.287   672.841 1.00 91.69  ? 707  ARG C N     1 
ATOM   9097  C  CA    . ARG C 2  707  ? 498.453 2.418   672.102 1.00 90.32  ? 707  ARG C CA    1 
ATOM   9098  C  C     . ARG C 2  707  ? 498.402 3.550   671.069 1.00 88.72  ? 707  ARG C C     1 
ATOM   9099  O  O     . ARG C 2  707  ? 497.493 3.599   670.226 1.00 90.26  ? 707  ARG C O     1 
ATOM   9100  C  CB    . ARG C 2  707  ? 498.771 1.087   671.413 1.00 85.64  ? 707  ARG C CB    1 
ATOM   9101  C  CG    . ARG C 2  707  ? 499.987 1.051   670.526 1.00 91.08  ? 707  ARG C CG    1 
ATOM   9102  C  CD    . ARG C 2  707  ? 500.170 -0.365  669.985 1.00 97.00  ? 707  ARG C CD    1 
ATOM   9103  N  NE    . ARG C 2  707  ? 500.407 -0.336  668.539 1.00 99.56  ? 707  ARG C NE    1 
ATOM   9104  C  CZ    . ARG C 2  707  ? 500.774 -1.386  667.817 1.00 101.31 ? 707  ARG C CZ    1 
ATOM   9105  N  NH1   . ARG C 2  707  ? 500.956 -2.552  668.417 1.00 103.96 ? 707  ARG C NH1   1 
ATOM   9106  N  NH2   . ARG C 2  707  ? 500.945 -1.276  666.499 1.00 102.66 ? 707  ARG C NH2   1 
ATOM   9107  N  N     . TYR C 2  708  ? 499.413 4.423   671.093 1.00 81.26  ? 708  TYR C N     1 
ATOM   9108  C  CA    . TYR C 2  708  ? 499.513 5.518   670.134 1.00 85.68  ? 708  TYR C CA    1 
ATOM   9109  C  C     . TYR C 2  708  ? 500.769 5.316   669.285 1.00 91.80  ? 708  TYR C C     1 
ATOM   9110  O  O     . TYR C 2  708  ? 501.793 4.852   669.792 1.00 94.30  ? 708  TYR C O     1 
ATOM   9111  C  CB    . TYR C 2  708  ? 499.541 6.833   670.929 1.00 84.62  ? 708  TYR C CB    1 
ATOM   9112  C  CG    . TYR C 2  708  ? 498.247 7.021   671.730 1.00 85.32  ? 708  TYR C CG    1 
ATOM   9113  C  CD1   . TYR C 2  708  ? 498.102 6.429   672.985 1.00 89.59  ? 708  TYR C CD1   1 
ATOM   9114  C  CD2   . TYR C 2  708  ? 497.194 7.794   671.255 1.00 78.60  ? 708  TYR C CD2   1 
ATOM   9115  C  CE1   . TYR C 2  708  ? 496.941 6.570   673.724 1.00 85.15  ? 708  TYR C CE1   1 
ATOM   9116  C  CE2   . TYR C 2  708  ? 496.030 7.952   671.988 1.00 76.20  ? 708  TYR C CE2   1 
ATOM   9117  C  CZ    . TYR C 2  708  ? 495.908 7.336   673.222 1.00 89.09  ? 708  TYR C CZ    1 
ATOM   9118  O  OH    . TYR C 2  708  ? 494.750 7.470   673.975 1.00 99.04  ? 708  TYR C OH    1 
ATOM   9119  N  N     . GLU C 2  709  ? 500.708 5.664   667.996 1.00 90.10  ? 709  GLU C N     1 
ATOM   9120  C  CA    . GLU C 2  709  ? 501.815 5.391   667.078 1.00 83.37  ? 709  GLU C CA    1 
ATOM   9121  C  C     . GLU C 2  709  ? 501.949 6.564   666.122 1.00 84.44  ? 709  GLU C C     1 
ATOM   9122  O  O     . GLU C 2  709  ? 500.954 7.188   665.754 1.00 87.63  ? 709  GLU C O     1 
ATOM   9123  C  CB    . GLU C 2  709  ? 501.588 4.019   666.349 1.00 83.00  ? 709  GLU C CB    1 
ATOM   9124  C  CG    . GLU C 2  709  ? 502.774 3.419   665.538 1.00 91.91  ? 709  GLU C CG    1 
ATOM   9125  C  CD    . GLU C 2  709  ? 502.490 2.026   664.865 1.00 102.81 ? 709  GLU C CD    1 
