data_6P1A
# 
_entry.id   6P1A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6P1A         
WWPDB D_1000240789 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6P1A 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yin, Z.'       1 ? 
'Ebright, R.H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            116 
_citation.language                  ? 
_citation.page_first                18384 
_citation.page_last                 18390 
_citation.title                     'Structural basis of Q-dependent antitermination.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1909801116 
_citation.pdbx_database_id_PubMed   31455742 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yin, Z.'       1 ?                   
primary 'Kaelber, J.T.' 2 0000-0001-9426-1030 
primary 'Ebright, R.H.' 3 0000-0001-8915-7140 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6P1A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     69.573 
_cell.length_a_esd                 ? 
_cell.length_b                     263.224 
_cell.length_b_esd                 ? 
_cell.length_c                     56.770 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6P1A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Q protein'                                                                      18668.789 3 ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(P*CP*TP*CP*AP*TP*TP*GP*AP*GP*CP*AP*AP*AP*TP*GP*AP*GP*CP*AP*AP*G)-3')
;
6480.225  2 ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*CP*TP*TP*GP*CP*TP*CP*AP*TP*TP*TP*GP*CP*TP*CP*AP*AP*TP*GP*AP*G)-3')
;
6404.145  2 ? ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                   62.068    3 ? ? ? ? 
5 non-polymer syn 'CHLORIDE ION'                                                                   35.453    2 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Transcription antitermination factor Q21'    
2 'Q21-binding element DNA, nontemplate strand' 
3 'Q21-binding element DNA, template strand'    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SGIRELNLTKEQHEWLNGWLELWGAWVYSGRLEKRMSSVIAKFMESVEPGRVMTRPMCNDDDGMLISQVVDSVMYIDKKA
FGILLSYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLATCRREVDEILNASLFMIYPVLDSAFKNRKRVEKIKH
VA
;
;SGIRELNLTKEQHEWLNGWLELWGAWVYSGRLEKRMSSVIAKFMESVEPGRVMTRPMCNDDDGMLISQVVDSVMYIDKKA
FGILLSYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLATCRREVDEILNASLFMIYPVLDSAFKNRKRVEKIKH
VA
;
A,B,C ? 
2 polydeoxyribonucleotide no no 
;(DC)(DT)(DC)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DA)(DA)(DA)(DT)(DG)(DA)(DG)(DC)(DA)(DA)
(DG)
;
CTCATTGAGCAAATGAGCAAG D,F   ? 
3 polydeoxyribonucleotide no no 
;(DC)(DT)(DT)(DG)(DC)(DT)(DC)(DA)(DT)(DT)(DT)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DG)(DA)
(DG)
;
CTTGCTCATTTGCTCAATGAG E,G   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   ARG n 
1 5   GLU n 
1 6   LEU n 
1 7   ASN n 
1 8   LEU n 
1 9   THR n 
1 10  LYS n 
1 11  GLU n 
1 12  GLN n 
1 13  HIS n 
1 14  GLU n 
1 15  TRP n 
1 16  LEU n 
1 17  ASN n 
1 18  GLY n 
1 19  TRP n 
1 20  LEU n 
1 21  GLU n 
1 22  LEU n 
1 23  TRP n 
1 24  GLY n 
1 25  ALA n 
1 26  TRP n 
1 27  VAL n 
1 28  TYR n 
1 29  SER n 
1 30  GLY n 
1 31  ARG n 
1 32  LEU n 
1 33  GLU n 
1 34  LYS n 
1 35  ARG n 
1 36  MET n 
1 37  SER n 
1 38  SER n 
1 39  VAL n 
1 40  ILE n 
1 41  ALA n 
1 42  LYS n 
1 43  PHE n 
1 44  MET n 
1 45  GLU n 
1 46  SER n 
1 47  VAL n 
1 48  GLU n 
1 49  PRO n 
1 50  GLY n 
1 51  ARG n 
1 52  VAL n 
1 53  MET n 
1 54  THR n 
1 55  ARG n 
1 56  PRO n 
1 57  MET n 
1 58  CYS n 
1 59  ASN n 
1 60  ASP n 
1 61  ASP n 
1 62  ASP n 
1 63  GLY n 
1 64  MET n 
1 65  LEU n 
1 66  ILE n 
1 67  SER n 
1 68  GLN n 
1 69  VAL n 
1 70  VAL n 
1 71  ASP n 
1 72  SER n 
1 73  VAL n 
1 74  MET n 
1 75  TYR n 
1 76  ILE n 
1 77  ASP n 
1 78  LYS n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  GLY n 
1 83  ILE n 
1 84  LEU n 
1 85  LEU n 
1 86  SER n 
1 87  TYR n 
1 88  TYR n 
1 89  ALA n 
1 90  HIS n 
1 91  GLY n 
1 92  SER n 
1 93  SER n 
1 94  LYS n 
1 95  HIS n 
1 96  ALA n 
1 97  ILE n 
1 98  ALA n 
1 99  SER n 
1 100 TYR n 
1 101 TYR n 
1 102 HIS n 
1 103 ARG n 
1 104 VAL n 
1 105 ALA n 
1 106 ARG n 
1 107 PRO n 
1 108 ARG n 
1 109 LYS n 
1 110 MET n 
1 111 LEU n 
1 112 CYS n 
1 113 ARG n 
1 114 GLY n 
1 115 GLY n 
1 116 GLY n 
1 117 ARG n 
1 118 ILE n 
1 119 GLN n 
1 120 LYS n 
1 121 PRO n 
1 122 SER n 
1 123 LEU n 
1 124 ALA n 
1 125 THR n 
1 126 CYS n 
1 127 ARG n 
1 128 ARG n 
1 129 GLU n 
1 130 VAL n 
1 131 ASP n 
1 132 GLU n 
1 133 ILE n 
1 134 LEU n 
1 135 ASN n 
1 136 ALA n 
1 137 SER n 
1 138 LEU n 
1 139 PHE n 
1 140 MET n 
1 141 ILE n 
1 142 TYR n 
1 143 PRO n 
1 144 VAL n 
1 145 LEU n 
1 146 ASP n 
1 147 SER n 
1 148 ALA n 
1 149 PHE n 
1 150 LYS n 
1 151 ASN n 
1 152 ARG n 
1 153 LYS n 
1 154 ARG n 
1 155 VAL n 
1 156 GLU n 
1 157 LYS n 
1 158 ILE n 
1 159 LYS n 
1 160 HIS n 
1 161 VAL n 
1 162 ALA n 
2 1   DC  n 
2 2   DT  n 
2 3   DC  n 
2 4   DA  n 
2 5   DT  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DA  n 
2 13  DA  n 
2 14  DT  n 
2 15  DG  n 
2 16  DA  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
2 20  DA  n 
2 21  DG  n 
3 1   DC  n 
3 2   DT  n 
3 3   DT  n 
3 4   DG  n 
3 5   DC  n 
3 6   DT  n 
3 7   DC  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DT  n 
3 12  DG  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DA  n 
3 17  DA  n 
3 18  DT  n 
3 19  DG  n 
3 20  DA  n 
3 21  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   162 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Phage 21' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10743 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 21 'Phage 21' ? 10743 ? 
3 1 sample 1 21 'Phage 21' ? 10743 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q9XJQ6_9CAUD Q9XJQ6 ? 1 
;GIRELNLTKEQHEWLNGWLELWAHGLSGRLEKRMSSVIAKFMESIEPGRVMTRPMCNDDDGMLISQVVDSVMYIDKKAFG
ILLSYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLATCRREVDEILNASLFMIYPVLDSAFKNRKRVEKIKHVA

;
2 
2 PDB 6P1A         6P1A   ? 2 ? 1 
3 PDB 6P1A         6P1A   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6P1A A 2 ? 162 ? Q9XJQ6 2 ? 161 ? 2 162 
2 1 6P1A B 2 ? 162 ? Q9XJQ6 2 ? 161 ? 2 162 
3 1 6P1A C 2 ? 162 ? Q9XJQ6 2 ? 161 ? 2 162 
4 2 6P1A D 1 ? 21  ? 6P1A   1 ? 21  ? 1 21  
5 3 6P1A E 1 ? 21  ? 6P1A   1 ? 21  ? 1 21  
6 2 6P1A F 1 ? 21  ? 6P1A   1 ? 21  ? 1 21  
7 3 6P1A G 1 ? 21  ? 6P1A   1 ? 21  ? 1 21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6P1A SER A 1  ? UNP Q9XJQ6 ?   ?  'expression tag' 1  1  
1 6P1A GLY A 24 ? UNP Q9XJQ6 ?   ?  insertion        24 2  
1 6P1A TRP A 26 ? UNP Q9XJQ6 HIS 25 conflict         26 3  
1 6P1A VAL A 27 ? UNP Q9XJQ6 GLY 26 conflict         27 4  
1 6P1A TYR A 28 ? UNP Q9XJQ6 LEU 27 conflict         28 5  
1 6P1A VAL A 47 ? UNP Q9XJQ6 ILE 46 conflict         47 6  
2 6P1A SER B 1  ? UNP Q9XJQ6 ?   ?  'expression tag' 1  7  
2 6P1A GLY B 24 ? UNP Q9XJQ6 ?   ?  insertion        24 8  
2 6P1A TRP B 26 ? UNP Q9XJQ6 HIS 25 conflict         26 9  
2 6P1A VAL B 27 ? UNP Q9XJQ6 GLY 26 conflict         27 10 
2 6P1A TYR B 28 ? UNP Q9XJQ6 LEU 27 conflict         28 11 
2 6P1A VAL B 47 ? UNP Q9XJQ6 ILE 46 conflict         47 12 
3 6P1A SER C 1  ? UNP Q9XJQ6 ?   ?  'expression tag' 1  13 
3 6P1A GLY C 24 ? UNP Q9XJQ6 ?   ?  insertion        24 14 
3 6P1A TRP C 26 ? UNP Q9XJQ6 HIS 25 conflict         26 15 
3 6P1A VAL C 27 ? UNP Q9XJQ6 GLY 26 conflict         27 16 
3 6P1A TYR C 28 ? UNP Q9XJQ6 LEU 27 conflict         28 17 
3 6P1A VAL C 47 ? UNP Q9XJQ6 ILE 46 conflict         47 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ?                 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6P1A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M Sodium chloride, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3,350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 9M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-10-02 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS-II BEAMLINE 17-ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID-1 
_diffrn_source.pdbx_synchrotron_site       NSLS-II 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6P1A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8370 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       25517 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.300 
_reflns.pdbx_Rmerge_I_obs                0.077 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.864 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.084 
_reflns.pdbx_Rpim_I_all                  0.033 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.850 2.900  ? ? ? ? ? ? 1247 99.800  ? ? ? ? 0.919 ? ? ? ? ? ? ? ? 5.900 ? 0.994 ? ? 1.009 0.409 ? 1  1 0.646 ? 
2.900 2.950  ? ? ? ? ? ? 1206 98.900  ? ? ? ? 0.782 ? ? ? ? ? ? ? ? 5.800 ? 0.935 ? ? 0.860 0.352 ? 2  1 0.680 ? 
2.950 3.010  ? ? ? ? ? ? 1260 97.800  ? ? ? ? 0.632 ? ? ? ? ? ? ? ? 5.500 ? 0.986 ? ? 0.698 0.291 ? 3  1 0.774 ? 
3.010 3.070  ? ? ? ? ? ? 1222 99.200  ? ? ? ? 0.570 ? ? ? ? ? ? ? ? 5.800 ? 0.955 ? ? 0.627 0.256 ? 4  1 0.797 ? 
3.070 3.140  ? ? ? ? ? ? 1274 100.000 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 6.300 ? 0.965 ? ? 0.517 0.203 ? 5  1 0.912 ? 
3.140 3.210  ? ? ? ? ? ? 1249 99.400  ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 6.400 ? 0.922 ? ? 0.373 0.146 ? 6  1 0.956 ? 
3.210 3.290  ? ? ? ? ? ? 1242 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 6.400 ? 0.959 ? ? 0.262 0.106 ? 7  1 0.947 ? 
3.290 3.380  ? ? ? ? ? ? 1257 99.400  ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 6.400 ? 0.942 ? ? 0.233 0.096 ? 8  1 0.952 ? 
3.380 3.480  ? ? ? ? ? ? 1263 100.000 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 6.500 ? 0.879 ? ? 0.175 0.069 ? 9  1 0.954 ? 
3.480 3.590  ? ? ? ? ? ? 1270 99.700  ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 6.500 ? 0.928 ? ? 0.160 0.062 ? 10 1 0.934 ? 
3.590 3.720  ? ? ? ? ? ? 1250 99.800  ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 6.500 ? 0.835 ? ? 0.132 0.052 ? 11 1 0.932 ? 
3.720 3.870  ? ? ? ? ? ? 1288 100.000 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 6.600 ? 0.790 ? ? 0.118 0.045 ? 12 1 0.966 ? 
3.870 4.040  ? ? ? ? ? ? 1274 99.800  ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 6.700 ? 0.784 ? ? 0.096 0.036 ? 13 1 0.972 ? 
4.040 4.260  ? ? ? ? ? ? 1269 99.800  ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 6.700 ? 0.767 ? ? 0.082 0.031 ? 14 1 0.981 ? 
4.260 4.520  ? ? ? ? ? ? 1283 99.800  ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 6.600 ? 0.824 ? ? 0.069 0.027 ? 15 1 0.979 ? 
4.520 4.870  ? ? ? ? ? ? 1289 99.900  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.400 ? 0.752 ? ? 0.060 0.024 ? 16 1 0.985 ? 
4.870 5.360  ? ? ? ? ? ? 1306 99.700  ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 5.800 ? 0.779 ? ? 0.053 0.021 ? 17 1 0.986 ? 
5.360 6.140  ? ? ? ? ? ? 1303 99.800  ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 6.200 ? 0.760 ? ? 0.051 0.020 ? 18 1 0.986 ? 
6.140 7.730  ? ? ? ? ? ? 1337 99.700  ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 6.900 ? 0.766 ? ? 0.047 0.017 ? 19 1 0.996 ? 
7.730 50.000 ? ? ? ? ? ? 1428 99.100  ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 6.500 ? 0.849 ? ? 0.038 0.015 ? 20 1 0.967 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                207.240 
_refine.B_iso_mean                               62.5374 
_refine.B_iso_min                                6.930 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6P1A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.8370 
_refine.ls_d_res_low                             47.8080 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     22885 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.4400 
_refine.ls_percent_reflns_R_free                 8.7300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2353 
_refine.ls_R_factor_R_free                       0.2749 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2314 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6P1B 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.2600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.8370 
_refine_hist.d_res_low                        47.8080 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5354 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       534 
_refine_hist.pdbx_B_iso_mean_ligand           54.82 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        3603 
_refine_hist.pdbx_number_atoms_nucleic_acid   1719 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2020 13.457 ? 1 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2020 13.457 ? 1 
'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2020 13.457 ? 1 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 4 TORSIONAL ? D 414  13.457 ? 2 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 5 TORSIONAL ? F 414  13.457 ? 2 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 6 TORSIONAL ? E 412  13.457 ? 3 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 7 TORSIONAL ? G 412  13.457 ? 3 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8372 2.9082  752  . 65  687  43.0000  . . . 0.3611 0.0000 0.2975 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.9082 2.9868  909  . 80  829  50.0000  . . . 0.3157 0.0000 0.2956 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.9868 3.0747  1222 . 106 1116 69.0000  . . . 0.3351 0.0000 0.2954 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.0747 3.1739  1681 . 147 1534 92.0000  . . . 0.3376 0.0000 0.3011 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.1739 3.2873  1740 . 153 1587 98.0000  . . . 0.2924 0.0000 0.2749 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.2873 3.4189  1771 . 154 1617 99.0000  . . . 0.3428 0.0000 0.2436 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.4189 3.5744  1810 . 159 1651 100.0000 . . . 0.2675 0.0000 0.2309 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.5744 3.7628  1813 . 158 1655 100.0000 . . . 0.2841 0.0000 0.2222 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.7628 3.9985  1811 . 159 1652 100.0000 . . . 0.2591 0.0000 0.2204 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.9985 4.3070  1839 . 160 1679 100.0000 . . . 0.2590 0.0000 0.2077 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.3070 4.7401  1843 . 161 1682 100.0000 . . . 0.2348 0.0000 0.1941 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.7401 5.4252  1826 . 159 1667 100.0000 . . . 0.2122 0.0000 0.2010 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 5.4252 6.8319  1885 . 166 1719 100.0000 . . . 0.2777 0.0000 0.2419 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 6.8319 47.8149 1983 . 172 1811 99.0000  . . . 0.2846 0.0000 0.2341 . . . . . . 14 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
1 2 
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
1 3 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
2 1 'chain D' 
2 2 'chain F' 
3 1 'chain E' 
3 2 
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1  ? A 7   A 13  
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 2  ? A 15  A 34  
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 3  ? A 35  A 35  
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 4  ? A 5   A 156 
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 5  ? A 5   A 156 
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 6  ? A 5   A 156 
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 1 7  ? A 5   A 156 
;(chain A and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 1  ? B 7   B 13  
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 2  ? B 15  B 34  
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 3  ? B 35  B 35  
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 4  ? B 7   B 153 
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 5  ? B 7   B 153 
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 6  ? B 7   B 153 
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 2 7  ? B 7   B 153 
;(chain B and (resid 7 through 13 or resid 15 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 98 or resid 100 or resid 102 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 112 or resid 114 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 153))
;
? ? ? ? ? ? ? ? 
1 3 1  ? C 7   C 13  
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 2  ? C 15  C 98  
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 3  ? C 100 C 100 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 4  ? C 6   C 156 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 5  ? C 153 C 153 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 6  ? C 6   C 156 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 7  ? C 6   C 156 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 8  ? C 6   C 156 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
1 3 9  ? C 6   C 156 
;(chain C and (resid 7 through 13 or resid 15 through 98 or resid 100 or resid 102 through 112 or resid 114 through 152 or (resid 153 and (name N or name CA or name C or name O or name CB ))))
;
? ? ? ? ? ? ? ? 
2 1 1  ? D 1   D 21  'chain D' ? ? ? ? ? ? ? ? 
2 2 1  ? F 1   F 21  'chain F' ? ? ? ? ? ? ? ? 
3 1 1  ? E 1   E 21  'chain E' ? ? ? ? ? ? ? ? 
3 2 1  ? G 1   G 1   
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 2  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 3  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 4  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 5  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 6  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 7  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 8  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 9  ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 10 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 11 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 12 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 13 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 14 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
3 2 15 ? G 1   G 21  
;(chain G and ((resid 1 and (name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N1 or name C2 or name O2 or name N3 or name C4 or name N4 or name C5 or name C6 )) or resid 2 through 21))
;
? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     6P1A 
_struct.title                        'Transcription antitermination factor Q21 in complex with Q21-binding-element DNA' 
_struct.pdbx_descriptor              'Q protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6P1A 
_struct_keywords.text            
'RNA polymerase, DNA Binding, transcription, Q-dependent antitermination, Q antitermination factor, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 9   ? SER A 29  ? THR A 9   SER A 29  1 ? 21 
HELX_P HELX_P2  AA2 GLU A 33  ? MET A 36  ? GLU A 33  MET A 36  5 ? 4  
HELX_P HELX_P3  AA3 SER A 37  ? GLU A 45  ? SER A 37  GLU A 45  1 ? 9  
HELX_P HELX_P4  AA4 ASN A 59  ? TYR A 75  ? ASN A 59  TYR A 75  1 ? 17 
HELX_P HELX_P5  AA5 ASP A 77  ? ALA A 89  ? ASP A 77  ALA A 89  1 ? 13 
HELX_P HELX_P6  AA6 SER A 93  ? VAL A 104 ? SER A 93  VAL A 104 1 ? 12 
HELX_P HELX_P7  AA7 LEU A 111 ? GLY A 115 ? LEU A 111 GLY A 115 5 ? 5  
HELX_P HELX_P8  AA8 SER A 122 ? GLU A 156 ? SER A 122 GLU A 156 1 ? 35 
HELX_P HELX_P9  AA9 THR B 9   ? SER B 29  ? THR B 9   SER B 29  1 ? 21 
HELX_P HELX_P10 AB1 GLU B 33  ? MET B 36  ? GLU B 33  MET B 36  5 ? 4  
HELX_P HELX_P11 AB2 SER B 37  ? SER B 46  ? SER B 37  SER B 46  1 ? 10 
HELX_P HELX_P12 AB3 ASN B 59  ? TYR B 75  ? ASN B 59  TYR B 75  1 ? 17 
HELX_P HELX_P13 AB4 ASP B 77  ? ALA B 89  ? ASP B 77  ALA B 89  1 ? 13 
HELX_P HELX_P14 AB5 SER B 93  ? VAL B 104 ? SER B 93  VAL B 104 1 ? 12 
HELX_P HELX_P15 AB6 SER B 122 ? LYS B 153 ? SER B 122 LYS B 153 1 ? 32 
HELX_P HELX_P16 AB7 THR C 9   ? SER C 29  ? THR C 9   SER C 29  1 ? 21 
HELX_P HELX_P17 AB8 GLU C 33  ? MET C 36  ? GLU C 33  MET C 36  5 ? 4  
HELX_P HELX_P18 AB9 SER C 37  ? SER C 46  ? SER C 37  SER C 46  1 ? 10 
HELX_P HELX_P19 AC1 ASN C 59  ? TYR C 75  ? ASN C 59  TYR C 75  1 ? 17 
HELX_P HELX_P20 AC2 ASP C 77  ? ALA C 89  ? ASP C 77  ALA C 89  1 ? 13 
HELX_P HELX_P21 AC3 SER C 93  ? VAL C 104 ? SER C 93  VAL C 104 1 ? 12 
HELX_P HELX_P22 AC4 LEU C 111 ? GLY C 115 ? LEU C 111 GLY C 115 5 ? 5  
HELX_P HELX_P23 AC5 SER C 122 ? GLU C 156 ? SER C 122 GLU C 156 1 ? 35 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? D DC 1  N3 ? ? ? 1_555 E DG 21 N1 ? ? D DC 1  E DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? D DC 1  N4 ? ? ? 1_555 E DG 21 O6 ? ? D DC 1  E DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? D DC 1  O2 ? ? ? 1_555 E DG 21 N2 ? ? D DC 1  E DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? D DT 2  N3 ? ? ? 1_555 E DA 20 N1 ? ? D DT 2  E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? D DT 2  O4 ? ? ? 1_555 E DA 20 N6 ? ? D DT 2  E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? D DC 3  N3 ? ? ? 1_555 E DG 19 N1 ? ? D DC 3  E DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? D DC 3  N4 ? ? ? 1_555 E DG 19 O6 ? ? D DC 3  E DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? D DC 3  O2 ? ? ? 1_555 E DG 19 N2 ? ? D DC 3  E DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? D DA 4  N1 ? ? ? 1_555 E DT 18 N3 ? ? D DA 4  E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? D DA 4  N6 ? ? ? 1_555 E DT 18 O4 ? ? D DA 4  E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? D DT 5  N3 ? ? ? 1_555 E DA 17 N1 ? ? D DT 5  E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? D DT 5  O4 ? ? ? 1_555 E DA 17 N6 ? ? D DT 5  E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? D DT 6  N3 ? ? ? 1_555 E DA 16 N1 ? ? D DT 6  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? D DT 6  O4 ? ? ? 1_555 E DA 16 N6 ? ? D DT 6  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? D DG 7  N1 ? ? ? 1_555 E DC 15 N3 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? D DG 7  N2 ? ? ? 1_555 E DC 15 O2 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? D DG 7  O6 ? ? ? 1_555 E DC 15 N4 ? ? D DG 7  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? D DA 8  N1 ? ? ? 1_555 E DT 14 N3 ? ? D DA 8  E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? D DA 8  N6 ? ? ? 1_555 E DT 14 O4 ? ? D DA 8  E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? D DG 9  N1 ? ? ? 1_555 E DC 13 N3 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? D DG 9  N2 ? ? ? 1_555 E DC 13 O2 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? D DG 9  O6 ? ? ? 1_555 E DC 13 N4 ? ? D DG 9  E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? D DC 10 N3 ? ? ? 1_555 E DG 12 N1 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? D DC 10 N4 ? ? ? 1_555 E DG 12 O6 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? D DC 10 O2 ? ? ? 1_555 E DG 12 N2 ? ? D DC 10 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? D DA 11 N1 ? ? ? 1_555 E DT 11 N3 ? ? D DA 11 E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? D DA 11 N6 ? ? ? 1_555 E DT 11 O4 ? ? D DA 11 E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? D DA 12 N1 ? ? ? 1_555 E DT 10 N3 ? ? D DA 12 E DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? D DA 12 N6 ? ? ? 1_555 E DT 10 O4 ? ? D DA 12 E DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? D DA 13 N1 ? ? ? 1_555 E DT 9  N3 ? ? D DA 13 E DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? D DA 13 N6 ? ? ? 1_555 E DT 9  O4 ? ? D DA 13 E DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? D DT 14 N3 ? ? ? 1_555 E DA 8  N1 ? ? D DT 14 E DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? D DT 14 O4 ? ? ? 1_555 E DA 8  N6 ? ? D DT 14 E DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? D DG 15 N1 ? ? ? 1_555 E DC 7  N3 ? ? D DG 15 E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? D DG 15 N2 ? ? ? 1_555 E DC 7  O2 ? ? D DG 15 E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? D DG 15 O6 ? ? ? 1_555 E DC 7  N4 ? ? D DG 15 E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? D DA 16 N1 ? ? ? 1_555 E DT 6  N3 ? ? D DA 16 E DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? D DA 16 N6 ? ? ? 1_555 E DT 6  O4 ? ? D DA 16 E DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? D DG 17 N1 ? ? ? 1_555 E DC 5  N3 ? ? D DG 17 E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? D DG 17 N2 ? ? ? 1_555 E DC 5  O2 ? ? D DG 17 E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? D DG 17 O6 ? ? ? 1_555 E DC 5  N4 ? ? D DG 17 E DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? D DC 18 N3 ? ? ? 1_555 E DG 4  N1 ? ? D DC 18 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? D DC 18 N4 ? ? ? 1_555 E DG 4  O6 ? ? D DC 18 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? D DC 18 O2 ? ? ? 1_555 E DG 4  N2 ? ? D DC 18 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? D DA 19 N1 ? ? ? 1_555 E DT 3  N3 ? ? D DA 19 E DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? D DA 19 N6 ? ? ? 1_555 E DT 3  O4 ? ? D DA 19 E DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? D DA 20 N1 ? ? ? 1_555 E DT 2  N3 ? ? D DA 20 E DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? D DA 20 N6 ? ? ? 1_555 E DT 2  O4 ? ? D DA 20 E DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? D DG 21 N1 ? ? ? 1_555 E DC 1  N3 ? ? D DG 21 E DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? D DG 21 N2 ? ? ? 1_555 E DC 1  O2 ? ? D DG 21 E DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? D DG 21 O6 ? ? ? 1_555 E DC 1  N4 ? ? D DG 21 E DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? F DC 1  N3 ? ? ? 1_555 G DG 21 N1 ? ? F DC 1  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? F DC 1  N4 ? ? ? 1_555 G DG 21 O6 ? ? F DC 1  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? F DC 1  O2 ? ? ? 1_555 G DG 21 N2 ? ? F DC 1  G DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? F DC 3  O2 ? ? ? 1_555 G DG 19 N2 ? ? F DC 3  G DG 19 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog56 hydrog ? ? F DA 4  N1 ? ? ? 1_555 G DT 18 N3 ? ? F DA 4  G DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? F DA 4  N6 ? ? ? 1_555 G DT 18 O4 ? ? F DA 4  G DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? F DT 5  N3 ? ? ? 1_555 G DA 17 N1 ? ? F DT 5  G DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? F DT 5  O4 ? ? ? 1_555 G DA 17 N6 ? ? F DT 5  G DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? F DT 6  N3 ? ? ? 1_555 G DA 16 N1 ? ? F DT 6  G DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? F DT 6  O4 ? ? ? 1_555 G DA 16 N6 ? ? F DT 6  G DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? F DG 7  N1 ? ? ? 1_555 G DC 15 N3 ? ? F DG 7  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? F DG 7  N2 ? ? ? 1_555 G DC 15 O2 ? ? F DG 7  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? F DG 7  O6 ? ? ? 1_555 G DC 15 N4 ? ? F DG 7  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? F DA 8  N1 ? ? ? 1_555 G DT 14 N3 ? ? F DA 8  G DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? F DA 8  N6 ? ? ? 1_555 G DT 14 O4 ? ? F DA 8  G DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? F DG 9  N1 ? ? ? 1_555 G DC 13 N3 ? ? F DG 9  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? F DG 9  N2 ? ? ? 1_555 G DC 13 O2 ? ? F DG 9  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? F DG 9  O6 ? ? ? 1_555 G DC 13 N4 ? ? F DG 9  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? F DC 10 N3 ? ? ? 1_555 G DG 12 N1 ? ? F DC 10 G DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? F DC 10 N4 ? ? ? 1_555 G DG 12 O6 ? ? F DC 10 G DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? F DC 10 O2 ? ? ? 1_555 G DG 12 N2 ? ? F DC 10 G DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? F DA 11 N1 ? ? ? 1_555 G DT 11 N3 ? ? F DA 11 G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? F DA 11 N6 ? ? ? 1_555 G DT 11 O4 ? ? F DA 11 G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? F DA 12 N1 ? ? ? 1_555 G DT 10 N3 ? ? F DA 12 G DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? F DA 12 N6 ? ? ? 1_555 G DT 10 O4 ? ? F DA 12 G DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? F DA 13 N1 ? ? ? 1_555 G DT 9  N3 ? ? F DA 13 G DT 9  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog78 hydrog ? ? F DT 14 N3 ? ? ? 1_555 G DA 8  N1 ? ? F DT 14 G DA 8  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog79 hydrog ? ? F DG 15 N1 ? ? ? 1_555 G DC 7  N3 ? ? F DG 15 G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80 hydrog ? ? F DG 15 N2 ? ? ? 1_555 G DC 7  O2 ? ? F DG 15 G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81 hydrog ? ? F DG 15 O6 ? ? ? 1_555 G DC 7  N4 ? ? F DG 15 G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82 hydrog ? ? F DA 16 N1 ? ? ? 1_555 G DT 6  N3 ? ? F DA 16 G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83 hydrog ? ? F DA 16 N6 ? ? ? 1_555 G DT 6  O4 ? ? F DA 16 G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84 hydrog ? ? F DG 17 N1 ? ? ? 1_555 G DC 5  N3 ? ? F DG 17 G DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85 hydrog ? ? F DG 17 N2 ? ? ? 1_555 G DC 5  O2 ? ? F DG 17 G DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86 hydrog ? ? F DG 17 O6 ? ? ? 1_555 G DC 5  N4 ? ? F DG 17 G DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87 hydrog ? ? F DC 18 N3 ? ? ? 1_555 G DG 4  N1 ? ? F DC 18 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88 hydrog ? ? F DC 18 N4 ? ? ? 1_555 G DG 4  O6 ? ? F DC 18 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89 hydrog ? ? F DC 18 O2 ? ? ? 1_555 G DG 4  N2 ? ? F DC 18 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90 hydrog ? ? F DA 19 N1 ? ? ? 1_555 G DT 3  N3 ? ? F DA 19 G DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91 hydrog ? ? F DA 19 N6 ? ? ? 1_555 G DT 3  O4 ? ? F DA 19 G DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92 hydrog ? ? F DA 20 N1 ? ? ? 1_555 G DT 2  N3 ? ? F DA 20 G DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93 hydrog ? ? F DA 20 N6 ? ? ? 1_555 G DT 2  O4 ? ? F DA 20 G DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94 hydrog ? ? F DG 21 N1 ? ? ? 1_555 G DC 1  N3 ? ? F DG 21 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95 hydrog ? ? F DG 21 N2 ? ? ? 1_555 G DC 1  O2 ? ? F DG 21 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96 hydrog ? ? F DG 21 O6 ? ? ? 1_555 G DC 1  N4 ? ? F DG 21 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 108 ? MET A 110 ? ARG A 108 MET A 110 
AA1 2 ARG A 117 ? GLN A 119 ? ARG A 117 GLN A 119 
AA2 1 ARG B 108 ? LYS B 109 ? ARG B 108 LYS B 109 
AA2 2 ILE B 118 ? GLN B 119 ? ILE B 118 GLN B 119 
AA3 1 ARG C 108 ? LYS C 109 ? ARG C 108 LYS C 109 
AA3 2 ILE C 118 ? GLN C 119 ? ILE C 118 GLN C 119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 110 ? N MET A 110 O ARG A 117 ? O ARG A 117 
AA2 1 2 N ARG B 108 ? N ARG B 108 O GLN B 119 ? O GLN B 119 
AA3 1 2 N ARG C 108 ? N ARG C 108 O GLN C 119 ? O GLN C 119 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 201 ? 4 'binding site for residue EDO A 201' 
AC2 Software A EDO 202 ? 2 'binding site for residue EDO A 202' 
AC3 Software B EDO 201 ? 2 'binding site for residue EDO B 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 LYS A 109 ? LYS A 109 . ? 1_555 ? 
2 AC1 4 ILE A 118 ? ILE A 118 . ? 1_555 ? 
3 AC1 4 GLU B 14  ? GLU B 14  . ? 1_555 ? 
4 AC1 4 ASN B 17  ? ASN B 17  . ? 1_555 ? 
5 AC2 2 ASP A 77  ? ASP A 77  . ? 1_555 ? 
6 AC2 2 ILE A 133 ? ILE A 133 . ? 1_555 ? 
7 AC3 2 HIS B 13  ? HIS B 13  . ? 1_555 ? 
8 AC3 2 ASN B 135 ? ASN B 135 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6P1A 
_atom_sites.fract_transf_matrix[1][1]   0.014373 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003799 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017615 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . GLU A 1 5   ? -11.010 44.331  17.759  1.00 60.46  ? 5   GLU A N      1 
ATOM   2    C  CA     . GLU A 1 5   ? -11.871 43.489  16.937  1.00 69.59  ? 5   GLU A CA     1 
ATOM   3    C  C      . GLU A 1 5   ? -11.325 43.384  15.515  1.00 61.37  ? 5   GLU A C      1 
ATOM   4    O  O      . GLU A 1 5   ? -11.367 42.319  14.898  1.00 69.48  ? 5   GLU A O      1 
ATOM   5    C  CB     . GLU A 1 5   ? -13.299 44.043  16.916  1.00 40.63  ? 5   GLU A CB     1 
ATOM   6    H  HA     . GLU A 1 5   ? -11.904 42.596  17.316  1.00 83.73  ? 5   GLU A HA     1 
ATOM   7    N  N      . LEU A 1 6   ? -10.809 44.498  15.004  1.00 46.22  ? 6   LEU A N      1 
ATOM   8    C  CA     . LEU A 1 6   ? -10.279 44.572  13.650  1.00 59.75  ? 6   LEU A CA     1 
ATOM   9    C  C      . LEU A 1 6   ? -8.760  44.464  13.674  1.00 54.67  ? 6   LEU A C      1 
ATOM   10   O  O      . LEU A 1 6   ? -8.088  45.225  14.380  1.00 40.78  ? 6   LEU A O      1 
ATOM   11   C  CB     . LEU A 1 6   ? -10.692 45.883  12.978  1.00 56.59  ? 6   LEU A CB     1 
ATOM   12   C  CG     . LEU A 1 6   ? -12.187 46.093  12.741  1.00 51.10  ? 6   LEU A CG     1 
ATOM   13   C  CD1    . LEU A 1 6   ? -12.440 47.493  12.193  1.00 47.58  ? 6   LEU A CD1    1 
ATOM   14   C  CD2    . LEU A 1 6   ? -12.738 45.026  11.801  1.00 59.95  ? 6   LEU A CD2    1 
ATOM   15   H  H      . LEU A 1 6   ? -10.756 45.240  15.435  1.00 55.68  ? 6   LEU A H      1 
ATOM   16   H  HA     . LEU A 1 6   ? -10.629 43.830  13.133  1.00 71.91  ? 6   LEU A HA     1 
ATOM   17   H  HB2    . LEU A 1 6   ? -10.387 46.615  13.536  1.00 68.12  ? 6   LEU A HB2    1 
ATOM   18   H  HB3    . LEU A 1 6   ? -10.259 45.924  12.111  1.00 68.12  ? 6   LEU A HB3    1 
ATOM   19   H  HG     . LEU A 1 6   ? -12.660 46.011  13.584  1.00 61.53  ? 6   LEU A HG     1 
ATOM   20   H  HD11   . LEU A 1 6   ? -13.370 47.566  11.930  1.00 57.31  ? 6   LEU A HD11   1 
ATOM   21   H  HD12   . LEU A 1 6   ? -12.240 48.144  12.885  1.00 57.31  ? 6   LEU A HD12   1 
ATOM   22   H  HD13   . LEU A 1 6   ? -11.866 47.640  11.425  1.00 57.31  ? 6   LEU A HD13   1 
ATOM   23   H  HD21   . LEU A 1 6   ? -13.653 45.250  11.571  1.00 72.16  ? 6   LEU A HD21   1 
ATOM   24   H  HD22   . LEU A 1 6   ? -12.192 44.999  10.999  1.00 72.16  ? 6   LEU A HD22   1 
ATOM   25   H  HD23   . LEU A 1 6   ? -12.711 44.166  12.249  1.00 72.16  ? 6   LEU A HD23   1 
ATOM   26   N  N      . ASN A 1 7   ? -8.224  43.532  12.892  1.00 49.45  ? 7   ASN A N      1 
ATOM   27   C  CA     . ASN A 1 7   ? -6.787  43.376  12.740  1.00 57.06  ? 7   ASN A CA     1 
ATOM   28   C  C      . ASN A 1 7   ? -6.424  43.416  11.262  1.00 40.11  ? 7   ASN A C      1 
ATOM   29   O  O      . ASN A 1 7   ? -7.287  43.405  10.380  1.00 51.08  ? 7   ASN A O      1 
ATOM   30   C  CB     . ASN A 1 7   ? -6.292  42.061  13.369  1.00 50.13  ? 7   ASN A CB     1 
ATOM   31   C  CG     . ASN A 1 7   ? -6.291  42.099  14.886  1.00 41.25  ? 7   ASN A CG     1 
ATOM   32   O  OD1    . ASN A 1 7   ? -6.128  43.158  15.492  1.00 47.02  ? 7   ASN A OD1    1 
ATOM   33   N  ND2    . ASN A 1 7   ? -6.452  40.937  15.507  1.00 50.41  ? 7   ASN A ND2    1 
ATOM   34   H  H      . ASN A 1 7   ? -8.685  42.969  12.433  1.00 59.55  ? 7   ASN A H      1 
ATOM   35   H  HA     . ASN A 1 7   ? -6.342  44.114  13.185  1.00 68.69  ? 7   ASN A HA     1 
ATOM   36   H  HB2    . ASN A 1 7   ? -6.874  41.337  13.087  1.00 60.37  ? 7   ASN A HB2    1 
ATOM   37   H  HB3    . ASN A 1 7   ? -5.384  41.891  13.072  1.00 60.37  ? 7   ASN A HB3    1 
ATOM   38   H  HD21   . ASN A 1 7   ? -6.459  40.907  16.367  1.00 60.70  ? 7   ASN A HD21   1 
ATOM   39   H  HD22   . ASN A 1 7   ? -6.551  40.215  15.050  1.00 60.70  ? 7   ASN A HD22   1 
ATOM   40   N  N      . LEU A 1 8   ? -5.124  43.494  11.004  1.00 30.94  ? 8   LEU A N      1 
ATOM   41   C  CA     . LEU A 1 8   ? -4.603  43.413  9.655   1.00 25.20  ? 8   LEU A CA     1 
ATOM   42   C  C      . LEU A 1 8   ? -4.427  41.953  9.267   1.00 34.43  ? 8   LEU A C      1 
ATOM   43   O  O      . LEU A 1 8   ? -4.326  41.063  10.116  1.00 36.29  ? 8   LEU A O      1 
ATOM   44   C  CB     . LEU A 1 8   ? -3.262  44.137  9.519   1.00 21.31  ? 8   LEU A CB     1 
ATOM   45   C  CG     . LEU A 1 8   ? -3.258  45.646  9.761   1.00 35.42  ? 8   LEU A CG     1 
ATOM   46   C  CD1    . LEU A 1 8   ? -1.828  46.172  9.748   1.00 31.72  ? 8   LEU A CD1    1 
ATOM   47   C  CD2    . LEU A 1 8   ? -4.118  46.366  8.739   1.00 30.06  ? 8   LEU A CD2    1 
ATOM   48   H  H      . LEU A 1 8   ? -4.517  43.595  11.605  1.00 37.34  ? 8   LEU A H      1 
ATOM   49   H  HA     . LEU A 1 8   ? -5.226  43.843  9.049   1.00 30.46  ? 8   LEU A HA     1 
ATOM   50   H  HB2    . LEU A 1 8   ? -2.646  43.747  10.159  1.00 25.79  ? 8   LEU A HB2    1 
ATOM   51   H  HB3    . LEU A 1 8   ? -2.937  43.995  8.616   1.00 25.79  ? 8   LEU A HB3    1 
ATOM   52   H  HG     . LEU A 1 8   ? -3.640  45.829  10.634  1.00 42.72  ? 8   LEU A HG     1 
ATOM   53   H  HD11   . LEU A 1 8   ? -1.843  47.130  9.900   1.00 38.27  ? 8   LEU A HD11   1 
ATOM   54   H  HD12   . LEU A 1 8   ? -1.323  45.733  10.450  1.00 38.27  ? 8   LEU A HD12   1 
ATOM   55   H  HD13   . LEU A 1 8   ? -1.429  45.981  8.884   1.00 38.27  ? 8   LEU A HD13   1 
ATOM   56   H  HD21   . LEU A 1 8   ? -3.962  47.320  8.811   1.00 36.29  ? 8   LEU A HD21   1 
ATOM   57   H  HD22   . LEU A 1 8   ? -3.878  46.057  7.851   1.00 36.29  ? 8   LEU A HD22   1 
ATOM   58   H  HD23   . LEU A 1 8   ? -5.051  46.169  8.917   1.00 36.29  ? 8   LEU A HD23   1 
ATOM   59   N  N      . THR A 1 9   ? -4.396  41.713  7.966   1.00 33.03  ? 9   THR A N      1 
ATOM   60   C  CA     . THR A 1 9   ? -4.052  40.393  7.482   1.00 27.76  ? 9   THR A CA     1 
ATOM   61   C  C      . THR A 1 9   ? -2.595  40.084  7.825   1.00 28.35  ? 9   THR A C      1 
ATOM   62   O  O      . THR A 1 9   ? -1.806  40.975  8.150   1.00 54.35  ? 9   THR A O      1 
ATOM   63   C  CB     . THR A 1 9   ? -4.252  40.328  5.977   1.00 43.11  ? 9   THR A CB     1 
ATOM   64   O  OG1    . THR A 1 9   ? -3.342  41.242  5.352   1.00 49.92  ? 9   THR A OG1    1 
ATOM   65   C  CG2    . THR A 1 9   ? -5.666  40.719  5.602   1.00 46.37  ? 9   THR A CG2    1 
ATOM   66   H  H      . THR A 1 9   ? -4.568  42.290  7.352   1.00 39.85  ? 9   THR A H      1 
ATOM   67   H  HA     . THR A 1 9   ? -4.619  39.723  7.895   1.00 33.53  ? 9   THR A HA     1 
ATOM   68   H  HB     . THR A 1 9   ? -4.093  39.423  5.668   1.00 51.94  ? 9   THR A HB     1 
ATOM   69   H  HG1    . THR A 1 9   ? -3.424  41.202  4.517   1.00 60.12  ? 9   THR A HG1    1 
ATOM   70   H  HG21   . THR A 1 9   ? -5.828  40.517  4.667   1.00 55.86  ? 9   THR A HG21   1 
ATOM   71   H  HG22   . THR A 1 9   ? -6.301  40.227  6.145   1.00 55.86  ? 9   THR A HG22   1 
ATOM   72   H  HG23   . THR A 1 9   ? -5.797  41.669  5.747   1.00 55.86  ? 9   THR A HG23   1 
ATOM   73   N  N      . LYS A 1 10  ? -2.233  38.804  7.738   1.00 23.93  ? 10  LYS A N      1 
ATOM   74   C  CA     . LYS A 1 10  ? -0.874  38.404  8.093   1.00 38.31  ? 10  LYS A CA     1 
ATOM   75   C  C      . LYS A 1 10  ? 0.151   39.149  7.243   1.00 37.89  ? 10  LYS A C      1 
ATOM   76   O  O      . LYS A 1 10  ? 1.148   39.671  7.760   1.00 36.68  ? 10  LYS A O      1 
ATOM   77   C  CB     . LYS A 1 10  ? -0.719  36.889  7.943   1.00 57.37  ? 10  LYS A CB     1 
ATOM   78   C  CG     . LYS A 1 10  ? 0.669   36.358  8.296   1.00 65.93  ? 10  LYS A CG     1 
ATOM   79   C  CD     . LYS A 1 10  ? 0.727   34.839  8.180   1.00 76.36  ? 10  LYS A CD     1 
ATOM   80   C  CE     . LYS A 1 10  ? 2.108   34.299  8.518   1.00 83.33  ? 10  LYS A CE     1 
ATOM   81   N  NZ     . LYS A 1 10  ? 2.164   32.813  8.420   1.00 97.35  ? 10  LYS A NZ     1 
ATOM   82   H  H      . LYS A 1 10  ? -2.743  38.160  7.483   1.00 28.94  ? 10  LYS A H      1 
ATOM   83   H  HA     . LYS A 1 10  ? -0.709  38.627  9.022   1.00 46.19  ? 10  LYS A HA     1 
ATOM   84   H  HB2    . LYS A 1 10  ? -1.357  36.453  8.528   1.00 69.05  ? 10  LYS A HB2    1 
ATOM   85   H  HB3    . LYS A 1 10  ? -0.898  36.650  7.020   1.00 69.05  ? 10  LYS A HB3    1 
ATOM   86   H  HG2    . LYS A 1 10  ? 1.323   36.736  7.688   1.00 79.33  ? 10  LYS A HG2    1 
ATOM   87   H  HG3    . LYS A 1 10  ? 0.884   36.603  9.210   1.00 79.33  ? 10  LYS A HG3    1 
ATOM   88   H  HD2    . LYS A 1 10  ? 0.088   34.446  8.796   1.00 91.85  ? 10  LYS A HD2    1 
ATOM   89   H  HD3    . LYS A 1 10  ? 0.513   34.579  7.270   1.00 91.85  ? 10  LYS A HD3    1 
ATOM   90   H  HE2    . LYS A 1 10  ? 2.756   34.669  7.898   1.00 100.22 ? 10  LYS A HE2    1 
ATOM   91   H  HE3    . LYS A 1 10  ? 2.336   34.552  9.426   1.00 100.22 ? 10  LYS A HE3    1 
ATOM   92   H  HZ1    . LYS A 1 10  ? 2.975   32.523  8.643   1.00 117.04 ? 10  LYS A HZ1    1 
ATOM   93   H  HZ2    . LYS A 1 10  ? 1.566   32.449  8.970   1.00 117.04 ? 10  LYS A HZ2    1 
ATOM   94   H  HZ3    . LYS A 1 10  ? 1.984   32.556  7.587   1.00 117.04 ? 10  LYS A HZ3    1 
ATOM   95   N  N      . GLU A 1 11  ? -0.082  39.215  5.933   1.00 39.47  ? 11  GLU A N      1 
ATOM   96   C  CA     . GLU A 1 11  ? 0.879   39.847  5.041   1.00 52.35  ? 11  GLU A CA     1 
ATOM   97   C  C      . GLU A 1 11  ? 0.991   41.341  5.333   1.00 45.77  ? 11  GLU A C      1 
ATOM   98   O  O      . GLU A 1 11  ? 2.098   41.885  5.443   1.00 42.77  ? 11  GLU A O      1 
ATOM   99   C  CB     . GLU A 1 11  ? 0.459   39.613  3.587   1.00 55.38  ? 11  GLU A CB     1 
ATOM   100  C  CG     . GLU A 1 11  ? 1.566   39.979  2.578   1.00 79.02  ? 11  GLU A CG     1 
ATOM   101  C  CD     . GLU A 1 11  ? 2.700   38.959  2.517   1.00 98.81  ? 11  GLU A CD     1 
ATOM   102  O  OE1    . GLU A 1 11  ? 2.522   37.831  3.021   1.00 87.00  ? 11  GLU A OE1    1 
ATOM   103  O  OE2    . GLU A 1 11  ? 3.753   39.256  1.916   1.00 100.22 ? 11  GLU A OE2    1 
ATOM   104  H  H      . GLU A 1 11  ? -0.781  38.905  5.540   1.00 47.58  ? 11  GLU A H      1 
ATOM   105  H  HA     . GLU A 1 11  ? 1.752   39.447  5.177   1.00 63.03  ? 11  GLU A HA     1 
ATOM   106  H  HB2    . GLU A 1 11  ? 0.243   38.674  3.468   1.00 66.68  ? 11  GLU A HB2    1 
ATOM   107  H  HB3    . GLU A 1 11  ? -0.318  40.159  3.391   1.00 66.68  ? 11  GLU A HB3    1 
ATOM   108  H  HG2    . GLU A 1 11  ? 1.175   40.039  1.692   1.00 95.04  ? 11  GLU A HG2    1 
ATOM   109  H  HG3    . GLU A 1 11  ? 1.949   40.833  2.830   1.00 95.04  ? 11  GLU A HG3    1 
ATOM   110  N  N      . GLN A 1 12  ? -0.157  42.013  5.486   1.00 27.12  ? 12  GLN A N      1 
ATOM   111  C  CA     . GLN A 1 12  ? -0.162  43.439  5.795   1.00 27.38  ? 12  GLN A CA     1 
ATOM   112  C  C      . GLN A 1 12  ? 0.550   43.710  7.106   1.00 28.16  ? 12  GLN A C      1 
ATOM   113  O  O      . GLN A 1 12  ? 1.335   44.661  7.216   1.00 30.37  ? 12  GLN A O      1 
ATOM   114  C  CB     . GLN A 1 12  ? -1.597  43.966  5.853   1.00 27.34  ? 12  GLN A CB     1 
ATOM   115  C  CG     . GLN A 1 12  ? -2.334  43.942  4.529   1.00 32.20  ? 12  GLN A CG     1 
ATOM   116  C  CD     . GLN A 1 12  ? -3.798  44.315  4.674   1.00 28.37  ? 12  GLN A CD     1 
ATOM   117  O  OE1    . GLN A 1 12  ? -4.407  44.076  5.715   1.00 35.56  ? 12  GLN A OE1    1 
ATOM   118  N  NE2    . GLN A 1 12  ? -4.368  44.910  3.631   1.00 40.99  ? 12  GLN A NE2    1 
ATOM   119  H  H      . GLN A 1 12  ? -0.942  41.667  5.416   1.00 32.76  ? 12  GLN A H      1 
ATOM   120  H  HA     . GLN A 1 12  ? 0.302   43.914  5.088   1.00 33.08  ? 12  GLN A HA     1 
ATOM   121  H  HB2    . GLN A 1 12  ? -2.101  43.421  6.478   1.00 33.03  ? 12  GLN A HB2    1 
ATOM   122  H  HB3    . GLN A 1 12  ? -1.576  44.886  6.159   1.00 33.03  ? 12  GLN A HB3    1 
ATOM   123  H  HG2    . GLN A 1 12  ? -1.919  44.576  3.924   1.00 38.86  ? 12  GLN A HG2    1 
ATOM   124  H  HG3    . GLN A 1 12  ? -2.287  43.047  4.156   1.00 38.86  ? 12  GLN A HG3    1 
ATOM   125  H  HE21   . GLN A 1 12  ? -3.909  45.065  2.920   1.00 49.41  ? 12  GLN A HE21   1 
ATOM   126  H  HE22   . GLN A 1 12  ? -5.196  45.141  3.666   1.00 49.41  ? 12  GLN A HE22   1 
ATOM   127  N  N      . HIS A 1 13  ? 0.287   42.878  8.114   1.00 26.95  ? 13  HIS A N      1 
ATOM   128  C  CA     . HIS A 1 13  ? 0.909   43.077  9.412   1.00 27.13  ? 13  HIS A CA     1 
ATOM   129  C  C      . HIS A 1 13  ? 2.417   42.920  9.332   1.00 29.14  ? 13  HIS A C      1 
ATOM   130  O  O      . HIS A 1 13  ? 3.159   43.762  9.840   1.00 39.14  ? 13  HIS A O      1 
ATOM   131  C  CB     . HIS A 1 13  ? 0.343   42.107  10.441  1.00 37.30  ? 13  HIS A CB     1 
ATOM   132  C  CG     . HIS A 1 13  ? 0.978   42.245  11.788  1.00 31.87  ? 13  HIS A CG     1 
ATOM   133  N  ND1    . HIS A 1 13  ? 2.158   41.613  12.115  1.00 20.76  ? 13  HIS A ND1    1 
ATOM   134  C  CD2    . HIS A 1 13  ? 0.620   42.964  12.878  1.00 14.73  ? 13  HIS A CD2    1 
ATOM   135  C  CE1    . HIS A 1 13  ? 2.490   41.921  13.356  1.00 23.79  ? 13  HIS A CE1    1 
ATOM   136  N  NE2    . HIS A 1 13  ? 1.574   42.739  13.841  1.00 23.97  ? 13  HIS A NE2    1 
ATOM   137  H  H      . HIS A 1 13  ? -0.241  42.201  8.071   1.00 32.56  ? 13  HIS A H      1 
ATOM   138  H  HA     . HIS A 1 13  ? 0.702   43.979  9.702   1.00 32.77  ? 13  HIS A HA     1 
ATOM   139  H  HB2    . HIS A 1 13  ? -0.608  42.272  10.540  1.00 44.98  ? 13  HIS A HB2    1 
ATOM   140  H  HB3    . HIS A 1 13  ? 0.491   41.199  10.132  1.00 44.98  ? 13  HIS A HB3    1 
ATOM   141  H  HD2    . HIS A 1 13  ? -0.130  43.508  12.959  1.00 17.89  ? 13  HIS A HD2    1 
ATOM   142  H  HE1    . HIS A 1 13  ? 3.242   41.614  13.810  1.00 28.76  ? 13  HIS A HE1    1 
ATOM   143  H  HE2    . HIS A 1 13  ? 1.573   43.075  14.633  1.00 28.98  ? 13  HIS A HE2    1 
ATOM   144  N  N      . GLU A 1 14  ? 2.897   41.834  8.721   1.00 28.76  ? 14  GLU A N      1 
ATOM   145  C  CA     A GLU A 1 14  ? 4.340   41.618  8.668   0.48 38.67  ? 14  GLU A CA     1 
ATOM   146  C  CA     B GLU A 1 14  ? 4.341   41.622  8.673   0.52 38.61  ? 14  GLU A CA     1 
ATOM   147  C  C      . GLU A 1 14  ? 5.024   42.705  7.849   1.00 28.84  ? 14  GLU A C      1 
ATOM   148  O  O      . GLU A 1 14  ? 6.125   43.156  8.196   1.00 29.15  ? 14  GLU A O      1 
ATOM   149  C  CB     A GLU A 1 14  ? 4.647   40.231  8.099   0.48 37.33  ? 14  GLU A CB     1 
ATOM   150  C  CB     B GLU A 1 14  ? 4.657   40.232  8.118   0.52 37.36  ? 14  GLU A CB     1 
ATOM   151  C  CG     A GLU A 1 14  ? 6.117   39.840  8.208   0.48 45.74  ? 14  GLU A CG     1 
ATOM   152  C  CG     B GLU A 1 14  ? 4.163   39.983  6.709   0.52 39.23  ? 14  GLU A CG     1 
ATOM   153  C  CD     A GLU A 1 14  ? 6.357   38.364  7.946   0.48 51.19  ? 14  GLU A CD     1 
ATOM   154  C  CD     B GLU A 1 14  ? 4.392   38.553  6.257   0.52 48.57  ? 14  GLU A CD     1 
ATOM   155  O  OE1    A GLU A 1 14  ? 5.373   37.594  7.918   0.48 51.94  ? 14  GLU A OE1    1 
ATOM   156  O  OE1    B GLU A 1 14  ? 5.089   37.805  6.976   0.52 51.71  ? 14  GLU A OE1    1 
ATOM   157  O  OE2    A GLU A 1 14  ? 7.531   37.974  7.770   0.48 45.40  ? 14  GLU A OE2    1 
ATOM   158  O  OE2    B GLU A 1 14  ? 3.872   38.175  5.187   0.52 43.49  ? 14  GLU A OE2    1 
ATOM   159  H  H      A GLU A 1 14  ? 2.423   41.226  8.341   0.48 34.73  ? 14  GLU A H      1 
ATOM   160  H  H      B GLU A 1 14  ? 2.424   41.226  8.340   0.52 34.73  ? 14  GLU A H      1 
ATOM   161  H  HA     A GLU A 1 14  ? 4.698   41.650  9.569   0.48 46.62  ? 14  GLU A HA     1 
ATOM   162  H  HA     B GLU A 1 14  ? 4.694   41.662  9.575   0.52 46.55  ? 14  GLU A HA     1 
ATOM   163  H  HB2    A GLU A 1 14  ? 4.127   39.572  8.585   0.48 45.01  ? 14  GLU A HB2    1 
ATOM   164  H  HB2    B GLU A 1 14  ? 5.620   40.114  8.115   0.52 45.04  ? 14  GLU A HB2    1 
ATOM   165  H  HB3    A GLU A 1 14  ? 4.404   40.218  7.160   0.48 45.01  ? 14  GLU A HB3    1 
ATOM   166  H  HB3    B GLU A 1 14  ? 4.243   39.570  8.694   0.52 45.04  ? 14  GLU A HB3    1 
ATOM   167  H  HG2    A GLU A 1 14  ? 6.627   40.347  7.556   0.48 55.11  ? 14  GLU A HG2    1 
ATOM   168  H  HG2    B GLU A 1 14  ? 3.210   40.162  6.670   0.52 47.30  ? 14  GLU A HG2    1 
ATOM   169  H  HG3    A GLU A 1 14  ? 6.431   40.040  9.103   0.48 55.11  ? 14  GLU A HG3    1 
ATOM   170  H  HG3    B GLU A 1 14  ? 4.636   40.571  6.099   0.52 47.30  ? 14  GLU A HG3    1 
ATOM   171  N  N      . TRP A 1 15  ? 4.382   43.158  6.768   1.00 26.69  ? 15  TRP A N      1 
ATOM   172  C  CA     . TRP A 1 15  ? 4.949   44.228  5.951   1.00 30.12  ? 15  TRP A CA     1 
ATOM   173  C  C      . TRP A 1 15  ? 5.072   45.523  6.750   1.00 22.38  ? 15  TRP A C      1 
ATOM   174  O  O      . TRP A 1 15  ? 6.157   46.125  6.834   1.00 22.35  ? 15  TRP A O      1 
ATOM   175  C  CB     . TRP A 1 15  ? 4.076   44.418  4.708   1.00 27.84  ? 15  TRP A CB     1 
ATOM   176  C  CG     . TRP A 1 15  ? 4.427   45.584  3.854   1.00 22.30  ? 15  TRP A CG     1 
ATOM   177  C  CD1    . TRP A 1 15  ? 5.402   45.639  2.903   1.00 27.53  ? 15  TRP A CD1    1 
ATOM   178  C  CD2    . TRP A 1 15  ? 3.779   46.859  3.839   1.00 30.51  ? 15  TRP A CD2    1 
ATOM   179  N  NE1    . TRP A 1 15  ? 5.413   46.876  2.308   1.00 30.33  ? 15  TRP A NE1    1 
ATOM   180  C  CE2    . TRP A 1 15  ? 4.424   47.644  2.865   1.00 26.14  ? 15  TRP A CE2    1 
ATOM   181  C  CE3    . TRP A 1 15  ? 2.719   47.416  4.561   1.00 38.55  ? 15  TRP A CE3    1 
ATOM   182  C  CZ2    . TRP A 1 15  ? 4.049   48.957  2.598   1.00 32.85  ? 15  TRP A CZ2    1 
ATOM   183  C  CZ3    . TRP A 1 15  ? 2.347   48.719  4.293   1.00 32.38  ? 15  TRP A CZ3    1 
ATOM   184  C  CH2    . TRP A 1 15  ? 3.010   49.475  3.321   1.00 35.35  ? 15  TRP A CH2    1 
ATOM   185  H  H      . TRP A 1 15  ? 3.624   42.865  6.489   1.00 32.25  ? 15  TRP A H      1 
ATOM   186  H  HA     . TRP A 1 15  ? 5.842   43.984  5.662   1.00 36.36  ? 15  TRP A HA     1 
ATOM   187  H  HB2    . TRP A 1 15  ? 4.151   43.624  4.157   1.00 33.62  ? 15  TRP A HB2    1 
ATOM   188  H  HB3    . TRP A 1 15  ? 3.157   44.537  4.995   1.00 33.62  ? 15  TRP A HB3    1 
ATOM   189  H  HD1    . TRP A 1 15  ? 5.976   44.940  2.688   1.00 33.26  ? 15  TRP A HD1    1 
ATOM   190  H  HE1    . TRP A 1 15  ? 5.953   47.128  1.688   1.00 36.61  ? 15  TRP A HE1    1 
ATOM   191  H  HE3    . TRP A 1 15  ? 2.274   46.919  5.209   1.00 46.48  ? 15  TRP A HE3    1 
ATOM   192  H  HZ2    . TRP A 1 15  ? 4.487   49.463  1.953   1.00 39.64  ? 15  TRP A HZ2    1 
ATOM   193  H  HZ3    . TRP A 1 15  ? 1.644   49.100  4.768   1.00 39.08  ? 15  TRP A HZ3    1 
ATOM   194  H  HH2    . TRP A 1 15  ? 2.737   50.350  3.162   1.00 42.63  ? 15  TRP A HH2    1 
ATOM   195  N  N      . LEU A 1 16  ? 3.965   45.968  7.348   1.00 26.89  ? 16  LEU A N      1 
ATOM   196  C  CA     . LEU A 1 16  ? 3.999   47.186  8.144   1.00 21.42  ? 16  LEU A CA     1 
ATOM   197  C  C      . LEU A 1 16  ? 4.954   47.051  9.318   1.00 21.12  ? 16  LEU A C      1 
ATOM   198  O  O      . LEU A 1 16  ? 5.595   48.029  9.707   1.00 26.10  ? 16  LEU A O      1 
ATOM   199  C  CB     . LEU A 1 16  ? 2.593   47.535  8.629   1.00 24.25  ? 16  LEU A CB     1 
ATOM   200  C  CG     . LEU A 1 16  ? 2.470   48.779  9.510   1.00 32.85  ? 16  LEU A CG     1 
ATOM   201  C  CD1    . LEU A 1 16  ? 3.114   49.986  8.861   1.00 27.50  ? 16  LEU A CD1    1 
ATOM   202  C  CD2    . LEU A 1 16  ? 1.002   49.061  9.797   1.00 34.26  ? 16  LEU A CD2    1 
ATOM   203  H  H      . LEU A 1 16  ? 3.194   45.588  7.309   1.00 32.49  ? 16  LEU A H      1 
ATOM   204  H  HA     . LEU A 1 16  ? 4.308   47.920  7.590   1.00 25.92  ? 16  LEU A HA     1 
ATOM   205  H  HB2    . LEU A 1 16  ? 2.033   47.680  7.850   1.00 29.32  ? 16  LEU A HB2    1 
ATOM   206  H  HB3    . LEU A 1 16  ? 2.257   46.785  9.144   1.00 29.32  ? 16  LEU A HB3    1 
ATOM   207  H  HG     . LEU A 1 16  ? 2.935   48.615  10.346  1.00 39.63  ? 16  LEU A HG     1 
ATOM   208  H  HD11   . LEU A 1 16  ? 2.932   50.771  9.402   1.00 33.22  ? 16  LEU A HD11   1 
ATOM   209  H  HD12   . LEU A 1 16  ? 4.071   49.840  8.802   1.00 33.22  ? 16  LEU A HD12   1 
ATOM   210  H  HD13   . LEU A 1 16  ? 2.742   50.103  7.973   1.00 33.22  ? 16  LEU A HD13   1 
ATOM   211  H  HD21   . LEU A 1 16  ? 0.937   49.842  10.369  1.00 41.32  ? 16  LEU A HD21   1 
ATOM   212  H  HD22   . LEU A 1 16  ? 0.543   49.225  8.959   1.00 41.32  ? 16  LEU A HD22   1 
ATOM   213  H  HD23   . LEU A 1 16  ? 0.614   48.291  10.243  1.00 41.32  ? 16  LEU A HD23   1 
ATOM   214  N  N      . ASN A 1 17  ? 5.078   45.851  9.886   1.00 19.57  ? 17  ASN A N      1 
ATOM   215  C  CA     . ASN A 1 17  ? 5.965   45.671  11.025  1.00 20.99  ? 17  ASN A CA     1 
ATOM   216  C  C      . ASN A 1 17  ? 7.426   45.773  10.611  1.00 29.96  ? 17  ASN A C      1 
ATOM   217  O  O      . ASN A 1 17  ? 8.239   46.357  11.334  1.00 30.42  ? 17  ASN A O      1 
ATOM   218  C  CB     . ASN A 1 17  ? 5.694   44.330  11.700  1.00 17.87  ? 17  ASN A CB     1 
ATOM   219  C  CG     . ASN A 1 17  ? 6.603   44.094  12.878  1.00 18.95  ? 17  ASN A CG     1 
ATOM   220  O  OD1    . ASN A 1 17  ? 6.320   44.533  13.990  1.00 18.29  ? 17  ASN A OD1    1 
ATOM   221  N  ND2    . ASN A 1 17  ? 7.699   43.382  12.645  1.00 27.12  ? 17  ASN A ND2    1 
ATOM   222  H  H      . ASN A 1 17  ? 4.666   45.139  9.636   1.00 23.70  ? 17  ASN A H      1 
ATOM   223  H  HA     . ASN A 1 17  ? 5.785   46.373  11.670  1.00 25.40  ? 17  ASN A HA     1 
ATOM   224  H  HB2    . ASN A 1 17  ? 4.778   44.313  12.017  1.00 21.66  ? 17  ASN A HB2    1 
ATOM   225  H  HB3    . ASN A 1 17  ? 5.837   43.617  11.059  1.00 21.66  ? 17  ASN A HB3    1 
ATOM   226  H  HD21   . ASN A 1 17  ? 8.250   43.220  13.285  1.00 32.76  ? 17  ASN A HD21   1 
ATOM   227  H  HD22   . ASN A 1 17  ? 7.858   43.084  11.855  1.00 32.76  ? 17  ASN A HD22   1 
ATOM   228  N  N      . GLY A 1 18  ? 7.785   45.210  9.457   1.00 25.02  ? 18  GLY A N      1 
ATOM   229  C  CA     . GLY A 1 18  ? 9.139   45.402  8.963   1.00 24.65  ? 18  GLY A CA     1 
ATOM   230  C  C      . GLY A 1 18  ? 9.448   46.867  8.726   1.00 20.42  ? 18  GLY A C      1 
ATOM   231  O  O      . GLY A 1 18  ? 10.492  47.382  9.157   1.00 33.88  ? 18  GLY A O      1 
ATOM   232  H  H      . GLY A 1 18  ? 7.280   44.727  8.957   1.00 30.24  ? 18  GLY A H      1 
ATOM   233  H  HA2    . GLY A 1 18  ? 9.772   45.054  9.609   1.00 29.79  ? 18  GLY A HA2    1 
ATOM   234  H  HA3    . GLY A 1 18  ? 9.248   44.924  8.125   1.00 29.79  ? 18  GLY A HA3    1 
ATOM   235  N  N      . TRP A 1 19  ? 8.526   47.570  8.057   1.00 17.87  ? 19  TRP A N      1 
ATOM   236  C  CA     . TRP A 1 19  ? 8.743   48.995  7.826   1.00 19.48  ? 19  TRP A CA     1 
ATOM   237  C  C      . TRP A 1 19  ? 8.895   49.749  9.140   1.00 14.45  ? 19  TRP A C      1 
ATOM   238  O  O      . TRP A 1 19  ? 9.766   50.614  9.271   1.00 20.77  ? 19  TRP A O      1 
ATOM   239  C  CB     . TRP A 1 19  ? 7.600   49.602  7.012   1.00 17.97  ? 19  TRP A CB     1 
ATOM   240  C  CG     . TRP A 1 19  ? 7.832   49.616  5.531   1.00 25.70  ? 19  TRP A CG     1 
ATOM   241  C  CD1    . TRP A 1 19  ? 7.002   49.127  4.566   1.00 26.65  ? 19  TRP A CD1    1 
ATOM   242  C  CD2    . TRP A 1 19  ? 8.978   50.139  4.847   1.00 25.79  ? 19  TRP A CD2    1 
ATOM   243  N  NE1    . TRP A 1 19  ? 7.555   49.321  3.325   1.00 32.14  ? 19  TRP A NE1    1 
ATOM   244  C  CE2    . TRP A 1 19  ? 8.769   49.938  3.470   1.00 23.75  ? 19  TRP A CE2    1 
ATOM   245  C  CE3    . TRP A 1 19  ? 10.160  50.756  5.267   1.00 29.64  ? 19  TRP A CE3    1 
ATOM   246  C  CZ2    . TRP A 1 19  ? 9.694   50.335  2.509   1.00 28.20  ? 19  TRP A CZ2    1 
ATOM   247  C  CZ3    . TRP A 1 19  ? 11.079  51.147  4.311   1.00 26.73  ? 19  TRP A CZ3    1 
ATOM   248  C  CH2    . TRP A 1 19  ? 10.841  50.935  2.949   1.00 24.82  ? 19  TRP A CH2    1 
ATOM   249  H  H      . TRP A 1 19  ? 7.792   47.256  7.738   1.00 21.66  ? 19  TRP A H      1 
ATOM   250  H  HA     . TRP A 1 19  ? 9.559   49.090  7.310   1.00 23.60  ? 19  TRP A HA     1 
ATOM   251  H  HB2    . TRP A 1 19  ? 6.795   49.087  7.178   1.00 21.77  ? 19  TRP A HB2    1 
ATOM   252  H  HB3    . TRP A 1 19  ? 7.472   50.520  7.298   1.00 21.77  ? 19  TRP A HB3    1 
ATOM   253  H  HD1    . TRP A 1 19  ? 6.181   48.721  4.726   1.00 32.20  ? 19  TRP A HD1    1 
ATOM   254  H  HE1    . TRP A 1 19  ? 7.196   49.093  2.577   1.00 38.79  ? 19  TRP A HE1    1 
ATOM   255  H  HE3    . TRP A 1 19  ? 10.324  50.900  6.170   1.00 35.78  ? 19  TRP A HE3    1 
ATOM   256  H  HZ2    . TRP A 1 19  ? 9.538   50.198  1.603   1.00 34.05  ? 19  TRP A HZ2    1 
ATOM   257  H  HZ3    . TRP A 1 19  ? 11.869  51.558  4.578   1.00 32.29  ? 19  TRP A HZ3    1 
ATOM   258  H  HH2    . TRP A 1 19  ? 11.478  51.209  2.329   1.00 30.00  ? 19  TRP A HH2    1 
ATOM   259  N  N      . LEU A 1 20  ? 8.056   49.436  10.128  1.00 14.78  ? 20  LEU A N      1 
ATOM   260  C  CA     . LEU A 1 20  ? 8.080   50.177  11.382  1.00 17.55  ? 20  LEU A CA     1 
ATOM   261  C  C      . LEU A 1 20  ? 9.305   49.840  12.217  1.00 11.41  ? 20  LEU A C      1 
ATOM   262  O  O      . LEU A 1 20  ? 9.787   50.691  12.962  1.00 11.68  ? 20  LEU A O      1 
ATOM   263  C  CB     . LEU A 1 20  ? 6.793   49.918  12.161  1.00 20.71  ? 20  LEU A CB     1 
ATOM   264  C  CG     . LEU A 1 20  ? 5.544   50.557  11.545  1.00 18.95  ? 20  LEU A CG     1 
ATOM   265  C  CD1    . LEU A 1 20  ? 4.304   50.166  12.327  1.00 29.13  ? 20  LEU A CD1    1 
ATOM   266  C  CD2    . LEU A 1 20  ? 5.682   52.071  11.494  1.00 15.24  ? 20  LEU A CD2    1 
ATOM   267  H  H      . LEU A 1 20  ? 7.471   48.807  10.098  1.00 17.96  ? 20  LEU A H      1 
ATOM   268  H  HA     . LEU A 1 20  ? 8.121   51.126  11.188  1.00 21.27  ? 20  LEU A HA     1 
ATOM   269  H  HB2    . LEU A 1 20  ? 6.644   48.961  12.202  1.00 25.07  ? 20  LEU A HB2    1 
ATOM   270  H  HB3    . LEU A 1 20  ? 6.896   50.277  13.056  1.00 25.07  ? 20  LEU A HB3    1 
ATOM   271  H  HG     . LEU A 1 20  ? 5.444   50.233  10.636  1.00 22.95  ? 20  LEU A HG     1 
ATOM   272  H  HD11   . LEU A 1 20  ? 3.528   50.577  11.916  1.00 35.17  ? 20  LEU A HD11   1 
ATOM   273  H  HD12   . LEU A 1 20  ? 4.213   49.200  12.313  1.00 35.17  ? 20  LEU A HD12   1 
ATOM   274  H  HD13   . LEU A 1 20  ? 4.396   50.476  13.242  1.00 35.17  ? 20  LEU A HD13   1 
ATOM   275  H  HD21   . LEU A 1 20  ? 4.814   52.461  11.306  1.00 18.50  ? 20  LEU A HD21   1 
ATOM   276  H  HD22   . LEU A 1 20  ? 6.008   52.387  12.351  1.00 18.50  ? 20  LEU A HD22   1 
ATOM   277  H  HD23   . LEU A 1 20  ? 6.310   52.307  10.793  1.00 18.50  ? 20  LEU A HD23   1 
ATOM   278  N  N      . GLU A 1 21  ? 9.823   48.617  12.119  1.00 15.55  ? 21  GLU A N      1 
ATOM   279  C  CA     . GLU A 1 21  ? 11.072  48.301  12.805  1.00 19.99  ? 21  GLU A CA     1 
ATOM   280  C  C      . GLU A 1 21  ? 12.223  49.103  12.213  1.00 17.32  ? 21  GLU A C      1 
ATOM   281  O  O      . GLU A 1 21  ? 13.033  49.694  12.945  1.00 12.05  ? 21  GLU A O      1 
ATOM   282  C  CB     . GLU A 1 21  ? 11.355  46.802  12.724  1.00 16.26  ? 21  GLU A CB     1 
ATOM   283  C  CG     . GLU A 1 21  ? 10.442  45.964  13.588  1.00 19.87  ? 21  GLU A CG     1 
ATOM   284  C  CD     . GLU A 1 21  ? 10.726  44.491  13.455  1.00 28.32  ? 21  GLU A CD     1 
ATOM   285  O  OE1    . GLU A 1 21  ? 11.683  44.141  12.734  1.00 39.47  ? 21  GLU A OE1    1 
ATOM   286  O  OE2    . GLU A 1 21  ? 10.011  43.687  14.089  1.00 37.73  ? 21  GLU A OE2    1 
ATOM   287  H  H      . GLU A 1 21  ? 9.481   47.966  11.672  1.00 18.88  ? 21  GLU A H      1 
ATOM   288  H  HA     . GLU A 1 21  ? 10.987  48.534  13.743  1.00 24.20  ? 21  GLU A HA     1 
ATOM   289  H  HB2    . GLU A 1 21  ? 11.241  46.513  11.805  1.00 19.73  ? 21  GLU A HB2    1 
ATOM   290  H  HB3    . GLU A 1 21  ? 12.267  46.640  13.012  1.00 19.73  ? 21  GLU A HB3    1 
ATOM   291  H  HG2    . GLU A 1 21  ? 10.566  46.213  14.517  1.00 24.06  ? 21  GLU A HG2    1 
ATOM   292  H  HG3    . GLU A 1 21  ? 9.522   46.119  13.323  1.00 24.06  ? 21  GLU A HG3    1 
ATOM   293  N  N      . LEU A 1 22  ? 12.308  49.141  10.881  1.00 24.24  ? 22  LEU A N      1 
ATOM   294  C  CA     . LEU A 1 22  ? 13.330  49.967  10.246  1.00 15.24  ? 22  LEU A CA     1 
ATOM   295  C  C      . LEU A 1 22  ? 13.171  51.430  10.646  1.00 20.71  ? 22  LEU A C      1 
ATOM   296  O  O      . LEU A 1 22  ? 14.145  52.098  11.014  1.00 29.90  ? 22  LEU A O      1 
ATOM   297  C  CB     . LEU A 1 22  ? 13.250  49.815  8.730   1.00 10.04  ? 22  LEU A CB     1 
ATOM   298  C  CG     . LEU A 1 22  ? 13.633  48.442  8.187   1.00 12.08  ? 22  LEU A CG     1 
ATOM   299  C  CD1    . LEU A 1 22  ? 13.380  48.381  6.693   1.00 20.70  ? 22  LEU A CD1    1 
ATOM   300  C  CD2    . LEU A 1 22  ? 15.090  48.138  8.495   1.00 17.13  ? 22  LEU A CD2    1 
ATOM   301  H  H      . LEU A 1 22  ? 11.800  48.710  10.337  1.00 29.31  ? 22  LEU A H      1 
ATOM   302  H  HA     . LEU A 1 22  ? 14.205  49.666  10.535  1.00 18.50  ? 22  LEU A HA     1 
ATOM   303  H  HB2    . LEU A 1 22  ? 12.337  49.991  8.454   1.00 12.26  ? 22  LEU A HB2    1 
ATOM   304  H  HB3    . LEU A 1 22  ? 13.849  50.463  8.327   1.00 12.26  ? 22  LEU A HB3    1 
ATOM   305  H  HG     . LEU A 1 22  ? 13.088  47.764  8.616   1.00 14.71  ? 22  LEU A HG     1 
ATOM   306  H  HD11   . LEU A 1 22  ? 13.619  47.499  6.368   1.00 25.06  ? 22  LEU A HD11   1 
ATOM   307  H  HD12   . LEU A 1 22  ? 12.440  48.551  6.524   1.00 25.06  ? 22  LEU A HD12   1 
ATOM   308  H  HD13   . LEU A 1 22  ? 13.922  49.054  6.252   1.00 25.06  ? 22  LEU A HD13   1 
ATOM   309  H  HD21   . LEU A 1 22  ? 15.360  47.349  7.999   1.00 20.77  ? 22  LEU A HD21   1 
ATOM   310  H  HD22   . LEU A 1 22  ? 15.634  48.896  8.231   1.00 20.77  ? 22  LEU A HD22   1 
ATOM   311  H  HD23   . LEU A 1 22  ? 15.185  47.979  9.447   1.00 20.77  ? 22  LEU A HD23   1 
ATOM   312  N  N      . TRP A 1 23  ? 11.933  51.931  10.614  1.00 15.98  ? 23  TRP A N      1 
ATOM   313  C  CA     . TRP A 1 23  ? 11.676  53.330  10.931  1.00 16.21  ? 23  TRP A CA     1 
ATOM   314  C  C      . TRP A 1 23  ? 12.009  53.646  12.383  1.00 19.62  ? 23  TRP A C      1 
ATOM   315  O  O      . TRP A 1 23  ? 12.548  54.716  12.678  1.00 19.87  ? 23  TRP A O      1 
ATOM   316  C  CB     . TRP A 1 23  ? 10.212  53.654  10.635  1.00 27.31  ? 23  TRP A CB     1 
ATOM   317  C  CG     . TRP A 1 23  ? 9.692   54.875  11.329  1.00 22.64  ? 23  TRP A CG     1 
ATOM   318  C  CD1    . TRP A 1 23  ? 9.818   56.169  10.920  1.00 19.84  ? 23  TRP A CD1    1 
ATOM   319  C  CD2    . TRP A 1 23  ? 8.963   54.913  12.563  1.00 23.75  ? 23  TRP A CD2    1 
ATOM   320  N  NE1    . TRP A 1 23  ? 9.208   57.011  11.819  1.00 24.58  ? 23  TRP A NE1    1 
ATOM   321  C  CE2    . TRP A 1 23  ? 8.675   56.265  12.837  1.00 21.32  ? 23  TRP A CE2    1 
ATOM   322  C  CE3    . TRP A 1 23  ? 8.524   53.934  13.461  1.00 18.26  ? 23  TRP A CE3    1 
ATOM   323  C  CZ2    . TRP A 1 23  ? 7.970   56.665  13.971  1.00 17.54  ? 23  TRP A CZ2    1 
ATOM   324  C  CZ3    . TRP A 1 23  ? 7.822   54.333  14.587  1.00 18.10  ? 23  TRP A CZ3    1 
ATOM   325  C  CH2    . TRP A 1 23  ? 7.553   55.687  14.831  1.00 18.15  ? 23  TRP A CH2    1 
ATOM   326  H  H      . TRP A 1 23  ? 11.228  51.483  10.413  1.00 19.39  ? 23  TRP A H      1 
ATOM   327  H  HA     . TRP A 1 23  ? 12.239  53.890  10.373  1.00 19.66  ? 23  TRP A HA     1 
ATOM   328  H  HB2    . TRP A 1 23  ? 10.114  53.795  9.681   1.00 32.99  ? 23  TRP A HB2    1 
ATOM   329  H  HB3    . TRP A 1 23  ? 9.667   52.902  10.917  1.00 32.99  ? 23  TRP A HB3    1 
ATOM   330  H  HD1    . TRP A 1 23  ? 10.253  56.442  10.145  1.00 24.02  ? 23  TRP A HD1    1 
ATOM   331  H  HE1    . TRP A 1 23  ? 9.167   57.868  11.753  1.00 29.71  ? 23  TRP A HE1    1 
ATOM   332  H  HE3    . TRP A 1 23  ? 8.699   53.034  13.305  1.00 22.12  ? 23  TRP A HE3    1 
ATOM   333  H  HZ2    . TRP A 1 23  ? 7.789   57.562  14.136  1.00 21.26  ? 23  TRP A HZ2    1 
ATOM   334  H  HZ3    . TRP A 1 23  ? 7.525   53.691  15.191  1.00 21.94  ? 23  TRP A HZ3    1 
ATOM   335  H  HH2    . TRP A 1 23  ? 7.080   55.925  15.596  1.00 22.00  ? 23  TRP A HH2    1 
ATOM   336  N  N      . GLY A 1 24  ? 11.699  52.732  13.304  1.00 18.95  ? 24  GLY A N      1 
ATOM   337  C  CA     . GLY A 1 24  ? 12.016  52.963  14.701  1.00 17.32  ? 24  GLY A CA     1 
ATOM   338  C  C      . GLY A 1 24  ? 13.508  52.976  14.954  1.00 19.02  ? 24  GLY A C      1 
ATOM   339  O  O      . GLY A 1 24  ? 14.007  53.804  15.723  1.00 25.81  ? 24  GLY A O      1 
ATOM   340  H  H      . GLY A 1 24  ? 11.310  51.981  13.146  1.00 22.95  ? 24  GLY A H      1 
ATOM   341  H  HA2    . GLY A 1 24  ? 11.650  53.818  14.977  1.00 21.00  ? 24  GLY A HA2    1 
ATOM   342  H  HA3    . GLY A 1 24  ? 11.620  52.261  15.241  1.00 21.00  ? 24  GLY A HA3    1 
ATOM   343  N  N      . ALA A 1 25  ? 14.242  52.062  14.314  1.00 26.45  ? 25  ALA A N      1 
ATOM   344  C  CA     . ALA A 1 25  ? 15.696  52.108  14.411  1.00 21.40  ? 25  ALA A CA     1 
ATOM   345  C  C      . ALA A 1 25  ? 16.224  53.437  13.891  1.00 19.11  ? 25  ALA A C      1 
ATOM   346  O  O      . ALA A 1 25  ? 17.097  54.058  14.509  1.00 14.68  ? 25  ALA A O      1 
ATOM   347  C  CB     . ALA A 1 25  ? 16.312  50.945  13.635  1.00 21.69  ? 25  ALA A CB     1 
ATOM   348  H  H      . ALA A 1 25  ? 13.931  51.423  13.830  1.00 31.96  ? 25  ALA A H      1 
ATOM   349  H  HA     . ALA A 1 25  ? 15.958  52.015  15.340  1.00 25.89  ? 25  ALA A HA     1 
ATOM   350  H  HB1    . ALA A 1 25  ? 17.278  50.995  13.706  1.00 26.24  ? 25  ALA A HB1    1 
ATOM   351  H  HB2    . ALA A 1 25  ? 15.995  50.110  14.014  1.00 26.24  ? 25  ALA A HB2    1 
ATOM   352  H  HB3    . ALA A 1 25  ? 16.045  51.009  12.705  1.00 26.24  ? 25  ALA A HB3    1 
ATOM   353  N  N      . TRP A 1 26  ? 15.671  53.907  12.773  1.00 18.47  ? 26  TRP A N      1 
ATOM   354  C  CA     . TRP A 1 26  ? 16.110  55.174  12.199  1.00 21.51  ? 26  TRP A CA     1 
ATOM   355  C  C      . TRP A 1 26  ? 15.811  56.342  13.135  1.00 21.21  ? 26  TRP A C      1 
ATOM   356  O  O      . TRP A 1 26  ? 16.656  57.222  13.334  1.00 21.56  ? 26  TRP A O      1 
ATOM   357  C  CB     . TRP A 1 26  ? 15.428  55.362  10.844  1.00 24.65  ? 26  TRP A CB     1 
ATOM   358  C  CG     . TRP A 1 26  ? 15.771  56.620  10.135  1.00 33.97  ? 26  TRP A CG     1 
ATOM   359  C  CD1    . TRP A 1 26  ? 16.915  56.882  9.440   1.00 26.31  ? 26  TRP A CD1    1 
ATOM   360  C  CD2    . TRP A 1 26  ? 14.953  57.787  10.021  1.00 33.95  ? 26  TRP A CD2    1 
ATOM   361  N  NE1    . TRP A 1 26  ? 16.862  58.146  8.906   1.00 37.28  ? 26  TRP A NE1    1 
ATOM   362  C  CE2    . TRP A 1 26  ? 15.667  58.722  9.249   1.00 27.50  ? 26  TRP A CE2    1 
ATOM   363  C  CE3    . TRP A 1 26  ? 13.686  58.134  10.500  1.00 27.45  ? 26  TRP A CE3    1 
ATOM   364  C  CZ2    . TRP A 1 26  ? 15.160  59.977  8.946   1.00 25.95  ? 26  TRP A CZ2    1 
ATOM   365  C  CZ3    . TRP A 1 26  ? 13.184  59.380  10.198  1.00 24.51  ? 26  TRP A CZ3    1 
ATOM   366  C  CH2    . TRP A 1 26  ? 13.919  60.288  9.428   1.00 36.89  ? 26  TRP A CH2    1 
ATOM   367  H  H      . TRP A 1 26  ? 15.046  53.516  12.330  1.00 22.38  ? 26  TRP A H      1 
ATOM   368  H  HA     . TRP A 1 26  ? 17.070  55.158  12.062  1.00 26.02  ? 26  TRP A HA     1 
ATOM   369  H  HB2    . TRP A 1 26  ? 15.684  54.625  10.268  1.00 29.80  ? 26  TRP A HB2    1 
ATOM   370  H  HB3    . TRP A 1 26  ? 14.468  55.358  10.981  1.00 29.80  ? 26  TRP A HB3    1 
ATOM   371  H  HD1    . TRP A 1 26  ? 17.626  56.292  9.342   1.00 31.79  ? 26  TRP A HD1    1 
ATOM   372  H  HE1    . TRP A 1 26  ? 17.478  58.515  8.433   1.00 44.95  ? 26  TRP A HE1    1 
ATOM   373  H  HE3    . TRP A 1 26  ? 13.192  57.535  11.011  1.00 33.15  ? 26  TRP A HE3    1 
ATOM   374  H  HZ2    . TRP A 1 26  ? 15.646  60.584  8.435   1.00 31.36  ? 26  TRP A HZ2    1 
ATOM   375  H  HZ3    . TRP A 1 26  ? 12.343  59.622  10.511  1.00 29.63  ? 26  TRP A HZ3    1 
ATOM   376  H  HH2    . TRP A 1 26  ? 13.555  61.122  9.239   1.00 44.48  ? 26  TRP A HH2    1 
ATOM   377  N  N      . VAL A 1 27  ? 14.627  56.347  13.747  1.00 23.34  ? 27  VAL A N      1 
ATOM   378  C  CA     . VAL A 1 27  ? 14.237  57.448  14.621  1.00 15.80  ? 27  VAL A CA     1 
ATOM   379  C  C      . VAL A 1 27  ? 15.093  57.468  15.881  1.00 16.48  ? 27  VAL A C      1 
ATOM   380  O  O      . VAL A 1 27  ? 15.501  58.535  16.354  1.00 23.93  ? 27  VAL A O      1 
ATOM   381  C  CB     . VAL A 1 27  ? 12.741  57.339  14.971  1.00 11.43  ? 27  VAL A CB     1 
ATOM   382  C  CG1    . VAL A 1 27  ? 12.414  58.223  16.149  1.00 9.32   ? 27  VAL A CG1    1 
ATOM   383  C  CG2    . VAL A 1 27  ? 11.878  57.702  13.774  1.00 17.50  ? 27  VAL A CG2    1 
ATOM   384  H  H      . VAL A 1 27  ? 14.034  55.729  13.675  1.00 28.23  ? 27  VAL A H      1 
ATOM   385  H  HA     . VAL A 1 27  ? 14.385  58.281  14.146  1.00 19.17  ? 27  VAL A HA     1 
ATOM   386  H  HB     . VAL A 1 27  ? 12.543  56.421  15.212  1.00 13.93  ? 27  VAL A HB     1 
ATOM   387  H  HG11   . VAL A 1 27  ? 11.456  58.377  16.171  1.00 11.40  ? 27  VAL A HG11   1 
ATOM   388  H  HG12   . VAL A 1 27  ? 12.697  57.780  16.964  1.00 11.40  ? 27  VAL A HG12   1 
ATOM   389  H  HG13   . VAL A 1 27  ? 12.882  59.066  16.051  1.00 11.40  ? 27  VAL A HG13   1 
ATOM   390  H  HG21   . VAL A 1 27  ? 10.946  57.568  14.005  1.00 21.22  ? 27  VAL A HG21   1 
ATOM   391  H  HG22   . VAL A 1 27  ? 12.032  58.632  13.543  1.00 21.22  ? 27  VAL A HG22   1 
ATOM   392  H  HG23   . VAL A 1 27  ? 12.119  57.132  13.027  1.00 21.22  ? 27  VAL A HG23   1 
ATOM   393  N  N      . TYR A 1 28  ? 15.365  56.296  16.455  1.00 18.09  ? 28  TYR A N      1 
ATOM   394  C  CA     . TYR A 1 28  ? 16.112  56.250  17.706  1.00 24.13  ? 28  TYR A CA     1 
ATOM   395  C  C      . TYR A 1 28  ? 17.533  56.778  17.562  1.00 29.35  ? 28  TYR A C      1 
ATOM   396  O  O      . TYR A 1 28  ? 18.121  57.212  18.559  1.00 27.43  ? 28  TYR A O      1 
ATOM   397  C  CB     . TYR A 1 28  ? 16.111  54.822  18.257  1.00 31.71  ? 28  TYR A CB     1 
ATOM   398  C  CG     . TYR A 1 28  ? 16.481  54.758  19.723  1.00 30.40  ? 28  TYR A CG     1 
ATOM   399  C  CD1    . TYR A 1 28  ? 15.595  55.189  20.701  1.00 25.84  ? 28  TYR A CD1    1 
ATOM   400  C  CD2    . TYR A 1 28  ? 17.703  54.243  20.129  1.00 34.75  ? 28  TYR A CD2    1 
ATOM   401  C  CE1    . TYR A 1 28  ? 15.928  55.139  22.042  1.00 30.68  ? 28  TYR A CE1    1 
ATOM   402  C  CE2    . TYR A 1 28  ? 18.043  54.180  21.469  1.00 47.25  ? 28  TYR A CE2    1 
ATOM   403  C  CZ     . TYR A 1 28  ? 17.150  54.629  22.421  1.00 34.27  ? 28  TYR A CZ     1 
ATOM   404  O  OH     . TYR A 1 28  ? 17.478  54.571  23.755  1.00 38.99  ? 28  TYR A OH     1 
ATOM   405  H  H      . TYR A 1 28  ? 15.133  55.528  16.147  1.00 21.92  ? 28  TYR A H      1 
ATOM   406  H  HA     . TYR A 1 28  ? 15.668  56.816  18.357  1.00 29.17  ? 28  TYR A HA     1 
ATOM   407  H  HB2    . TYR A 1 28  ? 15.224  54.444  18.155  1.00 38.27  ? 28  TYR A HB2    1 
ATOM   408  H  HB3    . TYR A 1 28  ? 16.756  54.292  17.762  1.00 38.27  ? 28  TYR A HB3    1 
ATOM   409  H  HD1    . TYR A 1 28  ? 14.762  55.518  20.450  1.00 31.22  ? 28  TYR A HD1    1 
ATOM   410  H  HD2    . TYR A 1 28  ? 18.305  53.934  19.490  1.00 41.92  ? 28  TYR A HD2    1 
ATOM   411  H  HE1    . TYR A 1 28  ? 15.331  55.447  22.684  1.00 37.03  ? 28  TYR A HE1    1 
ATOM   412  H  HE2    . TYR A 1 28  ? 18.868  53.838  21.727  1.00 56.92  ? 28  TYR A HE2    1 
ATOM   413  H  HH     . TYR A 1 28  ? 18.234  54.218  23.850  1.00 47.01  ? 28  TYR A HH     1 
ATOM   414  N  N      . SER A 1 29  ? 18.097  56.760  16.354  1.00 34.97  ? 29  SER A N      1 
ATOM   415  C  CA     . SER A 1 29  ? 19.441  57.283  16.143  1.00 32.79  ? 29  SER A CA     1 
ATOM   416  C  C      . SER A 1 29  ? 19.479  58.804  16.115  1.00 26.08  ? 29  SER A C      1 
ATOM   417  O  O      . SER A 1 29  ? 20.571  59.380  16.106  1.00 36.72  ? 29  SER A O      1 
ATOM   418  C  CB     . SER A 1 29  ? 20.028  56.739  14.839  1.00 17.63  ? 29  SER A CB     1 
ATOM   419  O  OG     . SER A 1 29  ? 19.284  57.184  13.721  1.00 36.47  ? 29  SER A OG     1 
ATOM   420  H  H      . SER A 1 29  ? 17.721  56.452  15.645  1.00 42.18  ? 29  SER A H      1 
ATOM   421  H  HA     . SER A 1 29  ? 20.007  56.977  16.869  1.00 39.57  ? 29  SER A HA     1 
ATOM   422  H  HB2    . SER A 1 29  ? 20.943  57.049  14.752  1.00 21.37  ? 29  SER A HB2    1 
ATOM   423  H  HB3    . SER A 1 29  ? 20.008  55.769  14.865  1.00 21.37  ? 29  SER A HB3    1 
ATOM   424  H  HG     . SER A 1 29  ? 18.480  56.952  13.800  1.00 43.98  ? 29  SER A HG     1 
ATOM   425  N  N      . GLY A 1 30  ? 18.321  59.459  16.109  1.00 33.48  ? 30  GLY A N      1 
ATOM   426  C  CA     . GLY A 1 30  ? 18.261  60.904  16.109  1.00 27.78  ? 30  GLY A CA     1 
ATOM   427  C  C      . GLY A 1 30  ? 18.342  61.544  14.744  1.00 23.79  ? 30  GLY A C      1 
ATOM   428  O  O      . GLY A 1 30  ? 18.792  62.691  14.637  1.00 48.98  ? 30  GLY A O      1 
ATOM   429  H  H      . GLY A 1 30  ? 17.549  59.080  16.105  1.00 40.39  ? 30  GLY A H      1 
ATOM   430  H  HA2    . GLY A 1 30  ? 17.424  61.180  16.515  1.00 33.55  ? 30  GLY A HA2    1 
ATOM   431  H  HA3    . GLY A 1 30  ? 18.998  61.245  16.639  1.00 33.55  ? 30  GLY A HA3    1 
ATOM   432  N  N      . ARG A 1 31  ? 17.925  60.840  13.693  1.00 18.36  ? 31  ARG A N      1 
ATOM   433  C  CA     . ARG A 1 31  ? 17.953  61.373  12.337  1.00 24.18  ? 31  ARG A CA     1 
ATOM   434  C  C      . ARG A 1 31  ? 16.655  62.047  11.912  1.00 24.93  ? 31  ARG A C      1 
ATOM   435  O  O      . ARG A 1 31  ? 16.565  62.510  10.771  1.00 31.01  ? 31  ARG A O      1 
ATOM   436  C  CB     . ARG A 1 31  ? 18.304  60.268  11.334  1.00 25.03  ? 31  ARG A CB     1 
ATOM   437  C  CG     . ARG A 1 31  ? 19.722  59.746  11.464  1.00 27.40  ? 31  ARG A CG     1 
ATOM   438  C  CD     . ARG A 1 31  ? 20.009  58.648  10.459  1.00 26.72  ? 31  ARG A CD     1 
ATOM   439  N  NE     . ARG A 1 31  ? 21.444  58.503  10.229  1.00 43.24  ? 31  ARG A NE     1 
ATOM   440  C  CZ     . ARG A 1 31  ? 22.274  57.847  11.035  1.00 35.67  ? 31  ARG A CZ     1 
ATOM   441  N  NH1    . ARG A 1 31  ? 21.820  57.269  12.139  1.00 54.79  ? 31  ARG A NH1    1 
ATOM   442  N  NH2    . ARG A 1 31  ? 23.565  57.773  10.740  1.00 50.80  ? 31  ARG A NH2    1 
ATOM   443  H  H      . ARG A 1 31  ? 17.618  60.039  13.743  1.00 22.25  ? 31  ARG A H      1 
ATOM   444  H  HA     . ARG A 1 31  ? 18.652  62.045  12.302  1.00 29.23  ? 31  ARG A HA     1 
ATOM   445  H  HB2    . ARG A 1 31  ? 17.700  59.521  11.471  1.00 30.25  ? 31  ARG A HB2    1 
ATOM   446  H  HB3    . ARG A 1 31  ? 18.199  60.618  10.436  1.00 30.25  ? 31  ARG A HB3    1 
ATOM   447  H  HG2    . ARG A 1 31  ? 20.346  60.472  11.308  1.00 33.10  ? 31  ARG A HG2    1 
ATOM   448  H  HG3    . ARG A 1 31  ? 19.850  59.384  12.355  1.00 33.10  ? 31  ARG A HG3    1 
ATOM   449  H  HD2    . ARG A 1 31  ? 19.666  57.806  10.796  1.00 32.28  ? 31  ARG A HD2    1 
ATOM   450  H  HD3    . ARG A 1 31  ? 19.584  58.866  9.615   1.00 32.28  ? 31  ARG A HD3    1 
ATOM   451  H  HE     . ARG A 1 31  ? 21.775  58.867  9.524   1.00 52.10  ? 31  ARG A HE     1 
ATOM   452  H  HH11   . ARG A 1 31  ? 20.985  57.317  12.337  1.00 65.97  ? 31  ARG A HH11   1 
ATOM   453  H  HH12   . ARG A 1 31  ? 22.361  56.846  12.657  1.00 65.97  ? 31  ARG A HH12   1 
ATOM   454  H  HH21   . ARG A 1 31  ? 23.865  58.149  10.028  1.00 61.18  ? 31  ARG A HH21   1 
ATOM   455  H  HH22   . ARG A 1 31  ? 24.102  57.349  11.261  1.00 61.18  ? 31  ARG A HH22   1 
ATOM   456  N  N      . LEU A 1 32  ? 15.652  62.118  12.779  1.00 28.58  ? 32  LEU A N      1 
ATOM   457  C  CA     . LEU A 1 32  ? 14.390  62.749  12.415  1.00 31.08  ? 32  LEU A CA     1 
ATOM   458  C  C      . LEU A 1 32  ? 14.443  64.224  12.785  1.00 46.23  ? 32  LEU A C      1 
ATOM   459  O  O      . LEU A 1 32  ? 14.818  64.572  13.910  1.00 35.91  ? 32  LEU A O      1 
ATOM   460  C  CB     . LEU A 1 32  ? 13.217  62.068  13.121  1.00 25.44  ? 32  LEU A CB     1 
ATOM   461  C  CG     . LEU A 1 32  ? 11.838  62.673  12.851  1.00 30.23  ? 32  LEU A CG     1 
ATOM   462  C  CD1    . LEU A 1 32  ? 11.489  62.637  11.376  1.00 20.69  ? 32  LEU A CD1    1 
ATOM   463  C  CD2    . LEU A 1 32  ? 10.787  61.938  13.650  1.00 41.25  ? 32  LEU A CD2    1 
ATOM   464  H  H      . LEU A 1 32  ? 15.678  61.810  13.581  1.00 34.51  ? 32  LEU A H      1 
ATOM   465  H  HA     . LEU A 1 32  ? 14.248  62.669  11.458  1.00 37.51  ? 32  LEU A HA     1 
ATOM   466  H  HB2    . LEU A 1 32  ? 13.187  61.142  12.834  1.00 30.74  ? 32  LEU A HB2    1 
ATOM   467  H  HB3    . LEU A 1 32  ? 13.371  62.115  14.077  1.00 30.74  ? 32  LEU A HB3    1 
ATOM   468  H  HG     . LEU A 1 32  ? 11.853  63.604  13.123  1.00 36.49  ? 32  LEU A HG     1 
ATOM   469  H  HD11   . LEU A 1 32  ? 10.563  62.905  11.264  1.00 25.05  ? 32  LEU A HD11   1 
ATOM   470  H  HD12   . LEU A 1 32  ? 12.070  63.250  10.899  1.00 25.05  ? 32  LEU A HD12   1 
ATOM   471  H  HD13   . LEU A 1 32  ? 11.614  61.735  11.044  1.00 25.05  ? 32  LEU A HD13   1 
ATOM   472  H  HD21   . LEU A 1 32  ? 9.916   62.315  13.449  1.00 49.71  ? 32  LEU A HD21   1 
ATOM   473  H  HD22   . LEU A 1 32  ? 10.805  60.999  13.407  1.00 49.71  ? 32  LEU A HD22   1 
ATOM   474  H  HD23   . LEU A 1 32  ? 10.981  62.038  14.595  1.00 49.71  ? 32  LEU A HD23   1 
ATOM   475  N  N      . GLU A 1 33  ? 14.049  65.089  11.851  1.00 42.34  ? 33  GLU A N      1 
ATOM   476  C  CA     . GLU A 1 33  ? 14.031  66.512  12.153  1.00 27.09  ? 33  GLU A CA     1 
ATOM   477  C  C      . GLU A 1 33  ? 12.993  66.776  13.233  1.00 27.64  ? 33  GLU A C      1 
ATOM   478  O  O      . GLU A 1 33  ? 11.838  66.351  13.121  1.00 30.64  ? 33  GLU A O      1 
ATOM   479  C  CB     . GLU A 1 33  ? 13.726  67.346  10.908  1.00 35.26  ? 33  GLU A CB     1 
ATOM   480  C  CG     . GLU A 1 33  ? 14.755  67.223  9.795   1.00 47.51  ? 33  GLU A CG     1 
ATOM   481  C  CD     . GLU A 1 33  ? 14.423  68.085  8.585   1.00 45.44  ? 33  GLU A CD     1 
ATOM   482  O  OE1    . GLU A 1 33  ? 13.418  68.823  8.629   1.00 56.16  ? 33  GLU A OE1    1 
ATOM   483  O  OE2    . GLU A 1 33  ? 15.165  68.022  7.583   1.00 47.58  ? 33  GLU A OE2    1 
ATOM   484  H  H      . GLU A 1 33  ? 13.793  64.881  11.056  1.00 51.03  ? 33  GLU A H      1 
ATOM   485  H  HA     . GLU A 1 33  ? 14.906  66.786  12.468  1.00 32.72  ? 33  GLU A HA     1 
ATOM   486  H  HB2    . GLU A 1 33  ? 12.871  67.061  10.548  1.00 42.53  ? 33  GLU A HB2    1 
ATOM   487  H  HB3    . GLU A 1 33  ? 13.683  68.280  11.165  1.00 42.53  ? 33  GLU A HB3    1 
ATOM   488  H  HG2    . GLU A 1 33  ? 15.621  67.502  10.133  1.00 57.22  ? 33  GLU A HG2    1 
ATOM   489  H  HG3    . GLU A 1 33  ? 14.796  66.299  9.503   1.00 57.22  ? 33  GLU A HG3    1 
ATOM   490  N  N      . LYS A 1 34  ? 13.400  67.515  14.264  1.00 23.14  ? 34  LYS A N      1 
ATOM   491  C  CA     . LYS A 1 34  ? 12.520  67.748  15.400  1.00 24.21  ? 34  LYS A CA     1 
ATOM   492  C  C      . LYS A 1 34  ? 11.228  68.433  14.974  1.00 30.87  ? 34  LYS A C      1 
ATOM   493  O  O      . LYS A 1 34  ? 10.185  68.236  15.607  1.00 37.09  ? 34  LYS A O      1 
ATOM   494  C  CB     . LYS A 1 34  ? 13.256  68.587  16.444  1.00 23.61  ? 34  LYS A CB     1 
ATOM   495  C  CG     . LYS A 1 34  ? 14.408  67.861  17.118  1.00 30.52  ? 34  LYS A CG     1 
ATOM   496  C  CD     . LYS A 1 34  ? 15.081  68.744  18.147  1.00 27.89  ? 34  LYS A CD     1 
ATOM   497  C  CE     . LYS A 1 34  ? 16.286  68.061  18.770  1.00 66.35  ? 34  LYS A CE     1 
ATOM   498  N  NZ     . LYS A 1 34  ? 16.929  68.924  19.801  1.00 90.42  ? 34  LYS A NZ     1 
ATOM   499  H  H      . LYS A 1 34  ? 14.172  67.888  14.330  1.00 27.99  ? 34  LYS A H      1 
ATOM   500  H  HA     . LYS A 1 34  ? 12.281  66.900  15.804  1.00 29.27  ? 34  LYS A HA     1 
ATOM   501  H  HB2    . LYS A 1 34  ? 13.617  69.376  16.011  1.00 28.55  ? 34  LYS A HB2    1 
ATOM   502  H  HB3    . LYS A 1 34  ? 12.626  68.847  17.135  1.00 28.55  ? 34  LYS A HB3    1 
ATOM   503  H  HG2    . LYS A 1 34  ? 14.073  67.069  17.566  1.00 36.84  ? 34  LYS A HG2    1 
ATOM   504  H  HG3    . LYS A 1 34  ? 15.067  67.612  16.451  1.00 36.84  ? 34  LYS A HG3    1 
ATOM   505  H  HD2    . LYS A 1 34  ? 15.381  69.562  17.721  1.00 33.68  ? 34  LYS A HD2    1 
ATOM   506  H  HD3    . LYS A 1 34  ? 14.449  68.951  18.854  1.00 33.68  ? 34  LYS A HD3    1 
ATOM   507  H  HE2    . LYS A 1 34  ? 16.005  67.236  19.195  1.00 79.83  ? 34  LYS A HE2    1 
ATOM   508  H  HE3    . LYS A 1 34  ? 16.941  67.872  18.079  1.00 79.83  ? 34  LYS A HE3    1 
ATOM   509  H  HZ1    . LYS A 1 34  ? 17.639  68.512  20.144  1.00 108.72 ? 34  LYS A HZ1    1 
ATOM   510  H  HZ2    . LYS A 1 34  ? 17.190  69.693  19.435  1.00 108.72 ? 34  LYS A HZ2    1 
ATOM   511  H  HZ3    . LYS A 1 34  ? 16.351  69.098  20.455  1.00 108.72 ? 34  LYS A HZ3    1 
ATOM   512  N  N      . ARG A 1 35  ? 11.266  69.208  13.887  1.00 29.47  ? 35  ARG A N      1 
ATOM   513  C  CA     . ARG A 1 35  ? 10.087  69.944  13.450  1.00 28.29  ? 35  ARG A CA     1 
ATOM   514  C  C      . ARG A 1 35  ? 9.006   69.033  12.888  1.00 32.03  ? 35  ARG A C      1 
ATOM   515  O  O      . ARG A 1 35  ? 7.855   69.465  12.761  1.00 28.97  ? 35  ARG A O      1 
ATOM   516  C  CB     . ARG A 1 35  ? 10.479  70.973  12.388  1.00 28.46  ? 35  ARG A CB     1 
ATOM   517  C  CG     . ARG A 1 35  ? 10.924  70.351  11.071  1.00 34.19  ? 35  ARG A CG     1 
ATOM   518  C  CD     . ARG A 1 35  ? 11.328  71.405  10.054  1.00 35.71  ? 35  ARG A CD     1 
ATOM   519  N  NE     . ARG A 1 35  ? 11.798  70.809  8.805   1.00 28.76  ? 35  ARG A NE     1 
ATOM   520  C  CZ     . ARG A 1 35  ? 11.019  70.496  7.771   1.00 27.27  ? 35  ARG A CZ     1 
ATOM   521  N  NH1    . ARG A 1 35  ? 9.710   70.719  7.814   1.00 19.76  ? 35  ARG A NH1    1 
ATOM   522  N  NH2    . ARG A 1 35  ? 11.553  69.957  6.685   1.00 27.47  ? 35  ARG A NH2    1 
ATOM   523  H  H      . ARG A 1 35  ? 11.959  69.323  13.390  1.00 35.58  ? 35  ARG A H      1 
ATOM   524  H  HA     . ARG A 1 35  ? 9.719   70.413  14.215  1.00 34.16  ? 35  ARG A HA     1 
ATOM   525  H  HB2    . ARG A 1 35  ? 9.714   71.540  12.205  1.00 34.37  ? 35  ARG A HB2    1 
ATOM   526  H  HB3    . ARG A 1 35  ? 11.214  71.507  12.728  1.00 34.37  ? 35  ARG A HB3    1 
ATOM   527  H  HG2    . ARG A 1 35  ? 11.689  69.776  11.231  1.00 41.24  ? 35  ARG A HG2    1 
ATOM   528  H  HG3    . ARG A 1 35  ? 10.193  69.835  10.698  1.00 41.24  ? 35  ARG A HG3    1 
ATOM   529  H  HD2    . ARG A 1 35  ? 10.562  71.965  9.853   1.00 43.07  ? 35  ARG A HD2    1 
ATOM   530  H  HD3    . ARG A 1 35  ? 12.045  71.944  10.422  1.00 43.07  ? 35  ARG A HD3    1 
ATOM   531  H  HE     . ARG A 1 35  ? 12.640  70.648  8.732   1.00 34.73  ? 35  ARG A HE     1 
ATOM   532  H  HH11   . ARG A 1 35  ? 9.356   71.070  8.515   1.00 23.93  ? 35  ARG A HH11   1 
ATOM   533  H  HH12   . ARG A 1 35  ? 9.217   70.513  7.141   1.00 23.93  ? 35  ARG A HH12   1 
ATOM   534  H  HH21   . ARG A 1 35  ? 12.400  69.810  6.650   1.00 33.18  ? 35  ARG A HH21   1 
ATOM   535  H  HH22   . ARG A 1 35  ? 11.054  69.754  6.015   1.00 33.18  ? 35  ARG A HH22   1 
ATOM   536  N  N      . MET A 1 36  ? 9.349   67.789  12.549  1.00 44.25  ? 36  MET A N      1 
ATOM   537  C  CA     . MET A 1 36  ? 8.408   66.886  11.898  1.00 27.71  ? 36  MET A CA     1 
ATOM   538  C  C      . MET A 1 36  ? 7.429   66.245  12.868  1.00 25.97  ? 36  MET A C      1 
ATOM   539  O  O      . MET A 1 36  ? 6.404   65.715  12.426  1.00 35.77  ? 36  MET A O      1 
ATOM   540  C  CB     . MET A 1 36  ? 9.166   65.794  11.146  1.00 39.92  ? 36  MET A CB     1 
ATOM   541  C  CG     . MET A 1 36  ? 9.831   66.296  9.890   1.00 25.36  ? 36  MET A CG     1 
ATOM   542  S  SD     . MET A 1 36  ? 8.598   66.763  8.671   1.00 32.70  ? 36  MET A SD     1 
ATOM   543  C  CE     . MET A 1 36  ? 9.646   67.262  7.306   1.00 83.31  ? 36  MET A CE     1 
ATOM   544  H  H      . MET A 1 36  ? 10.124  67.444  12.687  1.00 53.32  ? 36  MET A H      1 
ATOM   545  H  HA     . MET A 1 36  ? 7.901   67.399  11.249  1.00 33.47  ? 36  MET A HA     1 
ATOM   546  H  HB2    . MET A 1 36  ? 9.855   65.433  11.726  1.00 48.11  ? 36  MET A HB2    1 
ATOM   547  H  HB3    . MET A 1 36  ? 8.542   65.094  10.896  1.00 48.11  ? 36  MET A HB3    1 
ATOM   548  H  HG2    . MET A 1 36  ? 10.371  67.074  10.097  1.00 30.65  ? 36  MET A HG2    1 
ATOM   549  H  HG3    . MET A 1 36  ? 10.387  65.596  9.515   1.00 30.65  ? 36  MET A HG3    1 
ATOM   550  H  HE1    . MET A 1 36  ? 9.138   67.834  6.710   1.00 100.18 ? 36  MET A HE1    1 
ATOM   551  H  HE2    . MET A 1 36  ? 10.411  67.746  7.656   1.00 100.18 ? 36  MET A HE2    1 
ATOM   552  H  HE3    . MET A 1 36  ? 9.944   66.471  6.831   1.00 100.18 ? 36  MET A HE3    1 
ATOM   553  N  N      . SER A 1 37  ? 7.730   66.250  14.164  1.00 37.94  ? 37  SER A N      1 
ATOM   554  C  CA     . SER A 1 37  ? 6.825   65.683  15.152  1.00 30.68  ? 37  SER A CA     1 
ATOM   555  C  C      . SER A 1 37  ? 7.248   66.141  16.535  1.00 27.73  ? 37  SER A C      1 
ATOM   556  O  O      . SER A 1 37  ? 8.353   65.822  16.988  1.00 29.76  ? 37  SER A O      1 
ATOM   557  C  CB     . SER A 1 37  ? 6.819   64.155  15.075  1.00 28.19  ? 37  SER A CB     1 
ATOM   558  O  OG     . SER A 1 37  ? 5.919   63.606  16.021  1.00 33.57  ? 37  SER A OG     1 
ATOM   559  H  H      . SER A 1 37  ? 8.453   66.577  14.495  1.00 45.75  ? 37  SER A H      1 
ATOM   560  H  HA     . SER A 1 37  ? 5.919   65.982  14.977  1.00 37.03  ? 37  SER A HA     1 
ATOM   561  H  HB2    . SER A 1 37  ? 6.544   63.885  14.184  1.00 34.05  ? 37  SER A HB2    1 
ATOM   562  H  HB3    . SER A 1 37  ? 7.712   63.826  15.260  1.00 34.05  ? 37  SER A HB3    1 
ATOM   563  H  HG     . SER A 1 37  ? 5.147   63.913  15.895  1.00 40.50  ? 37  SER A HG     1 
ATOM   564  N  N      . SER A 1 38  ? 6.370   66.881  17.213  1.00 30.60  ? 38  SER A N      1 
ATOM   565  C  CA     . SER A 1 38  ? 6.661   67.312  18.573  1.00 26.14  ? 38  SER A CA     1 
ATOM   566  C  C      . SER A 1 38  ? 6.659   66.124  19.526  1.00 24.51  ? 38  SER A C      1 
ATOM   567  O  O      . SER A 1 38  ? 7.460   66.073  20.465  1.00 35.04  ? 38  SER A O      1 
ATOM   568  C  CB     . SER A 1 38  ? 5.648   68.366  19.015  1.00 39.05  ? 38  SER A CB     1 
ATOM   569  O  OG     . SER A 1 38  ? 4.325   67.869  18.919  1.00 42.75  ? 38  SER A OG     1 
ATOM   570  H  H      . SER A 1 38  ? 5.608   67.143  16.913  1.00 36.94  ? 38  SER A H      1 
ATOM   571  H  HA     . SER A 1 38  ? 7.540   67.721  18.600  1.00 31.59  ? 38  SER A HA     1 
ATOM   572  H  HB2    . SER A 1 38  ? 5.827   68.608  19.937  1.00 47.08  ? 38  SER A HB2    1 
ATOM   573  H  HB3    . SER A 1 38  ? 5.734   69.145  18.444  1.00 47.08  ? 38  SER A HB3    1 
ATOM   574  H  HG     . SER A 1 38  ? 3.776   68.478  19.100  1.00 51.52  ? 38  SER A HG     1 
ATOM   575  N  N      . VAL A 1 39  ? 5.771   65.153  19.293  1.00 25.59  ? 39  VAL A N      1 
ATOM   576  C  CA     . VAL A 1 39  ? 5.709   63.971  20.150  1.00 28.77  ? 39  VAL A CA     1 
ATOM   577  C  C      . VAL A 1 39  ? 7.020   63.195  20.088  1.00 26.73  ? 39  VAL A C      1 
ATOM   578  O  O      . VAL A 1 39  ? 7.603   62.842  21.122  1.00 26.18  ? 39  VAL A O      1 
ATOM   579  C  CB     . VAL A 1 39  ? 4.518   63.083  19.744  1.00 23.61  ? 39  VAL A CB     1 
ATOM   580  C  CG1    . VAL A 1 39  ? 4.465   61.841  20.604  1.00 16.88  ? 39  VAL A CG1    1 
ATOM   581  C  CG2    . VAL A 1 39  ? 3.218   63.855  19.857  1.00 30.37  ? 39  VAL A CG2    1 
ATOM   582  H  H      . VAL A 1 39  ? 5.199   65.154  18.651  1.00 30.92  ? 39  VAL A H      1 
ATOM   583  H  HA     . VAL A 1 39  ? 5.578   64.264  21.066  1.00 34.74  ? 39  VAL A HA     1 
ATOM   584  H  HB     . VAL A 1 39  ? 4.635   62.811  18.820  1.00 28.54  ? 39  VAL A HB     1 
ATOM   585  H  HG11   . VAL A 1 39  ? 3.588   61.435  20.518  1.00 20.47  ? 39  VAL A HG11   1 
ATOM   586  H  HG12   . VAL A 1 39  ? 5.147   61.220  20.305  1.00 20.47  ? 39  VAL A HG12   1 
ATOM   587  H  HG13   . VAL A 1 39  ? 4.625   62.089  21.528  1.00 20.47  ? 39  VAL A HG13   1 
ATOM   588  H  HG21   . VAL A 1 39  ? 2.481   63.268  19.626  1.00 36.66  ? 39  VAL A HG21   1 
ATOM   589  H  HG22   . VAL A 1 39  ? 3.116   64.171  20.769  1.00 36.66  ? 39  VAL A HG22   1 
ATOM   590  H  HG23   . VAL A 1 39  ? 3.244   64.609  19.248  1.00 36.66  ? 39  VAL A HG23   1 
ATOM   591  N  N      . ILE A 1 40  ? 7.512   62.932  18.874  1.00 25.94  ? 40  ILE A N      1 
ATOM   592  C  CA     . ILE A 1 40  ? 8.741   62.158  18.727  1.00 17.32  ? 40  ILE A CA     1 
ATOM   593  C  C      . ILE A 1 40  ? 9.934   62.948  19.244  1.00 17.25  ? 40  ILE A C      1 
ATOM   594  O  O      . ILE A 1 40  ? 10.874  62.379  19.811  1.00 16.37  ? 40  ILE A O      1 
ATOM   595  C  CB     . ILE A 1 40  ? 8.944   61.735  17.261  1.00 19.09  ? 40  ILE A CB     1 
ATOM   596  C  CG1    . ILE A 1 40  ? 7.747   60.915  16.775  1.00 29.86  ? 40  ILE A CG1    1 
ATOM   597  C  CG2    . ILE A 1 40  ? 10.225  60.924  17.129  1.00 9.22   ? 40  ILE A CG2    1 
ATOM   598  C  CD1    . ILE A 1 40  ? 7.801   60.535  15.313  1.00 8.13   ? 40  ILE A CD1    1 
ATOM   599  H  H      . ILE A 1 40  ? 7.160   63.186  18.132  1.00 31.34  ? 40  ILE A H      1 
ATOM   600  H  HA     . ILE A 1 40  ? 8.655   61.352  19.261  1.00 21.00  ? 40  ILE A HA     1 
ATOM   601  H  HB     . ILE A 1 40  ? 9.016   62.533  16.714  1.00 23.13  ? 40  ILE A HB     1 
ATOM   602  H  HG12   . ILE A 1 40  ? 7.705   60.094  17.290  1.00 36.04  ? 40  ILE A HG12   1 
ATOM   603  H  HG13   . ILE A 1 40  ? 6.940   61.434  16.913  1.00 36.04  ? 40  ILE A HG13   1 
ATOM   604  H  HG21   . ILE A 1 40  ? 10.288  60.578  16.225  1.00 11.28  ? 40  ILE A HG21   1 
ATOM   605  H  HG22   . ILE A 1 40  ? 10.983  61.499  17.316  1.00 11.28  ? 40  ILE A HG22   1 
ATOM   606  H  HG23   . ILE A 1 40  ? 10.201  60.191  17.763  1.00 11.28  ? 40  ILE A HG23   1 
ATOM   607  H  HD11   . ILE A 1 40  ? 6.922   60.236  15.032  1.00 9.97   ? 40  ILE A HD11   1 
ATOM   608  H  HD12   . ILE A 1 40  ? 8.068   61.311  14.795  1.00 9.97   ? 40  ILE A HD12   1 
ATOM   609  H  HD13   . ILE A 1 40  ? 8.447   59.821  15.196  1.00 9.97   ? 40  ILE A HD13   1 
ATOM   610  N  N      . ALA A 1 41  ? 9.922   64.268  19.054  1.00 33.06  ? 41  ALA A N      1 
ATOM   611  C  CA     . ALA A 1 41  ? 11.012  65.096  19.554  1.00 21.04  ? 41  ALA A CA     1 
ATOM   612  C  C      . ALA A 1 41  ? 11.068  65.064  21.076  1.00 24.55  ? 41  ALA A C      1 
ATOM   613  O  O      . ALA A 1 41  ? 12.139  64.877  21.666  1.00 31.21  ? 41  ALA A O      1 
ATOM   614  C  CB     . ALA A 1 41  ? 10.848  66.528  19.050  1.00 23.17  ? 41  ALA A CB     1 
ATOM   615  H  H      . ALA A 1 41  ? 9.303   64.703  18.644  1.00 39.89  ? 41  ALA A H      1 
ATOM   616  H  HA     . ALA A 1 41  ? 11.853  64.750  19.216  1.00 25.46  ? 41  ALA A HA     1 
ATOM   617  H  HB1    . ALA A 1 41  ? 11.576  67.069  19.394  1.00 28.02  ? 41  ALA A HB1    1 
ATOM   618  H  HB2    . ALA A 1 41  ? 10.867  66.526  18.081  1.00 28.02  ? 41  ALA A HB2    1 
ATOM   619  H  HB3    . ALA A 1 41  ? 9.999   66.878  19.364  1.00 28.02  ? 41  ALA A HB3    1 
ATOM   620  N  N      . LYS A 1 42  ? 9.918   65.238  21.731  1.00 25.68  ? 42  LYS A N      1 
ATOM   621  C  CA     . LYS A 1 42  ? 9.871   65.159  23.188  1.00 32.28  ? 42  LYS A CA     1 
ATOM   622  C  C      . LYS A 1 42  ? 10.274  63.773  23.677  1.00 31.10  ? 42  LYS A C      1 
ATOM   623  O  O      . LYS A 1 42  ? 10.940  63.640  24.711  1.00 37.75  ? 42  LYS A O      1 
ATOM   624  C  CB     . LYS A 1 42  ? 8.473   65.534  23.683  1.00 27.84  ? 42  LYS A CB     1 
ATOM   625  C  CG     . LYS A 1 42  ? 8.316   65.516  25.197  1.00 34.29  ? 42  LYS A CG     1 
ATOM   626  C  CD     . LYS A 1 42  ? 6.941   66.021  25.603  1.00 60.77  ? 42  LYS A CD     1 
ATOM   627  C  CE     . LYS A 1 42  ? 6.720   65.933  27.106  1.00 74.97  ? 42  LYS A CE     1 
ATOM   628  N  NZ     . LYS A 1 42  ? 6.661   64.523  27.581  1.00 69.78  ? 42  LYS A NZ     1 
ATOM   629  H  H      . LYS A 1 42  ? 9.159   65.402  21.361  1.00 31.03  ? 42  LYS A H      1 
ATOM   630  H  HA     . LYS A 1 42  ? 10.498  65.796  23.563  1.00 38.95  ? 42  LYS A HA     1 
ATOM   631  H  HB2    . LYS A 1 42  ? 8.267   66.431  23.378  1.00 33.63  ? 42  LYS A HB2    1 
ATOM   632  H  HB3    . LYS A 1 42  ? 7.835   64.903  23.315  1.00 33.63  ? 42  LYS A HB3    1 
ATOM   633  H  HG2    . LYS A 1 42  ? 8.419   64.608  25.523  1.00 41.37  ? 42  LYS A HG2    1 
ATOM   634  H  HG3    . LYS A 1 42  ? 8.986   66.091  25.599  1.00 41.37  ? 42  LYS A HG3    1 
ATOM   635  H  HD2    . LYS A 1 42  ? 6.851   66.950  25.338  1.00 73.14  ? 42  LYS A HD2    1 
ATOM   636  H  HD3    . LYS A 1 42  ? 6.262   65.485  25.165  1.00 73.14  ? 42  LYS A HD3    1 
ATOM   637  H  HE2    . LYS A 1 42  ? 7.452   66.375  27.562  1.00 90.18  ? 42  LYS A HE2    1 
ATOM   638  H  HE3    . LYS A 1 42  ? 5.880   66.363  27.330  1.00 90.18  ? 42  LYS A HE3    1 
ATOM   639  H  HZ1    . LYS A 1 42  ? 6.547   64.504  28.464  1.00 83.95  ? 42  LYS A HZ1    1 
ATOM   640  H  HZ2    . LYS A 1 42  ? 5.981   64.099  27.193  1.00 83.95  ? 42  LYS A HZ2    1 
ATOM   641  H  HZ3    . LYS A 1 42  ? 7.418   64.101  27.379  1.00 83.95  ? 42  LYS A HZ3    1 
ATOM   642  N  N      . PHE A 1 43  ? 9.888   62.727  22.942  1.00 20.81  ? 43  PHE A N      1 
ATOM   643  C  CA     . PHE A 1 43  ? 10.286  61.370  23.307  1.00 24.93  ? 43  PHE A CA     1 
ATOM   644  C  C      . PHE A 1 43  ? 11.796  61.198  23.213  1.00 30.34  ? 43  PHE A C      1 
ATOM   645  O  O      . PHE A 1 43  ? 12.402  60.481  24.019  1.00 38.12  ? 43  PHE A O      1 
ATOM   646  C  CB     . PHE A 1 43  ? 9.567   60.371  22.396  1.00 31.04  ? 43  PHE A CB     1 
ATOM   647  C  CG     . PHE A 1 43  ? 9.936   58.931  22.635  1.00 23.24  ? 43  PHE A CG     1 
ATOM   648  C  CD1    . PHE A 1 43  ? 9.211   58.149  23.517  1.00 19.93  ? 43  PHE A CD1    1 
ATOM   649  C  CD2    . PHE A 1 43  ? 10.989  58.350  21.943  1.00 29.44  ? 43  PHE A CD2    1 
ATOM   650  C  CE1    . PHE A 1 43  ? 9.542   56.817  23.723  1.00 22.07  ? 43  PHE A CE1    1 
ATOM   651  C  CE2    . PHE A 1 43  ? 11.329  57.020  22.145  1.00 28.34  ? 43  PHE A CE2    1 
ATOM   652  C  CZ     . PHE A 1 43  ? 10.603  56.252  23.035  1.00 26.88  ? 43  PHE A CZ     1 
ATOM   653  H  H      . PHE A 1 43  ? 9.401   62.774  22.235  1.00 25.18  ? 43  PHE A H      1 
ATOM   654  H  HA     . PHE A 1 43  ? 10.025  61.190  24.224  1.00 30.13  ? 43  PHE A HA     1 
ATOM   655  H  HB2    . PHE A 1 43  ? 8.612   60.456  22.537  1.00 37.46  ? 43  PHE A HB2    1 
ATOM   656  H  HB3    . PHE A 1 43  ? 9.787   60.581  21.474  1.00 37.46  ? 43  PHE A HB3    1 
ATOM   657  H  HD1    . PHE A 1 43  ? 8.493   58.520  23.977  1.00 24.14  ? 43  PHE A HD1    1 
ATOM   658  H  HD2    . PHE A 1 43  ? 11.475  58.859  21.335  1.00 35.54  ? 43  PHE A HD2    1 
ATOM   659  H  HE1    . PHE A 1 43  ? 9.052   56.304  24.323  1.00 26.71  ? 43  PHE A HE1    1 
ATOM   660  H  HE2    . PHE A 1 43  ? 12.043  56.646  21.681  1.00 34.23  ? 43  PHE A HE2    1 
ATOM   661  H  HZ     . PHE A 1 43  ? 10.827  55.360  23.172  1.00 32.47  ? 43  PHE A HZ     1 
ATOM   662  N  N      . MET A 1 44  ? 12.415  61.821  22.213  1.00 28.33  ? 44  MET A N      1 
ATOM   663  C  CA     . MET A 1 44  ? 13.849  61.692  21.995  1.00 31.24  ? 44  MET A CA     1 
ATOM   664  C  C      . MET A 1 44  ? 14.686  62.495  22.982  1.00 34.84  ? 44  MET A C      1 
ATOM   665  O  O      . MET A 1 44  ? 15.877  62.203  23.137  1.00 34.00  ? 44  MET A O      1 
ATOM   666  C  CB     . MET A 1 44  ? 14.178  62.110  20.562  1.00 28.45  ? 44  MET A CB     1 
ATOM   667  C  CG     . MET A 1 44  ? 13.806  61.069  19.506  1.00 25.33  ? 44  MET A CG     1 
ATOM   668  S  SD     . MET A 1 44  ? 14.868  59.605  19.531  1.00 44.51  ? 44  MET A SD     1 
ATOM   669  C  CE     . MET A 1 44  ? 13.883  58.462  20.485  1.00 33.65  ? 44  MET A CE     1 
ATOM   670  H  H      . MET A 1 44  ? 12.023  62.330  21.642  1.00 34.21  ? 44  MET A H      1 
ATOM   671  H  HA     . MET A 1 44  ? 14.096  60.760  22.103  1.00 37.70  ? 44  MET A HA     1 
ATOM   672  H  HB2    . MET A 1 44  ? 13.692  62.924  20.357  1.00 34.36  ? 44  MET A HB2    1 
ATOM   673  H  HB3    . MET A 1 44  ? 15.133  62.268  20.496  1.00 34.36  ? 44  MET A HB3    1 
ATOM   674  H  HG2    . MET A 1 44  ? 12.894  60.778  19.662  1.00 30.62  ? 44  MET A HG2    1 
ATOM   675  H  HG3    . MET A 1 44  ? 13.880  61.474  18.628  1.00 30.62  ? 44  MET A HG3    1 
ATOM   676  H  HE1    . MET A 1 44  ? 14.409  57.667  20.667  1.00 40.60  ? 44  MET A HE1    1 
ATOM   677  H  HE2    . MET A 1 44  ? 13.625  58.886  21.319  1.00 40.60  ? 44  MET A HE2    1 
ATOM   678  H  HE3    . MET A 1 44  ? 13.092  58.226  19.976  1.00 40.60  ? 44  MET A HE3    1 
ATOM   679  N  N      . GLU A 1 45  ? 14.101  63.495  23.650  1.00 40.38  ? 45  GLU A N      1 
ATOM   680  C  CA     . GLU A 1 45  ? 14.869  64.307  24.589  1.00 39.81  ? 45  GLU A CA     1 
ATOM   681  C  C      . GLU A 1 45  ? 15.487  63.465  25.698  1.00 54.67  ? 45  GLU A C      1 
ATOM   682  O  O      . GLU A 1 45  ? 16.552  63.814  26.221  1.00 44.25  ? 45  GLU A O      1 
ATOM   683  C  CB     . GLU A 1 45  ? 13.977  65.384  25.202  1.00 37.10  ? 45  GLU A CB     1 
ATOM   684  C  CG     . GLU A 1 45  ? 13.566  66.481  24.242  1.00 48.09  ? 45  GLU A CG     1 
ATOM   685  C  CD     . GLU A 1 45  ? 12.677  67.519  24.905  1.00 64.09  ? 45  GLU A CD     1 
ATOM   686  O  OE1    . GLU A 1 45  ? 12.445  67.404  26.129  1.00 46.21  ? 45  GLU A OE1    1 
ATOM   687  O  OE2    . GLU A 1 45  ? 12.209  68.444  24.205  1.00 58.32  ? 45  GLU A OE2    1 
ATOM   688  H  H      . GLU A 1 45  ? 13.275  63.720  23.578  1.00 48.67  ? 45  GLU A H      1 
ATOM   689  H  HA     . GLU A 1 45  ? 15.586  64.740  24.100  1.00 47.99  ? 45  GLU A HA     1 
ATOM   690  H  HB2    . GLU A 1 45  ? 13.166  64.964  25.530  1.00 44.74  ? 45  GLU A HB2    1 
ATOM   691  H  HB3    . GLU A 1 45  ? 14.455  65.801  25.936  1.00 44.74  ? 45  GLU A HB3    1 
ATOM   692  H  HG2    . GLU A 1 45  ? 14.361  66.930  23.912  1.00 57.92  ? 45  GLU A HG2    1 
ATOM   693  H  HG3    . GLU A 1 45  ? 13.075  66.090  23.502  1.00 57.92  ? 45  GLU A HG3    1 
ATOM   694  N  N      . SER A 1 46  ? 14.854  62.351  26.054  1.00 72.12  ? 46  SER A N      1 
ATOM   695  C  CA     . SER A 1 46  ? 15.317  61.492  27.142  1.00 76.91  ? 46  SER A CA     1 
ATOM   696  C  C      . SER A 1 46  ? 16.113  60.309  26.609  1.00 78.57  ? 46  SER A C      1 
ATOM   697  O  O      . SER A 1 46  ? 15.945  59.172  27.063  1.00 74.35  ? 46  SER A O      1 
ATOM   698  C  CB     . SER A 1 46  ? 14.127  61.013  27.971  1.00 73.75  ? 46  SER A CB     1 
ATOM   699  O  OG     . SER A 1 46  ? 13.207  60.282  27.177  1.00 51.16  ? 46  SER A OG     1 
ATOM   700  H  H      . SER A 1 46  ? 14.138  62.067  25.671  1.00 86.77  ? 46  SER A H      1 
ATOM   701  H  HA     . SER A 1 46  ? 15.897  62.003  27.726  1.00 92.51  ? 46  SER A HA     1 
ATOM   702  H  HB2    . SER A 1 46  ? 14.451  60.439  28.683  1.00 88.71  ? 46  SER A HB2    1 
ATOM   703  H  HB3    . SER A 1 46  ? 13.675  61.784  28.346  1.00 88.71  ? 46  SER A HB3    1 
ATOM   704  H  HG     . SER A 1 46  ? 12.538  60.066  27.638  1.00 61.61  ? 46  SER A HG     1 
ATOM   705  N  N      . VAL A 1 47  ? 17.008  60.563  25.654  1.00 61.15  ? 47  VAL A N      1 
ATOM   706  C  CA     . VAL A 1 47  ? 17.840  59.529  25.054  1.00 59.16  ? 47  VAL A CA     1 
ATOM   707  C  C      . VAL A 1 47  ? 19.293  59.986  25.070  1.00 71.95  ? 47  VAL A C      1 
ATOM   708  O  O      . VAL A 1 47  ? 19.595  61.151  24.789  1.00 69.94  ? 47  VAL A O      1 
ATOM   709  C  CB     . VAL A 1 47  ? 17.378  59.218  23.614  1.00 68.71  ? 47  VAL A CB     1 
ATOM   710  C  CG1    . VAL A 1 47  ? 18.362  58.297  22.912  1.00 67.12  ? 47  VAL A CG1    1 
ATOM   711  C  CG2    . VAL A 1 47  ? 15.978  58.608  23.627  1.00 59.15  ? 47  VAL A CG2    1 
ATOM   712  H  H      . VAL A 1 47  ? 17.150  61.347  25.333  1.00 73.60  ? 47  VAL A H      1 
ATOM   713  H  HA     . VAL A 1 47  ? 17.783  58.719  25.584  1.00 71.20  ? 47  VAL A HA     1 
ATOM   714  H  HB     . VAL A 1 47  ? 17.345  60.047  23.112  1.00 82.67  ? 47  VAL A HB     1 
ATOM   715  H  HG11   . VAL A 1 47  ? 17.931  57.907  22.135  1.00 80.76  ? 47  VAL A HG11   1 
ATOM   716  H  HG12   . VAL A 1 47  ? 19.137  58.813  22.637  1.00 80.76  ? 47  VAL A HG12   1 
ATOM   717  H  HG13   . VAL A 1 47  ? 18.633  57.597  23.526  1.00 80.76  ? 47  VAL A HG13   1 
ATOM   718  H  HG21   . VAL A 1 47  ? 15.703  58.428  22.715  1.00 71.20  ? 47  VAL A HG21   1 
ATOM   719  H  HG22   . VAL A 1 47  ? 15.998  57.782  24.135  1.00 71.20  ? 47  VAL A HG22   1 
ATOM   720  H  HG23   . VAL A 1 47  ? 15.364  59.235  24.040  1.00 71.20  ? 47  VAL A HG23   1 
ATOM   721  N  N      . GLU A 1 48  ? 20.187  59.052  25.385  1.00 90.84  ? 48  GLU A N      1 
ATOM   722  C  CA     . GLU A 1 48  ? 21.609  59.346  25.513  1.00 89.47  ? 48  GLU A CA     1 
ATOM   723  C  C      . GLU A 1 48  ? 22.212  59.736  24.164  1.00 87.27  ? 48  GLU A C      1 
ATOM   724  O  O      . GLU A 1 48  ? 21.841  59.170  23.131  1.00 91.84  ? 48  GLU A O      1 
ATOM   725  C  CB     . GLU A 1 48  ? 22.357  58.156  26.114  1.00 98.33  ? 48  GLU A CB     1 
ATOM   726  C  CG     . GLU A 1 48  ? 21.918  57.820  27.540  1.00 93.93  ? 48  GLU A CG     1 
ATOM   727  C  CD     . GLU A 1 48  ? 20.687  56.932  27.603  1.00 92.72  ? 48  GLU A CD     1 
ATOM   728  O  OE1    . GLU A 1 48  ? 20.371  56.273  26.589  1.00 80.62  ? 48  GLU A OE1    1 
ATOM   729  O  OE2    . GLU A 1 48  ? 20.029  56.897  28.665  1.00 90.95  ? 48  GLU A OE2    1 
ATOM   730  H  H      . GLU A 1 48  ? 19.995  58.227  25.533  1.00 109.22 ? 48  GLU A H      1 
ATOM   731  H  HA     . GLU A 1 48  ? 21.721  60.101  26.111  1.00 107.59 ? 48  GLU A HA     1 
ATOM   732  H  HB2    . GLU A 1 48  ? 22.197  57.374  25.562  1.00 118.22 ? 48  GLU A HB2    1 
ATOM   733  H  HB3    . GLU A 1 48  ? 23.305  58.360  26.134  1.00 118.22 ? 48  GLU A HB3    1 
ATOM   734  H  HG2    . GLU A 1 48  ? 22.641  57.357  27.990  1.00 112.93 ? 48  GLU A HG2    1 
ATOM   735  H  HG3    . GLU A 1 48  ? 21.712  58.646  28.006  1.00 112.93 ? 48  GLU A HG3    1 
ATOM   736  N  N      . PRO A 1 49  ? 23.133  60.708  24.134  1.00 91.91  ? 49  PRO A N      1 
ATOM   737  C  CA     . PRO A 1 49  ? 23.697  61.134  22.840  1.00 90.90  ? 49  PRO A CA     1 
ATOM   738  C  C      . PRO A 1 49  ? 24.484  60.054  22.128  1.00 105.65 ? 49  PRO A C      1 
ATOM   739  O  O      . PRO A 1 49  ? 24.434  59.972  20.895  1.00 115.58 ? 49  PRO A O      1 
ATOM   740  C  CB     . PRO A 1 49  ? 24.612  62.303  23.221  1.00 96.06  ? 49  PRO A CB     1 
ATOM   741  C  CG     . PRO A 1 49  ? 24.983  62.033  24.645  1.00 105.93 ? 49  PRO A CG     1 
ATOM   742  C  CD     . PRO A 1 49  ? 23.796  61.370  25.272  1.00 94.57  ? 49  PRO A CD     1 
ATOM   743  H  HA     . PRO A 1 49  ? 22.974  61.442  22.271  1.00 109.29 ? 49  PRO A HA     1 
ATOM   744  H  HB2    . PRO A 1 49  ? 25.397  62.310  22.651  1.00 115.49 ? 49  PRO A HB2    1 
ATOM   745  H  HB3    . PRO A 1 49  ? 24.133  63.142  23.137  1.00 115.49 ? 49  PRO A HB3    1 
ATOM   746  H  HG2    . PRO A 1 49  ? 25.756  61.448  24.674  1.00 127.33 ? 49  PRO A HG2    1 
ATOM   747  H  HG3    . PRO A 1 49  ? 25.183  62.870  25.093  1.00 127.33 ? 49  PRO A HG3    1 
ATOM   748  H  HD2    . PRO A 1 49  ? 24.075  60.718  25.935  1.00 113.70 ? 49  PRO A HD2    1 
ATOM   749  H  HD3    . PRO A 1 49  ? 23.209  62.026  25.679  1.00 113.70 ? 49  PRO A HD3    1 
ATOM   750  N  N      . GLY A 1 50  ? 25.258  59.256  22.859  1.00 108.54 ? 50  GLY A N      1 
ATOM   751  C  CA     . GLY A 1 50  ? 26.025  58.218  22.211  1.00 104.03 ? 50  GLY A CA     1 
ATOM   752  C  C      . GLY A 1 50  ? 25.276  56.912  22.326  1.00 105.99 ? 50  GLY A C      1 
ATOM   753  O  O      . GLY A 1 50  ? 25.189  56.326  23.410  1.00 103.74 ? 50  GLY A O      1 
ATOM   754  H  H      . GLY A 1 50  ? 25.349  59.300  23.714  1.00 130.47 ? 50  GLY A H      1 
ATOM   755  H  HA2    . GLY A 1 50  ? 26.152  58.432  21.273  1.00 125.05 ? 50  GLY A HA2    1 
ATOM   756  H  HA3    . GLY A 1 50  ? 26.893  58.128  22.635  1.00 125.05 ? 50  GLY A HA3    1 
ATOM   757  N  N      . ARG A 1 51  ? 24.762  56.431  21.200  1.00 102.05 ? 51  ARG A N      1 
ATOM   758  C  CA     . ARG A 1 51  ? 23.914  55.253  21.173  1.00 108.65 ? 51  ARG A CA     1 
ATOM   759  C  C      . ARG A 1 51  ? 24.618  54.185  20.352  1.00 100.53 ? 51  ARG A C      1 
ATOM   760  O  O      . ARG A 1 51  ? 25.419  54.485  19.463  1.00 99.76  ? 51  ARG A O      1 
ATOM   761  C  CB     . ARG A 1 51  ? 22.525  55.549  20.574  1.00 103.28 ? 51  ARG A CB     1 
ATOM   762  C  CG     . ARG A 1 51  ? 21.846  56.781  21.165  1.00 100.23 ? 51  ARG A CG     1 
ATOM   763  C  CD     . ARG A 1 51  ? 22.013  58.012  20.277  1.00 104.89 ? 51  ARG A CD     1 
ATOM   764  N  NE     . ARG A 1 51  ? 20.844  58.893  20.284  1.00 102.07 ? 51  ARG A NE     1 
ATOM   765  C  CZ     . ARG A 1 51  ? 20.888  60.193  19.995  1.00 96.98  ? 51  ARG A CZ     1 
ATOM   766  N  NH1    . ARG A 1 51  ? 22.037  60.770  19.664  1.00 95.99  ? 51  ARG A NH1    1 
ATOM   767  N  NH2    . ARG A 1 51  ? 19.781  60.923  20.036  1.00 90.20  ? 51  ARG A NH2    1 
ATOM   768  H  H      . ARG A 1 51  ? 24.896  56.780  20.426  1.00 122.67 ? 51  ARG A H      1 
ATOM   769  H  HA     . ARG A 1 51  ? 23.765  54.928  22.075  1.00 130.60 ? 51  ARG A HA     1 
ATOM   770  H  HB2    . ARG A 1 51  ? 22.622  55.694  19.620  1.00 124.15 ? 51  ARG A HB2    1 
ATOM   771  H  HB3    . ARG A 1 51  ? 21.947  54.786  20.737  1.00 124.15 ? 51  ARG A HB3    1 
ATOM   772  H  HG2    . ARG A 1 51  ? 20.897  56.606  21.263  1.00 120.49 ? 51  ARG A HG2    1 
ATOM   773  H  HG3    . ARG A 1 51  ? 22.238  56.977  22.030  1.00 120.49 ? 51  ARG A HG3    1 
ATOM   774  H  HD2    . ARG A 1 51  ? 22.774  58.525  20.591  1.00 126.08 ? 51  ARG A HD2    1 
ATOM   775  H  HD3    . ARG A 1 51  ? 22.162  57.723  19.363  1.00 126.08 ? 51  ARG A HD3    1 
ATOM   776  H  HE     . ARG A 1 51  ? 20.082  58.550  20.488  1.00 122.70 ? 51  ARG A HE     1 
ATOM   777  H  HH11   . ARG A 1 51  ? 22.760  60.304  19.635  1.00 115.40 ? 51  ARG A HH11   1 
ATOM   778  H  HH12   . ARG A 1 51  ? 22.060  61.609  19.478  1.00 115.40 ? 51  ARG A HH12   1 
ATOM   779  H  HH21   . ARG A 1 51  ? 19.032  60.557  20.250  1.00 108.46 ? 51  ARG A HH21   1 
ATOM   780  H  HH22   . ARG A 1 51  ? 19.811  61.762  19.849  1.00 108.46 ? 51  ARG A HH22   1 
ATOM   781  N  N      . VAL A 1 52  ? 24.306  52.938  20.658  1.00 109.16 ? 52  VAL A N      1 
ATOM   782  C  CA     . VAL A 1 52  ? 24.839  51.795  19.936  1.00 105.00 ? 52  VAL A CA     1 
ATOM   783  C  C      . VAL A 1 52  ? 23.715  51.276  19.048  1.00 103.03 ? 52  VAL A C      1 
ATOM   784  O  O      . VAL A 1 52  ? 22.794  50.598  19.518  1.00 102.41 ? 52  VAL A O      1 
ATOM   785  C  CB     . VAL A 1 52  ? 25.371  50.718  20.890  1.00 89.17  ? 52  VAL A CB     1 
ATOM   786  C  CG1    . VAL A 1 52  ? 26.600  51.240  21.631  1.00 73.06  ? 52  VAL A CG1    1 
ATOM   787  C  CG2    . VAL A 1 52  ? 24.295  50.282  21.886  1.00 79.39  ? 52  VAL A CG2    1 
ATOM   788  H  H      . VAL A 1 52  ? 23.773  52.724  21.298  1.00 131.21 ? 52  VAL A H      1 
ATOM   789  H  HA     . VAL A 1 52  ? 25.570  52.075  19.362  1.00 126.22 ? 52  VAL A HA     1 
ATOM   790  H  HB     . VAL A 1 52  ? 25.625  49.940  20.369  1.00 107.21 ? 52  VAL A HB     1 
ATOM   791  H  HG11   . VAL A 1 52  ? 26.929  50.547  22.224  1.00 87.89  ? 52  VAL A HG11   1 
ATOM   792  H  HG12   . VAL A 1 52  ? 27.284  51.474  20.984  1.00 87.89  ? 52  VAL A HG12   1 
ATOM   793  H  HG13   . VAL A 1 52  ? 26.350  52.024  22.145  1.00 87.89  ? 52  VAL A HG13   1 
ATOM   794  H  HG21   . VAL A 1 52  ? 24.653  50.346  22.786  1.00 95.48  ? 52  VAL A HG21   1 
ATOM   795  H  HG22   . VAL A 1 52  ? 23.525  50.865  21.794  1.00 95.48  ? 52  VAL A HG22   1 
ATOM   796  H  HG23   . VAL A 1 52  ? 24.041  49.366  21.696  1.00 95.48  ? 52  VAL A HG23   1 
ATOM   797  N  N      . MET A 1 53  ? 23.789  51.593  17.755  1.00 91.18  ? 53  MET A N      1 
ATOM   798  C  CA     . MET A 1 53  ? 22.765  51.192  16.793  1.00 95.34  ? 53  MET A CA     1 
ATOM   799  C  C      . MET A 1 53  ? 23.255  49.970  16.033  1.00 80.10  ? 53  MET A C      1 
ATOM   800  O  O      . MET A 1 53  ? 24.043  50.074  15.090  1.00 84.57  ? 53  MET A O      1 
ATOM   801  C  CB     . MET A 1 53  ? 22.395  52.323  15.837  1.00 82.91  ? 53  MET A CB     1 
ATOM   802  C  CG     . MET A 1 53  ? 21.565  53.426  16.465  1.00 72.45  ? 53  MET A CG     1 
ATOM   803  S  SD     . MET A 1 53  ? 19.790  53.116  16.245  1.00 69.02  ? 53  MET A SD     1 
ATOM   804  C  CE     . MET A 1 53  ? 19.528  51.602  17.176  1.00 55.88  ? 53  MET A CE     1 
ATOM   805  H  H      . MET A 1 53  ? 24.432  52.047  17.409  1.00 109.63 ? 53  MET A H      1 
ATOM   806  H  HA     . MET A 1 53  ? 21.969  50.961  17.298  1.00 114.62 ? 53  MET A HA     1 
ATOM   807  H  HB2    . MET A 1 53  ? 23.212  52.724  15.502  1.00 99.71  ? 53  MET A HB2    1 
ATOM   808  H  HB3    . MET A 1 53  ? 21.882  51.952  15.102  1.00 99.71  ? 53  MET A HB3    1 
ATOM   809  H  HG2    . MET A 1 53  ? 21.753  53.469  17.416  1.00 87.15  ? 53  MET A HG2    1 
ATOM   810  H  HG3    . MET A 1 53  ? 21.783  54.272  16.045  1.00 87.15  ? 53  MET A HG3    1 
ATOM   811  H  HE1    . MET A 1 53  ? 18.576  51.477  17.315  1.00 67.27  ? 53  MET A HE1    1 
ATOM   812  H  HE2    . MET A 1 53  ? 19.890  50.855  16.674  1.00 67.27  ? 53  MET A HE2    1 
ATOM   813  H  HE3    . MET A 1 53  ? 19.980  51.675  18.031  1.00 67.27  ? 53  MET A HE3    1 
ATOM   814  N  N      . THR A 1 54  ? 22.775  48.812  16.470  1.00 71.70  ? 54  THR A N      1 
ATOM   815  C  CA     . THR A 1 54  ? 23.015  47.538  15.819  1.00 68.36  ? 54  THR A CA     1 
ATOM   816  C  C      . THR A 1 54  ? 21.796  47.036  15.064  1.00 66.73  ? 54  THR A C      1 
ATOM   817  O  O      . THR A 1 54  ? 21.832  45.928  14.520  1.00 63.76  ? 54  THR A O      1 
ATOM   818  C  CB     . THR A 1 54  ? 23.441  46.505  16.869  1.00 76.77  ? 54  THR A CB     1 
ATOM   819  O  OG1    . THR A 1 54  ? 23.758  45.260  16.231  1.00 68.17  ? 54  THR A OG1    1 
ATOM   820  C  CG2    . THR A 1 54  ? 22.349  46.331  17.931  1.00 57.99  ? 54  THR A CG2    1 
ATOM   821  H  H      . THR A 1 54  ? 22.286  48.740  17.173  1.00 86.26  ? 54  THR A H      1 
ATOM   822  H  HA     . THR A 1 54  ? 23.739  47.632  15.180  1.00 82.24  ? 54  THR A HA     1 
ATOM   823  H  HB     . THR A 1 54  ? 24.237  46.811  17.332  1.00 92.34  ? 54  THR A HB     1 
ATOM   824  H  HG1    . THR A 1 54  ? 24.195  45.401  15.528  1.00 82.02  ? 54  THR A HG1    1 
ATOM   825  H  HG21   . THR A 1 54  ? 22.513  45.526  18.447  1.00 69.81  ? 54  THR A HG21   1 
ATOM   826  H  HG22   . THR A 1 54  ? 22.346  47.094  18.531  1.00 69.81  ? 54  THR A HG22   1 
ATOM   827  H  HG23   . THR A 1 54  ? 21.480  46.262  17.506  1.00 69.81  ? 54  THR A HG23   1 
ATOM   828  N  N      . ARG A 1 55  ? 20.719  47.822  15.017  1.00 52.64  ? 55  ARG A N      1 
ATOM   829  C  CA     . ARG A 1 55  ? 19.529  47.442  14.278  1.00 47.50  ? 55  ARG A CA     1 
ATOM   830  C  C      . ARG A 1 55  ? 19.541  48.032  12.876  1.00 35.20  ? 55  ARG A C      1 
ATOM   831  O  O      . ARG A 1 55  ? 20.020  49.152  12.669  1.00 45.87  ? 55  ARG A O      1 
ATOM   832  C  CB     . ARG A 1 55  ? 18.275  47.919  15.003  1.00 47.53  ? 55  ARG A CB     1 
ATOM   833  C  CG     . ARG A 1 55  ? 17.907  47.159  16.260  1.00 43.95  ? 55  ARG A CG     1 
ATOM   834  C  CD     . ARG A 1 55  ? 16.704  47.815  16.912  1.00 17.14  ? 55  ARG A CD     1 
ATOM   835  N  NE     . ARG A 1 55  ? 17.069  48.941  17.765  1.00 35.04  ? 55  ARG A NE     1 
ATOM   836  C  CZ     . ARG A 1 55  ? 16.205  49.842  18.219  1.00 36.32  ? 55  ARG A CZ     1 
ATOM   837  N  NH1    . ARG A 1 55  ? 14.927  49.769  17.868  1.00 39.74  ? 55  ARG A NH1    1 
ATOM   838  N  NH2    . ARG A 1 55  ? 16.618  50.822  19.015  1.00 37.69  ? 55  ARG A NH2    1 
ATOM   839  H  H      . ARG A 1 55  ? 20.655  48.585  15.408  1.00 63.39  ? 55  ARG A H      1 
ATOM   840  H  HA     . ARG A 1 55  ? 19.499  46.475  14.204  1.00 57.22  ? 55  ARG A HA     1 
ATOM   841  H  HB2    . ARG A 1 55  ? 18.406  48.846  15.256  1.00 57.25  ? 55  ARG A HB2    1 
ATOM   842  H  HB3    . ARG A 1 55  ? 17.525  47.844  14.393  1.00 57.25  ? 55  ARG A HB3    1 
ATOM   843  H  HG2    . ARG A 1 55  ? 17.683  46.243  16.037  1.00 52.96  ? 55  ARG A HG2    1 
ATOM   844  H  HG3    . ARG A 1 55  ? 18.650  47.177  16.884  1.00 52.96  ? 55  ARG A HG3    1 
ATOM   845  H  HD2    . ARG A 1 55  ? 16.108  48.143  16.220  1.00 20.79  ? 55  ARG A HD2    1 
ATOM   846  H  HD3    . ARG A 1 55  ? 16.245  47.160  17.461  1.00 20.79  ? 55  ARG A HD3    1 
ATOM   847  H  HE     . ARG A 1 55  ? 17.895  49.027  17.987  1.00 42.26  ? 55  ARG A HE     1 
ATOM   848  H  HH11   . ARG A 1 55  ? 14.659  49.140  17.346  1.00 47.91  ? 55  ARG A HH11   1 
ATOM   849  H  HH12   . ARG A 1 55  ? 14.366  50.352  18.161  1.00 47.91  ? 55  ARG A HH12   1 
ATOM   850  H  HH21   . ARG A 1 55  ? 17.447  50.874  19.237  1.00 45.44  ? 55  ARG A HH21   1 
ATOM   851  H  HH22   . ARG A 1 55  ? 16.056  51.403  19.308  1.00 45.44  ? 55  ARG A HH22   1 
ATOM   852  N  N      . PRO A 1 56  ? 18.993  47.317  11.899  1.00 17.12  ? 56  PRO A N      1 
ATOM   853  C  CA     . PRO A 1 56  ? 18.871  47.900  10.563  1.00 25.11  ? 56  PRO A CA     1 
ATOM   854  C  C      . PRO A 1 56  ? 17.932  49.091  10.584  1.00 29.63  ? 56  PRO A C      1 
ATOM   855  O  O      . PRO A 1 56  ? 16.869  49.060  11.206  1.00 47.86  ? 56  PRO A O      1 
ATOM   856  C  CB     . PRO A 1 56  ? 18.309  46.752  9.717   1.00 21.11  ? 56  PRO A CB     1 
ATOM   857  C  CG     . PRO A 1 56  ? 17.704  45.818  10.675  1.00 29.31  ? 56  PRO A CG     1 
ATOM   858  C  CD     . PRO A 1 56  ? 18.516  45.926  11.931  1.00 35.84  ? 56  PRO A CD     1 
ATOM   859  H  HA     . PRO A 1 56  ? 19.738  48.162  10.215  1.00 30.35  ? 56  PRO A HA     1 
ATOM   860  H  HB2    . PRO A 1 56  ? 17.642  47.094  9.101   1.00 25.55  ? 56  PRO A HB2    1 
ATOM   861  H  HB3    . PRO A 1 56  ? 19.027  46.324  9.225   1.00 25.55  ? 56  PRO A HB3    1 
ATOM   862  H  HG2    . PRO A 1 56  ? 16.783  46.072  10.840  1.00 35.38  ? 56  PRO A HG2    1 
ATOM   863  H  HG3    . PRO A 1 56  ? 17.741  44.917  10.320  1.00 35.38  ? 56  PRO A HG3    1 
ATOM   864  H  HD2    . PRO A 1 56  ? 17.965  45.767  12.714  1.00 43.23  ? 56  PRO A HD2    1 
ATOM   865  H  HD3    . PRO A 1 56  ? 19.260  45.304  11.917  1.00 43.23  ? 56  PRO A HD3    1 
ATOM   866  N  N      . MET A 1 57  ? 18.330  50.139  9.880   1.00 37.38  ? 57  MET A N      1 
ATOM   867  C  CA     . MET A 1 57  ? 17.518  51.334  9.747   1.00 28.83  ? 57  MET A CA     1 
ATOM   868  C  C      . MET A 1 57  ? 17.390  51.659  8.268   1.00 16.04  ? 57  MET A C      1 
ATOM   869  O  O      . MET A 1 57  ? 18.288  51.380  7.471   1.00 37.55  ? 57  MET A O      1 
ATOM   870  C  CB     . MET A 1 57  ? 18.118  52.516  10.535  1.00 25.42  ? 57  MET A CB     1 
ATOM   871  C  CG     . MET A 1 57  ? 19.541  52.879  10.166  1.00 38.12  ? 57  MET A CG     1 
ATOM   872  S  SD     . MET A 1 57  ? 20.187  54.248  11.162  1.00 41.27  ? 57  MET A SD     1 
ATOM   873  C  CE     . MET A 1 57  ? 20.147  53.581  12.824  1.00 37.63  ? 57  MET A CE     1 
ATOM   874  H  H      . MET A 1 57  ? 19.081  50.180  9.463   1.00 45.08  ? 57  MET A H      1 
ATOM   875  H  HA     . MET A 1 57  ? 16.631  51.188  10.110  1.00 34.81  ? 57  MET A HA     1 
ATOM   876  H  HB2    . MET A 1 57  ? 17.569  53.300  10.378  1.00 30.72  ? 57  MET A HB2    1 
ATOM   877  H  HB3    . MET A 1 57  ? 18.112  52.290  11.478  1.00 30.72  ? 57  MET A HB3    1 
ATOM   878  H  HG2    . MET A 1 57  ? 20.113  52.108  10.307  1.00 45.96  ? 57  MET A HG2    1 
ATOM   879  H  HG3    . MET A 1 57  ? 19.569  53.146  9.234   1.00 45.96  ? 57  MET A HG3    1 
ATOM   880  H  HE1    . MET A 1 57  ? 20.696  54.136  13.400  1.00 45.37  ? 57  MET A HE1    1 
ATOM   881  H  HE2    . MET A 1 57  ? 19.231  53.579  13.142  1.00 45.37  ? 57  MET A HE2    1 
ATOM   882  H  HE3    . MET A 1 57  ? 20.494  52.675  12.810  1.00 45.37  ? 57  MET A HE3    1 
ATOM   883  N  N      . CYS A 1 58  ? 16.251  52.241  7.911   1.00 25.46  ? 58  CYS A N      1 
ATOM   884  C  CA     . CYS A 1 58  ? 15.974  52.577  6.525   1.00 26.49  ? 58  CYS A CA     1 
ATOM   885  C  C      . CYS A 1 58  ? 16.817  53.778  6.108   1.00 26.92  ? 58  CYS A C      1 
ATOM   886  O  O      . CYS A 1 58  ? 17.632  54.300  6.876   1.00 33.12  ? 58  CYS A O      1 
ATOM   887  C  CB     . CYS A 1 58  ? 14.484  52.853  6.340   1.00 22.49  ? 58  CYS A CB     1 
ATOM   888  S  SG     . CYS A 1 58  ? 13.814  54.085  7.493   1.00 25.95  ? 58  CYS A SG     1 
ATOM   889  H  H      . CYS A 1 58  ? 15.620  52.452  8.456   1.00 30.77  ? 58  CYS A H      1 
ATOM   890  H  HA     . CYS A 1 58  ? 16.212  51.827  5.958   1.00 32.00  ? 58  CYS A HA     1 
ATOM   891  H  HB2    . CYS A 1 58  ? 14.339  53.182  5.439   1.00 27.20  ? 58  CYS A HB2    1 
ATOM   892  H  HB3    . CYS A 1 58  ? 13.996  52.026  6.475   1.00 27.20  ? 58  CYS A HB3    1 
ATOM   893  H  HG     . CYS A 1 58  ? 14.379  55.129  7.321   1.00 31.36  ? 58  CYS A HG     1 
ATOM   894  N  N      . ASN A 1 59  ? 16.636  54.213  4.865   1.00 25.59  ? 59  ASN A N      1 
ATOM   895  C  CA     . ASN A 1 59  ? 17.293  55.431  4.424   1.00 32.34  ? 59  ASN A CA     1 
ATOM   896  C  C      . ASN A 1 59  ? 16.571  56.637  5.026   1.00 42.50  ? 59  ASN A C      1 
ATOM   897  O  O      . ASN A 1 59  ? 15.606  56.506  5.788   1.00 32.11  ? 59  ASN A O      1 
ATOM   898  C  CB     . ASN A 1 59  ? 17.335  55.494  2.897   1.00 27.37  ? 59  ASN A CB     1 
ATOM   899  C  CG     . ASN A 1 59  ? 15.957  55.565  2.267   1.00 33.69  ? 59  ASN A CG     1 
ATOM   900  O  OD1    . ASN A 1 59  ? 15.038  56.182  2.808   1.00 38.82  ? 59  ASN A OD1    1 
ATOM   901  N  ND2    . ASN A 1 59  ? 15.804  54.911  1.119   1.00 39.45  ? 59  ASN A ND2    1 
ATOM   902  H  H      . ASN A 1 59  ? 16.147  53.827  4.272   1.00 30.93  ? 59  ASN A H      1 
ATOM   903  H  HA     . ASN A 1 59  ? 18.211  55.436  4.736   1.00 39.02  ? 59  ASN A HA     1 
ATOM   904  H  HB2    . ASN A 1 59  ? 17.827  56.285  2.628   1.00 33.06  ? 59  ASN A HB2    1 
ATOM   905  H  HB3    . ASN A 1 59  ? 17.776  54.698  2.562   1.00 33.06  ? 59  ASN A HB3    1 
ATOM   906  H  HD21   . ASN A 1 59  ? 15.043  54.918  0.718   1.00 47.55  ? 59  ASN A HD21   1 
ATOM   907  H  HD22   . ASN A 1 59  ? 16.466  54.481  0.777   1.00 47.55  ? 59  ASN A HD22   1 
ATOM   908  N  N      . ASP A 1 60  ? 17.036  57.836  4.679   1.00 36.42  ? 60  ASP A N      1 
ATOM   909  C  CA     . ASP A 1 60  ? 16.463  59.040  5.267   1.00 25.13  ? 60  ASP A CA     1 
ATOM   910  C  C      . ASP A 1 60  ? 15.127  59.404  4.633   1.00 20.43  ? 60  ASP A C      1 
ATOM   911  O  O      . ASP A 1 60  ? 14.239  59.925  5.319   1.00 34.87  ? 60  ASP A O      1 
ATOM   912  C  CB     . ASP A 1 60  ? 17.447  60.203  5.139   1.00 29.15  ? 60  ASP A CB     1 
ATOM   913  C  CG     . ASP A 1 60  ? 18.688  60.007  5.987   1.00 24.50  ? 60  ASP A CG     1 
ATOM   914  O  OD1    . ASP A 1 60  ? 18.742  59.013  6.737   1.00 34.02  ? 60  ASP A OD1    1 
ATOM   915  O  OD2    . ASP A 1 60  ? 19.614  60.839  5.901   1.00 37.91  ? 60  ASP A OD2    1 
ATOM   916  H  H      . ASP A 1 60  ? 17.671  57.976  4.117   1.00 43.92  ? 60  ASP A H      1 
ATOM   917  H  HA     . ASP A 1 60  ? 16.308  58.887  6.212   1.00 30.38  ? 60  ASP A HA     1 
ATOM   918  H  HB2    . ASP A 1 60  ? 17.725  60.283  4.213   1.00 35.19  ? 60  ASP A HB2    1 
ATOM   919  H  HB3    . ASP A 1 60  ? 17.012  61.020  5.426   1.00 35.19  ? 60  ASP A HB3    1 
ATOM   920  N  N      . ASP A 1 61  ? 14.964  59.144  3.337   1.00 19.14  ? 61  ASP A N      1 
ATOM   921  C  CA     . ASP A 1 61  ? 13.710  59.468  2.666   1.00 33.80  ? 61  ASP A CA     1 
ATOM   922  C  C      . ASP A 1 61  ? 12.564  58.626  3.215   1.00 32.47  ? 61  ASP A C      1 
ATOM   923  O  O      . ASP A 1 61  ? 11.510  59.157  3.597   1.00 33.45  ? 61  ASP A O      1 
ATOM   924  C  CB     . ASP A 1 61  ? 13.861  59.266  1.158   1.00 45.02  ? 61  ASP A CB     1 
ATOM   925  C  CG     . ASP A 1 61  ? 14.997  60.085  0.571   1.00 36.83  ? 61  ASP A CG     1 
ATOM   926  O  OD1    . ASP A 1 61  ? 16.150  59.600  0.575   1.00 45.71  ? 61  ASP A OD1    1 
ATOM   927  O  OD2    . ASP A 1 61  ? 14.741  61.217  0.115   1.00 47.09  ? 61  ASP A OD2    1 
ATOM   928  H  H      . ASP A 1 61  ? 15.557  58.784  2.828   1.00 23.18  ? 61  ASP A H      1 
ATOM   929  H  HA     . ASP A 1 61  ? 13.497  60.401  2.824   1.00 40.77  ? 61  ASP A HA     1 
ATOM   930  H  HB2    . ASP A 1 61  ? 14.043  58.329  0.981   1.00 54.25  ? 61  ASP A HB2    1 
ATOM   931  H  HB3    . ASP A 1 61  ? 13.039  59.533  0.719   1.00 54.25  ? 61  ASP A HB3    1 
ATOM   932  N  N      . ASP A 1 62  ? 12.744  57.303  3.236   1.00 33.05  ? 62  ASP A N      1 
ATOM   933  C  CA     . ASP A 1 62  ? 11.720  56.422  3.785   1.00 32.79  ? 62  ASP A CA     1 
ATOM   934  C  C      . ASP A 1 62  ? 11.441  56.754  5.243   1.00 31.33  ? 62  ASP A C      1 
ATOM   935  O  O      . ASP A 1 62  ? 10.284  56.746  5.680   1.00 27.20  ? 62  ASP A O      1 
ATOM   936  C  CB     . ASP A 1 62  ? 12.161  54.965  3.649   1.00 31.77  ? 62  ASP A CB     1 
ATOM   937  C  CG     . ASP A 1 62  ? 12.374  54.556  2.211   1.00 37.45  ? 62  ASP A CG     1 
ATOM   938  O  OD1    . ASP A 1 62  ? 12.088  55.383  1.318   1.00 38.31  ? 62  ASP A OD1    1 
ATOM   939  O  OD2    . ASP A 1 62  ? 12.839  53.417  1.978   1.00 29.96  ? 62  ASP A OD2    1 
ATOM   940  H  H      . ASP A 1 62  ? 13.441  56.895  2.942   1.00 39.88  ? 62  ASP A H      1 
ATOM   941  H  HA     . ASP A 1 62  ? 10.899  56.540  3.282   1.00 39.57  ? 62  ASP A HA     1 
ATOM   942  H  HB2    . ASP A 1 62  ? 12.997  54.841  4.124   1.00 38.34  ? 62  ASP A HB2    1 
ATOM   943  H  HB3    . ASP A 1 62  ? 11.476  54.390  4.026   1.00 38.34  ? 62  ASP A HB3    1 
ATOM   944  N  N      . GLY A 1 63  ? 12.489  57.043  6.014   1.00 24.02  ? 63  GLY A N      1 
ATOM   945  C  CA     . GLY A 1 63  ? 12.285  57.432  7.398   1.00 26.42  ? 63  GLY A CA     1 
ATOM   946  C  C      . GLY A 1 63  ? 11.398  58.655  7.516   1.00 28.30  ? 63  GLY A C      1 
ATOM   947  O  O      . GLY A 1 63  ? 10.456  58.683  8.310   1.00 23.39  ? 63  GLY A O      1 
ATOM   948  H  H      . GLY A 1 63  ? 13.312  57.021  5.764   1.00 29.03  ? 63  GLY A H      1 
ATOM   949  H  HA2    . GLY A 1 63  ? 11.868  56.702  7.881   1.00 31.92  ? 63  GLY A HA2    1 
ATOM   950  H  HA3    . GLY A 1 63  ? 13.142  57.633  7.807   1.00 31.92  ? 63  GLY A HA3    1 
ATOM   951  N  N      . MET A 1 64  ? 11.678  59.679  6.709   1.00 34.25  ? 64  MET A N      1 
ATOM   952  C  CA     . MET A 1 64  ? 10.880  60.898  6.765   1.00 26.91  ? 64  MET A CA     1 
ATOM   953  C  C      . MET A 1 64  ? 9.432   60.628  6.377   1.00 33.71  ? 64  MET A C      1 
ATOM   954  O  O      . MET A 1 64  ? 8.504   61.121  7.031   1.00 33.89  ? 64  MET A O      1 
ATOM   955  C  CB     . MET A 1 64  ? 11.493  61.944  5.831   1.00 31.95  ? 64  MET A CB     1 
ATOM   956  C  CG     . MET A 1 64  ? 10.940  63.355  5.971   1.00 37.16  ? 64  MET A CG     1 
ATOM   957  S  SD     . MET A 1 64  ? 11.490  64.208  7.461   1.00 72.19  ? 64  MET A SD     1 
ATOM   958  C  CE     . MET A 1 64  ? 13.263  64.279  7.196   1.00 67.29  ? 64  MET A CE     1 
ATOM   959  H  H      . MET A 1 64  ? 12.313  59.694  6.129   1.00 41.32  ? 64  MET A H      1 
ATOM   960  H  HA     . MET A 1 64  ? 10.898  61.244  7.671   1.00 32.51  ? 64  MET A HA     1 
ATOM   961  H  HB2    . MET A 1 64  ? 12.446  61.989  6.007   1.00 38.55  ? 64  MET A HB2    1 
ATOM   962  H  HB3    . MET A 1 64  ? 11.338  61.663  4.915   1.00 38.55  ? 64  MET A HB3    1 
ATOM   963  H  HG2    . MET A 1 64  ? 11.226  63.879  5.207   1.00 44.81  ? 64  MET A HG2    1 
ATOM   964  H  HG3    . MET A 1 64  ? 9.971   63.309  5.997   1.00 44.81  ? 64  MET A HG3    1 
ATOM   965  H  HE1    . MET A 1 64  ? 13.659  64.858  7.867   1.00 80.97  ? 64  MET A HE1    1 
ATOM   966  H  HE2    . MET A 1 64  ? 13.630  63.385  7.273   1.00 80.97  ? 64  MET A HE2    1 
ATOM   967  H  HE3    . MET A 1 64  ? 13.437  64.633  6.310   1.00 80.97  ? 64  MET A HE3    1 
ATOM   968  N  N      . LEU A 1 65  ? 9.216   59.824  5.334   1.00 24.11  ? 65  LEU A N      1 
ATOM   969  C  CA     . LEU A 1 65  ? 7.851   59.541  4.895   1.00 25.73  ? 65  LEU A CA     1 
ATOM   970  C  C      . LEU A 1 65  ? 7.078   58.780  5.967   1.00 26.89  ? 65  LEU A C      1 
ATOM   971  O  O      . LEU A 1 65  ? 5.935   59.129  6.303   1.00 33.58  ? 65  LEU A O      1 
ATOM   972  C  CB     . LEU A 1 65  ? 7.879   58.764  3.579   1.00 17.64  ? 65  LEU A CB     1 
ATOM   973  C  CG     . LEU A 1 65  ? 6.527   58.479  2.921   1.00 31.51  ? 65  LEU A CG     1 
ATOM   974  C  CD1    . LEU A 1 65  ? 6.700   58.328  1.423   1.00 34.60  ? 65  LEU A CD1    1 
ATOM   975  C  CD2    . LEU A 1 65  ? 5.884   57.232  3.498   1.00 40.01  ? 65  LEU A CD2    1 
ATOM   976  H  H      . LEU A 1 65  ? 9.830   59.437  4.871   1.00 29.15  ? 65  LEU A H      1 
ATOM   977  H  HA     . LEU A 1 65  ? 7.389   60.378  4.737   1.00 31.09  ? 65  LEU A HA     1 
ATOM   978  H  HB2    . LEU A 1 65  ? 8.404   59.274  2.941   1.00 21.39  ? 65  LEU A HB2    1 
ATOM   979  H  HB3    . LEU A 1 65  ? 8.301   57.907  3.745   1.00 21.39  ? 65  LEU A HB3    1 
ATOM   980  H  HG     . LEU A 1 65  ? 5.934   59.226  3.099   1.00 38.03  ? 65  LEU A HG     1 
ATOM   981  H  HD11   . LEU A 1 65  ? 5.839   58.131  1.024   1.00 41.73  ? 65  LEU A HD11   1 
ATOM   982  H  HD12   . LEU A 1 65  ? 7.051   59.157  1.061   1.00 41.73  ? 65  LEU A HD12   1 
ATOM   983  H  HD13   . LEU A 1 65  ? 7.320   57.603  1.248   1.00 41.73  ? 65  LEU A HD13   1 
ATOM   984  H  HD21   . LEU A 1 65  ? 5.220   56.902  2.873   1.00 48.22  ? 65  LEU A HD21   1 
ATOM   985  H  HD22   . LEU A 1 65  ? 6.569   56.560  3.639   1.00 48.22  ? 65  LEU A HD22   1 
ATOM   986  H  HD23   . LEU A 1 65  ? 5.462   57.456  4.342   1.00 48.22  ? 65  LEU A HD23   1 
ATOM   987  N  N      . ILE A 1 66  ? 7.691   57.730  6.514   1.00 33.70  ? 66  ILE A N      1 
ATOM   988  C  CA     . ILE A 1 66  ? 7.038   56.936  7.547   1.00 31.77  ? 66  ILE A CA     1 
ATOM   989  C  C      . ILE A 1 66  ? 6.765   57.793  8.775   1.00 27.68  ? 66  ILE A C      1 
ATOM   990  O  O      . ILE A 1 66  ? 5.716   57.663  9.416   1.00 21.66  ? 66  ILE A O      1 
ATOM   991  C  CB     . ILE A 1 66  ? 7.900   55.704  7.881   1.00 26.14  ? 66  ILE A CB     1 
ATOM   992  C  CG1    . ILE A 1 66  ? 8.061   54.824  6.637   1.00 23.75  ? 66  ILE A CG1    1 
ATOM   993  C  CG2    . ILE A 1 66  ? 7.278   54.908  9.010   1.00 24.95  ? 66  ILE A CG2    1 
ATOM   994  C  CD1    . ILE A 1 66  ? 9.119   53.737  6.771   1.00 25.31  ? 66  ILE A CD1    1 
ATOM   995  H  H      . ILE A 1 66  ? 8.480   57.458  6.306   1.00 40.66  ? 66  ILE A H      1 
ATOM   996  H  HA     . ILE A 1 66  ? 6.183   56.622  7.213   1.00 38.34  ? 66  ILE A HA     1 
ATOM   997  H  HB     . ILE A 1 66  ? 8.775   56.010  8.167   1.00 31.58  ? 66  ILE A HB     1 
ATOM   998  H  HG12   . ILE A 1 66  ? 7.214   54.388  6.453   1.00 28.71  ? 66  ILE A HG12   1 
ATOM   999  H  HG13   . ILE A 1 66  ? 8.312   55.388  5.889   1.00 28.71  ? 66  ILE A HG13   1 
ATOM   1000 H  HG21   . ILE A 1 66  ? 7.761   54.073  9.112   1.00 30.16  ? 66  ILE A HG21   1 
ATOM   1001 H  HG22   . ILE A 1 66  ? 7.335   55.425  9.830   1.00 30.16  ? 66  ILE A HG22   1 
ATOM   1002 H  HG23   . ILE A 1 66  ? 6.349   54.729  8.796   1.00 30.16  ? 66  ILE A HG23   1 
ATOM   1003 H  HD11   . ILE A 1 66  ? 9.262   53.326  5.904   1.00 30.58  ? 66  ILE A HD11   1 
ATOM   1004 H  HD12   . ILE A 1 66  ? 9.944   54.137  7.088   1.00 30.58  ? 66  ILE A HD12   1 
ATOM   1005 H  HD13   . ILE A 1 66  ? 8.809   53.072  7.406   1.00 30.58  ? 66  ILE A HD13   1 
ATOM   1006 N  N      . SER A 1 67  ? 7.690   58.696  9.114   1.00 24.26  ? 67  SER A N      1 
ATOM   1007 C  CA     . SER A 1 67  ? 7.470   59.580  10.252  1.00 19.38  ? 67  SER A CA     1 
ATOM   1008 C  C      . SER A 1 67  ? 6.281   60.493  10.006  1.00 23.99  ? 67  SER A C      1 
ATOM   1009 O  O      . SER A 1 67  ? 5.455   60.700  10.900  1.00 24.14  ? 67  SER A O      1 
ATOM   1010 C  CB     . SER A 1 67  ? 8.724   60.402  10.540  1.00 13.98  ? 67  SER A CB     1 
ATOM   1011 O  OG     . SER A 1 67  ? 9.780   59.572  10.982  1.00 15.96  ? 67  SER A OG     1 
ATOM   1012 H  H      . SER A 1 67  ? 8.439   58.814  8.709   1.00 29.32  ? 67  SER A H      1 
ATOM   1013 H  HA     . SER A 1 67  ? 7.286   59.039  11.035  1.00 23.47  ? 67  SER A HA     1 
ATOM   1014 H  HB2    . SER A 1 67  ? 8.997   60.856  9.727   1.00 16.99  ? 67  SER A HB2    1 
ATOM   1015 H  HB3    . SER A 1 67  ? 8.523   61.053  11.231  1.00 16.99  ? 67  SER A HB3    1 
ATOM   1016 H  HG     . SER A 1 67  ? 9.986   59.024  10.380  1.00 19.36  ? 67  SER A HG     1 
ATOM   1017 N  N      . GLN A 1 68  ? 6.181   61.060  8.802   1.00 23.39  ? 68  GLN A N      1 
ATOM   1018 C  CA     . GLN A 1 68  ? 5.023   61.886  8.485   1.00 25.84  ? 68  GLN A CA     1 
ATOM   1019 C  C      . GLN A 1 68  ? 3.735   61.100  8.680   1.00 23.72  ? 68  GLN A C      1 
ATOM   1020 O  O      . GLN A 1 68  ? 2.791   61.579  9.317   1.00 24.95  ? 68  GLN A O      1 
ATOM   1021 C  CB     . GLN A 1 68  ? 5.111   62.398  7.047   1.00 29.73  ? 68  GLN A CB     1 
ATOM   1022 C  CG     . GLN A 1 68  ? 6.212   63.411  6.790   1.00 51.49  ? 68  GLN A CG     1 
ATOM   1023 C  CD     . GLN A 1 68  ? 6.295   63.811  5.327   1.00 55.63  ? 68  GLN A CD     1 
ATOM   1024 O  OE1    . GLN A 1 68  ? 7.382   63.887  4.754   1.00 61.21  ? 68  GLN A OE1    1 
ATOM   1025 N  NE2    . GLN A 1 68  ? 5.143   64.065  4.716   1.00 51.99  ? 68  GLN A NE2    1 
ATOM   1026 H  H      . GLN A 1 68  ? 6.756   60.983  8.167   1.00 28.28  ? 68  GLN A H      1 
ATOM   1027 H  HA     . GLN A 1 68  ? 5.019   62.653  9.078   1.00 31.22  ? 68  GLN A HA     1 
ATOM   1028 H  HB2    . GLN A 1 68  ? 5.269   61.641  6.461   1.00 35.90  ? 68  GLN A HB2    1 
ATOM   1029 H  HB3    . GLN A 1 68  ? 4.268   62.822  6.821   1.00 35.90  ? 68  GLN A HB3    1 
ATOM   1030 H  HG2    . GLN A 1 68  ? 6.038   64.209  7.312   1.00 62.00  ? 68  GLN A HG2    1 
ATOM   1031 H  HG3    . GLN A 1 68  ? 7.065   63.025  7.046   1.00 62.00  ? 68  GLN A HG3    1 
ATOM   1032 H  HE21   . GLN A 1 68  ? 4.402   63.999  5.148   1.00 62.61  ? 68  GLN A HE21   1 
ATOM   1033 H  HE22   . GLN A 1 68  ? 5.138   64.295  3.887   1.00 62.61  ? 68  GLN A HE22   1 
ATOM   1034 N  N      . VAL A 1 69  ? 3.687   59.877  8.148   1.00 28.53  ? 69  VAL A N      1 
ATOM   1035 C  CA     . VAL A 1 69  ? 2.467   59.076  8.253   1.00 29.84  ? 69  VAL A CA     1 
ATOM   1036 C  C      . VAL A 1 69  ? 2.135   58.792  9.715   1.00 34.47  ? 69  VAL A C      1 
ATOM   1037 O  O      . VAL A 1 69  ? 0.994   58.978  10.165  1.00 31.48  ? 69  VAL A O      1 
ATOM   1038 C  CB     . VAL A 1 69  ? 2.603   57.775  7.445   1.00 34.07  ? 69  VAL A CB     1 
ATOM   1039 C  CG1    . VAL A 1 69  ? 1.418   56.867  7.726   1.00 32.57  ? 69  VAL A CG1    1 
ATOM   1040 C  CG2    . VAL A 1 69  ? 2.711   58.085  5.961   1.00 26.78  ? 69  VAL A CG2    1 
ATOM   1041 H  H      . VAL A 1 69  ? 4.333   59.494  7.729   1.00 34.45  ? 69  VAL A H      1 
ATOM   1042 H  HA     . VAL A 1 69  ? 1.735   59.589  7.875   1.00 36.03  ? 69  VAL A HA     1 
ATOM   1043 H  HB     . VAL A 1 69  ? 3.412   57.310  7.710   1.00 41.10  ? 69  VAL A HB     1 
ATOM   1044 H  HG11   . VAL A 1 69  ? 1.329   56.230  7.000   1.00 39.30  ? 69  VAL A HG11   1 
ATOM   1045 H  HG12   . VAL A 1 69  ? 1.570   56.398  8.561   1.00 39.30  ? 69  VAL A HG12   1 
ATOM   1046 H  HG13   . VAL A 1 69  ? 0.615   57.408  7.792   1.00 39.30  ? 69  VAL A HG13   1 
ATOM   1047 H  HG21   . VAL A 1 69  ? 2.800   57.253  5.470   1.00 32.35  ? 69  VAL A HG21   1 
ATOM   1048 H  HG22   . VAL A 1 69  ? 1.910   58.553  5.677   1.00 32.35  ? 69  VAL A HG22   1 
ATOM   1049 H  HG23   . VAL A 1 69  ? 3.490   58.643  5.811   1.00 32.35  ? 69  VAL A HG23   1 
ATOM   1050 N  N      . VAL A 1 70  ? 3.125   58.315  10.473  1.00 32.06  ? 70  VAL A N      1 
ATOM   1051 C  CA     . VAL A 1 70  ? 2.888   57.932  11.861  1.00 21.78  ? 70  VAL A CA     1 
ATOM   1052 C  C      . VAL A 1 70  ? 2.448   59.135  12.681  1.00 18.95  ? 70  VAL A C      1 
ATOM   1053 O  O      . VAL A 1 70  ? 1.530   59.037  13.503  1.00 19.81  ? 70  VAL A O      1 
ATOM   1054 C  CB     . VAL A 1 70  ? 4.153   57.282  12.452  1.00 16.48  ? 70  VAL A CB     1 
ATOM   1055 C  CG1    . VAL A 1 70  ? 4.021   57.110  13.952  1.00 23.14  ? 70  VAL A CG1    1 
ATOM   1056 C  CG2    . VAL A 1 70  ? 4.409   55.930  11.796  1.00 22.56  ? 70  VAL A CG2    1 
ATOM   1057 H  H      . VAL A 1 70  ? 3.937   58.205  10.210  1.00 38.69  ? 70  VAL A H      1 
ATOM   1058 H  HA     . VAL A 1 70  ? 2.170   57.280  11.882  1.00 26.35  ? 70  VAL A HA     1 
ATOM   1059 H  HB     . VAL A 1 70  ? 4.909   57.864  12.277  1.00 19.99  ? 70  VAL A HB     1 
ATOM   1060 H  HG11   . VAL A 1 70  ? 4.674   56.460  14.255  1.00 27.98  ? 70  VAL A HG11   1 
ATOM   1061 H  HG12   . VAL A 1 70  ? 4.180   57.965  14.383  1.00 27.98  ? 70  VAL A HG12   1 
ATOM   1062 H  HG13   . VAL A 1 70  ? 3.125   56.799  14.157  1.00 27.98  ? 70  VAL A HG13   1 
ATOM   1063 H  HG21   . VAL A 1 70  ? 5.238   55.563  12.142  1.00 27.29  ? 70  VAL A HG21   1 
ATOM   1064 H  HG22   . VAL A 1 70  ? 3.672   55.335  12.003  1.00 27.29  ? 70  VAL A HG22   1 
ATOM   1065 H  HG23   . VAL A 1 70  ? 4.477   56.053  10.837  1.00 27.29  ? 70  VAL A HG23   1 
ATOM   1066 N  N      . ASP A 1 71  ? 3.062   60.296  12.448  1.00 21.13  ? 71  ASP A N      1 