ATOM   9126  O  OE1   . GLU C 2  709  ? 501.506 1.899   664.099 1.00 113.80 ? 709  GLU C OE1   1 
ATOM   9127  O  OE2   . GLU C 2  709  ? 503.296 1.064   665.058 1.00 93.22  ? 709  GLU C OE2   1 
ATOM   9128  N  N     . ILE C 2  710  ? 503.180 6.879   665.732 1.00 89.45  ? 710  ILE C N     1 
ATOM   9129  C  CA    . ILE C 2  710  ? 503.407 7.906   664.711 1.00 91.68  ? 710  ILE C CA    1 
ATOM   9130  C  C     . ILE C 2  710  ? 504.682 7.573   663.939 1.00 91.35  ? 710  ILE C C     1 
ATOM   9131  O  O     . ILE C 2  710  ? 505.650 7.050   664.505 1.00 90.21  ? 710  ILE C O     1 
ATOM   9132  C  CB    . ILE C 2  710  ? 503.458 9.320   665.332 1.00 83.25  ? 710  ILE C CB    1 
ATOM   9133  C  CG1   . ILE C 2  710  ? 503.594 10.393  664.259 1.00 80.08  ? 710  ILE C CG1   1 
ATOM   9134  C  CG2   . ILE C 2  710  ? 504.621 9.438   666.286 1.00 91.05  ? 710  ILE C CG2   1 
ATOM   9135  C  CD1   . ILE C 2  710  ? 503.386 11.781  664.795 1.00 81.59  ? 710  ILE C CD1   1 
ATOM   9136  N  N     . GLU C 2  711  ? 504.646 7.823   662.622 1.00 97.22  ? 711  GLU C N     1 
ATOM   9137  C  CA    . GLU C 2  711  ? 505.765 7.630   661.692 1.00 96.11  ? 711  GLU C CA    1 
ATOM   9138  C  C     . GLU C 2  711  ? 506.299 8.982   661.223 1.00 94.11  ? 711  GLU C C     1 
ATOM   9139  O  O     . GLU C 2  711  ? 505.535 9.931   661.021 1.00 101.71 ? 711  GLU C O     1 
ATOM   9140  C  CB    . GLU C 2  711  ? 505.342 6.793   660.473 1.00 89.68  ? 711  GLU C CB    1 
ATOM   9141  C  CG    . GLU C 2  711  ? 504.993 5.351   660.802 1.00 94.13  ? 711  GLU C CG    1 
ATOM   9142  C  CD    . GLU C 2  711  ? 504.490 4.549   659.605 1.00 100.23 ? 711  GLU C CD    1 
ATOM   9143  O  OE1   . GLU C 2  711  ? 504.090 5.161   658.579 1.00 101.19 ? 711  GLU C OE1   1 
ATOM   9144  O  OE2   . GLU C 2  711  ? 504.508 3.297   659.699 1.00 101.51 ? 711  GLU C OE2   1 
ATOM   9145  N  N     . ALA C 2  712  ? 507.605 9.080   661.057 1.00 89.62  ? 712  ALA C N     1 
ATOM   9146  C  CA    . ALA C 2  712  ? 508.211 10.225  660.388 1.00 103.83 ? 712  ALA C CA    1 
ATOM   9147  C  C     . ALA C 2  712  ? 508.793 9.724   659.072 1.00 108.27 ? 712  ALA C C     1 
ATOM   9148  O  O     . ALA C 2  712  ? 509.671 8.852   659.073 1.00 108.20 ? 712  ALA C O     1 
ATOM   9149  C  CB    . ALA C 2  712  ? 509.290 10.872  661.250 1.00 110.93 ? 712  ALA C CB    1 
ATOM   9150  N  N     . ARG C 2  713  ? 508.338 10.287  657.954 1.00 104.64 ? 713  ARG C N     1 
ATOM   9151  C  CA    . ARG C 2  713  ? 508.703 9.708   656.671 1.00 109.58 ? 713  ARG C CA    1 
ATOM   9152  C  C     . ARG C 2  713  ? 509.317 10.750  655.732 1.00 113.42 ? 713  ARG C C     1 
ATOM   9153  O  O     . ARG C 2  713  ? 509.136 11.962  655.892 1.00 113.74 ? 713  ARG C O     1 
ATOM   9154  C  CB    . ARG C 2  713  ? 507.453 9.077   656.036 1.00 110.19 ? 713  ARG C CB    1 