ATOM   1067 C  CA     . ASP A 1 71  ? 2.689   61.484  13.206  1.00 20.64  ? 71  ASP A CA     1 
ATOM   1068 C  C      . ASP A 1 71  ? 1.293   61.951  12.832  1.00 20.55  ? 71  ASP A C      1 
ATOM   1069 O  O      . ASP A 1 71  ? 0.522   62.378  13.697  1.00 27.53  ? 71  ASP A O      1 
ATOM   1070 C  CB     . ASP A 1 71  ? 3.708   62.601  12.984  1.00 36.44  ? 71  ASP A CB     1 
ATOM   1071 C  CG     . ASP A 1 71  ? 3.416   63.827  13.828  1.00 31.32  ? 71  ASP A CG     1 
ATOM   1072 O  OD1    . ASP A 1 71  ? 3.701   63.798  15.043  1.00 24.33  ? 71  ASP A OD1    1 
ATOM   1073 O  OD2    . ASP A 1 71  ? 2.905   64.822  13.272  1.00 60.96  ? 71  ASP A OD2    1 
ATOM   1074 H  H      . ASP A 1 71  ? 3.685   60.421  11.869  1.00 25.58  ? 71  ASP A H      1 
ATOM   1075 H  HA     . ASP A 1 71  ? 2.695   61.266  14.151  1.00 24.98  ? 71  ASP A HA     1 
ATOM   1076 H  HB2    . ASP A 1 71  ? 4.591   62.276  13.220  1.00 43.94  ? 71  ASP A HB2    1 
ATOM   1077 H  HB3    . ASP A 1 71  ? 3.690   62.866  12.051  1.00 43.94  ? 71  ASP A HB3    1 
ATOM   1078 N  N      . SER A 1 72  ? 0.946   61.878  11.547  1.00 18.95  ? 72  SER A N      1 
ATOM   1079 C  CA     . SER A 1 72  ? -0.384  62.296  11.142  1.00 13.65  ? 72  SER A CA     1 
ATOM   1080 C  C      . SER A 1 72  ? -1.449  61.372  11.708  1.00 17.05  ? 72  SER A C      1 
ATOM   1081 O  O      . SER A 1 72  ? -2.578  61.810  11.949  1.00 33.70  ? 72  SER A O      1 
ATOM   1082 C  CB     . SER A 1 72  ? -0.489  62.327  9.620   1.00 17.92  ? 72  SER A CB     1 
ATOM   1083 O  OG     . SER A 1 72  ? -0.605  61.014  9.102   1.00 23.38  ? 72  SER A OG     1 
ATOM   1084 H  H      . SER A 1 72  ? 1.450   61.598  10.909  1.00 22.95  ? 72  SER A H      1 
ATOM   1085 H  HA     . SER A 1 72  ? -0.541  63.194  11.475  1.00 16.59  ? 72  SER A HA     1 
ATOM   1086 H  HB2    . SER A 1 72  ? -1.274  62.837  9.367   1.00 21.72  ? 72  SER A HB2    1 
ATOM   1087 H  HB3    . SER A 1 72  ? 0.309   62.742  9.256   1.00 21.72  ? 72  SER A HB3    1 
ATOM   1088 H  HG     . SER A 1 72  ? 0.013   60.531  9.403   1.00 28.27  ? 72  SER A HG     1 
ATOM   1089 N  N      . VAL A 1 73  ? -1.114  60.103  11.936  1.00 29.67  ? 73  VAL A N      1 
ATOM   1090 C  CA     . VAL A 1 73  ? -2.129  59.169  12.408  1.00 24.03  ? 73  VAL A CA     1 
ATOM   1091 C  C      . VAL A 1 73  ? -2.217  59.101  13.936  1.00 26.66  ? 73  VAL A C      1 
ATOM   1092 O  O      . VAL A 1 73  ? -3.316  58.944  14.478  1.00 28.37  ? 73  VAL A O      1 
ATOM   1093 C  CB     . VAL A 1 73  ? -1.872  57.770  11.819  1.00 20.49  ? 73  VAL A CB     1 
ATOM   1094 C  CG1    . VAL A 1 73  ? -2.860  56.759  12.396  1.00 23.71  ? 73  VAL A CG1    1 
ATOM   1095 C  CG2    . VAL A 1 73  ? -1.967  57.803  10.303  1.00 27.19  ? 73  VAL A CG2    1 
ATOM   1096 H  H      . VAL A 1 73  ? -0.329  59.768  11.828  1.00 35.82  ? 73  VAL A H      1 
ATOM   1097 H  HA     . VAL A 1 73  ? -2.991  59.486  12.094  1.00 29.05  ? 73  VAL A HA     1 
ATOM   1098 H  HB     . VAL A 1 73  ? -0.975  57.489  12.058  1.00 24.81  ? 73  VAL A HB     1 
ATOM   1099 H  HG11   . VAL A 1 73  ? -2.850  55.959  11.847  1.00 28.67  ? 73  VAL A HG11   1 
ATOM   1100 H  HG12   . VAL A 1 73  ? -2.595  56.541  13.303  1.00 28.67  ? 73  VAL A HG12   1 
ATOM   1101 H  HG13   . VAL A 1 73  ? -3.748  57.150  12.395  1.00 28.67  ? 73  VAL A HG13   1 
ATOM   1102 H  HG21   . VAL A 1 73  ? -1.728  56.931  9.952   1.00 32.85  ? 73  VAL A HG21   1 
ATOM   1103 H  HG22   . VAL A 1 73  ? -2.876  58.024  10.048  1.00 32.85  ? 73  VAL A HG22   1 
ATOM   1104 H  HG23   . VAL A 1 73  ? -1.355  58.475  9.963   1.00 32.85  ? 73  VAL A HG23   1 
ATOM   1105 N  N      . MET A 1 74  ? -1.101  59.265  14.653  1.00 23.93  ? 74  MET A N      1 
ATOM   1106 C  CA     . MET A 1 74  ? -1.045  58.957  16.076  1.00 20.13  ? 74  MET A CA     1 
ATOM   1107 C  C      . MET A 1 74  ? -0.997  60.185  16.980  1.00 35.21  ? 74  MET A C      1 
ATOM   1108 O  O      . MET A 1 74  ? -1.034  60.028  18.206  1.00 35.92  ? 74  MET A O      1 
ATOM   1109 C  CB     . MET A 1 74  ? 0.199   58.101  16.375  1.00 24.98  ? 74  MET A CB     1 
ATOM   1110 C  CG     . MET A 1 74  ? 0.323   56.788  15.604  1.00 13.19  ? 74  MET A CG     1 
ATOM   1111 S  SD     . MET A 1 74  ? -0.960  55.596  15.994  1.00 15.55  ? 74  MET A SD     1 
ATOM   1112 C  CE     . MET A 1 74  ? -0.662  55.307  17.740  1.00 25.85  ? 74  MET A CE     1 
ATOM   1113 H  H      . MET A 1 74  ? -0.359  59.557  14.329  1.00 28.94  ? 74  MET A H      1 
ATOM   1114 H  HA     . MET A 1 74  ? -1.846  58.451  16.288  1.00 24.37  ? 74  MET A HA     1 
ATOM   1115 H  HB2    . MET A 1 74  ? 0.985   58.629  16.166  1.00 30.19  ? 74  MET A HB2    1 
ATOM   1116 H  HB3    . MET A 1 74  ? 0.191   57.877  17.319  1.00 30.19  ? 74  MET A HB3    1 
ATOM   1117 H  HG2    . MET A 1 74  ? 0.271   56.978  14.655  1.00 16.05  ? 74  MET A HG2    1 
ATOM   1118 H  HG3    . MET A 1 74  ? 1.178   56.381  15.815  1.00 16.05  ? 74  MET A HG3    1 
ATOM   1119 H  HE1    . MET A 1 74  ? -1.293  54.644  18.062  1.00 31.24  ? 74  MET A HE1    1 
ATOM   1120 H  HE2    . MET A 1 74  ? 0.245   54.984  17.856  1.00 31.24  ? 74  MET A HE2    1 
ATOM   1121 H  HE3    . MET A 1 74  ? -0.782  56.139  18.223  1.00 31.24  ? 74  MET A HE3    1 
ATOM   1122 N  N      . TYR A 1 75  ? -0.940  61.401  16.427  1.00 37.64  ? 75  TYR A N      1 
ATOM   1123 C  CA     . TYR A 1 75  ? -0.843  62.583  17.280  1.00 25.78  ? 75  TYR A CA     1 
ATOM   1124 C  C      . TYR A 1 75  ? -2.088  62.785  18.138  1.00 30.27  ? 75  TYR A C      1 
ATOM   1125 O  O      . TYR A 1 75  ? -2.033  63.529  19.122  1.00 31.94  ? 75  TYR A O      1 
ATOM   1126 C  CB     . TYR A 1 75  ? -0.595  63.840  16.442  1.00 27.59  ? 75  TYR A CB     1 
ATOM   1127 C  CG     . TYR A 1 75  ? -1.816  64.309  15.685  1.00 35.71  ? 75  TYR A CG     1 
ATOM   1128 C  CD1    . TYR A 1 75  ? -2.261  63.632  14.556  1.00 30.58  ? 75  TYR A CD1    1 
ATOM   1129 C  CD2    . TYR A 1 75  ? -2.552  65.401  16.127  1.00 28.59  ? 75  TYR A CD2    1 
ATOM   1130 C  CE1    . TYR A 1 75  ? -3.384  64.049  13.870  1.00 35.79  ? 75  TYR A CE1    1 
ATOM   1131 C  CE2    . TYR A 1 75  ? -3.678  65.823  15.449  1.00 29.57  ? 75  TYR A CE2    1 
ATOM   1132 C  CZ     . TYR A 1 75  ? -4.090  65.141  14.321  1.00 35.40  ? 75  TYR A CZ     1 
ATOM   1133 O  OH     . TYR A 1 75  ? -5.213  65.549  13.636  1.00 47.62  ? 75  TYR A OH     1 
ATOM   1134 H  H      . TYR A 1 75  ? -0.955  61.564  15.582  1.00 45.38  ? 75  TYR A H      1 
ATOM   1135 H  HA     . TYR A 1 75  ? -0.081  62.463  17.869  1.00 31.16  ? 75  TYR A HA     1 
ATOM   1136 H  HB2    . TYR A 1 75  ? -0.317  64.559  17.031  1.00 33.33  ? 75  TYR A HB2    1 
ATOM   1137 H  HB3    . TYR A 1 75  ? 0.102   63.653  15.795  1.00 33.33  ? 75  TYR A HB3    1 
ATOM   1138 H  HD1    . TYR A 1 75  ? -1.794  62.886  14.258  1.00 36.91  ? 75  TYR A HD1    1 
ATOM   1139 H  HD2    . TYR A 1 75  ? -2.281  65.856  16.891  1.00 34.53  ? 75  TYR A HD2    1 
ATOM   1140 H  HE1    . TYR A 1 75  ? -3.661  63.595  13.108  1.00 43.16  ? 75  TYR A HE1    1 
ATOM   1141 H  HE2    . TYR A 1 75  ? -4.157  66.562  15.750  1.00 35.70  ? 75  TYR A HE2    1 
ATOM   1142 H  HH     . TYR A 1 75  ? -5.554  66.216  14.015  1.00 57.35  ? 75  TYR A HH     1 
ATOM   1143 N  N      . ILE A 1 76  ? -3.202  62.134  17.800  1.00 35.80  ? 76  ILE A N      1 
ATOM   1144 C  CA     . ILE A 1 76  ? -4.427  62.303  18.574  1.00 30.93  ? 76  ILE A CA     1 
ATOM   1145 C  C      . ILE A 1 76  ? -4.357  61.466  19.845  1.00 35.58  ? 76  ILE A C      1 
ATOM   1146 O  O      . ILE A 1 76  ? -4.754  61.919  20.924  1.00 44.82  ? 76  ILE A O      1 
ATOM   1147 C  CB     . ILE A 1 76  ? -5.672  61.962  17.729  1.00 35.03  ? 76  ILE A CB     1 
ATOM   1148 C  CG1    . ILE A 1 76  ? -5.591  60.547  17.139  1.00 28.83  ? 76  ILE A CG1    1 
ATOM   1149 C  CG2    . ILE A 1 76  ? -5.858  63.003  16.626  1.00 27.32  ? 76  ILE A CG2    1 
ATOM   1150 C  CD1    . ILE A 1 76  ? -6.863  60.111  16.420  1.00 34.94  ? 76  ILE A CD1    1 
ATOM   1151 H  H      . ILE A 1 76  ? -3.274  61.594  17.134  1.00 43.18  ? 76  ILE A H      1 
ATOM   1152 H  HA     . ILE A 1 76  ? -4.506  63.237  18.823  1.00 37.34  ? 76  ILE A HA     1 
ATOM   1153 H  HB     . ILE A 1 76  ? -6.444  61.983  18.317  1.00 42.25  ? 76  ILE A HB     1 
ATOM   1154 H  HG12   . ILE A 1 76  ? -4.863  60.517  16.499  1.00 34.81  ? 76  ILE A HG12   1 
ATOM   1155 H  HG13   . ILE A 1 76  ? -5.426  59.917  17.858  1.00 34.81  ? 76  ILE A HG13   1 
ATOM   1156 H  HG21   . ILE A 1 76  ? -6.713  62.854  16.192  1.00 33.01  ? 76  ILE A HG21   1 
ATOM   1157 H  HG22   . ILE A 1 76  ? -5.837  63.889  17.020  1.00 33.01  ? 76  ILE A HG22   1 
ATOM   1158 H  HG23   . ILE A 1 76  ? -5.139  62.911  15.981  1.00 33.01  ? 76  ILE A HG23   1 
ATOM   1159 H  HD11   . ILE A 1 76  ? -6.780  59.178  16.168  1.00 42.15  ? 76  ILE A HD11   1 
ATOM   1160 H  HD12   . ILE A 1 76  ? -7.619  60.227  17.017  1.00 42.15  ? 76  ILE A HD12   1 
ATOM   1161 H  HD13   . ILE A 1 76  ? -6.980  60.658  15.627  1.00 42.15  ? 76  ILE A HD13   1 
ATOM   1162 N  N      . ASP A 1 77  ? -3.855  60.236  19.737  1.00 27.26  ? 77  ASP A N      1 
ATOM   1163 C  CA     . ASP A 1 77  ? -3.769  59.313  20.867  1.00 19.46  ? 77  ASP A CA     1 
ATOM   1164 C  C      . ASP A 1 77  ? -2.313  59.280  21.324  1.00 23.94  ? 77  ASP A C      1 
ATOM   1165 O  O      . ASP A 1 77  ? -1.519  58.452  20.878  1.00 32.39  ? 77  ASP A O      1 
ATOM   1166 C  CB     . ASP A 1 77  ? -4.267  57.934  20.456  1.00 17.24  ? 77  ASP A CB     1 
ATOM   1167 C  CG     . ASP A 1 77  ? -4.509  57.033  21.637  1.00 37.73  ? 77  ASP A CG     1 
ATOM   1168 O  OD1    . ASP A 1 77  ? -3.817  57.205  22.663  1.00 40.86  ? 77  ASP A OD1    1 
ATOM   1169 O  OD2    . ASP A 1 77  ? -5.397  56.160  21.539  1.00 31.11  ? 77  ASP A OD2    1 
ATOM   1170 H  H      . ASP A 1 77  ? -3.551  59.909  19.002  1.00 32.92  ? 77  ASP A H      1 
ATOM   1171 H  HA     . ASP A 1 77  ? -4.314  59.635  21.601  1.00 23.56  ? 77  ASP A HA     1 
ATOM   1172 H  HB2    . ASP A 1 77  ? -5.104  58.030  19.974  1.00 20.90  ? 77  ASP A HB2    1 
ATOM   1173 H  HB3    . ASP A 1 77  ? -3.603  57.514  19.887  1.00 20.90  ? 77  ASP A HB3    1 
ATOM   1174 N  N      . LYS A 1 78  ? -1.967  60.186  22.242  1.00 25.36  ? 78  LYS A N      1 
ATOM   1175 C  CA     . LYS A 1 78  ? -0.577  60.304  22.674  1.00 26.70  ? 78  LYS A CA     1 
ATOM   1176 C  C      . LYS A 1 78  ? -0.102  59.074  23.440  1.00 20.39  ? 78  LYS A C      1 
ATOM   1177 O  O      . LYS A 1 78  ? 1.086   58.734  23.383  1.00 22.36  ? 78  LYS A O      1 
ATOM   1178 C  CB     . LYS A 1 78  ? -0.399  61.573  23.510  1.00 14.96  ? 78  LYS A CB     1 
ATOM   1179 C  CG     . LYS A 1 78  ? -0.801  62.843  22.766  1.00 25.35  ? 78  LYS A CG     1 
ATOM   1180 C  CD     . LYS A 1 78  ? -0.447  64.109  23.534  1.00 47.77  ? 78  LYS A CD     1 
ATOM   1181 C  CE     . LYS A 1 78  ? 0.951   64.614  23.198  1.00 61.28  ? 78  LYS A CE     1 
ATOM   1182 N  NZ     . LYS A 1 78  ? 2.036   63.713  23.686  1.00 65.39  ? 78  LYS A NZ     1 
ATOM   1183 H  H      . LYS A 1 78  ? -2.507  60.734  22.624  1.00 30.65  ? 78  LYS A H      1 
ATOM   1184 H  HA     . LYS A 1 78  ? -0.013  60.383  21.889  1.00 32.26  ? 78  LYS A HA     1 
ATOM   1185 H  HB2    . LYS A 1 78  ? -0.951  61.505  24.305  1.00 18.17  ? 78  LYS A HB2    1 
ATOM   1186 H  HB3    . LYS A 1 78  ? 0.535   61.656  23.760  1.00 18.17  ? 78  LYS A HB3    1 
ATOM   1187 H  HG2    . LYS A 1 78  ? -0.339  62.871  21.913  1.00 30.64  ? 78  LYS A HG2    1 
ATOM   1188 H  HG3    . LYS A 1 78  ? -1.760  62.837  22.623  1.00 30.64  ? 78  LYS A HG3    1 
ATOM   1189 H  HD2    . LYS A 1 78  ? -1.083  64.807  23.309  1.00 57.55  ? 78  LYS A HD2    1 
ATOM   1190 H  HD3    . LYS A 1 78  ? -0.481  63.925  24.486  1.00 57.55  ? 78  LYS A HD3    1 
ATOM   1191 H  HE2    . LYS A 1 78  ? 1.035   64.686  22.234  1.00 73.76  ? 78  LYS A HE2    1 
ATOM   1192 H  HE3    . LYS A 1 78  ? 1.079   65.483  23.608  1.00 73.76  ? 78  LYS A HE3    1 
ATOM   1193 H  HZ1    . LYS A 1 78  ? 2.057   62.969  23.198  1.00 78.68  ? 78  LYS A HZ1    1 
ATOM   1194 H  HZ2    . LYS A 1 78  ? 2.824   64.122  23.622  1.00 78.68  ? 78  LYS A HZ2    1 
ATOM   1195 H  HZ3    . LYS A 1 78  ? 1.892   63.496  24.537  1.00 78.68  ? 78  LYS A HZ3    1 
ATOM   1196 N  N      . LYS A 1 79  ? -1.001  58.392  24.150  1.00 16.57  ? 79  LYS A N      1 
ATOM   1197 C  CA     . LYS A 1 79  ? -0.613  57.173  24.854  1.00 15.22  ? 79  LYS A CA     1 
ATOM   1198 C  C      . LYS A 1 79  ? -0.193  56.082  23.879  1.00 20.00  ? 79  LYS A C      1 
ATOM   1199 O  O      . LYS A 1 79  ? 0.857   55.447  24.046  1.00 27.09  ? 79  LYS A O      1 
ATOM   1200 C  CB     . LYS A 1 79  ? -1.769  56.683  25.722  1.00 25.70  ? 79  LYS A CB     1 
ATOM   1201 C  CG     . LYS A 1 79  ? -1.448  55.442  26.533  1.00 30.39  ? 79  LYS A CG     1 
ATOM   1202 C  CD     . LYS A 1 79  ? -2.663  54.970  27.303  1.00 42.09  ? 79  LYS A CD     1 
ATOM   1203 C  CE     . LYS A 1 79  ? -2.378  53.680  28.058  1.00 59.15  ? 79  LYS A CE     1 
ATOM   1204 N  NZ     . LYS A 1 79  ? -3.571  53.199  28.817  1.00 64.76  ? 79  LYS A NZ     1 
ATOM   1205 H  H      . LYS A 1 79  ? -1.828  58.608  24.240  1.00 20.10  ? 79  LYS A H      1 
ATOM   1206 H  HA     . LYS A 1 79  ? 0.142   57.376  25.428  1.00 18.48  ? 79  LYS A HA     1 
ATOM   1207 H  HB2    . LYS A 1 79  ? -2.013  57.387  26.343  1.00 31.06  ? 79  LYS A HB2    1 
ATOM   1208 H  HB3    . LYS A 1 79  ? -2.522  56.472  25.147  1.00 31.06  ? 79  LYS A HB3    1 
ATOM   1209 H  HG2    . LYS A 1 79  ? -1.165  54.731  25.938  1.00 36.68  ? 79  LYS A HG2    1 
ATOM   1210 H  HG3    . LYS A 1 79  ? -0.742  55.645  27.167  1.00 36.68  ? 79  LYS A HG3    1 
ATOM   1211 H  HD2    . LYS A 1 79  ? -2.920  55.649  27.946  1.00 50.72  ? 79  LYS A HD2    1 
ATOM   1212 H  HD3    . LYS A 1 79  ? -3.391  54.806  26.684  1.00 50.72  ? 79  LYS A HD3    1 
ATOM   1213 H  HE2    . LYS A 1 79  ? -2.123  52.990  27.426  1.00 71.20  ? 79  LYS A HE2    1 
ATOM   1214 H  HE3    . LYS A 1 79  ? -1.658  53.833  28.690  1.00 71.20  ? 79  LYS A HE3    1 
ATOM   1215 H  HZ1    . LYS A 1 79  ? -3.322  52.604  29.431  1.00 77.92  ? 79  LYS A HZ1    1 
ATOM   1216 H  HZ2    . LYS A 1 79  ? -3.969  53.883  29.223  1.00 77.92  ? 79  LYS A HZ2    1 
ATOM   1217 H  HZ3    . LYS A 1 79  ? -4.151  52.815  28.262  1.00 77.92  ? 79  LYS A HZ3    1 
ATOM   1218 N  N      . ALA A 1 80  ? -1.013  55.843  22.853  1.00 22.31  ? 80  ALA A N      1 
ATOM   1219 C  CA     . ALA A 1 80  ? -0.672  54.833  21.861  1.00 20.03  ? 80  ALA A CA     1 
ATOM   1220 C  C      . ALA A 1 80  ? 0.584   55.227  21.102  1.00 20.13  ? 80  ALA A C      1 
ATOM   1221 O  O      . ALA A 1 80  ? 1.409   54.370  20.770  1.00 22.04  ? 80  ALA A O      1 
ATOM   1222 C  CB     . ALA A 1 80  ? -1.841  54.625  20.899  1.00 20.34  ? 80  ALA A CB     1 
ATOM   1223 H  H      . ALA A 1 80  ? -1.760  56.245  22.712  1.00 26.98  ? 80  ALA A H      1 
ATOM   1224 H  HA     . ALA A 1 80  ? -0.505  53.990  22.310  1.00 24.25  ? 80  ALA A HA     1 
ATOM   1225 H  HB1    . ALA A 1 80  ? -1.595  53.952  20.245  1.00 24.62  ? 80  ALA A HB1    1 
ATOM   1226 H  HB2    . ALA A 1 80  ? -2.615  54.330  21.403  1.00 24.62  ? 80  ALA A HB2    1 
ATOM   1227 H  HB3    . ALA A 1 80  ? -2.036  55.464  20.454  1.00 24.62  ? 80  ALA A HB3    1 
ATOM   1228 N  N      . PHE A 1 81  ? 0.757   56.523  20.836  1.00 18.26  ? 81  PHE A N      1 
ATOM   1229 C  CA     . PHE A 1 81  ? 1.974   56.990  20.183  1.00 15.10  ? 81  PHE A CA     1 
ATOM   1230 C  C      . PHE A 1 81  ? 3.196   56.659  21.031  1.00 15.92  ? 81  PHE A C      1 
ATOM   1231 O  O      . PHE A 1 81  ? 4.204   56.154  20.522  1.00 28.06  ? 81  PHE A O      1 
ATOM   1232 C  CB     . PHE A 1 81  ? 1.881   58.499  19.943  1.00 24.83  ? 81  PHE A CB     1 
ATOM   1233 C  CG     . PHE A 1 81  ? 2.716   58.998  18.788  1.00 32.71  ? 81  PHE A CG     1 
ATOM   1234 C  CD1    . PHE A 1 81  ? 3.810   58.282  18.325  1.00 29.17  ? 81  PHE A CD1    1 
ATOM   1235 C  CD2    . PHE A 1 81  ? 2.412   60.205  18.180  1.00 23.83  ? 81  PHE A CD2    1 
ATOM   1236 C  CE1    . PHE A 1 81  ? 4.569   58.751  17.265  1.00 19.50  ? 81  PHE A CE1    1 
ATOM   1237 C  CE2    . PHE A 1 81  ? 3.171   60.679  17.124  1.00 26.43  ? 81  PHE A CE2    1 
ATOM   1238 C  CZ     . PHE A 1 81  ? 4.250   59.949  16.667  1.00 18.54  ? 81  PHE A CZ     1 
ATOM   1239 H  H      . PHE A 1 81  ? 0.192   57.144  21.022  1.00 22.13  ? 81  PHE A H      1 
ATOM   1240 H  HA     . PHE A 1 81  ? 2.067   56.550  19.324  1.00 18.33  ? 81  PHE A HA     1 
ATOM   1241 H  HB2    . PHE A 1 81  ? 0.956   58.727  19.757  1.00 30.02  ? 81  PHE A HB2    1 
ATOM   1242 H  HB3    . PHE A 1 81  ? 2.181   58.959  20.743  1.00 30.02  ? 81  PHE A HB3    1 
ATOM   1243 H  HD1    . PHE A 1 81  ? 4.037   57.477  18.731  1.00 35.22  ? 81  PHE A HD1    1 
ATOM   1244 H  HD2    . PHE A 1 81  ? 1.689   60.704  18.485  1.00 28.81  ? 81  PHE A HD2    1 
ATOM   1245 H  HE1    . PHE A 1 81  ? 5.294   58.255  16.958  1.00 23.61  ? 81  PHE A HE1    1 
ATOM   1246 H  HE2    . PHE A 1 81  ? 2.953   61.489  16.723  1.00 31.93  ? 81  PHE A HE2    1 
ATOM   1247 H  HZ     . PHE A 1 81  ? 4.761   60.267  15.957  1.00 22.46  ? 81  PHE A HZ     1 
ATOM   1248 N  N      . GLY A 1 82  ? 3.120   56.931  22.335  1.00 17.74  ? 82  GLY A N      1 
ATOM   1249 C  CA     . GLY A 1 82  ? 4.241   56.627  23.208  1.00 19.08  ? 82  GLY A CA     1 
ATOM   1250 C  C      . GLY A 1 82  ? 4.537   55.143  23.291  1.00 17.27  ? 82  GLY A C      1 
ATOM   1251 O  O      . GLY A 1 82  ? 5.699   54.732  23.305  1.00 18.62  ? 82  GLY A O      1 
ATOM   1252 H  H      . GLY A 1 82  ? 2.443   57.284  22.730  1.00 21.51  ? 82  GLY A H      1 
ATOM   1253 H  HA2    . GLY A 1 82  ? 5.034   57.077  22.876  1.00 23.11  ? 82  GLY A HA2    1 
ATOM   1254 H  HA3    . GLY A 1 82  ? 4.046   56.949  24.102  1.00 23.11  ? 82  GLY A HA3    1 
ATOM   1255 N  N      . ILE A 1 83  ? 3.493   54.317  23.348  1.00 19.89  ? 83  ILE A N      1 
ATOM   1256 C  CA     . ILE A 1 83  ? 3.707   52.872  23.361  1.00 15.89  ? 83  ILE A CA     1 
ATOM   1257 C  C      . ILE A 1 83  ? 4.391   52.436  22.068  1.00 12.93  ? 83  ILE A C      1 
ATOM   1258 O  O      . ILE A 1 83  ? 5.348   51.652  22.081  1.00 16.93  ? 83  ILE A O      1 
ATOM   1259 C  CB     . ILE A 1 83  ? 2.377   52.130  23.578  1.00 17.82  ? 83  ILE A CB     1 
ATOM   1260 C  CG1    . ILE A 1 83  ? 1.854   52.383  24.992  1.00 17.00  ? 83  ILE A CG1    1 
ATOM   1261 C  CG2    . ILE A 1 83  ? 2.550   50.627  23.369  1.00 19.79  ? 83  ILE A CG2    1 
ATOM   1262 C  CD1    . ILE A 1 83  ? 0.480   51.803  25.246  1.00 23.43  ? 83  ILE A CD1    1 
ATOM   1263 H  H      . ILE A 1 83  ? 2.668   54.561  23.379  1.00 24.09  ? 83  ILE A H      1 
ATOM   1264 H  HA     . ILE A 1 83  ? 4.292   52.650  24.102  1.00 19.28  ? 83  ILE A HA     1 
ATOM   1265 H  HB     . ILE A 1 83  ? 1.741   52.469  22.929  1.00 21.60  ? 83  ILE A HB     1 
ATOM   1266 H  HG12   . ILE A 1 83  ? 2.467   51.981  25.627  1.00 20.62  ? 83  ILE A HG12   1 
ATOM   1267 H  HG13   . ILE A 1 83  ? 1.804   53.340  25.139  1.00 20.62  ? 83  ILE A HG13   1 
ATOM   1268 H  HG21   . ILE A 1 83  ? 1.737   50.174  23.640  1.00 23.97  ? 83  ILE A HG21   1 
ATOM   1269 H  HG22   . ILE A 1 83  ? 2.726   50.456  22.430  1.00 23.97  ? 83  ILE A HG22   1 
ATOM   1270 H  HG23   . ILE A 1 83  ? 3.296   50.317  23.906  1.00 23.97  ? 83  ILE A HG23   1 
ATOM   1271 H  HD11   . ILE A 1 83  ? 0.085   52.251  26.010  1.00 28.34  ? 83  ILE A HD11   1 
ATOM   1272 H  HD12   . ILE A 1 83  ? -0.071  51.940  24.460  1.00 28.34  ? 83  ILE A HD12   1 
ATOM   1273 H  HD13   . ILE A 1 83  ? 0.567   50.854  25.428  1.00 28.34  ? 83  ILE A HD13   1 
ATOM   1274 N  N      . LEU A 1 84  ? 3.901   52.938  20.930  1.00 15.21  ? 84  LEU A N      1 
ATOM   1275 C  CA     . LEU A 1 84  ? 4.491   52.601  19.639  1.00 16.08  ? 84  LEU A CA     1 
ATOM   1276 C  C      . LEU A 1 84  ? 5.964   52.980  19.602  1.00 19.38  ? 84  LEU A C      1 
ATOM   1277 O  O      . LEU A 1 84  ? 6.804   52.206  19.126  1.00 13.30  ? 84  LEU A O      1 
ATOM   1278 C  CB     . LEU A 1 84  ? 3.735   53.325  18.523  1.00 15.98  ? 84  LEU A CB     1 
ATOM   1279 C  CG     . LEU A 1 84  ? 3.947   52.844  17.086  1.00 27.60  ? 84  LEU A CG     1 
ATOM   1280 C  CD1    . LEU A 1 84  ? 3.251   51.509  16.866  1.00 25.37  ? 84  LEU A CD1    1 
ATOM   1281 C  CD2    . LEU A 1 84  ? 3.448   53.865  16.085  1.00 21.36  ? 84  LEU A CD2    1 
ATOM   1282 H  H      . LEU A 1 84  ? 3.231   53.474  20.879  1.00 18.46  ? 84  LEU A H      1 
ATOM   1283 H  HA     . LEU A 1 84  ? 4.414   51.645  19.493  1.00 19.51  ? 84  LEU A HA     1 
ATOM   1284 H  HB2    . LEU A 1 84  ? 2.786   53.242  18.707  1.00 19.39  ? 84  LEU A HB2    1 
ATOM   1285 H  HB3    . LEU A 1 84  ? 3.998   54.258  18.546  1.00 19.39  ? 84  LEU A HB3    1 
ATOM   1286 H  HG     . LEU A 1 84  ? 4.899   52.726  16.939  1.00 33.33  ? 84  LEU A HG     1 
ATOM   1287 H  HD11   . LEU A 1 84  ? 3.386   51.230  15.947  1.00 30.66  ? 84  LEU A HD11   1 
ATOM   1288 H  HD12   . LEU A 1 84  ? 3.630   50.851  17.470  1.00 30.66  ? 84  LEU A HD12   1 
ATOM   1289 H  HD13   . LEU A 1 84  ? 2.303   51.614  17.045  1.00 30.66  ? 84  LEU A HD13   1 
ATOM   1290 H  HD21   . LEU A 1 84  ? 3.572   53.515  15.189  1.00 25.84  ? 84  LEU A HD21   1 
ATOM   1291 H  HD22   . LEU A 1 84  ? 2.506   54.032  16.248  1.00 25.84  ? 84  LEU A HD22   1 
ATOM   1292 H  HD23   . LEU A 1 84  ? 3.953   54.686  16.193  1.00 25.84  ? 84  LEU A HD23   1 
ATOM   1293 N  N      . LEU A 1 85  ? 6.295   54.169  20.112  1.00 21.25  ? 85  LEU A N      1 
ATOM   1294 C  CA     . LEU A 1 85  ? 7.685   54.609  20.142  1.00 18.09  ? 85  LEU A CA     1 
ATOM   1295 C  C      . LEU A 1 85  ? 8.531   53.726  21.051  1.00 21.80  ? 85  LEU A C      1 
ATOM   1296 O  O      . LEU A 1 85  ? 9.642   53.331  20.681  1.00 31.00  ? 85  LEU A O      1 
ATOM   1297 C  CB     . LEU A 1 85  ? 7.757   56.066  20.594  1.00 19.72  ? 85  LEU A CB     1 
ATOM   1298 C  CG     . LEU A 1 85  ? 7.295   57.096  19.568  1.00 18.92  ? 85  LEU A CG     1 
ATOM   1299 C  CD1    . LEU A 1 85  ? 7.164   58.469  20.201  1.00 22.77  ? 85  LEU A CD1    1 
ATOM   1300 C  CD2    . LEU A 1 85  ? 8.302   57.133  18.426  1.00 19.38  ? 85  LEU A CD2    1 
ATOM   1301 H  H      . LEU A 1 85  ? 5.739   54.734  20.444  1.00 25.72  ? 85  LEU A H      1 
ATOM   1302 H  HA     . LEU A 1 85  ? 8.051   54.548  19.245  1.00 21.92  ? 85  LEU A HA     1 
ATOM   1303 H  HB2    . LEU A 1 85  ? 7.197   56.169  21.379  1.00 23.88  ? 85  LEU A HB2    1 
ATOM   1304 H  HB3    . LEU A 1 85  ? 8.679   56.271  20.815  1.00 23.88  ? 85  LEU A HB3    1 
ATOM   1305 H  HG     . LEU A 1 85  ? 6.422   56.852  19.224  1.00 22.92  ? 85  LEU A HG     1 
ATOM   1306 H  HD11   . LEU A 1 85  ? 6.852   59.097  19.531  1.00 27.54  ? 85  LEU A HD11   1 
ATOM   1307 H  HD12   . LEU A 1 85  ? 6.527   58.420  20.931  1.00 27.54  ? 85  LEU A HD12   1 
ATOM   1308 H  HD13   . LEU A 1 85  ? 8.031   58.746  20.536  1.00 27.54  ? 85  LEU A HD13   1 
ATOM   1309 H  HD21   . LEU A 1 85  ? 8.114   57.901  17.864  1.00 23.47  ? 85  LEU A HD21   1 
ATOM   1310 H  HD22   . LEU A 1 85  ? 9.196   57.204  18.796  1.00 23.47  ? 85  LEU A HD22   1 
ATOM   1311 H  HD23   . LEU A 1 85  ? 8.221   56.317  17.908  1.00 23.47  ? 85  LEU A HD23   1 
ATOM   1312 N  N      . SER A 1 86  ? 8.027   53.403  22.244  1.00 20.66  ? 86  SER A N      1 
ATOM   1313 C  CA     . SER A 1 86  ? 8.780   52.536  23.144  1.00 22.68  ? 86  SER A CA     1 
ATOM   1314 C  C      . SER A 1 86  ? 9.046   51.182  22.502  1.00 18.36  ? 86  SER A C      1 
ATOM   1315 O  O      . SER A 1 86  ? 10.132  50.612  22.662  1.00 23.03  ? 86  SER A O      1 
ATOM   1316 C  CB     . SER A 1 86  ? 8.023   52.358  24.460  1.00 19.20  ? 86  SER A CB     1 
ATOM   1317 O  OG     . SER A 1 86  ? 7.906   53.592  25.146  1.00 54.27  ? 86  SER A OG     1 
ATOM   1318 H  H      . SER A 1 86  ? 7.268   53.667  22.550  1.00 25.01  ? 86  SER A H      1 
ATOM   1319 H  HA     . SER A 1 86  ? 9.632   52.955  23.340  1.00 27.43  ? 86  SER A HA     1 
ATOM   1320 H  HB2    . SER A 1 86  ? 7.134   52.017  24.270  1.00 23.26  ? 86  SER A HB2    1 
ATOM   1321 H  HB3    . SER A 1 86  ? 8.506   51.730  25.019  1.00 23.26  ? 86  SER A HB3    1 
ATOM   1322 H  HG     . SER A 1 86  ? 7.498   54.149  24.669  1.00 65.34  ? 86  SER A HG     1 
ATOM   1323 N  N      . TYR A 1 87  ? 8.083   50.665  21.744  1.00 21.33  ? 87  TYR A N      1 
ATOM   1324 C  CA     . TYR A 1 87  ? 8.261   49.350  21.140  1.00 12.41  ? 87  TYR A CA     1 
ATOM   1325 C  C      . TYR A 1 87  ? 9.225   49.404  19.959  1.00 19.59  ? 87  TYR A C      1 
ATOM   1326 O  O      . TYR A 1 87  ? 10.253  48.719  19.960  1.00 22.13  ? 87  TYR A O      1 
ATOM   1327 C  CB     . TYR A 1 87  ? 6.898   48.778  20.742  1.00 10.34  ? 87  TYR A CB     1 
ATOM   1328 C  CG     . TYR A 1 87  ? 6.953   47.386  20.164  1.00 9.23   ? 87  TYR A CG     1 
ATOM   1329 C  CD1    . TYR A 1 87  ? 6.644   47.152  18.833  1.00 10.21  ? 87  TYR A CD1    1 
ATOM   1330 C  CD2    . TYR A 1 87  ? 7.231   46.297  20.970  1.00 9.62   ? 87  TYR A CD2    1 
ATOM   1331 C  CE1    . TYR A 1 87  ? 6.666   45.873  18.310  1.00 16.22  ? 87  TYR A CE1    1 
ATOM   1332 C  CE2    . TYR A 1 87  ? 7.270   45.019  20.455  1.00 10.41  ? 87  TYR A CE2    1 
ATOM   1333 C  CZ     . TYR A 1 87  ? 6.979   44.808  19.127  1.00 11.47  ? 87  TYR A CZ     1 
ATOM   1334 O  OH     . TYR A 1 87  ? 7.004   43.528  18.616  1.00 18.47  ? 87  TYR A OH     1 
ATOM   1335 H  H      . TYR A 1 87  ? 7.332   51.046  21.566  1.00 25.82  ? 87  TYR A H      1 
ATOM   1336 H  HA     . TYR A 1 87  ? 8.652   48.749  21.793  1.00 15.10  ? 87  TYR A HA     1 
ATOM   1337 H  HB2    . TYR A 1 87  ? 6.333   48.747  21.530  1.00 12.63  ? 87  TYR A HB2    1 
ATOM   1338 H  HB3    . TYR A 1 87  ? 6.502   49.358  20.073  1.00 12.63  ? 87  TYR A HB3    1 
ATOM   1339 H  HD1    . TYR A 1 87  ? 6.418   47.868  18.283  1.00 12.47  ? 87  TYR A HD1    1 
ATOM   1340 H  HD2    . TYR A 1 87  ? 7.395   46.429  21.875  1.00 11.76  ? 87  TYR A HD2    1 
ATOM   1341 H  HE1    . TYR A 1 87  ? 6.470   45.732  17.411  1.00 19.67  ? 87  TYR A HE1    1 
ATOM   1342 H  HE2    . TYR A 1 87  ? 7.492   44.302  21.004  1.00 12.71  ? 87  TYR A HE2    1 
ATOM   1343 H  HH     . TYR A 1 87  ? 7.248   42.986  19.210  1.00 22.38  ? 87  TYR A HH     1 
ATOM   1344 N  N      . TYR A 1 88  ? 8.942   50.250  18.965  1.00 17.16  ? 88  TYR A N      1 
ATOM   1345 C  CA     . TYR A 1 88  ? 9.731   50.238  17.737  1.00 11.13  ? 88  TYR A CA     1 
ATOM   1346 C  C      . TYR A 1 88  ? 10.971  51.123  17.819  1.00 20.68  ? 88  TYR A C      1 
ATOM   1347 O  O      . TYR A 1 88  ? 12.028  50.749  17.297  1.00 20.26  ? 88  TYR A O      1 
ATOM   1348 C  CB     . TYR A 1 88  ? 8.872   50.663  16.541  1.00 11.69  ? 88  TYR A CB     1 
ATOM   1349 C  CG     . TYR A 1 88  ? 7.869   49.614  16.108  1.00 11.88  ? 88  TYR A CG     1 
ATOM   1350 C  CD1    . TYR A 1 88  ? 8.284   48.451  15.477  1.00 12.76  ? 88  TYR A CD1    1 
ATOM   1351 C  CD2    . TYR A 1 88  ? 6.506   49.806  16.288  1.00 11.50  ? 88  TYR A CD2    1 
ATOM   1352 C  CE1    . TYR A 1 88  ? 7.376   47.490  15.073  1.00 14.30  ? 88  TYR A CE1    1 
ATOM   1353 C  CE2    . TYR A 1 88  ? 5.590   48.855  15.881  1.00 9.91   ? 88  TYR A CE2    1 
ATOM   1354 C  CZ     . TYR A 1 88  ? 6.029   47.701  15.273  1.00 14.65  ? 88  TYR A CZ     1 
ATOM   1355 O  OH     . TYR A 1 88  ? 5.111   46.758  14.866  1.00 18.08  ? 88  TYR A OH     1 
ATOM   1356 H  H      . TYR A 1 88  ? 8.308   50.830  18.979  1.00 20.81  ? 88  TYR A H      1 
ATOM   1357 H  HA     . TYR A 1 88  ? 10.027  49.327  17.582  1.00 13.57  ? 88  TYR A HA     1 
ATOM   1358 H  HB2    . TYR A 1 88  ? 8.379   51.463  16.779  1.00 14.25  ? 88  TYR A HB2    1 
ATOM   1359 H  HB3    . TYR A 1 88  ? 9.455   50.844  15.787  1.00 14.25  ? 88  TYR A HB3    1 
ATOM   1360 H  HD1    . TYR A 1 88  ? 9.191   48.314  15.323  1.00 15.53  ? 88  TYR A HD1    1 
ATOM   1361 H  HD2    . TYR A 1 88  ? 6.204   50.588  16.689  1.00 14.01  ? 88  TYR A HD2    1 
ATOM   1362 H  HE1    . TYR A 1 88  ? 7.672   46.707  14.669  1.00 17.37  ? 88  TYR A HE1    1 
ATOM   1363 H  HE2    . TYR A 1 88  ? 4.681   48.994  16.017  1.00 12.11  ? 88  TYR A HE2    1 
ATOM   1364 H  HH     . TYR A 1 88  ? 5.505   46.109  14.507  1.00 21.91  ? 88  TYR A HH     1 
ATOM   1365 N  N      . ALA A 1 89  ? 10.871  52.297  18.446  1.00 22.38  ? 89  ALA A N      1 
ATOM   1366 C  CA     . ALA A 1 89  ? 12.010  53.209  18.492  1.00 21.06  ? 89  ALA A CA     1 
ATOM   1367 C  C      . ALA A 1 89  ? 13.007  52.806  19.574  1.00 18.23  ? 89  ALA A C      1 
ATOM   1368 O  O      . ALA A 1 89  ? 14.192  52.599  19.294  1.00 27.51  ? 89  ALA A O      1 
ATOM   1369 C  CB     . ALA A 1 89  ? 11.533  54.646  18.722  1.00 26.14  ? 89  ALA A CB     1 
ATOM   1370 H  H      . ALA A 1 89  ? 10.166  52.584  18.846  1.00 27.07  ? 89  ALA A H      1 
ATOM   1371 H  HA     . ALA A 1 89  ? 12.462  53.172  17.634  1.00 25.48  ? 89  ALA A HA     1 
ATOM   1372 H  HB1    . ALA A 1 89  ? 12.285  55.249  18.615  1.00 31.59  ? 89  ALA A HB1    1 
ATOM   1373 H  HB2    . ALA A 1 89  ? 10.844  54.857  18.073  1.00 31.59  ? 89  ALA A HB2    1 
ATOM   1374 H  HB3    . ALA A 1 89  ? 11.174  54.719  19.620  1.00 31.59  ? 89  ALA A HB3    1 
ATOM   1375 N  N      . HIS A 1 90  ? 12.544  52.689  20.821  1.00 27.41  ? 90  HIS A N      1 
ATOM   1376 C  CA     . HIS A 1 90  ? 13.443  52.343  21.916  1.00 21.89  ? 90  HIS A CA     1 
ATOM   1377 C  C      . HIS A 1 90  ? 13.777  50.858  21.958  1.00 21.16  ? 90  HIS A C      1 
ATOM   1378 O  O      . HIS A 1 90  ? 14.818  50.489  22.510  1.00 26.19  ? 90  HIS A O      1 
ATOM   1379 C  CB     . HIS A 1 90  ? 12.831  52.749  23.259  1.00 22.92  ? 90  HIS A CB     1 
ATOM   1380 C  CG     . HIS A 1 90  ? 13.781  52.636  24.411  1.00 36.03  ? 90  HIS A CG     1 
ATOM   1381 N  ND1    . HIS A 1 90  ? 13.995  51.455  25.088  1.00 44.46  ? 90  HIS A ND1    1 
ATOM   1382 C  CD2    . HIS A 1 90  ? 14.558  53.564  25.018  1.00 35.95  ? 90  HIS A CD2    1 
ATOM   1383 C  CE1    . HIS A 1 90  ? 14.875  51.657  26.053  1.00 31.19  ? 90  HIS A CE1    1 
ATOM   1384 N  NE2    . HIS A 1 90  ? 15.231  52.929  26.033  1.00 48.56  ? 90  HIS A NE2    1 
ATOM   1385 H  H      . HIS A 1 90  ? 11.724  52.804  21.055  1.00 33.10  ? 90  HIS A H      1 
ATOM   1386 H  HA     . HIS A 1 90  ? 14.267  52.839  21.795  1.00 26.49  ? 90  HIS A HA     1 
ATOM   1387 H  HB2    . HIS A 1 90  ? 12.541  53.673  23.203  1.00 27.72  ? 90  HIS A HB2    1 
ATOM   1388 H  HB3    . HIS A 1 90  ? 12.072  52.173  23.443  1.00 27.72  ? 90  HIS A HB3    1 
ATOM   1389 H  HD2    . HIS A 1 90  ? 14.625  54.463  24.790  1.00 43.36  ? 90  HIS A HD2    1 
ATOM   1390 H  HE1    . HIS A 1 90  ? 15.190  51.013  26.646  1.00 37.65  ? 90  HIS A HE1    1 
ATOM   1391 H  HE2    . HIS A 1 90  ? 15.792  53.299  26.569  1.00 58.49  ? 90  HIS A HE2    1 
ATOM   1392 N  N      . GLY A 1 91  ? 12.922  50.004  21.402  1.00 28.26  ? 91  GLY A N      1 
ATOM   1393 C  CA     . GLY A 1 91  ? 13.189  48.583  21.359  1.00 24.60  ? 91  GLY A CA     1 
ATOM   1394 C  C      . GLY A 1 91  ? 12.712  47.789  22.554  1.00 17.78  ? 91  GLY A C      1 
ATOM   1395 O  O      . GLY A 1 91  ? 13.053  46.604  22.659  1.00 21.04  ? 91  GLY A O      1 
ATOM   1396 H  H      . GLY A 1 91  ? 12.175  50.231  21.042  1.00 34.13  ? 91  GLY A H      1 
ATOM   1397 H  HA2    . GLY A 1 91  ? 12.759  48.214  20.573  1.00 29.74  ? 91  GLY A HA2    1 
ATOM   1398 H  HA3    . GLY A 1 91  ? 14.147  48.453  21.285  1.00 29.74  ? 91  GLY A HA3    1 
ATOM   1399 N  N      . SER A 1 92  ? 11.961  48.397  23.470  1.00 19.14  ? 92  SER A N      1 
ATOM   1400 C  CA     . SER A 1 92  ? 11.440  47.659  24.611  1.00 15.76  ? 92  SER A CA     1 
ATOM   1401 C  C      . SER A 1 92  ? 10.510  46.548  24.139  1.00 17.76  ? 92  SER A C      1 
ATOM   1402 O  O      . SER A 1 92  ? 9.876   46.641  23.084  1.00 26.26  ? 92  SER A O      1 
ATOM   1403 C  CB     . SER A 1 92  ? 10.679  48.584  25.563  1.00 19.76  ? 92  SER A CB     1 
ATOM   1404 O  OG     . SER A 1 92  ? 11.531  49.553  26.150  1.00 38.66  ? 92  SER A OG     1 
ATOM   1405 H  H      . SER A 1 92  ? 11.740  49.228  23.452  1.00 23.19  ? 92  SER A H      1 
ATOM   1406 H  HA     . SER A 1 92  ? 12.183  47.269  25.099  1.00 19.13  ? 92  SER A HA     1 
ATOM   1407 H  HB2    . SER A 1 92  ? 9.985   49.041  25.064  1.00 23.93  ? 92  SER A HB2    1 
ATOM   1408 H  HB3    . SER A 1 92  ? 10.283  48.049  26.268  1.00 23.93  ? 92  SER A HB3    1 
ATOM   1409 H  HG     . SER A 1 92  ? 11.085  50.067  26.642  1.00 46.61  ? 92  SER A HG     1 
ATOM   1410 N  N      . SER A 1 93  ? 10.402  45.505  24.953  1.00 22.43  ? 93  SER A N      1 
ATOM   1411 C  CA     . SER A 1 93  ? 9.538   44.389  24.614  1.00 21.32  ? 93  SER A CA     1 
ATOM   1412 C  C      . SER A 1 93  ? 8.114   44.695  25.051  1.00 24.31  ? 93  SER A C      1 
ATOM   1413 O  O      . SER A 1 93  ? 7.873   45.532  25.926  1.00 25.92  ? 93  SER A O      1 
ATOM   1414 C  CB     . SER A 1 93  ? 10.011  43.107  25.299  1.00 21.97  ? 93  SER A CB     1 
ATOM   1415 O  OG     . SER A 1 93  ? 9.936   43.232  26.710  1.00 27.16  ? 93  SER A OG     1 
ATOM   1416 H  H      . SER A 1 93  ? 10.817  45.421  25.701  1.00 27.13  ? 93  SER A H      1 
ATOM   1417 H  HA     . SER A 1 93  ? 9.558   44.244  23.655  1.00 25.80  ? 93  SER A HA     1 
ATOM   1418 H  HB2    . SER A 1 93  ? 9.446   42.371  25.017  1.00 26.58  ? 93  SER A HB2    1 
ATOM   1419 H  HB3    . SER A 1 93  ? 10.931  42.934  25.046  1.00 26.58  ? 93  SER A HB3    1 
ATOM   1420 H  HG     . SER A 1 93  ? 10.211  42.528  27.076  1.00 32.80  ? 93  SER A HG     1 
ATOM   1421 N  N      . LYS A 1 94  ? 7.159   44.002  24.430  1.00 21.04  ? 94  LYS A N      1 
ATOM   1422 C  CA     . LYS A 1 94  ? 5.773   44.162  24.850  1.00 20.89  ? 94  LYS A CA     1 
ATOM   1423 C  C      . LYS A 1 94  ? 5.617   43.829  26.327  1.00 18.30  ? 94  LYS A C      1 
ATOM   1424 O  O      . LYS A 1 94  ? 4.866   44.498  27.046  1.00 16.39  ? 94  LYS A O      1 
ATOM   1425 C  CB     . LYS A 1 94  ? 4.841   43.313  23.989  1.00 14.65  ? 94  LYS A CB     1 
ATOM   1426 C  CG     . LYS A 1 94  ? 4.774   43.761  22.539  1.00 16.35  ? 94  LYS A CG     1 
ATOM   1427 C  CD     . LYS A 1 94  ? 3.648   43.078  21.777  1.00 7.43   ? 94  LYS A CD     1 
ATOM   1428 C  CE     . LYS A 1 94  ? 3.824   41.575  21.710  1.00 21.56  ? 94  LYS A CE     1 
ATOM   1429 N  NZ     . LYS A 1 94  ? 2.742   40.940  20.907  1.00 27.94  ? 94  LYS A NZ     1 
ATOM   1430 H  H      . LYS A 1 94  ? 7.283   43.450  23.782  1.00 25.47  ? 94  LYS A H      1 
ATOM   1431 H  HA     . LYS A 1 94  ? 5.510   45.086  24.719  1.00 25.28  ? 94  LYS A HA     1 
ATOM   1432 H  HB2    . LYS A 1 94  ? 5.154   42.395  24.002  1.00 17.79  ? 94  LYS A HB2    1 
ATOM   1433 H  HB3    . LYS A 1 94  ? 3.944   43.363  24.356  1.00 17.79  ? 94  LYS A HB3    1 
ATOM   1434 H  HG2    . LYS A 1 94  ? 4.622   44.719  22.509  1.00 19.83  ? 94  LYS A HG2    1 
ATOM   1435 H  HG3    . LYS A 1 94  ? 5.612   43.544  22.100  1.00 19.83  ? 94  LYS A HG3    1 
ATOM   1436 H  HD2    . LYS A 1 94  ? 2.805   43.262  22.221  1.00 9.13   ? 94  LYS A HD2    1 
ATOM   1437 H  HD3    . LYS A 1 94  ? 3.626   43.419  20.869  1.00 9.13   ? 94  LYS A HD3    1 
ATOM   1438 H  HE2    . LYS A 1 94  ? 4.676   41.369  21.293  1.00 26.08  ? 94  LYS A HE2    1 
ATOM   1439 H  HE3    . LYS A 1 94  ? 3.796   41.207  22.607  1.00 26.08  ? 94  LYS A HE3    1 
ATOM   1440 H  HZ1    . LYS A 1 94  ? 2.720   41.296  20.092  1.00 33.74  ? 94  LYS A HZ1    1 
ATOM   1441 H  HZ2    . LYS A 1 94  ? 2.889   40.065  20.837  1.00 33.74  ? 94  LYS A HZ2    1 
ATOM   1442 H  HZ3    . LYS A 1 94  ? 1.955   41.071  21.301  1.00 33.74  ? 94  LYS A HZ3    1 
ATOM   1443 N  N      . HIS A 1 95  ? 6.323   42.801  26.803  1.00 24.43  ? 95  HIS A N      1 
ATOM   1444 C  CA     . HIS A 1 95  ? 6.215   42.432  28.209  1.00 22.44  ? 95  HIS A CA     1 
ATOM   1445 C  C      . HIS A 1 95  ? 6.702   43.557  29.115  1.00 28.86  ? 95  HIS A C      1 
ATOM   1446 O  O      . HIS A 1 95  ? 6.078   43.848  30.140  1.00 26.62  ? 95  HIS A O      1 
ATOM   1447 C  CB     . HIS A 1 95  ? 7.003   41.153  28.481  1.00 24.28  ? 95  HIS A CB     1 
ATOM   1448 C  CG     . HIS A 1 95  ? 6.817   40.620  29.866  1.00 26.84  ? 95  HIS A CG     1 
ATOM   1449 N  ND1    . HIS A 1 95  ? 5.936   39.602  30.159  1.00 39.41  ? 95  HIS A ND1    1 
ATOM   1450 C  CD2    . HIS A 1 95  ? 7.383   40.978  31.042  1.00 42.15  ? 95  HIS A CD2    1 
ATOM   1451 C  CE1    . HIS A 1 95  ? 5.976   39.347  31.454  1.00 51.57  ? 95  HIS A CE1    1 
ATOM   1452 N  NE2    . HIS A 1 95  ? 6.847   40.168  32.013  1.00 47.15  ? 95  HIS A NE2    1 
ATOM   1453 H  H      . HIS A 1 95  ? 6.859   42.311  26.342  1.00 29.53  ? 95  HIS A H      1 
ATOM   1454 H  HA     . HIS A 1 95  ? 5.282   42.260  28.412  1.00 27.14  ? 95  HIS A HA     1 
ATOM   1455 H  HB2    . HIS A 1 95  ? 6.714   40.468  27.858  1.00 29.35  ? 95  HIS A HB2    1 
ATOM   1456 H  HB3    . HIS A 1 95  ? 7.948   41.336  28.358  1.00 29.35  ? 95  HIS A HB3    1 
ATOM   1457 H  HD2    . HIS A 1 95  ? 8.017   41.646  31.168  1.00 50.80  ? 95  HIS A HD2    1 
ATOM   1458 H  HE1    . HIS A 1 95  ? 5.476   38.700  31.897  1.00 62.10  ? 95  HIS A HE1    1 
ATOM   1459 H  HE2    . HIS A 1 95  ? 7.045   40.192  32.849  1.00 56.80  ? 95  HIS A HE2    1 
ATOM   1460 N  N      . ALA A 1 96  ? 7.809   44.210  28.749  1.00 29.29  ? 96  ALA A N      1 
ATOM   1461 C  CA     . ALA A 1 96  ? 8.334   45.299  29.569  1.00 17.67  ? 96  ALA A CA     1 
ATOM   1462 C  C      . ALA A 1 96  ? 7.390   46.494  29.573  1.00 18.17  ? 96  ALA A C      1 
ATOM   1463 O  O      . ALA A 1 96  ? 7.204   47.147  30.610  1.00 23.75  ? 96  ALA A O      1 
ATOM   1464 C  CB     . ALA A 1 96  ? 9.714   45.716  29.067  1.00 29.43  ? 96  ALA A CB     1 
ATOM   1465 H  H      . ALA A 1 96  ? 8.268   44.046  28.041  1.00 35.36  ? 96  ALA A H      1 
ATOM   1466 H  HA     . ALA A 1 96  ? 8.427   44.983  30.481  1.00 21.42  ? 96  ALA A HA     1 
ATOM   1467 H  HB1    . ALA A 1 96  ? 10.047  46.438  29.623  1.00 35.53  ? 96  ALA A HB1    1 
ATOM   1468 H  HB2    . ALA A 1 96  ? 10.313  44.955  29.121  1.00 35.53  ? 96  ALA A HB2    1 
ATOM   1469 H  HB3    . ALA A 1 96  ? 9.638   46.015  28.148  1.00 35.53  ? 96  ALA A HB3    1 
ATOM   1470 N  N      . ILE A 1 97  ? 6.801   46.808  28.418  1.00 20.37  ? 97  ILE A N      1 
ATOM   1471 C  CA     . ILE A 1 97  ? 5.848   47.909  28.356  1.00 25.63  ? 97  ILE A CA     1 
ATOM   1472 C  C      . ILE A 1 97  ? 4.637   47.599  29.221  1.00 27.91  ? 97  ILE A C      1 
ATOM   1473 O  O      . ILE A 1 97  ? 4.163   48.453  29.980  1.00 29.86  ? 97  ILE A O      1 
ATOM   1474 C  CB     . ILE A 1 97  ? 5.440   48.187  26.898  1.00 14.59  ? 97  ILE A CB     1 
ATOM   1475 C  CG1    . ILE A 1 97  ? 6.658   48.618  26.081  1.00 19.32  ? 97  ILE A CG1    1 
ATOM   1476 C  CG2    . ILE A 1 97  ? 4.364   49.256  26.850  1.00 17.98  ? 97  ILE A CG2    1 
ATOM   1477 C  CD1    . ILE A 1 97  ? 6.379   48.802  24.602  1.00 22.21  ? 97  ILE A CD1    1 
ATOM   1478 H  H      . ILE A 1 97  ? 6.933   46.406  27.670  1.00 24.65  ? 97  ILE A H      1 
ATOM   1479 H  HA     . ILE A 1 97  ? 6.276   48.708  28.702  1.00 30.97  ? 97  ILE A HA     1 
ATOM   1480 H  HB     . ILE A 1 97  ? 5.085   47.370  26.514  1.00 17.72  ? 97  ILE A HB     1 
ATOM   1481 H  HG12   . ILE A 1 97  ? 6.980   49.465  26.428  1.00 23.40  ? 97  ILE A HG12   1 
ATOM   1482 H  HG13   . ILE A 1 97  ? 7.347   47.941  26.169  1.00 23.40  ? 97  ILE A HG13   1 
ATOM   1483 H  HG21   . ILE A 1 97  ? 4.197   49.494  25.925  1.00 21.79  ? 97  ILE A HG21   1 
ATOM   1484 H  HG22   . ILE A 1 97  ? 3.554   48.906  27.253  1.00 21.79  ? 97  ILE A HG22   1 
ATOM   1485 H  HG23   . ILE A 1 97  ? 4.669   50.034  27.343  1.00 21.79  ? 97  ILE A HG23   1 
ATOM   1486 H  HD11   . ILE A 1 97  ? 7.221   48.807  24.121  1.00 26.86  ? 97  ILE A HD11   1 
ATOM   1487 H  HD12   . ILE A 1 97  ? 5.825   48.069  24.292  1.00 26.86  ? 97  ILE A HD12   1 
ATOM   1488 H  HD13   . ILE A 1 97  ? 5.918   49.645  24.471  1.00 26.86  ? 97  ILE A HD13   1 
ATOM   1489 N  N      . ALA A 1 98  ? 4.120   46.372  29.122  1.00 26.63  ? 98  ALA A N      1 
ATOM   1490 C  CA     . ALA A 1 98  ? 2.985   45.977  29.944  1.00 21.08  ? 98  ALA A CA     1 
ATOM   1491 C  C      . ALA A 1 98  ? 3.335   46.017  31.422  1.00 18.97  ? 98  ALA A C      1 
ATOM   1492 O  O      . ALA A 1 98  ? 2.498   46.374  32.250  1.00 24.32  ? 98  ALA A O      1 
ATOM   1493 C  CB     . ALA A 1 98  ? 2.509   44.582  29.549  1.00 25.86  ? 98  ALA A CB     1 
ATOM   1494 H  H      . ALA A 1 98  ? 4.406   45.758  28.592  1.00 32.17  ? 98  ALA A H      1 
ATOM   1495 H  HA     . ALA A 1 98  ? 2.258   46.600  29.787  1.00 25.51  ? 98  ALA A HA     1 
ATOM   1496 H  HB1    . ALA A 1 98  ? 1.751   44.338  30.103  1.00 31.25  ? 98  ALA A HB1    1 
ATOM   1497 H  HB2    . ALA A 1 98  ? 2.246   44.590  28.615  1.00 31.25  ? 98  ALA A HB2    1 
ATOM   1498 H  HB3    . ALA A 1 98  ? 3.233   43.951  29.682  1.00 31.25  ? 98  ALA A HB3    1 
ATOM   1499 N  N      . SER A 1 99  ? 4.571   45.660  31.775  1.00 18.06  ? 99  SER A N      1 
ATOM   1500 C  CA     . SER A 1 99  ? 4.987   45.724  33.172  1.00 20.43  ? 99  SER A CA     1 
ATOM   1501 C  C      . SER A 1 99  ? 4.986   47.162  33.677  1.00 21.20  ? 99  SER A C      1 
ATOM   1502 O  O      . SER A 1 99  ? 4.421   47.460  34.736  1.00 29.93  ? 99  SER A O      1 
ATOM   1503 C  CB     . SER A 1 99  ? 6.370   45.095  33.328  1.00 27.16  ? 99  SER A CB     1 
ATOM   1504 O  OG     . SER A 1 99  ? 6.382   43.763  32.839  1.00 39.59  ? 99  SER A OG     1 
ATOM   1505 H  H      . SER A 1 99  ? 5.179   45.382  31.234  1.00 21.89  ? 99  SER A H      1 
ATOM   1506 H  HA     . SER A 1 99  ? 4.362   45.216  33.712  1.00 24.73  ? 99  SER A HA     1 
ATOM   1507 H  HB2    . SER A 1 99  ? 7.014   45.620  32.827  1.00 32.80  ? 99  SER A HB2    1 
ATOM   1508 H  HB3    . SER A 1 99  ? 6.609   45.088  34.268  1.00 32.80  ? 99  SER A HB3    1 
ATOM   1509 H  HG     . SER A 1 99  ? 6.192   43.755  32.021  1.00 47.72  ? 99  SER A HG     1 
ATOM   1510 N  N      . TYR A 1 100 ? 5.622   48.070  32.935  1.00 26.18  ? 100 TYR A N      1 
ATOM   1511 C  CA     . TYR A 1 100 ? 5.592   49.477  33.325  1.00 37.92  ? 100 TYR A CA     1 
ATOM   1512 C  C      . TYR A 1 100 ? 4.157   49.983  33.431  1.00 29.73  ? 100 TYR A C      1 
ATOM   1513 O  O      . TYR A 1 100 ? 3.818   50.728  34.358  1.00 36.68  ? 100 TYR A O      1 
ATOM   1514 C  CB     . TYR A 1 100 ? 6.377   50.319  32.321  1.00 41.61  ? 100 TYR A CB     1 
ATOM   1515 C  CG     . TYR A 1 100 ? 6.195   51.810  32.494  1.00 20.90  ? 100 TYR A CG     1 
ATOM   1516 C  CD1    . TYR A 1 100 ? 5.252   52.501  31.749  1.00 21.83  ? 100 TYR A CD1    1 
ATOM   1517 C  CD2    . TYR A 1 100 ? 6.951   52.521  33.413  1.00 27.96  ? 100 TYR A CD2    1 
ATOM   1518 C  CE1    . TYR A 1 100 ? 5.076   53.859  31.903  1.00 29.06  ? 100 TYR A CE1    1 
ATOM   1519 C  CE2    . TYR A 1 100 ? 6.785   53.882  33.572  1.00 47.45  ? 100 TYR A CE2    1 
ATOM   1520 C  CZ     . TYR A 1 100 ? 5.844   54.545  32.815  1.00 41.71  ? 100 TYR A CZ     1 
ATOM   1521 O  OH     . TYR A 1 100 ? 5.666   55.901  32.968  1.00 57.60  ? 100 TYR A OH     1 
ATOM   1522 H  H      . TYR A 1 100 ? 6.068   47.903  32.218  1.00 31.63  ? 100 TYR A H      1 
ATOM   1523 H  HA     . TYR A 1 100 ? 6.016   49.571  34.192  1.00 45.72  ? 100 TYR A HA     1 
ATOM   1524 H  HB2    . TYR A 1 100 ? 7.322   50.123  32.423  1.00 50.15  ? 100 TYR A HB2    1 
ATOM   1525 H  HB3    . TYR A 1 100 ? 6.086   50.087  31.425  1.00 50.15  ? 100 TYR A HB3    1 
ATOM   1526 H  HD1    . TYR A 1 100 ? 4.728   52.040  31.134  1.00 26.41  ? 100 TYR A HD1    1 
ATOM   1527 H  HD2    . TYR A 1 100 ? 7.580   52.073  33.931  1.00 33.77  ? 100 TYR A HD2    1 
ATOM   1528 H  HE1    . TYR A 1 100 ? 4.442   54.309  31.392  1.00 35.08  ? 100 TYR A HE1    1 
ATOM   1529 H  HE2    . TYR A 1 100 ? 7.305   54.348  34.186  1.00 57.16  ? 100 TYR A HE2    1 
ATOM   1530 H  HH     . TYR A 1 100 ? 6.219   56.202  33.525  1.00 69.33  ? 100 TYR A HH     1 
ATOM   1531 N  N      A TYR A 1 101 ? 3.285   49.579  32.510  0.54 35.99  ? 101 TYR A N      1 
ATOM   1532 N  N      B TYR A 1 101 ? 3.319   49.607  32.460  0.46 35.95  ? 101 TYR A N      1 
ATOM   1533 C  CA     A TYR A 1 101 ? 1.914   50.077  32.559  0.54 33.13  ? 101 TYR A CA     1 
ATOM   1534 C  CA     B TYR A 1 101 ? 1.903   49.960  32.457  0.46 33.08  ? 101 TYR A CA     1 
ATOM   1535 C  C      A TYR A 1 101 ? 1.078   49.400  33.638  0.54 35.33  ? 101 TYR A C      1 
ATOM   1536 C  C      B TYR A 1 101 ? 1.213   49.469  33.724  0.46 35.40  ? 101 TYR A C      1 
ATOM   1537 O  O      A TYR A 1 101 ? 0.044   49.950  34.031  0.54 38.74  ? 101 TYR A O      1 
ATOM   1538 O  O      B TYR A 1 101 ? 0.442   50.206  34.350  0.46 38.33  ? 101 TYR A O      1 
ATOM   1539 C  CB     A TYR A 1 101 ? 1.244   49.926  31.193  0.54 25.45  ? 101 TYR A CB     1 
ATOM   1540 C  CB     B TYR A 1 101 ? 1.281   49.349  31.196  0.46 27.53  ? 101 TYR A CB     1 
ATOM   1541 C  CG     A TYR A 1 101 ? 1.428   51.151  30.330  0.54 22.32  ? 101 TYR A CG     1 
ATOM   1542 C  CG     B TYR A 1 101 ? -0.155  49.687  30.849  0.46 34.31  ? 101 TYR A CG     1 
ATOM   1543 C  CD1    A TYR A 1 101 ? 0.723   52.318  30.595  0.54 34.36  ? 101 TYR A CD1    1 
ATOM   1544 C  CD1    B TYR A 1 101 ? -0.975  50.402  31.711  0.46 41.81  ? 101 TYR A CD1    1 
ATOM   1545 C  CD2    A TYR A 1 101 ? 2.316   51.150  29.264  0.54 25.58  ? 101 TYR A CD2    1 
ATOM   1546 C  CD2    B TYR A 1 101 ? -0.692  49.263  29.638  0.46 27.71  ? 101 TYR A CD2    1 
ATOM   1547 C  CE1    A TYR A 1 101 ? 0.891   53.447  29.818  0.54 25.83  ? 101 TYR A CE1    1 
ATOM   1548 C  CE1    B TYR A 1 101 ? -2.289  50.689  31.367  0.46 38.62  ? 101 TYR A CE1    1 
ATOM   1549 C  CE2    A TYR A 1 101 ? 2.491   52.276  28.481  0.54 22.21  ? 101 TYR A CE2    1 
ATOM   1550 C  CE2    B TYR A 1 101 ? -1.992  49.542  29.291  0.46 20.51  ? 101 TYR A CE2    1 
ATOM   1551 C  CZ     A TYR A 1 101 ? 1.775   53.420  28.763  0.54 22.93  ? 101 TYR A CZ     1 
ATOM   1552 C  CZ     B TYR A 1 101 ? -2.787  50.252  30.154  0.46 31.52  ? 101 TYR A CZ     1 
ATOM   1553 O  OH     A TYR A 1 101 ? 1.941   54.544  27.988  0.54 31.99  ? 101 TYR A OH     1 
ATOM   1554 O  OH     B TYR A 1 101 ? -4.085  50.525  29.790  0.46 47.94  ? 101 TYR A OH     1 
ATOM   1555 H  H      A TYR A 1 101 ? 3.456   49.035  31.866  0.54 43.41  ? 101 TYR A H      1 
ATOM   1556 H  H      B TYR A 1 101 ? 3.550   49.137  31.778  0.46 43.35  ? 101 TYR A H      1 
ATOM   1557 H  HA     A TYR A 1 101 ? 1.936   51.025  32.765  0.54 39.97  ? 101 TYR A HA     1 
ATOM   1558 H  HA     B TYR A 1 101 ? 1.782   50.922  32.435  0.46 39.91  ? 101 TYR A HA     1 
ATOM   1559 H  HB2    A TYR A 1 101 ? 1.634   49.168  30.730  0.54 30.75  ? 101 TYR A HB2    1 
ATOM   1560 H  HB2    B TYR A 1 101 ? 1.819   49.632  30.439  0.46 33.25  ? 101 TYR A HB2    1 
ATOM   1561 H  HB3    A TYR A 1 101 ? 0.293   49.784  31.320  0.54 30.75  ? 101 TYR A HB3    1 
ATOM   1562 H  HB3    B TYR A 1 101 ? 1.320   48.384  31.289  0.46 33.25  ? 101 TYR A HB3    1 
ATOM   1563 H  HD1    A TYR A 1 101 ? 0.127   52.339  31.308  0.54 41.45  ? 101 TYR A HD1    1 
ATOM   1564 H  HD1    B TYR A 1 101 ? -0.640  50.693  32.528  0.46 50.39  ? 101 TYR A HD1    1 
ATOM   1565 H  HD2    A TYR A 1 101 ? 2.802   50.380  29.074  0.54 30.91  ? 101 TYR A HD2    1 
ATOM   1566 H  HD2    B TYR A 1 101 ? -0.158  48.778  29.050  0.46 33.47  ? 101 TYR A HD2    1 
ATOM   1567 H  HE1    A TYR A 1 101 ? 0.410   54.221  30.006  0.54 31.22  ? 101 TYR A HE1    1 
ATOM   1568 H  HE1    B TYR A 1 101 ? -2.830  51.171  31.949  0.46 46.56  ? 101 TYR A HE1    1 
ATOM   1569 H  HE2    A TYR A 1 101 ? 3.087   52.261  27.767  0.54 26.87  ? 101 TYR A HE2    1 
ATOM   1570 H  HE2    B TYR A 1 101 ? -2.330  49.251  28.475  0.46 24.83  ? 101 TYR A HE2    1 
ATOM   1571 H  HH     A TYR A 1 101 ? 2.494   54.390  27.374  0.54 38.60  ? 101 TYR A HH     1 
ATOM   1572 H  HH     B TYR A 1 101 ? -4.473  50.945  30.404  0.46 57.74  ? 101 TYR A HH     1 
ATOM   1573 N  N      . HIS A 1 102 ? 1.495   48.229  34.123  1.00 32.42  ? 102 HIS A N      1 
ATOM   1574 C  CA     . HIS A 1 102 ? 0.867   47.640  35.301  1.00 31.36  ? 102 HIS A CA     1 
ATOM   1575 C  C      . HIS A 1 102 ? 1.329   48.316  36.586  1.00 39.64  ? 102 HIS A C      1 
ATOM   1576 O  O      . HIS A 1 102 ? 0.542   48.474  37.526  1.00 58.58  ? 102 HIS A O      1 
ATOM   1577 C  CB     . HIS A 1 102 ? 1.167   46.140  35.339  1.00 31.08  ? 102 HIS A CB     1 
ATOM   1578 C  CG     . HIS A 1 102 ? 0.763   45.471  36.615  1.00 33.85  ? 102 HIS A CG     1 
ATOM   1579 N  ND1    . HIS A 1 102 ? -0.552  45.265  36.970  1.00 38.17  ? 102 HIS A ND1    1 
ATOM   1580 C  CD2    . HIS A 1 102 ? 1.509   44.915  37.598  1.00 27.02  ? 102 HIS A CD2    1 
ATOM   1581 C  CE1    . HIS A 1 102 ? -0.599  44.643  38.135  1.00 54.22  ? 102 HIS A CE1    1 
ATOM   1582 N  NE2    . HIS A 1 102 ? 0.639   44.415  38.535  1.00 53.92  ? 102 HIS A NE2    1 
ATOM   1583 H  H      A HIS A 1 102 ? 2.134   47.759  33.791  0.54 39.12  ? 102 HIS A H      1 
ATOM   1584 H  H      B HIS A 1 102 ? 2.049   47.704  33.729  0.46 39.12  ? 102 HIS A H      1 
ATOM   1585 H  HA     . HIS A 1 102 ? -0.093  47.761  35.241  1.00 37.85  ? 102 HIS A HA     1 
ATOM   1586 H  HB2    . HIS A 1 102 ? 0.686   45.709  34.615  1.00 37.51  ? 102 HIS A HB2    1 
ATOM   1587 H  HB3    . HIS A 1 102 ? 2.121   46.011  35.227  1.00 37.51  ? 102 HIS A HB3    1 
ATOM   1588 H  HD1    . HIS A 1 102 ? -1.236  45.505  36.507  1.00 46.02  ? 102 HIS A HD1    1 
ATOM   1589 H  HD2    . HIS A 1 102 ? 2.438   44.879  37.633  1.00 32.64  ? 102 HIS A HD2    1 
ATOM   1590 H  HE1    . HIS A 1 102 ? -1.372  44.406  38.594  1.00 65.28  ? 102 HIS A HE1    1 
ATOM   1591 N  N      . ARG A 1 103 ? 2.602   48.707  36.653  1.00 57.83  ? 103 ARG A N      1 
ATOM   1592 C  CA     . ARG A 1 103 ? 3.104   49.386  37.843  1.00 51.95  ? 103 ARG A CA     1 
ATOM   1593 C  C      . ARG A 1 103 ? 2.395   50.715  38.068  1.00 47.88  ? 103 ARG A C      1 
ATOM   1594 O  O      . ARG A 1 103 ? 1.981   51.031  39.190  1.00 54.64  ? 103 ARG A O      1 
ATOM   1595 C  CB     . ARG A 1 103 ? 4.607   49.620  37.719  1.00 54.14  ? 103 ARG A CB     1 
ATOM   1596 C  CG     . ARG A 1 103 ? 5.470   48.376  37.749  1.00 61.63  ? 103 ARG A CG     1 
ATOM   1597 C  CD     . ARG A 1 103 ? 6.893   48.773  37.404  1.00 67.93  ? 103 ARG A CD     1 
ATOM   1598 N  NE     . ARG A 1 103 ? 7.370   49.820  38.308  1.00 103.69 ? 103 ARG A NE     1 
ATOM   1599 C  CZ     . ARG A 1 103 ? 7.458   51.115  38.001  1.00 85.20  ? 103 ARG A CZ     1 
ATOM   1600 N  NH1    . ARG A 1 103 ? 7.102   51.561  36.802  1.00 68.48  ? 103 ARG A NH1    1 
ATOM   1601 N  NH2    . ARG A 1 103 ? 7.904   51.977  38.905  1.00 76.91  ? 103 ARG A NH2    1 
ATOM   1602 H  H      . ARG A 1 103 ? 3.187   48.594  36.033  1.00 69.61  ? 103 ARG A H      1 
ATOM   1603 H  HA     . ARG A 1 103 ? 2.937   48.815  38.609  1.00 62.56  ? 103 ARG A HA     1 
ATOM   1604 H  HB2    . ARG A 1 103 ? 4.776   50.068  36.876  1.00 65.19  ? 103 ARG A HB2    1 
ATOM   1605 H  HB3    . ARG A 1 103 ? 4.889   50.183  38.457  1.00 65.19  ? 103 ARG A HB3    1 
ATOM   1606 H  HG2    . ARG A 1 103 ? 5.456   47.981  38.635  1.00 74.17  ? 103 ARG A HG2    1 
ATOM   1607 H  HG3    . ARG A 1 103 ? 5.152   47.734  37.094  1.00 74.17  ? 103 ARG A HG3    1 
ATOM   1608 H  HD2    . ARG A 1 103 ? 7.475   48.002  37.490  1.00 81.73  ? 103 ARG A HD2    1 
ATOM   1609 H  HD3    . ARG A 1 103 ? 6.924   49.113  36.496  1.00 81.73  ? 103 ARG A HD3    1 
ATOM   1610 H  HE     . ARG A 1 103 ? 7.613   49.582  39.098  1.00 124.65 ? 103 ARG A HE     1 
ATOM   1611 H  HH11   . ARG A 1 103 ? 6.810   51.012  36.209  1.00 82.40  ? 103 ARG A HH11   1 
ATOM   1612 H  HH12   . ARG A 1 103 ? 7.164   52.399  36.619  1.00 82.40  ? 103 ARG A HH12   1 
ATOM   1613 H  HH21   . ARG A 1 103 ? 8.135   51.699  39.686  1.00 92.51  ? 103 ARG A HH21   1 
ATOM   1614 H  HH22   . ARG A 1 103 ? 7.962   52.812  38.711  1.00 92.51  ? 103 ARG A HH22   1 
ATOM   1615 N  N      . VAL A 1 104 ? 2.252   51.512  37.010  1.00 52.89  ? 104 VAL A N      1 
ATOM   1616 C  CA     . VAL A 1 104 ? 1.625   52.823  37.117  1.00 45.46  ? 104 VAL A CA     1 
ATOM   1617 C  C      . VAL A 1 104 ? 0.240   52.709  36.500  1.00 54.32  ? 104 VAL A C      1 
ATOM   1618 O  O      . VAL A 1 104 ? -0.028  53.289  35.442  1.00 73.60  ? 104 VAL A O      1 
ATOM   1619 C  CB     . VAL A 1 104 ? 2.458   53.902  36.405  1.00 50.67  ? 104 VAL A CB     1 
ATOM   1620 C  CG1    . VAL A 1 104 ? 1.888   55.290  36.688  1.00 102.83 ? 104 VAL A CG1    1 
ATOM   1621 C  CG2    . VAL A 1 104 ? 3.927   53.781  36.776  1.00 69.27  ? 104 VAL A CG2    1 
ATOM   1622 H  H      . VAL A 1 104 ? 2.513   51.313  36.216  1.00 63.68  ? 104 VAL A H      1 
ATOM   1623 H  HA     . VAL A 1 104 ? 1.549   53.083  38.049  1.00 54.76  ? 104 VAL A HA     1 
ATOM   1624 H  HB     . VAL A 1 104 ? 2.408   53.770  35.446  1.00 61.02  ? 104 VAL A HB     1 
ATOM   1625 H  HG11   . VAL A 1 104 ? 2.474   55.958  36.300  1.00 123.61 ? 104 VAL A HG11   1 
ATOM   1626 H  HG12   . VAL A 1 104 ? 1.005   55.355  36.292  1.00 123.61 ? 104 VAL A HG12   1 
ATOM   1627 H  HG13   . VAL A 1 104 ? 1.830   55.418  37.648  1.00 123.61 ? 104 VAL A HG13   1 
ATOM   1628 H  HG21   . VAL A 1 104 ? 4.398   54.568  36.460  1.00 83.34  ? 104 VAL A HG21   1 
ATOM   1629 H  HG22   . VAL A 1 104 ? 4.004   53.713  37.740  1.00 83.34  ? 104 VAL A HG22   1 
ATOM   1630 H  HG23   . VAL A 1 104 ? 4.293   52.986  36.358  1.00 83.34  ? 104 VAL A HG23   1 
ATOM   1631 N  N      . ALA A 1 105 ? -0.653  51.981  37.164  1.00 49.64  ? 105 ALA A N      1 
ATOM   1632 C  CA     . ALA A 1 105 ? -1.999  51.737  36.665  1.00 43.39  ? 105 ALA A CA     1 
ATOM   1633 C  C      . ALA A 1 105 ? -3.004  52.198  37.706  1.00 43.19  ? 105 ALA A C      1 
ATOM   1634 O  O      . ALA A 1 105 ? -2.999  51.711  38.841  1.00 43.15  ? 105 ALA A O      1 
ATOM   1635 C  CB     . ALA A 1 105 ? -2.204  50.256  36.345  1.00 51.99  ? 105 ALA A CB     1 
ATOM   1636 H  H      . ALA A 1 105 ? -0.494  51.611  37.924  1.00 59.79  ? 105 ALA A H      1 
ATOM   1637 H  HA     . ALA A 1 105 ? -2.140  52.253  35.856  1.00 52.28  ? 105 ALA A HA     1 
ATOM   1638 H  HB1    . ALA A 1 105 ? -3.113  50.123  36.036  1.00 62.60  ? 105 ALA A HB1    1 
ATOM   1639 H  HB2    . ALA A 1 105 ? -1.577  49.994  35.652  1.00 62.60  ? 105 ALA A HB2    1 
ATOM   1640 H  HB3    . ALA A 1 105 ? -2.047  49.735  37.148  1.00 62.60  ? 105 ALA A HB3    1 
ATOM   1641 N  N      . ARG A 1 106 ? -3.839  53.154  37.326  1.00 59.07  ? 106 ARG A N      1 
ATOM   1642 C  CA     . ARG A 1 106 ? -4.858  53.659  38.230  1.00 68.59  ? 106 ARG A CA     1 
ATOM   1643 C  C      . ARG A 1 106 ? -5.966  52.624  38.404  1.00 57.23  ? 106 ARG A C      1 
ATOM   1644 O  O      . ARG A 1 106 ? -6.320  51.929  37.446  1.00 45.28  ? 106 ARG A O      1 
ATOM   1645 C  CB     . ARG A 1 106 ? -5.438  54.962  37.686  1.00 64.52  ? 106 ARG A CB     1 
ATOM   1646 C  CG     . ARG A 1 106 ? -4.463  56.123  37.717  1.00 67.38  ? 106 ARG A CG     1 
ATOM   1647 C  CD     . ARG A 1 106 ? -5.121  57.415  37.281  1.00 76.45  ? 106 ARG A CD     1 
ATOM   1648 N  NE     . ARG A 1 106 ? -6.172  57.823  38.206  1.00 90.81  ? 106 ARG A NE     1 
ATOM   1649 C  CZ     . ARG A 1 106 ? -6.886  58.939  38.088  1.00 101.37 ? 106 ARG A CZ     1 
ATOM   1650 N  NH1    . ARG A 1 106 ? -6.666  59.774  37.081  1.00 101.29 ? 106 ARG A NH1    1 
ATOM   1651 N  NH2    . ARG A 1 106 ? -7.824  59.220  38.982  1.00 92.55  ? 106 ARG A NH2    1 
ATOM   1652 H  H      . ARG A 1 106 ? -3.839  53.528  36.552  1.00 71.09  ? 106 ARG A H      1 
ATOM   1653 H  HA     . ARG A 1 106 ? -4.468  53.835  39.101  1.00 82.53  ? 106 ARG A HA     1 
ATOM   1654 H  HB2    . ARG A 1 106 ? -5.705  54.824  36.763  1.00 77.64  ? 106 ARG A HB2    1 
ATOM   1655 H  HB3    . ARG A 1 106 ? -6.209  55.208  38.221  1.00 77.64  ? 106 ARG A HB3    1 
ATOM   1656 H  HG2    . ARG A 1 106 ? -4.132  56.240  38.622  1.00 81.08  ? 106 ARG A HG2    1 
ATOM   1657 H  HG3    . ARG A 1 106 ? -3.725  55.939  37.115  1.00 81.08  ? 106 ARG A HG3    1 
ATOM   1658 H  HD2    . ARG A 1 106 ? -4.454  58.119  37.248  1.00 91.96  ? 106 ARG A HD2    1 
ATOM   1659 H  HD3    . ARG A 1 106 ? -5.517  57.292  36.404  1.00 91.96  ? 106 ARG A HD3    1 
ATOM   1660 H  HE     . ARG A 1 106 ? -6.341  57.308  38.874  1.00 109.19 ? 106 ARG A HE     1 
ATOM   1661 H  HH11   . ARG A 1 106 ? -6.057  59.596  36.500  1.00 121.76 ? 106 ARG A HH11   1 
ATOM   1662 H  HH12   . ARG A 1 106 ? -7.131  60.494  37.010  1.00 121.76 ? 106 ARG A HH12   1 
ATOM   1663 H  HH21   . ARG A 1 106 ? -7.969  58.681  39.636  1.00 111.28 ? 106 ARG A HH21   1 
ATOM   1664 H  HH22   . ARG A 1 106 ? -8.287  59.940  38.907  1.00 111.28 ? 106 ARG A HH22   1 
ATOM   1665 N  N      . PRO A 1 107 ? -6.529  52.490  39.607  1.00 55.00  ? 107 PRO A N      1 
ATOM   1666 C  CA     . PRO A 1 107 ? -7.641  51.551  39.791  1.00 39.19  ? 107 PRO A CA     1 
ATOM   1667 C  C      . PRO A 1 107 ? -8.757  51.846  38.799  1.00 47.76  ? 107 PRO A C      1 
ATOM   1668 O  O      . PRO A 1 107 ? -9.107  53.002  38.552  1.00 47.29  ? 107 PRO A O      1 
ATOM   1669 C  CB     . PRO A 1 107 ? -8.082  51.800  41.236  1.00 49.99  ? 107 PRO A CB     1 
ATOM   1670 C  CG     . PRO A 1 107 ? -6.866  52.336  41.912  1.00 64.14  ? 107 PRO A CG     1 
ATOM   1671 C  CD     . PRO A 1 107 ? -6.142  53.140  40.873  1.00 64.65  ? 107 PRO A CD     1 
ATOM   1672 H  HA     . PRO A 1 107 ? -7.347  50.631  39.699  1.00 47.24  ? 107 PRO A HA     1 
ATOM   1673 H  HB2    . PRO A 1 107 ? -8.805  52.446  41.256  1.00 60.21  ? 107 PRO A HB2    1 
ATOM   1674 H  HB3    . PRO A 1 107 ? -8.369  50.968  41.643  1.00 60.21  ? 107 PRO A HB3    1 
ATOM   1675 H  HG2    . PRO A 1 107 ? -7.126  52.896  42.660  1.00 77.18  ? 107 PRO A HG2    1 
ATOM   1676 H  HG3    . PRO A 1 107 ? -6.314  51.601  42.224  1.00 77.18  ? 107 PRO A HG3    1 
ATOM   1677 H  HD2    . PRO A 1 107 ? -6.434  54.065  40.888  1.00 77.80  ? 107 PRO A HD2    1 
ATOM   1678 H  HD3    . PRO A 1 107 ? -5.183  53.093  41.006  1.00 77.80  ? 107 PRO A HD3    1 
ATOM   1679 N  N      . ARG A 1 108 ? -9.311  50.785  38.221  1.00 38.01  ? 108 ARG A N      1 
ATOM   1680 C  CA     . ARG A 1 108 ? -10.343 50.913  37.206  1.00 19.29  ? 108 ARG A CA     1 
ATOM   1681 C  C      . ARG A 1 108 ? -11.421 49.873  37.482  1.00 30.46  ? 108 ARG A C      1 
ATOM   1682 O  O      . ARG A 1 108 ? -11.210 48.913  38.226  1.00 32.20  ? 108 ARG A O      1 
ATOM   1683 C  CB     . ARG A 1 108 ? -9.711  50.735  35.817  1.00 27.40  ? 108 ARG A CB     1 
ATOM   1684 C  CG     . ARG A 1 108 ? -10.601 50.962  34.607  1.00 51.20  ? 108 ARG A CG     1 
ATOM   1685 C  CD     . ARG A 1 108 ? -10.582 49.748  33.703  1.00 46.76  ? 108 ARG A CD     1 
ATOM   1686 N  NE     . ARG A 1 108 ? -9.220  49.431  33.289  1.00 20.16  ? 108 ARG A NE     1 
ATOM   1687 C  CZ     . ARG A 1 108 ? -8.883  48.358  32.583  1.00 50.03  ? 108 ARG A CZ     1 
ATOM   1688 N  NH1    . ARG A 1 108 ? -9.811  47.492  32.188  1.00 24.67  ? 108 ARG A NH1    1 
ATOM   1689 N  NH2    . ARG A 1 108 ? -7.610  48.155  32.273  1.00 57.17  ? 108 ARG A NH2    1 
ATOM   1690 H  H      . ARG A 1 108 ? -9.101  49.972  38.405  1.00 45.82  ? 108 ARG A H      1 
ATOM   1691 H  HA     . ARG A 1 108 ? -10.779 51.779  37.235  1.00 23.36  ? 108 ARG A HA     1 
ATOM   1692 H  HB2    . ARG A 1 108 ? -8.973  51.361  35.744  1.00 33.09  ? 108 ARG A HB2    1 
ATOM   1693 H  HB3    . ARG A 1 108 ? -9.381  49.825  35.755  1.00 33.09  ? 108 ARG A HB3    1 
ATOM   1694 H  HG2    . ARG A 1 108 ? -11.513 51.116  34.899  1.00 61.65  ? 108 ARG A HG2    1 
ATOM   1695 H  HG3    . ARG A 1 108 ? -10.279 51.727  34.105  1.00 61.65  ? 108 ARG A HG3    1 
ATOM   1696 H  HD2    . ARG A 1 108 ? -10.945 48.984  34.179  1.00 56.33  ? 108 ARG A HD2    1 
ATOM   1697 H  HD3    . ARG A 1 108 ? -11.111 49.927  32.910  1.00 56.33  ? 108 ARG A HD3    1 
ATOM   1698 H  HE     . ARG A 1 108 ? -8.594  49.974  33.517  1.00 24.41  ? 108 ARG A HE     1 
ATOM   1699 H  HH11   . ARG A 1 108 ? -10.637 47.625  32.391  1.00 29.81  ? 108 ARG A HH11   1 
ATOM   1700 H  HH12   . ARG A 1 108 ? -9.587  46.799  31.731  1.00 29.81  ? 108 ARG A HH12   1 
ATOM   1701 H  HH21   . ARG A 1 108 ? -7.010  48.716  32.529  1.00 68.82  ? 108 ARG A HH21   1 
ATOM   1702 H  HH22   . ARG A 1 108 ? -7.384  47.463  31.815  1.00 68.82  ? 108 ARG A HH22   1 
ATOM   1703 N  N      . LYS A 1 109 ? -12.579 50.060  36.857  1.00 17.66  ? 109 LYS A N      1 
ATOM   1704 C  CA     . LYS A 1 109 ? -13.715 49.158  37.040  1.00 21.99  ? 109 LYS A CA     1 
ATOM   1705 C  C      . LYS A 1 109 ? -13.428 47.891  36.246  1.00 21.49  ? 109 LYS A C      1 
ATOM   1706 O  O      . LYS A 1 109 ? -13.649 47.840  35.034  1.00 26.07  ? 109 LYS A O      1 
ATOM   1707 C  CB     . LYS A 1 109 ? -15.007 49.817  36.576  1.00 30.40  ? 109 LYS A CB     1 
ATOM   1708 C  CG     . LYS A 1 109 ? -16.258 49.016  36.897  1.00 20.49  ? 109 LYS A CG     1 
ATOM   1709 C  CD     . LYS A 1 109 ? -17.484 49.587  36.205  1.00 31.64  ? 109 LYS A CD     1 
ATOM   1710 C  CE     . LYS A 1 109 ? -18.772 49.097  36.851  1.00 45.76  ? 109 LYS A CE     1 
ATOM   1711 N  NZ     . LYS A 1 109 ? -18.927 49.624  38.239  1.00 76.86  ? 109 LYS A NZ     1 
ATOM   1712 H  H      . LYS A 1 109 ? -12.734 50.710  36.315  1.00 21.41  ? 109 LYS A H      1 
ATOM   1713 H  HA     . LYS A 1 109 ? -13.810 48.934  37.979  1.00 26.61  ? 109 LYS A HA     1 
ATOM   1714 H  HB2    . LYS A 1 109 ? -15.090 50.680  37.011  1.00 36.70  ? 109 LYS A HB2    1 
ATOM   1715 H  HB3    . LYS A 1 109 ? -14.970 49.932  35.614  1.00 36.70  ? 109 LYS A HB3    1 
ATOM   1716 H  HG2    . LYS A 1 109 ? -16.138 48.101  36.598  1.00 24.80  ? 109 LYS A HG2    1 
ATOM   1717 H  HG3    . LYS A 1 109 ? -16.413 49.034  37.855  1.00 24.80  ? 109 LYS A HG3    1 
ATOM   1718 H  HD2    . LYS A 1 109 ? -17.463 50.555  36.263  1.00 38.18  ? 109 LYS A HD2    1 
ATOM   1719 H  HD3    . LYS A 1 109 ? -17.485 49.311  35.275  1.00 38.18  ? 109 LYS A HD3    1 
ATOM   1720 H  HE2    . LYS A 1 109 ? -19.530 49.398  36.325  1.00 55.13  ? 109 LYS A HE2    1 
ATOM   1721 H  HE3    . LYS A 1 109 ? -18.762 48.128  36.893  1.00 55.13  ? 109 LYS A HE3    1 
ATOM   1722 H  HZ1    . LYS A 1 109 ? -18.281 49.304  38.760  1.00 92.45  ? 109 LYS A HZ1    1 
ATOM   1723 H  HZ2    . LYS A 1 109 ? -18.881 50.513  38.234  1.00 92.45  ? 109 LYS A HZ2    1 
ATOM   1724 H  HZ3    . LYS A 1 109 ? -19.715 49.378  38.572  1.00 92.45  ? 109 LYS A HZ3    1 
ATOM   1725 N  N      . MET A 1 110 ? -12.928 46.864  36.928  1.00 24.25  ? 110 MET A N      1 
ATOM   1726 C  CA     . MET A 1 110 ? -12.675 45.580  36.290  1.00 33.17  ? 110 MET A CA     1 
ATOM   1727 C  C      . MET A 1 110 ? -13.983 44.803  36.200  1.00 21.17  ? 110 MET A C      1 
ATOM   1728 O  O      . MET A 1 110 ? -14.736 44.724  37.170  1.00 36.96  ? 110 MET A O      1 
ATOM   1729 C  CB     . MET A 1 110 ? -11.639 44.790  37.089  1.00 22.36  ? 110 MET A CB     1 
ATOM   1730 C  CG     . MET A 1 110 ? -10.370 45.586  37.369  1.00 37.01  ? 110 MET A CG     1 
ATOM   1731 S  SD     . MET A 1 110 ? -9.558  46.270  35.913  1.00 30.59  ? 110 MET A SD     1 
ATOM   1732 C  CE     . MET A 1 110 ? -9.249  44.805  34.938  1.00 29.23  ? 110 MET A CE     1 
ATOM   1733 H  H      . MET A 1 110 ? -12.727 46.887  37.764  1.00 29.32  ? 110 MET A H      1 
ATOM   1734 H  HA     . MET A 1 110 ? -12.313 45.712  35.400  1.00 40.02  ? 110 MET A HA     1 
ATOM   1735 H  HB2    . MET A 1 110 ? -12.027 44.535  37.941  1.00 27.05  ? 110 MET A HB2    1 
ATOM   1736 H  HB3    . MET A 1 110 ? -11.392 43.998  36.587  1.00 27.05  ? 110 MET A HB3    1 
ATOM   1737 H  HG2    . MET A 1 110 ? -10.596 46.329  37.951  1.00 44.63  ? 110 MET A HG2    1 
ATOM   1738 H  HG3    . MET A 1 110 ? -9.732  45.002  37.809  1.00 44.63  ? 110 MET A HG3    1 
ATOM   1739 H  HE1    . MET A 1 110 ? -8.765  45.056  34.135  1.00 35.29  ? 110 MET A HE1    1 
ATOM   1740 H  HE2    . MET A 1 110 ? -8.720  44.183  35.462  1.00 35.29  ? 110 MET A HE2    1 
ATOM   1741 H  HE3    . MET A 1 110 ? -10.097 44.399  34.700  1.00 35.29  ? 110 MET A HE3    1 
ATOM   1742 N  N      . LEU A 1 111 ? -14.227 44.181  35.052  1.00 12.23  ? 111 LEU A N      1 
ATOM   1743 C  CA     . LEU A 1 111 ? -15.523 43.596  34.747  1.00 18.34  ? 111 LEU A CA     1 
ATOM   1744 C  C      . LEU A 1 111 ? -15.448 42.078  34.789  1.00 29.17  ? 111 LEU A C      1 
ATOM   1745 O  O      . LEU A 1 111 ? -14.372 41.478  34.861  1.00 22.26  ? 111 LEU A O      1 
ATOM   1746 C  CB     . LEU A 1 111 ? -16.009 44.032  33.358  1.00 17.19  ? 111 LEU A CB     1 
ATOM   1747 C  CG     . LEU A 1 111 ? -16.077 45.518  33.015  1.00 28.21  ? 111 LEU A CG     1 
ATOM   1748 C  CD1    . LEU A 1 111 ? -16.520 45.679  31.578  1.00 14.85  ? 111 LEU A CD1    1 
ATOM   1749 C  CD2    . LEU A 1 111 ? -17.051 46.239  33.940  1.00 39.28  ? 111 LEU A CD2    1 
ATOM   1750 H  H      . LEU A 1 111 ? -13.645 44.085  34.426  1.00 14.89  ? 111 LEU A H      1 
ATOM   1751 H  HA     . LEU A 1 111 ? -16.157 43.898  35.416  1.00 22.22  ? 111 LEU A HA     1 
ATOM   1752 H  HB2    . LEU A 1 111 ? -15.415 43.630  32.706  1.00 20.84  ? 111 LEU A HB2    1 
ATOM   1753 H  HB3    . LEU A 1 111 ? -16.908 43.687  33.246  1.00 20.84  ? 111 LEU A HB3    1 
ATOM   1754 H  HG     . LEU A 1 111 ? -15.200 45.916  33.130  1.00 34.07  ? 111 LEU A HG     1 
ATOM   1755 H  HD11   . LEU A 1 111 ? -16.576 46.625  31.370  1.00 18.04  ? 111 LEU A HD11   1 
ATOM   1756 H  HD12   . LEU A 1 111 ? -15.872 45.250  30.998  1.00 18.04  ? 111 LEU A HD12   1 
ATOM   1757 H  HD13   . LEU A 1 111 ? -17.390 45.264  31.468  1.00 18.04  ? 111 LEU A HD13   1 
ATOM   1758 H  HD21   . LEU A 1 111 ? -17.093 47.174  33.687  1.00 47.35  ? 111 LEU A HD21   1 
ATOM   1759 H  HD22   . LEU A 1 111 ? -17.927 45.833  33.854  1.00 47.35  ? 111 LEU A HD22   1 
ATOM   1760 H  HD23   . LEU A 1 111 ? -16.737 46.157  34.854  1.00 47.35  ? 111 LEU A HD23   1 
ATOM   1761 N  N      . CYS A 1 112 ? -16.628 41.463  34.773  1.00 21.10  ? 112 CYS A N      1 
ATOM   1762 C  CA     . CYS A 1 112 ? -16.731 40.018  34.635  1.00 15.58  ? 112 CYS A CA     1 
ATOM   1763 C  C      . CYS A 1 112 ? -15.992 39.342  35.785  1.00 14.76  ? 112 CYS A C      1 
ATOM   1764 O  O      . CYS A 1 112 ? -16.472 39.354  36.921  1.00 35.07  ? 112 CYS A O      1 
ATOM   1765 C  CB     . CYS A 1 112 ? -16.182 39.599  33.273  1.00 19.41  ? 112 CYS A CB     1 
ATOM   1766 S  SG     . CYS A 1 112 ? -17.310 39.999  31.930  1.00 34.57  ? 112 CYS A SG     1 
ATOM   1767 H  H      . CYS A 1 112 ? -17.386 41.863  34.840  1.00 25.54  ? 112 CYS A H      1 
ATOM   1768 H  HA     . CYS A 1 112 ? -17.655 39.726  34.674  1.00 18.91  ? 112 CYS A HA     1 
ATOM   1769 H  HB2    . CYS A 1 112 ? -15.345 40.061  33.112  1.00 23.50  ? 112 CYS A HB2    1 
ATOM   1770 H  HB3    . CYS A 1 112 ? -16.037 38.640  33.271  1.00 23.50  ? 112 CYS A HB3    1 
ATOM   1771 H  HG     . CYS A 1 112 ? -16.804 39.685  30.889  1.00 41.70  ? 112 CYS A HG     1 
ATOM   1772 N  N      A ARG A 1 113 ? -14.821 38.765  35.503  0.21 18.72  ? 113 ARG A N      1 
ATOM   1773 N  N      B ARG A 1 113 ? -14.828 38.756  35.500  0.79 18.56  ? 113 ARG A N      1 
ATOM   1774 C  CA     A ARG A 1 113 ? -14.042 38.113  36.551  0.21 19.37  ? 113 ARG A CA     1 
ATOM   1775 C  CA     B ARG A 1 113 ? -14.038 38.114  36.546  0.79 19.49  ? 113 ARG A CA     1 
ATOM   1776 C  C      A ARG A 1 113 ? -13.798 39.055  37.722  0.21 20.80  ? 113 ARG A C      1 
ATOM   1777 C  C      B ARG A 1 113 ? -13.809 39.056  37.720  0.79 21.41  ? 113 ARG A C      1 
ATOM   1778 O  O      A ARG A 1 113 ? -13.835 38.637  38.886  0.21 24.19  ? 113 ARG A O      1 
ATOM   1779 O  O      B ARG A 1 113 ? -13.869 38.642  38.882  0.79 23.57  ? 113 ARG A O      1 
ATOM   1780 C  CB     A ARG A 1 113 ? -12.718 37.617  35.968  0.21 23.35  ? 113 ARG A CB     1 
ATOM   1781 C  CB     B ARG A 1 113 ? -12.709 37.642  35.954  0.79 23.40  ? 113 ARG A CB     1 
ATOM   1782 C  CG     A ARG A 1 113 ? -11.693 37.150  36.993  0.21 21.60  ? 113 ARG A CG     1 
ATOM   1783 C  CG     B ARG A 1 113 ? -11.637 37.243  36.958  0.79 19.75  ? 113 ARG A CG     1 
ATOM   1784 C  CD     A ARG A 1 113 ? -12.208 35.989  37.818  0.21 22.13  ? 113 ARG A CD     1 
ATOM   1785 C  CD     B ARG A 1 113 ? -12.035 36.025  37.743  0.79 21.64  ? 113 ARG A CD     1 
ATOM   1786 N  NE     A ARG A 1 113 ? -11.194 35.487  38.742  0.21 25.94  ? 113 ARG A NE     1 
ATOM   1787 N  NE     B ARG A 1 113 ? -10.877 35.200  38.068  0.79 27.79  ? 113 ARG A NE     1 
ATOM   1788 C  CZ     A ARG A 1 113 ? -10.234 34.626  38.413  0.21 27.57  ? 113 ARG A CZ     1 
ATOM   1789 C  CZ     B ARG A 1 113 ? -10.113 35.359  39.145  0.79 31.74  ? 113 ARG A CZ     1 
ATOM   1790 N  NH1    A ARG A 1 113 ? -10.142 34.161  37.173  0.21 23.67  ? 113 ARG A NH1    1 
ATOM   1791 N  NH1    B ARG A 1 113 ? -10.374 36.321  40.024  0.79 25.12  ? 113 ARG A NH1    1 
ATOM   1792 N  NH2    A ARG A 1 113 ? -9.360  34.229  39.327  0.21 29.50  ? 113 ARG A NH2    1 
ATOM   1793 N  NH2    B ARG A 1 113 ? -9.082  34.548  39.343  0.79 30.54  ? 113 ARG A NH2    1 
ATOM   1794 H  H      A ARG A 1 113 ? -14.460 38.738  34.724  0.21 22.67  ? 113 ARG A H      1 
ATOM   1795 H  H      B ARG A 1 113 ? -14.475 38.716  34.717  0.79 22.49  ? 113 ARG A H      1 
ATOM   1796 H  HA     A ARG A 1 113 ? -14.532 37.346  36.886  0.21 23.46  ? 113 ARG A HA     1 
ATOM   1797 H  HA     B ARG A 1 113 ? -14.513 37.338  36.884  0.79 23.61  ? 113 ARG A HA     1 
ATOM   1798 H  HB2    A ARG A 1 113 ? -12.904 36.867  35.381  0.21 28.23  ? 113 ARG A HB2    1 
ATOM   1799 H  HB2    B ARG A 1 113 ? -12.884 36.868  35.397  0.79 28.30  ? 113 ARG A HB2    1 
ATOM   1800 H  HB3    A ARG A 1 113 ? -12.315 38.341  35.464  0.21 28.23  ? 113 ARG A HB3    1 
ATOM   1801 H  HB3    B ARG A 1 113 ? -12.345 38.363  35.416  0.79 28.30  ? 113 ARG A HB3    1 
ATOM   1802 H  HG2    A ARG A 1 113 ? -10.889 36.861  36.532  0.21 26.13  ? 113 ARG A HG2    1 
ATOM   1803 H  HG2    B ARG A 1 113 ? -10.814 37.044  36.485  0.79 23.92  ? 113 ARG A HG2    1 
ATOM   1804 H  HG3    A ARG A 1 113 ? -11.485 37.882  37.594  0.21 26.13  ? 113 ARG A HG3    1 
ATOM   1805 H  HG3    B ARG A 1 113 ? -11.493 37.973  37.581  0.79 23.92  ? 113 ARG A HG3    1 
ATOM   1806 H  HD2    A ARG A 1 113 ? -12.974 36.281  38.338  0.21 26.77  ? 113 ARG A HD2    1 
ATOM   1807 H  HD2    B ARG A 1 113 ? -12.457 36.301  38.572  0.79 26.18  ? 113 ARG A HD2    1 
ATOM   1808 H  HD3    A ARG A 1 113 ? -12.465 35.265  37.227  0.21 26.77  ? 113 ARG A HD3    1 
ATOM   1809 H  HD3    B ARG A 1 113 ? -12.653 35.492  37.218  0.79 26.18  ? 113 ARG A HD3    1 
ATOM   1810 H  HE     A ARG A 1 113 ? -11.218 35.767  39.555  0.21 31.35  ? 113 ARG A HE     1 
ATOM   1811 H  HE     B ARG A 1 113 ? -10.673 34.565  37.525  0.79 33.56  ? 113 ARG A HE     1 
ATOM   1812 H  HH11   A ARG A 1 113 ? -10.705 34.416  36.575  0.21 28.62  ? 113 ARG A HH11   1 
ATOM   1813 H  HH11   B ARG A 1 113 ? -11.043 36.847  39.898  0.79 30.37  ? 113 ARG A HH11   1 
ATOM   1814 H  HH12   A ARG A 1 113 ? -9.519  33.604  36.968  0.21 28.62  ? 113 ARG A HH12   1 
ATOM   1815 H  HH12   B ARG A 1 113 ? -9.875  36.417  40.718  0.79 30.37  ? 113 ARG A HH12   1 
ATOM   1816 H  HH21   A ARG A 1 113 ? -9.414  34.528  40.131  0.21 35.62  ? 113 ARG A HH21   1 
ATOM   1817 H  HH21   B ARG A 1 113 ? -8.911  33.924  38.776  0.79 36.86  ? 113 ARG A HH21   1 
ATOM   1818 H  HH22   A ARG A 1 113 ? -8.740  33.672  39.116  0.21 35.62  ? 113 ARG A HH22   1 
ATOM   1819 H  HH22   B ARG A 1 113 ? -8.584  34.646  40.037  0.79 36.86  ? 113 ARG A HH22   1 
ATOM   1820 N  N      . GLY A 1 114 ? -13.547 40.330  37.435  1.00 19.98  ? 114 GLY A N      1 
ATOM   1821 C  CA     . GLY A 1 114 ? -13.346 41.321  38.470  1.00 17.91  ? 114 GLY A CA     1 
ATOM   1822 C  C      . GLY A 1 114 ? -14.600 41.738  39.205  1.00 22.04  ? 114 GLY A C      1 
ATOM   1823 O  O      . GLY A 1 114 ? -14.525 42.610  40.074  1.00 28.20  ? 114 GLY A O      1 
ATOM   1824 H  H      A GLY A 1 114 ? -13.489 40.644  36.636  0.21 24.19  ? 114 GLY A H      1 
ATOM   1825 H  H      B GLY A 1 114 ? -13.481 40.643  36.636  0.79 24.19  ? 114 GLY A H      1 
ATOM   1826 H  HA2    . GLY A 1 114 ? -12.725 40.965  39.124  1.00 21.71  ? 114 GLY A HA2    1 
ATOM   1827 H  HA3    . GLY A 1 114 ? -12.961 42.116  38.068  1.00 21.71  ? 114 GLY A HA3    1 
ATOM   1828 N  N      . GLY A 1 115 ? -15.745 41.157  38.864  1.00 19.17  ? 115 GLY A N      1 
ATOM   1829 C  CA     . GLY A 1 115 ? -17.002 41.531  39.501  1.00 22.88  ? 115 GLY A CA     1 
ATOM   1830 C  C      . GLY A 1 115 ? -17.316 43.006  39.447  1.00 16.00  ? 115 GLY A C      1 
ATOM   1831 O  O      . GLY A 1 115 ? -17.858 43.561  40.410  1.00 41.41  ? 115 GLY A O      1 
ATOM   1832 H  H      . GLY A 1 115 ? -15.826 40.544  38.267  1.00 23.22  ? 115 GLY A H      1 
ATOM   1833 H  HA2    . GLY A 1 115 ? -17.727 41.057  39.064  1.00 27.67  ? 115 GLY A HA2    1 
ATOM   1834 H  HA3    . GLY A 1 115 ? -16.970 41.268  40.434  1.00 27.67  ? 115 GLY A HA3    1 
ATOM   1835 N  N      . GLY A 1 116 ? -16.991 43.662  38.340  1.00 24.94  ? 116 GLY A N      1 
ATOM   1836 C  CA     . GLY A 1 116 ? -17.303 45.068  38.176  1.00 29.66  ? 116 GLY A CA     1 
ATOM   1837 C  C      . GLY A 1 116 ? -16.773 45.922  39.308  1.00 17.11  ? 116 GLY A C      1 
ATOM   1838 O  O      . GLY A 1 116 ? -17.305 47.000  39.586  1.00 24.20  ? 116 GLY A O      1 
ATOM   1839 H  H      . GLY A 1 116 ? -16.588 43.311  37.667  1.00 30.14  ? 116 GLY A H      1 
ATOM   1840 H  HA2    . GLY A 1 116 ? -16.914 45.387  37.347  1.00 35.81  ? 116 GLY A HA2    1 
ATOM   1841 H  HA3    . GLY A 1 116 ? -18.266 45.179  38.136  1.00 35.81  ? 116 GLY A HA3    1 
ATOM   1842 N  N      . ARG A 1 117 ? -15.704 45.461  39.947  1.00 23.38  ? 117 ARG A N      1 
ATOM   1843 C  CA     . ARG A 1 117 ? -15.119 46.130  41.098  1.00 29.71  ? 117 ARG A CA     1 
ATOM   1844 C  C      . ARG A 1 117 ? -13.955 47.014  40.666  1.00 27.65  ? 117 ARG A C      1 
ATOM   1845 O  O      . ARG A 1 117 ? -13.258 46.720  39.693  1.00 33.59  ? 117 ARG A O      1 
ATOM   1846 C  CB     . ARG A 1 117 ? -14.624 45.109  42.128  1.00 28.11  ? 117 ARG A CB     1 
ATOM   1847 C  CG     . ARG A 1 117 ? -15.714 44.339  42.865  1.00 27.39  ? 117 ARG A CG     1 
ATOM   1848 C  CD     . ARG A 1 117 ? -15.085 43.326  43.808  1.00 28.30  ? 117 ARG A CD     1 
ATOM   1849 N  NE     . ARG A 1 117 ? -15.913 42.994  44.968  1.00 24.28  ? 117 ARG A NE     1 
ATOM   1850 C  CZ     . ARG A 1 117 ? -16.737 41.952  45.043  1.00 30.09  ? 117 ARG A CZ     1 
ATOM   1851 N  NH1    . ARG A 1 117 ? -16.878 41.120  44.015  1.00 41.26  ? 117 ARG A NH1    1 
ATOM   1852 N  NH2    . ARG A 1 117 ? -17.426 41.744  46.157  1.00 20.22  ? 117 ARG A NH2    1 
ATOM   1853 H  H      . ARG A 1 117 ? -15.290 44.741  39.723  1.00 28.27  ? 117 ARG A H      1 
ATOM   1854 H  HA     . ARG A 1 117 ? -15.793 46.689  41.516  1.00 35.87  ? 117 ARG A HA     1 
ATOM   1855 H  HB2    . ARG A 1 117 ? -14.070 44.458  41.670  1.00 33.95  ? 117 ARG A HB2    1 
ATOM   1856 H  HB3    . ARG A 1 117 ? -14.101 45.579  42.796  1.00 33.95  ? 117 ARG A HB3    1 
ATOM   1857 H  HG2    . ARG A 1 117 ? -16.256 44.954  43.384  1.00 33.09  ? 117 ARG A HG2    1 
ATOM   1858 H  HG3    . ARG A 1 117 ? -16.270 43.867  42.225  1.00 33.09  ? 117 ARG A HG3    1 
ATOM   1859 H  HD2    . ARG A 1 117 ? -14.923 42.504  43.318  1.00 34.18  ? 117 ARG A HD2    1 
ATOM   1860 H  HD3    . ARG A 1 117 ? -14.248 43.687  44.138  1.00 34.18  ? 117 ARG A HD3    1 
ATOM   1861 H  HE     . ARG A 1 117 ? -15.864 43.512  45.653  1.00 29.35  ? 117 ARG A HE     1 
ATOM   1862 H  HH11   . ARG A 1 117 ? -16.434 41.253  43.291  1.00 49.73  ? 117 ARG A HH11   1 
ATOM   1863 H  HH12   . ARG A 1 117 ? -17.413 40.450  44.075  1.00 49.73  ? 117 ARG A HH12   1 
ATOM   1864 H  HH21   . ARG A 1 117 ? -17.339 42.282  46.823  1.00 24.48  ? 117 ARG A HH21   1 
ATOM   1865 H  HH22   . ARG A 1 117 ? -17.961 41.073  46.213  1.00 24.48  ? 117 ARG A HH22   1 
ATOM   1866 N  N      . ILE A 1 118 ? -13.766 48.116  41.387  1.00 42.36  ? 118 ILE A N      1 
ATOM   1867 C  CA     . ILE A 1 118 ? -12.632 49.005  41.145  1.00 26.15  ? 118 ILE A CA     1 
ATOM   1868 C  C      . ILE A 1 118 ? -11.391 48.388  41.776  1.00 29.33  ? 118 ILE A C      1 
ATOM   1869 O  O      . ILE A 1 118 ? -11.356 48.129  42.983  1.00 32.99  ? 118 ILE A O      1 
ATOM   1870 C  CB     . ILE A 1 118 ? -12.890 50.416  41.695  1.00 33.31  ? 118 ILE A CB     1 
ATOM   1871 C  CG1    . ILE A 1 118 ? -13.747 51.224  40.718  1.00 20.08  ? 118 ILE A CG1    1 
ATOM   1872 C  CG2    . ILE A 1 118 ? -11.572 51.136  41.985  1.00 37.87  ? 118 ILE A CG2    1 
ATOM   1873 C  CD1    . ILE A 1 118 ? -15.171 50.780  40.628  1.00 23.24  ? 118 ILE A CD1    1 
ATOM   1874 H  H      . ILE A 1 118 ? -14.282 48.373  42.024  1.00 51.04  ? 118 ILE A H      1 
ATOM   1875 H  HA     . ILE A 1 118 ? -12.489 49.080  40.189  1.00 31.59  ? 118 ILE A HA     1 
ATOM   1876 H  HB     . ILE A 1 118 ? -13.378 50.330  42.529  1.00 40.19  ? 118 ILE A HB     1 
ATOM   1877 H  HG12   . ILE A 1 118 ? -13.746 52.152  41.001  1.00 24.32  ? 118 ILE A HG12   1 
ATOM   1878 H  HG13   . ILE A 1 118 ? -13.360 51.148  39.831  1.00 24.32  ? 118 ILE A HG13   1 
ATOM   1879 H  HG21   . ILE A 1 118 ? -11.744 52.086  42.078  1.00 45.66  ? 118 ILE A HG21   1 
ATOM   1880 H  HG22   . ILE A 1 118 ? -11.195 50.787  42.808  1.00 45.66  ? 118 ILE A HG22   1 
ATOM   1881 H  HG23   . ILE A 1 118 ? -10.959 50.982  41.250  1.00 45.66  ? 118 ILE A HG23   1 
ATOM   1882 H  HD11   . ILE A 1 118 ? -15.203 49.903  40.215  1.00 28.11  ? 118 ILE A HD11   1 
ATOM   1883 H  HD12   . ILE A 1 118 ? -15.546 50.739  41.522  1.00 28.11  ? 118 ILE A HD12   1 
ATOM   1884 H  HD13   . ILE A 1 118 ? -15.667 51.417  40.090  1.00 28.11  ? 118 ILE A HD13   1 
ATOM   1885 N  N      . GLN A 1 119 ? -10.381 48.131  40.955  1.00 33.58  ? 119 GLN A N      1 
ATOM   1886 C  CA     . GLN A 1 119 ? -9.107  47.611  41.431  1.00 33.50  ? 119 GLN A CA     1 
ATOM   1887 C  C      . GLN A 1 119 ? -8.094  47.754  40.307  1.00 35.08  ? 119 GLN A C      1 
ATOM   1888 O  O      . GLN A 1 119 ? -8.459  47.977  39.149  1.00 34.29  ? 119 GLN A O      1 
ATOM   1889 C  CB     . GLN A 1 119 ? -9.251  46.161  41.906  1.00 35.20  ? 119 GLN A CB     1 
ATOM   1890 C  CG     . GLN A 1 119 ? -9.826  45.219  40.855  1.00 55.03  ? 119 GLN A CG     1 
ATOM   1891 C  CD     . GLN A 1 119 ? -10.028 43.807  41.377  1.00 62.93  ? 119 GLN A CD     1 
ATOM   1892 O  OE1    . GLN A 1 119 ? -9.840  43.539  42.564  1.00 94.48  ? 119 GLN A OE1    1 
ATOM   1893 N  NE2    . GLN A 1 119 ? -10.445 42.903  40.496  1.00 42.67  ? 119 GLN A NE2    1 
ATOM   1894 H  H      . GLN A 1 119 ? -10.409 48.252  40.104  1.00 40.51  ? 119 GLN A H      1 
ATOM   1895 H  HA     . GLN A 1 119 ? -8.778  48.131  42.181  1.00 40.41  ? 119 GLN A HA     1 
ATOM   1896 H  HB2    . GLN A 1 119 ? -8.374  45.827  42.154  1.00 42.46  ? 119 GLN A HB2    1 
ATOM   1897 H  HB3    . GLN A 1 119 ? -9.842  46.143  42.674  1.00 42.46  ? 119 GLN A HB3    1 
ATOM   1898 H  HG2    . GLN A 1 119 ? -10.687 45.558  40.565  1.00 66.25  ? 119 GLN A HG2    1 
ATOM   1899 H  HG3    . GLN A 1 119 ? -9.216  45.176  40.102  1.00 66.25  ? 119 GLN A HG3    1 
ATOM   1900 H  HE21   . GLN A 1 119 ? -10.586 43.131  39.679  1.00 51.42  ? 119 GLN A HE21   1 
ATOM   1901 H  HE22   . GLN A 1 119 ? -10.575 42.089  40.743  1.00 51.42  ? 119 GLN A HE22   1 
ATOM   1902 N  N      . LYS A 1 120 ? -6.819  47.633  40.661  1.00 34.65  ? 120 LYS A N      1 
ATOM   1903 C  CA     . LYS A 1 120 ? -5.773  47.785  39.663  1.00 34.50  ? 120 LYS A CA     1 
ATOM   1904 C  C      . LYS A 1 120 ? -5.791  46.596  38.707  1.00 37.04  ? 120 LYS A C      1 
ATOM   1905 O  O      . LYS A 1 120 ? -5.877  45.446  39.150  1.00 46.58  ? 120 LYS A O      1 
ATOM   1906 C  CB     . LYS A 1 120 ? -4.402  47.898  40.328  1.00 52.36  ? 120 LYS A CB     1 
ATOM   1907 C  CG     . LYS A 1 120 ? -4.158  49.224  41.039  1.00 64.45  ? 120 LYS A CG     1 
ATOM   1908 C  CD     . LYS A 1 120 ? -2.760  49.300  41.650  1.00 74.49  ? 120 LYS A CD     1 
ATOM   1909 C  CE     . LYS A 1 120 ? -1.662  49.246  40.594  1.00 69.43  ? 120 LYS A CE     1 
ATOM   1910 N  NZ     . LYS A 1 120 ? -0.307  49.435  41.191  1.00 87.22  ? 120 LYS A NZ     1 
ATOM   1911 H  H      . LYS A 1 120 ? -6.538  47.467  41.456  1.00 41.80  ? 120 LYS A H      1 
ATOM   1912 H  HA     . LYS A 1 120 ? -5.926  48.597  39.154  1.00 41.62  ? 120 LYS A HA     1 
ATOM   1913 H  HB2    . LYS A 1 120 ? -4.318  47.191  40.987  1.00 63.05  ? 120 LYS A HB2    1 
ATOM   1914 H  HB3    . LYS A 1 120 ? -3.718  47.799  39.647  1.00 63.05  ? 120 LYS A HB3    1 
ATOM   1915 H  HG2    . LYS A 1 120 ? -4.249  49.950  40.401  1.00 77.56  ? 120 LYS A HG2    1 
ATOM   1916 H  HG3    . LYS A 1 120 ? -4.807  49.327  41.753  1.00 77.56  ? 120 LYS A HG3    1 
ATOM   1917 H  HD2    . LYS A 1 120 ? -2.670  50.134  42.136  1.00 89.60  ? 120 LYS A HD2    1 
ATOM   1918 H  HD3    . LYS A 1 120 ? -2.635  48.550  42.253  1.00 89.60  ? 120 LYS A HD3    1 
ATOM   1919 H  HE2    . LYS A 1 120 ? -1.682  48.382  40.156  1.00 83.53  ? 120 LYS A HE2    1 
ATOM   1920 H  HE3    . LYS A 1 120 ? -1.808  49.952  39.945  1.00 83.53  ? 120 LYS A HE3    1 
ATOM   1921 H  HZ1    . LYS A 1 120 ? 0.314   49.400  40.555  1.00 104.88 ? 120 LYS A HZ1    1 
ATOM   1922 H  HZ2    . LYS A 1 120 ? -0.261  50.227  41.596  1.00 104.88 ? 120 LYS A HZ2    1 
ATOM   1923 H  HZ3    . LYS A 1 120 ? -0.146  48.796  41.788  1.00 104.88 ? 120 LYS A HZ3    1 
ATOM   1924 N  N      . PRO A 1 121 ? -5.682  46.831  37.399  1.00 29.28  ? 121 PRO A N      1 
ATOM   1925 C  CA     . PRO A 1 121 ? -5.713  45.708  36.458  1.00 28.82  ? 121 PRO A CA     1 
ATOM   1926 C  C      . PRO A 1 121 ? -4.496  44.810  36.609  1.00 24.86  ? 121 PRO A C      1 
ATOM   1927 O  O      . PRO A 1 121 ? -3.384  45.270  36.877  1.00 26.94  ? 121 PRO A O      1 
ATOM   1928 C  CB     . PRO A 1 121 ? -5.754  46.392  35.086  1.00 32.75  ? 121 PRO A CB     1 
ATOM   1929 C  CG     . PRO A 1 121 ? -5.191  47.740  35.307  1.00 28.68  ? 121 PRO A CG     1 
ATOM   1930 C  CD     . PRO A 1 121 ? -5.566  48.127  36.705  1.00 26.50  ? 121 PRO A CD     1 
ATOM   1931 H  HA     . PRO A 1 121 ? -6.516  45.178  36.581  1.00 34.80  ? 121 PRO A HA     1 
ATOM   1932 H  HB2    . PRO A 1 121 ? -5.216  45.892  34.452  1.00 39.51  ? 121 PRO A HB2    1 
ATOM   1933 H  HB3    . PRO A 1 121 ? -6.670  46.446  34.772  1.00 39.51  ? 121 PRO A HB3    1 
ATOM   1934 H  HG2    . PRO A 1 121 ? -4.227  47.710  35.207  1.00 34.63  ? 121 PRO A HG2    1 
ATOM   1935 H  HG3    . PRO A 1 121 ? -5.572  48.361  34.666  1.00 34.63  ? 121 PRO A HG3    1 
ATOM   1936 H  HD2    . PRO A 1 121 ? -4.874  48.673  37.109  1.00 32.01  ? 121 PRO A HD2    1 
ATOM   1937 H  HD3    . PRO A 1 121 ? -6.412  48.601  36.716  1.00 32.01  ? 121 PRO A HD3    1 
ATOM   1938 N  N      . SER A 1 122 ? -4.732  43.510  36.464  1.00 18.35  ? 122 SER A N      1 
ATOM   1939 C  CA     . SER A 1 122 ? -3.674  42.523  36.576  1.00 17.17  ? 122 SER A CA     1 
ATOM   1940 C  C      . SER A 1 122 ? -2.658  42.699  35.451  1.00 17.55  ? 122 SER A C      1 
ATOM   1941 O  O      . SER A 1 122 ? -2.896  43.395  34.461  1.00 28.86  ? 122 SER A O      1 
ATOM   1942 C  CB     . SER A 1 122 ? -4.264  41.118  36.542  1.00 10.78  ? 122 SER A CB     1 
ATOM   1943 O  OG     . SER A 1 122 ? -4.938  40.909  35.318  1.00 21.28  ? 122 SER A OG     1 
ATOM   1944 H  H      . SER A 1 122 ? -5.505  43.172  36.299  1.00 22.24  ? 122 SER A H      1 
ATOM   1945 H  HA     . SER A 1 122 ? -3.211  42.641  37.420  1.00 20.82  ? 122 SER A HA     1 
ATOM   1946 H  HB2    . SER A 1 122 ? -3.548  40.469  36.627  1.00 13.15  ? 122 SER A HB2    1 
ATOM   1947 H  HB3    . SER A 1 122 ? -4.892  41.017  37.274  1.00 13.15  ? 122 SER A HB3    1 
ATOM   1948 H  HG     . SER A 1 122 ? -5.516  41.507  35.203  1.00 25.75  ? 122 SER A HG     1 
ATOM   1949 N  N      . LEU A 1 123 ? -1.506  42.046  35.609  1.00 26.70  ? 123 LEU A N      1 
ATOM   1950 C  CA     . LEU A 1 123 ? -0.485  42.111  34.571  1.00 25.07  ? 123 LEU A CA     1 
ATOM   1951 C  C      . LEU A 1 123 ? -0.976  41.496  33.267  1.00 25.53  ? 123 LEU A C      1 
ATOM   1952 O  O      . LEU A 1 123 ? -0.607  41.964  32.186  1.00 41.34  ? 123 LEU A O      1 
ATOM   1953 C  CB     . LEU A 1 123 ? 0.784   41.395  35.032  1.00 32.95  ? 123 LEU A CB     1 
ATOM   1954 C  CG     . LEU A 1 123 ? 1.963   41.436  34.058  1.00 26.06  ? 123 LEU A CG     1 
ATOM   1955 C  CD1    . LEU A 1 123 ? 2.421   42.871  33.861  1.00 31.94  ? 123 LEU A CD1    1 
ATOM   1956 C  CD2    . LEU A 1 123 ? 3.110   40.563  34.538  1.00 49.33  ? 123 LEU A CD2    1 
ATOM   1957 H  H      . LEU A 1 123 ? -1.295  41.569  36.293  1.00 32.25  ? 123 LEU A H      1 
ATOM   1958 H  HA     . LEU A 1 123 ? -0.268  43.042  34.411  1.00 30.30  ? 123 LEU A HA     1 
ATOM   1959 H  HB2    . LEU A 1 123 ? 1.080   41.806  35.860  1.00 39.75  ? 123 LEU A HB2    1 
ATOM   1960 H  HB3    . LEU A 1 123 ? 0.568   40.462  35.184  1.00 39.75  ? 123 LEU A HB3    1 
ATOM   1961 H  HG     . LEU A 1 123 ? 1.677   41.083  33.201  1.00 31.49  ? 123 LEU A HG     1 
ATOM   1962 H  HD11   . LEU A 1 123 ? 3.241   42.872  33.343  1.00 38.54  ? 123 LEU A HD11   1 
ATOM   1963 H  HD12   . LEU A 1 123 ? 1.730   43.361  33.389  1.00 38.54  ? 123 LEU A HD12   1 
ATOM   1964 H  HD13   . LEU A 1 123 ? 2.579   43.274  34.730  1.00 38.54  ? 123 LEU A HD13   1 
ATOM   1965 H  HD21   . LEU A 1 123 ? 3.840   40.622  33.902  1.00 59.41  ? 123 LEU A HD21   1 
ATOM   1966 H  HD22   . LEU A 1 123 ? 3.403   40.876  35.408  1.00 59.41  ? 123 LEU A HD22   1 
ATOM   1967 H  HD23   . LEU A 1 123 ? 2.801   39.645  34.604  1.00 59.41  ? 123 LEU A HD23   1 
ATOM   1968 N  N      . ALA A 1 124 ? -1.806  40.451  33.343  1.00 21.75  ? 124 ALA A N      1 
ATOM   1969 C  CA     . ALA A 1 124 ? -2.337  39.845  32.126  1.00 25.66  ? 124 ALA A CA     1 
ATOM   1970 C  C      . ALA A 1 124 ? -3.201  40.836  31.364  1.00 23.64  ? 124 ALA A C      1 
ATOM   1971 O  O      . ALA A 1 124 ? -3.139  40.914  30.130  1.00 36.67  ? 124 ALA A O      1 
ATOM   1972 C  CB     . ALA A 1 124 ? -3.135  38.587  32.464  1.00 29.78  ? 124 ALA A CB     1 
ATOM   1973 H  H      . ALA A 1 124 ? -2.072  40.082  34.072  1.00 26.31  ? 124 ALA A H      1 
ATOM   1974 H  HA     . ALA A 1 124 ? -1.597  39.580  31.558  1.00 31.01  ? 124 ALA A HA     1 
ATOM   1975 H  HB1    . ALA A 1 124 ? -3.480  38.202  31.643  1.00 35.96  ? 124 ALA A HB1    1 
ATOM   1976 H  HB2    . ALA A 1 124 ? -2.551  37.952  32.907  1.00 35.96  ? 124 ALA A HB2    1 
ATOM   1977 H  HB3    . ALA A 1 124 ? -3.869  38.827  33.050  1.00 35.96  ? 124 ALA A HB3    1 
ATOM   1978 N  N      . THR A 1 125 ? -4.028  41.594  32.084  1.00 16.76  ? 125 THR A N      1 
ATOM   1979 C  CA     . THR A 1 125 ? -4.848  42.605  31.432  1.00 23.17  ? 125 THR A CA     1 
ATOM   1980 C  C      . THR A 1 125 ? -3.984  43.682  30.790  1.00 20.66  ? 125 THR A C      1 
ATOM   1981 O  O      . THR A 1 125 ? -4.290  44.154  29.691  1.00 36.31  ? 125 THR A O      1 
ATOM   1982 C  CB     . THR A 1 125 ? -5.813  43.219  32.445  1.00 21.42  ? 125 THR A CB     1 
ATOM   1983 O  OG1    . THR A 1 125 ? -6.777  42.234  32.835  1.00 23.85  ? 125 THR A OG1    1 
ATOM   1984 C  CG2    . THR A 1 125 ? -6.515  44.440  31.866  1.00 17.28  ? 125 THR A CG2    1 
ATOM   1985 H  H      . THR A 1 125 ? -4.131  41.544  32.936  1.00 20.33  ? 125 THR A H      1 
ATOM   1986 H  HA     . THR A 1 125 ? -5.372  42.187  30.732  1.00 28.02  ? 125 THR A HA     1 
ATOM   1987 H  HB     . THR A 1 125 ? -5.320  43.515  33.227  1.00 25.92  ? 125 THR A HB     1 
ATOM   1988 H  HG1    . THR A 1 125 ? -7.303  42.556  33.405  1.00 28.84  ? 125 THR A HG1    1 
ATOM   1989 H  HG21   . THR A 1 125 ? -7.312  44.640  32.382  1.00 20.95  ? 125 THR A HG21   1 
ATOM   1990 H  HG22   . THR A 1 125 ? -5.922  45.207  31.893  1.00 20.95  ? 125 THR A HG22   1 
ATOM   1991 H  HG23   . THR A 1 125 ? -6.770  44.271  30.946  1.00 20.95  ? 125 THR A HG23   1 
ATOM   1992 N  N      . CYS A 1 126 ? -2.889  44.067  31.445  1.00 18.58  ? 126 CYS A N      1 
ATOM   1993 C  CA     . CYS A 1 126 ? -2.004  45.070  30.862  1.00 26.06  ? 126 CYS A CA     1 
ATOM   1994 C  C      . CYS A 1 126 ? -1.317  44.539  29.611  1.00 19.45  ? 126 CYS A C      1 
ATOM   1995 O  O      . CYS A 1 126 ? -1.170  45.264  28.619  1.00 14.93  ? 126 CYS A O      1 
ATOM   1996 C  CB     . CYS A 1 126 ? -0.986  45.531  31.901  1.00 25.15  ? 126 CYS A CB     1 
ATOM   1997 S  SG     . CYS A 1 126 ? -1.737  46.506  33.231  1.00 37.16  ? 126 CYS A SG     1 
ATOM   1998 H  H      . CYS A 1 126 ? -2.639  43.770  32.213  1.00 22.51  ? 126 CYS A H      1 
ATOM   1999 H  HA     . CYS A 1 126 ? -2.528  45.844  30.601  1.00 31.49  ? 126 CYS A HA     1 
ATOM   2000 H  HB2    . CYS A 1 126 ? -0.566  44.752  32.299  1.00 30.39  ? 126 CYS A HB2    1 
ATOM   2001 H  HB3    . CYS A 1 126 ? -0.317  46.081  31.465  1.00 30.39  ? 126 CYS A HB3    1 
ATOM   2002 H  HG     . CYS A 1 126 ? -2.571  45.840  33.781  1.00 44.81  ? 126 CYS A HG     1 
ATOM   2003 N  N      . ARG A 1 127 ? -0.884  43.278  29.637  1.00 10.78  ? 127 ARG A N      1 
ATOM   2004 C  CA     . ARG A 1 127 ? -0.325  42.669  28.438  1.00 14.51  ? 127 ARG A CA     1 
ATOM   2005 C  C      . ARG A 1 127 ? -1.336  42.684  27.297  1.00 17.02  ? 127 ARG A C      1 
ATOM   2006 O  O      . ARG A 1 127 ? -1.010  43.064  26.163  1.00 33.32  ? 127 ARG A O      1 
ATOM   2007 C  CB     . ARG A 1 127 ? 0.113   41.235  28.732  1.00 10.57  ? 127 ARG A CB     1 
ATOM   2008 C  CG     . ARG A 1 127 ? 1.297   41.105  29.669  1.00 14.94  ? 127 ARG A CG     1 
ATOM   2009 C  CD     . ARG A 1 127 ? 1.614   39.638  29.891  1.00 11.37  ? 127 ARG A CD     1 
ATOM   2010 N  NE     . ARG A 1 127 ? 1.943   38.968  28.636  1.00 9.33   ? 127 ARG A NE     1 
ATOM   2011 C  CZ     . ARG A 1 127 ? 2.054   37.651  28.488  1.00 12.87  ? 127 ARG A CZ     1 
ATOM   2012 N  NH1    . ARG A 1 127 ? 1.853   36.842  29.518  1.00 17.31  ? 127 ARG A NH1    1 
ATOM   2013 N  NH2    . ARG A 1 127 ? 2.356   37.140  27.301  1.00 15.72  ? 127 ARG A NH2    1 
ATOM   2014 H  H      . ARG A 1 127 ? -0.903  42.763  30.325  1.00 13.15  ? 127 ARG A H      1 
ATOM   2015 H  HA     . ARG A 1 127 ? 0.456   43.177  28.166  1.00 17.63  ? 127 ARG A HA     1 
ATOM   2016 H  HB2    . ARG A 1 127 ? -0.632  40.765  29.138  1.00 12.90  ? 127 ARG A HB2    1 
ATOM   2017 H  HB3    . ARG A 1 127 ? 0.357   40.811  27.895  1.00 12.90  ? 127 ARG A HB3    1 
ATOM   2018 H  HG2    . ARG A 1 127 ? 2.073   41.537  29.279  1.00 18.14  ? 127 ARG A HG2    1 
ATOM   2019 H  HG3    . ARG A 1 127 ? 1.085   41.512  30.524  1.00 18.14  ? 127 ARG A HG3    1 
ATOM   2020 H  HD2    . ARG A 1 127 ? 2.375   39.561  30.488  1.00 13.86  ? 127 ARG A HD2    1 
ATOM   2021 H  HD3    . ARG A 1 127 ? 0.842   39.198  30.280  1.00 13.86  ? 127 ARG A HD3    1 
ATOM   2022 H  HE     . ARG A 1 127 ? 2.075   39.460  27.943  1.00 11.41  ? 127 ARG A HE     1 
ATOM   2023 H  HH11   . ARG A 1 127 ? 1.651   37.168  30.287  1.00 20.99  ? 127 ARG A HH11   1 
ATOM   2024 H  HH12   . ARG A 1 127 ? 1.926   35.991  29.417  1.00 20.99  ? 127 ARG A HH12   1 
ATOM   2025 H  HH21   . ARG A 1 127 ? 2.481   37.661  26.628  1.00 19.08  ? 127 ARG A HH21   1 
ATOM   2026 H  HH22   . ARG A 1 127 ? 2.428   36.288  27.205  1.00 19.08  ? 127 ARG A HH22   1 
ATOM   2027 N  N      . ARG A 1 128 ? -2.576  42.273  27.582  1.00 18.27  ? 128 ARG A N      1 
ATOM   2028 C  CA     . ARG A 1 128 ? -3.593  42.250  26.537  1.00 17.59  ? 128 ARG A CA     1 
ATOM   2029 C  C      . ARG A 1 128 ? -3.847  43.648  25.993  1.00 13.72  ? 128 ARG A C      1 
ATOM   2030 O  O      . ARG A 1 128 ? -3.951  43.838  24.777  1.00 18.37  ? 128 ARG A O      1 
ATOM   2031 C  CB     . ARG A 1 128 ? -4.895  41.641  27.060  1.00 11.93  ? 128 ARG A CB     1 
ATOM   2032 C  CG     . ARG A 1 128 ? -4.784  40.159  27.403  1.00 16.94  ? 128 ARG A CG     1 
ATOM   2033 C  CD     . ARG A 1 128 ? -6.145  39.512  27.629  1.00 9.38   ? 128 ARG A CD     1 
ATOM   2034 N  NE     . ARG A 1 128 ? -6.027  38.106  28.021  1.00 13.02  ? 128 ARG A NE     1 
ATOM   2035 C  CZ     . ARG A 1 128 ? -5.997  37.665  29.278  1.00 13.34  ? 128 ARG A CZ     1 
ATOM   2036 N  NH1    . ARG A 1 128 ? -6.087  38.511  30.295  1.00 22.99  ? 128 ARG A NH1    1 
ATOM   2037 N  NH2    . ARG A 1 128 ? -5.884  36.366  29.521  1.00 14.94  ? 128 ARG A NH2    1 
ATOM   2038 H  H      . ARG A 1 128 ? -2.847  42.009  28.354  1.00 22.15  ? 128 ARG A H      1 
ATOM   2039 H  HA     . ARG A 1 128 ? -3.274  41.689  25.813  1.00 21.33  ? 128 ARG A HA     1 
ATOM   2040 H  HB2    . ARG A 1 128 ? -5.159  42.112  27.865  1.00 14.53  ? 128 ARG A HB2    1 
ATOM   2041 H  HB3    . ARG A 1 128 ? -5.580  41.737  26.380  1.00 14.53  ? 128 ARG A HB3    1 
ATOM   2042 H  HG2    . ARG A 1 128 ? -4.348  39.695  26.671  1.00 20.55  ? 128 ARG A HG2    1 
ATOM   2043 H  HG3    . ARG A 1 128 ? -4.264  40.059  28.216  1.00 20.55  ? 128 ARG A HG3    1 
ATOM   2044 H  HD2    . ARG A 1 128 ? -6.610  39.986  28.336  1.00 11.47  ? 128 ARG A HD2    1 
ATOM   2045 H  HD3    . ARG A 1 128 ? -6.658  39.555  26.807  1.00 11.47  ? 128 ARG A HD3    1 
ATOM   2046 H  HE     . ARG A 1 128 ? -5.973  37.521  27.393  1.00 15.83  ? 128 ARG A HE     1 
ATOM   2047 H  HH11   . ARG A 1 128 ? -6.166  39.354  30.146  1.00 27.81  ? 128 ARG A HH11   1 
ATOM   2048 H  HH12   . ARG A 1 128 ? -6.067  38.216  31.102  1.00 27.81  ? 128 ARG A HH12   1 
ATOM   2049 H  HH21   . ARG A 1 128 ? -5.830  35.809  28.868  1.00 18.14  ? 128 ARG A HH21   1 
ATOM   2050 H  HH22   . ARG A 1 128 ? -5.864  36.080  30.332  1.00 18.14  ? 128 ARG A HH22   1 
ATOM   2051 N  N      . GLU A 1 129 ? -3.931  44.642  26.876  1.00 9.97   ? 129 GLU A N      1 
ATOM   2052 C  CA     . GLU A 1 129 ? -4.193  46.005  26.430  1.00 12.30  ? 129 GLU A CA     1 
ATOM   2053 C  C      . GLU A 1 129 ? -3.051  46.544  25.576  1.00 23.74  ? 129 GLU A C      1 
ATOM   2054 O  O      . GLU A 1 129 ? -3.293  47.244  24.588  1.00 24.69  ? 129 GLU A O      1 
ATOM   2055 C  CB     . GLU A 1 129 ? -4.457  46.909  27.632  1.00 20.72  ? 129 GLU A CB     1 
ATOM   2056 C  CG     . GLU A 1 129 ? -5.815  46.656  28.287  1.00 36.16  ? 129 GLU A CG     1 
ATOM   2057 C  CD     . GLU A 1 129 ? -6.142  47.646  29.390  1.00 60.44  ? 129 GLU A CD     1 
ATOM   2058 O  OE1    . GLU A 1 129 ? -5.242  48.410  29.803  1.00 63.82  ? 129 GLU A OE1    1 
ATOM   2059 O  OE2    . GLU A 1 129 ? -7.316  47.681  29.819  1.00 61.01  ? 129 GLU A OE2    1 
ATOM   2060 H  H      . GLU A 1 129 ? -3.842  44.557  27.727  1.00 12.18  ? 129 GLU A H      1 
ATOM   2061 H  HA     . GLU A 1 129 ? -4.991  46.005  25.879  1.00 14.98  ? 129 GLU A HA     1 
ATOM   2062 H  HB2    . GLU A 1 129 ? -3.770  46.753  28.300  1.00 25.08  ? 129 GLU A HB2    1 
ATOM   2063 H  HB3    . GLU A 1 129 ? -4.433  47.834  27.342  1.00 25.08  ? 129 GLU A HB3    1 
ATOM   2064 H  HG2    . GLU A 1 129 ? -6.507  46.724  27.610  1.00 43.61  ? 129 GLU A HG2    1 
ATOM   2065 H  HG3    . GLU A 1 129 ? -5.816  45.767  28.674  1.00 43.61  ? 129 GLU A HG3    1 
ATOM   2066 N  N      . VAL A 1 130 ? -1.801  46.246  25.942  1.00 25.62  ? 130 VAL A N      1 
ATOM   2067 C  CA     . VAL A 1 130 ? -0.670  46.699  25.133  1.00 11.19  ? 130 VAL A CA     1 
ATOM   2068 C  C      . VAL A 1 130 ? -0.727  46.062  23.750  1.00 15.63  ? 130 VAL A C      1 
ATOM   2069 O  O      . VAL A 1 130 ? -0.533  46.730  22.724  1.00 19.95  ? 130 VAL A O      1 
ATOM   2070 C  CB     . VAL A 1 130 ? 0.658   46.385  25.841  1.00 7.33   ? 130 VAL A CB     1 
ATOM   2071 C  CG1    . VAL A 1 130 ? 1.831   46.613  24.903  1.00 11.52  ? 130 VAL A CG1    1 
ATOM   2072 C  CG2    . VAL A 1 130 ? 0.802   47.236  27.077  1.00 17.05  ? 130 VAL A CG2    1 
ATOM   2073 H  H      . VAL A 1 130 ? -1.584  45.793  26.641  1.00 30.96  ? 130 VAL A H      1 
ATOM   2074 H  HA     . VAL A 1 130 ? -0.731  47.661  25.026  1.00 13.64  ? 130 VAL A HA     1 
ATOM   2075 H  HB     . VAL A 1 130 ? 0.660   45.452  26.107  1.00 9.01   ? 130 VAL A HB     1 
ATOM   2076 H  HG11   . VAL A 1 130 ? 2.646   46.678  25.426  1.00 14.05  ? 130 VAL A HG11   1 
ATOM   2077 H  HG12   . VAL A 1 130 ? 1.893   45.866  24.287  1.00 14.05  ? 130 VAL A HG12   1 
ATOM   2078 H  HG13   . VAL A 1 130 ? 1.687   47.436  24.411  1.00 14.05  ? 130 VAL A HG13   1 
ATOM   2079 H  HG21   . VAL A 1 130 ? 1.581   46.942  27.574  1.00 20.68  ? 130 VAL A HG21   1 
ATOM   2080 H  HG22   . VAL A 1 130 ? 0.909   48.163  26.811  1.00 20.68  ? 130 VAL A HG22   1 
ATOM   2081 H  HG23   . VAL A 1 130 ? 0.006   47.138  27.622  1.00 20.68  ? 130 VAL A HG23   1 
ATOM   2082 N  N      . ASP A 1 131 ? -0.986  44.750  23.704  1.00 11.36  ? 131 ASP A N      1 
ATOM   2083 C  CA     . ASP A 1 131 ? -1.134  44.083  22.415  1.00 12.65  ? 131 ASP A CA     1 
ATOM   2084 C  C      . ASP A 1 131 ? -2.235  44.743  21.591  1.00 18.44  ? 131 ASP A C      1 
ATOM   2085 O  O      . ASP A 1 131 ? -2.068  44.973  20.385  1.00 13.97  ? 131 ASP A O      1 
ATOM   2086 C  CB     . ASP A 1 131 ? -1.438  42.598  22.618  1.00 15.40  ? 131 ASP A CB     1 
ATOM   2087 C  CG     . ASP A 1 131 ? -0.283  41.846  23.259  1.00 26.85  ? 131 ASP A CG     1 
ATOM   2088 O  OD1    . ASP A 1 131 ? 0.655   42.495  23.773  1.00 31.66  ? 131 ASP A OD1    1 
ATOM   2089 O  OD2    . ASP A 1 131 ? -0.309  40.598  23.235  1.00 49.38  ? 131 ASP A OD2    1 
ATOM   2090 H  H      . ASP A 1 131 ? -1.078  44.238  24.388  1.00 13.84  ? 131 ASP A H      1 
ATOM   2091 H  HA     . ASP A 1 131 ? -0.299  44.151  21.927  1.00 15.40  ? 131 ASP A HA     1 
ATOM   2092 H  HB2    . ASP A 1 131 ? -2.211  42.509  23.197  1.00 18.70  ? 131 ASP A HB2    1 
ATOM   2093 H  HB3    . ASP A 1 131 ? -1.620  42.191  21.757  1.00 18.70  ? 131 ASP A HB3    1 
ATOM   2094 N  N      . GLU A 1 132 ? -3.371  45.045  22.226  1.00 22.79  ? 132 GLU A N      1 
ATOM   2095 C  CA     . GLU A 1 132 ? -4.494  45.649  21.521  1.00 17.09  ? 132 GLU A CA     1 
ATOM   2096 C  C      . GLU A 1 132 ? -4.132  47.022  20.980  1.00 18.78  ? 132 GLU A C      1 
ATOM   2097 O  O      . GLU A 1 132 ? -4.472  47.360  19.840  1.00 18.27  ? 132 GLU A O      1 
ATOM   2098 C  CB     . GLU A 1 132 ? -5.685  45.776  22.471  1.00 17.46  ? 132 GLU A CB     1 
ATOM   2099 C  CG     . GLU A 1 132 ? -6.892  46.505  21.900  1.00 34.95  ? 132 GLU A CG     1 
ATOM   2100 C  CD     . GLU A 1 132 ? -8.065  46.495  22.864  1.00 68.89  ? 132 GLU A CD     1 
ATOM   2101 O  OE1    . GLU A 1 132 ? -7.902  45.955  23.982  1.00 44.69  ? 132 GLU A OE1    1 
ATOM   2102 O  OE2    . GLU A 1 132 ? -9.134  47.045  22.519  1.00 79.51  ? 132 GLU A OE2    1 
ATOM   2103 H  H      . GLU A 1 132 ? -3.515  44.910  23.063  1.00 27.56  ? 132 GLU A H      1 
ATOM   2104 H  HA     . GLU A 1 132 ? -4.737  45.078  20.776  1.00 20.73  ? 132 GLU A HA     1 
ATOM   2105 H  HB2    . GLU A 1 132 ? -5.975  44.884  22.719  1.00 21.17  ? 132 GLU A HB2    1 
ATOM   2106 H  HB3    . GLU A 1 132 ? -5.398  46.263  23.259  1.00 21.17  ? 132 GLU A HB3    1 
ATOM   2107 H  HG2    . GLU A 1 132 ? -6.654  47.428  21.722  1.00 42.16  ? 132 GLU A HG2    1 
ATOM   2108 H  HG3    . GLU A 1 132 ? -7.170  46.069  21.079  1.00 42.16  ? 132 GLU A HG3    1 
ATOM   2109 N  N      . ILE A 1 133 ? -3.453  47.832  21.793  1.00 14.14  ? 133 ILE A N      1 
ATOM   2110 C  CA     . ILE A 1 133 ? -3.066  49.170  21.360  1.00 15.38  ? 133 ILE A CA     1 
ATOM   2111 C  C      . ILE A 1 133 ? -2.143  49.084  20.157  1.00 17.37  ? 133 ILE A C      1 
ATOM   2112 O  O      . ILE A 1 133 ? -2.313  49.810  19.170  1.00 31.19  ? 133 ILE A O      1 
ATOM   2113 C  CB     . ILE A 1 133 ? -2.406  49.946  22.514  1.00 17.83  ? 133 ILE A CB     1 
ATOM   2114 C  CG1    . ILE A 1 133 ? -3.451  50.308  23.571  1.00 13.55  ? 133 ILE A CG1    1 
ATOM   2115 C  CG2    . ILE A 1 133 ? -1.739  51.203  21.971  1.00 17.32  ? 133 ILE A CG2    1 
ATOM   2116 C  CD1    . ILE A 1 133 ? -2.870  50.900  24.839  1.00 13.01  ? 133 ILE A CD1    1 
ATOM   2117 H  H      . ILE A 1 133 ? -3.206  47.633  22.593  1.00 17.19  ? 133 ILE A H      1 
ATOM   2118 H  HA     . ILE A 1 133 ? -3.868  49.648  21.098  1.00 18.67  ? 133 ILE A HA     1 
ATOM   2119 H  HB     . ILE A 1 133 ? -1.732  49.385  22.929  1.00 21.62  ? 133 ILE A HB     1 
ATOM   2120 H  HG12   . ILE A 1 133 ? -4.061  50.962  23.194  1.00 16.47  ? 133 ILE A HG12   1 
ATOM   2121 H  HG13   . ILE A 1 133 ? -3.936  49.505  23.816  1.00 16.47  ? 133 ILE A HG13   1 
ATOM   2122 H  HG21   . ILE A 1 133 ? -1.576  51.817  22.705  1.00 21.00  ? 133 ILE A HG21   1 
ATOM   2123 H  HG22   . ILE A 1 133 ? -0.899  50.959  21.552  1.00 21.00  ? 133 ILE A HG22   1 
ATOM   2124 H  HG23   . ILE A 1 133 ? -2.327  51.616  21.319  1.00 21.00  ? 133 ILE A HG23   1 
ATOM   2125 H  HD11   . ILE A 1 133 ? -3.535  50.851  25.544  1.00 15.83  ? 133 ILE A HD11   1 
ATOM   2126 H  HD12   . ILE A 1 133 ? -2.082  50.393  25.092  1.00 15.83  ? 133 ILE A HD12   1 
ATOM   2127 H  HD13   . ILE A 1 133 ? -2.629  51.825  24.675  1.00 15.83  ? 133 ILE A HD13   1 
ATOM   2128 N  N      . LEU A 1 134 ? -1.148  48.200  20.218  1.00 14.25  ? 134 LEU A N      1 
ATOM   2129 C  CA     . LEU A 1 134 ? -0.226  48.076  19.095  1.00 12.64  ? 134 LEU A CA     1 
ATOM   2130 C  C      . LEU A 1 134 ? -0.954  47.619  17.834  1.00 14.93  ? 134 LEU A C      1 
ATOM   2131 O  O      . LEU A 1 134 ? -0.770  48.198  16.755  1.00 17.83  ? 134 LEU A O      1 
ATOM   2132 C  CB     . LEU A 1 134 ? 0.905   47.115  19.459  1.00 12.39  ? 134 LEU A CB     1 
ATOM   2133 C  CG     . LEU A 1 134 ? 1.986   47.695  20.376  1.00 11.55  ? 134 LEU A CG     1 
ATOM   2134 C  CD1    . LEU A 1 134 ? 2.905   46.617  20.913  1.00 11.30  ? 134 LEU A CD1    1 
ATOM   2135 C  CD2    . LEU A 1 134 ? 2.807   48.713  19.623  1.00 10.19  ? 134 LEU A CD2    1 
ATOM   2136 H  H      . LEU A 1 134 ? -0.989  47.674  20.879  1.00 17.31  ? 134 LEU A H      1 
ATOM   2137 H  HA     . LEU A 1 134 ? 0.168   48.943  18.909  1.00 15.39  ? 134 LEU A HA     1 
ATOM   2138 H  HB2    . LEU A 1 134 ? 0.521   46.348  19.912  1.00 15.08  ? 134 LEU A HB2    1 
ATOM   2139 H  HB3    . LEU A 1 134 ? 1.341   46.832  18.639  1.00 15.08  ? 134 LEU A HB3    1 
ATOM   2140 H  HG     . LEU A 1 134 ? 1.545   48.116  21.129  1.00 14.07  ? 134 LEU A HG     1 
ATOM   2141 H  HD11   . LEU A 1 134 ? 3.580   47.030  21.475  1.00 13.77  ? 134 LEU A HD11   1 
ATOM   2142 H  HD12   . LEU A 1 134 ? 2.382   45.986  21.432  1.00 13.77  ? 134 LEU A HD12   1 
ATOM   2143 H  HD13   . LEU A 1 134 ? 3.328   46.163  20.168  1.00 13.77  ? 134 LEU A HD13   1 
ATOM   2144 H  HD21   . LEU A 1 134 ? 3.562   48.978  20.171  1.00 12.44  ? 134 LEU A HD21   1 
ATOM   2145 H  HD22   . LEU A 1 134 ? 3.122   48.315  18.796  1.00 12.44  ? 134 LEU A HD22   1 
ATOM   2146 H  HD23   . LEU A 1 134 ? 2.253   49.485  19.428  1.00 12.44  ? 134 LEU A HD23   1 
ATOM   2147 N  N      . ASN A 1 135 ? -1.811  46.598  17.953  1.00 13.23  ? 135 ASN A N      1 
ATOM   2148 C  CA     . ASN A 1 135 ? -2.524  46.097  16.780  1.00 11.96  ? 135 ASN A CA     1 
ATOM   2149 C  C      . ASN A 1 135 ? -3.433  47.163  16.180  1.00 15.11  ? 135 ASN A C      1 
ATOM   2150 O  O      . ASN A 1 135 ? -3.540  47.275  14.955  1.00 21.33  ? 135 ASN A O      1 
ATOM   2151 C  CB     . ASN A 1 135 ? -3.331  44.846  17.131  1.00 24.09  ? 135 ASN A CB     1 
ATOM   2152 C  CG     . ASN A 1 135 ? -2.453  43.625  17.365  1.00 24.42  ? 135 ASN A CG     1 
ATOM   2153 O  OD1    . ASN A 1 135 ? -1.253  43.739  17.623  1.00 34.36  ? 135 ASN A OD1    1 
ATOM   2154 N  ND2    . ASN A 1 135 ? -3.052  42.446  17.258  1.00 29.46  ? 135 ASN A ND2    1 
ATOM   2155 H  H      . ASN A 1 135 ? -1.992  46.187  18.686  1.00 16.09  ? 135 ASN A H      1 
ATOM   2156 H  HA     . ASN A 1 135 ? -1.867  45.847  16.112  1.00 14.57  ? 135 ASN A HA     1 
ATOM   2157 H  HB2    . ASN A 1 135 ? -3.835  45.012  17.943  1.00 29.13  ? 135 ASN A HB2    1 
ATOM   2158 H  HB3    . ASN A 1 135 ? -3.936  44.644  16.401  1.00 29.13  ? 135 ASN A HB3    1 
ATOM   2159 H  HD21   . ASN A 1 135 ? -2.603  41.723  17.380  1.00 35.57  ? 135 ASN A HD21   1 
ATOM   2160 H  HD22   . ASN A 1 135 ? -3.889  42.405  17.066  1.00 35.57  ? 135 ASN A HD22   1 
ATOM   2161 N  N      . ALA A 1 136 ? -4.118  47.939  17.022  1.00 15.86  ? 136 ALA A N      1 
ATOM   2162 C  CA     . ALA A 1 136 ? -4.989  48.989  16.506  1.00 12.03  ? 136 ALA A CA     1 
ATOM   2163 C  C      . ALA A 1 136 ? -4.181  50.102  15.848  1.00 18.94  ? 136 ALA A C      1 
ATOM   2164 O  O      . ALA A 1 136 ? -4.583  50.642  14.807  1.00 25.91  ? 136 ALA A O      1 
ATOM   2165 C  CB     . ALA A 1 136 ? -5.857  49.547  17.630  1.00 17.12  ? 136 ALA A CB     1 
ATOM   2166 H  H      . ALA A 1 136 ? -4.098  47.879  17.880  1.00 19.25  ? 136 ALA A H      1 
ATOM   2167 H  HA     . ALA A 1 136 ? -5.576  48.608  15.834  1.00 14.65  ? 136 ALA A HA     1 
ATOM   2168 H  HB1    . ALA A 1 136 ? -6.431  50.242  17.271  1.00 20.75  ? 136 ALA A HB1    1 
ATOM   2169 H  HB2    . ALA A 1 136 ? -6.396  48.830  17.998  1.00 20.75  ? 136 ALA A HB2    1 
ATOM   2170 H  HB3    . ALA A 1 136 ? -5.282  49.916  18.319  1.00 20.75  ? 136 ALA A HB3    1 
ATOM   2171 N  N      . SER A 1 137 ? -3.045  50.470  16.441  1.00 20.72  ? 137 SER A N      1 
ATOM   2172 C  CA     . SER A 1 137 ? -2.192  51.474  15.820  1.00 22.70  ? 137 SER A CA     1 
ATOM   2173 C  C      . SER A 1 137 ? -1.739  51.012  14.443  1.00 21.53  ? 137 SER A C      1 
ATOM   2174 O  O      . SER A 1 137 ? -1.800  51.769  13.467  1.00 17.90  ? 137 SER A O      1 
ATOM   2175 C  CB     . SER A 1 137 ? -0.994  51.774  16.717  1.00 24.09  ? 137 SER A CB     1 
ATOM   2176 O  OG     . SER A 1 137 ? -1.419  52.273  17.972  1.00 21.57  ? 137 SER A OG     1 
ATOM   2177 H  H      . SER A 1 137 ? -2.752  50.161  17.188  1.00 25.08  ? 137 SER A H      1 
ATOM   2178 H  HA     . SER A 1 137 ? -2.694  52.298  15.714  1.00 27.45  ? 137 SER A HA     1 
ATOM   2179 H  HB2    . SER A 1 137 ? -0.490  50.957  16.856  1.00 29.12  ? 137 SER A HB2    1 
ATOM   2180 H  HB3    . SER A 1 137 ? -0.434  52.439  16.286  1.00 29.12  ? 137 SER A HB3    1 
ATOM   2181 H  HG     . SER A 1 137 ? -1.938  51.723  18.339  1.00 26.10  ? 137 SER A HG     1 
ATOM   2182 N  N      . LEU A 1 138 ? -1.295  49.759  14.338  1.00 17.45  ? 138 LEU A N      1 
ATOM   2183 C  CA     . LEU A 1 138 ? -0.867  49.256  13.039  1.00 14.55  ? 138 LEU A CA     1 
ATOM   2184 C  C      . LEU A 1 138 ? -2.035  49.214  12.061  1.00 17.83  ? 138 LEU A C      1 
ATOM   2185 O  O      . LEU A 1 138 ? -1.879  49.549  10.880  1.00 33.32  ? 138 LEU A O      1 
ATOM   2186 C  CB     . LEU A 1 138 ? -0.240  47.869  13.178  1.00 15.10  ? 138 LEU A CB     1 
ATOM   2187 C  CG     . LEU A 1 138 ? 1.285   47.837  13.328  1.00 16.26  ? 138 LEU A CG     1 
ATOM   2188 C  CD1    . LEU A 1 138 ? 1.736   48.602  14.560  1.00 15.71  ? 138 LEU A CD1    1 
ATOM   2189 C  CD2    . LEU A 1 138 ? 1.795   46.410  13.368  1.00 32.21  ? 138 LEU A CD2    1 
ATOM   2190 H  H      . LEU A 1 138 ? -1.235  49.195  14.985  1.00 21.16  ? 138 LEU A H      1 
ATOM   2191 H  HA     . LEU A 1 138 ? -0.187  49.851  12.686  1.00 17.68  ? 138 LEU A HA     1 
ATOM   2192 H  HB2    . LEU A 1 138 ? -0.615  47.444  13.966  1.00 18.33  ? 138 LEU A HB2    1 
ATOM   2193 H  HB3    . LEU A 1 138 ? -0.462  47.354  12.387  1.00 18.33  ? 138 LEU A HB3    1 
ATOM   2194 H  HG     . LEU A 1 138 ? 1.674   48.274  12.554  1.00 19.73  ? 138 LEU A HG     1 
ATOM   2195 H  HD11   . LEU A 1 138 ? 2.703   48.553  14.625  1.00 19.06  ? 138 LEU A HD11   1 
ATOM   2196 H  HD12   . LEU A 1 138 ? 1.457   49.527  14.477  1.00 19.06  ? 138 LEU A HD12   1 
ATOM   2197 H  HD13   . LEU A 1 138 ? 1.331   48.203  15.345  1.00 19.06  ? 138 LEU A HD13   1 
ATOM   2198 H  HD21   . LEU A 1 138 ? 2.759   46.422  13.473  1.00 38.87  ? 138 LEU A HD21   1 
ATOM   2199 H  HD22   . LEU A 1 138 ? 1.386   45.949  14.118  1.00 38.87  ? 138 LEU A HD22   1 
ATOM   2200 H  HD23   . LEU A 1 138 ? 1.558   45.966  12.539  1.00 38.87  ? 138 LEU A HD23   1 
ATOM   2201 N  N      . PHE A 1 139 ? -3.218  48.815  12.537  1.00 15.54  ? 139 PHE A N      1 
ATOM   2202 C  CA     . PHE A 1 139 ? -4.386  48.737  11.669  1.00 17.12  ? 139 PHE A CA     1 
ATOM   2203 C  C      . PHE A 1 139 ? -4.748  50.099  11.099  1.00 19.14  ? 139 PHE A C      1 
ATOM   2204 O  O      . PHE A 1 139 ? -5.172  50.204  9.942   1.00 17.27  ? 139 PHE A O      1 
ATOM   2205 C  CB     . PHE A 1 139 ? -5.561  48.165  12.457  1.00 21.08  ? 139 PHE A CB     1 
ATOM   2206 C  CG     . PHE A 1 139 ? -6.827  48.045  11.664  1.00 25.79  ? 139 PHE A CG     1 
ATOM   2207 C  CD1    . PHE A 1 139 ? -7.137  46.868  11.005  1.00 20.71  ? 139 PHE A CD1    1 
ATOM   2208 C  CD2    . PHE A 1 139 ? -7.715  49.103  11.591  1.00 15.64  ? 139 PHE A CD2    1 
ATOM   2209 C  CE1    . PHE A 1 139 ? -8.302  46.755  10.284  1.00 22.46  ? 139 PHE A CE1    1 
ATOM   2210 C  CE2    . PHE A 1 139 ? -8.880  48.992  10.872  1.00 17.75  ? 139 PHE A CE2    1 
ATOM   2211 C  CZ     . PHE A 1 139 ? -9.174  47.818  10.217  1.00 12.66  ? 139 PHE A CZ     1 
ATOM   2212 H  H      . PHE A 1 139 ? -3.368  48.586  13.353  1.00 18.87  ? 139 PHE A H      1 
ATOM   2213 H  HA     . PHE A 1 139 ? -4.188  48.147  10.925  1.00 20.75  ? 139 PHE A HA     1 
ATOM   2214 H  HB2    . PHE A 1 139 ? -5.323  47.278  12.770  1.00 25.51  ? 139 PHE A HB2    1 
ATOM   2215 H  HB3    . PHE A 1 139 ? -5.741  48.745  13.213  1.00 25.51  ? 139 PHE A HB3    1 
ATOM   2216 H  HD1    . PHE A 1 139 ? -6.552  46.147  11.050  1.00 25.07  ? 139 PHE A HD1    1 
ATOM   2217 H  HD2    . PHE A 1 139 ? -7.521  49.898  12.033  1.00 18.99  ? 139 PHE A HD2    1 
ATOM   2218 H  HE1    . PHE A 1 139 ? -8.501  45.961  9.842   1.00 27.17  ? 139 PHE A HE1    1 
ATOM   2219 H  HE2    . PHE A 1 139 ? -9.469  49.710  10.827  1.00 21.51  ? 139 PHE A HE2    1 
ATOM   2220 H  HZ     . PHE A 1 139 ? -9.963  47.743  9.729   1.00 15.41  ? 139 PHE A HZ     1 
ATOM   2221 N  N      . MET A 1 140 ? -4.616  51.153  11.900  1.00 23.19  ? 140 MET A N      1 
ATOM   2222 C  CA     . MET A 1 140 ? -4.914  52.487  11.391  1.00 21.63  ? 140 MET A CA     1 
ATOM   2223 C  C      . MET A 1 140 ? -3.782  53.036  10.531  1.00 25.95  ? 140 MET A C      1 
ATOM   2224 O  O      . MET A 1 140 ? -4.040  53.776  9.574   1.00 30.06  ? 140 MET A O      1 
ATOM   2225 C  CB     . MET A 1 140 ? -5.227  53.428  12.554  1.00 11.91  ? 140 MET A CB     1 
ATOM   2226 C  CG     . MET A 1 140 ? -6.518  53.058  13.265  1.00 25.06  ? 140 MET A CG     1 
ATOM   2227 S  SD     . MET A 1 140 ? -7.989  53.162  12.217  1.00 31.74  ? 140 MET A SD     1 
ATOM   2228 C  CE     . MET A 1 140 ? -8.087  54.928  11.953  1.00 16.94  ? 140 MET A CE     1 
ATOM   2229 H  H      . MET A 1 140 ? -4.361  51.125  12.721  1.00 28.05  ? 140 MET A H      1 
ATOM   2230 H  HA     . MET A 1 140 ? -5.711  52.442  10.840  1.00 26.17  ? 140 MET A HA     1 
ATOM   2231 H  HB2    . MET A 1 140 ? -4.504  53.386  13.199  1.00 14.51  ? 140 MET A HB2    1 
ATOM   2232 H  HB3    . MET A 1 140 ? -5.317  54.332  12.215  1.00 14.51  ? 140 MET A HB3    1 
ATOM   2233 H  HG2    . MET A 1 140 ? -6.447  52.145  13.585  1.00 30.29  ? 140 MET A HG2    1 
ATOM   2234 H  HG3    . MET A 1 140 ? -6.646  53.663  14.013  1.00 30.29  ? 140 MET A HG3    1 
ATOM   2235 H  HE1    . MET A 1 140 ? -8.874  55.125  11.423  1.00 20.54  ? 140 MET A HE1    1 
ATOM   2236 H  HE2    . MET A 1 140 ? -8.147  55.373  12.813  1.00 20.54  ? 140 MET A HE2    1 
ATOM   2237 H  HE3    . MET A 1 140 ? -7.290  55.222  11.484  1.00 20.54  ? 140 MET A HE3    1 
ATOM   2238 N  N      . ILE A 1 141 ? -2.536  52.655  10.812  1.00 26.84  ? 141 ILE A N      1 
ATOM   2239 C  CA     . ILE A 1 141 ? -1.418  53.226  10.071  1.00 24.63  ? 141 ILE A CA     1 
ATOM   2240 C  C      . ILE A 1 141 ? -1.296  52.597  8.689   1.00 28.04  ? 141 ILE A C      1 
ATOM   2241 O  O      . ILE A 1 141 ? -0.936  53.285  7.725   1.00 29.75  ? 141 ILE A O      1 
ATOM   2242 C  CB     . ILE A 1 141 ? -0.112  53.063  10.869  1.00 19.71  ? 141 ILE A CB     1 
ATOM   2243 C  CG1    . ILE A 1 141 ? -0.108  53.998  12.074  1.00 8.45   ? 141 ILE A CG1    1 
ATOM   2244 C  CG2    . ILE A 1 141 ? 1.102   53.319  9.985   1.00 25.23  ? 141 ILE A CG2    1 
ATOM   2245 C  CD1    . ILE A 1 141 ? 1.035   53.741  13.029  1.00 20.14  ? 141 ILE A CD1    1 
ATOM   2246 H  H      . ILE A 1 141 ? -2.315  52.080  11.413  1.00 32.42  ? 141 ILE A H      1 
ATOM   2247 H  HA     . ILE A 1 141 ? -1.585  54.174  9.951   1.00 29.77  ? 141 ILE A HA     1 
ATOM   2248 H  HB     . ILE A 1 141 ? -0.066  52.148  11.188  1.00 23.86  ? 141 ILE A HB     1 
ATOM   2249 H  HG12   . ILE A 1 141 ? -0.033  54.913  11.759  1.00 10.36  ? 141 ILE A HG12   1 
ATOM   2250 H  HG13   . ILE A 1 141 ? -0.937  53.883  12.563  1.00 10.36  ? 141 ILE A HG13   1 
ATOM   2251 H  HG21   . ILE A 1 141 ? 1.878   53.464  10.549  1.00 30.49  ? 141 ILE A HG21   1 
ATOM   2252 H  HG22   . ILE A 1 141 ? 1.247   52.547  9.416   1.00 30.49  ? 141 ILE A HG22   1 
ATOM   2253 H  HG23   . ILE A 1 141 ? 0.936   54.105  9.442   1.00 30.49  ? 141 ILE A HG23   1 
ATOM   2254 H  HD11   . ILE A 1 141 ? 0.854   54.194  13.867  1.00 24.38  ? 141 ILE A HD11   1 
ATOM   2255 H  HD12   . ILE A 1 141 ? 1.112   52.786  13.179  1.00 24.38  ? 141 ILE A HD12   1 
ATOM   2256 H  HD13   . ILE A 1 141 ? 1.855   54.081  12.639  1.00 24.38  ? 141 ILE A HD13   1 
ATOM   2257 N  N      . TYR A 1 142 ? -1.612  51.306  8.555   1.00 25.29  ? 142 TYR A N      1 
ATOM   2258 C  CA     . TYR A 1 142 ? -1.375  50.587  7.307   1.00 37.26  ? 142 TYR A CA     1 
ATOM   2259 C  C      . TYR A 1 142 ? -1.880  51.338  6.077   1.00 34.10  ? 142 TYR A C      1 
ATOM   2260 O  O      . TYR A 1 142 ? -1.082  51.642  5.179   1.00 28.41  ? 142 TYR A O      1 
ATOM   2261 C  CB     . TYR A 1 142 ? -2.026  49.202  7.359   1.00 35.45  ? 142 TYR A CB     1 
ATOM   2262 C  CG     . TYR A 1 142 ? -2.037  48.516  6.016   1.00 34.94  ? 142 TYR A CG     1 
ATOM   2263 C  CD1    . TYR A 1 142 ? -0.936  47.808  5.559   1.00 35.66  ? 142 TYR A CD1    1 
ATOM   2264 C  CD2    . TYR A 1 142 ? -3.151  48.600  5.192   1.00 41.30  ? 142 TYR A CD2    1 
ATOM   2265 C  CE1    . TYR A 1 142 ? -0.952  47.195  4.323   1.00 39.88  ? 142 TYR A CE1    1 
ATOM   2266 C  CE2    . TYR A 1 142 ? -3.174  47.994  3.959   1.00 33.99  ? 142 TYR A CE2    1 
ATOM   2267 C  CZ     . TYR A 1 142 ? -2.075  47.293  3.528   1.00 29.83  ? 142 TYR A CZ     1 
ATOM   2268 O  OH     . TYR A 1 142 ? -2.103  46.687  2.296   1.00 66.22  ? 142 TYR A OH     1 
ATOM   2269 H  H      . TYR A 1 142 ? -1.964  50.826  9.175   1.00 30.56  ? 142 TYR A H      1 
ATOM   2270 H  HA     . TYR A 1 142 ? -0.414  50.504  7.207   1.00 44.92  ? 142 TYR A HA     1 
ATOM   2271 H  HB2    . TYR A 1 142 ? -1.531  48.643  7.978   1.00 42.76  ? 142 TYR A HB2    1 
ATOM   2272 H  HB3    . TYR A 1 142 ? -2.944  49.294  7.657   1.00 42.76  ? 142 TYR A HB3    1 
ATOM   2273 H  HD1    . TYR A 1 142 ? -0.177  47.746  6.092   1.00 43.01  ? 142 TYR A HD1    1 
ATOM   2274 H  HD2    . TYR A 1 142 ? -3.897  49.076  5.480   1.00 49.77  ? 142 TYR A HD2    1 
ATOM   2275 H  HE1    . TYR A 1 142 ? -0.210  46.718  4.027   1.00 48.07  ? 142 TYR A HE1    1 
ATOM   2276 H  HE2    . TYR A 1 142 ? -3.929  48.059  3.420   1.00 41.00  ? 142 TYR A HE2    1 
ATOM   2277 H  HH     . TYR A 1 142 ? -2.843  46.827  1.924   1.00 79.69  ? 142 TYR A HH     1 
ATOM   2278 N  N      . PRO A 1 143 ? -3.176  51.654  5.983   1.00 37.25  ? 143 PRO A N      1 
ATOM   2279 C  CA     . PRO A 1 143 ? -3.672  52.260  4.734   1.00 40.80  ? 143 PRO A CA     1 
ATOM   2280 C  C      . PRO A 1 143 ? -3.019  53.589  4.401   1.00 35.38  ? 143 PRO A C      1 
ATOM   2281 O  O      . PRO A 1 143 ? -2.737  53.854  3.225   1.00 54.59  ? 143 PRO A O      1 
ATOM   2282 C  CB     . PRO A 1 143 ? -5.181  52.408  4.992   1.00 28.61  ? 143 PRO A CB     1 
ATOM   2283 C  CG     . PRO A 1 143 ? -5.319  52.442  6.464   1.00 31.11  ? 143 PRO A CG     1 
ATOM   2284 C  CD     . PRO A 1 143 ? -4.240  51.540  6.997   1.00 44.55  ? 143 PRO A CD     1 
ATOM   2285 H  HA     . PRO A 1 143 ? -3.532  51.645  3.997   1.00 49.18  ? 143 PRO A HA     1 
ATOM   2286 H  HB2    . PRO A 1 143 ? -5.504  53.231  4.595   1.00 34.55  ? 143 PRO A HB2    1 
ATOM   2287 H  HB3    . PRO A 1 143 ? -5.656  51.649  4.617   1.00 34.55  ? 143 PRO A HB3    1 
ATOM   2288 H  HG2    . PRO A 1 143 ? -5.197  53.350  6.784   1.00 37.54  ? 143 PRO A HG2    1 
ATOM   2289 H  HG3    . PRO A 1 143 ? -6.196  52.116  6.719   1.00 37.54  ? 143 PRO A HG3    1 
ATOM   2290 H  HD2    . PRO A 1 143 ? -3.927  51.848  7.862   1.00 53.68  ? 143 PRO A HD2    1 
ATOM   2291 H  HD3    . PRO A 1 143 ? -4.556  50.625  7.065   1.00 53.68  ? 143 PRO A HD3    1 
ATOM   2292 N  N      . VAL A 1 144 ? -2.763  54.435  5.402   1.00 37.70  ? 144 VAL A N      1 
ATOM   2293 C  CA     . VAL A 1 144 ? -2.148  55.734  5.137   1.00 40.76  ? 144 VAL A CA     1 
ATOM   2294 C  C      . VAL A 1 144 ? -0.744  55.552  4.573   1.00 38.39  ? 144 VAL A C      1 
ATOM   2295 O  O      . VAL A 1 144 ? -0.358  56.206  3.597   1.00 39.36  ? 144 VAL A O      1 
ATOM   2296 C  CB     . VAL A 1 144 ? -2.136  56.596  6.411   1.00 20.96  ? 144 VAL A CB     1 
ATOM   2297 C  CG1    . VAL A 1 144 ? -1.570  57.966  6.108   1.00 28.20  ? 144 VAL A CG1    1 
ATOM   2298 C  CG2    . VAL A 1 144 ? -3.534  56.718  6.982   1.00 27.08  ? 144 VAL A CG2    1 
ATOM   2299 H  H      . VAL A 1 144 ? -2.932  54.283  6.231   1.00 45.45  ? 144 VAL A H      1 
ATOM   2300 H  HA     . VAL A 1 144 ? -2.682  56.194  4.471   1.00 49.13  ? 144 VAL A HA     1 
ATOM   2301 H  HB     . VAL A 1 144 ? -1.573  56.170  7.077   1.00 25.37  ? 144 VAL A HB     1 
ATOM   2302 H  HG11   . VAL A 1 144 ? -1.685  58.534  6.885   1.00 34.06  ? 144 VAL A HG11   1 
ATOM   2303 H  HG12   . VAL A 1 144 ? -0.627  57.878  5.899   1.00 34.06  ? 144 VAL A HG12   1 
ATOM   2304 H  HG13   . VAL A 1 144 ? -2.043  58.342  5.349   1.00 34.06  ? 144 VAL A HG13   1 
ATOM   2305 H  HG21   . VAL A 1 144 ? -3.526  57.371  7.699   1.00 32.71  ? 144 VAL A HG21   1 
ATOM   2306 H  HG22   . VAL A 1 144 ? -4.138  57.006  6.279   1.00 32.71  ? 144 VAL A HG22   1 
ATOM   2307 H  HG23   . VAL A 1 144 ? -3.812  55.854  7.324   1.00 32.71  ? 144 VAL A HG23   1 
ATOM   2308 N  N      . LEU A 1 145 ? 0.043   54.661  5.181   1.00 32.14  ? 145 LEU A N      1 
ATOM   2309 C  CA     . LEU A 1 145 ? 1.405   54.435  4.703   1.00 42.98  ? 145 LEU A CA     1 
ATOM   2310 C  C      . LEU A 1 145 ? 1.401   53.808  3.315   1.00 37.48  ? 145 LEU A C      1 
ATOM   2311 O  O      . LEU A 1 145 ? 2.224   54.164  2.461   1.00 39.63  ? 145 LEU A O      1 
ATOM   2312 C  CB     . LEU A 1 145 ? 2.168   53.554  5.693   1.00 36.66  ? 145 LEU A CB     1 
ATOM   2313 C  CG     . LEU A 1 145 ? 3.608   53.194  5.318   1.00 31.95  ? 145 LEU A CG     1 
ATOM   2314 C  CD1    . LEU A 1 145 ? 4.446   54.443  5.135   1.00 29.27  ? 145 LEU A CD1    1 
ATOM   2315 C  CD2    . LEU A 1 145 ? 4.222   52.292  6.377   1.00 13.82  ? 145 LEU A CD2    1 
ATOM   2316 H  H      . LEU A 1 145 ? -0.182  54.182  5.859   1.00 38.79  ? 145 LEU A H      1 
ATOM   2317 H  HA     . LEU A 1 145 ? 1.864   55.287  4.648   1.00 51.79  ? 145 LEU A HA     1 
ATOM   2318 H  HB2    . LEU A 1 145 ? 2.203   54.018  6.544   1.00 44.21  ? 145 LEU A HB2    1 
ATOM   2319 H  HB3    . LEU A 1 145 ? 1.682   52.720  5.790   1.00 44.21  ? 145 LEU A HB3    1 
ATOM   2320 H  HG     . LEU A 1 145 ? 3.601   52.714  4.475   1.00 38.56  ? 145 LEU A HG     1 
ATOM   2321 H  HD11   . LEU A 1 145 ? 5.373   54.187  5.010   1.00 35.34  ? 145 LEU A HD11   1 
ATOM   2322 H  HD12   . LEU A 1 145 ? 4.128   54.925  4.356   1.00 35.34  ? 145 LEU A HD12   1 
ATOM   2323 H  HD13   . LEU A 1 145 ? 4.360   54.999  5.925   1.00 35.34  ? 145 LEU A HD13   1 
ATOM   2324 H  HD21   . LEU A 1 145 ? 5.148   52.118  6.146   1.00 16.80  ? 145 LEU A HD21   1 
ATOM   2325 H  HD22   . LEU A 1 145 ? 4.174   52.737  7.237   1.00 16.80  ? 145 LEU A HD22   1 
ATOM   2326 H  HD23   . LEU A 1 145 ? 3.727   51.458  6.408   1.00 16.80  ? 145 LEU A HD23   1 
ATOM   2327 N  N      . ASP A 1 146 ? 0.486   52.870  3.073   1.00 38.36  ? 146 ASP A N      1 
ATOM   2328 C  CA     . ASP A 1 146 ? 0.381   52.264  1.751   1.00 53.05  ? 146 ASP A CA     1 
ATOM   2329 C  C      . ASP A 1 146 ? 0.075   53.315  0.693   1.00 36.23  ? 146 ASP A C      1 
ATOM   2330 O  O      . ASP A 1 146 ? 0.735   53.376  -0.353  1.00 41.81  ? 146 ASP A O      1 
ATOM   2331 C  CB     . ASP A 1 146 ? -0.697  51.179  1.768   1.00 48.31  ? 146 ASP A CB     1 
ATOM   2332 C  CG     . ASP A 1 146 ? -0.869  50.511  0.426   1.00 33.10  ? 146 ASP A CG     1 
ATOM   2333 O  OD1    . ASP A 1 146 ? 0.076   49.841  -0.034  1.00 55.43  ? 146 ASP A OD1    1 
ATOM   2334 O  OD2    . ASP A 1 146 ? -1.960  50.648  -0.163  1.00 47.27  ? 146 ASP A OD2    1 
ATOM   2335 H  H      . ASP A 1 146 ? -0.079  52.570  3.648   1.00 46.25  ? 146 ASP A H      1 
ATOM   2336 H  HA     . ASP A 1 146 ? 1.227   51.847  1.523   1.00 63.87  ? 146 ASP A HA     1 
ATOM   2337 H  HB2    . ASP A 1 146 ? -0.451  50.499  2.413   1.00 58.18  ? 146 ASP A HB2    1 
ATOM   2338 H  HB3    . ASP A 1 146 ? -1.545  51.580  2.015   1.00 58.18  ? 146 ASP A HB3    1 
ATOM   2339 N  N      . SER A 1 147 ? -0.923  54.162  0.953   1.00 35.23  ? 147 SER A N      1 
ATOM   2340 C  CA     . SER A 1 147 ? -1.269  55.208  -0.001  1.00 36.97  ? 147 SER A CA     1 
ATOM   2341 C  C      . SER A 1 147 ? -0.119  56.190  -0.183  1.00 36.12  ? 147 SER A C      1 
ATOM   2342 O  O      . SER A 1 147 ? 0.102   56.694  -1.287  1.00 51.25  ? 147 SER A O      1 
ATOM   2343 C  CB     . SER A 1 147 ? -2.538  55.929  0.452   1.00 36.01  ? 147 SER A CB     1 
ATOM   2344 O  OG     . SER A 1 147 ? -3.633  55.030  0.506   1.00 38.04  ? 147 SER A OG     1 
ATOM   2345 H  H      . SER A 1 147 ? -1.408  54.152  1.663   1.00 42.49  ? 147 SER A H      1 
ATOM   2346 H  HA     . SER A 1 147 ? -1.450  54.802  -0.863  1.00 44.57  ? 147 SER A HA     1 
ATOM   2347 H  HB2    . SER A 1 147 ? -2.391  56.302  1.335   1.00 43.43  ? 147 SER A HB2    1 
ATOM   2348 H  HB3    . SER A 1 147 ? -2.741  56.637  -0.179  1.00 43.43  ? 147 SER A HB3    1 
ATOM   2349 H  HG     . SER A 1 147 ? -3.445  54.376  0.999   1.00 45.87  ? 147 SER A HG     1 
ATOM   2350 N  N      . ALA A 1 148 ? 0.626   56.476  0.887   1.00 50.47  ? 148 ALA A N      1 
ATOM   2351 C  CA     . ALA A 1 148 ? 1.761   57.387  0.773   1.00 41.07  ? 148 ALA A CA     1 
ATOM   2352 C  C      . ALA A 1 148 ? 2.827   56.814  -0.149  1.00 40.22  ? 148 ALA A C      1 
ATOM   2353 O  O      . ALA A 1 148 ? 3.354   57.513  -1.022  1.00 61.90  ? 148 ALA A O      1 
ATOM   2354 C  CB     . ALA A 1 148 ? 2.345   57.674  2.156   1.00 36.76  ? 148 ALA A CB     1 
ATOM   2355 H  H      . ALA A 1 148 ? 0.498   56.161  1.677   1.00 60.78  ? 148 ALA A H      1 
ATOM   2356 H  HA     . ALA A 1 148 ? 1.451   58.226  0.398   1.00 49.49  ? 148 ALA A HA     1 
ATOM   2357 H  HB1    . ALA A 1 148 ? 3.096   58.281  2.061   1.00 44.32  ? 148 ALA A HB1    1 
ATOM   2358 H  HB2    . ALA A 1 148 ? 1.660   58.079  2.711   1.00 44.32  ? 148 ALA A HB2    1 
ATOM   2359 H  HB3    . ALA A 1 148 ? 2.642   56.840  2.553   1.00 44.32  ? 148 ALA A HB3    1 
ATOM   2360 N  N      . PHE A 1 149 ? 3.171   55.539  0.043   1.00 42.62  ? 149 PHE A N      1 
ATOM   2361 C  CA     . PHE A 1 149 ? 4.153   54.906  -0.831  1.00 35.20  ? 149 PHE A CA     1 
ATOM   2362 C  C      . PHE A 1 149 ? 3.665   54.884  -2.274  1.00 44.49  ? 149 PHE A C      1 
ATOM   2363 O  O      . PHE A 1 149 ? 4.439   55.147  -3.204  1.00 54.45  ? 149 PHE A O      1 
ATOM   2364 C  CB     . PHE A 1 149 ? 4.453   53.485  -0.353  1.00 36.14  ? 149 PHE A CB     1 
ATOM   2365 C  CG     . PHE A 1 149 ? 5.491   53.402  0.739   1.00 33.90  ? 149 PHE A CG     1 
ATOM   2366 C  CD1    . PHE A 1 149 ? 6.609   54.222  0.731   1.00 39.48  ? 149 PHE A CD1    1 
ATOM   2367 C  CD2    . PHE A 1 149 ? 5.353   52.485  1.766   1.00 36.45  ? 149 PHE A CD2    1 
ATOM   2368 C  CE1    . PHE A 1 149 ? 7.558   54.136  1.728   1.00 30.71  ? 149 PHE A CE1    1 
ATOM   2369 C  CE2    . PHE A 1 149 ? 6.302   52.395  2.767   1.00 31.90  ? 149 PHE A CE2    1 
ATOM   2370 C  CZ     . PHE A 1 149 ? 7.405   53.220  2.746   1.00 34.64  ? 149 PHE A CZ     1 
ATOM   2371 H  H      . PHE A 1 149 ? 2.858   55.028  0.660   1.00 51.36  ? 149 PHE A H      1 
ATOM   2372 H  HA     . PHE A 1 149 ? 4.978   55.415  -0.791  1.00 42.46  ? 149 PHE A HA     1 
ATOM   2373 H  HB2    . PHE A 1 149 ? 3.634   53.094  -0.009  1.00 43.59  ? 149 PHE A HB2    1 
ATOM   2374 H  HB3    . PHE A 1 149 ? 4.777   52.966  -1.106  1.00 43.59  ? 149 PHE A HB3    1 
ATOM   2375 H  HD1    . PHE A 1 149 ? 6.720   54.840  0.045   1.00 47.59  ? 149 PHE A HD1    1 
ATOM   2376 H  HD2    . PHE A 1 149 ? 4.612   51.923  1.784   1.00 43.96  ? 149 PHE A HD2    1 
ATOM   2377 H  HE1    . PHE A 1 149 ? 8.301   54.695  1.713   1.00 37.07  ? 149 PHE A HE1    1 
ATOM   2378 H  HE2    . PHE A 1 149 ? 6.196   51.777  3.454   1.00 38.50  ? 149 PHE A HE2    1 
ATOM   2379 H  HZ     . PHE A 1 149 ? 8.045   53.159  3.418   1.00 41.78  ? 149 PHE A HZ     1 
ATOM   2380 N  N      . LYS A 1 150 ? 2.378   54.591  -2.484  1.00 52.08  ? 150 LYS A N      1 
ATOM   2381 C  CA     . LYS A 1 150 ? 1.854   54.542  -3.846  1.00 53.13  ? 150 LYS A CA     1 
ATOM   2382 C  C      . LYS A 1 150 ? 1.890   55.919  -4.501  1.00 64.57  ? 150 LYS A C      1 
ATOM   2383 O  O      . LYS A 1 150 ? 2.236   56.041  -5.682  1.00 80.97  ? 150 LYS A O      1 
ATOM   2384 C  CB     . LYS A 1 150 ? 0.435   53.974  -3.856  1.00 35.30  ? 150 LYS A CB     1 
ATOM   2385 C  CG     . LYS A 1 150 ? 0.370   52.485  -3.541  1.00 38.96  ? 150 LYS A CG     1 
ATOM   2386 C  CD     . LYS A 1 150 ? -1.052  51.954  -3.600  1.00 52.54  ? 150 LYS A CD     1 
ATOM   2387 C  CE     . LYS A 1 150 ? -1.093  50.451  -3.353  1.00 59.44  ? 150 LYS A CE     1 
ATOM   2388 N  NZ     . LYS A 1 150 ? -2.485  49.919  -3.366  1.00 54.50  ? 150 LYS A NZ     1 
ATOM   2389 H  H      . LYS A 1 150 ? 1.801   54.420  -1.869  1.00 62.71  ? 150 LYS A H      1 
ATOM   2390 H  HA     . LYS A 1 150 ? 2.411   53.945  -4.369  1.00 63.97  ? 150 LYS A HA     1 
ATOM   2391 H  HB2    . LYS A 1 150 ? -0.093  54.442  -3.190  1.00 42.58  ? 150 LYS A HB2    1 
ATOM   2392 H  HB3    . LYS A 1 150 ? 0.051   54.108  -4.737  1.00 42.58  ? 150 LYS A HB3    1 
ATOM   2393 H  HG2    . LYS A 1 150 ? 0.903   51.998  -4.188  1.00 46.97  ? 150 LYS A HG2    1 
ATOM   2394 H  HG3    . LYS A 1 150 ? 0.714   52.333  -2.646  1.00 46.97  ? 150 LYS A HG3    1 
ATOM   2395 H  HD2    . LYS A 1 150 ? -1.588  52.390  -2.919  1.00 63.26  ? 150 LYS A HD2    1 
ATOM   2396 H  HD3    . LYS A 1 150 ? -1.425  52.129  -4.479  1.00 63.26  ? 150 LYS A HD3    1 
ATOM   2397 H  HE2    . LYS A 1 150 ? -0.590  50.000  -4.049  1.00 71.54  ? 150 LYS A HE2    1 
ATOM   2398 H  HE3    . LYS A 1 150 ? -0.704  50.260  -2.485  1.00 71.54  ? 150 LYS A HE3    1 
ATOM   2399 H  HZ1    . LYS A 1 150 ? -2.478  49.044  -3.202  1.00 65.61  ? 150 LYS A HZ1    1 
ATOM   2400 H  HZ2    . LYS A 1 150 ? -2.973  50.326  -2.743  1.00 65.61  ? 150 LYS A HZ2    1 
ATOM   2401 H  HZ3    . LYS A 1 150 ? -2.858  50.060  -4.162  1.00 65.61  ? 150 LYS A HZ3    1 
ATOM   2402 N  N      . ASN A 1 151 ? 1.549   56.969  -3.751  1.00 65.42  ? 151 ASN A N      1 
ATOM   2403 C  CA     . ASN A 1 151 ? 1.552   58.308  -4.324  1.00 69.28  ? 151 ASN A CA     1 
ATOM   2404 C  C      . ASN A 1 151 ? 2.972   58.793  -4.580  1.00 77.61  ? 151 ASN A C      1 
ATOM   2405 O  O      . ASN A 1 151 ? 3.210   59.528  -5.546  1.00 97.29  ? 151 ASN A O      1 
ATOM   2406 C  CB     . ASN A 1 151 ? 0.822   59.269  -3.382  1.00 68.88  ? 151 ASN A CB     1 
ATOM   2407 C  CG     . ASN A 1 151 ? 0.804   60.693  -3.895  1.00 77.77  ? 151 ASN A CG     1 
ATOM   2408 O  OD1    . ASN A 1 151 ? 1.728   61.468  -3.645  1.00 62.24  ? 151 ASN A OD1    1 
ATOM   2409 N  ND2    . ASN A 1 151 ? -0.259  61.049  -4.607  1.00 98.13  ? 151 ASN A ND2    1 
ATOM   2410 H  H      . ASN A 1 151 ? 1.316   56.933  -2.924  1.00 78.72  ? 151 ASN A H      1 
ATOM   2411 H  HA     . ASN A 1 151 ? 1.080   58.298  -5.171  1.00 83.35  ? 151 ASN A HA     1 
ATOM   2412 H  HB2    . ASN A 1 151 ? -0.097  58.975  -3.280  1.00 82.87  ? 151 ASN A HB2    1 
ATOM   2413 H  HB3    . ASN A 1 151 ? 1.268   59.266  -2.521  1.00 82.87  ? 151 ASN A HB3    1 
ATOM   2414 H  HD21   . ASN A 1 151 ? -0.317  61.848  -4.922  1.00 117.98 ? 151 ASN A HD21   1 
ATOM   2415 H  HD22   . ASN A 1 151 ? -0.888  60.482  -4.754  1.00 117.98 ? 151 ASN A HD22   1 
ATOM   2416 N  N      . ARG A 1 152 ? 3.935   58.363  -3.758  1.00 78.84  ? 152 ARG A N      1 
ATOM   2417 C  CA     . ARG A 1 152 ? 5.328   58.687  -4.038  1.00 70.30  ? 152 ARG A CA     1 
ATOM   2418 C  C      . ARG A 1 152 ? 5.795   57.991  -5.310  1.00 92.35  ? 152 ARG A C      1 
ATOM   2419 O  O      . ARG A 1 152 ? 6.495   58.589  -6.134  1.00 101.25 ? 152 ARG A O      1 
ATOM   2420 C  CB     . ARG A 1 152 ? 6.219   58.279  -2.866  1.00 59.23  ? 152 ARG A CB     1 
ATOM   2421 C  CG     . ARG A 1 152 ? 7.661   58.717  -3.036  1.00 67.43  ? 152 ARG A CG     1 
ATOM   2422 C  CD     . ARG A 1 152 ? 8.546   58.278  -1.886  1.00 35.01  ? 152 ARG A CD     1 
ATOM   2423 N  NE     . ARG A 1 152 ? 8.698   56.827  -1.848  1.00 23.97  ? 152 ARG A NE     1 
ATOM   2424 C  CZ     . ARG A 1 152 ? 9.554   56.188  -1.058  1.00 27.81  ? 152 ARG A CZ     1 
ATOM   2425 N  NH1    . ARG A 1 152 ? 10.341  56.872  -0.241  1.00 33.87  ? 152 ARG A NH1    1 
ATOM   2426 N  NH2    . ARG A 1 152 ? 9.634   54.865  -1.091  1.00 41.23  ? 152 ARG A NH2    1 
ATOM   2427 H  H      . ARG A 1 152 ? 3.809   57.892  -3.049  1.00 94.82  ? 152 ARG A H      1 
ATOM   2428 H  HA     . ARG A 1 152 ? 5.406   59.647  -4.153  1.00 84.57  ? 152 ARG A HA     1 
ATOM   2429 H  HB2    . ARG A 1 152 ? 5.877   58.686  -2.054  1.00 71.29  ? 152 ARG A HB2    1 
ATOM   2430 H  HB3    . ARG A 1 152 ? 6.207   57.313  -2.783  1.00 71.29  ? 152 ARG A HB3    1 
ATOM   2431 H  HG2    . ARG A 1 152 ? 8.015   58.328  -3.852  1.00 81.14  ? 152 ARG A HG2    1 
ATOM   2432 H  HG3    . ARG A 1 152 ? 7.694   59.685  -3.088  1.00 81.14  ? 152 ARG A HG3    1 
ATOM   2433 H  HD2    . ARG A 1 152 ? 9.426   58.674  -1.989  1.00 42.23  ? 152 ARG A HD2    1 
ATOM   2434 H  HD3    . ARG A 1 152 ? 8.150   58.565  -1.048  1.00 42.23  ? 152 ARG A HD3    1 
ATOM   2435 H  HE     . ARG A 1 152 ? 8.202   56.357  -2.369  1.00 28.98  ? 152 ARG A HE     1 
ATOM   2436 H  HH11   . ARG A 1 152 ? 10.298  57.731  -0.221  1.00 40.86  ? 152 ARG A HH11   1 
ATOM   2437 H  HH12   . ARG A 1 152 ? 10.895  56.457  0.270   1.00 40.86  ? 152 ARG A HH12   1 
ATOM   2438 H  HH21   . ARG A 1 152 ? 9.130   54.417  -1.625  1.00 49.70  ? 152 ARG A HH21   1 
ATOM   2439 H  HH22   . ARG A 1 152 ? 10.189  54.454  -0.579  1.00 49.70  ? 152 ARG A HH22   1 
ATOM   2440 N  N      . LYS A 1 153 ? 5.409   56.721  -5.482  1.00 102.59 ? 153 LYS A N      1 
ATOM   2441 C  CA     . LYS A 1 153 ? 5.791   55.982  -6.682  1.00 94.44  ? 153 LYS A CA     1 
ATOM   2442 C  C      . LYS A 1 153 ? 5.164   56.593  -7.929  1.00 107.97 ? 153 LYS A C      1 
ATOM   2443 O  O      . LYS A 1 153 ? 5.788   56.624  -8.996  1.00 112.57 ? 153 LYS A O      1 
ATOM   2444 C  CB     . LYS A 1 153 ? 5.384   54.514  -6.544  1.00 75.89  ? 153 LYS A CB     1 
ATOM   2445 H  H      . LYS A 1 153 ? 4.933   56.271  -4.926  1.00 123.33 ? 153 LYS A H      1 
ATOM   2446 H  HA     . LYS A 1 153 ? 6.755   56.021  -6.779  1.00 113.54 ? 153 LYS A HA     1 
ATOM   2447 N  N      . ARG A 1 154 ? 3.926   57.081  -7.816  1.00 110.55 ? 154 ARG A N      1 
ATOM   2448 C  CA     . ARG A 1 154 ? 3.252   57.665  -8.971  1.00 117.93 ? 154 ARG A CA     1 
ATOM   2449 C  C      . ARG A 1 154 ? 3.843   59.026  -9.325  1.00 115.24 ? 154 ARG A C      1 
ATOM   2450 O  O      . ARG A 1 154 ? 4.336   59.232  -10.441 1.00 119.37 ? 154 ARG A O      1 
ATOM   2451 C  CB     . ARG A 1 154 ? 1.749   57.787  -8.704  1.00 99.39  ? 154 ARG A CB     1 
ATOM   2452 C  CG     . ARG A 1 154 ? 0.990   58.527  -9.804  1.00 99.17  ? 154 ARG A CG     1 
ATOM   2453 C  CD     . ARG A 1 154 ? -0.501  58.606  -9.524  1.00 104.76 ? 154 ARG A CD     1 
ATOM   2454 N  NE     . ARG A 1 154 ? -1.170  57.321  -9.709  1.00 107.39 ? 154 ARG A NE     1 
ATOM   2455 C  CZ     . ARG A 1 154 ? -2.488  57.149  -9.657  1.00 92.33  ? 154 ARG A CZ     1 
ATOM   2456 N  NH1    . ARG A 1 154 ? -3.287  58.183  -9.427  1.00 87.19  ? 154 ARG A NH1    1 
ATOM   2457 N  NH2    . ARG A 1 154 ? -3.008  55.942  -9.837  1.00 74.15  ? 154 ARG A NH2    1 
ATOM   2458 H  H      . ARG A 1 154 ? 3.462   57.085  -7.092  1.00 132.87 ? 154 ARG A H      1 
ATOM   2459 H  HA     . ARG A 1 154 ? 3.377   57.074  -9.729  1.00 141.73 ? 154 ARG A HA     1 
ATOM   2460 H  HB2    . ARG A 1 154 ? 1.371   56.897  -8.630  1.00 119.49 ? 154 ARG A HB2    1 
ATOM   2461 H  HB3    . ARG A 1 154 ? 1.617   58.273  -7.875  1.00 119.49 ? 154 ARG A HB3    1 
ATOM   2462 H  HG2    . ARG A 1 154 ? 1.332   59.432  -9.873  1.00 119.22 ? 154 ARG A HG2    1 
ATOM   2463 H  HG3    . ARG A 1 154 ? 1.115   58.060  -10.645 1.00 119.22 ? 154 ARG A HG3    1 