ATOM   9155  C  CG    . ARG C 2  713  ? 506.489 10.134  655.505 1.00 112.16 ? 713  ARG C CG    1 
ATOM   9156  C  CD    . ARG C 2  713  ? 505.355 9.547   654.682 1.00 118.19 ? 713  ARG C CD    1 
ATOM   9157  N  NE    . ARG C 2  713  ? 504.471 10.598  654.162 1.00 122.97 ? 713  ARG C NE    1 
ATOM   9158  C  CZ    . ARG C 2  713  ? 504.458 11.016  652.889 1.00 117.30 ? 713  ARG C CZ    1 
ATOM   9159  N  NH1   . ARG C 2  713  ? 505.277 10.472  651.982 1.00 109.21 ? 713  ARG C NH1   1 
ATOM   9160  N  NH2   . ARG C 2  713  ? 503.619 11.979  652.520 1.00 110.97 ? 713  ARG C NH2   1 
ATOM   9161  N  N     . ASP C 2  714  ? 510.024 10.250  654.713 1.00 111.03 ? 714  ASP C N     1 
ATOM   9162  C  CA    . ASP C 2  714  ? 510.559 11.103  653.663 1.00 106.08 ? 714  ASP C CA    1 
ATOM   9163  C  C     . ASP C 2  714  ? 509.449 11.526  652.707 1.00 106.66 ? 714  ASP C C     1 
ATOM   9164  O  O     . ASP C 2  714  ? 508.681 10.689  652.220 1.00 103.77 ? 714  ASP C O     1 
ATOM   9165  C  CB    . ASP C 2  714  ? 511.661 10.328  652.935 1.00 107.16 ? 714  ASP C CB    1 
ATOM   9166  C  CG    . ASP C 2  714  ? 512.978 10.273  653.735 1.00 108.67 ? 714  ASP C CG    1 
ATOM   9167  O  OD1   . ASP C 2  714  ? 513.437 11.326  654.239 1.00 113.27 ? 714  ASP C OD1   1 
ATOM   9168  O  OD2   . ASP C 2  714  ? 513.521 9.152   653.909 1.00 99.21  ? 714  ASP C OD2   1 
ATOM   9169  N  N     . THR C 2  715  ? 509.421 12.814  652.377 1.00 111.41 ? 715  THR C N     1 
ATOM   9170  C  CA    . THR C 2  715  ? 508.479 13.395  651.430 1.00 110.16 ? 715  THR C CA    1 
ATOM   9171  C  C     . THR C 2  715  ? 509.265 14.090  650.338 1.00 111.35 ? 715  THR C C     1 
ATOM   9172  O  O     . THR C 2  715  ? 510.457 14.373  650.503 1.00 112.36 ? 715  THR C O     1 
ATOM   9173  C  CB    . THR C 2  715  ? 507.517 14.416  652.058 1.00 111.11 ? 715  THR C CB    1 
ATOM   9174  O  OG1   . THR C 2  715  ? 508.261 15.391  652.798 1.00 111.31 ? 715  THR C OG1   1 
ATOM   9175  C  CG2   . THR C 2  715  ? 506.506 13.731  652.967 1.00 113.35 ? 715  THR C CG2   1 
ATOM   9176  N  N     . LYS C 2  716  ? 508.570 14.401  649.234 1.00 112.28 ? 716  LYS C N     1 
ATOM   9177  C  CA    . LYS C 2  716  ? 509.209 15.149  648.157 1.00 109.02 ? 716  LYS C CA    1 
ATOM   9178  C  C     . LYS C 2  716  ? 509.526 16.584  648.569 1.00 110.21 ? 716  LYS C C     1 
ATOM   9179  O  O     . LYS C 2  716  ? 510.270 17.271  647.859 1.00 113.41 ? 716  LYS C O     1 
ATOM   9180  C  CB    . LYS C 2  716  ? 508.294 15.178  646.932 1.00 101.85 ? 716  LYS C CB    1 
ATOM   9181  C  CG    . LYS C 2  716  ? 507.933 13.803  646.465 1.00 100.67 ? 716  LYS C CG    1 
ATOM   9182  C  CD    . LYS C 2  716  ? 507.374 13.761  645.072 1.00 92.50  ? 716  LYS C CD    1 
ATOM   9183  C  CE    . LYS C 2  716  ? 507.364 12.295  644.659 1.00 95.77  ? 716  LYS C CE    1 
ATOM   9184  N  NZ    . LYS C 2  716  ? 508.719 11.671  644.691 1.00 99.89  ? 716  LYS C NZ    1 
ATOM   9185  N  N     . LEU C 2  717  ? 508.953 17.055  649.675 1.00 107.63 ? 717  LEU C N     1 
ATOM   9186  C  CA    . LEU C 2  717  ? 509.175 18.393  650.204 1.00 104.30 ? 717  LEU C CA    1 
ATOM   9187  C  C     . LEU C 2  717  ? 510.235 18.419  651.309 1.00 106.17 ? 717  LEU C C     1 
ATOM   9188  O  O     . LEU C 2  717  ? 510.510 19.494  651.863 1.00 100.30 ? 717  LEU C O     1 
ATOM   9189  C  CB    . LEU C 2  717  ? 507.854 18.992  650.696 1.00 106.78 ? 717  LEU C CB    1 
ATOM   9190  C  CG    . LEU C 2  717  ? 506.872 19.540  649.653 1.00 99.93  ? 717  LEU C CG    1 
ATOM   9191  C  CD1   . LEU C 2  717  ? 506.843 18.699  648.384 1.00 95.92  ? 717  LEU C CD1   1 
ATOM   9192  C  CD2   . LEU C 2  717  ? 505.463 19.659  650.244 1.00 104.69 ? 717  LEU C CD2   1 
ATOM   9193  N  N     . GLY C 2  718  ? 510.838 17.263  651.630 1.00 107.69 ? 718  GLY C N     1 
ATOM   9194  C  CA    . GLY C 2  718  ? 511.760 17.104  652.741 1.00 109.67 ? 718  GLY C CA    1 
ATOM   9195  C  C     . GLY C 2  718  ? 511.292 16.244  653.912 1.00 112.24 ? 718  GLY C C     1 
ATOM   9196  O  O     . GLY C 2  718  ? 510.113 15.901  654.048 1.00 113.92 ? 718  GLY C O     1 
ATOM   9197  N  N     . PRO C 2  719  ? 512.243 15.873  654.780 1.00 108.88 ? 719  PRO C N     1 
ATOM   9198  C  CA    . PRO C 2  719  ? 511.961 14.885  655.829 1.00 106.75 ? 719  PRO C CA    1 
ATOM   9199  C  C     . PRO C 2  719  ? 511.035 15.396  656.928 1.00 108.21 ? 719  PRO C C     1 
ATOM   9200  O  O     . PRO C 2  719  ? 511.132 16.545  657.371 1.00 105.46 ? 719  PRO C O     1 
ATOM   9201  C  CB    . PRO C 2  719  ? 513.356 14.561  656.383 1.00 103.14 ? 719  PRO C CB    1 
ATOM   9202  C  CG    . PRO C 2  719  ? 514.106 15.819  656.195 1.00 100.15 ? 719  PRO C CG    1 
ATOM   9203  C  CD    . PRO C 2  719  ? 513.629 16.366  654.876 1.00 103.92 ? 719  PRO C CD    1 
ATOM   9204  N  N     . GLU C 2  720  ? 510.095 14.540  657.332 1.00 110.90 ? 720  GLU C N     1 
ATOM   9205  C  CA    . GLU C 2  720  ? 509.433 14.726  658.618 1.00 105.33 ? 720  GLU C CA    1 
ATOM   9206  C  C     . GLU C 2  720  ? 510.469 14.433  659.698 1.00 104.15 ? 720  GLU C C     1 
ATOM   9207  O  O     . GLU C 2  720  ? 511.211 13.447  659.622 1.00 102.45 ? 720  GLU C O     1 
ATOM   9208  C  CB    . GLU C 2  720  ? 508.239 13.773  658.750 1.00 99.32  ? 720  GLU C CB    1 
ATOM   9209  C  CG    . GLU C 2  720  ? 507.040 14.137  657.857 1.00 107.56 ? 720  GLU C CG    1 
ATOM   9210  C  CD    . GLU C 2  720  ? 505.877 13.113  657.892 1.00 111.22 ? 720  GLU C CD    1 
ATOM   9211  O  OE1   . GLU C 2  720  ? 506.089 11.944  658.314 1.00 106.88 ? 720  GLU C OE1   1 
ATOM   9212  O  OE2   . GLU C 2  720  ? 504.757 13.471  657.440 1.00 108.51 ? 720  GLU C OE2   1 