ATOM   2464 H  HD2    . ARG A 1 154 ? -0.638  58.887  -8.606  1.00 125.92 ? 154 ARG A HD2    1 
ATOM   2465 H  HD3    . ARG A 1 154 ? -0.905  59.246  -10.131 1.00 125.92 ? 154 ARG A HD3    1 
ATOM   2466 H  HE     . ARG A 1 154 ? -0.680  56.631  -9.861  1.00 129.09 ? 154 ARG A HE     1 
ATOM   2467 H  HH11   . ARG A 1 154 ? -2.953  58.967  -9.311  1.00 104.85 ? 154 ARG A HH11   1 
ATOM   2468 H  HH12   . ARG A 1 154 ? -4.139  58.069  -9.394  1.00 104.85 ? 154 ARG A HH12   1 
ATOM   2469 H  HH21   . ARG A 1 154 ? -2.493  55.270  -9.987  1.00 89.19  ? 154 ARG A HH21   1 
ATOM   2470 H  HH22   . ARG A 1 154 ? -3.860  55.832  -9.803  1.00 89.19  ? 154 ARG A HH22   1 
ATOM   2471 N  N      . VAL A 1 155 ? 3.802   59.975  -8.385  1.00 107.74 ? 155 VAL A N      1 
ATOM   2472 C  CA     . VAL A 1 155 ? 4.180   61.350  -8.704  1.00 116.84 ? 155 VAL A CA     1 
ATOM   2473 C  C      . VAL A 1 155 ? 5.625   61.416  -9.187  1.00 123.70 ? 155 VAL A C      1 
ATOM   2474 O  O      . VAL A 1 155 ? 5.940   62.126  -10.149 1.00 125.23 ? 155 VAL A O      1 
ATOM   2475 C  CB     . VAL A 1 155 ? 3.946   62.266  -7.489  1.00 119.06 ? 155 VAL A CB     1 
ATOM   2476 C  CG1    . VAL A 1 155 ? 4.456   63.675  -7.778  1.00 109.34 ? 155 VAL A CG1    1 
ATOM   2477 C  CG2    . VAL A 1 155 ? 2.466   62.291  -7.124  1.00 98.33  ? 155 VAL A CG2    1 
ATOM   2478 H  H      . VAL A 1 155 ? 3.562   59.851  -7.568  1.00 129.50 ? 155 VAL A H      1 
ATOM   2479 H  HA     . VAL A 1 155 ? 3.614   61.659  -9.429  1.00 140.42 ? 155 VAL A HA     1 
ATOM   2480 H  HB     . VAL A 1 155 ? 4.439   61.919  -6.729  1.00 143.09 ? 155 VAL A HB     1 
ATOM   2481 H  HG11   . VAL A 1 155 ? 4.092   64.284  -7.116  1.00 131.42 ? 155 VAL A HG11   1 
ATOM   2482 H  HG12   . VAL A 1 155 ? 5.424   63.675  -7.731  1.00 131.42 ? 155 VAL A HG12   1 
ATOM   2483 H  HG13   . VAL A 1 155 ? 4.167   63.939  -8.665  1.00 131.42 ? 155 VAL A HG13   1 
ATOM   2484 H  HG21   . VAL A 1 155 ? 2.335   62.896  -6.378  1.00 118.21 ? 155 VAL A HG21   1 
ATOM   2485 H  HG22   . VAL A 1 155 ? 1.957   62.597  -7.891  1.00 118.21 ? 155 VAL A HG22   1 
ATOM   2486 H  HG23   . VAL A 1 155 ? 2.186   61.396  -6.877  1.00 118.21 ? 155 VAL A HG23   1 
ATOM   2487 N  N      . GLU A 1 156 ? 6.523   60.686  -8.533  1.00 124.29 ? 156 GLU A N      1 
ATOM   2488 C  CA     . GLU A 1 156 ? 7.933   60.705  -8.912  1.00 126.31 ? 156 GLU A CA     1 
ATOM   2489 C  C      . GLU A 1 156 ? 8.132   60.071  -10.286 1.00 118.73 ? 156 GLU A C      1 
ATOM   2490 O  O      . GLU A 1 156 ? 8.162   58.847  -10.419 1.00 119.28 ? 156 GLU A O      1 
ATOM   2491 C  CB     . GLU A 1 156 ? 8.783   59.977  -7.869  1.00 125.79 ? 156 GLU A CB     1 
ATOM   2492 C  CG     . GLU A 1 156 ? 10.283  60.116  -8.090  1.00 114.60 ? 156 GLU A CG     1 
ATOM   2493 C  CD     . GLU A 1 156 ? 11.099  59.415  -7.022  1.00 113.30 ? 156 GLU A CD     1 
ATOM   2494 O  OE1    . GLU A 1 156 ? 10.538  58.550  -6.315  1.00 109.34 ? 156 GLU A OE1    1 
ATOM   2495 O  OE2    . GLU A 1 156 ? 12.299  59.732  -6.887  1.00 114.63 ? 156 GLU A OE2    1 
ATOM   2496 H  H      . GLU A 1 156 ? 6.342   60.172  -7.867  1.00 149.36 ? 156 GLU A H      1 
ATOM   2497 H  HA     . GLU A 1 156 ? 8.237   61.625  -8.954  1.00 151.78 ? 156 GLU A HA     1 
ATOM   2498 H  HB2    . GLU A 1 156 ? 8.579   60.339  -6.993  1.00 151.16 ? 156 GLU A HB2    1 
ATOM   2499 H  HB3    . GLU A 1 156 ? 8.567   59.031  -7.896  1.00 151.16 ? 156 GLU A HB3    1 
ATOM   2500 H  HG2    . GLU A 1 156 ? 10.514  59.727  -8.948  1.00 137.73 ? 156 GLU A HG2    1 
ATOM   2501 H  HG3    . GLU A 1 156 ? 10.519  61.057  -8.078  1.00 137.73 ? 156 GLU A HG3    1 
ATOM   2502 N  N      . ASN B 1 7   ? -34.624 51.576  41.670  1.00 37.49  ? 7   ASN B N      1 
ATOM   2503 C  CA     . ASN B 1 7   ? -33.219 51.335  41.981  1.00 58.91  ? 7   ASN B CA     1 
ATOM   2504 C  C      . ASN B 1 7   ? -32.441 52.641  42.113  1.00 45.97  ? 7   ASN B C      1 
ATOM   2505 O  O      . ASN B 1 7   ? -32.970 53.722  41.859  1.00 49.34  ? 7   ASN B O      1 
ATOM   2506 C  CB     . ASN B 1 7   ? -32.573 50.449  40.914  1.00 71.75  ? 7   ASN B CB     1 
ATOM   2507 C  CG     . ASN B 1 7   ? -33.018 49.003  41.010  1.00 88.79  ? 7   ASN B CG     1 
ATOM   2508 O  OD1    . ASN B 1 7   ? -33.337 48.509  42.093  1.00 72.43  ? 7   ASN B OD1    1 
ATOM   2509 N  ND2    . ASN B 1 7   ? -33.036 48.315  39.875  1.00 97.06  ? 7   ASN B ND2    1 
ATOM   2510 H  HA     . ASN B 1 7   ? -33.169 50.873  42.832  1.00 70.91  ? 7   ASN B HA     1 
ATOM   2511 H  HB2    . ASN B 1 7   ? -32.817 50.781  40.036  1.00 86.32  ? 7   ASN B HB2    1 
ATOM   2512 H  HB3    . ASN B 1 7   ? -31.609 50.474  41.023  1.00 86.32  ? 7   ASN B HB3    1 
ATOM   2513 H  HD21   . ASN B 1 7   ? -33.281 47.490  39.876  1.00 116.69 ? 7   ASN B HD21   1 
ATOM   2514 H  HD22   . ASN B 1 7   ? -32.802 48.693  39.139  1.00 116.69 ? 7   ASN B HD22   1 
ATOM   2515 N  N      . LEU B 1 8   ? -31.183 52.529  42.526  1.00 41.09  ? 8   LEU B N      1 
ATOM   2516 C  CA     . LEU B 1 8   ? -30.317 53.689  42.660  1.00 36.04  ? 8   LEU B CA     1 
ATOM   2517 C  C      . LEU B 1 8   ? -29.716 54.060  41.310  1.00 32.69  ? 8   LEU B C      1 
ATOM   2518 O  O      . LEU B 1 8   ? -29.583 53.227  40.411  1.00 24.94  ? 8   LEU B O      1 
ATOM   2519 C  CB     . LEU B 1 8   ? -29.195 53.397  43.658  1.00 32.73  ? 8   LEU B CB     1 
ATOM   2520 C  CG     . LEU B 1 8   ? -29.602 53.099  45.104  1.00 23.51  ? 8   LEU B CG     1 
ATOM   2521 C  CD1    . LEU B 1 8   ? -28.411 52.573  45.882  1.00 32.86  ? 8   LEU B CD1    1 
ATOM   2522 C  CD2    . LEU B 1 8   ? -30.165 54.329  45.789  1.00 19.53  ? 8   LEU B CD2    1 
ATOM   2523 H  H      . LEU B 1 8   ? -30.805 51.786  42.735  1.00 49.52  ? 8   LEU B H      1 
ATOM   2524 H  HA     . LEU B 1 8   ? -30.833 54.443  42.987  1.00 43.46  ? 8   LEU B HA     1 
ATOM   2525 H  HB2    . LEU B 1 8   ? -28.705 52.623  43.338  1.00 39.49  ? 8   LEU B HB2    1 
ATOM   2526 H  HB3    . LEU B 1 8   ? -28.611 54.171  43.684  1.00 39.49  ? 8   LEU B HB3    1 
ATOM   2527 H  HG     . LEU B 1 8   ? -30.299 52.424  45.092  1.00 28.43  ? 8   LEU B HG     1 
ATOM   2528 H  HD11   . LEU B 1 8   ? -28.688 52.382  46.792  1.00 39.64  ? 8   LEU B HD11   1 
ATOM   2529 H  HD12   . LEU B 1 8   ? -28.089 51.762  45.457  1.00 39.64  ? 8   LEU B HD12   1 
ATOM   2530 H  HD13   . LEU B 1 8   ? -27.713 53.246  45.883  1.00 39.64  ? 8   LEU B HD13   1 
ATOM   2531 H  HD21   . LEU B 1 8   ? -30.425 54.095  46.694  1.00 23.65  ? 8   LEU B HD21   1 
ATOM   2532 H  HD22   . LEU B 1 8   ? -29.483 55.018  45.809  1.00 23.65  ? 8   LEU B HD22   1 
ATOM   2533 H  HD23   . LEU B 1 8   ? -30.937 54.641  45.293  1.00 23.65  ? 8   LEU B HD23   1 
ATOM   2534 N  N      . THR B 1 9   ? -29.348 55.332  41.175  1.00 35.36  ? 9   THR B N      1 
ATOM   2535 C  CA     . THR B 1 9   ? -28.633 55.765  39.988  1.00 30.75  ? 9   THR B CA     1 
ATOM   2536 C  C      . THR B 1 9   ? -27.229 55.163  39.982  1.00 24.05  ? 9   THR B C      1 
ATOM   2537 O  O      . THR B 1 9   ? -26.741 54.642  40.987  1.00 29.73  ? 9   THR B O      1 
ATOM   2538 C  CB     . THR B 1 9   ? -28.558 57.289  39.929  1.00 30.75  ? 9   THR B CB     1 
ATOM   2539 O  OG1    . THR B 1 9   ? -27.782 57.776  41.030  1.00 48.82  ? 9   THR B OG1    1 
ATOM   2540 C  CG2    . THR B 1 9   ? -29.958 57.890  40.001  1.00 43.57  ? 9   THR B CG2    1 
ATOM   2541 H  H      . THR B 1 9   ? -29.501 55.953  41.750  1.00 42.64  ? 9   THR B H      1 
ATOM   2542 H  HA     . THR B 1 9   ? -29.105 55.462  39.197  1.00 37.11  ? 9   THR B HA     1 
ATOM   2543 H  HB     . THR B 1 9   ? -28.144 57.562  39.095  1.00 37.12  ? 9   THR B HB     1 
ATOM   2544 H  HG1    . THR B 1 9   ? -27.674 58.606  40.960  1.00 58.79  ? 9   THR B HG1    1 
ATOM   2545 H  HG21   . THR B 1 9   ? -29.921 58.841  39.814  1.00 52.50  ? 9   THR B HG21   1 
ATOM   2546 H  HG22   . THR B 1 9   ? -30.536 57.463  39.349  1.00 52.50  ? 9   THR B HG22   1 
ATOM   2547 H  HG23   . THR B 1 9   ? -30.331 57.757  40.886  1.00 52.50  ? 9   THR B HG23   1 
ATOM   2548 N  N      . LYS B 1 10  ? -26.577 55.232  38.822  1.00 28.07  ? 10  LYS B N      1 
ATOM   2549 C  CA     . LYS B 1 10  ? -25.231 54.682  38.703  1.00 27.39  ? 10  LYS B CA     1 
ATOM   2550 C  C      . LYS B 1 10  ? -24.280 55.321  39.710  1.00 39.37  ? 10  LYS B C      1 
ATOM   2551 O  O      . LYS B 1 10  ? -23.519 54.625  40.391  1.00 37.10  ? 10  LYS B O      1 
ATOM   2552 C  CB     . LYS B 1 10  ? -24.720 54.865  37.272  1.00 25.34  ? 10  LYS B CB     1 
ATOM   2553 C  CG     . LYS B 1 10  ? -23.281 54.412  37.070  1.00 54.38  ? 10  LYS B CG     1 
ATOM   2554 C  CD     . LYS B 1 10  ? -22.849 54.509  35.614  1.00 59.44  ? 10  LYS B CD     1 
ATOM   2555 C  CE     . LYS B 1 10  ? -21.393 54.091  35.441  1.00 67.47  ? 10  LYS B CE     1 
ATOM   2556 N  NZ     . LYS B 1 10  ? -20.966 54.110  34.015  1.00 86.91  ? 10  LYS B NZ     1 
ATOM   2557 H  H      . LYS B 1 10  ? -26.884 55.586  38.102  1.00 33.90  ? 10  LYS B H      1 
ATOM   2558 H  HA     . LYS B 1 10  ? -25.262 53.730  38.890  1.00 33.08  ? 10  LYS B HA     1 
ATOM   2559 H  HB2    . LYS B 1 10  ? -25.280 54.348  36.673  1.00 30.62  ? 10  LYS B HB2    1 
ATOM   2560 H  HB3    . LYS B 1 10  ? -24.769 55.806  37.043  1.00 30.62  ? 10  LYS B HB3    1 
ATOM   2561 H  HG2    . LYS B 1 10  ? -22.693 54.974  37.598  1.00 65.47  ? 10  LYS B HG2    1 
ATOM   2562 H  HG3    . LYS B 1 10  ? -23.196 53.487  37.349  1.00 65.47  ? 10  LYS B HG3    1 
ATOM   2563 H  HD2    . LYS B 1 10  ? -23.402 53.923  35.074  1.00 71.55  ? 10  LYS B HD2    1 
ATOM   2564 H  HD3    . LYS B 1 10  ? -22.942 55.426  35.311  1.00 71.55  ? 10  LYS B HD3    1 
ATOM   2565 H  HE2    . LYS B 1 10  ? -20.825 54.703  35.934  1.00 81.17  ? 10  LYS B HE2    1 
ATOM   2566 H  HE3    . LYS B 1 10  ? -21.279 53.188  35.778  1.00 81.17  ? 10  LYS B HE3    1 
ATOM   2567 H  HZ1    . LYS B 1 10  ? -20.108 53.884  33.951  1.00 104.50 ? 10  LYS B HZ1    1 
ATOM   2568 H  HZ2    . LYS B 1 10  ? -21.453 53.532  33.544  1.00 104.50 ? 10  LYS B HZ2    1 
ATOM   2569 H  HZ3    . LYS B 1 10  ? -21.077 54.925  33.675  1.00 104.50 ? 10  LYS B HZ3    1 
ATOM   2570 N  N      . GLU B 1 11  ? -24.310 56.652  39.817  1.00 43.12  ? 11  GLU B N      1 
ATOM   2571 C  CA     . GLU B 1 11  ? -23.371 57.350  40.694  1.00 49.41  ? 11  GLU B CA     1 
ATOM   2572 C  C      . GLU B 1 11  ? -23.668 57.075  42.166  1.00 31.13  ? 11  GLU B C      1 
ATOM   2573 O  O      . GLU B 1 11  ? -22.739 56.899  42.968  1.00 32.67  ? 11  GLU B O      1 
ATOM   2574 C  CB     . GLU B 1 11  ? -23.401 58.845  40.398  1.00 43.17  ? 11  GLU B CB     1 
ATOM   2575 C  CG     . GLU B 1 11  ? -22.028 59.490  40.505  1.00 69.03  ? 11  GLU B CG     1 
ATOM   2576 C  CD     . GLU B 1 11  ? -21.057 58.994  39.437  1.00 64.06  ? 11  GLU B CD     1 
ATOM   2577 O  OE1    . GLU B 1 11  ? -21.497 58.259  38.527  1.00 61.49  ? 11  GLU B OE1    1 
ATOM   2578 O  OE2    . GLU B 1 11  ? -19.857 59.343  39.512  1.00 44.11  ? 11  GLU B OE2    1 
ATOM   2579 H  H      . GLU B 1 11  ? -24.855 57.169  39.398  1.00 51.96  ? 11  GLU B H      1 
ATOM   2580 H  HA     . GLU B 1 11  ? -22.474 57.027  40.515  1.00 59.50  ? 11  GLU B HA     1 
ATOM   2581 H  HB2    . GLU B 1 11  ? -23.728 58.981  39.495  1.00 52.02  ? 11  GLU B HB2    1 
ATOM   2582 H  HB3    . GLU B 1 11  ? -23.989 59.281  41.033  1.00 52.02  ? 11  GLU B HB3    1 
ATOM   2583 H  HG2    . GLU B 1 11  ? -22.121 60.450  40.402  1.00 83.06  ? 11  GLU B HG2    1 
ATOM   2584 H  HG3    . GLU B 1 11  ? -21.649 59.285  41.374  1.00 83.06  ? 11  GLU B HG3    1 
ATOM   2585 N  N      . GLN B 1 12  ? -24.947 57.085  42.554  1.00 19.32  ? 12  GLN B N      1 
ATOM   2586 C  CA     . GLN B 1 12  ? -25.297 56.730  43.925  1.00 32.64  ? 12  GLN B CA     1 
ATOM   2587 C  C      . GLN B 1 12  ? -24.800 55.332  44.256  1.00 32.92  ? 12  GLN B C      1 
ATOM   2588 O  O      . GLN B 1 12  ? -24.265 55.090  45.348  1.00 35.92  ? 12  GLN B O      1 
ATOM   2589 C  CB     . GLN B 1 12  ? -26.810 56.802  44.125  1.00 20.44  ? 12  GLN B CB     1 
ATOM   2590 C  CG     . GLN B 1 12  ? -27.388 58.194  44.018  1.00 36.25  ? 12  GLN B CG     1 
ATOM   2591 C  CD     . GLN B 1 12  ? -28.903 58.196  44.043  1.00 34.27  ? 12  GLN B CD     1 
ATOM   2592 O  OE1    . GLN B 1 12  ? -29.545 57.241  43.600  1.00 30.99  ? 12  GLN B OE1    1 
ATOM   2593 N  NE2    . GLN B 1 12  ? -29.483 59.263  44.579  1.00 44.20  ? 12  GLN B NE2    1 
ATOM   2594 H  H      . GLN B 1 12  ? -25.615 57.288  42.053  1.00 23.40  ? 12  GLN B H      1 
ATOM   2595 H  HA     . GLN B 1 12  ? -24.884 57.367  44.528  1.00 39.39  ? 12  GLN B HA     1 
ATOM   2596 H  HB2    . GLN B 1 12  ? -27.238 56.254  43.449  1.00 24.75  ? 12  GLN B HB2    1 
ATOM   2597 H  HB3    . GLN B 1 12  ? -27.022 56.464  45.010  1.00 24.75  ? 12  GLN B HB3    1 
ATOM   2598 H  HG2    . GLN B 1 12  ? -27.074 58.727  44.766  1.00 43.71  ? 12  GLN B HG2    1 
ATOM   2599 H  HG3    . GLN B 1 12  ? -27.101 58.594  43.182  1.00 43.71  ? 12  GLN B HG3    1 
ATOM   2600 H  HE21   . GLN B 1 12  ? -29.001 59.905  44.887  1.00 53.25  ? 12  GLN B HE21   1 
ATOM   2601 H  HE22   . GLN B 1 12  ? -30.341 59.313  44.617  1.00 53.25  ? 12  GLN B HE22   1 
ATOM   2602 N  N      . HIS B 1 13  ? -24.978 54.397  43.322  1.00 36.22  ? 13  HIS B N      1 
ATOM   2603 C  CA     . HIS B 1 13  ? -24.537 53.032  43.556  1.00 28.85  ? 13  HIS B CA     1 
ATOM   2604 C  C      . HIS B 1 13  ? -23.022 52.977  43.698  1.00 22.64  ? 13  HIS B C      1 
ATOM   2605 O  O      . HIS B 1 13  ? -22.505 52.281  44.572  1.00 25.82  ? 13  HIS B O      1 
ATOM   2606 C  CB     . HIS B 1 13  ? -25.009 52.127  42.419  1.00 33.05  ? 13  HIS B CB     1 
ATOM   2607 C  CG     . HIS B 1 13  ? -24.692 50.679  42.626  1.00 35.03  ? 13  HIS B CG     1 
ATOM   2608 N  ND1    . HIS B 1 13  ? -23.474 50.124  42.296  1.00 20.06  ? 13  HIS B ND1    1 
ATOM   2609 C  CD2    . HIS B 1 13  ? -25.445 49.667  43.120  1.00 16.18  ? 13  HIS B CD2    1 
ATOM   2610 C  CE1    . HIS B 1 13  ? -23.489 48.834  42.584  1.00 31.45  ? 13  HIS B CE1    1 
ATOM   2611 N  NE2    . HIS B 1 13  ? -24.673 48.532  43.085  1.00 42.18  ? 13  HIS B NE2    1 
ATOM   2612 H  H      . HIS B 1 13  ? -25.347 54.527  42.556  1.00 43.68  ? 13  HIS B H      1 
ATOM   2613 H  HA     . HIS B 1 13  ? -24.932 52.702  44.377  1.00 34.84  ? 13  HIS B HA     1 
ATOM   2614 H  HB2    . HIS B 1 13  ? -25.972 52.210  42.335  1.00 39.87  ? 13  HIS B HB2    1 
ATOM   2615 H  HB3    . HIS B 1 13  ? -24.579 52.409  41.597  1.00 39.87  ? 13  HIS B HB3    1 
ATOM   2616 H  HD2    . HIS B 1 13  ? -26.321 49.730  43.426  1.00 19.64  ? 13  HIS B HD2    1 
ATOM   2617 H  HE1    . HIS B 1 13  ? -22.785 48.240  42.456  1.00 37.96  ? 13  HIS B HE1    1 
ATOM   2618 H  HE2    . HIS B 1 13  ? -24.921 47.751  43.346  1.00 50.83  ? 13  HIS B HE2    1 
ATOM   2619 N  N      . GLU B 1 14  ? -22.293 53.710  42.852  1.00 20.30  ? 14  GLU B N      1 
ATOM   2620 C  CA     . GLU B 1 14  ? -20.835 53.712  42.944  1.00 23.64  ? 14  GLU B CA     1 
ATOM   2621 C  C      . GLU B 1 14  ? -20.377 54.237  44.298  1.00 20.73  ? 14  GLU B C      1 
ATOM   2622 O  O      . GLU B 1 14  ? -19.479 53.664  44.931  1.00 38.89  ? 14  GLU B O      1 
ATOM   2623 C  CB     . GLU B 1 14  ? -20.236 54.559  41.820  1.00 33.68  ? 14  GLU B CB     1 
ATOM   2624 C  CG     . GLU B 1 14  ? -20.355 53.948  40.434  1.00 58.62  ? 14  GLU B CG     1 
ATOM   2625 C  CD     . GLU B 1 14  ? -19.822 54.865  39.342  1.00 77.24  ? 14  GLU B CD     1 
ATOM   2626 O  OE1    . GLU B 1 14  ? -19.319 55.961  39.669  1.00 60.41  ? 14  GLU B OE1    1 
ATOM   2627 O  OE2    . GLU B 1 14  ? -19.908 54.488  38.154  1.00 87.88  ? 14  GLU B OE2    1 
ATOM   2628 H  H      . GLU B 1 14  ? -22.611 54.206  42.225  1.00 24.58  ? 14  GLU B H      1 
ATOM   2629 H  HA     . GLU B 1 14  ? -20.514 52.802  42.841  1.00 28.58  ? 14  GLU B HA     1 
ATOM   2630 H  HB2    . GLU B 1 14  ? -20.693 55.415  41.803  1.00 40.63  ? 14  GLU B HB2    1 
ATOM   2631 H  HB3    . GLU B 1 14  ? -19.292 54.690  42.002  1.00 40.63  ? 14  GLU B HB3    1 
ATOM   2632 H  HG2    . GLU B 1 14  ? -19.847 53.122  40.407  1.00 70.56  ? 14  GLU B HG2    1 
ATOM   2633 H  HG3    . GLU B 1 14  ? -21.289 53.769  40.246  1.00 70.56  ? 14  GLU B HG3    1 
ATOM   2634 N  N      . TRP B 1 15  ? -20.981 55.332  44.754  1.00 21.91  ? 15  TRP B N      1 
ATOM   2635 C  CA     . TRP B 1 15  ? -20.629 55.896  46.053  1.00 30.18  ? 15  TRP B CA     1 
ATOM   2636 C  C      . TRP B 1 15  ? -20.870 54.888  47.170  1.00 29.01  ? 15  TRP B C      1 
ATOM   2637 O  O      . TRP B 1 15  ? -19.967 54.584  47.968  1.00 26.25  ? 15  TRP B O      1 
ATOM   2638 C  CB     . TRP B 1 15  ? -21.447 57.167  46.284  1.00 24.96  ? 15  TRP B CB     1 
ATOM   2639 C  CG     . TRP B 1 15  ? -21.307 57.777  47.635  1.00 20.06  ? 15  TRP B CG     1 
ATOM   2640 C  CD1    . TRP B 1 15  ? -20.336 58.639  48.047  1.00 27.10  ? 15  TRP B CD1    1 
ATOM   2641 C  CD2    . TRP B 1 15  ? -22.173 57.582  48.756  1.00 19.14  ? 15  TRP B CD2    1 
ATOM   2642 N  NE1    . TRP B 1 15  ? -20.544 58.995  49.356  1.00 20.60  ? 15  TRP B NE1    1 
ATOM   2643 C  CE2    . TRP B 1 15  ? -21.666 58.358  49.815  1.00 13.70  ? 15  TRP B CE2    1 
ATOM   2644 C  CE3    . TRP B 1 15  ? -23.328 56.826  48.968  1.00 24.24  ? 15  TRP B CE3    1 
ATOM   2645 C  CZ2    . TRP B 1 15  ? -22.270 58.398  51.067  1.00 18.97  ? 15  TRP B CZ2    1 
ATOM   2646 C  CZ3    . TRP B 1 15  ? -23.931 56.869  50.216  1.00 24.01  ? 15  TRP B CZ3    1 
ATOM   2647 C  CH2    . TRP B 1 15  ? -23.400 57.649  51.248  1.00 20.35  ? 15  TRP B CH2    1 
ATOM   2648 H  H      . TRP B 1 15  ? -21.595 55.766  44.336  1.00 26.51  ? 15  TRP B H      1 
ATOM   2649 H  HA     . TRP B 1 15  ? -19.687 56.128  46.062  1.00 36.43  ? 15  TRP B HA     1 
ATOM   2650 H  HB2    . TRP B 1 15  ? -21.169 57.833  45.636  1.00 30.17  ? 15  TRP B HB2    1 
ATOM   2651 H  HB3    . TRP B 1 15  ? -22.385 56.954  46.159  1.00 30.17  ? 15  TRP B HB3    1 
ATOM   2652 H  HD1    . TRP B 1 15  ? -19.634 58.942  47.518  1.00 32.74  ? 15  TRP B HD1    1 
ATOM   2653 H  HE1    . TRP B 1 15  ? -20.050 59.531  49.813  1.00 24.93  ? 15  TRP B HE1    1 
ATOM   2654 H  HE3    . TRP B 1 15  ? -23.686 56.305  48.286  1.00 29.31  ? 15  TRP B HE3    1 
ATOM   2655 H  HZ2    . TRP B 1 15  ? -21.919 58.914  51.756  1.00 22.98  ? 15  TRP B HZ2    1 
ATOM   2656 H  HZ3    . TRP B 1 15  ? -24.701 56.371  50.369  1.00 29.03  ? 15  TRP B HZ3    1 
ATOM   2657 H  HH2    . TRP B 1 15  ? -23.825 57.659  52.075  1.00 24.64  ? 15  TRP B HH2    1 
ATOM   2658 N  N      . LEU B 1 16  ? -22.093 54.353  47.237  1.00 29.88  ? 16  LEU B N      1 
ATOM   2659 C  CA     . LEU B 1 16  ? -22.425 53.395  48.283  1.00 18.49  ? 16  LEU B CA     1 
ATOM   2660 C  C      . LEU B 1 16  ? -21.556 52.151  48.202  1.00 18.64  ? 16  LEU B C      1 
ATOM   2661 O  O      . LEU B 1 16  ? -21.169 51.595  49.233  1.00 29.95  ? 16  LEU B O      1 
ATOM   2662 C  CB     . LEU B 1 16  ? -23.900 53.013  48.191  1.00 14.31  ? 16  LEU B CB     1 
ATOM   2663 C  CG     . LEU B 1 16  ? -24.403 51.996  49.212  1.00 15.01  ? 16  LEU B CG     1 
ATOM   2664 C  CD1    . LEU B 1 16  ? -24.065 52.439  50.622  1.00 13.91  ? 16  LEU B CD1    1 
ATOM   2665 C  CD2    . LEU B 1 16  ? -25.906 51.800  49.054  1.00 19.71  ? 16  LEU B CD2    1 
ATOM   2666 H  H      . LEU B 1 16  ? -22.738 54.527  46.696  1.00 36.07  ? 16  LEU B H      1 
ATOM   2667 H  HA     . LEU B 1 16  ? -22.267 53.815  49.144  1.00 22.40  ? 16  LEU B HA     1 
ATOM   2668 H  HB2    . LEU B 1 16  ? -24.427 53.819  48.307  1.00 17.39  ? 16  LEU B HB2    1 
ATOM   2669 H  HB3    . LEU B 1 16  ? -24.058 52.637  47.311  1.00 17.39  ? 16  LEU B HB3    1 
ATOM   2670 H  HG     . LEU B 1 16  ? -23.965 51.145  49.058  1.00 18.23  ? 16  LEU B HG     1 
ATOM   2671 H  HD11   . LEU B 1 16  ? -24.506 51.849  51.253  1.00 16.91  ? 16  LEU B HD11   1 
ATOM   2672 H  HD12   . LEU B 1 16  ? -23.104 52.397  50.745  1.00 16.91  ? 16  LEU B HD12   1 
ATOM   2673 H  HD13   . LEU B 1 16  ? -24.375 53.350  50.749  1.00 16.91  ? 16  LEU B HD13   1 
ATOM   2674 H  HD21   . LEU B 1 16  ? -26.208 51.140  49.698  1.00 23.87  ? 16  LEU B HD21   1 
ATOM   2675 H  HD22   . LEU B 1 16  ? -26.354 52.646  49.214  1.00 23.87  ? 16  LEU B HD22   1 
ATOM   2676 H  HD23   . LEU B 1 16  ? -26.092 51.492  48.154  1.00 23.87  ? 16  LEU B HD23   1 
ATOM   2677 N  N      . ASN B 1 17  ? -21.210 51.715  46.991  1.00 26.86  ? 17  ASN B N      1 
ATOM   2678 C  CA     . ASN B 1 17  ? -20.428 50.498  46.836  1.00 27.43  ? 17  ASN B CA     1 
ATOM   2679 C  C      . ASN B 1 17  ? -19.001 50.718  47.314  1.00 19.97  ? 17  ASN B C      1 
ATOM   2680 O  O      . ASN B 1 17  ? -18.413 49.840  47.952  1.00 29.32  ? 17  ASN B O      1 
ATOM   2681 C  CB     . ASN B 1 17  ? -20.448 50.051  45.373  1.00 25.74  ? 17  ASN B CB     1 
ATOM   2682 C  CG     . ASN B 1 17  ? -19.736 48.737  45.154  1.00 28.58  ? 17  ASN B CG     1 
ATOM   2683 O  OD1    . ASN B 1 17  ? -20.343 47.672  45.258  1.00 42.42  ? 17  ASN B OD1    1 
ATOM   2684 N  ND2    . ASN B 1 17  ? -18.442 48.800  44.872  1.00 44.71  ? 17  ASN B ND2    1 
ATOM   2685 H  H      . ASN B 1 17  ? -21.414 52.102  46.250  1.00 32.45  ? 17  ASN B H      1 
ATOM   2686 H  HA     . ASN B 1 17  ? -20.821 49.789  47.369  1.00 33.14  ? 17  ASN B HA     1 
ATOM   2687 H  HB2    . ASN B 1 17  ? -21.369 49.943  45.088  1.00 31.10  ? 17  ASN B HB2    1 
ATOM   2688 H  HB3    . ASN B 1 17  ? -20.010 50.724  44.830  1.00 31.10  ? 17  ASN B HB3    1 
ATOM   2689 H  HD21   . ASN B 1 17  ? -17.995 48.077  44.740  1.00 53.87  ? 17  ASN B HD21   1 
ATOM   2690 H  HD22   . ASN B 1 17  ? -18.049 49.564  44.822  1.00 53.87  ? 17  ASN B HD22   1 
ATOM   2691 N  N      . GLY B 1 18  ? -18.428 51.884  47.017  1.00 20.41  ? 18  GLY B N      1 
ATOM   2692 C  CA     . GLY B 1 18  ? -17.116 52.203  47.555  1.00 24.73  ? 18  GLY B CA     1 
ATOM   2693 C  C      . GLY B 1 18  ? -17.119 52.240  49.069  1.00 24.81  ? 18  GLY B C      1 
ATOM   2694 O  O      . GLY B 1 18  ? -16.218 51.701  49.727  1.00 34.56  ? 18  GLY B O      1 
ATOM   2695 H  H      . GLY B 1 18  ? -18.770 52.495  46.518  1.00 24.71  ? 18  GLY B H      1 
ATOM   2696 H  HA2    . GLY B 1 18  ? -16.477 51.534  47.265  1.00 29.90  ? 18  GLY B HA2    1 
ATOM   2697 H  HA3    . GLY B 1 18  ? -16.835 53.072  47.227  1.00 29.90  ? 18  GLY B HA3    1 
ATOM   2698 N  N      . TRP B 1 19  ? -18.129 52.895  49.648  1.00 28.67  ? 19  TRP B N      1 
ATOM   2699 C  CA     . TRP B 1 19  ? -18.206 52.941  51.104  1.00 25.47  ? 19  TRP B CA     1 
ATOM   2700 C  C      . TRP B 1 19  ? -18.325 51.539  51.689  1.00 18.73  ? 19  TRP B C      1 
ATOM   2701 O  O      . TRP B 1 19  ? -17.641 51.209  52.664  1.00 24.62  ? 19  TRP B O      1 
ATOM   2702 C  CB     . TRP B 1 19  ? -19.370 53.819  51.553  1.00 23.46  ? 19  TRP B CB     1 
ATOM   2703 C  CG     . TRP B 1 19  ? -18.971 55.250  51.758  1.00 24.19  ? 19  TRP B CG     1 
ATOM   2704 C  CD1    . TRP B 1 19  ? -19.538 56.343  51.182  1.00 29.05  ? 19  TRP B CD1    1 
ATOM   2705 C  CD2    . TRP B 1 19  ? -17.913 55.741  52.595  1.00 27.24  ? 19  TRP B CD2    1 
ATOM   2706 N  NE1    . TRP B 1 19  ? -18.903 57.485  51.604  1.00 26.76  ? 19  TRP B NE1    1 
ATOM   2707 C  CE2    . TRP B 1 19  ? -17.902 57.142  52.472  1.00 15.15  ? 19  TRP B CE2    1 
ATOM   2708 C  CE3    . TRP B 1 19  ? -16.974 55.131  53.435  1.00 45.98  ? 19  TRP B CE3    1 
ATOM   2709 C  CZ2    . TRP B 1 19  ? -16.994 57.944  53.157  1.00 26.18  ? 19  TRP B CZ2    1 
ATOM   2710 C  CZ3    . TRP B 1 19  ? -16.070 55.932  54.114  1.00 19.77  ? 19  TRP B CZ3    1 
ATOM   2711 C  CH2    . TRP B 1 19  ? -16.089 57.321  53.971  1.00 16.97  ? 19  TRP B CH2    1 
ATOM   2712 H  H      . TRP B 1 19  ? -18.761 53.307  49.234  1.00 34.61  ? 19  TRP B H      1 
ATOM   2713 H  HA     . TRP B 1 19  ? -17.391 53.342  51.445  1.00 30.78  ? 19  TRP B HA     1 
ATOM   2714 H  HB2    . TRP B 1 19  ? -20.064 53.795  50.875  1.00 28.36  ? 19  TRP B HB2    1 
ATOM   2715 H  HB3    . TRP B 1 19  ? -19.716 53.480  52.394  1.00 28.36  ? 19  TRP B HB3    1 
ATOM   2716 H  HD1    . TRP B 1 19  ? -20.252 56.320  50.587  1.00 35.07  ? 19  TRP B HD1    1 
ATOM   2717 H  HE1    . TRP B 1 19  ? -19.103 58.286  51.362  1.00 32.32  ? 19  TRP B HE1    1 
ATOM   2718 H  HE3    . TRP B 1 19  ? -16.956 54.206  53.535  1.00 55.40  ? 19  TRP B HE3    1 
ATOM   2719 H  HZ2    . TRP B 1 19  ? -17.003 58.869  53.064  1.00 31.64  ? 19  TRP B HZ2    1 
ATOM   2720 H  HZ3    . TRP B 1 19  ? -15.441 55.538  54.674  1.00 23.94  ? 19  TRP B HZ3    1 
ATOM   2721 H  HH2    . TRP B 1 19  ? -15.472 57.835  54.440  1.00 20.58  ? 19  TRP B HH2    1 
ATOM   2722 N  N      . LEU B 1 20  ? -19.162 50.688  51.089  1.00 23.78  ? 20  LEU B N      1 
ATOM   2723 C  CA     . LEU B 1 20  ? -19.350 49.350  51.635  1.00 17.76  ? 20  LEU B CA     1 
ATOM   2724 C  C      . LEU B 1 20  ? -18.115 48.486  51.433  1.00 19.08  ? 20  LEU B C      1 
ATOM   2725 O  O      . LEU B 1 20  ? -17.828 47.628  52.266  1.00 27.97  ? 20  LEU B O      1 
ATOM   2726 C  CB     . LEU B 1 20  ? -20.560 48.662  51.002  1.00 12.57  ? 20  LEU B CB     1 
ATOM   2727 C  CG     . LEU B 1 20  ? -21.936 49.210  51.372  1.00 13.91  ? 20  LEU B CG     1 
ATOM   2728 C  CD1    . LEU B 1 20  ? -23.016 48.433  50.639  1.00 20.28  ? 20  LEU B CD1    1 
ATOM   2729 C  CD2    . LEU B 1 20  ? -22.160 49.173  52.872  1.00 14.18  ? 20  LEU B CD2    1 
ATOM   2730 H  H      . LEU B 1 20  ? -19.621 50.857  50.382  1.00 28.75  ? 20  LEU B H      1 
ATOM   2731 H  HA     . LEU B 1 20  ? -19.522 49.440  52.585  1.00 21.53  ? 20  LEU B HA     1 
ATOM   2732 H  HB2    . LEU B 1 20  ? -20.476 48.735  50.038  1.00 15.30  ? 20  LEU B HB2    1 
ATOM   2733 H  HB3    . LEU B 1 20  ? -20.546 47.729  51.267  1.00 15.30  ? 20  LEU B HB3    1 
ATOM   2734 H  HG     . LEU B 1 20  ? -21.990 50.141  51.102  1.00 16.90  ? 20  LEU B HG     1 
ATOM   2735 H  HD11   . LEU B 1 20  ? -23.884 48.793  50.880  1.00 24.56  ? 20  LEU B HD11   1 
ATOM   2736 H  HD12   . LEU B 1 20  ? -22.875 48.521  49.683  1.00 24.56  ? 20  LEU B HD12   1 
ATOM   2737 H  HD13   . LEU B 1 20  ? -22.963 47.499  50.896  1.00 24.56  ? 20  LEU B HD13   1 
ATOM   2738 H  HD21   . LEU B 1 20  ? -23.104 49.302  53.054  1.00 17.23  ? 20  LEU B HD21   1 
ATOM   2739 H  HD22   . LEU B 1 20  ? -21.872 48.312  53.213  1.00 17.23  ? 20  LEU B HD22   1 
ATOM   2740 H  HD23   . LEU B 1 20  ? -21.643 49.883  53.286  1.00 17.23  ? 20  LEU B HD23   1 
ATOM   2741 N  N      . GLU B 1 21  ? -17.366 48.701  50.352  1.00 17.45  ? 21  GLU B N      1 
ATOM   2742 C  CA     . GLU B 1 21  ? -16.122 47.963  50.158  1.00 21.86  ? 21  GLU B CA     1 
ATOM   2743 C  C      . GLU B 1 21  ? -15.108 48.324  51.238  1.00 15.04  ? 21  GLU B C      1 
ATOM   2744 O  O      . GLU B 1 21  ? -14.498 47.441  51.860  1.00 26.04  ? 21  GLU B O      1 
ATOM   2745 C  CB     . GLU B 1 21  ? -15.567 48.256  48.764  1.00 6.93   ? 21  GLU B CB     1 
ATOM   2746 C  CG     . GLU B 1 21  ? -14.656 47.184  48.202  1.00 30.64  ? 21  GLU B CG     1 
ATOM   2747 C  CD     . GLU B 1 21  ? -15.417 45.991  47.654  1.00 55.82  ? 21  GLU B CD     1 
ATOM   2748 O  OE1    . GLU B 1 21  ? -15.352 44.904  48.275  1.00 57.05  ? 21  GLU B OE1    1 
ATOM   2749 O  OE2    . GLU B 1 21  ? -16.079 46.144  46.601  1.00 25.09  ? 21  GLU B OE2    1 
ATOM   2750 H  H      . GLU B 1 21  ? -17.551 49.260  49.725  1.00 21.16  ? 21  GLU B H      1 
ATOM   2751 H  HA     . GLU B 1 21  ? -16.297 47.010  50.219  1.00 26.45  ? 21  GLU B HA     1 
ATOM   2752 H  HB2    . GLU B 1 21  ? -16.312 48.356  48.151  1.00 8.54   ? 21  GLU B HB2    1 
ATOM   2753 H  HB3    . GLU B 1 21  ? -15.057 49.080  48.803  1.00 8.54   ? 21  GLU B HB3    1 
ATOM   2754 H  HG2    . GLU B 1 21  ? -14.132 47.562  47.479  1.00 36.99  ? 21  GLU B HG2    1 
ATOM   2755 H  HG3    . GLU B 1 21  ? -14.070 46.866  48.907  1.00 36.99  ? 21  GLU B HG3    1 
ATOM   2756 N  N      . LEU B 1 22  ? -14.926 49.622  51.490  1.00 18.10  ? 22  LEU B N      1 
ATOM   2757 C  CA     . LEU B 1 22  ? -14.041 50.031  52.577  1.00 18.98  ? 22  LEU B CA     1 
ATOM   2758 C  C      . LEU B 1 22  ? -14.516 49.472  53.914  1.00 33.77  ? 22  LEU B C      1 
ATOM   2759 O  O      . LEU B 1 22  ? -13.710 48.988  54.718  1.00 31.66  ? 22  LEU B O      1 
ATOM   2760 C  CB     . LEU B 1 22  ? -13.945 51.554  52.641  1.00 25.91  ? 22  LEU B CB     1 
ATOM   2761 C  CG     . LEU B 1 22  ? -13.224 52.250  51.490  1.00 9.08   ? 22  LEU B CG     1 
ATOM   2762 C  CD1    . LEU B 1 22  ? -13.317 53.740  51.659  1.00 13.24  ? 22  LEU B CD1    1 
ATOM   2763 C  CD2    . LEU B 1 22  ? -11.770 51.827  51.432  1.00 20.47  ? 22  LEU B CD2    1 
ATOM   2764 H  H      . LEU B 1 22  ? -15.294 50.269  51.059  1.00 21.94  ? 22  LEU B H      1 
ATOM   2765 H  HA     . LEU B 1 22  ? -13.153 49.683  52.399  1.00 22.99  ? 22  LEU B HA     1 
ATOM   2766 H  HB2    . LEU B 1 22  ? -14.847 51.910  52.666  1.00 31.30  ? 22  LEU B HB2    1 
ATOM   2767 H  HB3    . LEU B 1 22  ? -13.473 51.790  53.455  1.00 31.30  ? 22  LEU B HB3    1 
ATOM   2768 H  HG     . LEU B 1 22  ? -13.645 51.998  50.653  1.00 11.11  ? 22  LEU B HG     1 
ATOM   2769 H  HD11   . LEU B 1 22  ? -12.848 54.171  50.927  1.00 16.10  ? 22  LEU B HD11   1 
ATOM   2770 H  HD12   . LEU B 1 22  ? -14.252 54.001  51.651  1.00 16.10  ? 22  LEU B HD12   1 
ATOM   2771 H  HD13   . LEU B 1 22  ? -12.911 53.988  52.504  1.00 16.10  ? 22  LEU B HD13   1 
ATOM   2772 H  HD21   . LEU B 1 22  ? -11.306 52.380  50.784  1.00 24.78  ? 22  LEU B HD21   1 
ATOM   2773 H  HD22   . LEU B 1 22  ? -11.373 51.941  52.309  1.00 24.78  ? 22  LEU B HD22   1 
ATOM   2774 H  HD23   . LEU B 1 22  ? -11.723 50.895  51.166  1.00 24.78  ? 22  LEU B HD23   1 
ATOM   2775 N  N      . TRP B 1 23  ? -15.824 49.535  54.174  1.00 37.39  ? 23  TRP B N      1 
ATOM   2776 C  CA     . TRP B 1 23  ? -16.352 49.056  55.447  1.00 31.94  ? 23  TRP B CA     1 
ATOM   2777 C  C      . TRP B 1 23  ? -16.163 47.553  55.595  1.00 23.63  ? 23  TRP B C      1 
ATOM   2778 O  O      . TRP B 1 23  ? -15.881 47.067  56.692  1.00 26.34  ? 23  TRP B O      1 
ATOM   2779 C  CB     . TRP B 1 23  ? -17.829 49.426  55.572  1.00 29.34  ? 23  TRP B CB     1 
ATOM   2780 C  CG     . TRP B 1 23  ? -18.586 48.613  56.586  1.00 29.84  ? 23  TRP B CG     1 
ATOM   2781 C  CD1    . TRP B 1 23  ? -18.625 48.815  57.935  1.00 26.70  ? 23  TRP B CD1    1 
ATOM   2782 C  CD2    . TRP B 1 23  ? -19.431 47.484  56.325  1.00 19.05  ? 23  TRP B CD2    1 
ATOM   2783 N  NE1    . TRP B 1 23  ? -19.436 47.878  58.531  1.00 19.37  ? 23  TRP B NE1    1 
ATOM   2784 C  CE2    . TRP B 1 23  ? -19.943 47.051  57.564  1.00 20.93  ? 23  TRP B CE2    1 
ATOM   2785 C  CE3    . TRP B 1 23  ? -19.801 46.797  55.166  1.00 14.58  ? 23  TRP B CE3    1 
ATOM   2786 C  CZ2    . TRP B 1 23  ? -20.804 45.960  57.676  1.00 23.76  ? 23  TRP B CZ2    1 
ATOM   2787 C  CZ3    . TRP B 1 23  ? -20.659 45.714  55.280  1.00 15.35  ? 23  TRP B CZ3    1 
ATOM   2788 C  CH2    . TRP B 1 23  ? -21.149 45.307  56.526  1.00 11.07  ? 23  TRP B CH2    1 
ATOM   2789 H  H      . TRP B 1 23  ? -16.420 49.847  53.637  1.00 45.09  ? 23  TRP B H      1 
ATOM   2790 H  HA     . TRP B 1 23  ? -15.869 49.490  56.168  1.00 38.54  ? 23  TRP B HA     1 
ATOM   2791 H  HB2    . TRP B 1 23  ? -17.894 50.357  55.834  1.00 35.42  ? 23  TRP B HB2    1 
ATOM   2792 H  HB3    . TRP B 1 23  ? -18.255 49.293  54.711  1.00 35.42  ? 23  TRP B HB3    1 
ATOM   2793 H  HD1    . TRP B 1 23  ? -18.170 49.488  58.386  1.00 32.26  ? 23  TRP B HD1    1 
ATOM   2794 H  HE1    . TRP B 1 23  ? -19.598 47.821  59.373  1.00 23.46  ? 23  TRP B HE1    1 
ATOM   2795 H  HE3    . TRP B 1 23  ? -19.479 47.061  54.335  1.00 17.71  ? 23  TRP B HE3    1 
ATOM   2796 H  HZ2    . TRP B 1 23  ? -21.131 45.687  58.502  1.00 28.73  ? 23  TRP B HZ2    1 
ATOM   2797 H  HZ3    . TRP B 1 23  ? -20.912 45.250  54.515  1.00 18.64  ? 23  TRP B HZ3    1 
ATOM   2798 H  HH2    . TRP B 1 23  ? -21.722 44.576  56.572  1.00 13.50  ? 23  TRP B HH2    1 
ATOM   2799 N  N      . GLY B 1 24  ? -16.327 46.801  54.506  1.00 23.00  ? 24  GLY B N      1 
ATOM   2800 C  CA     . GLY B 1 24  ? -16.129 45.365  54.569  1.00 24.62  ? 24  GLY B CA     1 
ATOM   2801 C  C      . GLY B 1 24  ? -14.685 45.001  54.830  1.00 25.44  ? 24  GLY B C      1 
ATOM   2802 O  O      . GLY B 1 24  ? -14.398 44.067  55.583  1.00 26.85  ? 24  GLY B O      1 
ATOM   2803 H  H      . GLY B 1 24  ? -16.550 47.096  53.730  1.00 27.82  ? 24  GLY B H      1 
ATOM   2804 H  HA2    . GLY B 1 24  ? -16.673 44.996  55.283  1.00 29.76  ? 24  GLY B HA2    1 
ATOM   2805 H  HA3    . GLY B 1 24  ? -16.400 44.966  53.728  1.00 29.76  ? 24  GLY B HA3    1 
ATOM   2806 N  N      . ALA B 1 25  ? -13.754 45.716  54.194  1.00 45.66  ? 25  ALA B N      1 
ATOM   2807 C  CA     . ALA B 1 25  ? -12.344 45.519  54.516  1.00 26.96  ? 25  ALA B CA     1 
ATOM   2808 C  C      . ALA B 1 25  ? -12.075 45.836  55.983  1.00 22.67  ? 25  ALA B C      1 
ATOM   2809 O  O      . ALA B 1 25  ? -11.361 45.096  56.668  1.00 26.05  ? 25  ALA B O      1 
ATOM   2810 C  CB     . ALA B 1 25  ? -11.471 46.383  53.609  1.00 29.17  ? 25  ALA B CB     1 
ATOM   2811 H  H      . ALA B 1 25  ? -13.907 46.306  53.588  1.00 55.00  ? 25  ALA B H      1 
ATOM   2812 H  HA     . ALA B 1 25  ? -12.109 44.592  54.357  1.00 32.57  ? 25  ALA B HA     1 
ATOM   2813 H  HB1    . ALA B 1 25  ? -10.540 46.241  53.838  1.00 35.23  ? 25  ALA B HB1    1 
ATOM   2814 H  HB2    . ALA B 1 25  ? -11.628 46.130  52.686  1.00 35.23  ? 25  ALA B HB2    1 
ATOM   2815 H  HB3    . ALA B 1 25  ? -11.706 47.315  53.740  1.00 35.23  ? 25  ALA B HB3    1 
ATOM   2816 N  N      . TRP B 1 26  ? -12.661 46.922  56.488  1.00 30.61  ? 26  TRP B N      1 
ATOM   2817 C  CA     . TRP B 1 26  ? -12.459 47.297  57.884  1.00 30.94  ? 26  TRP B CA     1 
ATOM   2818 C  C      . TRP B 1 26  ? -13.008 46.234  58.829  1.00 33.42  ? 26  TRP B C      1 
ATOM   2819 O  O      . TRP B 1 26  ? -12.369 45.890  59.831  1.00 28.83  ? 26  TRP B O      1 
ATOM   2820 C  CB     . TRP B 1 26  ? -13.129 48.646  58.142  1.00 28.36  ? 26  TRP B CB     1 
ATOM   2821 C  CG     . TRP B 1 26  ? -13.059 49.132  59.551  1.00 24.97  ? 26  TRP B CG     1 
ATOM   2822 C  CD1    . TRP B 1 26  ? -11.993 49.717  60.169  1.00 29.00  ? 26  TRP B CD1    1 
ATOM   2823 C  CD2    . TRP B 1 26  ? -14.112 49.091  60.517  1.00 29.87  ? 26  TRP B CD2    1 
ATOM   2824 N  NE1    . TRP B 1 26  ? -12.318 50.042  61.464  1.00 25.03  ? 26  TRP B NE1    1 
ATOM   2825 C  CE2    . TRP B 1 26  ? -13.614 49.667  61.702  1.00 31.77  ? 26  TRP B CE2    1 
ATOM   2826 C  CE3    . TRP B 1 26  ? -15.429 48.621  60.496  1.00 30.40  ? 26  TRP B CE3    1 
ATOM   2827 C  CZ2    . TRP B 1 26  ? -14.385 49.782  62.854  1.00 32.19  ? 26  TRP B CZ2    1 
ATOM   2828 C  CZ3    . TRP B 1 26  ? -16.192 48.739  61.640  1.00 30.08  ? 26  TRP B CZ3    1 
ATOM   2829 C  CH2    . TRP B 1 26  ? -15.669 49.314  62.803  1.00 29.09  ? 26  TRP B CH2    1 
ATOM   2830 H  H      . TRP B 1 26  ? -13.176 47.454  56.050  1.00 36.94  ? 26  TRP B H      1 
ATOM   2831 H  HA     . TRP B 1 26  ? -11.510 47.383  58.061  1.00 37.35  ? 26  TRP B HA     1 
ATOM   2832 H  HB2    . TRP B 1 26  ? -12.698 49.312  57.584  1.00 34.25  ? 26  TRP B HB2    1 
ATOM   2833 H  HB3    . TRP B 1 26  ? -14.067 48.572  57.907  1.00 34.25  ? 26  TRP B HB3    1 
ATOM   2834 H  HD1    . TRP B 1 26  ? -11.167 49.873  59.772  1.00 35.02  ? 26  TRP B HD1    1 
ATOM   2835 H  HE1    . TRP B 1 26  ? -11.794 50.419  62.031  1.00 30.25  ? 26  TRP B HE1    1 
ATOM   2836 H  HE3    . TRP B 1 26  ? -15.783 48.238  59.727  1.00 36.69  ? 26  TRP B HE3    1 
ATOM   2837 H  HZ2    . TRP B 1 26  ? -14.041 50.164  63.629  1.00 38.84  ? 26  TRP B HZ2    1 
ATOM   2838 H  HZ3    . TRP B 1 26  ? -17.070 48.430  61.637  1.00 36.32  ? 26  TRP B HZ3    1 
ATOM   2839 H  HH2    . TRP B 1 26  ? -16.207 49.379  63.559  1.00 35.12  ? 26  TRP B HH2    1 
ATOM   2840 N  N      . VAL B 1 27  ? -14.189 45.698  58.523  1.00 39.23  ? 27  VAL B N      1 
ATOM   2841 C  CA     . VAL B 1 27  ? -14.806 44.694  59.383  1.00 36.06  ? 27  VAL B CA     1 
ATOM   2842 C  C      . VAL B 1 27  ? -14.023 43.392  59.336  1.00 31.38  ? 27  VAL B C      1 
ATOM   2843 O  O      . VAL B 1 27  ? -13.838 42.726  60.362  1.00 36.53  ? 27  VAL B O      1 
ATOM   2844 C  CB     . VAL B 1 27  ? -16.276 44.484  58.980  1.00 22.94  ? 27  VAL B CB     1 
ATOM   2845 C  CG1    . VAL B 1 27  ? -16.798 43.180  59.555  1.00 26.26  ? 27  VAL B CG1    1 
ATOM   2846 C  CG2    . VAL B 1 27  ? -17.118 45.656  59.459  1.00 24.93  ? 27  VAL B CG2    1 
ATOM   2847 H  H      . VAL B 1 27  ? -14.652 45.896  57.826  1.00 47.29  ? 27  VAL B H      1 
ATOM   2848 H  HA     . VAL B 1 27  ? -14.786 45.020  60.296  1.00 43.49  ? 27  VAL B HA     1 
ATOM   2849 H  HB     . VAL B 1 27  ? -16.341 44.435  58.014  1.00 27.75  ? 27  VAL B HB     1 
ATOM   2850 H  HG11   . VAL B 1 27  ? -17.768 43.196  59.543  1.00 31.73  ? 27  VAL B HG11   1 
ATOM   2851 H  HG12   . VAL B 1 27  ? -16.473 42.444  59.013  1.00 31.73  ? 27  VAL B HG12   1 
ATOM   2852 H  HG13   . VAL B 1 27  ? -16.479 43.087  60.466  1.00 31.73  ? 27  VAL B HG13   1 
ATOM   2853 H  HG21   . VAL B 1 27  ? -18.044 45.499  59.218  1.00 30.13  ? 27  VAL B HG21   1 
ATOM   2854 H  HG22   . VAL B 1 27  ? -17.036 45.731  60.423  1.00 30.13  ? 27  VAL B HG22   1 
ATOM   2855 H  HG23   . VAL B 1 27  ? -16.799 46.468  59.036  1.00 30.13  ? 27  VAL B HG23   1 
ATOM   2856 N  N      . TYR B 1 28  ? -13.567 42.996  58.148  1.00 35.56  ? 28  TYR B N      1 
ATOM   2857 C  CA     . TYR B 1 28  ? -12.845 41.740  58.025  1.00 24.74  ? 28  TYR B CA     1 
ATOM   2858 C  C      . TYR B 1 28  ? -11.552 41.772  58.827  1.00 28.07  ? 28  TYR B C      1 
ATOM   2859 O  O      . TYR B 1 28  ? -11.059 40.715  59.229  1.00 37.27  ? 28  TYR B O      1 
ATOM   2860 C  CB     . TYR B 1 28  ? -12.556 41.452  56.553  1.00 29.37  ? 28  TYR B CB     1 
ATOM   2861 C  CG     . TYR B 1 28  ? -12.338 39.992  56.239  1.00 35.64  ? 28  TYR B CG     1 
ATOM   2862 C  CD1    . TYR B 1 28  ? -13.416 39.121  56.170  1.00 42.63  ? 28  TYR B CD1    1 
ATOM   2863 C  CD2    . TYR B 1 28  ? -11.069 39.485  56.002  1.00 46.25  ? 28  TYR B CD2    1 
ATOM   2864 C  CE1    . TYR B 1 28  ? -13.241 37.787  55.878  1.00 39.60  ? 28  TYR B CE1    1 
ATOM   2865 C  CE2    . TYR B 1 28  ? -10.882 38.145  55.709  1.00 61.16  ? 28  TYR B CE2    1 
ATOM   2866 C  CZ     . TYR B 1 28  ? -11.975 37.302  55.648  1.00 49.58  ? 28  TYR B CZ     1 
ATOM   2867 O  OH     . TYR B 1 28  ? -11.806 35.968  55.358  1.00 68.58  ? 28  TYR B OH     1 
ATOM   2868 H  H      . TYR B 1 28  ? -13.661 43.430  57.412  1.00 42.89  ? 28  TYR B H      1 
ATOM   2869 H  HA     . TYR B 1 28  ? -13.390 41.012  58.361  1.00 29.90  ? 28  TYR B HA     1 
ATOM   2870 H  HB2    . TYR B 1 28  ? -13.309 41.758  56.024  1.00 35.46  ? 28  TYR B HB2    1 
ATOM   2871 H  HB3    . TYR B 1 28  ? -11.753 41.932  56.295  1.00 35.46  ? 28  TYR B HB3    1 
ATOM   2872 H  HD1    . TYR B 1 28  ? -14.274 39.445  56.323  1.00 51.37  ? 28  TYR B HD1    1 
ATOM   2873 H  HD2    . TYR B 1 28  ? -10.333 40.052  56.041  1.00 55.71  ? 28  TYR B HD2    1 
ATOM   2874 H  HE1    . TYR B 1 28  ? -13.974 37.217  55.837  1.00 47.74  ? 28  TYR B HE1    1 
ATOM   2875 H  HE2    . TYR B 1 28  ? -10.027 37.814  55.553  1.00 73.61  ? 28  TYR B HE2    1 
ATOM   2876 H  HH     . TYR B 1 28  ? -10.994 35.804  55.224  1.00 82.51  ? 28  TYR B HH     1 
ATOM   2877 N  N      . SER B 1 29  ? -11.003 42.962  59.080  1.00 33.14  ? 29  SER B N      1 
ATOM   2878 C  CA     . SER B 1 29  ? -9.802  43.101  59.893  1.00 33.45  ? 29  SER B CA     1 
ATOM   2879 C  C      . SER B 1 29  ? -10.091 42.960  61.381  1.00 28.86  ? 29  SER B C      1 
ATOM   2880 O  O      . SER B 1 29  ? -9.147  42.886  62.175  1.00 29.31  ? 29  SER B O      1 
ATOM   2881 C  CB     . SER B 1 29  ? -9.126  44.448  59.612  1.00 28.59  ? 29  SER B CB     1 
ATOM   2882 O  OG     . SER B 1 29  ? -9.964  45.531  59.972  1.00 41.41  ? 29  SER B OG     1 
ATOM   2883 H  H      . SER B 1 29  ? -11.312 43.710  58.788  1.00 39.99  ? 29  SER B H      1 
ATOM   2884 H  HA     . SER B 1 29  ? -9.170  42.407  59.646  1.00 40.36  ? 29  SER B HA     1 
ATOM   2885 H  HB2    . SER B 1 29  ? -8.307  44.501  60.128  1.00 34.52  ? 29  SER B HB2    1 
ATOM   2886 H  HB3    . SER B 1 29  ? -8.926  44.507  58.665  1.00 34.52  ? 29  SER B HB3    1 
ATOM   2887 H  HG     . SER B 1 29  ? -10.599 45.597  59.425  1.00 49.91  ? 29  SER B HG     1 
ATOM   2888 N  N      . GLY B 1 30  ? -11.361 42.938  61.777  1.00 32.11  ? 30  GLY B N      1 
ATOM   2889 C  CA     . GLY B 1 30  ? -11.708 42.700  63.162  1.00 28.74  ? 30  GLY B CA     1 
ATOM   2890 C  C      . GLY B 1 30  ? -11.662 43.903  64.070  1.00 24.97  ? 30  GLY B C      1 
ATOM   2891 O  O      . GLY B 1 30  ? -11.450 43.747  65.276  1.00 44.75  ? 30  GLY B O      1 
ATOM   2892 H  H      . GLY B 1 30  ? -12.037 43.058  61.259  1.00 38.75  ? 30  GLY B H      1 
ATOM   2893 H  HA2    . GLY B 1 30  ? -12.611 42.345  63.194  1.00 34.70  ? 30  GLY B HA2    1 
ATOM   2894 H  HA3    . GLY B 1 30  ? -11.096 42.039  63.522  1.00 34.70  ? 30  GLY B HA3    1 
ATOM   2895 N  N      . ARG B 1 31  ? -11.854 45.102  63.538  1.00 27.30  ? 31  ARG B N      1 
ATOM   2896 C  CA     . ARG B 1 31  ? -11.837 46.292  64.374  1.00 21.87  ? 31  ARG B CA     1 
ATOM   2897 C  C      . ARG B 1 31  ? -13.216 46.647  64.915  1.00 30.89  ? 31  ARG B C      1 
ATOM   2898 O  O      . ARG B 1 31  ? -13.358 47.683  65.575  1.00 30.02  ? 31  ARG B O      1 
ATOM   2899 C  CB     . ARG B 1 31  ? -11.261 47.481  63.606  1.00 26.01  ? 31  ARG B CB     1 
ATOM   2900 C  CG     . ARG B 1 31  ? -9.827  47.260  63.180  1.00 35.12  ? 31  ARG B CG     1 
ATOM   2901 C  CD     . ARG B 1 31  ? -9.241  48.472  62.501  1.00 21.70  ? 31  ARG B CD     1 
ATOM   2902 N  NE     . ARG B 1 31  ? -8.993  49.522  63.485  1.00 14.25  ? 31  ARG B NE     1 
ATOM   2903 C  CZ     . ARG B 1 31  ? -7.878  49.617  64.207  1.00 26.06  ? 31  ARG B CZ     1 
ATOM   2904 N  NH1    . ARG B 1 31  ? -6.909  48.719  64.070  1.00 19.69  ? 31  ARG B NH1    1 
ATOM   2905 N  NH2    . ARG B 1 31  ? -7.735  50.606  65.078  1.00 22.77  ? 31  ARG B NH2    1 
ATOM   2906 H  H      . ARG B 1 31  ? -11.996 45.250  62.702  1.00 32.98  ? 31  ARG B H      1 
ATOM   2907 H  HA     . ARG B 1 31  ? -11.252 46.127  65.130  1.00 26.46  ? 31  ARG B HA     1 
ATOM   2908 H  HB2    . ARG B 1 31  ? -11.792 47.629  62.808  1.00 31.43  ? 31  ARG B HB2    1 
ATOM   2909 H  HB3    . ARG B 1 31  ? -11.289 48.267  64.174  1.00 31.43  ? 31  ARG B HB3    1 
ATOM   2910 H  HG2    . ARG B 1 31  ? -9.289  47.063  63.963  1.00 42.36  ? 31  ARG B HG2    1 
ATOM   2911 H  HG3    . ARG B 1 31  ? -9.791  46.518  62.557  1.00 42.36  ? 31  ARG B HG3    1 
ATOM   2912 H  HD2    . ARG B 1 31  ? -8.400  48.235  62.079  1.00 26.25  ? 31  ARG B HD2    1 
ATOM   2913 H  HD3    . ARG B 1 31  ? -9.863  48.808  61.837  1.00 26.25  ? 31  ARG B HD3    1 
ATOM   2914 H  HE     . ARG B 1 31  ? -9.604  50.115  63.606  1.00 17.32  ? 31  ARG B HE     1 
ATOM   2915 H  HH11   . ARG B 1 31  ? -6.999  48.071  63.511  1.00 23.84  ? 31  ARG B HH11   1 
ATOM   2916 H  HH12   . ARG B 1 31  ? -6.191  48.786  64.539  1.00 23.84  ? 31  ARG B HH12   1 
ATOM   2917 H  HH21   . ARG B 1 31  ? -8.361  51.186  65.177  1.00 27.54  ? 31  ARG B HH21   1 
ATOM   2918 H  HH22   . ARG B 1 31  ? -7.015  50.667  65.545  1.00 27.54  ? 31  ARG B HH22   1 
ATOM   2919 N  N      . LEU B 1 32  ? -14.235 45.837  64.630  1.00 39.51  ? 32  LEU B N      1 
ATOM   2920 C  CA     . LEU B 1 32  ? -15.588 46.105  65.098  1.00 40.13  ? 32  LEU B CA     1 
ATOM   2921 C  C      . LEU B 1 32  ? -15.844 45.385  66.419  1.00 38.76  ? 32  LEU B C      1 
ATOM   2922 O  O      . LEU B 1 32  ? -15.563 44.189  66.549  1.00 25.11  ? 32  LEU B O      1 
ATOM   2923 C  CB     . LEU B 1 32  ? -16.608 45.660  64.050  1.00 25.20  ? 32  LEU B CB     1 
ATOM   2924 C  CG     . LEU B 1 32  ? -18.087 45.866  64.390  1.00 36.01  ? 32  LEU B CG     1 
ATOM   2925 C  CD1    . LEU B 1 32  ? -18.400 47.338  64.602  1.00 23.67  ? 32  LEU B CD1    1 
ATOM   2926 C  CD2    . LEU B 1 32  ? -18.973 45.280  63.308  1.00 30.48  ? 32  LEU B CD2    1 
ATOM   2927 H  H      . LEU B 1 32  ? -14.163 45.120  64.161  1.00 47.62  ? 32  LEU B H      1 
ATOM   2928 H  HA     . LEU B 1 32  ? -15.692 47.057  65.252  1.00 48.37  ? 32  LEU B HA     1 
ATOM   2929 H  HB2    . LEU B 1 32  ? -16.434 46.156  63.234  1.00 30.45  ? 32  LEU B HB2    1 
ATOM   2930 H  HB3    . LEU B 1 32  ? -16.483 44.711  63.894  1.00 30.45  ? 32  LEU B HB3    1 
ATOM   2931 H  HG     . LEU B 1 32  ? -18.279 45.401  65.219  1.00 43.43  ? 32  LEU B HG     1 
ATOM   2932 H  HD11   . LEU B 1 32  ? -19.356 47.442  64.734  1.00 28.62  ? 32  LEU B HD11   1 
ATOM   2933 H  HD12   . LEU B 1 32  ? -17.922 47.653  65.385  1.00 28.62  ? 32  LEU B HD12   1 
ATOM   2934 H  HD13   . LEU B 1 32  ? -18.119 47.837  63.819  1.00 28.62  ? 32  LEU B HD13   1 
ATOM   2935 H  HD21   . LEU B 1 32  ? -19.897 45.502  63.502  1.00 36.79  ? 32  LEU B HD21   1 
ATOM   2936 H  HD22   . LEU B 1 32  ? -18.716 45.655  62.451  1.00 36.79  ? 32  LEU B HD22   1 
ATOM   2937 H  HD23   . LEU B 1 32  ? -18.860 44.317  63.294  1.00 36.79  ? 32  LEU B HD23   1 
ATOM   2938 N  N      . GLU B 1 33  ? -16.376 46.120  67.391  1.00 41.77  ? 33  GLU B N      1 
ATOM   2939 C  CA     . GLU B 1 33  ? -16.745 45.546  68.678  1.00 32.26  ? 33  GLU B CA     1 
ATOM   2940 C  C      . GLU B 1 33  ? -17.946 44.618  68.531  1.00 35.78  ? 33  GLU B C      1 
ATOM   2941 O  O      . GLU B 1 33  ? -18.915 44.939  67.838  1.00 49.96  ? 33  GLU B O      1 
ATOM   2942 C  CB     . GLU B 1 33  ? -17.055 46.662  69.674  1.00 50.41  ? 33  GLU B CB     1 
ATOM   2943 C  CG     . GLU B 1 33  ? -15.872 47.589  69.933  1.00 63.22  ? 33  GLU B CG     1 
ATOM   2944 C  CD     . GLU B 1 33  ? -16.207 48.725  70.878  1.00 73.02  ? 33  GLU B CD     1 
ATOM   2945 O  OE1    . GLU B 1 33  ? -17.357 48.781  71.362  1.00 67.30  ? 33  GLU B OE1    1 
ATOM   2946 O  OE2    . GLU B 1 33  ? -15.318 49.565  71.133  1.00 81.44  ? 33  GLU B OE2    1 
ATOM   2947 H  H      . GLU B 1 33  ? -16.536 46.963  67.330  1.00 50.34  ? 33  GLU B H      1 
ATOM   2948 H  HA     . GLU B 1 33  ? -16.007 45.021  69.025  1.00 38.92  ? 33  GLU B HA     1 
ATOM   2949 H  HB2    . GLU B 1 33  ? -17.783 47.199  69.325  1.00 60.70  ? 33  GLU B HB2    1 
ATOM   2950 H  HB3    . GLU B 1 33  ? -17.312 46.264  70.520  1.00 60.70  ? 33  GLU B HB3    1 
ATOM   2951 H  HG2    . GLU B 1 33  ? -15.150 47.076  70.328  1.00 76.08  ? 33  GLU B HG2    1 
ATOM   2952 H  HG3    . GLU B 1 33  ? -15.583 47.975  69.092  1.00 76.08  ? 33  GLU B HG3    1 
ATOM   2953 N  N      . LYS B 1 34  ? -17.878 43.451  69.183  1.00 52.48  ? 34  LYS B N      1 
ATOM   2954 C  CA     . LYS B 1 34  ? -18.960 42.477  69.066  1.00 44.76  ? 34  LYS B CA     1 
ATOM   2955 C  C      . LYS B 1 34  ? -20.293 43.034  69.551  1.00 43.00  ? 34  LYS B C      1 
ATOM   2956 O  O      . LYS B 1 34  ? -21.349 42.608  69.071  1.00 59.17  ? 34  LYS B O      1 
ATOM   2957 C  CB     . LYS B 1 34  ? -18.630 41.200  69.844  1.00 48.66  ? 34  LYS B CB     1 
ATOM   2958 C  CG     . LYS B 1 34  ? -17.545 40.325  69.230  1.00 60.04  ? 34  LYS B CG     1 
ATOM   2959 C  CD     . LYS B 1 34  ? -17.319 39.042  70.040  1.00 72.67  ? 34  LYS B CD     1 
ATOM   2960 C  CE     . LYS B 1 34  ? -18.530 38.106  69.990  1.00 70.83  ? 34  LYS B CE     1 
ATOM   2961 N  NZ     . LYS B 1 34  ? -18.274 36.795  70.653  1.00 77.62  ? 34  LYS B NZ     1 
ATOM   2962 H  H      . LYS B 1 34  ? -17.228 43.205  69.690  1.00 63.19  ? 34  LYS B H      1 
ATOM   2963 H  HA     . LYS B 1 34  ? -19.045 42.250  68.127  1.00 53.93  ? 34  LYS B HA     1 
ATOM   2964 H  HB2    . LYS B 1 34  ? -18.331 41.451  70.732  1.00 58.60  ? 34  LYS B HB2    1 
ATOM   2965 H  HB3    . LYS B 1 34  ? -19.436 40.663  69.905  1.00 58.60  ? 34  LYS B HB3    1 
ATOM   2966 H  HG2    . LYS B 1 34  ? -17.808 40.074  68.330  1.00 72.27  ? 34  LYS B HG2    1 
ATOM   2967 H  HG3    . LYS B 1 34  ? -16.711 40.820  69.205  1.00 72.27  ? 34  LYS B HG3    1 
ATOM   2968 H  HD2    . LYS B 1 34  ? -16.555 38.567  69.678  1.00 87.42  ? 34  LYS B HD2    1 
ATOM   2969 H  HD3    . LYS B 1 34  ? -17.156 39.275  70.968  1.00 87.42  ? 34  LYS B HD3    1 
ATOM   2970 H  HE2    . LYS B 1 34  ? -19.276 38.530  70.442  1.00 85.21  ? 34  LYS B HE2    1 
ATOM   2971 H  HE3    . LYS B 1 34  ? -18.758 37.934  69.063  1.00 85.21  ? 34  LYS B HE3    1 
ATOM   2972 H  HZ1    . LYS B 1 34  ? -19.000 36.283  70.605  1.00 93.36  ? 34  LYS B HZ1    1 
ATOM   2973 H  HZ2    . LYS B 1 34  ? -17.598 36.378  70.251  1.00 93.36  ? 34  LYS B HZ2    1 
ATOM   2974 H  HZ3    . LYS B 1 34  ? -18.066 36.922  71.509  1.00 93.36  ? 34  LYS B HZ3    1 
ATOM   2975 N  N      . ARG B 1 35  ? -20.274 43.988  70.486  1.00 46.46  ? 35  ARG B N      1 
ATOM   2976 C  CA     . ARG B 1 35  ? -21.525 44.522  71.015  1.00 50.18  ? 35  ARG B CA     1 
ATOM   2977 C  C      . ARG B 1 35  ? -22.280 45.351  69.984  1.00 58.08  ? 35  ARG B C      1 
ATOM   2978 O  O      . ARG B 1 35  ? -23.481 45.587  70.157  1.00 55.01  ? 35  ARG B O      1 
ATOM   2979 C  CB     . ARG B 1 35  ? -21.253 45.379  72.254  1.00 40.97  ? 35  ARG B CB     1 
ATOM   2980 C  CG     . ARG B 1 35  ? -20.430 46.626  71.974  1.00 66.73  ? 35  ARG B CG     1 
ATOM   2981 C  CD     . ARG B 1 35  ? -20.239 47.476  73.222  1.00 87.43  ? 35  ARG B CD     1 
ATOM   2982 N  NE     . ARG B 1 35  ? -19.447 48.669  72.934  1.00 79.48  ? 35  ARG B NE     1 
ATOM   2983 C  CZ     . ARG B 1 35  ? -19.949 49.830  72.517  1.00 77.39  ? 35  ARG B CZ     1 
ATOM   2984 N  NH1    . ARG B 1 35  ? -21.256 49.979  72.338  1.00 56.34  ? 35  ARG B NH1    1 
ATOM   2985 N  NH2    . ARG B 1 35  ? -19.135 50.849  72.279  1.00 86.65  ? 35  ARG B NH2    1 
ATOM   2986 H  H      . ARG B 1 35  ? -19.564 44.336  70.823  1.00 55.97  ? 35  ARG B H      1 
ATOM   2987 H  HA     . ARG B 1 35  ? -22.087 43.777  71.280  1.00 60.43  ? 35  ARG B HA     1 
ATOM   2988 H  HB2    . ARG B 1 35  ? -22.102 45.664  72.627  1.00 49.37  ? 35  ARG B HB2    1 
ATOM   2989 H  HB3    . ARG B 1 35  ? -20.768 44.845  72.902  1.00 49.37  ? 35  ARG B HB3    1 
ATOM   2990 H  HG2    . ARG B 1 35  ? -19.554 46.364  71.649  1.00 80.30  ? 35  ARG B HG2    1 
ATOM   2991 H  HG3    . ARG B 1 35  ? -20.883 47.165  71.307  1.00 80.30  ? 35  ARG B HG3    1 
ATOM   2992 H  HD2    . ARG B 1 35  ? -21.106 47.756  73.556  1.00 105.13 ? 35  ARG B HD2    1 
ATOM   2993 H  HD3    . ARG B 1 35  ? -19.776 46.956  73.897  1.00 105.13 ? 35  ARG B HD3    1 
ATOM   2994 H  HE     . ARG B 1 35  ? -18.596 48.619  73.042  1.00 95.59  ? 35  ARG B HE     1 
ATOM   2995 H  HH11   . ARG B 1 35  ? -21.789 49.322  72.491  1.00 67.83  ? 35  ARG B HH11   1 
ATOM   2996 H  HH12   . ARG B 1 35  ? -21.570 50.734  72.068  1.00 67.83  ? 35  ARG B HH12   1 
ATOM   2997 H  HH21   . ARG B 1 35  ? -18.288 50.758  72.395  1.00 104.19 ? 35  ARG B HH21   1 
ATOM   2998 H  HH22   . ARG B 1 35  ? -19.454 51.600  72.010  1.00 104.19 ? 35  ARG B HH22   1 
ATOM   2999 N  N      . MET B 1 36  ? -21.610 45.778  68.909  1.00 52.71  ? 36  MET B N      1 
ATOM   3000 C  CA     . MET B 1 36  ? -22.232 46.634  67.909  1.00 46.72  ? 36  MET B CA     1 
ATOM   3001 C  C      . MET B 1 36  ? -23.130 45.865  66.952  1.00 43.92  ? 36  MET B C      1 
ATOM   3002 O  O      . MET B 1 36  ? -24.021 46.466  66.343  1.00 40.95  ? 36  MET B O      1 
ATOM   3003 C  CB     . MET B 1 36  ? -21.153 47.351  67.092  1.00 49.35  ? 36  MET B CB     1 
ATOM   3004 C  CG     . MET B 1 36  ? -20.458 48.521  67.777  1.00 54.57  ? 36  MET B CG     1 
ATOM   3005 S  SD     . MET B 1 36  ? -21.543 49.950  67.960  1.00 78.73  ? 36  MET B SD     1 
ATOM   3006 C  CE     . MET B 1 36  ? -20.427 51.149  68.685  1.00 76.48  ? 36  MET B CE     1 
ATOM   3007 H  H      . MET B 1 36  ? -20.789 45.584  68.739  1.00 63.46  ? 36  MET B H      1 
ATOM   3008 H  HA     . MET B 1 36  ? -22.763 47.300  68.373  1.00 56.28  ? 36  MET B HA     1 
ATOM   3009 H  HB2    . MET B 1 36  ? -20.467 46.705  66.864  1.00 59.43  ? 36  MET B HB2    1 
ATOM   3010 H  HB3    . MET B 1 36  ? -21.565 47.697  66.284  1.00 59.43  ? 36  MET B HB3    1 
ATOM   3011 H  HG2    . MET B 1 36  ? -20.170 48.245  68.662  1.00 65.70  ? 36  MET B HG2    1 
ATOM   3012 H  HG3    . MET B 1 36  ? -19.691 48.789  67.248  1.00 65.70  ? 36  MET B HG3    1 
ATOM   3013 H  HE1    . MET B 1 36  ? -20.886 51.999  68.767  1.00 91.99  ? 36  MET B HE1    1 
ATOM   3014 H  HE2    . MET B 1 36  ? -20.153 50.835  69.561  1.00 91.99  ? 36  MET B HE2    1 
ATOM   3015 H  HE3    . MET B 1 36  ? -19.651 51.245  68.111  1.00 91.99  ? 36  MET B HE3    1 
ATOM   3016 N  N      . SER B 1 37  ? -22.923 44.558  66.806  1.00 30.45  ? 37  SER B N      1 
ATOM   3017 C  CA     . SER B 1 37  ? -23.752 43.761  65.910  1.00 36.73  ? 37  SER B CA     1 
ATOM   3018 C  C      . SER B 1 37  ? -23.531 42.273  66.147  1.00 41.48  ? 37  SER B C      1 
ATOM   3019 O  O      . SER B 1 37  ? -22.418 41.770  65.967  1.00 43.83  ? 37  SER B O      1 
ATOM   3020 C  CB     . SER B 1 37  ? -23.448 44.118  64.454  1.00 35.08  ? 37  SER B CB     1 
ATOM   3021 O  OG     . SER B 1 37  ? -24.264 43.379  63.566  1.00 55.03  ? 37  SER B OG     1 
ATOM   3022 H  H      . SER B 1 37  ? -22.311 44.112  67.213  1.00 36.75  ? 37  SER B H      1 
ATOM   3023 H  HA     . SER B 1 37  ? -24.686 43.957  66.084  1.00 44.29  ? 37  SER B HA     1 
ATOM   3024 H  HB2    . SER B 1 37  ? -23.614 45.064  64.321  1.00 42.31  ? 37  SER B HB2    1 
ATOM   3025 H  HB3    . SER B 1 37  ? -22.517 43.916  64.268  1.00 42.31  ? 37  SER B HB3    1 
ATOM   3026 H  HG     . SER B 1 37  ? -25.074 43.546  63.713  1.00 66.25  ? 37  SER B HG     1 
ATOM   3027 N  N      . SER B 1 38  ? -24.587 41.558  66.540  1.00 31.41  ? 38  SER B N      1 
ATOM   3028 C  CA     . SER B 1 38  ? -24.458 40.126  66.783  1.00 22.93  ? 38  SER B CA     1 
ATOM   3029 C  C      . SER B 1 38  ? -24.268 39.354  65.483  1.00 34.23  ? 38  SER B C      1 
ATOM   3030 O  O      . SER B 1 38  ? -23.520 38.372  65.445  1.00 36.50  ? 38  SER B O      1 
ATOM   3031 C  CB     . SER B 1 38  ? -25.682 39.614  67.539  1.00 35.76  ? 38  SER B CB     1 
ATOM   3032 O  OG     . SER B 1 38  ? -26.869 39.886  66.817  1.00 57.21  ? 38  SER B OG     1 
ATOM   3033 H  H      . SER B 1 38  ? -25.377 41.872  66.670  1.00 37.91  ? 38  SER B H      1 
ATOM   3034 H  HA     . SER B 1 38  ? -23.676 39.973  67.336  1.00 27.73  ? 38  SER B HA     1 
ATOM   3035 H  HB2    . SER B 1 38  ? -25.599 38.655  67.661  1.00 43.13  ? 38  SER B HB2    1 
ATOM   3036 H  HB3    . SER B 1 38  ? -25.729 40.056  68.401  1.00 43.13  ? 38  SER B HB3    1 
ATOM   3037 H  HG     . SER B 1 38  ? -27.534 39.587  67.234  1.00 68.87  ? 38  SER B HG     1 
ATOM   3038 N  N      . VAL B 1 39  ? -24.949 39.770  64.412  1.00 28.45  ? 39  VAL B N      1 
ATOM   3039 C  CA     . VAL B 1 39  ? -24.822 39.080  63.130  1.00 23.57  ? 39  VAL B CA     1 
ATOM   3040 C  C      . VAL B 1 39  ? -23.391 39.181  62.611  1.00 31.09  ? 39  VAL B C      1 
ATOM   3041 O  O      . VAL B 1 39  ? -22.813 38.200  62.127  1.00 32.84  ? 39  VAL B O      1 
ATOM   3042 C  CB     . VAL B 1 39  ? -25.828 39.644  62.112  1.00 20.56  ? 39  VAL B CB     1 
ATOM   3043 C  CG1    . VAL B 1 39  ? -25.704 38.905  60.795  1.00 24.68  ? 39  VAL B CG1    1 
ATOM   3044 C  CG2    . VAL B 1 39  ? -27.239 39.551  62.648  1.00 16.97  ? 39  VAL B CG2    1 
ATOM   3045 H  H      . VAL B 1 39  ? -25.485 40.443  64.401  1.00 34.36  ? 39  VAL B H      1 
ATOM   3046 H  HA     . VAL B 1 39  ? -25.026 38.142  63.267  1.00 28.50  ? 39  VAL B HA     1 
ATOM   3047 H  HB     . VAL B 1 39  ? -25.632 40.581  61.957  1.00 24.88  ? 39  VAL B HB     1 
ATOM   3048 H  HG11   . VAL B 1 39  ? -26.460 39.133  60.232  1.00 29.84  ? 39  VAL B HG11   1 
ATOM   3049 H  HG12   . VAL B 1 39  ? -24.878 39.170  60.361  1.00 29.84  ? 39  VAL B HG12   1 
ATOM   3050 H  HG13   . VAL B 1 39  ? -25.696 37.951  60.968  1.00 29.84  ? 39  VAL B HG13   1 
ATOM   3051 H  HG21   . VAL B 1 39  ? -27.858 39.837  61.958  1.00 20.59  ? 39  VAL B HG21   1 
ATOM   3052 H  HG22   . VAL B 1 39  ? -27.422 38.631  62.896  1.00 20.59  ? 39  VAL B HG22   1 
ATOM   3053 H  HG23   . VAL B 1 39  ? -27.320 40.126  63.424  1.00 20.59  ? 39  VAL B HG23   1 
ATOM   3054 N  N      . ILE B 1 40  ? -22.806 40.379  62.681  1.00 28.64  ? 40  ILE B N      1 
ATOM   3055 C  CA     . ILE B 1 40  ? -21.438 40.559  62.203  1.00 38.77  ? 40  ILE B CA     1 
ATOM   3056 C  C      . ILE B 1 40  ? -20.465 39.776  63.076  1.00 42.99  ? 40  ILE B C      1 
ATOM   3057 O  O      . ILE B 1 40  ? -19.454 39.257  62.585  1.00 46.00  ? 40  ILE B O      1 
ATOM   3058 C  CB     . ILE B 1 40  ? -21.076 42.055  62.157  1.00 32.74  ? 40  ILE B CB     1 
ATOM   3059 C  CG1    . ILE B 1 40  ? -22.033 42.803  61.226  1.00 29.18  ? 40  ILE B CG1    1 
ATOM   3060 C  CG2    . ILE B 1 40  ? -19.632 42.225  61.715  1.00 14.51  ? 40  ILE B CG2    1 
ATOM   3061 C  CD1    . ILE B 1 40  ? -21.826 44.298  61.201  1.00 26.61  ? 40  ILE B CD1    1 
ATOM   3062 H  H      . ILE B 1 40  ? -23.171 41.091  62.996  1.00 34.58  ? 40  ILE B H      1 
ATOM   3063 H  HA     . ILE B 1 40  ? -21.379 40.213  61.299  1.00 46.74  ? 40  ILE B HA     1 
ATOM   3064 H  HB     . ILE B 1 40  ? -21.169 42.432  63.047  1.00 39.50  ? 40  ILE B HB     1 
ATOM   3065 H  HG12   . ILE B 1 40  ? -21.909 42.473  60.322  1.00 35.23  ? 40  ILE B HG12   1 
ATOM   3066 H  HG13   . ILE B 1 40  ? -22.944 42.637  61.517  1.00 35.23  ? 40  ILE B HG13   1 
ATOM   3067 H  HG21   . ILE B 1 40  ? -19.479 43.156  61.489  1.00 17.63  ? 40  ILE B HG21   1 
ATOM   3068 H  HG22   . ILE B 1 40  ? -19.046 41.960  62.441  1.00 17.63  ? 40  ILE B HG22   1 
ATOM   3069 H  HG23   . ILE B 1 40  ? -19.472 41.666  60.939  1.00 17.63  ? 40  ILE B HG23   1 
ATOM   3070 H  HD11   . ILE B 1 40  ? -22.604 44.718  60.804  1.00 32.15  ? 40  ILE B HD11   1 
ATOM   3071 H  HD12   . ILE B 1 40  ? -21.705 44.615  62.110  1.00 32.15  ? 40  ILE B HD12   1 
ATOM   3072 H  HD13   . ILE B 1 40  ? -21.037 44.498  60.674  1.00 32.15  ? 40  ILE B HD13   1 
ATOM   3073 N  N      . ALA B 1 41  ? -20.742 39.681  64.377  1.00 41.83  ? 41  ALA B N      1 
ATOM   3074 C  CA     . ALA B 1 41  ? -19.894 38.891  65.265  1.00 37.15  ? 41  ALA B CA     1 
ATOM   3075 C  C      . ALA B 1 41  ? -19.959 37.412  64.903  1.00 42.71  ? 41  ALA B C      1 
ATOM   3076 O  O      . ALA B 1 41  ? -18.929 36.726  64.842  1.00 51.35  ? 41  ALA B O      1 
ATOM   3077 C  CB     . ALA B 1 41  ? -20.314 39.111  66.717  1.00 44.84  ? 41  ALA B CB     1 
ATOM   3078 H  H      . ALA B 1 41  ? -21.407 40.059  64.768  1.00 50.41  ? 41  ALA B H      1 
ATOM   3079 H  HA     . ALA B 1 41  ? -18.975 39.186  65.170  1.00 44.80  ? 41  ALA B HA     1 
ATOM   3080 H  HB1    . ALA B 1 41  ? -19.748 38.574  67.294  1.00 54.02  ? 41  ALA B HB1    1 
ATOM   3081 H  HB2    . ALA B 1 41  ? -20.213 40.050  66.936  1.00 54.02  ? 41  ALA B HB2    1 
ATOM   3082 H  HB3    . ALA B 1 41  ? -21.241 38.845  66.821  1.00 54.02  ? 41  ALA B HB3    1 
ATOM   3083 N  N      . LYS B 1 42  ? -21.168 36.900  64.669  1.00 39.41  ? 42  LYS B N      1 
ATOM   3084 C  CA     . LYS B 1 42  ? -21.316 35.515  64.243  1.00 44.39  ? 42  LYS B CA     1 
ATOM   3085 C  C      . LYS B 1 42  ? -20.596 35.275  62.924  1.00 37.92  ? 42  LYS B C      1 
ATOM   3086 O  O      . LYS B 1 42  ? -19.975 34.223  62.728  1.00 52.54  ? 42  LYS B O      1 
ATOM   3087 C  CB     . LYS B 1 42  ? -22.801 35.168  64.118  1.00 40.26  ? 42  LYS B CB     1 
ATOM   3088 C  CG     . LYS B 1 42  ? -23.092 33.737  63.676  1.00 50.68  ? 42  LYS B CG     1 
ATOM   3089 C  CD     . LYS B 1 42  ? -22.520 32.708  64.638  1.00 74.76  ? 42  LYS B CD     1 
ATOM   3090 C  CE     . LYS B 1 42  ? -22.900 31.294  64.223  1.00 70.45  ? 42  LYS B CE     1 
ATOM   3091 N  NZ     . LYS B 1 42  ? -22.271 30.269  65.100  1.00 88.68  ? 42  LYS B NZ     1 
ATOM   3092 H  H      . LYS B 1 42  ? -21.910 37.329  64.750  1.00 47.51  ? 42  LYS B H      1 
ATOM   3093 H  HA     . LYS B 1 42  ? -20.926 34.930  64.911  1.00 53.49  ? 42  LYS B HA     1 
ATOM   3094 H  HB2    . LYS B 1 42  ? -23.220 35.296  64.983  1.00 48.53  ? 42  LYS B HB2    1 
ATOM   3095 H  HB3    . LYS B 1 42  ? -23.201 35.762  63.464  1.00 48.53  ? 42  LYS B HB3    1 
ATOM   3096 H  HG2    . LYS B 1 42  ? -24.052 33.607  63.631  1.00 61.03  ? 42  LYS B HG2    1 
ATOM   3097 H  HG3    . LYS B 1 42  ? -22.695 33.587  62.804  1.00 61.03  ? 42  LYS B HG3    1 
ATOM   3098 H  HD2    . LYS B 1 42  ? -21.552 32.775  64.644  1.00 89.93  ? 42  LYS B HD2    1 
ATOM   3099 H  HD3    . LYS B 1 42  ? -22.869 32.869  65.528  1.00 89.93  ? 42  LYS B HD3    1 
ATOM   3100 H  HE2    . LYS B 1 42  ? -23.863 31.193  64.280  1.00 84.75  ? 42  LYS B HE2    1 
ATOM   3101 H  HE3    . LYS B 1 42  ? -22.604 31.138  63.313  1.00 84.75  ? 42  LYS B HE3    1 
ATOM   3102 H  HZ1    . LYS B 1 42  ? -22.517 29.454  64.840  1.00 106.63 ? 42  LYS B HZ1    1 
ATOM   3103 H  HZ2    . LYS B 1 42  ? -21.384 30.332  65.054  1.00 106.63 ? 42  LYS B HZ2    1 
ATOM   3104 H  HZ3    . LYS B 1 42  ? -22.526 30.392  65.944  1.00 106.63 ? 42  LYS B HZ3    1 
ATOM   3105 N  N      . PHE B 1 43  ? -20.648 36.249  62.014  1.00 33.26  ? 43  PHE B N      1 
ATOM   3106 C  CA     . PHE B 1 43  ? -19.943 36.103  60.746  1.00 39.34  ? 43  PHE B CA     1 
ATOM   3107 C  C      . PHE B 1 43  ? -18.436 36.072  60.955  1.00 24.54  ? 43  PHE B C      1 
ATOM   3108 O  O      . PHE B 1 43  ? -17.728 35.287  60.313  1.00 34.21  ? 43  PHE B O      1 
ATOM   3109 C  CB     . PHE B 1 43  ? -20.330 37.239  59.801  1.00 33.79  ? 43  PHE B CB     1 
ATOM   3110 C  CG     . PHE B 1 43  ? -19.639 37.181  58.470  1.00 22.10  ? 43  PHE B CG     1 
ATOM   3111 C  CD1    . PHE B 1 43  ? -20.212 36.505  57.409  1.00 25.41  ? 43  PHE B CD1    1 
ATOM   3112 C  CD2    . PHE B 1 43  ? -18.417 37.807  58.279  1.00 21.24  ? 43  PHE B CD2    1 
ATOM   3113 C  CE1    . PHE B 1 43  ? -19.580 36.449  56.184  1.00 27.36  ? 43  PHE B CE1    1 
ATOM   3114 C  CE2    . PHE B 1 43  ? -17.781 37.755  57.060  1.00 13.92  ? 43  PHE B CE2    1 
ATOM   3115 C  CZ     . PHE B 1 43  ? -18.362 37.075  56.010  1.00 26.38  ? 43  PHE B CZ     1 
ATOM   3116 H  H      . PHE B 1 43  ? -21.075 36.990  62.104  1.00 40.13  ? 43  PHE B H      1 
ATOM   3117 H  HA     . PHE B 1 43  ? -20.208 35.265  60.334  1.00 47.43  ? 43  PHE B HA     1 
ATOM   3118 H  HB2    . PHE B 1 43  ? -21.286 37.200  59.640  1.00 40.77  ? 43  PHE B HB2    1 
ATOM   3119 H  HB3    . PHE B 1 43  ? -20.098 38.084  60.218  1.00 40.77  ? 43  PHE B HB3    1 
ATOM   3120 H  HD1    . PHE B 1 43  ? -21.033 36.083  57.523  1.00 30.71  ? 43  PHE B HD1    1 
ATOM   3121 H  HD2    . PHE B 1 43  ? -18.023 38.268  58.983  1.00 25.70  ? 43  PHE B HD2    1 
ATOM   3122 H  HE1    . PHE B 1 43  ? -19.974 35.991  55.477  1.00 33.05  ? 43  PHE B HE1    1 
ATOM   3123 H  HE2    . PHE B 1 43  ? -16.960 38.176  56.944  1.00 16.92  ? 43  PHE B HE2    1 
ATOM   3124 H  HZ     . PHE B 1 43  ? -17.934 37.039  55.185  1.00 31.87  ? 43  PHE B HZ     1 
ATOM   3125 N  N      . MET B 1 44  ? -17.928 36.912  61.857  1.00 27.65  ? 44  MET B N      1 
ATOM   3126 C  CA     . MET B 1 44  ? -16.495 36.962  62.105  1.00 44.85  ? 44  MET B CA     1 
ATOM   3127 C  C      . MET B 1 44  ? -15.998 35.743  62.862  1.00 41.81  ? 44  MET B C      1 
ATOM   3128 O  O      . MET B 1 44  ? -14.796 35.459  62.836  1.00 43.97  ? 44  MET B O      1 
ATOM   3129 C  CB     . MET B 1 44  ? -16.145 38.229  62.881  1.00 48.26  ? 44  MET B CB     1 
ATOM   3130 C  CG     . MET B 1 44  ? -16.118 39.478  62.032  1.00 21.97  ? 44  MET B CG     1 
ATOM   3131 S  SD     . MET B 1 44  ? -14.709 39.449  60.908  1.00 53.40  ? 44  MET B SD     1 
ATOM   3132 C  CE     . MET B 1 44  ? -15.470 38.904  59.378  1.00 36.76  ? 44  MET B CE     1 
ATOM   3133 H  H      . MET B 1 44  ? -18.390 37.458  62.334  1.00 33.40  ? 44  MET B H      1 
ATOM   3134 H  HA     . MET B 1 44  ? -16.037 37.002  61.250  1.00 54.04  ? 44  MET B HA     1 
ATOM   3135 H  HB2    . MET B 1 44  ? -16.808 38.359  63.578  1.00 58.13  ? 44  MET B HB2    1 
ATOM   3136 H  HB3    . MET B 1 44  ? -15.266 38.119  63.275  1.00 58.13  ? 44  MET B HB3    1 
ATOM   3137 H  HG2    . MET B 1 44  ? -16.931 39.531  61.507  1.00 26.58  ? 44  MET B HG2    1 
ATOM   3138 H  HG3    . MET B 1 44  ? -16.041 40.257  62.604  1.00 26.58  ? 44  MET B HG3    1 
ATOM   3139 H  HE1    . MET B 1 44  ? -14.876 39.109  58.639  1.00 44.33  ? 44  MET B HE1    1 
ATOM   3140 H  HE2    . MET B 1 44  ? -15.623 37.947  59.424  1.00 44.33  ? 44  MET B HE2    1 
ATOM   3141 H  HE3    . MET B 1 44  ? -16.314 39.368  59.262  1.00 44.33  ? 44  MET B HE3    1 
ATOM   3142 N  N      . GLU B 1 45  ? -16.884 35.039  63.565  1.00 63.37  ? 45  GLU B N      1 
ATOM   3143 C  CA     . GLU B 1 45  ? -16.461 33.815  64.235  1.00 68.76  ? 45  GLU B CA     1 
ATOM   3144 C  C      . GLU B 1 45  ? -15.956 32.769  63.242  1.00 60.92  ? 45  GLU B C      1 
ATOM   3145 O  O      . GLU B 1 45  ? -15.062 31.982  63.576  1.00 52.32  ? 45  GLU B O      1 
ATOM   3146 C  CB     . GLU B 1 45  ? -17.618 33.249  65.064  1.00 65.56  ? 45  GLU B CB     1 
ATOM   3147 C  CG     . GLU B 1 45  ? -17.941 34.052  66.319  1.00 75.97  ? 45  GLU B CG     1 
ATOM   3148 C  CD     . GLU B 1 45  ? -19.114 33.486  67.101  1.00 79.32  ? 45  GLU B CD     1 
ATOM   3149 O  OE1    . GLU B 1 45  ? -19.635 32.418  66.712  1.00 73.20  ? 45  GLU B OE1    1 
ATOM   3150 O  OE2    . GLU B 1 45  ? -19.530 34.128  68.091  1.00 63.07  ? 45  GLU B OE2    1 
ATOM   3151 H  H      . GLU B 1 45  ? -17.713 35.241  63.667  1.00 76.26  ? 45  GLU B H      1 
ATOM   3152 H  HA     . GLU B 1 45  ? -15.732 34.026  64.839  1.00 82.73  ? 45  GLU B HA     1 
ATOM   3153 H  HB2    . GLU B 1 45  ? -18.416 33.232  64.512  1.00 78.89  ? 45  GLU B HB2    1 
ATOM   3154 H  HB3    . GLU B 1 45  ? -17.388 32.348  65.342  1.00 78.89  ? 45  GLU B HB3    1 
ATOM   3155 H  HG2    . GLU B 1 45  ? -17.165 34.051  66.902  1.00 91.38  ? 45  GLU B HG2    1 
ATOM   3156 H  HG3    . GLU B 1 45  ? -18.162 34.961  66.064  1.00 91.38  ? 45  GLU B HG3    1 
ATOM   3157 N  N      . SER B 1 46  ? -16.496 32.752  62.022  1.00 59.96  ? 46  SER B N      1 
ATOM   3158 C  CA     . SER B 1 46  ? -16.166 31.735  61.023  1.00 65.04  ? 46  SER B CA     1 
ATOM   3159 C  C      . SER B 1 46  ? -15.237 32.240  59.926  1.00 73.80  ? 46  SER B C      1 
ATOM   3160 O  O      . SER B 1 46  ? -15.485 31.981  58.746  1.00 83.28  ? 46  SER B O      1 
ATOM   3161 C  CB     . SER B 1 46  ? -17.447 31.183  60.404  1.00 67.54  ? 46  SER B CB     1 
ATOM   3162 O  OG     . SER B 1 46  ? -18.171 32.215  59.761  1.00 69.54  ? 46  SER B OG     1 