ATOM   9213  N  N     . ARG C 2  721  ? 510.516 15.270  660.720 1.00 104.71 ? 721  ARG C N     1 
ATOM   9214  C  CA    . ARG C 2  721  ? 511.482 15.047  661.779 1.00 104.46 ? 721  ARG C CA    1 
ATOM   9215  C  C     . ARG C 2  721  ? 510.791 15.033  663.129 1.00 107.88 ? 721  ARG C C     1 
ATOM   9216  O  O     . ARG C 2  721  ? 509.971 15.907  663.433 1.00 104.87 ? 721  ARG C O     1 
ATOM   9217  C  CB    . ARG C 2  721  ? 512.507 16.144  661.743 1.00 105.36 ? 721  ARG C CB    1 
ATOM   9218  C  CG    . ARG C 2  721  ? 513.444 16.060  660.566 1.00 111.10 ? 721  ARG C CG    1 
ATOM   9219  C  CD    . ARG C 2  721  ? 514.479 17.145  660.714 1.00 119.26 ? 721  ARG C CD    1 
ATOM   9220  N  NE    . ARG C 2  721  ? 513.986 18.309  659.969 1.00 123.77 ? 721  ARG C NE    1 
ATOM   9221  C  CZ    . ARG C 2  721  ? 513.237 19.279  660.512 1.00 123.93 ? 721  ARG C CZ    1 
ATOM   9222  N  NH1   . ARG C 2  721  ? 512.892 19.238  661.806 1.00 115.97 ? 721  ARG C NH1   1 
ATOM   9223  N  NH2   . ARG C 2  721  ? 512.814 20.292  659.762 1.00 120.42 ? 721  ARG C NH2   1 
ATOM   9224  N  N     . ILE C 2  722  ? 511.181 14.074  663.958 1.00 107.09 ? 722  ILE C N     1 
ATOM   9225  C  CA    . ILE C 2  722  ? 510.703 13.989  665.327 1.00 103.04 ? 722  ILE C CA    1 
ATOM   9226  C  C     . ILE C 2  722  ? 511.679 14.725  666.235 1.00 106.53 ? 722  ILE C C     1 
ATOM   9227  O  O     . ILE C 2  722  ? 512.807 14.281  666.479 1.00 107.02 ? 722  ILE C O     1 
ATOM   9228  C  CB    . ILE C 2  722  ? 510.481 12.535  665.740 1.00 101.81 ? 722  ILE C CB    1 
ATOM   9229  C  CG1   . ILE C 2  722  ? 509.166 12.090  665.109 1.00 98.47  ? 722  ILE C CG1   1 
ATOM   9230  C  CG2   . ILE C 2  722  ? 510.545 12.358  667.249 1.00 104.01 ? 722  ILE C CG2   1 
ATOM   9231  C  CD1   . ILE C 2  722  ? 509.030 10.639  664.979 1.00 103.71 ? 722  ILE C CD1   1 
ATOM   9232  N  N     . THR C 2  723  ? 511.223 15.854  666.755 1.00 107.84 ? 723  THR C N     1 
ATOM   9233  C  CA    . THR C 2  723  ? 512.087 16.823  667.397 1.00 111.55 ? 723  THR C CA    1 
ATOM   9234  C  C     . THR C 2  723  ? 511.337 17.467  668.551 1.00 116.21 ? 723  THR C C     1 
ATOM   9235  O  O     . THR C 2  723  ? 510.103 17.479  668.593 1.00 114.64 ? 723  THR C O     1 
ATOM   9236  C  CB    . THR C 2  723  ? 512.533 17.903  666.416 1.00 113.95 ? 723  THR C CB    1 
ATOM   9237  O  OG1   . THR C 2  723  ? 513.143 18.968  667.156 1.00 120.65 ? 723  THR C OG1   1 
ATOM   9238  C  CG2   . THR C 2  723  ? 511.334 18.435  665.604 1.00 108.57 ? 723  THR C CG2   1 
ATOM   9239  N  N     . ARG C 2  724  ? 512.099 18.004  669.494 1.00 116.24 ? 724  ARG C N     1 
ATOM   9240  C  CA    . ARG C 2  724  ? 511.489 18.751  670.582 1.00 115.19 ? 724  ARG C CA    1 
ATOM   9241  C  C     . ARG C 2  724  ? 511.199 20.198  670.186 1.00 117.12 ? 724  ARG C C     1 
ATOM   9242  O  O     . ARG C 2  724  ? 510.524 20.911  670.936 1.00 112.53 ? 724  ARG C O     1 
ATOM   9243  C  CB    . ARG C 2  724  ? 512.397 18.722  671.807 1.00 111.23 ? 724  ARG C CB    1 
ATOM   9244  C  CG    . ARG C 2  724  ? 511.690 19.058  673.064 1.00 108.97 ? 724  ARG C CG    1 
ATOM   9245  C  CD    . ARG C 2  724  ? 512.651 19.299  674.173 1.00 115.06 ? 724  ARG C CD    1 
ATOM   9246  N  NE    . ARG C 2  724  ? 511.950 19.282  675.451 1.00 120.08 ? 724  ARG C NE    1 
ATOM   9247  C  CZ    . ARG C 2  724  ? 511.250 20.299  675.935 1.00 122.94 ? 724  ARG C CZ    1 
ATOM   9248  N  NH1   . ARG C 2  724  ? 511.156 21.427  675.234 1.00 120.27 ? 724  ARG C NH1   1 
ATOM   9249  N  NH2   . ARG C 2  724  ? 510.643 20.184  677.118 1.00 121.14 ? 724  ARG C NH2   1 
ATOM   9250  N  N     . ASP C 2  725  ? 511.699 20.638  669.028 1.00 117.00 ? 725  ASP C N     1 
ATOM   9251  C  CA    . ASP C 2  725  ? 511.551 22.012  668.543 1.00 118.38 ? 725  ASP C CA    1 
ATOM   9252  C  C     . ASP C 2  725  ? 510.314 22.102  667.650 1.00 118.83 ? 725  ASP C C     1 
ATOM   9253  O  O     . ASP C 2  725  ? 510.333 21.668  666.494 1.00 117.36 ? 725  ASP C O     1 
ATOM   9254  C  CB    . ASP C 2  725  ? 512.833 22.415  667.814 1.00 118.81 ? 725  ASP C CB    1 
ATOM   9255  C  CG    . ASP C 2  725  ? 512.951 23.915  667.576 1.00 124.22 ? 725  ASP C CG    1 
ATOM   9256  O  OD1   . ASP C 2  725  ? 511.915 24.592  667.369 1.00 125.03 ? 725  ASP C OD1   1 
ATOM   9257  O  OD2   . ASP C 2  725  ? 514.101 24.416  667.620 1.00 124.50 ? 725  ASP C OD2   1 
ATOM   9258  N  N     . ILE C 2  726  ? 509.240 22.677  668.192 1.00 116.18 ? 726  ILE C N     1 
ATOM   9259  C  CA    . ILE C 2  726  ? 507.963 22.823  667.504 1.00 115.22 ? 726  ILE C CA    1 
ATOM   9260  C  C     . ILE C 2  726  ? 507.540 24.286  667.424 1.00 118.50 ? 726  ILE C C     1 
ATOM   9261  O  O     . ILE C 2  726  ? 507.370 24.940  668.459 1.00 116.83 ? 726  ILE C O     1 
ATOM   9262  C  CB    . ILE C 2  726  ? 506.866 21.980  668.178 1.00 111.79 ? 726  ILE C CB    1 
ATOM   9263  C  CG1   . ILE C 2  726  ? 507.299 20.509  668.255 1.00 108.51 ? 726  ILE C CG1   1 
ATOM   9264  C  CG2   . ILE C 2  726  ? 505.523 22.186  667.517 1.00 107.89 ? 726  ILE C CG2   1 
ATOM   9265  C  CD1   . ILE C 2  726  ? 507.564 20.001  669.639 1.00 111.70 ? 726  ILE C CD1   1 
ATOM   9266  N  N     . PRO C 2  727  ? 507.362 24.824  666.215 1.00 122.24 ? 727  PRO C N     1 
ATOM   9267  C  CA    . PRO C 2  727  ? 507.036 26.252  666.017 1.00 128.34 ? 727  PRO C CA    1 
ATOM   9268  C  C     . PRO C 2  727  ? 505.847 26.809  666.808 1.00 126.01 ? 727  PRO C C     1 
ATOM   9269  O  O     . PRO C 2  727  ? 504.773 26.204  666.884 1.00 122.99 ? 727  PRO C O     1 
ATOM   9270  C  CB    . PRO C 2  727  ? 506.812 26.350  664.501 1.00 123.60 ? 727  PRO C CB    1 
ATOM   9271  C  CG    . PRO C 2  727  ? 506.432 24.979  664.083 1.00 121.9