ATOM   3163 H  H      . SER B 1 46  ? -17.067 33.333  61.747  1.00 72.17  ? 46  SER B H      1 
ATOM   3164 H  HA     . SER B 1 46  ? -15.699 31.019  61.480  1.00 78.26  ? 46  SER B HA     1 
ATOM   3165 H  HB2    . SER B 1 46  ? -17.217 30.503  59.751  1.00 81.27  ? 46  SER B HB2    1 
ATOM   3166 H  HB3    . SER B 1 46  ? -17.997 30.798  61.104  1.00 81.27  ? 46  SER B HB3    1 
ATOM   3167 H  HG     . SER B 1 46  ? -18.860 31.900  59.398  1.00 83.66  ? 46  SER B HG     1 
ATOM   3168 N  N      . VAL B 1 47  ? -14.183 32.977  60.258  1.00 75.16  ? 47  VAL B N      1 
ATOM   3169 C  CA     . VAL B 1 47  ? -13.212 33.431  59.269  1.00 87.09  ? 47  VAL B CA     1 
ATOM   3170 C  C      . VAL B 1 47  ? -11.822 33.143  59.815  1.00 103.59 ? 47  VAL B C      1 
ATOM   3171 O  O      . VAL B 1 47  ? -11.589 33.208  61.026  1.00 106.39 ? 47  VAL B O      1 
ATOM   3172 C  CB     . VAL B 1 47  ? -13.373 34.919  58.896  1.00 90.85  ? 47  VAL B CB     1 
ATOM   3173 C  CG1    . VAL B 1 47  ? -14.686 35.121  58.143  1.00 78.12  ? 47  VAL B CG1    1 
ATOM   3174 C  CG2    . VAL B 1 47  ? -13.306 35.808  60.124  1.00 73.96  ? 47  VAL B CG2    1 
ATOM   3175 H  H      . VAL B 1 47  ? -14.008 33.230  61.062  1.00 90.41  ? 47  VAL B H      1 
ATOM   3176 H  HA     . VAL B 1 47  ? -13.336 32.930  58.449  1.00 104.72 ? 47  VAL B HA     1 
ATOM   3177 H  HB     . VAL B 1 47  ? -12.639 35.181  58.318  1.00 109.23 ? 47  VAL B HB     1 
ATOM   3178 H  HG11   . VAL B 1 47  ? -14.719 36.029  57.805  1.00 93.95  ? 47  VAL B HG11   1 
ATOM   3179 H  HG12   . VAL B 1 47  ? -14.726 34.492  57.405  1.00 93.95  ? 47  VAL B HG12   1 
ATOM   3180 H  HG13   . VAL B 1 47  ? -15.426 34.966  58.751  1.00 93.95  ? 47  VAL B HG13   1 
ATOM   3181 H  HG21   . VAL B 1 47  ? -13.340 36.736  59.844  1.00 88.97  ? 47  VAL B HG21   1 
ATOM   3182 H  HG22   . VAL B 1 47  ? -14.061 35.608  60.700  1.00 88.97  ? 47  VAL B HG22   1 
ATOM   3183 H  HG23   . VAL B 1 47  ? -12.476 35.635  60.595  1.00 88.97  ? 47  VAL B HG23   1 
ATOM   3184 N  N      . GLU B 1 48  ? -10.897 32.825  58.917  1.00 101.89 ? 48  GLU B N      1 
ATOM   3185 C  CA     . GLU B 1 48  ? -9.585  32.369  59.353  1.00 104.23 ? 48  GLU B CA     1 
ATOM   3186 C  C      . GLU B 1 48  ? -8.961  33.489  60.183  1.00 110.93 ? 48  GLU B C      1 
ATOM   3187 O  O      . GLU B 1 48  ? -8.853  34.623  59.692  1.00 103.08 ? 48  GLU B O      1 
ATOM   3188 C  CB     . GLU B 1 48  ? -8.739  32.000  58.128  1.00 88.50  ? 48  GLU B CB     1 
ATOM   3189 C  CG     . GLU B 1 48  ? -7.554  31.063  58.407  1.00 92.23  ? 48  GLU B CG     1 
ATOM   3190 C  CD     . GLU B 1 48  ? -6.236  31.778  58.552  1.00 97.41  ? 48  GLU B CD     1 
ATOM   3191 O  OE1    . GLU B 1 48  ? -6.028  32.752  57.800  1.00 91.21  ? 48  GLU B OE1    1 
ATOM   3192 O  OE2    . GLU B 1 48  ? -5.409  31.348  59.389  1.00 80.32  ? 48  GLU B OE2    1 
ATOM   3193 H  H      . GLU B 1 48  ? -11.002 32.863  58.064  1.00 122.49 ? 48  GLU B H      1 
ATOM   3194 H  HA     . GLU B 1 48  ? -9.633  31.572  59.903  1.00 125.29 ? 48  GLU B HA     1 
ATOM   3195 H  HB2    . GLU B 1 48  ? -9.313  31.558  57.482  1.00 106.41 ? 48  GLU B HB2    1 
ATOM   3196 H  HB3    . GLU B 1 48  ? -8.379  32.817  57.747  1.00 106.41 ? 48  GLU B HB3    1 
ATOM   3197 H  HG2    . GLU B 1 48  ? -7.724  30.584  59.234  1.00 110.89 ? 48  GLU B HG2    1 
ATOM   3198 H  HG3    . GLU B 1 48  ? -7.472  30.436  57.671  1.00 110.89 ? 48  GLU B HG3    1 
ATOM   3199 N  N      . PRO B 1 49  ? -8.538  33.225  61.440  1.00 120.75 ? 49  PRO B N      1 
ATOM   3200 C  CA     . PRO B 1 49  ? -8.002  34.308  62.281  1.00 121.50 ? 49  PRO B CA     1 
ATOM   3201 C  C      . PRO B 1 49  ? -6.707  34.928  61.780  1.00 115.61 ? 49  PRO B C      1 
ATOM   3202 O  O      . PRO B 1 49  ? -6.655  36.147  61.590  1.00 107.04 ? 49  PRO B O      1 
ATOM   3203 C  CB     . PRO B 1 49  ? -7.808  33.625  63.643  1.00 118.61 ? 49  PRO B CB     1 
ATOM   3204 C  CG     . PRO B 1 49  ? -8.829  32.551  63.664  1.00 110.73 ? 49  PRO B CG     1 
ATOM   3205 C  CD     . PRO B 1 49  ? -8.919  32.049  62.247  1.00 115.41 ? 49  PRO B CD     1 
ATOM   3206 H  HA     . PRO B 1 49  ? -8.665  35.014  62.345  1.00 146.01 ? 49  PRO B HA     1 
ATOM   3207 H  HB2    . PRO B 1 49  ? -6.913  33.258  63.706  1.00 142.54 ? 49  PRO B HB2    1 
ATOM   3208 H  HB3    . PRO B 1 49  ? -7.957  34.263  64.359  1.00 142.54 ? 49  PRO B HB3    1 
ATOM   3209 H  HG2    . PRO B 1 49  ? -8.546  31.842  64.263  1.00 133.09 ? 49  PRO B HG2    1 
ATOM   3210 H  HG3    . PRO B 1 49  ? -9.680  32.913  63.957  1.00 133.09 ? 49  PRO B HG3    1 
ATOM   3211 H  HD2    . PRO B 1 49  ? -8.301  31.316  62.102  1.00 138.71 ? 49  PRO B HD2    1 
ATOM   3212 H  HD3    . PRO B 1 49  ? -9.823  31.767  62.039  1.00 138.71 ? 49  PRO B HD3    1 
ATOM   3213 N  N      . GLY B 1 50  ? -5.652  34.137  61.593  1.00 114.66 ? 50  GLY B N      1 
ATOM   3214 C  CA     . GLY B 1 50  ? -4.411  34.724  61.129  1.00 95.46  ? 50  GLY B CA     1 
ATOM   3215 C  C      . GLY B 1 50  ? -4.506  34.941  59.636  1.00 90.00  ? 50  GLY B C      1 
ATOM   3216 O  O      . GLY B 1 50  ? -4.455  33.982  58.870  1.00 93.90  ? 50  GLY B O      1 
ATOM   3217 H  H      . GLY B 1 50  ? -5.636  33.287  61.724  1.00 137.80 ? 50  GLY B H      1 
ATOM   3218 H  HA2    . GLY B 1 50  ? -4.258  35.575  61.569  1.00 114.77 ? 50  GLY B HA2    1 
ATOM   3219 H  HA3    . GLY B 1 50  ? -3.667  34.131  61.321  1.00 114.77 ? 50  GLY B HA3    1 
ATOM   3220 N  N      . ARG B 1 51  ? -4.550  36.194  59.199  1.00 89.01  ? 51  ARG B N      1 
ATOM   3221 C  CA     . ARG B 1 51  ? -4.844  36.512  57.813  1.00 87.97  ? 51  ARG B CA     1 
ATOM   3222 C  C      . ARG B 1 51  ? -4.162  37.822  57.466  1.00 101.29 ? 51  ARG B C      1 
ATOM   3223 O  O      . ARG B 1 51  ? -3.964  38.687  58.331  1.00 96.55  ? 51  ARG B O      1 
ATOM   3224 C  CB     . ARG B 1 51  ? -6.351  36.668  57.576  1.00 89.96  ? 51  ARG B CB     1 
ATOM   3225 C  CG     . ARG B 1 51  ? -6.923  37.834  58.391  1.00 88.34  ? 51  ARG B CG     1 
ATOM   3226 C  CD     . ARG B 1 51  ? -8.404  38.013  58.187  1.00 83.13  ? 51  ARG B CD     1 
ATOM   3227 N  NE     . ARG B 1 51  ? -8.969  39.030  59.071  1.00 93.85  ? 51  ARG B NE     1 
ATOM   3228 C  CZ     . ARG B 1 51  ? -9.235  38.846  60.362  1.00 79.52  ? 51  ARG B CZ     1 
ATOM   3229 N  NH1    . ARG B 1 51  ? -8.978  37.681  60.940  1.00 93.53  ? 51  ARG B NH1    1 
ATOM   3230 N  NH2    . ARG B 1 51  ? -9.758  39.831  61.080  1.00 60.27  ? 51  ARG B NH2    1 
ATOM   3231 H  H      . ARG B 1 51  ? -4.411  36.883  59.694  1.00 107.03 ? 51  ARG B H      1 
ATOM   3232 H  HA     . ARG B 1 51  ? -4.503  35.804  57.244  1.00 105.78 ? 51  ARG B HA     1 
ATOM   3233 H  HB2    . ARG B 1 51  ? -6.512  36.843  56.635  1.00 108.16 ? 51  ARG B HB2    1 
ATOM   3234 H  HB3    . ARG B 1 51  ? -6.805  35.854  57.844  1.00 108.16 ? 51  ARG B HB3    1 
ATOM   3235 H  HG2    . ARG B 1 51  ? -6.769  37.667  59.334  1.00 106.23 ? 51  ARG B HG2    1 
ATOM   3236 H  HG3    . ARG B 1 51  ? -6.482  38.655  58.123  1.00 106.23 ? 51  ARG B HG3    1 
ATOM   3237 H  HD2    . ARG B 1 51  ? -8.568  38.285  57.270  1.00 99.97  ? 51  ARG B HD2    1 
ATOM   3238 H  HD3    . ARG B 1 51  ? -8.854  37.172  58.368  1.00 99.97  ? 51  ARG B HD3    1 
ATOM   3239 H  HE     . ARG B 1 51  ? -9.142  39.802  58.734  1.00 112.84 ? 51  ARG B HE     1 
ATOM   3240 H  HH11   . ARG B 1 51  ? -8.638  37.039  60.480  1.00 112.45 ? 51  ARG B HH11   1 
ATOM   3241 H  HH12   . ARG B 1 51  ? -9.152  37.567  61.774  1.00 112.45 ? 51  ARG B HH12   1 
ATOM   3242 H  HH21   . ARG B 1 51  ? -9.926  40.590  60.712  1.00 72.54  ? 51  ARG B HH21   1 
ATOM   3243 H  HH22   . ARG B 1 51  ? -9.930  39.711  61.915  1.00 72.54  ? 51  ARG B HH22   1 
ATOM   3244 N  N      . VAL B 1 52  ? -3.852  37.982  56.188  1.00 94.09  ? 52  VAL B N      1 
ATOM   3245 C  CA     . VAL B 1 52  ? -3.333  39.246  55.688  1.00 61.68  ? 52  VAL B CA     1 
ATOM   3246 C  C      . VAL B 1 52  ? -4.478  39.921  54.954  1.00 70.27  ? 52  VAL B C      1 
ATOM   3247 O  O      . VAL B 1 52  ? -5.370  39.261  54.404  1.00 80.12  ? 52  VAL B O      1 
ATOM   3248 C  CB     . VAL B 1 52  ? -2.090  39.085  54.787  1.00 66.63  ? 52  VAL B CB     1 
ATOM   3249 C  CG1    . VAL B 1 52  ? -0.955  38.395  55.559  1.00 45.16  ? 52  VAL B CG1    1 
ATOM   3250 C  CG2    . VAL B 1 52  ? -2.427  38.327  53.510  1.00 81.63  ? 52  VAL B CG2    1 
ATOM   3251 H  H      . VAL B 1 52  ? -3.934  37.370  55.590  1.00 113.12 ? 52  VAL B H      1 
ATOM   3252 H  HA     . VAL B 1 52  ? -3.044  39.795  56.434  1.00 74.24  ? 52  VAL B HA     1 
ATOM   3253 H  HB     . VAL B 1 52  ? -1.783  39.966  54.523  1.00 80.17  ? 52  VAL B HB     1 
ATOM   3254 H  HG11   . VAL B 1 52  ? -0.173  38.339  54.988  1.00 54.41  ? 52  VAL B HG11   1 
ATOM   3255 H  HG12   . VAL B 1 52  ? -0.750  38.916  56.351  1.00 54.41  ? 52  VAL B HG12   1 
ATOM   3256 H  HG13   . VAL B 1 52  ? -1.243  37.504  55.814  1.00 54.41  ? 52  VAL B HG13   1 
ATOM   3257 H  HG21   . VAL B 1 52  ? -1.602  38.063  53.073  1.00 98.17  ? 52  VAL B HG21   1 
ATOM   3258 H  HG22   . VAL B 1 52  ? -2.947  37.540  53.738  1.00 98.17  ? 52  VAL B HG22   1 
ATOM   3259 H  HG23   . VAL B 1 52  ? -2.940  38.905  52.925  1.00 98.17  ? 52  VAL B HG23   1 
ATOM   3260 N  N      . MET B 1 53  ? -4.444  41.250  54.924  1.00 61.11  ? 53  MET B N      1 
ATOM   3261 C  CA     . MET B 1 53  ? -5.548  42.011  54.361  1.00 75.65  ? 53  MET B CA     1 
ATOM   3262 C  C      . MET B 1 53  ? -5.259  42.503  52.951  1.00 76.71  ? 53  MET B C      1 
ATOM   3263 O  O      . MET B 1 53  ? -5.866  42.034  51.983  1.00 75.99  ? 53  MET B O      1 
ATOM   3264 C  CB     . MET B 1 53  ? -5.873  43.210  55.260  1.00 77.18  ? 53  MET B CB     1 
ATOM   3265 C  CG     . MET B 1 53  ? -6.417  42.843  56.636  1.00 89.04  ? 53  MET B CG     1 
ATOM   3266 S  SD     . MET B 1 53  ? -7.903  41.817  56.571  1.00 98.54  ? 53  MET B SD     1 
ATOM   3267 C  CE     . MET B 1 53  ? -9.088  42.938  55.820  1.00 57.59  ? 53  MET B CE     1 
ATOM   3268 H  H      . MET B 1 53  ? -3.795  41.730  55.223  1.00 73.55  ? 53  MET B H      1 
ATOM   3269 H  HA     . MET B 1 53  ? -6.316  41.420  54.320  1.00 91.00  ? 53  MET B HA     1 
ATOM   3270 H  HB2    . MET B 1 53  ? -5.061  43.723  55.394  1.00 92.83  ? 53  MET B HB2    1 
ATOM   3271 H  HB3    . MET B 1 53  ? -6.542  43.755  54.817  1.00 92.83  ? 53  MET B HB3    1 
ATOM   3272 H  HG2    . MET B 1 53  ? -5.737  42.350  57.121  1.00 107.07 ? 53  MET B HG2    1 
ATOM   3273 H  HG3    . MET B 1 53  ? -6.639  43.657  57.113  1.00 107.07 ? 53  MET B HG3    1 
ATOM   3274 H  HE1    . MET B 1 53  ? -9.768  42.419  55.363  1.00 69.33  ? 53  MET B HE1    1 
ATOM   3275 H  HE2    . MET B 1 53  ? -9.496  43.479  56.515  1.00 69.33  ? 53  MET B HE2    1 
ATOM   3276 H  HE3    . MET B 1 53  ? -8.626  43.508  55.186  1.00 69.33  ? 53  MET B HE3    1 
ATOM   3277 N  N      . THR B 1 54  ? -4.342  43.453  52.826  1.00 56.90  ? 54  THR B N      1 
ATOM   3278 C  CA     . THR B 1 54  ? -3.948  43.992  51.532  1.00 55.09  ? 54  THR B CA     1 
ATOM   3279 C  C      . THR B 1 54  ? -5.106  44.694  50.826  1.00 58.10  ? 54  THR B C      1 
ATOM   3280 O  O      . THR B 1 54  ? -5.110  44.786  49.594  1.00 67.41  ? 54  THR B O      1 
ATOM   3281 C  CB     . THR B 1 54  ? -3.379  42.897  50.616  1.00 75.88  ? 54  THR B CB     1 
ATOM   3282 O  OG1    . THR B 1 54  ? -4.447  42.086  50.102  1.00 60.17  ? 54  THR B OG1    1 
ATOM   3283 C  CG2    . THR B 1 54  ? -2.385  42.011  51.370  1.00 81.37  ? 54  THR B CG2    1 
ATOM   3284 H  H      . THR B 1 54  ? -3.927  43.807  53.490  1.00 68.50  ? 54  THR B H      1 
ATOM   3285 H  HA     . THR B 1 54  ? -3.251  44.648  51.686  1.00 66.33  ? 54  THR B HA     1 
ATOM   3286 H  HB     . THR B 1 54  ? -2.910  43.315  49.877  1.00 91.27  ? 54  THR B HB     1 
ATOM   3287 H  HG1    . THR B 1 54  ? -4.704  41.545  50.691  1.00 72.42  ? 54  THR B HG1    1 
ATOM   3288 H  HG21   . THR B 1 54  ? -1.921  41.429  50.749  1.00 97.86  ? 54  THR B HG21   1 
ATOM   3289 H  HG22   . THR B 1 54  ? -1.733  42.563  51.831  1.00 97.86  ? 54  THR B HG22   1 
ATOM   3290 H  HG23   . THR B 1 54  ? -2.853  41.467  52.022  1.00 97.86  ? 54  THR B HG23   1 
ATOM   3291 N  N      . ARG B 1 55  ? -6.102  45.180  51.571  1.00 44.52  ? 55  ARG B N      1 
ATOM   3292 C  CA     . ARG B 1 55  ? -7.178  45.954  50.968  1.00 41.49  ? 55  ARG B CA     1 
ATOM   3293 C  C      . ARG B 1 55  ? -7.370  47.247  51.748  1.00 33.29  ? 55  ARG B C      1 
ATOM   3294 O  O      . ARG B 1 55  ? -7.195  47.274  52.971  1.00 43.67  ? 55  ARG B O      1 
ATOM   3295 C  CB     . ARG B 1 55  ? -8.523  45.209  50.917  1.00 36.25  ? 55  ARG B CB     1 
ATOM   3296 C  CG     . ARG B 1 55  ? -8.554  44.022  49.970  1.00 46.46  ? 55  ARG B CG     1 
ATOM   3297 C  CD     . ARG B 1 55  ? -9.935  43.370  49.890  1.00 32.13  ? 55  ARG B CD     1 
ATOM   3298 N  NE     . ARG B 1 55  ? -10.460 42.933  51.180  1.00 69.01  ? 55  ARG B NE     1 
ATOM   3299 C  CZ     . ARG B 1 55  ? -11.701 42.486  51.363  1.00 53.43  ? 55  ARG B CZ     1 
ATOM   3300 N  NH1    . ARG B 1 55  ? -12.538 42.394  50.334  1.00 62.42  ? 55  ARG B NH1    1 
ATOM   3301 N  NH2    . ARG B 1 55  ? -12.108 42.127  52.572  1.00 36.86  ? 55  ARG B NH2    1 
ATOM   3302 H  H      . ARG B 1 55  ? -6.169  45.073  52.422  1.00 53.64  ? 55  ARG B H      1 
ATOM   3303 H  HA     . ARG B 1 55  ? -6.927  46.148  50.052  1.00 50.00  ? 55  ARG B HA     1 
ATOM   3304 H  HB2    . ARG B 1 55  ? -8.727  44.880  51.806  1.00 43.72  ? 55  ARG B HB2    1 
ATOM   3305 H  HB3    . ARG B 1 55  ? -9.209  45.831  50.628  1.00 43.72  ? 55  ARG B HB3    1 
ATOM   3306 H  HG2    . ARG B 1 55  ? -8.311  44.320  49.080  1.00 55.97  ? 55  ARG B HG2    1 
ATOM   3307 H  HG3    . ARG B 1 55  ? -7.924  43.353  50.280  1.00 55.97  ? 55  ARG B HG3    1 
ATOM   3308 H  HD2    . ARG B 1 55  ? -10.562 44.011  49.518  1.00 38.77  ? 55  ARG B HD2    1 
ATOM   3309 H  HD3    . ARG B 1 55  ? -9.879  42.590  49.315  1.00 38.77  ? 55  ARG B HD3    1 
ATOM   3310 H  HE     . ARG B 1 55  ? -9.938  42.966  51.862  1.00 83.03  ? 55  ARG B HE     1 
ATOM   3311 H  HH11   . ARG B 1 55  ? -12.278 42.623  49.547  1.00 75.12  ? 55  ARG B HH11   1 
ATOM   3312 H  HH12   . ARG B 1 55  ? -13.339 42.105  50.455  1.00 75.12  ? 55  ARG B HH12   1 
ATOM   3313 H  HH21   . ARG B 1 55  ? -11.570 42.183  53.241  1.00 44.45  ? 55  ARG B HH21   1 
ATOM   3314 H  HH22   . ARG B 1 55  ? -12.910 41.839  52.688  1.00 44.45  ? 55  ARG B HH22   1 
ATOM   3315 N  N      . PRO B 1 56  ? -7.736  48.331  51.065  1.00 34.04  ? 56  PRO B N      1 
ATOM   3316 C  CA     . PRO B 1 56  ? -7.977  49.602  51.761  1.00 31.84  ? 56  PRO B CA     1 
ATOM   3317 C  C      . PRO B 1 56  ? -9.207  49.541  52.654  1.00 31.46  ? 56  PRO B C      1 
ATOM   3318 O  O      . PRO B 1 56  ? -10.237 48.974  52.281  1.00 40.98  ? 56  PRO B O      1 
ATOM   3319 C  CB     . PRO B 1 56  ? -8.168  50.603  50.615  1.00 21.37  ? 56  PRO B CB     1 
ATOM   3320 C  CG     . PRO B 1 56  ? -8.607  49.775  49.464  1.00 27.56  ? 56  PRO B CG     1 
ATOM   3321 C  CD     . PRO B 1 56  ? -7.942  48.447  49.611  1.00 39.90  ? 56  PRO B CD     1 
ATOM   3322 H  HA     . PRO B 1 56  ? -7.205  49.849  52.294  1.00 38.42  ? 56  PRO B HA     1 
ATOM   3323 H  HB2    . PRO B 1 56  ? -8.846  51.255  50.853  1.00 25.86  ? 56  PRO B HB2    1 
ATOM   3324 H  HB3    . PRO B 1 56  ? -7.330  51.051  50.422  1.00 25.86  ? 56  PRO B HB3    1 
ATOM   3325 H  HG2    . PRO B 1 56  ? -9.571  49.677  49.485  1.00 33.28  ? 56  PRO B HG2    1 
ATOM   3326 H  HG3    . PRO B 1 56  ? -8.334  50.202  48.636  1.00 33.28  ? 56  PRO B HG3    1 
ATOM   3327 H  HD2    . PRO B 1 56  ? -8.516  47.736  49.286  1.00 48.10  ? 56  PRO B HD2    1 
ATOM   3328 H  HD3    . PRO B 1 56  ? -7.094  48.431  49.140  1.00 48.10  ? 56  PRO B HD3    1 
ATOM   3329 N  N      . MET B 1 57  ? -9.091  50.131  53.844  1.00 24.48  ? 57  MET B N      1 
ATOM   3330 C  CA     . MET B 1 57  ? -10.178 50.174  54.812  1.00 21.67  ? 57  MET B CA     1 
ATOM   3331 C  C      . MET B 1 57  ? -10.320 51.572  55.398  1.00 20.29  ? 57  MET B C      1 
ATOM   3332 O  O      . MET B 1 57  ? -9.359  52.343  55.452  1.00 40.16  ? 57  MET B O      1 
ATOM   3333 C  CB     . MET B 1 57  ? -9.941  49.162  55.929  1.00 41.02  ? 57  MET B CB     1 
ATOM   3334 C  CG     . MET B 1 57  ? -8.674  49.420  56.723  1.00 33.29  ? 57  MET B CG     1 
ATOM   3335 S  SD     . MET B 1 57  ? -8.338  48.105  57.899  1.00 46.17  ? 57  MET B SD     1 
ATOM   3336 C  CE     . MET B 1 57  ? -8.078  46.733  56.769  1.00 43.59  ? 57  MET B CE     1 
ATOM   3337 H  H      . MET B 1 57  ? -8.374  50.522  54.114  1.00 29.59  ? 57  MET B H      1 
ATOM   3338 H  HA     . MET B 1 57  ? -11.011 49.955  54.366  1.00 26.23  ? 57  MET B HA     1 
ATOM   3339 H  HB2    . MET B 1 57  ? -10.689 49.196  56.545  1.00 49.45  ? 57  MET B HB2    1 
ATOM   3340 H  HB3    . MET B 1 57  ? -9.872  48.277  55.539  1.00 49.45  ? 57  MET B HB3    1 
ATOM   3341 H  HG2    . MET B 1 57  ? -7.922  49.480  56.113  1.00 40.17  ? 57  MET B HG2    1 
ATOM   3342 H  HG3    . MET B 1 57  ? -8.769  50.250  57.215  1.00 40.17  ? 57  MET B HG3    1 
ATOM   3343 H  HE1    . MET B 1 57  ? -7.701  45.987  57.260  1.00 52.53  ? 57  MET B HE1    1 
ATOM   3344 H  HE2    . MET B 1 57  ? -8.929  46.478  56.380  1.00 52.53  ? 57  MET B HE2    1 
ATOM   3345 H  HE3    . MET B 1 57  ? -7.465  47.012  56.070  1.00 52.53  ? 57  MET B HE3    1 
ATOM   3346 N  N      . CYS B 1 58  ? -11.533 51.889  55.841  1.00 19.81  ? 58  CYS B N      1 
ATOM   3347 C  CA     . CYS B 1 58  ? -11.812 53.188  56.432  1.00 27.74  ? 58  CYS B CA     1 
ATOM   3348 C  C      . CYS B 1 58  ? -11.197 53.285  57.829  1.00 26.11  ? 58  CYS B C      1 
ATOM   3349 O  O      . CYS B 1 58  ? -10.571 52.349  58.335  1.00 32.37  ? 58  CYS B O      1 
ATOM   3350 C  CB     . CYS B 1 58  ? -13.318 53.409  56.501  1.00 34.17  ? 58  CYS B CB     1 
ATOM   3351 S  SG     . CYS B 1 58  ? -14.163 52.043  57.318  1.00 30.31  ? 58  CYS B SG     1 
ATOM   3352 H  H      . CYS B 1 58  ? -12.214 51.365  55.811  1.00 23.99  ? 58  CYS B H      1 
ATOM   3353 H  HA     . CYS B 1 58  ? -11.414 53.875  55.874  1.00 33.50  ? 58  CYS B HA     1 
ATOM   3354 H  HB2    . CYS B 1 58  ? -13.498 54.221  57.002  1.00 41.22  ? 58  CYS B HB2    1 
ATOM   3355 H  HB3    . CYS B 1 58  ? -13.670 53.490  55.601  1.00 41.22  ? 58  CYS B HB3    1 
ATOM   3356 H  HG     . CYS B 1 58  ? -15.337 52.286  57.372  1.00 36.59  ? 58  CYS B HG     1 
ATOM   3357 N  N      . ASN B 1 59  ? -11.368 54.450  58.455  1.00 29.42  ? 59  ASN B N      1 
ATOM   3358 C  CA     . ASN B 1 59  ? -10.968 54.650  59.840  1.00 41.72  ? 59  ASN B CA     1 
ATOM   3359 C  C      . ASN B 1 59  ? -12.017 54.045  60.775  1.00 41.64  ? 59  ASN B C      1 
ATOM   3360 O  O      . ASN B 1 59  ? -12.997 53.436  60.339  1.00 47.62  ? 59  ASN B O      1 
ATOM   3361 C  CB     . ASN B 1 59  ? -10.738 56.135  60.118  1.00 30.88  ? 59  ASN B CB     1 
ATOM   3362 C  CG     . ASN B 1 59  ? -11.984 56.972  59.924  1.00 42.07  ? 59  ASN B CG     1 
ATOM   3363 O  OD1    . ASN B 1 59  ? -13.100 56.524  60.185  1.00 57.10  ? 59  ASN B OD1    1 
ATOM   3364 N  ND2    . ASN B 1 59  ? -11.798 58.202  59.456  1.00 37.08  ? 59  ASN B ND2    1 
ATOM   3365 H  H      . ASN B 1 59  ? -11.719 55.146  58.091  1.00 35.53  ? 59  ASN B H      1 
ATOM   3366 H  HA     . ASN B 1 59  ? -10.128 54.193  59.999  1.00 50.28  ? 59  ASN B HA     1 
ATOM   3367 H  HB2    . ASN B 1 59  ? -10.445 56.242  61.036  1.00 37.27  ? 59  ASN B HB2    1 
ATOM   3368 H  HB3    . ASN B 1 59  ? -10.057 56.467  59.511  1.00 37.27  ? 59  ASN B HB3    1 
ATOM   3369 H  HD21   . ASN B 1 59  ? -12.472 58.720  59.328  1.00 44.71  ? 59  ASN B HD21   1 
ATOM   3370 H  HD22   . ASN B 1 59  ? -11.003 58.480  59.282  1.00 44.71  ? 59  ASN B HD22   1 
ATOM   3371 N  N      . ASP B 1 60  ? -11.816 54.223  62.084  1.00 39.10  ? 60  ASP B N      1 
ATOM   3372 C  CA     . ASP B 1 60  ? -12.709 53.606  63.060  1.00 37.01  ? 60  ASP B CA     1 
ATOM   3373 C  C      . ASP B 1 60  ? -14.028 54.363  63.198  1.00 35.41  ? 60  ASP B C      1 
ATOM   3374 O  O      . ASP B 1 60  ? -15.077 53.742  63.395  1.00 26.50  ? 60  ASP B O      1 
ATOM   3375 C  CB     . ASP B 1 60  ? -12.013 53.503  64.419  1.00 47.45  ? 60  ASP B CB     1 
ATOM   3376 C  CG     . ASP B 1 60  ? -10.855 52.521  64.410  1.00 34.96  ? 60  ASP B CG     1 
ATOM   3377 O  OD1    . ASP B 1 60  ? -10.637 51.863  63.371  1.00 26.03  ? 60  ASP B OD1    1 
ATOM   3378 O  OD2    . ASP B 1 60  ? -10.166 52.401  65.445  1.00 43.41  ? 60  ASP B OD2    1 
ATOM   3379 H  H      . ASP B 1 60  ? -11.180 54.689  62.428  1.00 47.13  ? 60  ASP B H      1 
ATOM   3380 H  HA     . ASP B 1 60  ? -12.917 52.708  62.756  1.00 44.63  ? 60  ASP B HA     1 
ATOM   3381 H  HB2    . ASP B 1 60  ? -11.665 54.376  64.663  1.00 57.16  ? 60  ASP B HB2    1 
ATOM   3382 H  HB3    . ASP B 1 60  ? -12.654 53.205  65.082  1.00 57.16  ? 60  ASP B HB3    1 
ATOM   3383 N  N      . ASP B 1 61  ? -14.007 55.693  63.093  1.00 32.32  ? 61  ASP B N      1 
ATOM   3384 C  CA     . ASP B 1 61  ? -15.248 56.456  63.206  1.00 33.84  ? 61  ASP B CA     1 
ATOM   3385 C  C      . ASP B 1 61  ? -16.201 56.114  62.066  1.00 38.88  ? 61  ASP B C      1 
ATOM   3386 O  O      . ASP B 1 61  ? -17.369 55.767  62.293  1.00 48.41  ? 61  ASP B O      1 
ATOM   3387 C  CB     . ASP B 1 61  ? -14.950 57.956  63.221  1.00 47.08  ? 61  ASP B CB     1 
ATOM   3388 C  CG     . ASP B 1 61  ? -14.029 58.361  64.356  1.00 51.23  ? 61  ASP B CG     1 
ATOM   3389 O  OD1    . ASP B 1 61  ? -13.555 57.468  65.090  1.00 57.09  ? 61  ASP B OD1    1 
ATOM   3390 O  OD2    . ASP B 1 61  ? -13.785 59.577  64.516  1.00 46.34  ? 61  ASP B OD2    1 
ATOM   3391 H  H      . ASP B 1 61  ? -13.304 56.169  62.959  1.00 39.00  ? 61  ASP B H      1 
ATOM   3392 H  HA     . ASP B 1 61  ? -15.678 56.227  64.046  1.00 40.82  ? 61  ASP B HA     1 
ATOM   3393 H  HB2    . ASP B 1 61  ? -14.522 58.201  62.386  1.00 56.72  ? 61  ASP B HB2    1 
ATOM   3394 H  HB3    . ASP B 1 61  ? -15.783 58.443  63.322  1.00 56.72  ? 61  ASP B HB3    1 
ATOM   3395 N  N      . ASP B 1 62  ? -15.720 56.228  60.826  1.00 33.29  ? 62  ASP B N      1 
ATOM   3396 C  CA     . ASP B 1 62  ? -16.538 55.869  59.675  1.00 37.18  ? 62  ASP B CA     1 
ATOM   3397 C  C      . ASP B 1 62  ? -16.941 54.400  59.732  1.00 40.00  ? 62  ASP B C      1 
ATOM   3398 O  O      . ASP B 1 62  ? -18.070 54.040  59.377  1.00 34.27  ? 62  ASP B O      1 
ATOM   3399 C  CB     . ASP B 1 62  ? -15.780 56.161  58.377  1.00 41.28  ? 62  ASP B CB     1 
ATOM   3400 C  CG     . ASP B 1 62  ? -15.390 57.626  58.234  1.00 42.47  ? 62  ASP B CG     1 
ATOM   3401 O  OD1    . ASP B 1 62  ? -15.757 58.443  59.106  1.00 39.51  ? 62  ASP B OD1    1 
ATOM   3402 O  OD2    . ASP B 1 62  ? -14.715 57.957  57.234  1.00 29.48  ? 62  ASP B OD2    1 
ATOM   3403 H  H      . ASP B 1 62  ? -14.931 56.508  60.626  1.00 40.17  ? 62  ASP B H      1 
ATOM   3404 H  HA     . ASP B 1 62  ? -17.343 56.410  59.681  1.00 44.84  ? 62  ASP B HA     1 
ATOM   3405 H  HB2    . ASP B 1 62  ? -14.968 55.632  58.361  1.00 49.75  ? 62  ASP B HB2    1 
ATOM   3406 H  HB3    . ASP B 1 62  ? -16.344 55.927  57.623  1.00 49.75  ? 62  ASP B HB3    1 
ATOM   3407 N  N      . GLY B 1 63  ? -16.021 53.532  60.158  1.00 36.91  ? 63  GLY B N      1 
ATOM   3408 C  CA     . GLY B 1 63  ? -16.350 52.122  60.275  1.00 28.64  ? 63  GLY B CA     1 
ATOM   3409 C  C      . GLY B 1 63  ? -17.514 51.879  61.216  1.00 39.33  ? 63  GLY B C      1 
ATOM   3410 O  O      . GLY B 1 63  ? -18.457 51.161  60.884  1.00 43.75  ? 63  GLY B O      1 
ATOM   3411 H  H      . GLY B 1 63  ? -15.214 53.731  60.381  1.00 44.51  ? 63  GLY B H      1 
ATOM   3412 H  HA2    . GLY B 1 63  ? -16.586 51.773  59.401  1.00 34.58  ? 63  GLY B HA2    1 
ATOM   3413 H  HA3    . GLY B 1 63  ? -15.579 51.638  60.610  1.00 34.58  ? 63  GLY B HA3    1 
ATOM   3414 N  N      . MET B 1 64  ? -17.463 52.480  62.405  1.00 34.82  ? 64  MET B N      1 
ATOM   3415 C  CA     . MET B 1 64  ? -18.545 52.301  63.366  1.00 31.99  ? 64  MET B CA     1 
ATOM   3416 C  C      . MET B 1 64  ? -19.845 52.904  62.849  1.00 25.82  ? 64  MET B C      1 
ATOM   3417 O  O      . MET B 1 64  ? -20.923 52.335  63.057  1.00 25.28  ? 64  MET B O      1 
ATOM   3418 C  CB     . MET B 1 64  ? -18.160 52.908  64.715  1.00 31.04  ? 64  MET B CB     1 
ATOM   3419 C  CG     . MET B 1 64  ? -17.191 52.045  65.513  1.00 42.89  ? 64  MET B CG     1 
ATOM   3420 S  SD     . MET B 1 64  ? -16.931 52.642  67.193  1.00 83.15  ? 64  MET B SD     1 
ATOM   3421 C  CE     . MET B 1 64  ? -16.096 54.197  66.886  1.00 42.08  ? 64  MET B CE     1 
ATOM   3422 H  H      . MET B 1 64  ? -16.825 52.989  62.676  1.00 41.99  ? 64  MET B H      1 
ATOM   3423 H  HA     . MET B 1 64  ? -18.680 51.351  63.506  1.00 38.60  ? 64  MET B HA     1 
ATOM   3424 H  HB2    . MET B 1 64  ? -17.738 53.767  64.563  1.00 37.47  ? 64  MET B HB2    1 
ATOM   3425 H  HB3    . MET B 1 64  ? -18.963 53.022  65.247  1.00 37.47  ? 64  MET B HB3    1 
ATOM   3426 H  HG2    . MET B 1 64  ? -17.544 51.143  65.568  1.00 51.69  ? 64  MET B HG2    1 
ATOM   3427 H  HG3    . MET B 1 64  ? -16.332 52.039  65.062  1.00 51.69  ? 64  MET B HG3    1 
ATOM   3428 H  HE1    . MET B 1 64  ? -15.864 54.603  67.735  1.00 50.71  ? 64  MET B HE1    1 
ATOM   3429 H  HE2    . MET B 1 64  ? -15.292 54.027  66.369  1.00 50.71  ? 64  MET B HE2    1 
ATOM   3430 H  HE3    . MET B 1 64  ? -16.690 54.782  66.390  1.00 50.71  ? 64  MET B HE3    1 
ATOM   3431 N  N      . LEU B 1 65  ? -19.769 54.053  62.174  1.00 34.37  ? 65  LEU B N      1 
ATOM   3432 C  CA     . LEU B 1 65  ? -20.981 54.666  61.638  1.00 33.98  ? 65  LEU B CA     1 
ATOM   3433 C  C      . LEU B 1 65  ? -21.637 53.752  60.609  1.00 32.35  ? 65  LEU B C      1 
ATOM   3434 O  O      . LEU B 1 65  ? -22.854 53.512  60.650  1.00 32.12  ? 65  LEU B O      1 
ATOM   3435 C  CB     . LEU B 1 65  ? -20.646 56.023  61.017  1.00 26.97  ? 65  LEU B CB     1 
ATOM   3436 C  CG     . LEU B 1 65  ? -21.823 56.869  60.527  1.00 33.08  ? 65  LEU B CG     1 
ATOM   3437 C  CD1    . LEU B 1 65  ? -21.426 58.336  60.537  1.00 43.21  ? 65  LEU B CD1    1 
ATOM   3438 C  CD2    . LEU B 1 65  ? -22.297 56.465  59.148  1.00 42.05  ? 65  LEU B CD2    1 
ATOM   3439 H  H      . LEU B 1 65  ? -19.045 54.489  62.016  1.00 41.46  ? 65  LEU B H      1 
ATOM   3440 H  HA     . LEU B 1 65  ? -21.611 54.813  62.361  1.00 41.00  ? 65  LEU B HA     1 
ATOM   3441 H  HB2    . LEU B 1 65  ? -20.176 56.549  61.684  1.00 32.58  ? 65  LEU B HB2    1 
ATOM   3442 H  HB3    . LEU B 1 65  ? -20.070 55.867  60.252  1.00 32.58  ? 65  LEU B HB3    1 
ATOM   3443 H  HG     . LEU B 1 65  ? -22.571 56.725  61.127  1.00 39.91  ? 65  LEU B HG     1 
ATOM   3444 H  HD11   . LEU B 1 65  ? -22.154 58.863  60.172  1.00 52.06  ? 65  LEU B HD11   1 
ATOM   3445 H  HD12   . LEU B 1 65  ? -21.247 58.608  61.451  1.00 52.06  ? 65  LEU B HD12   1 
ATOM   3446 H  HD13   . LEU B 1 65  ? -20.630 58.452  59.995  1.00 52.06  ? 65  LEU B HD13   1 
ATOM   3447 H  HD21   . LEU B 1 65  ? -22.826 57.186  58.773  1.00 50.68  ? 65  LEU B HD21   1 
ATOM   3448 H  HD22   . LEU B 1 65  ? -21.525 56.293  58.587  1.00 50.68  ? 65  LEU B HD22   1 
ATOM   3449 H  HD23   . LEU B 1 65  ? -22.837 55.662  59.223  1.00 50.68  ? 65  LEU B HD23   1 
ATOM   3450 N  N      . ILE B 1 66  ? -20.841 53.236  59.669  1.00 26.96  ? 66  ILE B N      1 
ATOM   3451 C  CA     . ILE B 1 66  ? -21.374 52.337  58.652  1.00 22.48  ? 66  ILE B CA     1 
ATOM   3452 C  C      . ILE B 1 66  ? -21.895 51.059  59.292  1.00 31.72  ? 66  ILE B C      1 
ATOM   3453 O  O      . ILE B 1 66  ? -22.911 50.504  58.861  1.00 30.41  ? 66  ILE B O      1 
ATOM   3454 C  CB     . ILE B 1 66  ? -20.308 52.038  57.583  1.00 22.77  ? 66  ILE B CB     1 
ATOM   3455 C  CG1    . ILE B 1 66  ? -19.895 53.322  56.870  1.00 18.57  ? 66  ILE B CG1    1 
ATOM   3456 C  CG2    . ILE B 1 66  ? -20.826 51.020  56.575  1.00 22.13  ? 66  ILE B CG2    1 
ATOM   3457 C  CD1    . ILE B 1 66  ? -18.687 53.154  55.993  1.00 26.66  ? 66  ILE B CD1    1 
ATOM   3458 H  H      . ILE B 1 66  ? -19.998 53.389  59.600  1.00 32.57  ? 66  ILE B H      1 
ATOM   3459 H  HA     . ILE B 1 66  ? -22.119 52.780  58.214  1.00 27.19  ? 66  ILE B HA     1 
ATOM   3460 H  HB     . ILE B 1 66  ? -19.531 51.664  58.028  1.00 27.54  ? 66  ILE B HB     1 
ATOM   3461 H  HG12   . ILE B 1 66  ? -20.629 53.620  56.310  1.00 22.49  ? 66  ILE B HG12   1 
ATOM   3462 H  HG13   . ILE B 1 66  ? -19.689 53.998  57.534  1.00 22.49  ? 66  ILE B HG13   1 
ATOM   3463 H  HG21   . ILE B 1 66  ? -20.185 50.937  55.852  1.00 26.77  ? 66  ILE B HG21   1 
ATOM   3464 H  HG22   . ILE B 1 66  ? -20.938 50.165  57.019  1.00 26.77  ? 66  ILE B HG22   1 
ATOM   3465 H  HG23   . ILE B 1 66  ? -21.679 51.326  56.228  1.00 26.77  ? 66  ILE B HG23   1 
ATOM   3466 H  HD11   . ILE B 1 66  ? -18.336 54.029  55.767  1.00 32.20  ? 66  ILE B HD11   1 
ATOM   3467 H  HD12   . ILE B 1 66  ? -18.017 52.643  56.474  1.00 32.20  ? 66  ILE B HD12   1 
ATOM   3468 H  HD13   . ILE B 1 66  ? -18.946 52.682  55.186  1.00 32.20  ? 66  ILE B HD13   1 
ATOM   3469 N  N      . SER B 1 67  ? -21.211 50.571  60.330  1.00 23.10  ? 67  SER B N      1 
ATOM   3470 C  CA     . SER B 1 67  ? -21.656 49.354  60.997  1.00 21.21  ? 67  SER B CA     1 
ATOM   3471 C  C      . SER B 1 67  ? -23.021 49.560  61.638  1.00 22.57  ? 67  SER B C      1 
ATOM   3472 O  O      . SER B 1 67  ? -23.924 48.732  61.480  1.00 25.73  ? 67  SER B O      1 
ATOM   3473 C  CB     . SER B 1 67  ? -20.625 48.928  62.045  1.00 26.82  ? 67  SER B CB     1 
ATOM   3474 O  OG     . SER B 1 67  ? -19.393 48.565  61.444  1.00 20.95  ? 67  SER B OG     1 
ATOM   3475 H  H      . SER B 1 67  ? -20.499 50.921  60.662  1.00 27.93  ? 67  SER B H      1 
ATOM   3476 H  HA     . SER B 1 67  ? -21.731 48.641  60.343  1.00 25.67  ? 67  SER B HA     1 
ATOM   3477 H  HB2    . SER B 1 67  ? -20.471 49.669  62.652  1.00 32.40  ? 67  SER B HB2    1 
ATOM   3478 H  HB3    . SER B 1 67  ? -20.972 48.166  62.534  1.00 32.40  ? 67  SER B HB3    1 
ATOM   3479 H  HG     . SER B 1 67  ? -19.050 49.232  61.066  1.00 25.36  ? 67  SER B HG     1 
ATOM   3480 N  N      . GLN B 1 68  ? -23.193 50.676  62.350  1.00 24.57  ? 68  GLN B N      1 
ATOM   3481 C  CA     . GLN B 1 68  ? -24.487 51.001  62.944  1.00 28.94  ? 68  GLN B CA     1 
ATOM   3482 C  C      . GLN B 1 68  ? -25.571 51.090  61.878  1.00 31.73  ? 68  GLN B C      1 
ATOM   3483 O  O      . GLN B 1 68  ? -26.676 50.559  62.049  1.00 26.78  ? 68  GLN B O      1 
ATOM   3484 C  CB     . GLN B 1 68  ? -24.385 52.316  63.715  1.00 32.97  ? 68  GLN B CB     1 
ATOM   3485 C  CG     . GLN B 1 68  ? -23.502 52.247  64.950  1.00 56.65  ? 68  GLN B CG     1 
ATOM   3486 C  CD     . GLN B 1 68  ? -23.347 53.595  65.636  1.00 78.18  ? 68  GLN B CD     1 
ATOM   3487 O  OE1    . GLN B 1 68  ? -24.267 54.416  65.643  1.00 67.11  ? 68  GLN B OE1    1 
ATOM   3488 N  NE2    . GLN B 1 68  ? -22.170 53.833  66.207  1.00 78.80  ? 68  GLN B NE2    1 
ATOM   3489 H  H      . GLN B 1 68  ? -22.580 51.259  62.503  1.00 29.70  ? 68  GLN B H      1 
ATOM   3490 H  HA     . GLN B 1 68  ? -24.733 50.299  63.567  1.00 34.94  ? 68  GLN B HA     1 
ATOM   3491 H  HB2    . GLN B 1 68  ? -24.014 52.993  63.127  1.00 39.78  ? 68  GLN B HB2    1 
ATOM   3492 H  HB3    . GLN B 1 68  ? -25.273 52.577  64.003  1.00 39.78  ? 68  GLN B HB3    1 
ATOM   3493 H  HG2    . GLN B 1 68  ? -23.897 51.630  65.586  1.00 68.19  ? 68  GLN B HG2    1 
ATOM   3494 H  HG3    . GLN B 1 68  ? -22.620 51.938  64.692  1.00 68.19  ? 68  GLN B HG3    1 
ATOM   3495 H  HE21   . GLN B 1 68  ? -21.548 53.239  66.175  1.00 94.78  ? 68  GLN B HE21   1 
ATOM   3496 H  HE22   . GLN B 1 68  ? -22.030 54.581  66.609  1.00 94.78  ? 68  GLN B HE22   1 
ATOM   3497 N  N      . VAL B 1 69  ? -25.277 51.774  60.770  1.00 26.00  ? 69  VAL B N      1 
ATOM   3498 C  CA     . VAL B 1 69  ? -26.273 51.931  59.711  1.00 25.53  ? 69  VAL B CA     1 
ATOM   3499 C  C      . VAL B 1 69  ? -26.675 50.572  59.145  1.00 28.32  ? 69  VAL B C      1 
ATOM   3500 O  O      . VAL B 1 69  ? -27.865 50.237  59.052  1.00 29.25  ? 69  VAL B O      1 
ATOM   3501 C  CB     . VAL B 1 69  ? -25.731 52.857  58.608  1.00 28.70  ? 69  VAL B CB     1 
ATOM   3502 C  CG1    . VAL B 1 69  ? -26.657 52.845  57.412  1.00 27.49  ? 69  VAL B CG1    1 
ATOM   3503 C  CG2    . VAL B 1 69  ? -25.555 54.273  59.136  1.00 36.15  ? 69  VAL B CG2    1 
ATOM   3504 H  H      . VAL B 1 69  ? -24.521 52.151  60.608  1.00 31.42  ? 69  VAL B H      1 
ATOM   3505 H  HA     . VAL B 1 69  ? -27.066 52.339  60.094  1.00 30.85  ? 69  VAL B HA     1 
ATOM   3506 H  HB     . VAL B 1 69  ? -24.862 52.533  58.325  1.00 34.65  ? 69  VAL B HB     1 
ATOM   3507 H  HG11   . VAL B 1 69  ? -26.531 53.664  56.907  1.00 33.20  ? 69  VAL B HG11   1 
ATOM   3508 H  HG12   . VAL B 1 69  ? -26.446 52.079  56.857  1.00 33.20  ? 69  VAL B HG12   1 
ATOM   3509 H  HG13   . VAL B 1 69  ? -27.574 52.786  57.723  1.00 33.20  ? 69  VAL B HG13   1 
ATOM   3510 H  HG21   . VAL B 1 69  ? -25.092 54.804  58.469  1.00 43.60  ? 69  VAL B HG21   1 
ATOM   3511 H  HG22   . VAL B 1 69  ? -26.429 54.655  59.314  1.00 43.60  ? 69  VAL B HG22   1 
ATOM   3512 H  HG23   . VAL B 1 69  ? -25.035 54.243  59.954  1.00 43.60  ? 69  VAL B HG23   1 
ATOM   3513 N  N      . VAL B 1 70  ? -25.685 49.770  58.751  1.00 33.71  ? 70  VAL B N      1 
ATOM   3514 C  CA     . VAL B 1 70  ? -25.970 48.490  58.111  1.00 32.03  ? 70  VAL B CA     1 
ATOM   3515 C  C      . VAL B 1 70  ? -26.694 47.566  59.078  1.00 25.81  ? 70  VAL B C      1 
ATOM   3516 O  O      . VAL B 1 70  ? -27.577 46.800  58.681  1.00 21.88  ? 70  VAL B O      1 
ATOM   3517 C  CB     . VAL B 1 70  ? -24.672 47.857  57.577  1.00 26.67  ? 70  VAL B CB     1 
ATOM   3518 C  CG1    . VAL B 1 70  ? -24.931 46.450  57.066  1.00 19.47  ? 70  VAL B CG1    1 
ATOM   3519 C  CG2    . VAL B 1 70  ? -24.080 48.719  56.479  1.00 19.86  ? 70  VAL B CG2    1 
ATOM   3520 H  H      . VAL B 1 70  ? -24.847 49.941  58.840  1.00 40.66  ? 70  VAL B H      1 
ATOM   3521 H  HA     . VAL B 1 70  ? -26.556 48.647  57.354  1.00 38.65  ? 70  VAL B HA     1 
ATOM   3522 H  HB     . VAL B 1 70  ? -24.031 47.799  58.303  1.00 32.22  ? 70  VAL B HB     1 
ATOM   3523 H  HG11   . VAL B 1 70  ? -24.174 46.164  56.531  1.00 23.58  ? 70  VAL B HG11   1 
ATOM   3524 H  HG12   . VAL B 1 70  ? -25.045 45.854  57.823  1.00 23.58  ? 70  VAL B HG12   1 
ATOM   3525 H  HG13   . VAL B 1 70  ? -25.736 46.454  56.524  1.00 23.58  ? 70  VAL B HG13   1 
ATOM   3526 H  HG21   . VAL B 1 70  ? -23.245 48.324  56.183  1.00 24.05  ? 70  VAL B HG21   1 
ATOM   3527 H  HG22   . VAL B 1 70  ? -24.707 48.762  55.739  1.00 24.05  ? 70  VAL B HG22   1 
ATOM   3528 H  HG23   . VAL B 1 70  ? -23.920 49.609  56.828  1.00 24.05  ? 70  VAL B HG23   1 
ATOM   3529 N  N      . ASP B 1 71  ? -26.332 47.613  60.361  1.00 27.40  ? 71  ASP B N      1 
ATOM   3530 C  CA     . ASP B 1 71  ? -26.999 46.757  61.331  1.00 27.15  ? 71  ASP B CA     1 
ATOM   3531 C  C      . ASP B 1 71  ? -28.446 47.185  61.539  1.00 32.68  ? 71  ASP B C      1 
ATOM   3532 O  O      . ASP B 1 71  ? -29.341 46.338  61.617  1.00 35.37  ? 71  ASP B O      1 
ATOM   3533 C  CB     . ASP B 1 71  ? -26.240 46.777  62.654  1.00 32.66  ? 71  ASP B CB     1 
ATOM   3534 C  CG     . ASP B 1 71  ? -26.816 45.817  63.660  1.00 28.61  ? 71  ASP B CG     1 
ATOM   3535 O  OD1    . ASP B 1 71  ? -26.542 44.605  63.538  1.00 44.39  ? 71  ASP B OD1    1 
ATOM   3536 O  OD2    . ASP B 1 71  ? -27.564 46.272  64.551  1.00 35.14  ? 71  ASP B OD2    1 
ATOM   3537 H  H      . ASP B 1 71  ? -25.718 48.120  60.687  1.00 33.10  ? 71  ASP B H      1 
ATOM   3538 H  HA     . ASP B 1 71  ? -26.998 45.846  60.998  1.00 32.80  ? 71  ASP B HA     1 
ATOM   3539 H  HB2    . ASP B 1 71  ? -25.316 46.528  62.494  1.00 39.41  ? 71  ASP B HB2    1 
ATOM   3540 H  HB3    . ASP B 1 71  ? -26.282 47.670  63.031  1.00 39.41  ? 71  ASP B HB3    1 
ATOM   3541 N  N      . SER B 1 72  ? -28.701 48.495  61.614  1.00 30.94  ? 72  SER B N      1 
ATOM   3542 C  CA     . SER B 1 72  ? -30.073 48.960  61.784  1.00 24.54  ? 72  SER B CA     1 
ATOM   3543 C  C      . SER B 1 72  ? -30.919 48.662  60.554  1.00 26.45  ? 72  SER B C      1 
ATOM   3544 O  O      . SER B 1 72  ? -32.144 48.533  60.665  1.00 33.60  ? 72  SER B O      1 
ATOM   3545 C  CB     . SER B 1 72  ? -30.094 50.456  62.088  1.00 32.10  ? 72  SER B CB     1 
ATOM   3546 O  OG     . SER B 1 72  ? -29.825 51.213  60.922  1.00 53.55  ? 72  SER B OG     1 
ATOM   3547 H  H      . SER B 1 72  ? -28.112 49.120  61.570  1.00 37.34  ? 72  SER B H      1 
ATOM   3548 H  HA     . SER B 1 72  ? -30.463 48.498  62.542  1.00 29.66  ? 72  SER B HA     1 
ATOM   3549 H  HB2    . SER B 1 72  ? -30.971 50.697  62.425  1.00 38.73  ? 72  SER B HB2    1 
ATOM   3550 H  HB3    . SER B 1 72  ? -29.417 50.653  62.754  1.00 38.73  ? 72  SER B HB3    1 
ATOM   3551 H  HG     . SER B 1 72  ? -29.041 51.068  60.660  1.00 64.48  ? 72  SER B HG     1 
ATOM   3552 N  N      . VAL B 1 73  ? -30.297 48.564  59.381  1.00 37.06  ? 73  VAL B N      1 
ATOM   3553 C  CA     . VAL B 1 73  ? -31.065 48.330  58.161  1.00 22.16  ? 73  VAL B CA     1 
ATOM   3554 C  C      . VAL B 1 73  ? -31.256 46.842  57.870  1.00 27.35  ? 73  VAL B C      1 
ATOM   3555 O  O      . VAL B 1 73  ? -32.290 46.450  57.318  1.00 21.27  ? 73  VAL B O      1 
ATOM   3556 C  CB     . VAL B 1 73  ? -30.383 49.032  56.974  1.00 23.09  ? 73  VAL B CB     1 
ATOM   3557 C  CG1    . VAL B 1 73  ? -31.075 48.670  55.670  1.00 26.36  ? 73  VAL B CG1    1 
ATOM   3558 C  CG2    . VAL B 1 73  ? -30.388 50.536  57.177  1.00 33.63  ? 73  VAL B CG2    1 
ATOM   3559 H  H      . VAL B 1 73  ? -29.448 48.627  59.265  1.00 44.69  ? 73  VAL B H      1 
ATOM   3560 H  HA     . VAL B 1 73  ? -31.948 48.711  58.280  1.00 26.80  ? 73  VAL B HA     1 
ATOM   3561 H  HB     . VAL B 1 73  ? -29.461 48.733  56.920  1.00 27.92  ? 73  VAL B HB     1 
ATOM   3562 H  HG11   . VAL B 1 73  ? -30.843 49.329  54.996  1.00 31.85  ? 73  VAL B HG11   1 
ATOM   3563 H  HG12   . VAL B 1 73  ? -30.779 47.791  55.388  1.00 31.85  ? 73  VAL B HG12   1 
ATOM   3564 H  HG13   . VAL B 1 73  ? -32.034 48.667  55.812  1.00 31.85  ? 73  VAL B HG13   1 
ATOM   3565 H  HG21   . VAL B 1 73  ? -29.885 50.954  56.460  1.00 40.58  ? 73  VAL B HG21   1 
ATOM   3566 H  HG22   . VAL B 1 73  ? -31.305 50.853  57.165  1.00 40.58  ? 73  VAL B HG22   1 
ATOM   3567 H  HG23   . VAL B 1 73  ? -29.978 50.741  58.032  1.00 40.58  ? 73  VAL B HG23   1 
ATOM   3568 N  N      . MET B 1 74  ? -30.286 46.005  58.234  1.00 26.25  ? 74  MET B N      1 
ATOM   3569 C  CA     . MET B 1 74  ? -30.235 44.612  57.815  1.00 17.39  ? 74  MET B CA     1 
ATOM   3570 C  C      . MET B 1 74  ? -30.500 43.623  58.942  1.00 30.15  ? 74  MET B C      1 
ATOM   3571 O  O      . MET B 1 74  ? -30.405 42.413  58.713  1.00 38.83  ? 74  MET B O      1 
ATOM   3572 C  CB     . MET B 1 74  ? -28.871 44.310  57.184  1.00 25.56  ? 74  MET B CB     1 
ATOM   3573 C  CG     . MET B 1 74  ? -28.526 45.171  55.973  1.00 17.62  ? 74  MET B CG     1 
ATOM   3574 S  SD     . MET B 1 74  ? -29.596 44.879  54.556  1.00 28.22  ? 74  MET B SD     1 
ATOM   3575 C  CE     . MET B 1 74  ? -29.234 43.161  54.188  1.00 25.38  ? 74  MET B CE     1 
ATOM   3576 H  H      . MET B 1 74  ? -29.628 46.231  58.739  1.00 31.71  ? 74  MET B H      1 
ATOM   3577 H  HA     . MET B 1 74  ? -30.918 44.481  57.139  1.00 21.09  ? 74  MET B HA     1 
ATOM   3578 H  HB2    . MET B 1 74  ? -28.183 44.455  57.852  1.00 30.88  ? 74  MET B HB2    1 
ATOM   3579 H  HB3    . MET B 1 74  ? -28.863 43.384  56.896  1.00 30.88  ? 74  MET B HB3    1 
ATOM   3580 H  HG2    . MET B 1 74  ? -28.607 46.106  56.219  1.00 21.36  ? 74  MET B HG2    1 
ATOM   3581 H  HG3    . MET B 1 74  ? -27.615 44.978  55.701  1.00 21.36  ? 74  MET B HG3    1 
ATOM   3582 H  HE1    . MET B 1 74  ? -29.683 42.913  53.365  1.00 30.67  ? 74  MET B HE1    1 
ATOM   3583 H  HE2    . MET B 1 74  ? -28.275 43.055  54.087  1.00 30.67  ? 74  MET B HE2    1 
ATOM   3584 H  HE3    . MET B 1 74  ? -29.553 42.608  54.918  1.00 30.67  ? 74  MET B HE3    1 
ATOM   3585 N  N      . TYR B 1 75  ? -30.794 44.091  60.157  1.00 34.65  ? 75  TYR B N      1 
ATOM   3586 C  CA     . TYR B 1 75  ? -31.029 43.166  61.260  1.00 39.53  ? 75  TYR B CA     1 
ATOM   3587 C  C      . TYR B 1 75  ? -32.242 42.279  61.030  1.00 38.80  ? 75  TYR B C      1 
ATOM   3588 O  O      . TYR B 1 75  ? -32.397 41.263  61.715  1.00 57.83  ? 75  TYR B O      1 
ATOM   3589 C  CB     . TYR B 1 75  ? -31.239 43.930  62.565  1.00 31.48  ? 75  TYR B CB     1 
ATOM   3590 C  CG     . TYR B 1 75  ? -32.574 44.644  62.617  1.00 40.97  ? 75  TYR B CG     1 
ATOM   3591 C  CD1    . TYR B 1 75  ? -32.785 45.810  61.892  1.00 44.45  ? 75  TYR B CD1    1 
ATOM   3592 C  CD2    . TYR B 1 75  ? -33.636 44.129  63.348  1.00 45.77  ? 75  TYR B CD2    1 
ATOM   3593 C  CE1    . TYR B 1 75  ? -34.003 46.464  61.925  1.00 53.01  ? 75  TYR B CE1    1 
ATOM   3594 C  CE2    . TYR B 1 75  ? -34.862 44.774  63.384  1.00 47.35  ? 75  TYR B CE2    1 
ATOM   3595 C  CZ     . TYR B 1 75  ? -35.040 45.941  62.668  1.00 52.50  ? 75  TYR B CZ     1 
ATOM   3596 O  OH     . TYR B 1 75  ? -36.253 46.592  62.694  1.00 45.67  ? 75  TYR B OH     1 
ATOM   3597 H  H      . TYR B 1 75  ? -30.863 44.923  60.364  1.00 41.80  ? 75  TYR B H      1 
ATOM   3598 H  HA     . TYR B 1 75  ? -30.240 42.607  61.343  1.00 47.66  ? 75  TYR B HA     1 
ATOM   3599 H  HB2    . TYR B 1 75  ? -31.204 43.304  63.306  1.00 37.99  ? 75  TYR B HB2    1 
ATOM   3600 H  HB3    . TYR B 1 75  ? -30.538 44.594  62.658  1.00 37.99  ? 75  TYR B HB3    1 
ATOM   3601 H  HD1    . TYR B 1 75  ? -32.095 46.156  61.374  1.00 53.55  ? 75  TYR B HD1    1 
ATOM   3602 H  HD2    . TYR B 1 75  ? -33.523 43.337  63.823  1.00 55.14  ? 75  TYR B HD2    1 
ATOM   3603 H  HE1    . TYR B 1 75  ? -34.123 47.254  61.449  1.00 63.83  ? 75  TYR B HE1    1 
ATOM   3604 H  HE2    . TYR B 1 75  ? -35.561 44.423  63.886  1.00 57.03  ? 75  TYR B HE2    1 
ATOM   3605 H  HH     . TYR B 1 75  ? -36.805 46.154  63.152  1.00 55.02  ? 75  TYR B HH     1 
ATOM   3606 N  N      . ILE B 1 76  ? -33.106 42.640  60.087  1.00 31.54  ? 76  ILE B N      1 
ATOM   3607 C  CA     . ILE B 1 76  ? -34.340 41.894  59.884  1.00 31.61  ? 76  ILE B CA     1 
ATOM   3608 C  C      . ILE B 1 76  ? -34.107 40.661  59.017  1.00 32.91  ? 76  ILE B C      1 
ATOM   3609 O  O      . ILE B 1 76  ? -34.600 39.572  59.328  1.00 56.74  ? 76  ILE B O      1 
ATOM   3610 C  CB     . ILE B 1 76  ? -35.417 42.837  59.312  1.00 29.97  ? 76  ILE B CB     1 
ATOM   3611 C  CG1    . ILE B 1 76  ? -36.726 42.092  59.068  1.00 30.60  ? 76  ILE B CG1    1 
ATOM   3612 C  CG2    . ILE B 1 76  ? -34.933 43.521  58.036  1.00 42.22  ? 76  ILE B CG2    1 
ATOM   3613 C  CD1    . ILE B 1 76  ? -37.904 43.028  58.872  1.00 46.12  ? 76  ILE B CD1    1 
ATOM   3614 H  H      . ILE B 1 76  ? -33.003 43.308  59.554  1.00 38.07  ? 76  ILE B H      1 
ATOM   3615 H  HA     . ILE B 1 76  ? -34.658 41.566  60.740  1.00 38.15  ? 76  ILE B HA     1 
ATOM   3616 H  HB     . ILE B 1 76  ? -35.582 43.525  59.976  1.00 36.18  ? 76  ILE B HB     1 
ATOM   3617 H  HG12   . ILE B 1 76  ? -36.637 41.550  58.269  1.00 36.94  ? 76  ILE B HG12   1 
ATOM   3618 H  HG13   . ILE B 1 76  ? -36.916 41.527  59.833  1.00 36.94  ? 76  ILE B HG13   1 
ATOM   3619 H  HG21   . ILE B 1 76  ? -35.662 44.038  57.659  1.00 50.88  ? 76  ILE B HG21   1 
ATOM   3620 H  HG22   . ILE B 1 76  ? -34.190 44.105  58.253  1.00 50.88  ? 76  ILE B HG22   1 
ATOM   3621 H  HG23   . ILE B 1 76  ? -34.647 42.843  57.404  1.00 50.88  ? 76  ILE B HG23   1 
ATOM   3622 H  HD11   . ILE B 1 76  ? -38.721 42.506  58.836  1.00 55.56  ? 76  ILE B HD11   1 
ATOM   3623 H  HD12   . ILE B 1 76  ? -37.942 43.649  59.616  1.00 55.56  ? 76  ILE B HD12   1 
ATOM   3624 H  HD13   . ILE B 1 76  ? -37.787 43.515  58.041  1.00 55.56  ? 76  ILE B HD13   1 
ATOM   3625 N  N      . ASP B 1 77  ? -33.358 40.799  57.927  1.00 44.52  ? 77  ASP B N      1 
ATOM   3626 C  CA     . ASP B 1 77  ? -33.127 39.709  56.977  1.00 32.67  ? 77  ASP B CA     1 
ATOM   3627 C  C      . ASP B 1 77  ? -31.707 39.172  57.161  1.00 31.69  ? 77  ASP B C      1 
ATOM   3628 O  O      . ASP B 1 77  ? -30.764 39.641  56.522  1.00 41.87  ? 77  ASP B O      1 
ATOM   3629 C  CB     . ASP B 1 77  ? -33.358 40.201  55.555  1.00 29.13  ? 77  ASP B CB     1 
ATOM   3630 C  CG     . ASP B 1 77  ? -33.453 39.071  54.558  1.00 45.54  ? 77  ASP B CG     1 
ATOM   3631 O  OD1    . ASP B 1 77  ? -32.817 38.022  54.789  1.00 57.16  ? 77  ASP B OD1    1 
ATOM   3632 O  OD2    . ASP B 1 77  ? -34.172 39.230  53.547  1.00 46.68  ? 77  ASP B OD2    1 
ATOM   3633 H  H      . ASP B 1 77  ? -32.964 41.532  57.711  1.00 53.64  ? 77  ASP B H      1 
ATOM   3634 H  HA     . ASP B 1 77  ? -33.738 38.982  57.176  1.00 39.42  ? 77  ASP B HA     1 
ATOM   3635 H  HB2    . ASP B 1 77  ? -34.189 40.700  55.524  1.00 35.17  ? 77  ASP B HB2    1 
ATOM   3636 H  HB3    . ASP B 1 77  ? -32.619 40.771  55.293  1.00 35.17  ? 77  ASP B HB3    1 
ATOM   3637 N  N      . LYS B 1 78  ? -31.565 38.164  58.028  1.00 34.98  ? 78  LYS B N      1 
ATOM   3638 C  CA     . LYS B 1 78  ? -30.244 37.616  58.334  1.00 31.06  ? 78  LYS B CA     1 
ATOM   3639 C  C      . LYS B 1 78  ? -29.603 36.957  57.119  1.00 21.87  ? 78  LYS B C      1 
ATOM   3640 O  O      . LYS B 1 78  ? -28.373 36.965  56.988  1.00 16.90  ? 78  LYS B O      1 
ATOM   3641 C  CB     . LYS B 1 78  ? -30.355 36.612  59.485  1.00 32.32  ? 78  LYS B CB     1 
ATOM   3642 C  CG     . LYS B 1 78  ? -30.916 37.201  60.773  1.00 57.30  ? 78  LYS B CG     1 
ATOM   3643 C  CD     . LYS B 1 78  ? -30.005 38.282  61.338  1.00 72.64  ? 78  LYS B CD     1 
ATOM   3644 C  CE     . LYS B 1 78  ? -30.529 38.822  62.663  1.00 80.67  ? 78  LYS B CE     1 
ATOM   3645 N  NZ     . LYS B 1 78  ? -30.501 37.820  63.764  1.00 95.20  ? 78  LYS B NZ     1 
ATOM   3646 H  H      . LYS B 1 78  ? -32.211 37.782  58.449  1.00 42.19  ? 78  LYS B H      1 
ATOM   3647 H  HA     . LYS B 1 78  ? -29.665 38.342  58.614  1.00 37.48  ? 78  LYS B HA     1 
ATOM   3648 H  HB2    . LYS B 1 78  ? -30.942 35.890  59.211  1.00 39.00  ? 78  LYS B HB2    1 
ATOM   3649 H  HB3    . LYS B 1 78  ? -29.471 36.266  59.680  1.00 39.00  ? 78  LYS B HB3    1 
ATOM   3650 H  HG2    . LYS B 1 78  ? -31.783 37.596  60.594  1.00 68.98  ? 78  LYS B HG2    1 
ATOM   3651 H  HG3    . LYS B 1 78  ? -31.002 36.498  61.436  1.00 68.98  ? 78  LYS B HG3    1 
ATOM   3652 H  HD2    . LYS B 1 78  ? -29.122 37.911  61.489  1.00 87.38  ? 78  LYS B HD2    1 
ATOM   3653 H  HD3    . LYS B 1 78  ? -29.953 39.018  60.709  1.00 87.38  ? 78  LYS B HD3    1 
ATOM   3654 H  HE2    . LYS B 1 78  ? -29.980 39.575  62.934  1.00 97.02  ? 78  LYS B HE2    1 
ATOM   3655 H  HE3    . LYS B 1 78  ? -31.448 39.107  62.544  1.00 97.02  ? 78  LYS B HE3    1 
ATOM   3656 H  HZ1    . LYS B 1 78  ? -30.827 38.180  64.511  1.00 114.46 ? 78  LYS B HZ1    1 
ATOM   3657 H  HZ2    . LYS B 1 78  ? -30.995 37.113  63.545  1.00 114.46 ? 78  LYS B HZ2    1 
ATOM   3658 H  HZ3    . LYS B 1 78  ? -29.665 37.554  63.913  1.00 114.46 ? 78  LYS B HZ3    1 
ATOM   3659 N  N      . LYS B 1 79  ? -30.409 36.391  56.220  1.00 24.41  ? 79  LYS B N      1 
ATOM   3660 C  CA     . LYS B 1 79  ? -29.867 35.800  55.001  1.00 17.94  ? 79  LYS B CA     1 
ATOM   3661 C  C      . LYS B 1 79  ? -29.230 36.866  54.119  1.00 29.26  ? 79  LYS B C      1 
ATOM   3662 O  O      . LYS B 1 79  ? -28.103 36.704  53.629  1.00 36.13  ? 79  LYS B O      1 
ATOM   3663 C  CB     . LYS B 1 79  ? -30.980 35.080  54.241  1.00 21.18  ? 79  LYS B CB     1 
ATOM   3664 C  CG     . LYS B 1 79  ? -30.505 34.351  53.013  1.00 27.47  ? 79  LYS B CG     1 
ATOM   3665 C  CD     . LYS B 1 79  ? -31.656 33.755  52.230  1.00 70.66  ? 79  LYS B CD     1 
ATOM   3666 C  CE     . LYS B 1 79  ? -31.132 33.083  50.979  1.00 81.65  ? 79  LYS B CE     1 
ATOM   3667 N  NZ     . LYS B 1 79  ? -30.461 31.814  51.328  1.00 87.64  ? 79  LYS B NZ     1 
ATOM   3668 H  H      . LYS B 1 79  ? -31.264 36.336  56.290  1.00 29.50  ? 79  LYS B H      1 
ATOM   3669 H  HA     . LYS B 1 79  ? -29.186 35.151  55.238  1.00 21.74  ? 79  LYS B HA     1 
ATOM   3670 H  HB2    . LYS B 1 79  ? -31.390 34.429  54.832  1.00 25.63  ? 79  LYS B HB2    1 
ATOM   3671 H  HB3    . LYS B 1 79  ? -31.639 35.735  53.960  1.00 25.63  ? 79  LYS B HB3    1 
ATOM   3672 H  HG2    . LYS B 1 79  ? -30.033 34.971  52.435  1.00 33.18  ? 79  LYS B HG2    1 
ATOM   3673 H  HG3    . LYS B 1 79  ? -29.913 33.630  53.278  1.00 33.18  ? 79  LYS B HG3    1 
ATOM   3674 H  HD2    . LYS B 1 79  ? -32.113 33.093  52.772  1.00 85.01  ? 79  LYS B HD2    1 
ATOM   3675 H  HD3    . LYS B 1 79  ? -32.274 34.457  51.972  1.00 85.01  ? 79  LYS B HD3    1 
ATOM   3676 H  HE2    . LYS B 1 79  ? -31.869 32.891  50.379  1.00 98.20  ? 79  LYS B HE2    1 
ATOM   3677 H  HE3    . LYS B 1 79  ? -30.491 33.664  50.541  1.00 98.20  ? 79  LYS B HE3    1 
ATOM   3678 H  HZ1    . LYS B 1 79  ? -30.038 31.487  50.615  1.00 105.38 ? 79  LYS B HZ1    1 
ATOM   3679 H  HZ2    . LYS B 1 79  ? -29.868 31.951  51.977  1.00 105.38 ? 79  LYS B HZ2    1 
ATOM   3680 H  HZ3    . LYS B 1 79  ? -31.061 31.218  51.606  1.00 105.38 ? 79  LYS B HZ3    1 
ATOM   3681 N  N      . ALA B 1 80  ? -29.948 37.970  53.900  1.00 24.67  ? 80  ALA B N      1 
ATOM   3682 C  CA     . ALA B 1 80  ? -29.407 39.061  53.101  1.00 20.03  ? 80  ALA B CA     1 
ATOM   3683 C  C      . ALA B 1 80  ? -28.208 39.694  53.788  1.00 23.59  ? 80  ALA B C      1 
ATOM   3684 O  O      . ALA B 1 80  ? -27.253 40.106  53.125  1.00 27.21  ? 80  ALA B O      1 
ATOM   3685 C  CB     . ALA B 1 80  ? -30.491 40.106  52.840  1.00 18.28  ? 80  ALA B CB     1 
ATOM   3686 H  H      . ALA B 1 80  ? -30.741 38.111  54.201  1.00 29.82  ? 80  ALA B H      1 
ATOM   3687 H  HA     . ALA B 1 80  ? -29.117 38.712  52.243  1.00 24.25  ? 80  ALA B HA     1 
ATOM   3688 H  HB1    . ALA B 1 80  ? -30.116 40.822  52.304  1.00 22.16  ? 80  ALA B HB1    1 
ATOM   3689 H  HB2    . ALA B 1 80  ? -31.225 39.687  52.365  1.00 22.16  ? 80  ALA B HB2    1 
ATOM   3690 H  HB3    . ALA B 1 80  ? -30.803 40.456  53.689  1.00 22.16  ? 80  ALA B HB3    1 
ATOM   3691 N  N      . PHE B 1 81  ? -28.243 39.785  55.118  1.00 23.76  ? 81  PHE B N      1 
ATOM   3692 C  CA     . PHE B 1 81  ? -27.097 40.309  55.855  1.00 20.64  ? 81  PHE B CA     1 
ATOM   3693 C  C      . PHE B 1 81  ? -25.871 39.439  55.621  1.00 17.46  ? 81  PHE B C      1 
ATOM   3694 O  O      . PHE B 1 81  ? -24.765 39.948  55.391  1.00 21.70  ? 81  PHE B O      1 
ATOM   3695 C  CB     . PHE B 1 81  ? -27.440 40.393  57.344  1.00 24.41  ? 81  PHE B CB     1 
ATOM   3696 C  CG     . PHE B 1 81  ? -26.640 41.419  58.111  1.00 18.34  ? 81  PHE B CG     1 
ATOM   3697 C  CD1    . PHE B 1 81  ? -25.393 41.839  57.674  1.00 22.59  ? 81  PHE B CD1    1 
ATOM   3698 C  CD2    . PHE B 1 81  ? -27.147 41.962  59.278  1.00 20.10  ? 81  PHE B CD2    1 
ATOM   3699 C  CE1    . PHE B 1 81  ? -24.671 42.779  58.389  1.00 22.66  ? 81  PHE B CE1    1 
ATOM   3700 C  CE2    . PHE B 1 81  ? -26.429 42.901  59.995  1.00 26.74  ? 81  PHE B CE2    1 
ATOM   3701 C  CZ     . PHE B 1 81  ? -25.191 43.310  59.549  1.00 21.66  ? 81  PHE B CZ     1 
ATOM   3702 H  H      . PHE B 1 81  ? -28.908 39.555  55.612  1.00 28.73  ? 81  PHE B H      1 
ATOM   3703 H  HA     . PHE B 1 81  ? -26.892 41.206  55.548  1.00 24.98  ? 81  PHE B HA     1 
ATOM   3704 H  HB2    . PHE B 1 81  ? -28.377 40.626  57.434  1.00 29.51  ? 81  PHE B HB2    1 
ATOM   3705 H  HB3    . PHE B 1 81  ? -27.272 39.528  57.749  1.00 29.51  ? 81  PHE B HB3    1 
ATOM   3706 H  HD1    . PHE B 1 81  ? -25.038 41.486  56.890  1.00 27.33  ? 81  PHE B HD1    1 
ATOM   3707 H  HD2    . PHE B 1 81  ? -27.983 41.691  59.584  1.00 24.33  ? 81  PHE B HD2    1 
ATOM   3708 H  HE1    . PHE B 1 81  ? -23.834 43.051  58.087  1.00 27.41  ? 81  PHE B HE1    1 
ATOM   3709 H  HE2    . PHE B 1 81  ? -26.782 43.257  60.778  1.00 32.31  ? 81  PHE B HE2    1 
ATOM   3710 H  HZ     . PHE B 1 81  ? -24.708 43.944  60.030  1.00 26.21  ? 81  PHE B HZ     1 
ATOM   3711 N  N      . GLY B 1 82  ? -26.045 38.122  55.682  1.00 15.88  ? 82  GLY B N      1 
ATOM   3712 C  CA     . GLY B 1 82  ? -24.926 37.238  55.425  1.00 22.29  ? 82  GLY B CA     1 
ATOM   3713 C  C      . GLY B 1 82  ? -24.409 37.377  54.010  1.00 15.96  ? 82  GLY B C      1 
ATOM   3714 O  O      . GLY B 1 82  ? -23.201 37.357  53.777  1.00 12.27  ? 82  GLY B O      1 
ATOM   3715 H  H      . GLY B 1 82  ? -26.785 37.724  55.865  1.00 19.27  ? 82  GLY B H      1 
ATOM   3716 H  HA2    . GLY B 1 82  ? -24.204 37.445  56.039  1.00 26.96  ? 82  GLY B HA2    1 
ATOM   3717 H  HA3    . GLY B 1 82  ? -25.203 36.318  55.563  1.00 26.96  ? 82  GLY B HA3    1 
ATOM   3718 N  N      . ILE B 1 83  ? -25.318 37.532  53.046  1.00 13.71  ? 83  ILE B N      1 
ATOM   3719 C  CA     . ILE B 1 83  ? -24.895 37.734  51.662  1.00 10.37  ? 83  ILE B CA     1 
ATOM   3720 C  C      . ILE B 1 83  ? -24.082 39.018  51.540  1.00 12.48  ? 83  ILE B C      1 
ATOM   3721 O  O      . ILE B 1 83  ? -23.023 39.050  50.903  1.00 13.40  ? 83  ILE B O      1 
ATOM   3722 C  CB     . ILE B 1 83  ? -26.118 37.749  50.727  1.00 9.44   ? 83  ILE B CB     1 
ATOM   3723 C  CG1    . ILE B 1 83  ? -26.721 36.346  50.628  1.00 15.08  ? 83  ILE B CG1    1 
ATOM   3724 C  CG2    . ILE B 1 83  ? -25.737 38.279  49.356  1.00 15.95  ? 83  ILE B CG2    1 
ATOM   3725 C  CD1    . ILE B 1 83  ? -28.027 36.290  49.860  1.00 19.27  ? 83  ILE B CD1    1 
ATOM   3726 H  H      . ILE B 1 83  ? -26.169 37.524  53.164  1.00 16.66  ? 83  ILE B H      1 
ATOM   3727 H  HA     . ILE B 1 83  ? -24.326 36.994  51.400  1.00 12.66  ? 83  ILE B HA     1 
ATOM   3728 H  HB     . ILE B 1 83  ? -26.788 38.343  51.101  1.00 11.54  ? 83  ILE B HB     1 
ATOM   3729 H  HG12   . ILE B 1 83  ? -26.087 35.767  50.176  1.00 18.31  ? 83  ILE B HG12   1 
ATOM   3730 H  HG13   . ILE B 1 83  ? -26.891 36.017  51.524  1.00 18.31  ? 83  ILE B HG13   1 
ATOM   3731 H  HG21   . ILE B 1 83  ? -26.433 38.046  48.722  1.00 19.36  ? 83  ILE B HG21   1 
ATOM   3732 H  HG22   . ILE B 1 83  ? -25.643 39.243  49.405  1.00 19.36  ? 83  ILE B HG22   1 
ATOM   3733 H  HG23   . ILE B 1 83  ? -24.896 37.879  49.085  1.00 19.36  ? 83  ILE B HG23   1 
ATOM   3734 H  HD11   . ILE B 1 83  ? -28.449 35.431  50.018  1.00 23.34  ? 83  ILE B HD11   1 
ATOM   3735 H  HD12   . ILE B 1 83  ? -28.605 37.005  50.169  1.00 23.34  ? 83  ILE B HD12   1 
ATOM   3736 H  HD13   . ILE B 1 83  ? -27.842 36.399  48.914  1.00 23.34  ? 83  ILE B HD13   1 
ATOM   3737 N  N      . LEU B 1 84  ? -24.572 40.098  52.145  1.00 18.65  ? 84  LEU B N      1 
ATOM   3738 C  CA     . LEU B 1 84  ? -23.862 41.369  52.100  1.00 13.84  ? 84  LEU B CA     1 
ATOM   3739 C  C      . LEU B 1 84  ? -22.465 41.240  52.688  1.00 15.02  ? 84  LEU B C      1 
ATOM   3740 O  O      . LEU B 1 84  ? -21.492 41.749  52.117  1.00 18.40  ? 84  LEU B O      1 
ATOM   3741 C  CB     . LEU B 1 84  ? -24.668 42.428  52.851  1.00 12.84  ? 84  LEU B CB     1 
ATOM   3742 C  CG     . LEU B 1 84  ? -24.242 43.881  52.666  1.00 14.92  ? 84  LEU B CG     1 
ATOM   3743 C  CD1    . LEU B 1 84  ? -24.579 44.379  51.265  1.00 19.04  ? 84  LEU B CD1    1 
ATOM   3744 C  CD2    . LEU B 1 84  ? -24.915 44.731  53.723  1.00 14.64  ? 84  LEU B CD2    1 
ATOM   3745 H  H      . LEU B 1 84  ? -25.310 40.122  52.586  1.00 22.60  ? 84  LEU B H      1 
ATOM   3746 H  HA     . LEU B 1 84  ? -23.770 41.653  51.177  1.00 16.83  ? 84  LEU B HA     1 
ATOM   3747 H  HB2    . LEU B 1 84  ? -25.591 42.364  52.559  1.00 15.63  ? 84  LEU B HB2    1 
ATOM   3748 H  HB3    . LEU B 1 84  ? -24.606 42.233  53.799  1.00 15.63  ? 84  LEU B HB3    1 
ATOM   3749 H  HG     . LEU B 1 84  ? -23.280 43.957  52.766  1.00 18.12  ? 84  LEU B HG     1 
ATOM   3750 H  HD11   . LEU B 1 84  ? -24.355 45.321  51.202  1.00 23.07  ? 84  LEU B HD11   1 
ATOM   3751 H  HD12   . LEU B 1 84  ? -24.063 43.873  50.617  1.00 23.07  ? 84  LEU B HD12   1 
ATOM   3752 H  HD13   . LEU B 1 84  ? -25.527 44.253  51.104  1.00 23.07  ? 84  LEU B HD13   1 
ATOM   3753 H  HD21   . LEU B 1 84  ? -24.648 45.656  53.602  1.00 17.78  ? 84  LEU B HD21   1 
ATOM   3754 H  HD22   . LEU B 1 84  ? -25.877 44.650  53.628  1.00 17.78  ? 84  LEU B HD22   1 
ATOM   3755 H  HD23   . LEU B 1 84  ? -24.642 44.420  54.600  1.00 17.78  ? 84  LEU B HD23   1 
ATOM   3756 N  N      . LEU B 1 85  ? -22.344 40.555  53.827  1.00 12.33  ? 85  LEU B N      1 
ATOM   3757 C  CA     . LEU B 1 85  ? -21.032 40.377  54.443  1.00 17.34  ? 85  LEU B CA     1 
ATOM   3758 C  C      . LEU B 1 85  ? -20.126 39.512  53.572  1.00 16.60  ? 85  LEU B C      1 
ATOM   3759 O  O      . LEU B 1 85  ? -18.934 39.805  53.423  1.00 21.11  ? 85  LEU B O      1 
ATOM   3760 C  CB     . LEU B 1 85  ? -21.185 39.779  55.840  1.00 20.50  ? 85  LEU B CB     1 
ATOM   3761 C  CG     . LEU B 1 85  ? -21.782 40.726  56.885  1.00 17.75  ? 85  LEU B CG     1 
ATOM   3762 C  CD1    . LEU B 1 85  ? -22.100 39.984  58.170  1.00 22.98  ? 85  LEU B CD1    1 
ATOM   3763 C  CD2    . LEU B 1 85  ? -20.843 41.887  57.166  1.00 23.51  ? 85  LEU B CD2    1 
ATOM   3764 H  H      . LEU B 1 85  ? -22.993 40.189  54.256  1.00 15.01  ? 85  LEU B H      1 
ATOM   3765 H  HA     . LEU B 1 85  ? -20.609 41.245  54.539  1.00 21.02  ? 85  LEU B HA     1 
ATOM   3766 H  HB2    . LEU B 1 85  ? -21.766 39.005  55.781  1.00 24.82  ? 85  LEU B HB2    1 
ATOM   3767 H  HB3    . LEU B 1 85  ? -20.308 39.511  56.157  1.00 24.82  ? 85  LEU B HB3    1 
ATOM   3768 H  HG     . LEU B 1 85  ? -22.610 41.088  56.532  1.00 21.51  ? 85  LEU B HG     1 
ATOM   3769 H  HD11   . LEU B 1 85  ? -22.484 40.606  58.808  1.00 27.80  ? 85  LEU B HD11   1 
ATOM   3770 H  HD12   . LEU B 1 85  ? -22.734 39.275  57.977  1.00 27.80  ? 85  LEU B HD12   1 
ATOM   3771 H  HD13   . LEU B 1 85  ? -21.281 39.607  58.528  1.00 27.80  ? 85  LEU B HD13   1 
ATOM   3772 H  HD21   . LEU B 1 85  ? -21.178 42.387  57.927  1.00 28.43  ? 85  LEU B HD21   1 
ATOM   3773 H  HD22   . LEU B 1 85  ? -19.960 41.538  57.363  1.00 28.43  ? 85  LEU B HD22   1 
ATOM   3774 H  HD23   . LEU B 1 85  ? -20.806 42.460  56.384  1.00 28.43  ? 85  LEU B HD23   1 
ATOM   3775 N  N      . SER B 1 86  ? -20.662 38.426  53.010  1.00 18.57  ? 86  SER B N      1 
ATOM   3776 C  CA     . SER B 1 86  ? -19.869 37.577  52.129  1.00 15.31  ? 86  SER B CA     1 
ATOM   3777 C  C      . SER B 1 86  ? -19.368 38.361  50.929  1.00 15.25  ? 86  SER B C      1 
ATOM   3778 O  O      . SER B 1 86  ? -18.258 38.121  50.441  1.00 22.87  ? 86  SER B O      1 
ATOM   3779 C  CB     . SER B 1 86  ? -20.694 36.378  51.661  1.00 10.94  ? 86  SER B CB     1 
ATOM   3780 O  OG     . SER B 1 86  ? -21.055 35.552  52.750  1.00 43.32  ? 86  SER B OG     1 
ATOM   3781 H  H      . SER B 1 86  ? -21.473 38.162  53.121  1.00 22.50  ? 86  SER B H      1 
ATOM   3782 H  HA     . SER B 1 86  ? -19.106 37.244  52.626  1.00 18.59  ? 86  SER B HA     1 
ATOM   3783 H  HB2    . SER B 1 86  ? -21.501 36.700  51.229  1.00 13.34  ? 86  SER B HB2    1 
ATOM   3784 H  HB3    . SER B 1 86  ? -20.166 35.859  51.034  1.00 13.34  ? 86  SER B HB3    1 
ATOM   3785 H  HG     . SER B 1 86  ? -21.515 35.988  53.301  1.00 52.20  ? 86  SER B HG     1 
ATOM   3786 N  N      . TYR B 1 87  ? -20.176 39.298  50.432  1.00 17.45  ? 87  TYR B N      1 
ATOM   3787 C  CA     . TYR B 1 87  ? -19.794 40.047  49.243  1.00 12.55  ? 87  TYR B CA     1 
ATOM   3788 C  C      . TYR B 1 87  ? -18.733 41.091  49.580  1.00 12.23  ? 87  TYR B C      1 
ATOM   3789 O  O      . TYR B 1 87  ? -17.644 41.100  48.996  1.00 27.13  ? 87  TYR B O      1 
ATOM   3790 C  CB     . TYR B 1 87  ? -21.018 40.728  48.631  1.00 12.19  ? 87  TYR B CB     1 
ATOM   3791 C  CG     . TYR B 1 87  ? -20.755 41.349  47.282  1.00 9.31   ? 87  TYR B CG     1 
ATOM   3792 C  CD1    . TYR B 1 87  ? -20.435 42.692  47.158  1.00 16.22  ? 87  TYR B CD1    1 
ATOM   3793 C  CD2    . TYR B 1 87  ? -20.764 40.571  46.136  1.00 15.42  ? 87  TYR B CD2    1 
ATOM   3794 C  CE1    . TYR B 1 87  ? -20.176 43.251  45.921  1.00 19.74  ? 87  TYR B CE1    1 
ATOM   3795 C  CE2    . TYR B 1 87  ? -20.518 41.120  44.899  1.00 20.49  ? 87  TYR B CE2    1 
ATOM   3796 C  CZ     . TYR B 1 87  ? -20.216 42.459  44.796  1.00 15.16  ? 87  TYR B CZ     1 
ATOM   3797 O  OH     . TYR B 1 87  ? -19.959 43.003  43.558  1.00 22.71  ? 87  TYR B OH     1 
ATOM   3798 H  H      . TYR B 1 87  ? -20.940 39.514  50.761  1.00 21.16  ? 87  TYR B H      1 
ATOM   3799 H  HA     . TYR B 1 87  ? -19.431 39.430  48.588  1.00 15.27  ? 87  TYR B HA     1 
ATOM   3800 H  HB2    . TYR B 1 87  ? -21.720 40.068  48.522  1.00 14.84  ? 87  TYR B HB2    1 
ATOM   3801 H  HB3    . TYR B 1 87  ? -21.315 41.432  49.229  1.00 14.84  ? 87  TYR B HB3    1 
ATOM   3802 H  HD1    . TYR B 1 87  ? -20.395 43.225  47.919  1.00 19.68  ? 87  TYR B HD1    1 
ATOM   3803 H  HD2    . TYR B 1 87  ? -20.941 39.661  46.204  1.00 18.71  ? 87  TYR B HD2    1 
ATOM   3804 H  HE1    . TYR B 1 87  ? -19.975 44.156  45.850  1.00 23.91  ? 87  TYR B HE1    1 
ATOM   3805 H  HE2    . TYR B 1 87  ? -20.554 40.589  44.136  1.00 24.80  ? 87  TYR B HE2    1 
ATOM   3806 H  HH     . TYR B 1 87  ? -20.094 42.430  42.959  1.00 27.47  ? 87  TYR B HH     1 
ATOM   3807 N  N      . TYR B 1 88  ? -19.031 41.968  50.539  1.00 11.12  ? 88  TYR B N      1 
ATOM   3808 C  CA     . TYR B 1 88  ? -18.156 43.102  50.812  1.00 15.24  ? 88  TYR B CA     1 
ATOM   3809 C  C      . TYR B 1 88  ? -17.059 42.785  51.817  1.00 16.62  ? 88  TYR B C      1 
ATOM   3810 O  O      . TYR B 1 88  ? -15.906 43.177  51.609  1.00 29.64  ? 88  TYR B O      1 
ATOM   3811 C  CB     . TYR B 1 88  ? -18.981 44.284  51.323  1.00 13.51  ? 88  TYR B CB     1 
ATOM   3812 C  CG     . TYR B 1 88  ? -19.806 44.940  50.246  1.00 13.33  ? 88  TYR B CG     1 
ATOM   3813 C  CD1    . TYR B 1 88  ? -19.217 45.755  49.292  1.00 20.30  ? 88  TYR B CD1    1 
ATOM   3814 C  CD2    . TYR B 1 88  ? -21.175 44.732  50.173  1.00 16.54  ? 88  TYR B CD2    1 
ATOM   3815 C  CE1    . TYR B 1 88  ? -19.972 46.352  48.301  1.00 23.15  ? 88  TYR B CE1    1 
ATOM   3816 C  CE2    . TYR B 1 88  ? -21.936 45.322  49.189  1.00 13.39  ? 88  TYR B CE2    1 
ATOM   3817 C  CZ     . TYR B 1 88  ? -21.333 46.128  48.257  1.00 17.36  ? 88  TYR B CZ     1 
ATOM   3818 O  OH     . TYR B 1 88  ? -22.102 46.713  47.279  1.00 26.55  ? 88  TYR B OH     1 
ATOM   3819 H  H      . TYR B 1 88  ? -19.729 41.927  51.040  1.00 13.56  ? 88  TYR B H      1 
ATOM   3820 H  HA     . TYR B 1 88  ? -17.726 43.355  49.980  1.00 18.51  ? 88  TYR B HA     1 
ATOM   3821 H  HB2    . TYR B 1 88  ? -19.586 43.971  52.013  1.00 16.43  ? 88  TYR B HB2    1 
ATOM   3822 H  HB3    . TYR B 1 88  ? -18.380 44.953  51.687  1.00 16.43  ? 88  TYR B HB3    1 
ATOM   3823 H  HD1    . TYR B 1 88  ? -18.299 45.902  49.320  1.00 24.58  ? 88  TYR B HD1    1 
ATOM   3824 H  HD2    . TYR B 1 88  ? -21.587 44.183  50.801  1.00 20.07  ? 88  TYR B HD2    1 
ATOM   3825 H  HE1    . TYR B 1 88  ? -19.566 46.900  47.669  1.00 28.00  ? 88  TYR B HE1    1 
ATOM   3826 H  HE2    . TYR B 1 88  ? -22.854 45.175  49.157  1.00 16.29  ? 88  TYR B HE2    1 
ATOM   3827 H  HH     . TYR B 1 88  ? -21.626 47.209  46.797  1.00 32.08  ? 88  TYR B HH     1 
ATOM   3828 N  N      . ALA B 1 89  ? -17.382 42.071  52.895  1.00 24.42  ? 89  ALA B N      1 
ATOM   3829 C  CA     . ALA B 1 89  ? -16.388 41.810  53.930  1.00 26.99  ? 89  ALA B CA     1 
ATOM   3830 C  C      . ALA B 1 89  ? -15.456 40.679  53.514  1.00 31.39  ? 89  ALA B C      1 
ATOM   3831 O  O      . ALA B 1 89  ? -14.230 40.840  53.522  1.00 47.99  ? 89  ALA B O      1 
ATOM   3832 C  CB     . ALA B 1 89  ? -17.077 41.481  55.254  1.00 22.10  ? 89  ALA B CB     1 
ATOM   3833 H  H      . ALA B 1 89  ? -18.158 41.733  53.049  1.00 29.52  ? 89  ALA B H      1 
ATOM   3834 H  HA     . ALA B 1 89  ? -15.855 42.609  54.065  1.00 32.61  ? 89  ALA B HA     1 
ATOM   3835 H  HB1    . ALA B 1 89  ? -16.403 41.371  55.942  1.00 26.74  ? 89  ALA B HB1    1 
ATOM   3836 H  HB2    . ALA B 1 89  ? -17.674 42.209  55.488  1.00 26.74  ? 89  ALA B HB2    1 
ATOM   3837 H  HB3    . ALA B 1 89  ? -17.582 40.659  55.152  1.00 26.74  ? 89  ALA B HB3    1 
ATOM   3838 N  N      . HIS B 1 90  ? -16.019 39.523  53.160  1.00 26.16  ? 90  HIS B N      1 
ATOM   3839 C  CA     . HIS B 1 90  ? -15.210 38.391  52.734  1.00 24.88  ? 90  HIS B CA     1 
ATOM   3840 C  C      . HIS B 1 90  ? -14.736 38.510  51.292  1.00 25.41  ? 90  HIS B C      1 
ATOM   3841 O  O      . HIS B 1 90  ? -13.734 37.885  50.931  1.00 54.90  ? 90  HIS B O      1 
ATOM   3842 C  CB     . HIS B 1 90  ? -15.992 37.090  52.906  1.00 30.34  ? 90  HIS B CB     1 
ATOM   3843 C  CG     . HIS B 1 90  ? -15.175 35.864  52.654  1.00 50.38  ? 90  HIS B CG     1 
ATOM   3844 N  ND1    . HIS B 1 90  ? -15.024 35.316  51.399  1.00 51.85  ? 90  HIS B ND1    1 
ATOM   3845 C  CD2    . HIS B 1 90  ? -14.435 35.099  53.491  1.00 58.42  ? 90  HIS B CD2    1 
ATOM   3846 C  CE1    . HIS B 1 90  ? -14.246 34.251  51.477  1.00 53.41  ? 90  HIS B CE1    1 
ATOM   3847 N  NE2    . HIS B 1 90  ? -13.872 34.100  52.735  1.00 67.25  ? 90  HIS B NE2    1 
ATOM   3848 H  H      . HIS B 1 90  ? -16.866 39.373  53.160  1.00 31.61  ? 90  HIS B H      1 
ATOM   3849 H  HA     . HIS B 1 90  ? -14.424 38.346  53.301  1.00 30.07  ? 90  HIS B HA     1 
ATOM   3850 H  HB2    . HIS B 1 90  ? -16.325 37.043  53.816  1.00 36.62  ? 90  HIS B HB2    1 
ATOM   3851 H  HB3    . HIS B 1 90  ? -16.734 37.086  52.282  1.00 36.62  ? 90  HIS B HB3    1 
ATOM   3852 H  HD2    . HIS B 1 90  ? -14.328 35.226  54.406  1.00 70.32  ? 90  HIS B HD2    1 
ATOM   3853 H  HE1    . HIS B 1 90  ? -14.002 33.702  50.767  1.00 64.30  ? 90  HIS B HE1    1 
ATOM   3854 H  HE2    . HIS B 1 90  ? -13.360 33.477  53.032  1.00 80.92  ? 90  HIS B HE2    1 
ATOM   3855 N  N      . GLY B 1 91  ? -15.431 39.279  50.461  1.00 24.34  ? 91  GLY B N      1 
ATOM   3856 C  CA     . GLY B 1 91  ? -15.013 39.492  49.094  1.00 10.92  ? 91  GLY B CA     1 
ATOM   3857 C  C      . GLY B 1 91  ? -15.528 38.493  48.085  1.00 13.26  ? 91  GLY B C      1 
ATOM   3858 O  O      . GLY B 1 91  ? -15.110 38.546  46.923  1.00 27.35  ? 91  GLY B O      1 
ATOM   3859 H  H      . GLY B 1 91  ? -16.156 39.691  50.674  1.00 29.43  ? 91  GLY B H      1 
ATOM   3860 H  HA2    . GLY B 1 91  ? -15.314 40.370  48.814  1.00 13.31  ? 91  GLY B HA2    1 
ATOM   3861 H  HA3    . GLY B 1 91  ? -14.044 39.465  49.062  1.00 13.31  ? 91  GLY B HA3    1 
ATOM   3862 N  N      . SER B 1 92  ? -16.420 37.589  48.480  1.00 19.95  ? 92  SER B N      1 
ATOM   3863 C  CA     . SER B 1 92  ? -16.964 36.620  47.541  1.00 11.07  ? 92  SER B CA     1 
ATOM   3864 C  C      . SER B 1 92  ? -17.752 37.311  46.435  1.00 19.96  ? 92  SER B C      1 
ATOM   3865 O  O      . SER B 1 92  ? -18.262 38.423  46.598  1.00 22.16  ? 92  SER B O      1 
ATOM   3866 C  CB     . SER B 1 92  ? -17.858 35.621  48.267  1.00 16.08  ? 92  SER B CB     1 
ATOM   3867 O  OG     . SER B 1 92  ? -17.098 34.839  49.172  1.00 52.42  ? 92  SER B OG     1 
ATOM   3868 H  H      . SER B 1 92  ? -16.724 37.516  49.281  1.00 24.15  ? 92  SER B H      1 
ATOM   3869 H  HA     . SER B 1 92  ? -16.232 36.135  47.129  1.00 13.51  ? 92  SER B HA     1 
ATOM   3870 H  HB2    . SER B 1 92  ? -18.538 36.105  48.761  1.00 19.51  ? 92  SER B HB2    1 
ATOM   3871 H  HB3    . SER B 1 92  ? -18.274 35.036  47.615  1.00 19.51  ? 92  SER B HB3    1 
ATOM   3872 H  HG     . SER B 1 92  ? -16.824 35.318  49.805  1.00 63.12  ? 92  SER B HG     1 
ATOM   3873 N  N      . SER B 1 93  ? -17.828 36.643  45.292  1.00 14.68  ? 93  SER B N      1 
ATOM   3874 C  CA     . SER B 1 93  ? -18.557 37.148  44.142  1.00 12.25  ? 93  SER B CA     1 
ATOM   3875 C  C      . SER B 1 93  ? -20.008 36.699  44.194  1.00 20.69  ? 93  SER B C      1 
ATOM   3876 O  O      . SER B 1 93  ? -20.362 35.739  44.882  1.00 35.52  ? 93  SER B O      1 
ATOM   3877 C  CB     . SER B 1 93  ? -17.914 36.664  42.844  1.00 29.65  ? 93  SER B CB     1 
ATOM   3878 O  OG     . SER B 1 93  ? -17.956 35.249  42.762  1.00 16.02  ? 93  SER B OG     1 
ATOM   3879 H  H      . SER B 1 93  ? -17.457 35.879  45.157  1.00 17.83  ? 93  SER B H      1 
ATOM   3880 H  HA     . SER B 1 93  ? -18.534 38.118  44.149  1.00 14.91  ? 93  SER B HA     1 
ATOM   3881 H  HB2    . SER B 1 93  ? -18.398 37.040  42.092  1.00 35.79  ? 93  SER B HB2    1 
ATOM   3882 H  HB3    . SER B 1 93  ? -16.989 36.955  42.822  1.00 35.79  ? 93  SER B HB3    1 
ATOM   3883 H  HG     . SER B 1 93  ? -17.604 34.992  42.044  1.00 19.44  ? 93  SER B HG     1 
ATOM   3884 N  N      . LYS B 1 94  ? -20.855 37.403  43.440  1.00 21.01  ? 94  LYS B N      1 
ATOM   3885 C  CA     . LYS B 1 94  ? -22.251 36.997  43.358  1.00 19.27  ? 94  LYS B CA     1 
ATOM   3886 C  C      . LYS B 1 94  ? -22.364 35.566  42.851  1.00 13.49  ? 94  LYS B C      1 
ATOM   3887 O  O      . LYS B 1 94  ? -23.145 34.772  43.383  1.00 24.29  ? 94  LYS B O      1 
ATOM   3888 C  CB     . LYS B 1 94  ? -23.032 37.940  42.443  1.00 22.57  ? 94  LYS B CB     1 
ATOM   3889 C  CG     . LYS B 1 94  ? -23.064 39.385  42.910  1.00 15.62  ? 94  LYS B CG     1 
ATOM   3890 C  CD     . LYS B 1 94  ? -24.086 40.209  42.132  1.00 16.82  ? 94  LYS B CD     1 
ATOM   3891 C  CE     . LYS B 1 94  ? -23.797 40.234  40.645  1.00 23.66  ? 94  LYS B CE     1 
ATOM   3892 N  NZ     . LYS B 1 94  ? -24.761 41.105  39.917  1.00 53.12  ? 94  LYS B NZ     1 
ATOM   3893 H  H      . LYS B 1 94  ? -20.651 38.100  42.980  1.00 25.43  ? 94  LYS B H      1 
ATOM   3894 H  HA     . LYS B 1 94  ? -22.642 37.050  44.243  1.00 23.34  ? 94  LYS B HA     1 
ATOM   3895 H  HB2    . LYS B 1 94  ? -22.624 37.925  41.563  1.00 27.30  ? 94  LYS B HB2    1 
ATOM   3896 H  HB3    . LYS B 1 94  ? -23.949 37.629  42.389  1.00 27.30  ? 94  LYS B HB3    1 
ATOM   3897 H  HG2    . LYS B 1 94  ? -23.304 39.413  43.850  1.00 18.95  ? 94  LYS B HG2    1 
ATOM   3898 H  HG3    . LYS B 1 94  ? -22.189 39.783  42.780  1.00 18.95  ? 94  LYS B HG3    1 
ATOM   3899 H  HD2    . LYS B 1 94  ? -24.967 39.826  42.261  1.00 20.40  ? 94  LYS B HD2    1 
ATOM   3900 H  HD3    . LYS B 1 94  ? -24.070 41.123  42.457  1.00 20.40  ? 94  LYS B HD3    1 
ATOM   3901 H  HE2    . LYS B 1 94  ? -22.902 40.579  40.497  1.00 28.61  ? 94  LYS B HE2    1 
ATOM   3902 H  HE3    . LYS B 1 94  ? -23.869 39.335  40.288  1.00 28.61  ? 94  LYS B HE3    1 
ATOM   3903 H  HZ1    . LYS B 1 94  ? -24.669 41.949  40.183  1.00 63.96  ? 94  LYS B HZ1    1 
ATOM   3904 H  HZ2    . LYS B 1 94  ? -24.611 41.060  39.041  1.00 63.96  ? 94  LYS B HZ2    1 
ATOM   3905 H  HZ3    . LYS B 1 94  ? -25.595 40.840  40.081  1.00 63.96  ? 94  LYS B HZ3    1 
ATOM   3906 N  N      . HIS B 1 95  ? -21.568 35.210  41.841  1.00 22.90  ? 95  HIS B N      1 
ATOM   3907 C  CA     . HIS B 1 95  ? -21.638 33.864  41.283  1.00 30.21  ? 95  HIS B CA     1 
ATOM   3908 C  C      . HIS B 1 95  ? -21.257 32.824  42.326  1.00 20.67  ? 95  HIS B C      1 
ATOM   3909 O  O      . HIS B 1 95  ? -21.882 31.761  42.408  1.00 22.44  ? 95  HIS B O      1 
ATOM   3910 C  CB     . HIS B 1 95  ? -20.734 33.763  40.052  1.00 33.47  ? 95  HIS B CB     1 
ATOM   3911 C  CG     . HIS B 1 95  ? -20.854 32.467  39.312  1.00 23.09  ? 95  HIS B CG     1 
ATOM   3912 N  ND1    . HIS B 1 95  ? -19.949 31.439  39.463  1.00 33.65  ? 95  HIS B ND1    1 
ATOM   3913 C  CD2    . HIS B 1 95  ? -21.765 32.036  38.408  1.00 21.83  ? 95  HIS B CD2    1 
ATOM   3914 C  CE1    . HIS B 1 95  ? -20.300 30.429  38.688  1.00 37.02  ? 95  HIS B CE1    1 
ATOM   3915 N  NE2    . HIS B 1 95  ? -21.399 30.765  38.037  1.00 30.78  ? 95  HIS B NE2    1 
ATOM   3916 H  H      . HIS B 1 95  ? -20.987 35.722  41.466  1.00 27.69  ? 95  HIS B H      1 
ATOM   3917 H  HA     . HIS B 1 95  ? -22.547 33.682  40.998  1.00 36.47  ? 95  HIS B HA     1 
ATOM   3918 H  HB2    . HIS B 1 95  ? -20.967 34.476  39.437  1.00 40.39  ? 95  HIS B HB2    1 
ATOM   3919 H  HB3    . HIS B 1 95  ? -19.812 33.857  40.336  1.00 40.39  ? 95  HIS B HB3    1 
ATOM   3920 H  HD1    . HIS B 1 95  ? -19.262 31.453  39.981  1.00 40.60  ? 95  HIS B HD1    1 
ATOM   3921 H  HD2    . HIS B 1 95  ? -22.501 32.512  38.096  1.00 26.42  ? 95  HIS B HD2    1 
ATOM   3922 H  HE1    . HIS B 1 95  ? -19.850 29.618  38.613  1.00 44.64  ? 95  HIS B HE1    1 
ATOM   3923 N  N      . ALA B 1 96  ? -20.239 33.115  43.139  1.00 20.09  ? 96  ALA B N      1 
ATOM   3924 C  CA     . ALA B 1 96  ? -19.824 32.172  44.172  1.00 17.36  ? 96  ALA B CA     1 
ATOM   3925 C  C      . ALA B 1 96  ? -20.900 32.015  45.240  1.00 19.25  ? 96  ALA B C      1 
ATOM   3926 O  O      . ALA B 1 96  ? -21.147 30.903  45.720  1.00 40.76  ? 96  ALA B O      1 
ATOM   3927 C  CB     . ALA B 1 96  ? -18.507 32.628  44.797  1.00 16.99  ? 96  ALA B CB     1 
ATOM   3928 H  H      . ALA B 1 96  ? -19.779 33.841  43.114  1.00 24.32  ? 96  ALA B H      1 
ATOM   3929 H  HA     . ALA B 1 96  ? -19.677 31.305  43.765  1.00 21.05  ? 96  ALA B HA     1 
ATOM   3930 H  HB1    . ALA B 1 96  ? -18.245 31.992  45.482  1.00 20.61  ? 96  ALA B HB1    1 
ATOM   3931 H  HB2    . ALA B 1 96  ? -17.827 32.669  44.107  1.00 20.61  ? 96  ALA B HB2    1 
ATOM   3932 H  HB3    . ALA B 1 96  ? -18.631 33.505  45.192  1.00 20.61  ? 96  ALA B HB3    1 
ATOM   3933 N  N      . ILE B 1 97  ? -21.547 33.116  45.628  1.00 30.42  ? 97  ILE B N      1 
ATOM   3934 C  CA     . ILE B 1 97  ? -22.630 33.049  46.607  1.00 22.50  ? 97  ILE B CA     1 
ATOM   3935 C  C      . ILE B 1 97  ? -23.800 32.244  46.056  1.00 28.21  ? 97  ILE B C      1 
ATOM   3936 O  O      . ILE B 1 97  ? -24.375 31.391  46.749  1.00 29.59  ? 97  ILE B O      1 
ATOM   3937 C  CB     . ILE B 1 97  ? -23.062 34.475  47.007  1.00 13.69  ? 97  ILE B CB     1 
ATOM   3938 C  CG1    . ILE B 1 97  ? -21.904 35.187  47.711  1.00 16.27  ? 97  ILE B CG1    1 
ATOM   3939 C  CG2    . ILE B 1 97  ? -24.317 34.427  47.859  1.00 31.40  ? 97  ILE B CG2    1 
ATOM   3940 C  CD1    . ILE B 1 97  ? -22.157 36.638  48.019  1.00 14.48  ? 97  ILE B CD1    1 
ATOM   3941 H  H      . ILE B 1 97  ? -21.380 33.910  45.342  1.00 36.72  ? 97  ILE B H      1 
ATOM   3942 H  HA     . ILE B 1 97  ? -22.305 32.594  47.399  1.00 27.22  ? 97  ILE B HA     1 
ATOM   3943 H  HB     . ILE B 1 97  ? -23.279 34.984  46.211  1.00 16.65  ? 97  ILE B HB     1 
ATOM   3944 H  HG12   . ILE B 1 97  ? -21.729 34.736  48.552  1.00 19.74  ? 97  ILE B HG12   1 
ATOM   3945 H  HG13   . ILE B 1 97  ? -21.120 35.142  47.141  1.00 19.74  ? 97  ILE B HG13   1 
ATOM   3946 H  HG21   . ILE B 1 97  ? -24.437 35.285  48.294  1.00 37.90  ? 97  ILE B HG21   1 
ATOM   3947 H  HG22   . ILE B 1 97  ? -25.079 34.236  47.289  1.00 37.90  ? 97  ILE B HG22   1 
ATOM   3948 H  HG23   . ILE B 1 97  ? -24.220 33.729  48.526  1.00 37.90  ? 97  ILE B HG23   1 
ATOM   3949 H  HD11   . ILE B 1 97  ? -21.332 37.045  48.328  1.00 17.59  ? 97  ILE B HD11   1 
ATOM   3950 H  HD12   . ILE B 1 97  ? -22.463 37.083  47.213  1.00 17.59  ? 97  ILE B HD12   1 
ATOM   3951 H  HD13   . ILE B 1 97  ? -22.835 36.701  48.709  1.00 17.59  ? 97  ILE B HD13   1 
ATOM   3952 N  N      . ALA B 1 98  ? -24.172 32.500  44.801  1.00 18.09  ? 98  ALA B N      1 
ATOM   3953 C  CA     . ALA B 1 98  ? -25.262 31.755  44.184  1.00 22.67  ? 98  ALA B CA     1 
ATOM   3954 C  C      . ALA B 1 98  ? -24.919 30.277  44.077  1.00 28.97  ? 98  ALA B C      1 
ATOM   3955 O  O      . ALA B 1 98  ? -25.782 29.419  44.277  1.00 35.75  ? 98  ALA B O      1 
ATOM   3956 C  CB     . ALA B 1 98  ? -25.587 32.331  42.807  1.00 14.77  ? 98  ALA B CB     1 
ATOM   3957 H  H      . ALA B 1 98  ? -23.813 33.092  44.290  1.00 21.93  ? 98  ALA B H      1 
ATOM   3958 H  HA     . ALA B 1 98  ? -26.053 31.845  44.738  1.00 27.42  ? 98  ALA B HA     1 
ATOM   3959 H  HB1    . ALA B 1 98  ? -26.314 31.822  42.415  1.00 17.94  ? 98  ALA B HB1    1 
ATOM   3960 H  HB2    . ALA B 1 98  ? -25.850 33.260  42.907  1.00 17.94  ? 98  ALA B HB2    1 
ATOM   3961 H  HB3    . ALA B 1 98  ? -24.799 32.270  42.245  1.00 17.94  ? 98  ALA B HB3    1 
ATOM   3962 N  N      . SER B 1 99  ? -23.660 29.958  43.774  1.00 28.61  ? 99  SER B N      1 
ATOM   3963 C  CA     A SER B 1 99  ? -23.261 28.558  43.680  0.29 29.14  ? 99  SER B CA     1 
ATOM   3964 C  CA     B SER B 1 99  ? -23.255 28.560  43.681  0.71 28.93  ? 99  SER B CA     1 
ATOM   3965 C  C      . SER B 1 99  ? -23.285 27.888  45.047  1.00 33.83  ? 99  SER B C      1 
ATOM   3966 O  O      . SER B 1 99  ? -23.703 26.734  45.168  1.00 54.19  ? 99  SER B O      1 
ATOM   3967 C  CB     A SER B 1 99  ? -21.871 28.446  43.057  0.29 32.50  ? 99  SER B CB     1 
ATOM   3968 C  CB     B SER B 1 99  ? -21.859 28.457  43.067  0.71 32.68  ? 99  SER B CB     1 
ATOM   3969 O  OG     A SER B 1 99  ? -20.884 28.985  43.917  0.29 29.51  ? 99  SER B OG     1 
ATOM   3970 O  OG     B SER B 1 99  ? -21.842 28.945  41.735  0.71 36.52  ? 99  SER B OG     1 
ATOM   3971 H  H      A SER B 1 99  ? -23.029 30.521  43.621  0.29 34.55  ? 99  SER B H      1 
ATOM   3972 H  H      B SER B 1 99  ? -23.030 30.522  43.620  0.71 34.55  ? 99  SER B H      1 
ATOM   3973 H  HA     A SER B 1 99  ? -23.887 28.095  43.103  0.29 35.18  ? 99  SER B HA     1 
ATOM   3974 H  HA     B SER B 1 99  ? -23.875 28.093  43.099  0.71 34.93  ? 99  SER B HA     1 
ATOM   3975 H  HB2    A SER B 1 99  ? -21.672 27.511  42.896  0.29 39.21  ? 99  SER B HB2    1 
ATOM   3976 H  HB2    B SER B 1 99  ? -21.242 28.982  43.601  0.71 39.43  ? 99  SER B HB2    1 
ATOM   3977 H  HB3    A SER B 1 99  ? -21.860 28.936  42.220  0.29 39.21  ? 99  SER B HB3    1 
ATOM   3978 H  HB3    B SER B 1 99  ? -21.585 27.527  43.063  0.71 39.43  ? 99  SER B HB3    1 
ATOM   3979 H  HG     A SER B 1 99  ? -21.081 29.776  44.121  0.29 35.62  ? 99  SER B HG     1 
ATOM   3980 H  HG     B SER B 1 99  ? -22.082 29.749  41.721  0.71 44.04  ? 99  SER B HG     1 
ATOM   3981 N  N      . TYR B 1 100 ? -22.841 28.592  46.090  1.00 33.49  ? 100 TYR B N      1 
ATOM   3982 C  CA     . TYR B 1 100 ? -22.864 28.009  47.426  1.00 42.03  ? 100 TYR B CA     1 
ATOM   3983 C  C      . TYR B 1 100 ? -24.292 27.774  47.897  1.00 45.52  ? 100 TYR B C      1 
ATOM   3984 O  O      . TYR B 1 100 ? -24.569 26.790  48.592  1.00 62.71  ? 100 TYR B O      1 
ATOM   3985 C  CB     . TYR B 1 100 ? -22.131 28.910  48.417  1.00 47.89  ? 100 TYR B CB     1 
ATOM   3986 C  CG     . TYR B 1 100 ? -22.331 28.495  49.860  1.00 51.17  ? 100 TYR B CG     1 
ATOM   3987 C  CD1    . TYR B 1 100 ? -21.558 27.490  50.425  1.00 61.47  ? 100 TYR B CD1    1 
ATOM   3988 C  CD2    . TYR B 1 100 ? -23.301 29.098  50.652  1.00 38.08  ? 100 TYR B CD2    1 
ATOM   3989 C  CE1    . TYR B 1 100 ? -21.735 27.104  51.739  1.00 57.67  ? 100 TYR B CE1    1 
ATOM   3990 C  CE2    . TYR B 1 100 ? -23.486 28.717  51.968  1.00 45.17  ? 100 TYR B CE2    1 
ATOM   3991 C  CZ     . TYR B 1 100 ? -22.700 27.719  52.506  1.00 50.56  ? 100 TYR B CZ     1 
ATOM   3992 O  OH     . TYR B 1 100 ? -22.873 27.330  53.814  1.00 32.12  ? 100 TYR B OH     1 
ATOM   3993 H  H      . TYR B 1 100 ? -22.528 29.392  46.052  1.00 40.40  ? 100 TYR B H      1 
ATOM   3994 H  HA     . TYR B 1 100 ? -22.401 27.156  47.394  1.00 50.65  ? 100 TYR B HA     1 
ATOM   3995 H  HB2    . TYR B 1 100 ? -21.181 28.879  48.226  1.00 57.69  ? 100 TYR B HB2    1 
ATOM   3996 H  HB3    . TYR B 1 100 ? -22.460 29.817  48.318  1.00 57.69  ? 100 TYR B HB3    1 
ATOM   3997 H  HD1    . TYR B 1 100 ? -20.908 27.070  49.909  1.00 73.98  ? 100 TYR B HD1    1 
ATOM   3998 H  HD2    . TYR B 1 100 ? -23.834 29.769  50.290  1.00 45.91  ? 100 TYR B HD2    1 
ATOM   3999 H  HE1    . TYR B 1 100 ? -21.206 26.432  52.105  1.00 69.42  ? 100 TYR B HE1    1 
ATOM   4000 H  HE2    . TYR B 1 100 ? -24.137 29.131  52.488  1.00 54.42  ? 100 TYR B HE2    1 
ATOM   4001 H  HH     . TYR B 1 100 ? -23.480 27.788  54.172  1.00 38.77  ? 100 TYR B HH     1 
ATOM   4002 N  N      . TYR B 1 101 ? -25.209 28.677  47.548  1.00 43.25  ? 101 TYR B N      1 
ATOM   4003 C  CA     . TYR B 1 101 ? -26.602 28.494  47.934  1.00 45.30  ? 101 TYR B CA     1 
ATOM   4004 C  C      . TYR B 1 101 ? -27.329 27.500  47.039  1.00 48.74  ? 101 TYR B C      1 
ATOM   4005 O  O      . TYR B 1 101 ? -28.335 26.930  47.466  1.00 79.05  ? 101 TYR B O      1 
ATOM   4006 C  CB     . TYR B 1 101 ? -27.327 29.840  47.937  1.00 49.72  ? 101 TYR B CB     1 
ATOM   4007 C  CG     . TYR B 1 101 ? -27.119 30.606  49.225  1.00 58.67  ? 101 TYR B CG     1 
ATOM   4008 C  CD1    . TYR B 1 101 ? -27.845 30.287  50.364  1.00 69.60  ? 101 TYR B CD1    1 
ATOM   4009 C  CD2    . TYR B 1 101 ? -26.185 31.631  49.312  1.00 52.67  ? 101 TYR B CD2    1 
ATOM   4010 C  CE1    . TYR B 1 101 ? -27.653 30.970  51.550  1.00 54.96  ? 101 TYR B CE1    1 
ATOM   4011 C  CE2    . TYR B 1 101 ? -25.990 32.323  50.497  1.00 48.87  ? 101 TYR B CE2    1 
ATOM   4012 C  CZ     . TYR B 1 101 ? -26.731 31.987  51.611  1.00 48.44  ? 101 TYR B CZ     1 
ATOM   4013 O  OH     . TYR B 1 101 ? -26.551 32.664  52.795  1.00 53.51  ? 101 TYR B OH     1 
ATOM   4014 H  H      . TYR B 1 101 ? -25.051 29.390  47.094  1.00 52.11  ? 101 TYR B H      1 
ATOM   4015 H  HA     . TYR B 1 101 ? -26.636 28.146  48.839  1.00 54.57  ? 101 TYR B HA     1 
ATOM   4016 H  HB2    . TYR B 1 101 ? -26.991 30.383  47.206  1.00 59.88  ? 101 TYR B HB2    1 
ATOM   4017 H  HB3    . TYR B 1 101 ? -28.279 29.688  47.827  1.00 59.88  ? 101 TYR B HB3    1 
ATOM   4018 H  HD1    . TYR B 1 101 ? -28.472 29.602  50.328  1.00 83.73  ? 101 TYR B HD1    1 
ATOM   4019 H  HD2    . TYR B 1 101 ? -25.682 31.857  48.563  1.00 63.42  ? 101 TYR B HD2    1 
ATOM   4020 H  HE1    . TYR B 1 101 ? -28.147 30.741  52.304  1.00 66.17  ? 101 TYR B HE1    1 
ATOM   4021 H  HE2    . TYR B 1 101 ? -25.363 33.008  50.541  1.00 58.86  ? 101 TYR B HE2    1 
ATOM   4022 H  HH     . TYR B 1 101 ? -26.038 33.319  52.676  1.00 64.42  ? 101 TYR B HH     1 
ATOM   4023 N  N      . HIS B 1 102 ? -26.840 27.277  45.818  1.00 42.28  ? 102 HIS B N      1 
ATOM   4024 C  CA     . HIS B 1 102 ? -27.379 26.220  44.969  1.00 50.03  ? 102 HIS B CA     1 
ATOM   4025 C  C      . HIS B 1 102 ? -26.912 24.855  45.453  1.00 47.82  ? 102 HIS B C      1 
ATOM   4026 O  O      . HIS B 1 102 ? -27.677 23.884  45.429  1.00 48.75  ? 102 HIS B O      1 
ATOM   4027 C  CB     . HIS B 1 102 ? -26.934 26.450  43.526  1.00 45.10  ? 102 HIS B CB     1 
ATOM   4028 C  CG     . HIS B 1 102 ? -27.361 25.376  42.578  1.00 32.51  ? 102 HIS B CG     1 
ATOM   4029 N  ND1    . HIS B 1 102 ? -28.658 25.258  42.124  1.00 56.71  ? 102 HIS B ND1    1 
ATOM   4030 C  CD2    . HIS B 1 102 ? -26.670 24.360  42.009  1.00 48.68  ? 102 HIS B CD2    1 
ATOM   4031 C  CE1    . HIS B 1 102 ? -28.743 24.226  41.304  1.00 61.50  ? 102 HIS B CE1    1 
ATOM   4032 N  NE2    . HIS B 1 102 ? -27.551 23.662  41.220  1.00 64.81  ? 102 HIS B NE2    1 
ATOM   4033 H  H      . HIS B 1 102 ? -26.199 27.722  45.458  1.00 50.95  ? 102 HIS B H      1 
ATOM   4034 H  HA     . HIS B 1 102 ? -28.348 26.244  45.000  1.00 60.25  ? 102 HIS B HA     1 
ATOM   4035 H  HB2    . HIS B 1 102 ? -27.313 27.287  43.214  1.00 54.33  ? 102 HIS B HB2    1 
ATOM   4036 H  HB3    . HIS B 1 102 ? -25.965 26.495  43.503  1.00 54.33  ? 102 HIS B HB3    1 
ATOM   4037 H  HD1    . HIS B 1 102 ? -29.309 25.775  42.342  1.00 68.27  ? 102 HIS B HD1    1 
ATOM   4038 H  HD2    . HIS B 1 102 ? -25.768 24.171  42.130  1.00 58.63  ? 102 HIS B HD2    1 
ATOM   4039 H  HE1    . HIS B 1 102 ? -29.511 23.945  40.861  1.00 74.01  ? 102 HIS B HE1    1 
ATOM   4040 N  N      . ARG B 1 103 ? -25.658 24.769  45.905  1.00 54.73  ? 103 ARG B N      1 
ATOM   4041 C  CA     . ARG B 1 103 ? -25.135 23.524  46.452  1.00 54.69  ? 103 ARG B CA     1 
ATOM   4042 C  C      . ARG B 1 103 ? -25.927 23.109  47.682  1.00 64.31  ? 103 ARG B C      1 
ATOM   4043 O  O      . ARG B 1 103 ? -26.283 21.934  47.834  1.00 80.75  ? 103 ARG B O      1 
ATOM   4044 C  CB     . ARG B 1 103 ? -23.647 23.684  46.789  1.00 65.95  ? 103 ARG B CB     1 
ATOM   4045 C  CG     . ARG B 1 103 ? -22.762 23.870  45.559  1.00 77.25  ? 103 ARG B CG     1 
ATOM   4046 C  CD     . ARG B 1 103 ? -21.296 24.253  45.854  1.00 85.24  ? 103 ARG B CD     1 
ATOM   4047 N  NE     . ARG B 1 103 ? -20.580 23.304  46.710  1.00 82.37  ? 103 ARG B NE     1 
ATOM   4048 C  CZ     . ARG B 1 103 ? -20.205 23.521  47.971  1.00 87.11  ? 103 ARG B CZ     1 
ATOM   4049 N  NH1    . ARG B 1 103 ? -20.436 24.684  48.571  1.00 79.36  ? 103 ARG B NH1    1 
ATOM   4050 N  NH2    . ARG B 1 103 ? -19.562 22.566  48.631  1.00 102.24 ? 103 ARG B NH2    1 
ATOM   4051 H  H      . ARG B 1 103 ? -25.091 25.417  45.905  1.00 65.89  ? 103 ARG B H      1 
ATOM   4052 H  HA     . ARG B 1 103 ? -25.212 22.822  45.787  1.00 65.84  ? 103 ARG B HA     1 
ATOM   4053 H  HB2    . ARG B 1 103 ? -23.536 24.463  47.356  1.00 79.35  ? 103 ARG B HB2    1 
ATOM   4054 H  HB3    . ARG B 1 103 ? -23.344 22.888  47.255  1.00 79.35  ? 103 ARG B HB3    1 
ATOM   4055 H  HG2    . ARG B 1 103 ? -22.748 23.037  45.062  1.00 92.92  ? 103 ARG B HG2    1 
ATOM   4056 H  HG3    . ARG B 1 103 ? -23.141 24.577  45.013  1.00 92.92  ? 103 ARG B HG3    1 
ATOM   4057 H  HD2    . ARG B 1 103 ? -20.815 24.308  45.013  1.00 102.50 ? 103 ARG B HD2    1 
ATOM   4058 H  HD3    . ARG B 1 103 ? -21.285 25.115  46.300  1.00 102.50 ? 103 ARG B HD3    1 
ATOM   4059 H  HE     . ARG B 1 103 ? -20.384 22.539  46.369  1.00 99.06  ? 103 ARG B HE     1 
ATOM   4060 H  HH11   . ARG B 1 103 ? -20.834 25.316  48.145  1.00 95.45  ? 103 ARG B HH11   1 
ATOM   4061 H  HH12   . ARG B 1 103 ? -20.187 24.805  49.385  1.00 95.45  ? 103 ARG B HH12   1 
ATOM   4062 H  HH21   . ARG B 1 103 ? -19.391 21.817  48.244  1.00 122.90 ? 103 ARG B HH21   1 
ATOM   4063 H  HH22   . ARG B 1 103 ? -19.317 22.697  49.444  1.00 122.90 ? 103 ARG B HH22   1 
ATOM   4064 N  N      . VAL B 1 104 ? -26.217 24.063  48.566  1.00 51.56  ? 104 VAL B N      1 
ATOM   4065 C  CA     . VAL B 1 104 ? -26.951 23.786  49.793  1.00 48.85  ? 104 VAL B CA     1 
ATOM   4066 C  C      . VAL B 1 104 ? -28.356 24.353  49.643  1.00 65.45  ? 104 VAL B C      1 
ATOM   4067 O  O      . VAL B 1 104 ? -28.726 25.310  50.332  1.00 82.34  ? 104 VAL B O      1 
ATOM   4068 C  CB     . VAL B 1 104 ? -26.239 24.409  51.008  1.00 55.90  ? 104 VAL B CB     1 
ATOM   4069 C  CG1    . VAL B 1 104 ? -26.922 23.992  52.309  1.00 82.75  ? 104 VAL B CG1    1 
ATOM   4070 C  CG2    . VAL B 1 104 ? -24.753 24.086  50.986  1.00 71.50  ? 104 VAL B CG2    1 
ATOM   4071 H  H      . VAL B 1 104 ? -25.995 24.888  48.474  1.00 62.09  ? 104 VAL B H      1 
ATOM   4072 H  HA     . VAL B 1 104 ? -27.010 22.828  49.933  1.00 58.83  ? 104 VAL B HA     1 
ATOM   4073 H  HB     . VAL B 1 104 ? -26.310 25.375  50.962  1.00 67.29  ? 104 VAL B HB     1 
ATOM   4074 H  HG11   . VAL B 1 104 ? -26.413 24.339  53.058  1.00 99.51  ? 104 VAL B HG11   1 
ATOM   4075 H  HG12   . VAL B 1 104 ? -27.822 24.354  52.324  1.00 99.51  ? 104 VAL B HG12   1 
ATOM   4076 H  HG13   . VAL B 1 104 ? -26.955 23.023  52.353  1.00 99.51  ? 104 VAL B HG13   1 
ATOM   4077 H  HG21   . VAL B 1 104 ? -24.362 24.340  51.837  1.00 86.02  ? 104 VAL B HG21   1 
ATOM   4078 H  HG22   . VAL B 1 104 ? -24.639 23.133  50.842  1.00 86.02  ? 104 VAL B HG22   1 
ATOM   4079 H  HG23   . VAL B 1 104 ? -24.332 24.582  50.267  1.00 86.02  ? 104 VAL B HG23   1 
ATOM   4080 N  N      . ALA B 1 105 ? -29.150 23.769  48.751  1.00 50.99  ? 105 ALA B N      1 
ATOM   4081 C  CA     . ALA B 1 105 ? -30.513 24.222  48.509  1.00 57.47  ? 105 ALA B CA     1 
ATOM   4082 C  C      . ALA B 1 105 ? -31.454 23.042  48.659  1.00 65.68  ? 105 ALA B C      1 
ATOM   4083 O  O      . ALA B 1 105 ? -31.370 22.074  47.896  1.00 75.97  ? 105 ALA B O      1 
ATOM   4084 C  CB     . ALA B 1 105 ? -30.661 24.838  47.116  1.00 64.43  ? 105 ALA B CB     1 
ATOM   4085 H  H      . ALA B 1 105 ? -28.915 23.098  48.267  1.00 61.40  ? 105 ALA B H      1 
ATOM   4086 H  HA     . ALA B 1 105 ? -30.746 24.893  49.170  1.00 69.17  ? 105 ALA B HA     1 
ATOM   4087 H  HB1    . ALA B 1 105 ? -31.597 25.035  46.956  1.00 77.54  ? 105 ALA B HB1    1 
ATOM   4088 H  HB2    . ALA B 1 105 ? -30.140 25.655  47.076  1.00 77.54  ? 105 ALA B HB2    1 
ATOM   4089 H  HB3    . ALA B 1 105 ? -30.337 24.206  46.455  1.00 77.54  ? 105 ALA B HB3    1 
ATOM   4090 N  N      . ARG B 1 106 ? -32.351 23.132  49.628  1.00 68.24  ? 106 ARG B N      1 
ATOM   4091 C  CA     . ARG B 1 106 ? -33.340 22.094  49.828  1.00 74.66  ? 106 ARG B CA     1 
ATOM   4092 C  C      . ARG B 1 106 ? -34.344 22.126  48.680  1.00 65.52  ? 106 ARG B C      1 
ATOM   4093 O  O      . ARG B 1 106 ? -34.573 23.178  48.079  1.00 57.95  ? 106 ARG B O      1 
ATOM   4094 C  CB     . ARG B 1 106 ? -34.057 22.291  51.156  1.00 86.87  ? 106 ARG B CB     1 
ATOM   4095 C  CG     . ARG B 1 106 ? -33.189 22.023  52.370  1.00 96.94  ? 106 ARG B CG     1 
ATOM   4096 C  CD     . ARG B 1 106 ? -34.007 22.133  53.638  1.00 115.23 ? 106 ARG B CD     1 
ATOM   4097 N  NE     . ARG B 1 106 ? -35.044 21.108  53.710  1.00 125.51 ? 106 ARG B NE     1 
ATOM   4098 C  CZ     . ARG B 1 106 ? -35.894 20.977  54.723  1.00 120.45 ? 106 ARG B CZ     1 
ATOM   4099 N  NH1    . ARG B 1 106 ? -35.837 21.809  55.754  1.00 123.31 ? 106 ARG B NH1    1 
ATOM   4100 N  NH2    . ARG B 1 106 ? -36.808 20.016  54.701  1.00 115.75 ? 106 ARG B NH2    1 
ATOM   4101 H  H      . ARG B 1 106 ? -32.408 23.785  50.184  1.00 82.10  ? 106 ARG B H      1 
ATOM   4102 H  HA     . ARG B 1 106 ? -32.914 21.223  49.849  1.00 89.81  ? 106 ARG B HA     1 
ATOM   4103 H  HB2    . ARG B 1 106 ? -34.364 23.209  51.210  1.00 104.46 ? 106 ARG B HB2    1 
ATOM   4104 H  HB3    . ARG B 1 106 ? -34.813 21.685  51.194  1.00 104.46 ? 106 ARG B HB3    1 
ATOM   4105 H  HG2    . ARG B 1 106 ? -32.821 21.127  52.316  1.00 116.54 ? 106 ARG B HG2    1 
ATOM   4106 H  HG3    . ARG B 1 106 ? -32.471 22.674  52.408  1.00 116.54 ? 106 ARG B HG3    1 
ATOM   4107 H  HD2    . ARG B 1 106 ? -33.423 22.027  54.405  1.00 138.50 ? 106 ARG B HD2    1 
ATOM   4108 H  HD3    . ARG B 1 106 ? -34.438 23.002  53.665  1.00 138.50 ? 106 ARG B HD3    1 
ATOM   4109 H  HE     . ARG B 1 106 ? -35.109 20.555  53.055  1.00 150.82 ? 106 ARG B HE     1 
ATOM   4110 H  HH11   . ARG B 1 106 ? -35.249 22.436  55.768  1.00 148.19 ? 106 ARG B HH11   1 
ATOM   4111 H  HH12   . ARG B 1 106 ? -36.388 21.721  56.408  1.00 148.19 ? 106 ARG B HH12   1 
ATOM   4112 H  HH21   . ARG B 1 106 ? -36.850 19.478  54.032  1.00 139.12 ? 106 ARG B HH21   1 
ATOM   4113 H  HH22   . ARG B 1 106 ? -37.358 19.931  55.357  1.00 139.12 ? 106 ARG B HH22   1 
ATOM   4114 N  N      . PRO B 1 107 ? -34.894 20.975  48.298  1.00 67.86  ? 107 PRO B N      1 
ATOM   4115 C  CA     . PRO B 1 107 ? -35.903 20.972  47.236  1.00 73.94  ? 107 PRO B CA     1 
ATOM   4116 C  C      . PRO B 1 107 ? -37.029 21.943  47.566  1.00 78.67  ? 107 PRO B C      1 
ATOM   4117 O  O      . PRO B 1 107 ? -37.491 22.021  48.706  1.00 73.32  ? 107 PRO B O      1 
ATOM   4118 C  CB     . PRO B 1 107 ? -36.393 19.521  47.220  1.00 76.90  ? 107 PRO B CB     1 
ATOM   4119 C  CG     . PRO B 1 107 ? -35.275 18.731  47.782  1.00 69.73  ? 107 PRO B CG     1 
ATOM   4120 C  CD     . PRO B 1 107 ? -34.626 19.616  48.806  1.00 75.06  ? 107 PRO B CD     1 
ATOM   4121 H  HA     . PRO B 1 107 ? -35.512 21.192  46.376  1.00 88.94  ? 107 PRO B HA     1 
ATOM   4122 H  HB2    . PRO B 1 107 ? -37.189 19.435  47.768  1.00 92.49  ? 107 PRO B HB2    1 
ATOM   4123 H  HB3    . PRO B 1 107 ? -36.587 19.248  46.309  1.00 92.49  ? 107 PRO B HB3    1 
ATOM   4124 H  HG2    . PRO B 1 107 ? -35.619 17.923  48.194  1.00 83.89  ? 107 PRO B HG2    1 
ATOM   4125 H  HG3    . PRO B 1 107 ? -34.649 18.503  47.077  1.00 83.89  ? 107 PRO B HG3    1 
ATOM   4126 H  HD2    . PRO B 1 107 ? -35.029 19.488  49.679  1.00 90.29  ? 107 PRO B HD2    1 
ATOM   4127 H  HD3    . PRO B 1 107 ? -33.672 19.447  48.853  1.00 90.29  ? 107 PRO B HD3    1 
ATOM   4128 N  N      . ARG B 1 108 ? -37.473 22.689  46.557  1.00 77.43  ? 108 ARG B N      1 
ATOM   4129 C  CA     . ARG B 1 108 ? -38.539 23.664  46.733  1.00 92.52  ? 108 ARG B CA     1 
ATOM   4130 C  C      . ARG B 1 108 ? -39.541 23.474  45.604  1.00 88.51  ? 108 ARG B C      1 
ATOM   4131 O  O      . ARG B 1 108 ? -39.237 22.871  44.571  1.00 89.07  ? 108 ARG B O      1 
ATOM   4132 C  CB     . ARG B 1 108 ? -37.990 25.113  46.744  1.00 96.38  ? 108 ARG B CB     1 
ATOM   4133 C  CG     . ARG B 1 108 ? -36.486 25.187  47.043  1.00 85.68  ? 108 ARG B CG     1 
ATOM   4134 C  CD     . ARG B 1 108 ? -35.942 26.575  47.439  1.00 65.58  ? 108 ARG B CD     1 
ATOM   4135 N  NE     . ARG B 1 108 ? -36.115 27.617  46.423  1.00 67.69  ? 108 ARG B NE     1 
ATOM   4136 C  CZ     . ARG B 1 108 ? -35.357 28.711  46.325  1.00 56.81  ? 108 ARG B CZ     1 
ATOM   4137 N  NH1    . ARG B 1 108 ? -34.353 28.921  47.169  1.00 53.42  ? 108 ARG B NH1    1 
ATOM   4138 N  NH2    . ARG B 1 108 ? -35.594 29.604  45.374  1.00 51.95  ? 108 ARG B NH2    1 
ATOM   4139 H  H      . ARG B 1 108 ? -37.166 22.646  45.755  1.00 93.14  ? 108 ARG B H      1 
ATOM   4140 H  HA     . ARG B 1 108 ? -38.995 23.524  47.578  1.00 111.24 ? 108 ARG B HA     1 
ATOM   4141 H  HB2    . ARG B 1 108 ? -38.141 25.513  45.874  1.00 115.87 ? 108 ARG B HB2    1 
ATOM   4142 H  HB3    . ARG B 1 108 ? -38.455 25.620  47.428  1.00 115.87 ? 108 ARG B HB3    1 
ATOM   4143 H  HG2    . ARG B 1 108 ? -36.292 24.584  47.777  1.00 103.03 ? 108 ARG B HG2    1 
ATOM   4144 H  HG3    . ARG B 1 108 ? -36.004 24.908  46.248  1.00 103.03 ? 108 ARG B HG3    1 
ATOM   4145 H  HD2    . ARG B 1 108 ? -36.403 26.870  48.240  1.00 78.91  ? 108 ARG B HD2    1 
ATOM   4146 H  HD3    . ARG B 1 108 ? -34.991 26.495  47.615  1.00 78.91  ? 108 ARG B HD3    1 
ATOM   4147 H  HE     . ARG B 1 108 ? -36.749 27.516  45.851  1.00 81.45  ? 108 ARG B HE     1 
ATOM   4148 H  HH11   . ARG B 1 108 ? -34.185 28.348  47.788  1.00 64.32  ? 108 ARG B HH11   1 
ATOM   4149 H  HH12   . ARG B 1 108 ? -33.872 29.630  47.096  1.00 64.32  ? 108 ARG B HH12   1 
ATOM   4150 H  HH21   . ARG B 1 108 ? -36.238 29.478  44.817  1.00 62.55  ? 108 ARG B HH21   1 
ATOM   4151 H  HH22   . ARG B 1 108 ? -35.105 30.308  45.313  1.00 62.55  ? 108 ARG B HH22   1 
ATOM   4152 N  N      . LYS B 1 109 ? -40.751 23.985  45.814  1.00 88.03  ? 109 LYS B N      1 
ATOM   4153 C  CA     . LYS B 1 109 ? -41.830 23.803  44.844  1.00 98.06  ? 109 LYS B CA     1 
ATOM   4154 C  C      . LYS B 1 109 ? -41.657 24.830  43.730  1.00 106.50 ? 109 LYS B C      1 
ATOM   4155 O  O      . LYS B 1 109 ? -42.122 25.967  43.821  1.00 102.57 ? 109 LYS B O      1 
ATOM   4156 C  CB     . LYS B 1 109 ? -43.185 23.917  45.531  1.00 90.98  ? 109 LYS B CB     1 
ATOM   4157 C  CG     . LYS B 1 109 ? -44.365 23.416  44.701  1.00 96.49  ? 109 LYS B CG     1 
ATOM   4158 C  CD     . LYS B 1 109 ? -44.630 21.925  44.903  1.00 95.12  ? 109 LYS B CD     1 
ATOM   4159 C  CE     . LYS B 1 109 ? -45.978 21.526  44.313  1.00 87.50  ? 109 LYS B CE     1 
ATOM   4160 N  NZ     . LYS B 1 109 ? -46.249 20.062  44.424  1.00 100.41 ? 109 LYS B NZ     1 
ATOM   4161 H  H      . LYS B 1 109 ? -40.971 24.441  46.509  1.00 105.85 ? 109 LYS B H      1 
ATOM   4162 H  HA     . LYS B 1 109 ? -41.766 22.921  44.444  1.00 117.89 ? 109 LYS B HA     1 
ATOM   4163 H  HB2    . LYS B 1 109 ? -43.161 23.396  46.349  1.00 109.39 ? 109 LYS B HB2    1 
ATOM   4164 H  HB3    . LYS B 1 109 ? -43.349 24.850  45.738  1.00 109.39 ? 109 LYS B HB3    1 
ATOM   4165 H  HG2    . LYS B 1 109 ? -45.164 23.901  44.959  1.00 116.01 ? 109 LYS B HG2    1 
ATOM   4166 H  HG3    . LYS B 1 109 ? -44.176 23.563  43.761  1.00 116.01 ? 109 LYS B HG3    1 
ATOM   4167 H  HD2    . LYS B 1 109 ? -43.937 21.411  44.460  1.00 114.36 ? 109 LYS B HD2    1 
ATOM   4168 H  HD3    . LYS B 1 109 ? -44.638 21.724  45.852  1.00 114.36 ? 109 LYS B HD3    1 
ATOM   4169 H  HE2    . LYS B 1 109 ? -46.681 21.997  44.787  1.00 105.22 ? 109 LYS B HE2    1 
ATOM   4170 H  HE3    . LYS B 1 109 ? -45.994 21.763  43.373  1.00 105.22 ? 109 LYS B HE3    1 
ATOM   4171 H  HZ1    . LYS B 1 109 ? -45.596 19.601  44.033  1.00 120.71 ? 109 LYS B HZ1    1 
ATOM   4172 H  HZ2    . LYS B 1 109 ? -46.296 19.825  45.281  1.00 120.71 ? 109 LYS B HZ2    1 
ATOM   4173 H  HZ3    . LYS B 1 109 ? -47.020 19.864  44.027  1.00 120.71 ? 109 LYS B HZ3    1 
ATOM   4174 N  N      . MET B 1 110 ? -40.970 24.421  42.664  1.00 101.71 ? 110 MET B N      1 
ATOM   4175 C  CA     . MET B 1 110 ? -40.829 25.240  41.465  1.00 90.89  ? 110 MET B CA     1 
ATOM   4176 C  C      . MET B 1 110 ? -42.038 25.057  40.555  1.00 78.78  ? 110 MET B C      1 
ATOM   4177 O  O      . MET B 1 110 ? -42.465 23.927  40.303  1.00 95.35  ? 110 MET B O      1 
ATOM   4178 C  CB     . MET B 1 110 ? -39.543 24.861  40.726  1.00 91.50  ? 110 MET B CB     1 
ATOM   4179 C  CG     . MET B 1 110 ? -38.242 25.144  41.482  1.00 82.26  ? 110 MET B CG     1 
ATOM   4180 S  SD     . MET B 1 110 ? -37.970 26.904  41.803  1.00 84.16  ? 110 MET B SD     1 
ATOM   4181 C  CE     . MET B 1 110 ? -38.127 26.997  43.580  1.00 74.71  ? 110 MET B CE     1 
ATOM   4182 H  H      . MET B 1 110 ? -40.571 23.661  42.610  1.00 122.27 ? 110 MET B H      1 
ATOM   4183 H  HA     . MET B 1 110 ? -40.771 26.174  41.720  1.00 109.28 ? 110 MET B HA     1 
ATOM   4184 H  HB2    . MET B 1 110 ? -39.568 23.910  40.538  1.00 110.02 ? 110 MET B HB2    1 
ATOM   4185 H  HB3    . MET B 1 110 ? -39.510 25.363  39.896  1.00 110.02 ? 110 MET B HB3    1 
ATOM   4186 H  HG2    . MET B 1 110 ? -38.271 24.686  42.337  1.00 98.93  ? 110 MET B HG2    1 
ATOM   4187 H  HG3    . MET B 1 110 ? -37.496 24.818  40.956  1.00 98.93  ? 110 MET B HG3    1 
ATOM   4188 H  HE1    . MET B 1 110 ? -38.054 27.925  43.855  1.00 89.87  ? 110 MET B HE1    1 
ATOM   4189 H  HE2    . MET B 1 110 ? -38.991 26.642  43.840  1.00 89.87  ? 110 MET B HE2    1 
ATOM   4190 H  HE3    . MET B 1 110 ? -37.418 26.475  43.987  1.00 89.87  ? 110 MET B HE3    1 
ATOM   4191 N  N      . LEU B 1 111 ? -42.595 26.180  40.048  1.00 70.28  ? 111 LEU B N      1 
ATOM   4192 C  CA     . LEU B 1 111 ? -43.845 26.140  39.279  1.00 93.26  ? 111 LEU B CA     1 
ATOM   4193 C  C      . LEU B 1 111 ? -43.818 27.160  38.129  1.00 96.03  ? 111 LEU B C      1 
ATOM   4194 O  O      . LEU B 1 111 ? -44.555 28.144  38.096  1.00 100.78 ? 111 LEU B O      1 
ATOM   4195 C  CB     . LEU B 1 111 ? -45.074 26.350  40.175  1.00 108.71 ? 111 LEU B CB     1 
ATOM   4196 C  CG     . LEU B 1 111 ? -44.930 26.809  41.628  1.00 91.93  ? 111 LEU B CG     1 
ATOM   4197 C  CD1    . LEU B 1 111 ? -45.509 28.200  41.806  1.00 58.26  ? 111 LEU B CD1    1 
ATOM   4198 C  CD2    . LEU B 1 111 ? -45.621 25.817  42.552  1.00 85.65  ? 111 LEU B CD2    1 
ATOM   4199 H  H      . LEU B 1 111 ? -42.261 26.967  40.140  1.00 84.55  ? 111 LEU B H      1 
ATOM   4200 H  HA     . LEU B 1 111 ? -43.895 25.261  38.871  1.00 112.12 ? 111 LEU B HA     1 
ATOM   4201 H  HB2    . LEU B 1 111 ? -45.627 27.018  39.741  1.00 130.67 ? 111 LEU B HB2    1 
ATOM   4202 H  HB3    . LEU B 1 111 ? -45.544 25.503  40.211  1.00 130.67 ? 111 LEU B HB3    1 
ATOM   4203 H  HG     . LEU B 1 111 ? -43.990 26.847  41.864  1.00 110.53 ? 111 LEU B HG     1 
ATOM   4204 H  HD11   . LEU B 1 111 ? -45.399 28.472  42.730  1.00 70.13  ? 111 LEU B HD11   1 
ATOM   4205 H  HD12   . LEU B 1 111 ? -45.038 28.815  41.222  1.00 70.13  ? 111 LEU B HD12   1 
ATOM   4206 H  HD13   . LEU B 1 111 ? -46.451 28.182  41.576  1.00 70.13  ? 111 LEU B HD13   1 
ATOM   4207 H  HD21   . LEU B 1 111 ? -45.487 26.095  43.472  1.00 102.99 ? 111 LEU B HD21   1 
ATOM   4208 H  HD22   . LEU B 1 111 ? -46.569 25.801  42.347  1.00 102.99 ? 111 LEU B HD22   1 
ATOM   4209 H  HD23   . LEU B 1 111 ? -45.238 24.936  42.414  1.00 102.99 ? 111 LEU B HD23   1 
ATOM   4210 N  N      . CYS B 1 112 ? -42.943 26.907  37.158  1.00 89.14  ? 112 CYS B N      1 
ATOM   4211 C  CA     . CYS B 1 112 ? -42.933 27.608  35.877  1.00 86.24  ? 112 CYS B CA     1 
ATOM   4212 C  C      . CYS B 1 112 ? -42.360 26.660  34.832  1.00 96.77  ? 112 CYS B C      1 
ATOM   4213 O  O      . CYS B 1 112 ? -43.109 26.043  34.068  1.00 93.16  ? 112 CYS B O      1 
ATOM   4214 C  CB     . CYS B 1 112 ? -42.140 28.916  35.929  1.00 88.96  ? 112 CYS B CB     1 
ATOM   4215 S  SG     . CYS B 1 112 ? -43.049 30.328  36.622  1.00 76.90  ? 112 CYS B SG     1 
ATOM   4216 H  H      . CYS B 1 112 ? -42.324 26.313  37.218  1.00 107.18 ? 112 CYS B H      1 
ATOM   4217 H  HA     . CYS B 1 112 ? -43.835 27.871  35.637  1.00 103.71 ? 112 CYS B HA     1 
ATOM   4218 H  HB2    . CYS B 1 112 ? -41.353 28.777  36.479  1.00 106.97 ? 112 CYS B HB2    1 
ATOM   4219 H  HB3    . CYS B 1 112 ? -41.877 29.153  35.026  1.00 106.97 ? 112 CYS B HB3    1 
ATOM   4220 H  HG     . CYS B 1 112 ? -43.397 30.059  37.738  1.00 92.50  ? 112 CYS B HG     1 
ATOM   4221 N  N      . ARG B 1 113 ? -41.036 26.531  34.797  1.00 95.44  ? 113 ARG B N      1 
ATOM   4222 C  CA     . ARG B 1 113 ? -40.392 25.413  34.122  1.00 72.75  ? 113 ARG B CA     1 
ATOM   4223 C  C      . ARG B 1 113 ? -40.203 24.307  35.152  1.00 82.34  ? 113 ARG B C      1 
ATOM   4224 O  O      . ARG B 1 113 ? -39.515 24.501  36.161  1.00 74.06  ? 113 ARG B O      1 
ATOM   4225 C  CB     . ARG B 1 113 ? -39.062 25.827  33.499  1.00 75.62  ? 113 ARG B CB     1 
ATOM   4226 C  CG     . ARG B 1 113 ? -38.359 24.697  32.753  1.00 87.32  ? 113 ARG B CG     1 
ATOM   4227 C  CD     . ARG B 1 113 ? -37.708 25.194  31.470  1.00 84.63  ? 113 ARG B CD     1 
ATOM   4228 N  NE     . ARG B 1 113 ? -36.498 24.448  31.135  1.00 71.34  ? 113 ARG B NE     1 
ATOM   4229 C  CZ     . ARG B 1 113 ? -35.677 24.763  30.137  1.00 75.07  ? 113 ARG B CZ     1 
ATOM   4230 N  NH1    . ARG B 1 113 ? -35.933 25.813  29.367  1.00 73.29  ? 113 ARG B NH1    1 
ATOM   4231 N  NH2    . ARG B 1 113 ? -34.596 24.029  29.908  1.00 87.12  ? 113 ARG B NH2    1 
ATOM   4232 H  H      . ARG B 1 113 ? -40.488 27.084  35.162  1.00 114.74 ? 113 ARG B H      1 
ATOM   4233 H  HA     . ARG B 1 113 ? -40.948 25.091  33.396  1.00 87.52  ? 113 ARG B HA     1 
ATOM   4234 H  HB2    . ARG B 1 113 ? -39.222 26.545  32.867  1.00 90.96  ? 113 ARG B HB2    1 
ATOM   4235 H  HB3    . ARG B 1 113 ? -38.468 26.132  34.203  1.00 90.96  ? 113 ARG B HB3    1 
ATOM   4236 H  HG2    . ARG B 1 113 ? -37.668 24.320  33.320  1.00 105.00 ? 113 ARG B HG2    1 
ATOM   4237 H  HG3    . ARG B 1 113 ? -39.008 24.014  32.521  1.00 105.00 ? 113 ARG B HG3    1 
ATOM   4238 H  HD2    . ARG B 1 113 ? -38.335 25.096  30.737  1.00 101.77 ? 113 ARG B HD2    1 
ATOM   4239 H  HD3    . ARG B 1 113 ? -37.466 26.128  31.577  1.00 101.77 ? 113 ARG B HD3    1 
ATOM   4240 H  HE     . ARG B 1 113 ? -36.304 23.760  31.613  1.00 85.83  ? 113 ARG B HE     1 
ATOM   4241 H  HH11   . ARG B 1 113 ? -36.632 26.293  29.512  1.00 88.16  ? 113 ARG B HH11   1 
ATOM   4242 H  HH12   . ARG B 1 113 ? -35.400 26.014  28.722  1.00 88.16  ? 113 ARG B HH12   1 
ATOM   4243 H  HH21   . ARG B 1 113 ? -34.425 23.349  30.406  1.00 104.77 ? 113 ARG B HH21   1 
ATOM   4244 H  HH22   . ARG B 1 113 ? -34.066 24.234  29.263  1.00 104.77 ? 113 ARG B HH22   1 
ATOM   4245 N  N      . GLY B 1 114 ? -40.824 23.160  34.904  1.00 100.50 ? 114 GLY B N      1 
ATOM   4246 C  CA     . GLY B 1 114 ? -40.988 22.146  35.924  1.00 103.60 ? 114 GLY B CA     1 
ATOM   4247 C  C      . GLY B 1 114 ? -42.442 22.080  36.344  1.00 103.57 ? 114 GLY B C      1 
ATOM   4248 O  O      . GLY B 1 114 ? -43.024 23.094  36.740  1.00 92.97  ? 114 GLY B O      1 
ATOM   4249 H  H      . GLY B 1 114 ? -41.162 22.946  34.142  1.00 120.82 ? 114 GLY B H      1 
ATOM   4250 H  HA2    . GLY B 1 114 ? -40.717 21.280  35.579  1.00 124.53 ? 114 GLY B HA2    1 
ATOM   4251 H  HA3    . GLY B 1 114 ? -40.443 22.362  36.697  1.00 124.53 ? 114 GLY B HA3    1 
ATOM   4252 N  N      . GLY B 1 115 ? -43.043 20.897  36.255  1.00 122.15 ? 115 GLY B N      1 
ATOM   4253 C  CA     . GLY B 1 115 ? -44.461 20.753  36.522  1.00 116.58 ? 115 GLY B CA     1 
ATOM   4254 C  C      . GLY B 1 115 ? -44.811 20.736  37.993  1.00 110.29 ? 115 GLY B C      1 
ATOM   4255 O  O      . GLY B 1 115 ? -45.349 19.743  38.495  1.00 124.82 ? 115 GLY B O      1 
ATOM   4256 H  H      . GLY B 1 115 ? -42.648 20.164  36.042  1.00 146.80 ? 115 GLY B H      1 
ATOM   4257 H  HA2    . GLY B 1 115 ? -44.935 21.493  36.110  1.00 140.11 ? 115 GLY B HA2    1 
ATOM   4258 H  HA3    . GLY B 1 115 ? -44.772 19.922  36.131  1.00 140.11 ? 115 GLY B HA3    1 
ATOM   4259 N  N      . GLY B 1 116 ? -44.528 21.832  38.693  1.00 76.42  ? 116 GLY B N      1 
ATOM   4260 C  CA     . GLY B 1 116 ? -44.872 21.915  40.099  1.00 88.79  ? 116 GLY B CA     1 
ATOM   4261 C  C      . GLY B 1 116 ? -44.270 20.807  40.927  1.00 107.27 ? 116 GLY B C      1 
ATOM   4262 O  O      . GLY B 1 116 ? -44.874 20.377  41.916  1.00 113.68 ? 116 GLY B O      1 
ATOM   4263 H  H      . GLY B 1 116 ? -44.141 22.533  38.377  1.00 91.91  ? 116 GLY B H      1 
ATOM   4264 H  HA2    . GLY B 1 116 ? -44.558 22.762  40.453  1.00 106.76 ? 116 GLY B HA2    1 
ATOM   4265 H  HA3    . GLY B 1 116 ? -45.837 21.872  40.193  1.00 106.76 ? 116 GLY B HA3    1 
ATOM   4266 N  N      . ARG B 1 117 ? -43.109 20.305  40.532  1.00 103.69 ? 117 ARG B N      1 
ATOM   4267 C  CA     . ARG B 1 117 ? -42.476 19.195  41.224  1.00 104.18 ? 117 ARG B CA     1 
ATOM   4268 C  C      . ARG B 1 117 ? -41.472 19.752  42.223  1.00 91.91  ? 117 ARG B C      1 
ATOM   4269 O  O      . ARG B 1 117 ? -40.842 20.784  41.986  1.00 74.42  ? 117 ARG B O      1 
ATOM   4270 C  CB     . ARG B 1 117 ? -41.812 18.254  40.213  1.00 102.21 ? 117 ARG B CB     1 
ATOM   4271 C  CG     . ARG B 1 117 ? -40.344 17.933  40.455  1.00 98.73  ? 117 ARG B CG     1 
ATOM   4272 C  CD     . ARG B 1 117 ? -39.847 16.870  39.472  1.00 96.01  ? 117 ARG B CD     1 
ATOM   4273 N  NE     . ARG B 1 117 ? -38.996 17.418  38.413  1.00 107.64 ? 117 ARG B NE     1 
ATOM   4274 C  CZ     . ARG B 1 117 ? -39.395 17.692  37.172  1.00 105.16 ? 117 ARG B CZ     1 
ATOM   4275 N  NH1    . ARG B 1 117 ? -40.649 17.478  36.793  1.00 110.46 ? 117 ARG B NH1    1 
ATOM   4276 N  NH2    . ARG B 1 117 ? -38.528 18.186  36.297  1.00 80.97  ? 117 ARG B NH2    1 
ATOM   4277 H  H      . ARG B 1 117 ? -42.664 20.596  39.856  1.00 124.64 ? 117 ARG B H      1 
ATOM   4278 H  HA     . ARG B 1 117 ? -43.123 18.666  41.717  1.00 125.24 ? 117 ARG B HA     1 
ATOM   4279 H  HB2    . ARG B 1 117 ? -42.294 17.412  40.223  1.00 122.87 ? 117 ARG B HB2    1 
ATOM   4280 H  HB3    . ARG B 1 117 ? -41.874 18.661  39.335  1.00 122.87 ? 117 ARG B HB3    1 
ATOM   4281 H  HG2    . ARG B 1 117 ? -39.813 18.735  40.334  1.00 118.69 ? 117 ARG B HG2    1 
ATOM   4282 H  HG3    . ARG B 1 117 ? -40.231 17.593  41.357  1.00 118.69 ? 117 ARG B HG3    1 
ATOM   4283 H  HD2    . ARG B 1 117 ? -39.329 16.208  39.958  1.00 115.43 ? 117 ARG B HD2    1 
ATOM   4284 H  HD3    . ARG B 1 117 ? -40.612 16.448  39.050  1.00 115.43 ? 117 ARG B HD3    1 
ATOM   4285 H  HE     . ARG B 1 117 ? -38.173 17.576  38.609  1.00 129.39 ? 117 ARG B HE     1 
ATOM   4286 H  HH11   . ARG B 1 117 ? -41.219 17.158  37.353  1.00 132.77 ? 117 ARG B HH11   1 
ATOM   4287 H  HH12   . ARG B 1 117 ? -40.893 17.660  35.989  1.00 132.77 ? 117 ARG B HH12   1 
ATOM   4288 H  HH21   . ARG B 1 117 ? -37.713 18.327  36.533  1.00 97.37  ? 117 ARG B HH21   1 
ATOM   4289 H  HH22   . ARG B 1 117 ? -38.781 18.364  35.495  1.00 97.37  ? 117 ARG B HH22   1 
ATOM   4290 N  N      . ILE B 1 118 ? -41.325 19.054  43.349  1.00 104.06 ? 118 ILE B N      1 
ATOM   4291 C  CA     . ILE B 1 118 ? -40.388 19.501  44.373  1.00 109.08 ? 118 ILE B CA     1 
ATOM   4292 C  C      . ILE B 1 118 ? -38.992 19.178  43.856  1.00 104.64 ? 118 ILE B C      1 
ATOM   4293 O  O      . ILE B 1 118 ? -38.666 18.011  43.606  1.00 112.73 ? 118 ILE B O      1 
ATOM   4294 C  CB     . ILE B 1 118 ? -40.654 18.816  45.721  1.00 104.67 ? 118 ILE B CB     1 
ATOM   4295 C  CG1    . ILE B 1 118 ? -41.953 19.297  46.376  1.00 104.30 ? 118 ILE B CG1    1 
ATOM   4296 C  CG2    . ILE B 1 118 ? -39.551 19.121  46.708  1.00 103.21 ? 118 ILE B CG2    1 
ATOM   4297 C  CD1    . ILE B 1 118 ? -43.210 18.637  45.847  1.00 118.26 ? 118 ILE B CD1    1 
ATOM   4298 H  H      . ILE B 1 118 ? -41.749 18.330  43.540  1.00 125.09 ? 118 ILE B H      1 
ATOM   4299 H  HA     . ILE B 1 118 ? -40.480 20.456  44.515  1.00 131.11 ? 118 ILE B HA     1 
ATOM   4300 H  HB     . ILE B 1 118 ? -40.708 17.869  45.519  1.00 125.82 ? 118 ILE B HB     1 
ATOM   4301 H  HG12   . ILE B 1 118 ? -41.905 19.114  47.328  1.00 125.37 ? 118 ILE B HG12   1 
ATOM   4302 H  HG13   . ILE B 1 118 ? -42.039 20.252  46.226  1.00 125.37 ? 118 ILE B HG13   1 
ATOM   4303 H  HG21   . ILE B 1 118 ? -39.733 18.655  47.539  1.00 124.07 ? 118 ILE B HG21   1 
ATOM   4304 H  HG22   . ILE B 1 118 ? -38.706 18.821  46.339  1.00 124.07 ? 118 ILE B HG22   1 
ATOM   4305 H  HG23   . ILE B 1 118 ? -39.523 20.078  46.864  1.00 124.07 ? 118 ILE B HG23   1 
ATOM   4306 H  HD11   . ILE B 1 118 ? -43.984 19.102  46.201  1.00 142.13 ? 118 ILE B HD11   1 
ATOM   4307 H  HD12   . ILE B 1 118 ? -43.209 18.686  44.878  1.00 142.13 ? 118 ILE B HD12   1 
ATOM   4308 H  HD13   . ILE B 1 118 ? -43.223 17.709  46.131  1.00 142.13 ? 118 ILE B HD13   1 
ATOM   4309 N  N      . GLN B 1 119 ? -38.149 20.201  43.718  1.00 85.04  ? 119 GLN B N      1 
ATOM   4310 C  CA     . GLN B 1 119 ? -36.794 19.987  43.228  1.00 73.70  ? 119 GLN B CA     1 
ATOM   4311 C  C      . GLN B 1 119 ? -35.926 21.180  43.604  1.00 73.16  ? 119 GLN B C      1 
ATOM   4312 O  O      . GLN B 1 119 ? -36.421 22.239  43.998  1.00 78.78  ? 119 GLN B O      1 
ATOM   4313 C  CB     . GLN B 1 119 ? -36.765 19.790  41.706  1.00 71.18  ? 119 GLN B CB     1 
ATOM   4314 C  CG     . GLN B 1 119 ? -37.286 20.980  40.907  1.00 68.64  ? 119 GLN B CG     1 
ATOM   4315 C  CD     . GLN B 1 119 ? -37.249 20.740  39.407  1.00 72.81  ? 119 GLN B CD     1 
ATOM   4316 O  OE1    . GLN B 1 119 ? -36.956 19.636  38.949  1.00 65.62  ? 119 GLN B OE1    1 
ATOM   4317 N  NE2    . GLN B 1 119 ? -37.523 21.786  38.635  1.00 71.58  ? 119 GLN B NE2    1 
ATOM   4318 H  H      . GLN B 1 119 ? -38.340 21.020  43.900  1.00 102.27 ? 119 GLN B H      1 
ATOM   4319 H  HA     . GLN B 1 119 ? -36.443 19.195  43.663  1.00 88.66  ? 119 GLN B HA     1 
ATOM   4320 H  HB2    . GLN B 1 119 ? -35.847 19.632  41.433  1.00 85.63  ? 119 GLN B HB2    1 
ATOM   4321 H  HB3    . GLN B 1 119 ? -37.314 19.022  41.483  1.00 85.63  ? 119 GLN B HB3    1 
ATOM   4322 H  HG2    . GLN B 1 119 ? -38.207 21.152  41.161  1.00 82.58  ? 119 GLN B HG2    1 
ATOM   4323 H  HG3    . GLN B 1 119 ? -36.738 21.756  41.101  1.00 82.58  ? 119 GLN B HG3    1 
ATOM   4324 H  HE21   . GLN B 1 119 ? -37.708 22.547  38.991  1.00 86.11  ? 119 GLN B HE21   1 
ATOM   4325 H  HE22   . GLN B 1 119 ? -37.515 21.702  37.779  1.00 86.11  ? 119 GLN B HE22   1 
ATOM   4326 N  N      . LYS B 1 120 ? -34.616 20.984  43.479  1.00 59.44  ? 120 LYS B N      1 
ATOM   4327 C  CA     . LYS B 1 120 ? -33.667 22.037  43.802  1.00 53.22  ? 120 LYS B CA     1 
ATOM   4328 C  C      . LYS B 1 120 ? -33.757 23.159  42.770  1.00 55.13  ? 120 LYS B C      1 
ATOM   4329 O  O      . LYS B 1 120 ? -33.856 22.893  41.568  1.00 53.45  ? 120 LYS B O      1 
ATOM   4330 C  CB     . LYS B 1 120 ? -32.245 21.484  43.838  1.00 51.04  ? 120 LYS B CB     1 
ATOM   4331 C  CG     . LYS B 1 120 ? -31.964 20.585  45.027  1.00 51.49  ? 120 LYS B CG     1 
ATOM   4332 C  CD     . LYS B 1 120 ? -30.518 20.105  45.053  1.00 59.62  ? 120 LYS B CD     1 
ATOM   4333 C  CE     . LYS B 1 120 ? -29.540 21.258  45.235  1.00 58.58  ? 120 LYS B CE     1 
ATOM   4334 N  NZ     . LYS B 1 120 ? -28.132 20.791  45.369  1.00 75.87  ? 120 LYS B NZ     1 
ATOM   4335 H  H      . LYS B 1 120 ? -34.252 20.253  43.209  1.00 71.54  ? 120 LYS B H      1 
ATOM   4336 H  HA     . LYS B 1 120 ? -33.876 22.401  44.677  1.00 64.07  ? 120 LYS B HA     1 
ATOM   4337 H  HB2    . LYS B 1 120 ? -32.092 20.965  43.032  1.00 61.46  ? 120 LYS B HB2    1 
ATOM   4338 H  HB3    . LYS B 1 120 ? -31.623 22.227  43.876  1.00 61.46  ? 120 LYS B HB3    1 
ATOM   4339 H  HG2    . LYS B 1 120 ? -32.135 21.076  45.846  1.00 62.01  ? 120 LYS B HG2    1 
ATOM   4340 H  HG3    . LYS B 1 120 ? -32.541 19.806  44.981  1.00 62.01  ? 120 LYS B HG3    1 
ATOM   4341 H  HD2    . LYS B 1 120 ? -30.399 19.488  45.791  1.00 71.76  ? 120 LYS B HD2    1 
ATOM   4342 H  HD3    . LYS B 1 120 ? -30.313 19.664  44.214  1.00 71.76  ? 120 LYS B HD3    1 
ATOM   4343 H  HE2    . LYS B 1 120 ? -29.592 21.843  44.463  1.00 70.52  ? 120 LYS B HE2    1 
ATOM   4344 H  HE3    . LYS B 1 120 ? -29.773 21.748  46.039  1.00 70.52  ? 120 LYS B HE3    1 
ATOM   4345 H  HZ1    . LYS B 1 120 ? -28.055 20.255  46.075  1.00 91.26  ? 120 LYS B HZ1    1 
ATOM   4346 H  HZ2    . LYS B 1 120 ? -27.888 20.345  44.639  1.00 91.26  ? 120 LYS B HZ2    1 
ATOM   4347 H  HZ3    . LYS B 1 120 ? -27.589 21.489  45.476  1.00 91.26  ? 120 LYS B HZ3    1 
ATOM   4348 N  N      . PRO B 1 121 ? -33.729 24.419  43.203  1.00 56.64  ? 121 PRO B N      1 
ATOM   4349 C  CA     . PRO B 1 121 ? -33.825 25.527  42.245  1.00 58.45  ? 121 PRO B CA     1 
ATOM   4350 C  C      . PRO B 1 121 ? -32.573 25.605  41.387  1.00 49.67  ? 121 PRO B C      1 
ATOM   4351 O  O      . PRO B 1 121 ? -31.460 25.362  41.861  1.00 30.49  ? 121 PRO B O      1 
ATOM   4352 C  CB     . PRO B 1 121 ? -33.973 26.761  43.140  1.00 50.22  ? 121 PRO B CB     1 
ATOM   4353 C  CG     . PRO B 1 121 ? -33.295 26.374  44.403  1.00 38.64  ? 121 PRO B CG     1 
ATOM   4354 C  CD     . PRO B 1 121 ? -33.510 24.901  44.578  1.00 48.62  ? 121 PRO B CD     1 
ATOM   4355 H  HA     . PRO B 1 121 ? -34.610 25.440  41.682  1.00 70.36  ? 121 PRO B HA     1 
ATOM   4356 H  HB2    . PRO B 1 121 ? -33.538 27.525  42.729  1.00 60.48  ? 121 PRO B HB2    1 
ATOM   4357 H  HB3    . PRO B 1 121 ? -34.911 26.954  43.290  1.00 60.48  ? 121 PRO B HB3    1 
ATOM   4358 H  HG2    . PRO B 1 121 ? -32.348 26.574  44.337  1.00 46.58  ? 121 PRO B HG2    1 
ATOM   4359 H  HG3    . PRO B 1 121 ? -33.686 26.865  45.143  1.00 46.58  ? 121 PRO B HG3    1 
ATOM   4360 H  HD2    . PRO B 1 121 ? -32.727 24.483  44.969  1.00 58.56  ? 121 PRO B HD2    1 
ATOM   4361 H  HD3    . PRO B 1 121 ? -34.288 24.730  45.131  1.00 58.56  ? 121 PRO B HD3    1 
ATOM   4362 N  N      . SER B 1 122 ? -32.758 25.958  40.119  1.00 30.57  ? 122 SER B N      1 
ATOM   4363 C  CA     . SER B 1 122 ? -31.621 26.025  39.219  1.00 36.45  ? 122 SER B CA     1 
ATOM   4364 C  C      . SER B 1 122 ? -30.633 27.091  39.683  1.00 35.69  ? 122 SER B C      1 
ATOM   4365 O  O      . SER B 1 122 ? -30.957 27.983  40.471  1.00 39.57  ? 122 SER B O      1 
ATOM   4366 C  CB     . SER B 1 122 ? -32.080 26.347  37.799  1.00 31.78  ? 122 SER B CB     1 
ATOM   4367 O  OG     . SER B 1 122 ? -32.712 27.612  37.760  1.00 43.36  ? 122 SER B OG     1 
ATOM   4368 H  H      . SER B 1 122 ? -33.516 26.159  39.765  1.00 36.90  ? 122 SER B H      1 
ATOM   4369 H  HA     . SER B 1 122 ? -31.172 25.165  39.212  1.00 43.96  ? 122 SER B HA     1 
ATOM   4370 H  HB2    . SER B 1 122 ? -31.308 26.359  37.212  1.00 38.35  ? 122 SER B HB2    1 
ATOM   4371 H  HB3    . SER B 1 122 ? -32.708 25.668  37.508  1.00 38.35  ? 122 SER B HB3    1 
ATOM   4372 H  HG     . SER B 1 122 ? -33.294 27.661  38.363  1.00 52.24  ? 122 SER B HG     1 
ATOM   4373 N  N      . LEU B 1 123 ? -29.406 26.988  39.170  1.00 33.47  ? 123 LEU B N      1 
ATOM   4374 C  CA     . LEU B 1 123 ? -28.391 27.986  39.480  1.00 30.74  ? 123 LEU B CA     1 
ATOM   4375 C  C      . LEU B 1 123 ? -28.766 29.352  38.927  1.00 31.05  ? 123 LEU B C      1 
ATOM   4376 O  O      . LEU B 1 123 ? -28.406 30.375  39.517  1.00 36.53  ? 123 LEU B O      1 
ATOM   4377 C  CB     . LEU B 1 123 ? -27.034 27.545  38.940  1.00 31.96  ? 123 LEU B CB     1 
ATOM   4378 C  CG     . LEU B 1 123 ? -25.871 28.507  39.181  1.00 16.16  ? 123 LEU B CG     1 
ATOM   4379 C  CD1    . LEU B 1 123 ? -25.620 28.734  40.660  1.00 31.39  ? 123 LEU B CD1    1 
ATOM   4380 C  CD2    . LEU B 1 123 ? -24.624 27.958  38.514  1.00 19.99  ? 123 LEU B CD2    1 
ATOM   4381 H  H      . LEU B 1 123 ? -29.139 26.358  38.648  1.00 40.38  ? 123 LEU B H      1 
ATOM   4382 H  HA     . LEU B 1 123 ? -28.314 28.064  40.443  1.00 37.10  ? 123 LEU B HA     1 
ATOM   4383 H  HB2    . LEU B 1 123 ? -26.801 26.702  39.360  1.00 38.57  ? 123 LEU B HB2    1 
ATOM   4384 H  HB3    . LEU B 1 123 ? -27.114 27.426  37.981  1.00 38.57  ? 123 LEU B HB3    1 
ATOM   4385 H  HG     . LEU B 1 123 ? -26.094 29.371  38.800  1.00 19.61  ? 123 LEU B HG     1 
ATOM   4386 H  HD11   . LEU B 1 123 ? -24.828 29.285  40.765  1.00 37.88  ? 123 LEU B HD11   1 
ATOM   4387 H  HD12   . LEU B 1 123 ? -26.389 29.184  41.045  1.00 37.88  ? 123 LEU B HD12   1 
ATOM   4388 H  HD13   . LEU B 1 123 ? -25.487 27.877  41.093  1.00 37.88  ? 123 LEU B HD13   1 
ATOM   4389 H  HD21   . LEU B 1 123 ? -23.897 28.587  38.636  1.00 24.20  ? 123 LEU B HD21   1 
ATOM   4390 H  HD22   . LEU B 1 123 ? -24.397 27.107  38.920  1.00 24.20  ? 123 LEU B HD22   1 
ATOM   4391 H  HD23   . LEU B 1 123 ? -24.800 27.836  37.567  1.00 24.20  ? 123 LEU B HD23   1 
ATOM   4392 N  N      . ALA B 1 124 ? -29.478 29.392  37.797  1.00 23.47  ? 124 ALA B N      1 
ATOM   4393 C  CA     . ALA B 1 124 ? -29.888 30.674  37.233  1.00 27.48  ? 124 ALA B CA     1 
ATOM   4394 C  C      . ALA B 1 124 ? -30.811 31.420  38.188  1.00 27.85  ? 124 ALA B C      1 
ATOM   4395 O  O      . ALA B 1 124 ? -30.654 32.630  38.406  1.00 35.50  ? 124 ALA B O      1 
ATOM   4396 C  CB     . ALA B 1 124 ? -30.576 30.455  35.885  1.00 29.54  ? 124 ALA B CB     1 
ATOM   4397 H  H      . ALA B 1 124 ? -29.732 28.705  37.346  1.00 28.38  ? 124 ALA B H      1 
ATOM   4398 H  HA     . ALA B 1 124 ? -29.101 31.220  37.085  1.00 33.19  ? 124 ALA B HA     1 
ATOM   4399 H  HB1    . ALA B 1 124 ? -30.838 31.314  35.521  1.00 35.66  ? 124 ALA B HB1    1 
ATOM   4400 H  HB2    . ALA B 1 124 ? -29.956 30.015  35.282  1.00 35.66  ? 124 ALA B HB2    1 
ATOM   4401 H  HB3    . ALA B 1 124 ? -31.359 29.898  36.017  1.00 35.66  ? 124 ALA B HB3    1 
ATOM   4402 N  N      . THR B 1 125 ? -31.775 30.714  38.780  1.00 31.85  ? 125 THR B N      1 
ATOM   4403 C  CA     . THR B 1 125 ? -32.668 31.355  39.737  1.00 42.68  ? 125 THR B CA     1 
ATOM   4404 C  C      . THR B 1 125 ? -31.903 31.824  40.969  1.00 34.80  ? 125 THR B C      1 
ATOM   4405 O  O      . THR B 1 125 ? -32.186 32.897  41.509  1.00 23.80  ? 125 THR B O      1 
ATOM   4406 C  CB     . THR B 1 125 ? -33.795 30.396  40.123  1.00 36.22  ? 125 THR B CB     1 
ATOM   4407 O  OG1    . THR B 1 125 ? -34.616 30.144  38.977  1.00 39.83  ? 125 THR B OG1    1 
ATOM   4408 C  CG2    . THR B 1 125 ? -34.660 30.992  41.213  1.00 41.78  ? 125 THR B CG2    1 
ATOM   4409 H  H      . THR B 1 125 ? -31.930 29.878  38.648  1.00 38.44  ? 125 THR B H      1 
ATOM   4410 H  HA     . THR B 1 125 ? -33.073 32.134  39.323  1.00 51.43  ? 125 THR B HA     1 
ATOM   4411 H  HB     . THR B 1 125 ? -33.410 29.568  40.451  1.00 43.68  ? 125 THR B HB     1 
ATOM   4412 H  HG1    . THR B 1 125 ? -35.103 29.474  39.115  1.00 48.01  ? 125 THR B HG1    1 
ATOM   4413 H  HG21   . THR B 1 125 ? -35.484 30.486  41.296  1.00 50.35  ? 125 THR B HG21   1 
ATOM   4414 H  HG22   . THR B 1 125 ? -34.190 30.968  42.061  1.00 50.35  ? 125 THR B HG22   1 
ATOM   4415 H  HG23   . THR B 1 125 ? -34.877 31.913  40.999  1.00 50.35  ? 125 THR B HG23   1 
ATOM   4416 N  N      . CYS B 1 126 ? -30.910 31.048  41.414  1.00 24.98  ? 126 CYS B N      1 
ATOM   4417 C  CA     . CYS B 1 126 ? -30.113 31.465  42.563  1.00 22.31  ? 126 CYS B CA     1 
ATOM   4418 C  C      . CYS B 1 126 ? -29.317 32.726  42.250  1.00 29.36  ? 126 CYS B C      1 
ATOM   4419 O  O      . CYS B 1 126 ? -29.216 33.633  43.086  1.00 29.86  ? 126 CYS B O      1 
ATOM   4420 C  CB     . CYS B 1 126 ? -29.181 30.330  42.984  1.00 28.77  ? 126 CYS B CB     1 
ATOM   4421 S  SG     . CYS B 1 126 ? -30.038 28.912  43.701  1.00 38.45  ? 126 CYS B SG     1 
ATOM   4422 H  H      . CYS B 1 126 ? -30.683 30.291  41.075  1.00 30.20  ? 126 CYS B H      1 
ATOM   4423 H  HA     . CYS B 1 126 ? -30.705 31.661  43.306  1.00 26.99  ? 126 CYS B HA     1 
ATOM   4424 H  HB2    . CYS B 1 126 ? -28.696 30.020  42.203  1.00 34.73  ? 126 CYS B HB2    1 
ATOM   4425 H  HB3    . CYS B 1 126 ? -28.560 30.668  43.648  1.00 34.73  ? 126 CYS B HB3    1 
ATOM   4426 H  HG     . CYS B 1 126 ? -30.782 28.450  42.881  1.00 46.36  ? 126 CYS B HG     1 
ATOM   4427 N  N      . ARG B 1 127 ? -28.745 32.803  41.048  1.00 21.06  ? 127 ARG B N      1 
ATOM   4428 C  CA     . ARG B 1 127 ? -28.053 34.017  40.632  1.00 28.27  ? 127 ARG B CA     1 
ATOM   4429 C  C      . ARG B 1 127 ? -29.001 35.211  40.640  1.00 28.33  ? 127 ARG B C      1 
ATOM   4430 O  O      . ARG B 1 127 ? -28.664 36.287  41.153  1.00 21.13  ? 127 ARG B O      1 
ATOM   4431 C  CB     . ARG B 1 127 ? -27.455 33.816  39.240  1.00 20.47  ? 127 ARG B CB     1 
ATOM   4432 C  CG     . ARG B 1 127 ? -26.319 32.808  39.173  1.00 13.15  ? 127 ARG B CG     1 
ATOM   4433 C  CD     . ARG B 1 127 ? -25.865 32.634  37.736  1.00 11.00  ? 127 ARG B CD     1 
ATOM   4434 N  NE     . ARG B 1 127 ? -25.364 33.877  37.160  1.00 8.80   ? 127 ARG B NE     1 
ATOM   4435 C  CZ     . ARG B 1 127 ? -25.136 34.060  35.863  1.00 16.51  ? 127 ARG B CZ     1 
ATOM   4436 N  NH1    . ARG B 1 127 ? -25.382 33.085  34.997  1.00 26.81  ? 127 ARG B NH1    1 
ATOM   4437 N  NH2    . ARG B 1 127 ? -24.675 35.226  35.431  1.00 17.57  ? 127 ARG B NH2    1 
ATOM   4438 H  H      . ARG B 1 127 ? -28.742 32.174  40.462  1.00 25.49  ? 127 ARG B H      1 
ATOM   4439 H  HA     . ARG B 1 127 ? -27.330 34.201  41.251  1.00 34.13  ? 127 ARG B HA     1 
ATOM   4440 H  HB2    . ARG B 1 127 ? -28.156 33.506  38.646  1.00 24.78  ? 127 ARG B HB2    1 
ATOM   4441 H  HB3    . ARG B 1 127 ? -27.108 34.667  38.929  1.00 24.78  ? 127 ARG B HB3    1 
ATOM   4442 H  HG2    . ARG B 1 127 ? -25.569 33.124  39.700  1.00 15.99  ? 127 ARG B HG2    1 
ATOM   4443 H  HG3    . ARG B 1 127 ? -26.623 31.950  39.509  1.00 15.99  ? 127 ARG B HG3    1 
ATOM   4444 H  HD2    . ARG B 1 127 ? -25.151 31.978  37.705  1.00 13.41  ? 127 ARG B HD2    1 
ATOM   4445 H  HD3    . ARG B 1 127 ? -26.615 32.334  37.199  1.00 13.41  ? 127 ARG B HD3    1 
ATOM   4446 H  HE     . ARG B 1 127 ? -25.206 34.533  37.693  1.00 10.77  ? 127 ARG B HE     1 
ATOM   4447 H  HH11   . ARG B 1 127 ? -25.690 32.331  35.273  1.00 32.38  ? 127 ARG B HH11   1 
ATOM   4448 H  HH12   . ARG B 1 127 ? -25.233 33.207  34.158  1.00 32.38  ? 127 ARG B HH12   1 
ATOM   4449 H  HH21   . ARG B 1 127 ? -24.524 35.862  35.989  1.00 21.30  ? 127 ARG B HH21   1 
ATOM   4450 H  HH22   . ARG B 1 127 ? -24.527 35.345  34.592  1.00 21.30  ? 127 ARG B HH22   1 
ATOM   4451 N  N      . ARG B 1 128 ? -30.196 35.039  40.068  1.00 23.90  ? 128 ARG B N      1 
ATOM   4452 C  CA     . ARG B 1 128 ? -31.157 36.137  40.029  1.00 28.03  ? 128 ARG B CA     1 
ATOM   4453 C  C      . ARG B 1 128 ? -31.546 36.582  41.435  1.00 25.36  ? 128 ARG B C      1 
ATOM   4454 O  O      . ARG B 1 128 ? -31.634 37.780  41.720  1.00 26.15  ? 128 ARG B O      1 
ATOM   4455 C  CB     . ARG B 1 128 ? -32.396 35.718  39.238  1.00 16.66  ? 128 ARG B CB     1 
ATOM   4456 C  CG     . ARG B 1 128 ? -32.161 35.518  37.747  1.00 15.62  ? 128 ARG B CG     1 
ATOM   4457 C  CD     . ARG B 1 128 ? -33.478 35.349  36.999  1.00 25.77  ? 128 ARG B CD     1 
ATOM   4458 N  NE     . ARG B 1 128 ? -33.305 35.125  35.562  1.00 35.24  ? 128 ARG B NE     1 
ATOM   4459 C  CZ     . ARG B 1 128 ? -33.220 33.932  34.975  1.00 31.73  ? 128 ARG B CZ     1 
ATOM   4460 N  NH1    . ARG B 1 128 ? -33.290 32.817  35.691  1.00 39.79  ? 128 ARG B NH1    1 
ATOM   4461 N  NH2    . ARG B 1 128 ? -33.068 33.857  33.658  1.00 15.20  ? 128 ARG B NH2    1 
ATOM   4462 H  H      . ARG B 1 128 ? -30.470 34.310  39.703  1.00 28.89  ? 128 ARG B H      1 
ATOM   4463 H  HA     . ARG B 1 128 ? -30.750 36.893  39.578  1.00 33.85  ? 128 ARG B HA     1 
ATOM   4464 H  HB2    . ARG B 1 128 ? -32.722 34.878  39.598  1.00 20.21  ? 128 ARG B HB2    1 
ATOM   4465 H  HB3    . ARG B 1 128 ? -33.073 36.406  39.338  1.00 20.21  ? 128 ARG B HB3    1 
ATOM   4466 H  HG2    . ARG B 1 128 ? -31.702 36.293  37.386  1.00 18.96  ? 128 ARG B HG2    1 
ATOM   4467 H  HG3    . ARG B 1 128 ? -31.626 34.721  37.608  1.00 18.96  ? 128 ARG B HG3    1 
ATOM   4468 H  HD2    . ARG B 1 128 ? -33.951 34.585  37.365  1.00 31.14  ? 128 ARG B HD2    1 
ATOM   4469 H  HD3    . ARG B 1 128 ? -34.009 36.153  37.113  1.00 31.14  ? 128 ARG B HD3    1 
ATOM   4470 H  HE     . ARG B 1 128 ? -33.254 35.819  35.057  1.00 42.50  ? 128 ARG B HE     1 
ATOM   4471 H  HH11   . ARG B 1 128 ? -33.391 32.859  36.544  1.00 47.96  ? 128 ARG B HH11   1 
ATOM   4472 H  HH12   . ARG B 1 128 ? -33.234 32.052  35.302  1.00 47.96  ? 128 ARG B HH12   1 
ATOM   4473 H  HH21   . ARG B 1 128 ? -33.025 34.576  33.189  1.00 18.45  ? 128 ARG B HH21   1 
ATOM   4474 H  HH22   . ARG B 1 128 ? -33.013 33.089  33.275  1.00 18.45  ? 128 ARG B HH22   1 
ATOM   4475 N  N      . GLU B 1 129 ? -31.776 35.620  42.328  1.00 19.55  ? 129 GLU B N      1 
ATOM   4476 C  CA     . GLU B 1 129 ? -32.159 35.942  43.696  1.00 14.66  ? 129 GLU B CA     1 
ATOM   4477 C  C      . GLU B 1 129 ? -31.044 36.695  44.408  1.00 18.04  ? 129 GLU B C      1 
ATOM   4478 O  O      . GLU B 1 129 ? -31.306 37.650  45.142  1.00 25.41  ? 129 GLU B O      1 
ATOM   4479 C  CB     . GLU B 1 129 ? -32.511 34.655  44.442  1.00 23.05  ? 129 GLU B CB     1 
ATOM   4480 C  CG     . GLU B 1 129 ? -33.812 34.007  43.973  1.00 24.12  ? 129 GLU B CG     1 
ATOM   4481 C  CD     . GLU B 1 129 ? -34.199 32.783  44.784  1.00 34.30  ? 129 GLU B CD     1 
ATOM   4482 O  OE1    . GLU B 1 129 ? -33.381 32.324  45.610  1.00 37.55  ? 129 GLU B OE1    1 
ATOM   4483 O  OE2    . GLU B 1 129 ? -35.317 32.266  44.574  1.00 43.28  ? 129 GLU B OE2    1 
ATOM   4484 H  H      . GLU B 1 129 ? -31.717 34.777  42.169  1.00 23.67  ? 129 GLU B H      1 
ATOM   4485 H  HA     . GLU B 1 129 ? -32.944 36.511  43.688  1.00 17.81  ? 129 GLU B HA     1 
ATOM   4486 H  HB2    . GLU B 1 129 ? -31.796 34.013  44.309  1.00 27.88  ? 129 GLU B HB2    1 
ATOM   4487 H  HB3    . GLU B 1 129 ? -32.604 34.857  45.386  1.00 27.88  ? 129 GLU B HB3    1 
ATOM   4488 H  HG2    . GLU B 1 129 ? -34.531 34.654  44.049  1.00 29.16  ? 129 GLU B HG2    1 
ATOM   4489 H  HG3    . GLU B 1 129 ? -33.711 33.731  43.048  1.00 29.16  ? 129 GLU B HG3    1 
ATOM   4490 N  N      . VAL B 1 130 ? -29.790 36.286  44.193  1.00 20.97  ? 130 VAL B N      1 
ATOM   4491 C  CA     . VAL B 1 130 ? -28.663 36.987  44.805  1.00 14.95  ? 130 VAL B CA     1 
ATOM   4492 C  C      . VAL B 1 130 ? -28.578 38.413  44.283  1.00 18.78  ? 130 VAL B C      1 
ATOM   4493 O  O      . VAL B 1 130 ? -28.354 39.366  45.047  1.00 23.75  ? 130 VAL B O      1 
ATOM   4494 C  CB     . VAL B 1 130 ? -27.353 36.220  44.551  1.00 11.19  ? 130 VAL B CB     1 
ATOM   4495 C  CG1    . VAL B 1 130 ? -26.163 37.081  44.898  1.00 14.78  ? 130 VAL B CG1    1 
ATOM   4496 C  CG2    . VAL B 1 130 ? -27.316 34.965  45.377  1.00 13.29  ? 130 VAL B CG2    1 
ATOM   4497 H  H      . VAL B 1 130 ? -29.567 35.615  43.704  1.00 25.38  ? 130 VAL B H      1 
ATOM   4498 H  HA     . VAL B 1 130 ? -28.810 37.024  45.763  1.00 18.16  ? 130 VAL B HA     1 
ATOM   4499 H  HB     . VAL B 1 130 ? -27.309 35.984  43.611  1.00 13.65  ? 130 VAL B HB     1 
ATOM   4500 H  HG11   . VAL B 1 130 ? -25.388 36.512  45.025  1.00 17.96  ? 130 VAL B HG11   1 
ATOM   4501 H  HG12   . VAL B 1 130 ? -26.001 37.703  44.172  1.00 17.96  ? 130 VAL B HG12   1 
ATOM   4502 H  HG13   . VAL B 1 130 ? -26.354 37.568  45.715  1.00 17.96  ? 130 VAL B HG13   1 
ATOM   4503 H  HG21   . VAL B 1 130 ? -26.500 34.480  45.178  1.00 16.17  ? 130 VAL B HG21   1 
ATOM   4504 H  HG22   . VAL B 1 130 ? -27.338 35.205  46.316  1.00 16.17  ? 130 VAL B HG22   1 
ATOM   4505 H  HG23   . VAL B 1 130 ? -28.087 34.419  45.156  1.00 16.17  ? 130 VAL B HG23   1 
ATOM   4506 N  N      . ASP B 1 131 ? -28.714 38.582  42.967  1.00 17.58  ? 131 ASP B N      1 
ATOM   4507 C  CA     . ASP B 1 131 ? -28.693 39.915  42.390  1.00 19.98  ? 131 ASP B CA     1 
ATOM   4508 C  C      . ASP B 1 131 ? -29.809 40.746  42.992  1.00 22.22  ? 131 ASP B C      1 
ATOM   4509 O  O      . ASP B 1 131 ? -29.632 41.916  43.350  1.00 22.77  ? 131 ASP B O      1 
ATOM   4510 C  CB     . ASP B 1 131 ? -28.855 39.852  40.873  1.00 24.53  ? 131 ASP B CB     1 
ATOM   4511 C  CG     . ASP B 1 131 ? -27.706 39.151  40.169  1.00 36.97  ? 131 ASP B CG     1 
ATOM   4512 O  OD1    . ASP B 1 131 ? -26.876 38.497  40.841  1.00 42.50  ? 131 ASP B OD1    1 
ATOM   4513 O  OD2    . ASP B 1 131 ? -27.621 39.273  38.929  1.00 48.30  ? 131 ASP B OD2    1 
ATOM   4514 H  H      . ASP B 1 131 ? -28.818 37.948  42.396  1.00 21.31  ? 131 ASP B H      1 
ATOM   4515 H  HA     . ASP B 1 131 ? -27.835 40.327  42.577  1.00 24.19  ? 131 ASP B HA     1 
ATOM   4516 H  HB2    . ASP B 1 131 ? -29.670 39.369  40.665  1.00 29.65  ? 131 ASP B HB2    1 
ATOM   4517 H  HB3    . ASP B 1 131 ? -28.908 40.756  40.526  1.00 29.65  ? 131 ASP B HB3    1 
ATOM   4518 N  N      . GLU B 1 132 ? -31.004 40.142  43.103  1.00 23.62  ? 132 GLU B N      1 
ATOM   4519 C  CA     . GLU B 1 132 ? -32.148 40.889  43.626  1.00 33.03  ? 132 GLU B CA     1 
ATOM   4520 C  C      . GLU B 1 132 ? -31.940 41.260  45.092  1.00 22.08  ? 132 GLU B C      1 
ATOM   4521 O  O      . GLU B 1 132 ? -32.334 42.358  45.516  1.00 34.06  ? 132 GLU B O      1 
ATOM   4522 C  CB     . GLU B 1 132 ? -33.447 40.096  43.449  1.00 33.63  ? 132 GLU B CB     1 
ATOM   4523 C  CG     . GLU B 1 132 ? -33.784 39.866  41.967  1.00 70.02  ? 132 GLU B CG     1 
ATOM   4524 C  CD     . GLU B 1 132 ? -34.929 38.890  41.770  1.00 86.29  ? 132 GLU B CD     1 
ATOM   4525 O  OE1    . GLU B 1 132 ? -35.451 38.385  42.790  1.00 74.48  ? 132 GLU B OE1    1 
ATOM   4526 O  OE2    . GLU B 1 132 ? -35.278 38.602  40.601  1.00 73.28  ? 132 GLU B OE2    1 
ATOM   4527 H  H      . GLU B 1 132 ? -31.172 39.326  42.890  1.00 28.57  ? 132 GLU B H      1 
ATOM   4528 H  HA     . GLU B 1 132 ? -32.238 41.708  43.113  1.00 39.85  ? 132 GLU B HA     1 
ATOM   4529 H  HB2    . GLU B 1 132 ? -33.351 39.230  43.876  1.00 40.58  ? 132 GLU B HB2    1 
ATOM   4530 H  HB3    . GLU B 1 132 ? -34.178 40.587  43.855  1.00 40.58  ? 132 GLU B HB3    1 
ATOM   4531 H  HG2    . GLU B 1 132 ? -34.039 40.712  41.566  1.00 84.24  ? 132 GLU B HG2    1 
ATOM   4532 H  HG3    . GLU B 1 132 ? -33.004 39.507  41.516  1.00 84.24  ? 132 GLU B HG3    1 
ATOM   4533 N  N      . ILE B 1 133 ? -31.373 40.372  45.890  1.00 20.88  ? 133 ILE B N      1 
ATOM   4534 C  CA     . ILE B 1 133 ? -31.123 40.656  47.300  1.00 14.37  ? 133 ILE B CA     1 
ATOM   4535 C  C      . ILE B 1 133 ? -30.094 41.784  47.477  1.00 22.60  ? 133 ILE B C      1 
ATOM   4536 O  O      . ILE B 1 133 ? -30.269 42.689  48.308  1.00 23.41  ? 133 ILE B O      1 
ATOM   4537 C  CB     . ILE B 1 133 ? -30.695 39.361  47.982  1.00 10.99  ? 133 ILE B CB     1 
ATOM   4538 C  CG1    . ILE B 1 133 ? -31.883 38.398  48.031  1.00 8.82   ? 133 ILE B CG1    1 
ATOM   4539 C  CG2    . ILE B 1 133 ? -30.187 39.628  49.376  1.00 13.23  ? 133 ILE B CG2    1 
ATOM   4540 C  CD1    . ILE B 1 133 ? -31.525 37.001  48.466  1.00 8.13   ? 133 ILE B CD1    1 
ATOM   4541 H  H      . ILE B 1 133 ? -31.119 39.587  45.645  1.00 25.27  ? 133 ILE B H      1 
ATOM   4542 H  HA     . ILE B 1 133 ? -31.938 40.980  47.715  1.00 17.46  ? 133 ILE B HA     1 
ATOM   4543 H  HB     . ILE B 1 133 ? -29.974 38.965  47.468  1.00 13.40  ? 133 ILE B HB     1 
ATOM   4544 H  HG12   . ILE B 1 133 ? -32.538 38.744  48.658  1.00 10.80  ? 133 ILE B HG12   1 
ATOM   4545 H  HG13   . ILE B 1 133 ? -32.273 38.340  47.144  1.00 10.80  ? 133 ILE B HG13   1 
ATOM   4546 H  HG21   . ILE B 1 133 ? -30.157 38.792  49.867  1.00 16.10  ? 133 ILE B HG21   1 
ATOM   4547 H  HG22   . ILE B 1 133 ? -29.297 40.010  49.320  1.00 16.10  ? 133 ILE B HG22   1 
ATOM   4548 H  HG23   . ILE B 1 133 ? -30.787 40.249  49.818  1.00 16.10  ? 133 ILE B HG23   1 
ATOM   4549 H  HD11   . ILE B 1 133 ? -32.273 36.411  48.284  1.00 9.97   ? 133 ILE B HD11   1 
ATOM   4550 H  HD12   . ILE B 1 133 ? -30.744 36.706  47.972  1.00 9.97   ? 133 ILE B HD12   1 
ATOM   4551 H  HD13   . ILE B 1 133 ? -31.332 37.006  49.417  1.00 9.97   ? 133 ILE B HD13   1 
ATOM   4552 N  N      . LEU B 1 134 ? -28.990 41.729  46.728  1.00 18.40  ? 134 LEU B N      1 
ATOM   4553 C  CA     . LEU B 1 134 ? -27.976 42.775  46.860  1.00 17.72  ? 134 LEU B CA     1 
ATOM   4554 C  C      . LEU B 1 134 ? -28.520 44.139  46.447  1.00 23.25  ? 134 LEU B C      1 
ATOM   4555 O  O      . LEU B 1 134 ? -28.266 45.150  47.120  1.00 26.21  ? 134 LEU B O      1 
ATOM   4556 C  CB     . LEU B 1 134 ? -26.730 42.427  46.050  1.00 21.13  ? 134 LEU B CB     1 
ATOM   4557 C  CG     . LEU B 1 134 ? -25.810 41.376  46.673  1.00 13.51  ? 134 LEU B CG     1 
ATOM   4558 C  CD1    . LEU B 1 134 ? -24.726 40.962  45.703  1.00 23.53  ? 134 LEU B CD1    1 
ATOM   4559 C  CD2    . LEU B 1 134 ? -25.198 41.907  47.948  1.00 15.95  ? 134 LEU B CD2    1 
ATOM   4560 H  H      . LEU B 1 134 ? -28.808 41.117  46.152  1.00 22.29  ? 134 LEU B H      1 
ATOM   4561 H  HA     . LEU B 1 134 ? -27.715 42.824  47.794  1.00 21.48  ? 134 LEU B HA     1 
ATOM   4562 H  HB2    . LEU B 1 134 ? -27.013 42.088  45.186  1.00 25.57  ? 134 LEU B HB2    1 
ATOM   4563 H  HB3    . LEU B 1 134 ? -26.207 43.236  45.933  1.00 25.57  ? 134 LEU B HB3    1 
ATOM   4564 H  HG     . LEU B 1 134 ? -26.336 40.589  46.886  1.00 16.42  ? 134 LEU B HG     1 
ATOM   4565 H  HD11   . LEU B 1 134 ? -24.152 40.307  46.131  1.00 28.45  ? 134 LEU B HD11   1 
ATOM   4566 H  HD12   . LEU B 1 134 ? -25.138 40.576  44.914  1.00 28.45  ? 134 LEU B HD12   1 
ATOM   4567 H  HD13   . LEU B 1 134 ? -24.207 41.744  45.456  1.00 28.45  ? 134 LEU B HD13   1 
ATOM   4568 H  HD21   . LEU B 1 134 ? -24.438 41.353  48.187  1.00 19.36  ? 134 LEU B HD21   1 
ATOM   4569 H  HD22   . LEU B 1 134 ? -24.908 42.821  47.802  1.00 19.36  ? 134 LEU B HD22   1 
ATOM   4570 H  HD23   . LEU B 1 134 ? -25.863 41.879  48.653  1.00 19.36  ? 134 LEU B HD23   1 
ATOM   4571 N  N      . ASN B 1 135 ? -29.259 44.196  45.331  1.00 24.21  ? 135 ASN B N      1 
ATOM   4572 C  CA     . ASN B 1 135 ? -29.809 45.478  44.899  1.00 26.19  ? 135 ASN B CA     1 
ATOM   4573 C  C      . ASN B 1 135 ? -30.755 46.051  45.944  1.00 32.13  ? 135 ASN B C      1 
ATOM   4574 O  O      . ASN B 1 135 ? -30.709 47.250  46.242  1.00 34.49  ? 135 ASN B O      1 
ATOM   4575 C  CB     . ASN B 1 135 ? -30.534 45.321  43.563  1.00 30.13  ? 135 ASN B CB     1 
ATOM   4576 C  CG     . ASN B 1 135 ? -29.584 45.118  42.402  1.00 38.32  ? 135 ASN B CG     1 
ATOM   4577 O  OD1    . ASN B 1 135 ? -28.419 44.760  42.586  1.00 45.19  ? 135 ASN B OD1    1 
ATOM   4578 N  ND2    . ASN B 1 135 ? -30.081 45.345  41.192  1.00 52.01  ? 135 ASN B ND2    1 
ATOM   4579 H  H      . ASN B 1 135 ? -29.450 43.528  44.824  1.00 29.27  ? 135 ASN B H      1 
ATOM   4580 H  HA     . ASN B 1 135 ? -29.075 46.100  44.773  1.00 31.65  ? 135 ASN B HA     1 
ATOM   4581 H  HB2    . ASN B 1 135 ? -31.120 44.550  43.609  1.00 36.37  ? 135 ASN B HB2    1 
ATOM   4582 H  HB3    . ASN B 1 135 ? -31.053 46.122  43.389  1.00 36.37  ? 135 ASN B HB3    1 
ATOM   4583 H  HD21   . ASN B 1 135 ? -29.583 45.244  40.497  1.00 62.63  ? 135 ASN B HD21   1 
ATOM   4584 H  HD22   . ASN B 1 135 ? -30.900 45.592  41.102  1.00 62.63  ? 135 ASN B HD22   1 
ATOM   4585 N  N      . ALA B 1 136 ? -31.612 45.202  46.525  1.00 23.49  ? 136 ALA B N      1 
ATOM   4586 C  CA     . ALA B 1 136 ? -32.554 45.680  47.531  1.00 24.53  ? 136 ALA B CA     1 
ATOM   4587 C  C      . ALA B 1 136 ? -31.839 46.129  48.798  1.00 22.02  ? 136 ALA B C      1 
ATOM   4588 O  O      . ALA B 1 136 ? -32.212 47.142  49.403  1.00 23.94  ? 136 ALA B O      1 
ATOM   4589 C  CB     . ALA B 1 136 ? -33.563 44.577  47.845  1.00 20.26  ? 136 ALA B CB     1 
ATOM   4590 H  H      . ALA B 1 136 ? -31.666 44.361  46.356  1.00 28.40  ? 136 ALA B H      1 
ATOM   4591 H  HA     . ALA B 1 136 ? -33.033 46.446  47.178  1.00 29.65  ? 136 ALA B HA     1 
ATOM   4592 H  HB1    . ALA B 1 136 ? -34.191 44.903  48.509  1.00 24.53  ? 136 ALA B HB1    1 
ATOM   4593 H  HB2    . ALA B 1 136 ? -34.035 44.340  47.032  1.00 24.53  ? 136 ALA B HB2    1 
ATOM   4594 H  HB3    . ALA B 1 136 ? -33.089 43.804  48.190  1.00 24.53  ? 136 ALA B HB3    1 
ATOM   4595 N  N      . SER B 1 137 ? -30.811 45.393  49.221  1.00 23.29  ? 137 SER B N      1 
ATOM   4596 C  CA     . SER B 1 137 ? -30.055 45.804  50.397  1.00 30.85  ? 137 SER B CA     1 
ATOM   4597 C  C      . SER B 1 137 ? -29.421 47.172  50.188  1.00 21.51  ? 137 SER B C      1 
ATOM   4598 O  O      . SER B 1 137 ? -29.506 48.047  51.057  1.00 24.14  ? 137 SER B O      1 
ATOM   4599 C  CB     . SER B 1 137 ? -28.995 44.758  50.725  1.00 18.65  ? 137 SER B CB     1 
ATOM   4600 O  OG     . SER B 1 137 ? -29.607 43.508  50.978  1.00 41.57  ? 137 SER B OG     1 
ATOM   4601 H  H      . SER B 1 137 ? -30.536 44.667  48.852  1.00 28.16  ? 137 SER B H      1 
ATOM   4602 H  HA     . SER B 1 137 ? -30.658 45.866  51.154  1.00 37.23  ? 137 SER B HA     1 
ATOM   4603 H  HB2    . SER B 1 137 ? -28.390 44.669  49.972  1.00 22.60  ? 137 SER B HB2    1 
ATOM   4604 H  HB3    . SER B 1 137 ? -28.504 45.037  51.514  1.00 22.60  ? 137 SER B HB3    1 
ATOM   4605 H  HG     . SER B 1 137 ? -30.046 43.262  50.306  1.00 50.10  ? 137 SER B HG     1 
ATOM   4606 N  N      . LEU B 1 138 ? -28.785 47.382  49.033  1.00 18.48  ? 138 LEU B N      1 
ATOM   4607 C  CA     . LEU B 1 138 ? -28.168 48.682  48.779  1.00 22.08  ? 138 LEU B CA     1 
ATOM   4608 C  C      . LEU B 1 138 ? -29.217 49.784  48.668  1.00 22.98  ? 138 LEU B C      1 
ATOM   4609 O  O      . LEU B 1 138 ? -29.005 50.901  49.160  1.00 18.55  ? 138 LEU B O      1 
ATOM   4610 C  CB     . LEU B 1 138 ? -27.294 48.617  47.527  1.00 16.19  ? 138 LEU B CB     1 
ATOM   4611 C  CG     . LEU B 1 138 ? -25.803 48.398  47.811  1.00 13.29  ? 138 LEU B CG     1 
ATOM   4612 C  CD1    . LEU B 1 138 ? -25.563 47.137  48.611  1.00 23.96  ? 138 LEU B CD1    1 
ATOM   4613 C  CD2    . LEU B 1 138 ? -25.022 48.341  46.509  1.00 45.31  ? 138 LEU B CD2    1 
ATOM   4614 H  H      . LEU B 1 138 ? -28.697 46.807  48.400  1.00 22.39  ? 138 LEU B H      1 
ATOM   4615 H  HA     . LEU B 1 138 ? -27.590 48.904  49.525  1.00 26.71  ? 138 LEU B HA     1 
ATOM   4616 H  HB2    . LEU B 1 138 ? -27.600 47.882  46.973  1.00 19.65  ? 138 LEU B HB2    1 
ATOM   4617 H  HB3    . LEU B 1 138 ? -27.381 49.455  47.045  1.00 19.65  ? 138 LEU B HB3    1 
ATOM   4618 H  HG     . LEU B 1 138 ? -25.485 49.145  48.341  1.00 16.16  ? 138 LEU B HG     1 
ATOM   4619 H  HD11   . LEU B 1 138 ? -24.610 46.962  48.645  1.00 28.97  ? 138 LEU B HD11   1 
ATOM   4620 H  HD12   . LEU B 1 138 ? -25.909 47.262  49.509  1.00 28.97  ? 138 LEU B HD12   1 
ATOM   4621 H  HD13   . LEU B 1 138 ? -26.020 46.398  48.181  1.00 28.97  ? 138 LEU B HD13   1 
ATOM   4622 H  HD21   . LEU B 1 138 ? -24.079 48.236  46.711  1.00 54.59  ? 138 LEU B HD21   1 
ATOM   4623 H  HD22   . LEU B 1 138 ? -25.335 47.587  45.986  1.00 54.59  ? 138 LEU B HD22   1 
ATOM   4624 H  HD23   . LEU B 1 138 ? -25.165 49.166  46.019  1.00 54.59  ? 138 LEU B HD23   1 
ATOM   4625 N  N      . PHE B 1 139 ? -30.352 49.500  48.027  1.00 31.11  ? 139 PHE B N      1 
ATOM   4626 C  CA     . PHE B 1 139 ? -31.395 50.512  47.918  1.00 24.40  ? 139 PHE B CA     1 
ATOM   4627 C  C      . PHE B 1 139 ? -31.913 50.914  49.292  1.00 21.75  ? 139 PHE B C      1 
ATOM   4628 O  O      . PHE B 1 139 ? -32.200 52.092  49.534  1.00 36.78  ? 139 PHE B O      1 
ATOM   4629 C  CB     . PHE B 1 139 ? -32.543 50.004  47.046  1.00 20.40  ? 139 PHE B CB     1 
ATOM   4630 C  CG     . PHE B 1 139 ? -33.668 50.987  46.906  1.00 23.64  ? 139 PHE B CG     1 
ATOM   4631 C  CD1    . PHE B 1 139 ? -33.667 51.926  45.889  1.00 31.53  ? 139 PHE B CD1    1 
ATOM   4632 C  CD2    . PHE B 1 139 ? -34.721 50.982  47.805  1.00 42.20  ? 139 PHE B CD2    1 
ATOM   4633 C  CE1    . PHE B 1 139 ? -34.699 52.834  45.767  1.00 33.49  ? 139 PHE B CE1    1 
ATOM   4634 C  CE2    . PHE B 1 139 ? -35.753 51.886  47.689  1.00 42.33  ? 139 PHE B CE2    1 
ATOM   4635 C  CZ     . PHE B 1 139 ? -35.743 52.813  46.669  1.00 54.56  ? 139 PHE B CZ     1 
ATOM   4636 H  H      . PHE B 1 139 ? -30.539 48.747  47.655  1.00 37.55  ? 139 PHE B H      1 
ATOM   4637 H  HA     . PHE B 1 139 ? -31.019 51.297  47.489  1.00 29.49  ? 139 PHE B HA     1 
ATOM   4638 H  HB2    . PHE B 1 139 ? -32.202 49.814  46.158  1.00 24.69  ? 139 PHE B HB2    1 
ATOM   4639 H  HB3    . PHE B 1 139 ? -32.903 49.195  47.442  1.00 24.69  ? 139 PHE B HB3    1 
ATOM   4640 H  HD1    . PHE B 1 139 ? -32.963 51.946  45.281  1.00 38.06  ? 139 PHE B HD1    1 
ATOM   4641 H  HD2    . PHE B 1 139 ? -34.732 50.359  48.495  1.00 50.86  ? 139 PHE B HD2    1 
ATOM   4642 H  HE1    . PHE B 1 139 ? -34.690 53.458  45.078  1.00 40.41  ? 139 PHE B HE1    1 
ATOM   4643 H  HE2    . PHE B 1 139 ? -36.456 51.871  48.298  1.00 51.01  ? 139 PHE B HE2    1 
ATOM   4644 H  HZ     . PHE B 1 139 ? -36.440 53.424  46.588  1.00 65.68  ? 139 PHE B HZ     1 
ATOM   4645 N  N      . MET B 1 140 ? -32.026 49.954  50.214  1.00 21.82  ? 140 MET B N      1 
ATOM   4646 C  CA     . MET B 1 140 ? -32.495 50.280  51.556  1.00 25.25  ? 140 MET B CA     1 
ATOM   4647 C  C      . MET B 1 140 ? -31.419 50.975  52.377  1.00 36.96  ? 140 MET B C      1 
ATOM   4648 O  O      . MET B 1 140 ? -31.740 51.781  53.258  1.00 52.15  ? 140 MET B O      1 
ATOM   4649 C  CB     . MET B 1 140 ? -32.952 49.018  52.289  1.00 21.72  ? 140 MET B CB     1 
ATOM   4650 C  CG     . MET B 1 140 ? -34.192 48.366  51.701  1.00 39.68  ? 140 MET B CG     1 
ATOM   4651 S  SD     . MET B 1 140 ? -34.836 47.054  52.756  1.00 86.11  ? 140 MET B SD     1 
ATOM   4652 C  CE     . MET B 1 140 ? -33.485 45.877  52.706  1.00 45.98  ? 140 MET B CE     1 
ATOM   4653 H  H      . MET B 1 140 ? -31.841 49.124  50.089  1.00 26.40  ? 140 MET B H      1 
ATOM   4654 H  HA     . MET B 1 140 ? -33.263 50.866  51.468  1.00 30.52  ? 140 MET B HA     1 
ATOM   4655 H  HB2    . MET B 1 140 ? -32.235 48.366  52.259  1.00 26.28  ? 140 MET B HB2    1 
ATOM   4656 H  HB3    . MET B 1 140 ? -33.151 49.250  53.210  1.00 26.28  ? 140 MET B HB3    1 
ATOM   4657 H  HG2    . MET B 1 140 ? -34.884 49.037  51.596  1.00 47.83  ? 140 MET B HG2    1 
ATOM   4658 H  HG3    . MET B 1 140 ? -33.970 47.979  50.840  1.00 47.83  ? 140 MET B HG3    1 
ATOM   4659 H  HE1    . MET B 1 140 ? -33.770 45.052  53.129  1.00 55.40  ? 140 MET B HE1    1 
ATOM   4660 H  HE2    . MET B 1 140 ? -33.247 45.710  51.781  1.00 55.40  ? 140 MET B HE2    1 
ATOM   4661 H  HE3    . MET B 1 140 ? -32.726 46.248  53.181  1.00 55.40  ? 140 MET B HE3    1 
ATOM   4662 N  N      . ILE B 1 141 ? -30.147 50.676  52.112  1.00 27.13  ? 141 ILE B N      1 
ATOM   4663 C  CA     . ILE B 1 141 ? -29.077 51.246  52.921  1.00 34.25  ? 141 ILE B CA     1 
ATOM   4664 C  C      . ILE B 1 141 ? -28.738 52.677  52.513  1.00 31.72  ? 141 ILE B C      1 
ATOM   4665 O  O      . ILE B 1 141 ? -28.389 53.498  53.370  1.00 28.24  ? 141 ILE B O      1 
ATOM   4666 C  CB     . ILE B 1 141 ? -27.826 50.350  52.846  1.00 24.96  ? 141 ILE B CB     1 
ATOM   4667 C  CG1    . ILE B 1 141 ? -28.044 49.064  53.645  1.00 18.08  ? 141 ILE B CG1    1 
ATOM   4668 C  CG2    . ILE B 1 141 ? -26.592 51.112  53.313  1.00 21.49  ? 141 ILE B CG2    1 
ATOM   4669 C  CD1    . ILE B 1 141 ? -26.944 48.041  53.460  1.00 30.33  ? 141 ILE B CD1    1 
ATOM   4670 H  H      . ILE B 1 141 ? -29.881 50.155  51.482  1.00 32.78  ? 141 ILE B H      1 
ATOM   4671 H  HA     . ILE B 1 141 ? -29.392 51.278  53.838  1.00 41.32  ? 141 ILE B HA     1 
ATOM   4672 H  HB     . ILE B 1 141 ? -27.677 50.097  51.922  1.00 30.17  ? 141 ILE B HB     1 
ATOM   4673 H  HG12   . ILE B 1 141 ? -28.088 49.285  54.588  1.00 21.91  ? 141 ILE B HG12   1 
ATOM   4674 H  HG13   . ILE B 1 141 ? -28.877 48.657  53.360  1.00 21.91  ? 141 ILE B HG13   1 
ATOM   4675 H  HG21   . ILE B 1 141 ? -25.873 50.481  53.475  1.00 26.00  ? 141 ILE B HG21   1 
ATOM   4676 H  HG22   . ILE B 1 141 ? -26.329 51.742  52.623  1.00 26.00  ? 141 ILE B HG22   1 
ATOM   4677 H  HG23   . ILE B 1 141 ? -26.805 51.588  54.131  1.00 26.00  ? 141 ILE B HG23   1 
ATOM   4678 H  HD11   . ILE B 1 141 ? -27.256 47.180  53.782  1.00 36.62  ? 141 ILE B HD11   1 
ATOM   4679 H  HD12   . ILE B 1 141 ? -26.723 47.981  52.518  1.00 36.62  ? 141 ILE B HD12   1 
ATOM   4680 H  HD13   . ILE B 1 141 ? -26.165 48.320  53.966  1.00 36.62  ? 141 ILE B HD13   1 
ATOM   4681 N  N      . TYR B 1 142 ? -28.826 53.005  51.223  1.00 35.59  ? 142 TYR B N      1 
ATOM   4682 C  CA     . TYR B 1 142 ? -28.306 54.279  50.730  1.00 31.41  ? 142 TYR B CA     1 
ATOM   4683 C  C      . TYR B 1 142 ? -28.805 55.464  51.559  1.00 23.72  ? 142 TYR B C      1 
ATOM   4684 O  O      . TYR B 1 142 ? -27.987 56.220  52.106  1.00 23.36  ? 142 TYR B O      1 
ATOM   4685 C  CB     . TYR B 1 142 ? -28.675 54.476  49.258  1.00 19.37  ? 142 TYR B CB     1 
ATOM   4686 C  CG     . TYR B 1 142 ? -28.175 55.778  48.689  1.00 18.54  ? 142 TYR B CG     1 
ATOM   4687 C  CD1    . TYR B 1 142 ? -26.880 55.874  48.198  1.00 25.53  ? 142 TYR B CD1    1 
ATOM   4688 C  CD2    . TYR B 1 142 ? -28.974 56.911  48.656  1.00 24.98  ? 142 TYR B CD2    1 
ATOM   4689 C  CE1    . TYR B 1 142 ? -26.396 57.054  47.676  1.00 34.18  ? 142 TYR B CE1    1 
ATOM   4690 C  CE2    . TYR B 1 142 ? -28.495 58.105  48.136  1.00 29.89  ? 142 TYR B CE2    1 
ATOM   4691 C  CZ     . TYR B 1 142 ? -27.203 58.169  47.648  1.00 29.74  ? 142 TYR B CZ     1 
ATOM   4692 O  OH     . TYR B 1 142 ? -26.710 59.343  47.126  1.00 31.10  ? 142 TYR B OH     1 
ATOM   4693 H  H      . TYR B 1 142 ? -29.180 52.508  50.618  1.00 42.93  ? 142 TYR B H      1 
ATOM   4694 H  HA     . TYR B 1 142 ? -27.340 54.257  50.817  1.00 37.91  ? 142 TYR B HA     1 
ATOM   4695 H  HB2    . TYR B 1 142 ? -28.287 53.755  48.738  1.00 23.46  ? 142 TYR B HB2    1 
ATOM   4696 H  HB3    . TYR B 1 142 ? -29.641 54.464  49.172  1.00 23.46  ? 142 TYR B HB3    1 
ATOM   4697 H  HD1    . TYR B 1 142 ? -26.327 55.126  48.222  1.00 30.86  ? 142 TYR B HD1    1 
ATOM   4698 H  HD2    . TYR B 1 142 ? -29.842 56.870  48.986  1.00 30.19  ? 142 TYR B HD2    1 
ATOM   4699 H  HE1    . TYR B 1 142 ? -25.528 57.098  47.344  1.00 41.23  ? 142 TYR B HE1    1 
ATOM   4700 H  HE2    . TYR B 1 142 ? -29.040 58.858  48.116  1.00 36.08  ? 142 TYR B HE2    1 
ATOM   4701 H  HH     . TYR B 1 142 ? -27.303 59.938  47.146  1.00 37.53  ? 142 TYR B HH     1 
ATOM   4702 N  N      . PRO B 1 143 ? -30.123 55.676  51.669  1.00 25.69  ? 143 PRO B N      1 
ATOM   4703 C  CA     . PRO B 1 143 ? -30.595 56.886  52.365  1.00 22.22  ? 143 PRO B CA     1 
ATOM   4704 C  C      . PRO B 1 143 ? -30.182 56.946  53.825  1.00 33.46  ? 143 PRO B C      1 
ATOM   4705 O  O      . PRO B 1 143 ? -29.833 58.024  54.324  1.00 44.42  ? 143 PRO B O      1 
ATOM   4706 C  CB     . PRO B 1 143 ? -32.122 56.802  52.211  1.00 10.10  ? 143 PRO B CB     1 
ATOM   4707 C  CG     . PRO B 1 143 ? -32.407 55.369  52.035  1.00 20.58  ? 143 PRO B CG     1 
ATOM   4708 C  CD     . PRO B 1 143 ? -31.243 54.805  51.271  1.00 39.73  ? 143 PRO B CD     1 
ATOM   4709 H  HA     . PRO B 1 143 ? -30.265 57.674  51.906  1.00 26.88  ? 143 PRO B HA     1 
ATOM   4710 H  HB2    . PRO B 1 143 ? -32.554 57.147  53.009  1.00 12.33  ? 143 PRO B HB2    1 
ATOM   4711 H  HB3    . PRO B 1 143 ? -32.405 57.311  51.435  1.00 12.33  ? 143 PRO B HB3    1 
ATOM   4712 H  HG2    . PRO B 1 143 ? -32.486 54.943  52.903  1.00 24.92  ? 143 PRO B HG2    1 
ATOM   4713 H  HG3    . PRO B 1 143 ? -33.231 55.259  51.535  1.00 24.92  ? 143 PRO B HG3    1 
ATOM   4714 H  HD2    . PRO B 1 143 ? -31.074 53.885  51.529  1.00 47.89  ? 143 PRO B HD2    1 
ATOM   4715 H  HD3    . PRO B 1 143 ? -31.399 54.858  50.315  1.00 47.89  ? 143 PRO B HD3    1 
ATOM   4716 N  N      . VAL B 1 144 ? -30.208 55.814  54.530  1.00 29.54  ? 144 VAL B N      1 
ATOM   4717 C  CA     . VAL B 1 144 ? -29.832 55.813  55.941  1.00 16.64  ? 144 VAL B CA     1 
ATOM   4718 C  C      . VAL B 1 144 ? -28.385 56.259  56.095  1.00 23.31  ? 144 VAL B C      1 
ATOM   4719 O  O      . VAL B 1 144 ? -28.057 57.092  56.948  1.00 35.04  ? 144 VAL B O      1 
ATOM   4720 C  CB     . VAL B 1 144 ? -30.060 54.420  56.555  1.00 13.65  ? 144 VAL B CB     1 
ATOM   4721 C  CG1    . VAL B 1 144 ? -29.733 54.424  58.038  1.00 21.03  ? 144 VAL B CG1    1 
ATOM   4722 C  CG2    . VAL B 1 144 ? -31.490 53.974  56.332  1.00 30.32  ? 144 VAL B CG2    1 
ATOM   4723 H  H      . VAL B 1 144 ? -30.435 55.044  54.221  1.00 35.66  ? 144 VAL B H      1 
ATOM   4724 H  HA     . VAL B 1 144 ? -30.396 56.445  56.414  1.00 20.18  ? 144 VAL B HA     1 
ATOM   4725 H  HB     . VAL B 1 144 ? -29.467 53.788  56.119  1.00 16.59  ? 144 VAL B HB     1 
ATOM   4726 H  HG11   . VAL B 1 144 ? -29.948 53.555  58.411  1.00 25.45  ? 144 VAL B HG11   1 
ATOM   4727 H  HG12   . VAL B 1 144 ? -28.788 54.608  58.153  1.00 25.45  ? 144 VAL B HG12   1 
ATOM   4728 H  HG13   . VAL B 1 144 ? -30.259 55.111  58.476  1.00 25.45  ? 144 VAL B HG13   1 
ATOM   4729 H  HG21   . VAL B 1 144 ? -31.656 53.174  56.856  1.00 36.60  ? 144 VAL B HG21   1 
ATOM   4730 H  HG22   . VAL B 1 144 ? -32.089 54.683  56.611  1.00 36.60  ? 144 VAL B HG22   1 
ATOM   4731 H  HG23   . VAL B 1 144 ? -31.618 53.784  55.390  1.00 36.60  ? 144 VAL B HG23   1 
ATOM   4732 N  N      . LEU B 1 145 ? -27.496 55.719  55.262  1.00 17.12  ? 145 LEU B N      1 
ATOM   4733 C  CA     . LEU B 1 145 ? -26.086 56.078  55.359  1.00 23.99  ? 145 LEU B CA     1 
ATOM   4734 C  C      . LEU B 1 145 ? -25.867 57.538  54.988  1.00 31.50  ? 145 LEU B C      1 
ATOM   4735 O  O      . LEU B 1 145 ? -25.059 58.233  55.619  1.00 37.10  ? 145 LEU B O      1 
ATOM   4736 C  CB     . LEU B 1 145 ? -25.252 55.163  54.464  1.00 22.95  ? 145 LEU B CB     1 
ATOM   4737 C  CG     . LEU B 1 145 ? -23.749 55.437  54.429  1.00 23.14  ? 145 LEU B CG     1 
ATOM   4738 C  CD1    . LEU B 1 145 ? -23.147 55.310  55.817  1.00 25.21  ? 145 LEU B CD1    1 
ATOM   4739 C  CD2    . LEU B 1 145 ? -23.066 54.493  53.453  1.00 25.01  ? 145 LEU B CD2    1 
ATOM   4740 H  H      . LEU B 1 145 ? -27.679 55.152  54.642  1.00 20.76  ? 145 LEU B H      1 
ATOM   4741 H  HA     . LEU B 1 145 ? -25.791 55.953  56.274  1.00 29.01  ? 145 LEU B HA     1 
ATOM   4742 H  HB2    . LEU B 1 145 ? -25.369 54.251  54.774  1.00 27.76  ? 145 LEU B HB2    1 
ATOM   4743 H  HB3    . LEU B 1 145 ? -25.580 55.249  53.556  1.00 27.76  ? 145 LEU B HB3    1 
ATOM   4744 H  HG     . LEU B 1 145 ? -23.596 56.345  54.125  1.00 27.99  ? 145 LEU B HG     1 
ATOM   4745 H  HD11   . LEU B 1 145 ? -22.182 55.383  55.751  1.00 30.46  ? 145 LEU B HD11   1 
ATOM   4746 H  HD12   . LEU B 1 145 ? -23.495 56.021  56.378  1.00 30.46  ? 145 LEU B HD12   1 
ATOM   4747 H  HD13   . LEU B 1 145 ? -23.389 54.448  56.189  1.00 30.46  ? 145 LEU B HD13   1 
ATOM   4748 H  HD21   . LEU B 1 145 ? -22.116 54.685  53.440  1.00 30.23  ? 145 LEU B HD21   1 
ATOM   4749 H  HD22   . LEU B 1 145 ? -23.215 53.579  53.741  1.00 30.23  ? 145 LEU B HD22   1 
ATOM   4750 H  HD23   . LEU B 1 145 ? -23.442 54.627  52.569  1.00 30.23  ? 145 LEU B HD23   1 
ATOM   4751 N  N      . ASP B 1 146 ? -26.568 58.019  53.962  1.00 37.00  ? 146 ASP B N      1 
ATOM   4752 C  CA     . ASP B 1 146 ? -26.442 59.421  53.582  1.00 39.95  ? 146 ASP B CA     1 
ATOM   4753 C  C      . ASP B 1 146 ? -26.845 60.332  54.736  1.00 38.64  ? 146 ASP B C      1 
ATOM   4754 O  O      . ASP B 1 146 ? -26.115 61.268  55.096  1.00 45.27  ? 146 ASP B O      1 
ATOM   4755 C  CB     . ASP B 1 146 ? -27.301 59.691  52.347  1.00 41.56  ? 146 ASP B CB     1 
ATOM   4756 C  CG     . ASP B 1 146 ? -27.199 61.114  51.866  1.00 42.98  ? 146 ASP B CG     1 
ATOM   4757 O  OD1    . ASP B 1 146 ? -26.101 61.513  51.420  1.00 45.26  ? 146 ASP B OD1    1 
ATOM   4758 O  OD2    . ASP B 1 146 ? -28.223 61.827  51.930  1.00 49.59  ? 146 ASP B OD2    1 
ATOM   4759 H  H      . ASP B 1 146 ? -27.113 57.564  53.477  1.00 44.61  ? 146 ASP B H      1 
ATOM   4760 H  HA     . ASP B 1 146 ? -25.519 59.616  53.358  1.00 48.16  ? 146 ASP B HA     1 
ATOM   4761 H  HB2    . ASP B 1 146 ? -27.010 59.109  51.627  1.00 50.09  ? 146 ASP B HB2    1 
ATOM   4762 H  HB3    . ASP B 1 146 ? -28.229 59.512  52.563  1.00 50.09  ? 146 ASP B HB3    1 
ATOM   4763 N  N      . SER B 1 147 ? -28.001 60.054  55.346  1.00 36.62  ? 147 SER B N      1 
ATOM   4764 C  CA     . SER B 1 147 ? -28.463 60.859  56.470  1.00 24.33  ? 147 SER B CA     1 
ATOM   4765 C  C      . SER B 1 147 ? -27.503 60.766  57.649  1.00 29.94  ? 147 SER B C      1 
ATOM   4766 O  O      . SER B 1 147 ? -27.284 61.755  58.355  1.00 44.88  ? 147 SER B O      1 
ATOM   4767 C  CB     . SER B 1 147 ? -29.863 60.414  56.891  1.00 30.60  ? 147 SER B CB     1 
ATOM   4768 O  OG     . SER B 1 147 ? -30.794 60.576  55.833  1.00 51.04  ? 147 SER B OG     1 
ATOM   4769 H  H      . SER B 1 147 ? -28.530 59.411  55.130  1.00 44.16  ? 147 SER B H      1 
ATOM   4770 H  HA     . SER B 1 147 ? -28.509 61.787  56.190  1.00 29.41  ? 147 SER B HA     1 
ATOM   4771 H  HB2    . SER B 1 147 ? -29.833 59.477  57.141  1.00 36.94  ? 147 SER B HB2    1 
ATOM   4772 H  HB3    . SER B 1 147 ? -30.150 60.950  57.646  1.00 36.94  ? 147 SER B HB3    1 
ATOM   4773 H  HG     . SER B 1 147 ? -30.571 60.099  55.178  1.00 61.46  ? 147 SER B HG     1 
ATOM   4774 N  N      . ALA B 1 148 ? -26.920 59.587  57.880  1.00 33.89  ? 148 ALA B N      1 
ATOM   4775 C  CA     . ALA B 1 148 ? -25.980 59.433  58.986  1.00 34.91  ? 148 ALA B CA     1 
ATOM   4776 C  C      . ALA B 1 148 ? -24.737 60.285  58.771  1.00 27.83  ? 148 ALA B C      1 
ATOM   4777 O  O      . ALA B 1 148 ? -24.293 61.001  59.678  1.00 45.21  ? 148 ALA B O      1 
ATOM   4778 C  CB     . ALA B 1 148 ? -25.599 57.962  59.154  1.00 33.25  ? 148 ALA B CB     1 
ATOM   4779 H  H      . ALA B 1 148 ? -27.049 58.873  57.419  1.00 40.89  ? 148 ALA B H      1 
ATOM   4780 H  HA     . ALA B 1 148 ? -26.412 59.727  59.803  1.00 42.11  ? 148 ALA B HA     1 
ATOM   4781 H  HB1    . ALA B 1 148 ? -24.975 57.880  59.891  1.00 40.11  ? 148 ALA B HB1    1 
ATOM   4782 H  HB2    . ALA B 1 148 ? -26.400 57.448  59.339  1.00 40.11  ? 148 ALA B HB2    1 
ATOM   4783 H  HB3    . ALA B 1 148 ? -25.187 57.648  58.334  1.00 40.11  ? 148 ALA B HB3    1 
ATOM   4784 N  N      . PHE B 1 149 ? -24.158 60.217  57.571  1.00 32.88  ? 149 PHE B N      1 
ATOM   4785 C  CA     . PHE B 1 149 ? -22.981 61.030  57.282  1.00 34.58  ? 149 PHE B CA     1 
ATOM   4786 C  C      . PHE B 1 149 ? -23.299 62.515  57.406  1.00 44.87  ? 149 PHE B C      1 
ATOM   4787 O  O      . PHE B 1 149 ? -22.482 63.289  57.918  1.00 37.67  ? 149 PHE B O      1 
ATOM   4788 C  CB     . PHE B 1 149 ? -22.432 60.718  55.888  1.00 26.21  ? 149 PHE B CB     1 
ATOM   4789 C  CG     . PHE B 1 149 ? -21.471 59.554  55.846  1.00 33.91  ? 149 PHE B CG     1 
ATOM   4790 C  CD1    . PHE B 1 149 ? -20.491 59.406  56.815  1.00 33.61  ? 149 PHE B CD1    1 
ATOM   4791 C  CD2    . PHE B 1 149 ? -21.520 58.634  54.811  1.00 36.67  ? 149 PHE B CD2    1 
ATOM   4792 C  CE1    . PHE B 1 149 ? -19.603 58.353  56.773  1.00 27.94  ? 149 PHE B CE1    1 
ATOM   4793 C  CE2    . PHE B 1 149 ? -20.628 57.578  54.761  1.00 33.53  ? 149 PHE B CE2    1 
ATOM   4794 C  CZ     . PHE B 1 149 ? -19.668 57.438  55.743  1.00 33.96  ? 149 PHE B CZ     1 
ATOM   4795 H  H      . PHE B 1 149 ? -24.419 59.719  56.920  1.00 39.67  ? 149 PHE B H      1 
ATOM   4796 H  HA     . PHE B 1 149 ? -22.291 60.807  57.926  1.00 41.71  ? 149 PHE B HA     1 
ATOM   4797 H  HB2    . PHE B 1 149 ? -23.175 60.507  55.302  1.00 31.67  ? 149 PHE B HB2    1 
ATOM   4798 H  HB3    . PHE B 1 149 ? -21.961 61.499  55.558  1.00 31.67  ? 149 PHE B HB3    1 
ATOM   4799 H  HD1    . PHE B 1 149 ? -20.432 60.027  57.505  1.00 40.55  ? 149 PHE B HD1    1 
ATOM   4800 H  HD2    . PHE B 1 149 ? -22.160 58.728  54.143  1.00 44.22  ? 149 PHE B HD2    1 
ATOM   4801 H  HE1    . PHE B 1 149 ? -18.960 58.259  57.438  1.00 33.74  ? 149 PHE B HE1    1 
ATOM   4802 H  HE2    . PHE B 1 149 ? -20.674 56.962  54.065  1.00 40.46  ? 149 PHE B HE2    1 
ATOM   4803 H  HZ     . PHE B 1 149 ? -19.068 56.729  55.711  1.00 40.97  ? 149 PHE B HZ     1 
ATOM   4804 N  N      . LYS B 1 150 ? -24.477 62.936  56.937  1.00 41.94  ? 150 LYS B N      1 
ATOM   4805 C  CA     . LYS B 1 150 ? -24.829 64.351  57.016  1.00 43.19  ? 150 LYS B CA     1 
ATOM   4806 C  C      . LYS B 1 150 ? -25.025 64.807  58.459  1.00 59.50  ? 150 LYS B C      1 
ATOM   4807 O  O      . LYS B 1 150 ? -24.536 65.873  58.852  1.00 66.00  ? 150 LYS B O      1 
ATOM   4808 C  CB     . LYS B 1 150 ? -26.094 64.610  56.196  1.00 36.56  ? 150 LYS B CB     1 
ATOM   4809 C  CG     . LYS B 1 150 ? -25.875 64.498  54.698  1.00 58.59  ? 150 LYS B CG     1 
ATOM   4810 C  CD     . LYS B 1 150 ? -27.160 64.702  53.916  1.00 48.05  ? 150 LYS B CD     1 
ATOM   4811 C  CE     . LYS B 1 150 ? -26.897 64.643  52.419  1.00 54.95  ? 150 LYS B CE     1 
ATOM   4812 N  NZ     . LYS B 1 150 ? -28.154 64.740  51.622  1.00 72.90  ? 150 LYS B NZ     1 
ATOM   4813 H  H      . LYS B 1 150 ? -25.076 62.434  56.578  1.00 50.55  ? 150 LYS B H      1 
ATOM   4814 H  HA     . LYS B 1 150 ? -24.104 64.875  56.641  1.00 52.04  ? 150 LYS B HA     1 
ATOM   4815 H  HB2    . LYS B 1 150 ? -26.768 63.959  56.447  1.00 44.09  ? 150 LYS B HB2    1 
ATOM   4816 H  HB3    . LYS B 1 150 ? -26.411 65.506  56.384  1.00 44.09  ? 150 LYS B HB3    1 
ATOM   4817 H  HG2    . LYS B 1 150 ? -25.240 65.176  54.417  1.00 70.52  ? 150 LYS B HG2    1 
ATOM   4818 H  HG3    . LYS B 1 150 ? -25.532 63.615  54.490  1.00 70.52  ? 150 LYS B HG3    1 
ATOM   4819 H  HD2    . LYS B 1 150 ? -27.792 64.003  54.145  1.00 57.88  ? 150 LYS B HD2    1 
ATOM   4820 H  HD3    . LYS B 1 150 ? -27.534 65.571  54.129  1.00 57.88  ? 150 LYS B HD3    1 
ATOM   4821 H  HE2    . LYS B 1 150 ? -26.321 65.382  52.167  1.00 66.16  ? 150 LYS B HE2    1 
ATOM   4822 H  HE3    . LYS B 1 150 ? -26.467 63.800  52.204  1.00 66.16  ? 150 LYS B HE3    1 
ATOM   4823 H  HZ1    . LYS B 1 150 ? -28.690 65.357  51.975  1.00 87.70  ? 150 LYS B HZ1    1 
ATOM   4824 H  HZ2    . LYS B 1 150 ? -27.966 64.967  50.783  1.00 87.70  ? 150 LYS B HZ2    1 
ATOM   4825 H  HZ3    . LYS B 1 150 ? -28.576 63.956  51.622  1.00 87.70  ? 150 LYS B HZ3    1 
ATOM   4826 N  N      . ASN B 1 151 ? -25.725 64.010  59.266  1.00 39.66  ? 151 ASN B N      1 
ATOM   4827 C  CA     . ASN B 1 151 ? -26.031 64.381  60.641  1.00 20.14  ? 151 ASN B CA     1 
ATOM   4828 C  C      . ASN B 1 151 ? -24.840 64.259  61.581  1.00 37.90  ? 151 ASN B C      1 
ATOM   4829 O  O      . ASN B 1 151 ? -24.855 64.872  62.653  1.00 63.10  ? 151 ASN B O      1 
ATOM   4830 C  CB     . ASN B 1 151 ? -27.208 63.551  61.148  1.00 38.63  ? 151 ASN B CB     1 
ATOM   4831 C  CG     . ASN B 1 151 ? -28.469 63.790  60.340  1.00 51.75  ? 151 ASN B CG     1 
ATOM   4832 O  OD1    . ASN B 1 151 ? -28.640 64.851  59.736  1.00 35.62  ? 151 ASN B OD1    1 
ATOM   4833 N  ND2    . ASN B 1 151 ? -29.365 62.809  60.332  1.00 63.81  ? 151 ASN B ND2    1 
ATOM   4834 H  H      . ASN B 1 151 ? -26.037 63.242  59.038  1.00 47.80  ? 151 ASN B H      1 
ATOM   4835 H  HA     . ASN B 1 151 ? -26.299 65.313  60.661  1.00 24.38  ? 151 ASN B HA     1 
ATOM   4836 H  HB2    . ASN B 1 151 ? -26.983 62.610  61.087  1.00 46.57  ? 151 ASN B HB2    1 
ATOM   4837 H  HB3    . ASN B 1 151 ? -27.391 63.789  62.071  1.00 46.57  ? 151 ASN B HB3    1 
ATOM   4838 H  HD21   . ASN B 1 151 ? -30.096 62.898  59.888  1.00 76.78  ? 151 ASN B HD21   1 
ATOM   4839 H  HD22   . ASN B 1 151 ? -29.214 62.085  60.771  1.00 76.78  ? 151 ASN B HD22   1 
ATOM   4840 N  N      . ARG B 1 152 ? -23.820 63.473  61.229  1.00 50.82  ? 152 ARG B N      1 
ATOM   4841 C  CA     . ARG B 1 152 ? -22.651 63.380  62.100  1.00 54.20  ? 152 ARG B CA     1 
ATOM   4842 C  C      . ARG B 1 152 ? -21.986 64.737  62.304  1.00 60.54  ? 152 ARG B C      1 
ATOM   4843 O  O      . ARG B 1 152 ? -21.568 65.064  63.421  1.00 63.15  ? 152 ARG B O      1 
ATOM   4844 C  CB     . ARG B 1 152 ? -21.649 62.373  61.533  1.00 53.47  ? 152 ARG B CB     1 
ATOM   4845 C  CG     . ARG B 1 152 ? -20.388 62.218  62.376  1.00 70.69  ? 152 ARG B CG     1 
ATOM   4846 C  CD     . ARG B 1 152 ? -19.460 61.148  61.817  1.00 63.06  ? 152 ARG B CD     1 
ATOM   4847 N  NE     . ARG B 1 152 ? -18.964 61.462  60.480  1.00 42.71  ? 152 ARG B NE     1 
ATOM   4848 C  CZ     . ARG B 1 152 ? -18.029 60.757  59.849  1.00 37.40  ? 152 ARG B CZ     1 
ATOM   4849 N  NH1    . ARG B 1 152 ? -17.482 59.702  60.438  1.00 27.26  ? 152 ARG B NH1    1 
ATOM   4850 N  NH2    . ARG B 1 152 ? -17.643 61.104  58.628  1.00 52.40  ? 152 ARG B NH2    1 
ATOM   4851 H  H      . ARG B 1 152 ? -23.780 62.997  60.514  1.00 61.21  ? 152 ARG B H      1 
ATOM   4852 H  HA     . ARG B 1 152 ? -22.944 63.062  62.969  1.00 65.26  ? 152 ARG B HA     1 
ATOM   4853 H  HB2    . ARG B 1 152 ? -22.077 61.505  61.478  1.00 64.38  ? 152 ARG B HB2    1 
ATOM   4854 H  HB3    . ARG B 1 152 ? -21.379 62.667  60.649  1.00 64.38  ? 152 ARG B HB3    1 
ATOM   4855 H  HG2    . ARG B 1 152 ? -19.907 63.060  62.390  1.00 85.05  ? 152 ARG B HG2    1 
ATOM   4856 H  HG3    . ARG B 1 152 ? -20.636 61.962  63.278  1.00 85.05  ? 152 ARG B HG3    1 
ATOM   4857 H  HD2    . ARG B 1 152 ? -18.694 61.057  62.405  1.00 75.88  ? 152 ARG B HD2    1 
ATOM   4858 H  HD3    . ARG B 1 152 ? -19.942 60.308  61.766  1.00 75.88  ? 152 ARG B HD3    1 
ATOM   4859 H  HE     . ARG B 1 152 ? -19.296 62.144  60.076  1.00 51.47  ? 152 ARG B HE     1 
ATOM   4860 H  HH11   . ARG B 1 152 ? -17.731 59.474  61.229  1.00 32.93  ? 152 ARG B HH11   1 
ATOM   4861 H  HH12   . ARG B 1 152 ? -16.878 59.247  60.030  1.00 32.93  ? 152 ARG B HH12   1 
ATOM   4862 H  HH21   . ARG B 1 152 ? -17.997 61.786  58.242  1.00 63.10  ? 152 ARG B HH21   1 
ATOM   4863 H  HH22   . ARG B 1 152 ? -17.038 60.646  58.222  1.00 63.10  ? 152 ARG B HH22   1 
ATOM   4864 N  N      . LYS B 1 153 ? -21.891 65.545  61.254  1.00 64.80  ? 153 LYS B N      1 
ATOM   4865 C  CA     . LYS B 1 153 ? -21.284 66.869  61.377  1.00 86.39  ? 153 LYS B CA     1 
ATOM   4866 C  C      . LYS B 1 153 ? -22.095 67.757  62.320  1.00 95.38  ? 153 LYS B C      1 
ATOM   4867 O  O      . LYS B 1 153 ? -21.573 68.268  63.314  1.00 87.30  ? 153 LYS B O      1 
ATOM   4868 C  CB     . LYS B 1 153 ? -21.164 67.534  60.003  1.00 50.90  ? 153 LYS B CB     1 
ATOM   4869 H  H      . LYS B 1 153 ? -22.169 65.353  60.463  1.00 77.98  ? 153 LYS B H      1 
ATOM   4870 H  HA     . LYS B 1 153 ? -20.392 66.773  61.744  1.00 103.88 ? 153 LYS B HA     1 
ATOM   4871 N  N      . LEU C 1 6   ? 24.227  19.316  7.263   1.00 91.40  ? 6   LEU C N      1 
ATOM   4872 C  CA     . LEU C 1 6   ? 24.980  20.539  7.521   1.00 113.37 ? 6   LEU C CA     1 
ATOM   4873 C  C      . LEU C 1 6   ? 24.178  21.771  7.111   1.00 99.16  ? 6   LEU C C      1 
ATOM   4874 O  O      . LEU C 1 6   ? 24.208  22.186  5.951   1.00 87.54  ? 6   LEU C O      1 
ATOM   4875 C  CB     . LEU C 1 6   ? 26.317  20.511  6.777   1.00 121.61 ? 6   LEU C CB     1 
ATOM   4876 H  HA     . LEU C 1 6   ? 25.166  20.602  8.471   1.00 136.26 ? 6   LEU C HA     1 
ATOM   4877 N  N      . ASN C 1 7   ? 23.465  22.352  8.076   1.00 88.22  ? 7   ASN C N      1 
ATOM   4878 C  CA     . ASN C 1 7   ? 22.629  23.521  7.838   1.00 87.59  ? 7   ASN C CA     1 
ATOM   4879 C  C      . ASN C 1 7   ? 22.776  24.482  9.011   1.00 85.70  ? 7   ASN C C      1 
ATOM   4880 O  O      . ASN C 1 7   ? 23.403  24.168  10.027  1.00 73.70  ? 7   ASN C O      1 
ATOM   4881 C  CB     . ASN C 1 7   ? 21.159  23.127  7.639   1.00 89.00  ? 7   ASN C CB     1 
ATOM   4882 C  CG     . ASN C 1 7   ? 20.913  22.439  6.307   1.00 95.03  ? 7   ASN C CG     1 
ATOM   4883 O  OD1    . ASN C 1 7   ? 21.603  22.700  5.321   1.00 97.19  ? 7   ASN C OD1    1 
ATOM   4884 N  ND2    . ASN C 1 7   ? 19.927  21.547  6.276   1.00 85.76  ? 7   ASN C ND2    1 
ATOM   4885 H  H      . ASN C 1 7   ? 23.452  22.080  8.892   1.00 106.08 ? 7   ASN C H      1 
ATOM   4886 H  HA     . ASN C 1 7   ? 22.932  23.974  7.035   1.00 105.33 ? 7   ASN C HA     1 
ATOM   4887 H  HB2    . ASN C 1 7   ? 20.896  22.517  8.346   1.00 107.02 ? 7   ASN C HB2    1 
ATOM   4888 H  HB3    . ASN C 1 7   ? 20.611  23.927  7.670   1.00 107.02 ? 7   ASN C HB3    1 
ATOM   4889 H  HD21   . ASN C 1 7   ? 19.748  21.130  5.546   1.00 103.13 ? 7   ASN C HD21   1 
ATOM   4890 H  HD22   . ASN C 1 7   ? 19.470  21.387  6.986   1.00 103.13 ? 7   ASN C HD22   1 
ATOM   4891 N  N      . LEU C 1 8   ? 22.188  25.667  8.858   1.00 89.55  ? 8   LEU C N      1 
ATOM   4892 C  CA     . LEU C 1 8   ? 22.214  26.676  9.906   1.00 70.04  ? 8   LEU C CA     1 
ATOM   4893 C  C      . LEU C 1 8   ? 21.123  26.418  10.940  1.00 59.09  ? 8   LEU C C      1 
ATOM   4894 O  O      . LEU C 1 8   ? 20.086  25.812  10.652  1.00 46.34  ? 8   LEU C O      1 
ATOM   4895 C  CB     . LEU C 1 8   ? 22.030  28.073  9.306   1.00 47.94  ? 8   LEU C CB     1 
ATOM   4896 C  CG     . LEU C 1 8   ? 23.114  28.583  8.355   1.00 47.79  ? 8   LEU C CG     1 
ATOM   4897 C  CD1    . LEU C 1 8   ? 22.669  29.861  7.663   1.00 44.98  ? 8   LEU C CD1    1 
ATOM   4898 C  CD2    . LEU C 1 8   ? 24.408  28.825  9.113   1.00 48.03  ? 8   LEU C CD2    1 
ATOM   4899 H  H      . LEU C 1 8   ? 21.765  25.911  8.151   1.00 107.68 ? 8   LEU C H      1 
ATOM   4900 H  HA     . LEU C 1 8   ? 23.072  26.643  10.357  1.00 84.27  ? 8   LEU C HA     1 
ATOM   4901 H  HB2    . LEU C 1 8   ? 21.197  28.075  8.809   1.00 57.75  ? 8   LEU C HB2    1 
ATOM   4902 H  HB3    . LEU C 1 8   ? 21.980  28.706  10.039  1.00 57.75  ? 8   LEU C HB3    1 
ATOM   4903 H  HG     . LEU C 1 8   ? 23.273  27.911  7.673   1.00 57.56  ? 8   LEU C HG     1 
ATOM   4904 H  HD11   . LEU C 1 8   ? 23.371  30.156  7.062   1.00 54.19  ? 8   LEU C HD11   1 
ATOM   4905 H  HD12   . LEU C 1 8   ? 21.858  29.683  7.161   1.00 54.19  ? 8   LEU C HD12   1 
ATOM   4906 H  HD13   . LEU C 1 8   ? 22.501  30.541  8.334   1.00 54.19  ? 8   LEU C HD13   1 
ATOM   4907 H  HD21   . LEU C 1 8   ? 25.068  29.191  8.504   1.00 57.85  ? 8   LEU C HD21   1 
ATOM   4908 H  HD22   . LEU C 1 8   ? 24.239  29.451  9.834   1.00 57.85  ? 8   LEU C HD22   1 
ATOM   4909 H  HD23   . LEU C 1 8   ? 24.724  27.982  9.475   1.00 57.85  ? 8   LEU C HD23   1 
ATOM   4910 N  N      . THR C 1 9   ? 21.360  26.908  12.153  1.00 42.80  ? 9   THR C N      1 
ATOM   4911 C  CA     . THR C 1 9   ? 20.350  26.859  13.197  1.00 38.70  ? 9   THR C CA     1 
ATOM   4912 C  C      . THR C 1 9   ? 19.178  27.775  12.849  1.00 44.24  ? 9   THR C C      1 
ATOM   4913 O  O      . THR C 1 9   ? 19.247  28.612  11.944  1.00 63.19  ? 9   THR C O      1 
ATOM   4914 C  CB     . THR C 1 9   ? 20.948  27.247  14.550  1.00 54.76  ? 9   THR C CB     1 
ATOM   4915 O  OG1    . THR C 1 9   ? 21.444  28.591  14.496  1.00 52.50  ? 9   THR C OG1    1 
ATOM   4916 C  CG2    . THR C 1 9   ? 22.066  26.296  14.940  1.00 67.89  ? 9   THR C CG2    1 
ATOM   4917 H  H      . THR C 1 9   ? 22.099  27.275  12.396  1.00 51.58  ? 9   THR C H      1 
ATOM   4918 H  HA     . THR C 1 9   ? 20.015  25.951  13.269  1.00 46.66  ? 9   THR C HA     1 
ATOM   4919 H  HB     . THR C 1 9   ? 20.260  27.192  15.232  1.00 65.92  ? 9   THR C HB     1 
ATOM   4920 H  HG1    . THR C 1 9   ? 21.854  28.775  15.206  1.00 63.21  ? 9   THR C HG1    1 
ATOM   4921 H  HG21   . THR C 1 9   ? 22.441  26.559  15.796  1.00 81.68  ? 9   THR C HG21   1 
ATOM   4922 H  HG22   . THR C 1 9   ? 21.723  25.392  15.011  1.00 81.68  ? 9   THR C HG22   1 
ATOM   4923 H  HG23   . THR C 1 9   ? 22.767  26.316  14.270  1.00 81.68  ? 9   THR C HG23   1 
ATOM   4924 N  N      . LYS C 1 10  ? 18.080  27.599  13.587  1.00 53.97  ? 10  LYS C N      1 
ATOM   4925 C  CA     . LYS C 1 10  ? 16.874  28.380  13.334  1.00 47.63  ? 10  LYS C CA     1 
ATOM   4926 C  C      . LYS C 1 10  ? 17.150  29.875  13.429  1.00 43.51  ? 10  LYS C C      1 
ATOM   4927 O  O      . LYS C 1 10  ? 16.762  30.650  12.547  1.00 49.44  ? 10  LYS C O      1 
ATOM   4928 C  CB     . LYS C 1 10  ? 15.790  27.989  14.338  1.00 50.22  ? 10  LYS C CB     1 
ATOM   4929 C  CG     . LYS C 1 10  ? 14.506  28.782  14.203  1.00 68.45  ? 10  LYS C CG     1 
ATOM   4930 C  CD     . LYS C 1 10  ? 13.483  28.355  15.239  1.00 74.49  ? 10  LYS C CD     1 
ATOM   4931 C  CE     . LYS C 1 10  ? 12.215  29.184  15.130  1.00 74.68  ? 10  LYS C CE     1 
ATOM   4932 N  NZ     . LYS C 1 10  ? 11.198  28.789  16.142  1.00 83.64  ? 10  LYS C NZ     1 
ATOM   4933 H  H      . LYS C 1 10  ? 18.008  27.038  14.235  1.00 64.98  ? 10  LYS C H      1 
ATOM   4934 H  HA     . LYS C 1 10  ? 16.561  28.184  12.437  1.00 57.37  ? 10  LYS C HA     1 
ATOM   4935 H  HB2    . LYS C 1 10  ? 15.573  27.052  14.210  1.00 60.48  ? 10  LYS C HB2    1 
ATOM   4936 H  HB3    . LYS C 1 10  ? 16.132  28.131  15.235  1.00 60.48  ? 10  LYS C HB3    1 
ATOM   4937 H  HG2    . LYS C 1 10  ? 14.695  29.725  14.331  1.00 82.36  ? 10  LYS C HG2    1 
ATOM   4938 H  HG3    . LYS C 1 10  ? 14.128  28.636  13.322  1.00 82.36  ? 10  LYS C HG3    1 
ATOM   4939 H  HD2    . LYS C 1 10  ? 13.252  27.423  15.099  1.00 89.60  ? 10  LYS C HD2    1 
ATOM   4940 H  HD3    . LYS C 1 10  ? 13.853  28.476  16.127  1.00 89.60  ? 10  LYS C HD3    1 
ATOM   4941 H  HE2    . LYS C 1 10  ? 12.433  30.119  15.270  1.00 89.83  ? 10  LYS C HE2    1 
ATOM   4942 H  HE3    . LYS C 1 10  ? 11.829  29.062  14.249  1.00 89.83  ? 10  LYS C HE3    1 
ATOM   4943 H  HZ1    . LYS C 1 10  ? 10.466  29.286  16.048  1.00 100.58 ? 10  LYS C HZ1    1 
ATOM   4944 H  HZ2    . LYS C 1 10  ? 10.981  27.932  16.036  1.00 100.58 ? 10  LYS C HZ2    1 
ATOM   4945 H  HZ3    . LYS C 1 10  ? 11.523  28.905  16.962  1.00 100.58 ? 10  LYS C HZ3    1 
ATOM   4946 N  N      . GLU C 1 11  ? 17.824  30.300  14.499  1.00 43.21  ? 11  GLU C N      1 
ATOM   4947 C  CA     . GLU C 1 11  ? 18.057  31.723  14.716  1.00 55.53  ? 11  GLU C CA     1 
ATOM   4948 C  C      . GLU C 1 11  ? 18.988  32.300  13.654  1.00 48.43  ? 11  GLU C C      1 
ATOM   4949 O  O      . GLU C 1 11  ? 18.737  33.392  13.128  1.00 53.00  ? 11  GLU C O      1 
ATOM   4950 C  CB     . GLU C 1 11  ? 18.615  31.949  16.126  1.00 59.26  ? 11  GLU C CB     1 
ATOM   4951 C  CG     . GLU C 1 11  ? 19.882  31.168  16.459  1.00 83.69  ? 11  GLU C CG     1 
ATOM   4952 C  CD     . GLU C 1 11  ? 19.599  29.787  17.039  1.00 88.74  ? 11  GLU C CD     1 
ATOM   4953 O  OE1    . GLU C 1 11  ? 18.424  29.355  17.029  1.00 68.65  ? 11  GLU C OE1    1 
ATOM   4954 O  OE2    . GLU C 1 11  ? 20.554  29.144  17.527  1.00 76.69  ? 11  GLU C OE2    1 
ATOM   4955 H  H      . GLU C 1 11  ? 18.154  29.790  15.108  1.00 52.07  ? 11  GLU C H      1 
ATOM   4956 H  HA     . GLU C 1 11  ? 17.214  32.198  14.653  1.00 66.86  ? 11  GLU C HA     1 
ATOM   4957 H  HB2    . GLU C 1 11  ? 18.821  32.891  16.227  1.00 71.33  ? 11  GLU C HB2    1 
ATOM   4958 H  HB3    . GLU C 1 11  ? 17.937  31.687  16.769  1.00 71.33  ? 11  GLU C HB3    1 
ATOM   4959 H  HG2    . GLU C 1 11  ? 20.401  31.050  15.648  1.00 100.65 ? 11  GLU C HG2    1 
ATOM   4960 H  HG3    . GLU C 1 11  ? 20.396  31.667  17.112  1.00 100.65 ? 11  GLU C HG3    1 
ATOM   4961 N  N      . GLN C 1 12  ? 20.068  31.586  13.331  1.00 57.65  ? 12  GLN C N      1 
ATOM   4962 C  CA     . GLN C 1 12  ? 20.965  32.030  12.270  1.00 51.08  ? 12  GLN C CA     1 
ATOM   4963 C  C      . GLN C 1 12  ? 20.220  32.154  10.951  1.00 34.26  ? 12  GLN C C      1 
ATOM   4964 O  O      . GLN C 1 12  ? 20.393  33.136  10.216  1.00 38.25  ? 12  GLN C O      1 
ATOM   4965 C  CB     . GLN C 1 12  ? 22.126  31.046  12.130  1.00 44.12  ? 12  GLN C CB     1 
ATOM   4966 C  CG     . GLN C 1 12  ? 23.038  30.993  13.342  1.00 63.69  ? 12  GLN C CG     1 
ATOM   4967 C  CD     . GLN C 1 12  ? 24.062  29.880  13.254  1.00 53.28  ? 12  GLN C CD     1 
ATOM   4968 O  OE1    . GLN C 1 12  ? 23.818  28.843  12.636  1.00 55.97  ? 12  GLN C OE1    1 
ATOM   4969 N  NE2    . GLN C 1 12  ? 25.215  30.087  13.879  1.00 62.30  ? 12  GLN C NE2    1 
ATOM   4970 H  H      . GLN C 1 12  ? 20.302  30.848  13.706  1.00 69.40  ? 12  GLN C H      1 
ATOM   4971 H  HA     . GLN C 1 12  ? 21.327  32.899  12.502  1.00 61.51  ? 12  GLN C HA     1 
ATOM   4972 H  HB2    . GLN C 1 12  ? 21.765  30.156  11.993  1.00 53.16  ? 12  GLN C HB2    1 
ATOM   4973 H  HB3    . GLN C 1 12  ? 22.664  31.307  11.366  1.00 53.16  ? 12  GLN C HB3    1 
ATOM   4974 H  HG2    . GLN C 1 12  ? 23.515  31.834  13.416  1.00 76.64  ? 12  GLN C HG2    1 
ATOM   4975 H  HG3    . GLN C 1 12  ? 22.501  30.845  14.136  1.00 76.64  ? 12  GLN C HG3    1 
ATOM   4976 H  HE21   . GLN C 1 12  ? 25.348  30.823  14.303  1.00 74.97  ? 12  GLN C HE21   1 
ATOM   4977 H  HE22   . GLN C 1 12  ? 25.829  29.485  13.859  1.00 74.97  ? 12  GLN C HE22   1 
ATOM   4978 N  N      . HIS C 1 13  ? 19.381  31.168  10.636  1.00 30.22  ? 13  HIS C N      1 
ATOM   4979 C  CA     . HIS C 1 13  ? 18.649  31.199  9.380   1.00 29.17  ? 13  HIS C CA     1 
ATOM   4980 C  C      . HIS C 1 13  ? 17.702  32.388  9.331   1.00 45.39  ? 13  HIS C C      1 
ATOM   4981 O  O      . HIS C 1 13  ? 17.645  33.101  8.328   1.00 49.59  ? 13  HIS C O      1 
ATOM   4982 C  CB     . HIS C 1 13  ? 17.886  29.892  9.179   1.00 32.09  ? 13  HIS C CB     1 
ATOM   4983 C  CG     . HIS C 1 13  ? 17.137  29.827  7.885   1.00 30.89  ? 13  HIS C CG     1 
ATOM   4984 N  ND1    . HIS C 1 13  ? 15.868  30.343  7.731   1.00 40.06  ? 13  HIS C ND1    1 
ATOM   4985 C  CD2    . HIS C 1 13  ? 17.483  29.315  6.681   1.00 35.22  ? 13  HIS C CD2    1 
ATOM   4986 C  CE1    . HIS C 1 13  ? 15.463  30.145  6.490   1.00 37.51  ? 13  HIS C CE1    1 
ATOM   4987 N  NE2    . HIS C 1 13  ? 16.424  29.523  5.831   1.00 42.79  ? 13  HIS C NE2    1 
ATOM   4988 H  H      . HIS C 1 13  ? 19.220  30.480  11.127  1.00 36.48  ? 13  HIS C H      1 
ATOM   4989 H  HA     . HIS C 1 13  ? 19.284  31.287  8.652   1.00 35.22  ? 13  HIS C HA     1 
ATOM   4990 H  HB2    . HIS C 1 13  ? 18.518  29.157  9.193   1.00 38.73  ? 13  HIS C HB2    1 
ATOM   4991 H  HB3    . HIS C 1 13  ? 17.244  29.792  9.899   1.00 38.73  ? 13  HIS C HB3    1 
ATOM   4992 H  HD2    . HIS C 1 13  ? 18.288  28.899  6.469   1.00 42.48  ? 13  HIS C HD2    1 
ATOM   4993 H  HE1    . HIS C 1 13  ? 14.640  30.399  6.139   1.00 45.23  ? 13  HIS C HE1    1 
ATOM   4994 H  HE2    . HIS C 1 13  ? 16.393  29.288  5.005   1.00 51.56  ? 13  HIS C HE2    1 
ATOM   4995 N  N      . GLU C 1 14  ? 16.954  32.627  10.414  1.00 55.06  ? 14  GLU C N      1 
ATOM   4996 C  CA     . GLU C 1 14  ? 16.003  33.735  10.417  1.00 50.93  ? 14  GLU C CA     1 
ATOM   4997 C  C      . GLU C 1 14  ? 16.718  35.079  10.330  1.00 33.49  ? 14  GLU C C      1 
ATOM   4998 O  O      . GLU C 1 14  ? 16.259  35.987  9.626   1.00 44.20  ? 14  GLU C O      1 
ATOM   4999 C  CB     . GLU C 1 14  ? 15.121  33.671  11.663  1.00 58.03  ? 14  GLU C CB     1 
ATOM   5000 C  CG     . GLU C 1 14  ? 13.965  32.684  11.539  1.00 69.38  ? 14  GLU C CG     1 
ATOM   5001 C  CD     . GLU C 1 14  ? 13.163  32.545  12.821  1.00 85.75  ? 14  GLU C CD     1 
ATOM   5002 O  OE1    . GLU C 1 14  ? 13.675  32.935  13.891  1.00 107.07 ? 14  GLU C OE1    1 
ATOM   5003 O  OE2    . GLU C 1 14  ? 12.019  32.044  12.757  1.00 56.04  ? 14  GLU C OE2    1 
ATOM   5004 H  H      . GLU C 1 14  ? 16.978  32.172  11.144  1.00 66.29  ? 14  GLU C H      1 
ATOM   5005 H  HA     . GLU C 1 14  ? 15.428  33.653  9.640   1.00 61.33  ? 14  GLU C HA     1 
ATOM   5006 H  HB2    . GLU C 1 14  ? 15.666  33.398  12.418  1.00 69.85  ? 14  GLU C HB2    1 
ATOM   5007 H  HB3    . GLU C 1 14  ? 14.745  34.550  11.826  1.00 69.85  ? 14  GLU C HB3    1 
ATOM   5008 H  HG2    . GLU C 1 14  ? 13.364  32.989  10.842  1.00 83.47  ? 14  GLU C HG2    1 
ATOM   5009 H  HG3    . GLU C 1 14  ? 14.320  31.810  11.313  1.00 83.47  ? 14  GLU C HG3    1 
ATOM   5010 N  N      . TRP C 1 15  ? 17.845  35.222  11.031  1.00 37.10  ? 15  TRP C N      1 
ATOM   5011 C  CA     . TRP C 1 15  ? 18.626  36.453  10.947  1.00 43.93  ? 15  TRP C CA     1 
ATOM   5012 C  C      . TRP C 1 15  ? 19.102  36.706  9.521   1.00 39.06  ? 15  TRP C C      1 
ATOM   5013 O  O      . TRP C 1 15  ? 18.870  37.785  8.949   1.00 50.53  ? 15  TRP C O      1 
ATOM   5014 C  CB     . TRP C 1 15  ? 19.811  36.364  11.911  1.00 21.44  ? 15  TRP C CB     1 
ATOM   5015 C  CG     . TRP C 1 15  ? 20.796  37.480  11.797  1.00 27.03  ? 15  TRP C CG     1 
ATOM   5016 C  CD1    . TRP C 1 15  ? 20.714  38.709  12.381  1.00 36.08  ? 15  TRP C CD1    1 
ATOM   5017 C  CD2    . TRP C 1 15  ? 22.026  37.466  11.063  1.00 36.00  ? 15  TRP C CD2    1 
ATOM   5018 N  NE1    . TRP C 1 15  ? 21.814  39.464  12.053  1.00 45.19  ? 15  TRP C NE1    1 
ATOM   5019 C  CE2    . TRP C 1 15  ? 22.635  38.723  11.245  1.00 39.46  ? 15  TRP C CE2    1 
ATOM   5020 C  CE3    . TRP C 1 15  ? 22.670  36.513  10.268  1.00 36.30  ? 15  TRP C CE3    1 
ATOM   5021 C  CZ2    . TRP C 1 15  ? 23.855  39.054  10.658  1.00 45.84  ? 15  TRP C CZ2    1 
ATOM   5022 C  CZ3    . TRP C 1 15  ? 23.883  36.843  9.686   1.00 40.63  ? 15  TRP C CZ3    1 
ATOM   5023 C  CH2    . TRP C 1 15  ? 24.462  38.103  9.885   1.00 42.91  ? 15  TRP C CH2    1 
ATOM   5024 H  H      . TRP C 1 15  ? 18.177  34.628  11.557  1.00 44.74  ? 15  TRP C H      1 
ATOM   5025 H  HA     . TRP C 1 15  ? 18.073  37.205  11.209  1.00 52.93  ? 15  TRP C HA     1 
ATOM   5026 H  HB2    . TRP C 1 15  ? 19.470  36.368  12.819  1.00 25.94  ? 15  TRP C HB2    1 
ATOM   5027 H  HB3    . TRP C 1 15  ? 20.287  35.537  11.739  1.00 25.94  ? 15  TRP C HB3    1 
ATOM   5028 H  HD1    . TRP C 1 15  ? 20.014  38.994  12.924  1.00 43.52  ? 15  TRP C HD1    1 
ATOM   5029 H  HE1    . TRP C 1 15  ? 21.962  40.270  12.312  1.00 54.45  ? 15  TRP C HE1    1 
ATOM   5030 H  HE3    . TRP C 1 15  ? 22.291  35.675  10.132  1.00 43.77  ? 15  TRP C HE3    1 
ATOM   5031 H  HZ2    . TRP C 1 15  ? 24.242  39.890  10.787  1.00 55.22  ? 15  TRP C HZ2    1 
ATOM   5032 H  HZ3    . TRP C 1 15  ? 24.320  36.217  9.155   1.00 48.97  ? 15  TRP C HZ3    1 
ATOM   5033 H  HH2    . TRP C 1 15  ? 25.278  38.297  9.482   1.00 51.70  ? 15  TRP C HH2    1 
ATOM   5034 N  N      . LEU C 1 16  ? 19.775  35.714  8.930   1.00 33.53  ? 16  LEU C N      1 
ATOM   5035 C  CA     . LEU C 1 16  ? 20.276  35.877  7.573   1.00 27.44  ? 16  LEU C CA     1 
ATOM   5036 C  C      . LEU C 1 16  ? 19.138  36.114  6.594   1.00 28.54  ? 16  LEU C C      1 
ATOM   5037 O  O      . LEU C 1 16  ? 19.294  36.881  5.642   1.00 30.53  ? 16  LEU C O      1 
ATOM   5038 C  CB     . LEU C 1 16  ? 21.082  34.647  7.158   1.00 31.09  ? 16  LEU C CB     1 
ATOM   5039 C  CG     . LEU C 1 16  ? 21.689  34.671  5.754   1.00 23.41  ? 16  LEU C CG     1 
ATOM   5040 C  CD1    . LEU C 1 16  ? 22.543  35.910  5.565   1.00 21.34  ? 16  LEU C CD1    1 
ATOM   5041 C  CD2    . LEU C 1 16  ? 22.500  33.411  5.499   1.00 27.48  ? 16  LEU C CD2    1 
ATOM   5042 H  H      . LEU C 1 16  ? 19.951  34.952  9.287   1.00 40.46  ? 16  LEU C H      1 
ATOM   5043 H  HA     . LEU C 1 16  ? 20.869  36.644  7.545   1.00 33.14  ? 16  LEU C HA     1 
ATOM   5044 H  HB2    . LEU C 1 16  ? 21.815  34.543  7.784   1.00 37.52  ? 16  LEU C HB2    1 
ATOM   5045 H  HB3    . LEU C 1 16  ? 20.496  33.875  7.202   1.00 37.52  ? 16  LEU C HB3    1 
ATOM   5046 H  HG     . LEU C 1 16  ? 20.973  34.699  5.100   1.00 28.31  ? 16  LEU C HG     1 
ATOM   5047 H  HD11   . LEU C 1 16  ? 23.018  35.841  4.722   1.00 25.83  ? 16  LEU C HD11   1 
ATOM   5048 H  HD12   . LEU C 1 16  ? 21.968  36.692  5.557   1.00 25.83  ? 16  LEU C HD12   1 
ATOM   5049 H  HD13   . LEU C 1 16  ? 23.175  35.973  6.298   1.00 25.83  ? 16  LEU C HD13   1 
ATOM   5050 H  HD21   . LEU C 1 16  ? 22.813  33.417  4.581   1.00 33.19  ? 16  LEU C HD21   1 
ATOM   5051 H  HD22   . LEU C 1 16  ? 23.256  33.394  6.107   1.00 33.19  ? 16  LEU C HD22   1 
ATOM   5052 H  HD23   . LEU C 1 16  ? 21.936  32.636  5.651   1.00 33.19  ? 16  LEU C HD23   1 
ATOM   5053 N  N      . ASN C 1 17  ? 17.981  35.490  6.825   1.00 22.94  ? 17  ASN C N      1 
ATOM   5054 C  CA     . ASN C 1 17  ? 16.858  35.651  5.912   1.00 29.27  ? 17  ASN C CA     1 
ATOM   5055 C  C      . ASN C 1 17  ? 16.262  37.047  5.999   1.00 29.29  ? 17  ASN C C      1 
ATOM   5056 O  O      . ASN C 1 17  ? 15.864  37.618  4.979   1.00 34.70  ? 17  ASN C O      1 
ATOM   5057 C  CB     . ASN C 1 17  ? 15.785  34.609  6.198   1.00 24.91  ? 17  ASN C CB     1 
ATOM   5058 C  CG     . ASN C 1 17  ? 14.586  34.776  5.308   1.00 22.95  ? 17  ASN C CG     1 
ATOM   5059 O  OD1    . ASN C 1 17  ? 14.536  34.245  4.203   1.00 29.57  ? 17  ASN C OD1    1 
ATOM   5060 N  ND2    . ASN C 1 17  ? 13.611  35.542  5.780   1.00 48.51  ? 17  ASN C ND2    1 
ATOM   5061 H  H      . ASN C 1 17  ? 17.823  34.974  7.495   1.00 27.75  ? 17  ASN C H      1 
ATOM   5062 H  HA     . ASN C 1 17  ? 17.183  35.513  5.008   1.00 35.33  ? 17  ASN C HA     1 
ATOM   5063 H  HB2    . ASN C 1 17  ? 16.152  33.724  6.049   1.00 30.11  ? 17  ASN C HB2    1 
ATOM   5064 H  HB3    . ASN C 1 17  ? 15.493  34.696  7.119   1.00 30.11  ? 17  ASN C HB3    1 
ATOM   5065 H  HD21   . ASN C 1 17  ? 12.901  35.672  5.311   1.00 58.43  ? 17  ASN C HD21   1 
ATOM   5066 H  HD22   . ASN C 1 17  ? 13.689  35.910  6.553   1.00 58.43  ? 17  ASN C HD22   1 
ATOM   5067 N  N      . GLY C 1 18  ? 16.165  37.606  7.203   1.00 31.91  ? 18  GLY C N      1 
ATOM   5068 C  CA     . GLY C 1 18  ? 15.729  38.986  7.311   1.00 34.41  ? 18  GLY C CA     1 
ATOM   5069 C  C      . GLY C 1 18  ? 16.668  39.920  6.576   1.00 23.85  ? 18  GLY C C      1 
ATOM   5070 O  O      . GLY C 1 18  ? 16.237  40.783  5.797   1.00 26.65  ? 18  GLY C O      1 
ATOM   5071 H  H      . GLY C 1 18  ? 16.341  37.219  7.951   1.00 38.51  ? 18  GLY C H      1 
ATOM   5072 H  HA2    . GLY C 1 18  ? 14.841  39.077  6.931   1.00 41.51  ? 18  GLY C HA2    1 
ATOM   5073 H  HA3    . GLY C 1 18  ? 15.701  39.247  8.245   1.00 41.51  ? 18  GLY C HA3    1 
ATOM   5074 N  N      . TRP C 1 19  ? 17.973  39.741  6.797   1.00 35.01  ? 19  TRP C N      1 
ATOM   5075 C  CA     . TRP C 1 19  ? 18.951  40.572  6.103   1.00 17.32  ? 19  TRP C CA     1 
ATOM   5076 C  C      . TRP C 1 19  ? 18.821  40.424  4.592   1.00 23.28  ? 19  TRP C C      1 
ATOM   5077 O  O      . TRP C 1 19  ? 18.896  41.412  3.853   1.00 34.41  ? 19  TRP C O      1 
ATOM   5078 C  CB     . TRP C 1 19  ? 20.361  40.211  6.556   1.00 13.26  ? 19  TRP C CB     1 
ATOM   5079 C  CG     . TRP C 1 19  ? 20.836  41.021  7.713   1.00 18.94  ? 19  TRP C CG     1 
ATOM   5080 C  CD1    . TRP C 1 19  ? 21.304  40.551  8.903   1.00 24.87  ? 19  TRP C CD1    1 
ATOM   5081 C  CD2    . TRP C 1 19  ? 20.896  42.449  7.793   1.00 9.19   ? 19  TRP C CD2    1 
ATOM   5082 N  NE1    . TRP C 1 19  ? 21.652  41.596  9.720   1.00 26.15  ? 19  TRP C NE1    1 
ATOM   5083 C  CE2    . TRP C 1 19  ? 21.410  42.773  9.061   1.00 10.44  ? 19  TRP C CE2    1 
ATOM   5084 C  CE3    . TRP C 1 19  ? 20.564  43.485  6.916   1.00 14.65  ? 19  TRP C CE3    1 
ATOM   5085 C  CZ2    . TRP C 1 19  ? 21.602  44.086  9.473   1.00 26.73  ? 19  TRP C CZ2    1 
ATOM   5086 C  CZ3    . TRP C 1 19  ? 20.755  44.789  7.328   1.00 13.59  ? 19  TRP C CZ3    1 
ATOM   5087 C  CH2    . TRP C 1 19  ? 21.270  45.078  8.593   1.00 15.70  ? 19  TRP C CH2    1 
ATOM   5088 H  H      . TRP C 1 19  ? 18.311  39.159  7.332   1.00 42.23  ? 19  TRP C H      1 
ATOM   5089 H  HA     . TRP C 1 19  ? 18.791  41.501  6.330   1.00 21.00  ? 19  TRP C HA     1 
ATOM   5090 H  HB2    . TRP C 1 19  ? 20.376  39.278  6.821   1.00 16.13  ? 19  TRP C HB2    1 
ATOM   5091 H  HB3    . TRP C 1 19  ? 20.974  40.358  5.819   1.00 16.13  ? 19  TRP C HB3    1 
ATOM   5092 H  HD1    . TRP C 1 19  ? 21.378  39.652  9.128   1.00 30.06  ? 19  TRP C HD1    1 
ATOM   5093 H  HE1    . TRP C 1 19  ? 21.969  41.525  10.516  1.00 31.59  ? 19  TRP C HE1    1 
ATOM   5094 H  HE3    . TRP C 1 19  ? 20.221  43.300  6.072   1.00 17.80  ? 19  TRP C HE3    1 
ATOM   5095 H  HZ2    . TRP C 1 19  ? 21.942  44.282  10.316  1.00 32.29  ? 19  TRP C HZ2    1 
ATOM   5096 H  HZ3    . TRP C 1 19  ? 20.536  45.487  6.753   1.00 16.53  ? 19  TRP C HZ3    1 
ATOM   5097 H  HH2    . TRP C 1 19  ? 21.391  45.966  8.843   1.00 19.06  ? 19  TRP C HH2    1 
ATOM   5098 N  N      . LEU C 1 20  ? 18.620  39.197  4.113   1.00 16.55  ? 20  LEU C N      1 
ATOM   5099 C  CA     . LEU C 1 20  ? 18.538  38.975  2.676   1.00 28.17  ? 20  LEU C CA     1 
ATOM   5100 C  C      . LEU C 1 20  ? 17.247  39.538  2.095   1.00 20.66  ? 20  LEU C C      1 
ATOM   5101 O  O      . LEU C 1 20  ? 17.244  40.006  0.955   1.00 24.46  ? 20  LEU C O      1 
ATOM   5102 C  CB     . LEU C 1 20  ? 18.665  37.480  2.377   1.00 36.11  ? 20  LEU C CB     1 
ATOM   5103 C  CG     . LEU C 1 20  ? 20.055  36.874  2.612   1.00 31.17  ? 20  LEU C CG     1 
ATOM   5104 C  CD1    . LEU C 1 20  ? 20.038  35.370  2.384   1.00 31.42  ? 20  LEU C CD1    1 
ATOM   5105 C  CD2    . LEU C 1 20  ? 21.091  37.526  1.711   1.00 28.34  ? 20  LEU C CD2    1 
ATOM   5106 H  H      . LEU C 1 20  ? 18.530  38.488  4.591   1.00 20.08  ? 20  LEU C H      1 
ATOM   5107 H  HA     . LEU C 1 20  ? 19.276  39.429  2.241   1.00 34.02  ? 20  LEU C HA     1 
ATOM   5108 H  HB2    . LEU C 1 20  ? 18.041  37.002  2.945   1.00 43.54  ? 20  LEU C HB2    1 
ATOM   5109 H  HB3    . LEU C 1 20  ? 18.441  37.337  1.444   1.00 43.54  ? 20  LEU C HB3    1 
ATOM   5110 H  HG     . LEU C 1 20  ? 20.305  37.039  3.534   1.00 37.62  ? 20  LEU C HG     1 
ATOM   5111 H  HD11   . LEU C 1 20  ? 20.927  35.017  2.546   1.00 37.92  ? 20  LEU C HD11   1 
ATOM   5112 H  HD12   . LEU C 1 20  ? 19.404  34.965  2.997   1.00 37.92  ? 20  LEU C HD12   1 
ATOM   5113 H  HD13   . LEU C 1 20  ? 19.773  35.193  1.468   1.00 37.92  ? 20  LEU C HD13   1 
ATOM   5114 H  HD21   . LEU C 1 20  ? 21.912  37.011  1.751   1.00 34.22  ? 20  LEU C HD21   1 
ATOM   5115 H  HD22   . LEU C 1 20  ? 20.754  37.542  0.802   1.00 34.22  ? 20  LEU C HD22   1 
ATOM   5116 H  HD23   . LEU C 1 20  ? 21.253  38.431  2.020   1.00 34.22  ? 20  LEU C HD23   1 
ATOM   5117 N  N      . GLU C 1 21  ? 16.152  39.531  2.857   1.00 28.94  ? 21  GLU C N      1 
ATOM   5118 C  CA     . GLU C 1 21  ? 14.922  40.166  2.390   1.00 30.30  ? 21  GLU C CA     1 
ATOM   5119 C  C      . GLU C 1 21  ? 15.114  41.671  2.247   1.00 28.06  ? 21  GLU C C      1 
ATOM   5120 O  O      . GLU C 1 21  ? 14.694  42.277  1.251   1.00 17.76  ? 21  GLU C O      1 
ATOM   5121 C  CB     . GLU C 1 21  ? 13.771  39.857  3.349   1.00 26.68  ? 21  GLU C CB     1 
ATOM   5122 C  CG     . GLU C 1 21  ? 13.283  38.416  3.294   1.00 39.28  ? 21  GLU C CG     1 
ATOM   5123 C  CD     . GLU C 1 21  ? 12.175  38.125  4.296   1.00 39.35  ? 21  GLU C CD     1 
ATOM   5124 O  OE1    . GLU C 1 21  ? 11.708  39.066  4.971   1.00 25.33  ? 21  GLU C OE1    1 
ATOM   5125 O  OE2    . GLU C 1 21  ? 11.784  36.945  4.422   1.00 42.38  ? 21  GLU C OE2    1 
ATOM   5126 H  H      . GLU C 1 21  ? 16.094  39.172  3.636   1.00 34.94  ? 21  GLU C H      1 
ATOM   5127 H  HA     . GLU C 1 21  ? 14.689  39.803  1.521   1.00 36.58  ? 21  GLU C HA     1 
ATOM   5128 H  HB2    . GLU C 1 21  ? 14.068  40.032  4.256   1.00 32.24  ? 21  GLU C HB2    1 
ATOM   5129 H  HB3    . GLU C 1 21  ? 13.021  40.430  3.128   1.00 32.24  ? 21  GLU C HB3    1 
ATOM   5130 H  HG2    . GLU C 1 21  ? 12.939  38.234  2.406   1.00 47.35  ? 21  GLU C HG2    1 
ATOM   5131 H  HG3    . GLU C 1 21  ? 14.026  37.824  3.490   1.00 47.35  ? 21  GLU C HG3    1 
ATOM   5132 N  N      . LEU C 1 22  ? 15.739  42.297  3.249   1.00 25.26  ? 22  LEU C N      1 
ATOM   5133 C  CA     . LEU C 1 22  ? 16.042  43.721  3.141   1.00 26.92  ? 22  LEU C CA     1 
ATOM   5134 C  C      . LEU C 1 22  ? 16.941  44.000  1.939   1.00 35.30  ? 22  LEU C C      1 
ATOM   5135 O  O      . LEU C 1 22  ? 16.708  44.954  1.184   1.00 33.18  ? 22  LEU C O      1 
ATOM   5136 C  CB     . LEU C 1 22  ? 16.696  44.224  4.427   1.00 31.97  ? 22  LEU C CB     1 
ATOM   5137 C  CG     . LEU C 1 22  ? 15.824  44.220  5.685   1.00 17.08  ? 22  LEU C CG     1 
ATOM   5138 C  CD1    . LEU C 1 22  ? 16.628  44.689  6.892   1.00 16.33  ? 22  LEU C CD1    1 
ATOM   5139 C  CD2    . LEU C 1 22  ? 14.587  45.071  5.491   1.00 19.56  ? 22  LEU C CD2    1 
ATOM   5140 H  H      . LEU C 1 22  ? 15.993  41.929  3.984   1.00 30.53  ? 22  LEU C H      1 
ATOM   5141 H  HA     . LEU C 1 22  ? 15.211  44.208  3.020   1.00 32.52  ? 22  LEU C HA     1 
ATOM   5142 H  HB2    . LEU C 1 22  ? 17.466  43.663  4.612   1.00 38.58  ? 22  LEU C HB2    1 
ATOM   5143 H  HB3    . LEU C 1 22  ? 16.981  45.140  4.281   1.00 38.58  ? 22  LEU C HB3    1 
ATOM   5144 H  HG     . LEU C 1 22  ? 15.527  43.313  5.859   1.00 20.71  ? 22  LEU C HG     1 
ATOM   5145 H  HD11   . LEU C 1 22  ? 16.061  44.663  7.679   1.00 19.81  ? 22  LEU C HD11   1 
ATOM   5146 H  HD12   . LEU C 1 22  ? 17.389  44.100  7.013   1.00 19.81  ? 22  LEU C HD12   1 
ATOM   5147 H  HD13   . LEU C 1 22  ? 16.933  45.596  6.735   1.00 19.81  ? 22  LEU C HD13   1 
ATOM   5148 H  HD21   . LEU C 1 22  ? 14.147  45.189  6.347   1.00 23.69  ? 22  LEU C HD21   1 
ATOM   5149 H  HD22   . LEU C 1 22  ? 14.850  45.933  5.132   1.00 23.69  ? 22  LEU C HD22   1 
ATOM   5150 H  HD23   . LEU C 1 22  ? 13.990  44.624  4.871   1.00 23.69  ? 22  LEU C HD23   1 
ATOM   5151 N  N      . TRP C 1 23  ? 17.973  43.172  1.741   1.00 39.56  ? 23  TRP C N      1 
ATOM   5152 C  CA     . TRP C 1 23  ? 18.898  43.384  0.631   1.00 29.76  ? 23  TRP C CA     1 
ATOM   5153 C  C      . TRP C 1 23  ? 18.211  43.191  -0.714  1.00 25.69  ? 23  TRP C C      1 
ATOM   5154 O  O      . TRP C 1 23  ? 18.476  43.934  -1.664  1.00 35.65  ? 23  TRP C O      1 
ATOM   5155 C  CB     . TRP C 1 23  ? 20.095  42.443  0.754   1.00 35.86  ? 23  TRP C CB     1 
ATOM   5156 C  CG     . TRP C 1 23  ? 20.839  42.254  -0.534  1.00 30.83  ? 23  TRP C CG     1 
ATOM   5157 C  CD1    . TRP C 1 23  ? 21.778  43.087  -1.068  1.00 29.55  ? 23  TRP C CD1    1 
ATOM   5158 C  CD2    . TRP C 1 23  ? 20.714  41.154  -1.445  1.00 34.64  ? 23  TRP C CD2    1 
ATOM   5159 N  NE1    . TRP C 1 23  ? 22.240  42.578  -2.259  1.00 37.32  ? 23  TRP C NE1    1 
ATOM   5160 C  CE2    . TRP C 1 23  ? 21.604  41.391  -2.512  1.00 39.75  ? 23  TRP C CE2    1 
ATOM   5161 C  CE3    . TRP C 1 23  ? 19.935  39.993  -1.463  1.00 26.72  ? 23  TRP C CE3    1 
ATOM   5162 C  CZ2    . TRP C 1 23  ? 21.735  40.512  -3.584  1.00 28.41  ? 23  TRP C CZ2    1 
ATOM   5163 C  CZ3    . TRP C 1 23  ? 20.067  39.121  -2.529  1.00 28.06  ? 23  TRP C CZ3    1 
ATOM   5164 C  CH2    . TRP C 1 23  ? 20.960  39.385  -3.573  1.00 26.60  ? 23  TRP C CH2    1 
ATOM   5165 H  H      . TRP C 1 23  ? 18.156  42.488  2.228   1.00 47.69  ? 23  TRP C H      1 
ATOM   5166 H  HA     . TRP C 1 23  ? 19.224  44.297  0.675   1.00 35.92  ? 23  TRP C HA     1 
ATOM   5167 H  HB2    . TRP C 1 23  ? 20.715  42.809  1.405   1.00 43.25  ? 23  TRP C HB2    1 
ATOM   5168 H  HB3    . TRP C 1 23  ? 19.781  41.573  1.047   1.00 43.25  ? 23  TRP C HB3    1 
ATOM   5169 H  HD1    . TRP C 1 23  ? 22.065  43.883  -0.682  1.00 35.68  ? 23  TRP C HD1    1 
ATOM   5170 H  HE1    . TRP C 1 23  ? 22.832  42.945  -2.764  1.00 45.00  ? 23  TRP C HE1    1 
ATOM   5171 H  HE3    . TRP C 1 23  ? 19.339  39.810  -0.772  1.00 32.28  ? 23  TRP C HE3    1 
ATOM   5172 H  HZ2    . TRP C 1 23  ? 22.327  40.684  -4.280  1.00 34.31  ? 23  TRP C HZ2    1 
ATOM   5173 H  HZ3    . TRP C 1 23  ? 19.553  38.346  -2.552  1.00 33.89  ? 23  TRP C HZ3    1 
ATOM   5174 H  HH2    . TRP C 1 23  ? 21.029  38.780  -4.277  1.00 32.14  ? 23  TRP C HH2    1 
ATOM   5175 N  N      . GLY C 1 24  ? 17.323  42.205  -0.818  1.00 25.95  ? 24  GLY C N      1 
ATOM   5176 C  CA     . GLY C 1 24  ? 16.603  42.005  -2.060  1.00 25.68  ? 24  GLY C CA     1 
ATOM   5177 C  C      . GLY C 1 24  ? 15.676  43.162  -2.364  1.00 26.16  ? 24  GLY C C      1 
ATOM   5178 O  O      . GLY C 1 24  ? 15.586  43.610  -3.510  1.00 36.69  ? 24  GLY C O      1 
ATOM   5179 H  H      . GLY C 1 24  ? 17.123  41.647  -0.194  1.00 31.36  ? 24  GLY C H      1 
ATOM   5180 H  HA2    . GLY C 1 24  ? 17.236  41.918  -2.790  1.00 31.03  ? 24  GLY C HA2    1 
ATOM   5181 H  HA3    . GLY C 1 24  ? 16.075  41.194  -2.001  1.00 31.03  ? 24  GLY C HA3    1 
ATOM   5182 N  N      . ALA C 1 25  ? 14.988  43.675  -1.342  1.00 43.12  ? 25  ALA C N      1 
ATOM   5183 C  CA     . ALA C 1 25  ? 14.170  44.865  -1.541  1.00 32.42  ? 25  ALA C CA     1 
ATOM   5184 C  C      . ALA C 1 25  ? 15.022  46.030  -2.026  1.00 33.55  ? 25  ALA C C      1 
ATOM   5185 O  O      . ALA C 1 25  ? 14.626  46.765  -2.938  1.00 27.61  ? 25  ALA C O      1 
ATOM   5186 C  CB     . ALA C 1 25  ? 13.446  45.224  -0.246  1.00 39.02  ? 25  ALA C CB     1 
ATOM   5187 H  H      . ALA C 1 25  ? 14.978  43.361  -0.541  1.00 51.96  ? 25  ALA C H      1 
ATOM   5188 H  HA     . ALA C 1 25  ? 13.497  44.682  -2.215  1.00 39.12  ? 25  ALA C HA     1 
ATOM   5189 H  HB1    . ALA C 1 25  ? 12.908  46.018  -0.394  1.00 47.04  ? 25  ALA C HB1    1 
ATOM   5190 H  HB2    . ALA C 1 25  ? 12.877  44.483  0.014   1.00 47.04  ? 25  ALA C HB2    1 
ATOM   5191 H  HB3    . ALA C 1 25  ? 14.104  45.395  0.446   1.00 47.04  ? 25  ALA C HB3    1 
ATOM   5192 N  N      . TRP C 1 26  ? 16.209  46.200  -1.438  1.00 35.62  ? 26  TRP C N      1 
ATOM   5193 C  CA     . TRP C 1 26  ? 17.093  47.287  -1.849  1.00 30.76  ? 26  TRP C CA     1 
ATOM   5194 C  C      . TRP C 1 26  ? 17.542  47.113  -3.294  1.00 44.11  ? 26  TRP C C      1 
ATOM   5195 O  O      . TRP C 1 26  ? 17.625  48.087  -4.052  1.00 48.94  ? 26  TRP C O      1 
ATOM   5196 C  CB     . TRP C 1 26  ? 18.298  47.353  -0.912  1.00 32.58  ? 26  TRP C CB     1 
ATOM   5197 C  CG     . TRP C 1 26  ? 19.285  48.425  -1.254  1.00 33.70  ? 26  TRP C CG     1 
ATOM   5198 C  CD1    . TRP C 1 26  ? 19.160  49.759  -1.004  1.00 43.27  ? 26  TRP C CD1    1 
ATOM   5199 C  CD2    . TRP C 1 26  ? 20.559  48.252  -1.884  1.00 38.32  ? 26  TRP C CD2    1 
ATOM   5200 N  NE1    . TRP C 1 26  ? 20.273  50.430  -1.446  1.00 43.86  ? 26  TRP C NE1    1 
ATOM   5201 C  CE2    . TRP C 1 26  ? 21.147  49.527  -1.990  1.00 43.95  ? 26  TRP C CE2    1 
ATOM   5202 C  CE3    . TRP C 1 26  ? 21.258  47.144  -2.372  1.00 51.60  ? 26  TRP C CE3    1 
ATOM   5203 C  CZ2    . TRP C 1 26  ? 22.400  49.726  -2.565  1.00 55.47  ? 26  TRP C CZ2    1 
ATOM   5204 C  CZ3    . TRP C 1 26  ? 22.503  47.343  -2.943  1.00 45.49  ? 26  TRP C CZ3    1 
ATOM   5205 C  CH2    . TRP C 1 26  ? 23.061  48.625  -3.034  1.00 49.05  ? 26  TRP C CH2    1 
ATOM   5206 H  H      . TRP C 1 26  ? 16.523  45.707  -0.807  1.00 42.96  ? 26  TRP C H      1 
ATOM   5207 H  HA     . TRP C 1 26  ? 16.615  48.128  -1.785  1.00 37.13  ? 26  TRP C HA     1 
ATOM   5208 H  HB2    . TRP C 1 26  ? 17.981  47.523  -0.011  1.00 39.31  ? 26  TRP C HB2    1 
ATOM   5209 H  HB3    . TRP C 1 26  ? 18.764  46.503  -0.946  1.00 39.31  ? 26  TRP C HB3    1 
ATOM   5210 H  HD1    . TRP C 1 26  ? 18.427  50.157  -0.593  1.00 52.14  ? 26  TRP C HD1    1 
ATOM   5211 H  HE1    . TRP C 1 26  ? 20.400  51.279  -1.391  1.00 52.85  ? 26  TRP C HE1    1 
ATOM   5212 H  HE3    . TRP C 1 26  ? 20.894  46.290  -2.314  1.00 62.13  ? 26  TRP C HE3    1 
ATOM   5213 H  HZ2    . TRP C 1 26  ? 22.773  50.576  -2.628  1.00 66.78  ? 26  TRP C HZ2    1 
ATOM   5214 H  HZ3    . TRP C 1 26  ? 22.977  46.614  -3.271  1.00 54.80  ? 26  TRP C HZ3    1 
ATOM   5215 H  HH2    . TRP C 1 26  ? 23.899  48.729  -3.423  1.00 59.08  ? 26  TRP C HH2    1 
ATOM   5216 N  N      . VAL C 1 27  ? 17.847  45.878  -3.690  1.00 37.35  ? 27  VAL C N      1 
ATOM   5217 C  CA     . VAL C 1 27  ? 18.304  45.625  -5.051  1.00 34.25  ? 27  VAL C CA     1 
ATOM   5218 C  C      . VAL C 1 27  ? 17.178  45.877  -6.047  1.00 36.66  ? 27  VAL C C      1 
ATOM   5219 O  O      . VAL C 1 27  ? 17.399  46.447  -7.122  1.00 43.60  ? 27  VAL C O      1 
ATOM   5220 C  CB     . VAL C 1 27  ? 18.855  44.191  -5.164  1.00 39.86  ? 27  VAL C CB     1 
ATOM   5221 C  CG1    . VAL C 1 27  ? 18.970  43.773  -6.623  1.00 40.46  ? 27  VAL C CG1    1 
ATOM   5222 C  CG2    . VAL C 1 27  ? 20.208  44.083  -4.467  1.00 34.67  ? 27  VAL C CG2    1 
ATOM   5223 H  H      . VAL C 1 27  ? 17.798  45.176  -3.197  1.00 45.03  ? 27  VAL C H      1 
ATOM   5224 H  HA     . VAL C 1 27  ? 19.025  46.241  -5.257  1.00 41.31  ? 27  VAL C HA     1 
ATOM   5225 H  HB     . VAL C 1 27  ? 18.238  43.585  -4.726  1.00 48.05  ? 27  VAL C HB     1 
ATOM   5226 H  HG11   . VAL C 1 27  ? 19.570  43.013  -6.687  1.00 48.77  ? 27  VAL C HG11   1 
ATOM   5227 H  HG12   . VAL C 1 27  ? 18.091  43.529  -6.952  1.00 48.77  ? 27  VAL C HG12   1 
ATOM   5228 H  HG13   . VAL C 1 27  ? 19.322  44.516  -7.138  1.00 48.77  ? 27  VAL C HG13   1 
ATOM   5229 H  HG21   . VAL C 1 27  ? 20.522  43.168  -4.528  1.00 41.82  ? 27  VAL C HG21   1 
ATOM   5230 H  HG22   . VAL C 1 27  ? 20.837  44.679  -4.904  1.00 41.82  ? 27  VAL C HG22   1 
ATOM   5231 H  HG23   . VAL C 1 27  ? 20.105  44.336  -3.537  1.00 41.82  ? 27  VAL C HG23   1 
ATOM   5232 N  N      . TYR C 1 28  ? 15.952  45.476  -5.702  1.00 37.25  ? 28  TYR C N      1 
ATOM   5233 C  CA     . TYR C 1 28  ? 14.832  45.616  -6.626  1.00 39.38  ? 28  TYR C CA     1 
ATOM   5234 C  C      . TYR C 1 28  ? 14.553  47.067  -6.994  1.00 45.67  ? 28  TYR C C      1 
ATOM   5235 O  O      . TYR C 1 28  ? 13.962  47.321  -8.050  1.00 54.57  ? 28  TYR C O      1 
ATOM   5236 C  CB     . TYR C 1 28  ? 13.570  45.010  -6.014  1.00 38.86  ? 28  TYR C CB     1 
ATOM   5237 C  CG     . TYR C 1 28  ? 12.476  44.708  -7.013  1.00 44.83  ? 28  TYR C CG     1 
ATOM   5238 C  CD1    . TYR C 1 28  ? 12.540  43.586  -7.831  1.00 56.88  ? 28  TYR C CD1    1 
ATOM   5239 C  CD2    . TYR C 1 28  ? 11.386  45.558  -7.149  1.00 43.73  ? 28  TYR C CD2    1 
ATOM   5240 C  CE1    . TYR C 1 28  ? 11.537  43.311  -8.746  1.00 61.74  ? 28  TYR C CE1    1 
ATOM   5241 C  CE2    . TYR C 1 28  ? 10.381  45.295  -8.062  1.00 60.71  ? 28  TYR C CE2    1 
ATOM   5242 C  CZ     . TYR C 1 28  ? 10.461  44.170  -8.859  1.00 82.37  ? 28  TYR C CZ     1 
ATOM   5243 O  OH     . TYR C 1 28  ? 9.463   43.904  -9.769  1.00 92.41  ? 28  TYR C OH     1 
ATOM   5244 H  H      . TYR C 1 28  ? 15.745  45.122  -4.946  1.00 44.91  ? 28  TYR C H      1 
ATOM   5245 H  HA     . TYR C 1 28  ? 15.053  45.133  -7.437  1.00 47.47  ? 28  TYR C HA     1 
ATOM   5246 H  HB2    . TYR C 1 28  ? 13.806  44.177  -5.577  1.00 46.85  ? 28  TYR C HB2    1 
ATOM   5247 H  HB3    . TYR C 1 28  ? 13.209  45.634  -5.365  1.00 46.85  ? 28  TYR C HB3    1 
ATOM   5248 H  HD1    . TYR C 1 28  ? 13.268  43.011  -7.763  1.00 68.47  ? 28  TYR C HD1    1 
ATOM   5249 H  HD2    . TYR C 1 28  ? 11.331  46.318  -6.616  1.00 52.70  ? 28  TYR C HD2    1 
ATOM   5250 H  HE1    . TYR C 1 28  ? 11.587  42.552  -9.281  1.00 74.30  ? 28  TYR C HE1    1 
ATOM   5251 H  HE2    . TYR C 1 28  ? 9.655   45.872  -8.138  1.00 73.07  ? 28  TYR C HE2    1 
ATOM   5252 H  HH     . TYR C 1 28  ? 8.890   44.518  -9.756  1.00 111.11 ? 28  TYR C HH     1 
ATOM   5253 N  N      . SER C 1 29  ? 14.951  48.023  -6.153  1.00 49.78  ? 29  SER C N      1 
ATOM   5254 C  CA     . SER C 1 29  ? 14.717  49.431  -6.447  1.00 39.17  ? 29  SER C CA     1 
ATOM   5255 C  C      . SER C 1 29  ? 15.692  50.010  -7.461  1.00 55.09  ? 29  SER C C      1 
ATOM   5256 O  O      . SER C 1 29  ? 15.455  51.118  -7.953  1.00 69.73  ? 29  SER C O      1 
ATOM   5257 C  CB     . SER C 1 29  ? 14.807  50.256  -5.161  1.00 49.14  ? 29  SER C CB     1 
ATOM   5258 O  OG     . SER C 1 29  ? 16.116  50.204  -4.619  1.00 40.93  ? 29  SER C OG     1 
ATOM   5259 H  H      . SER C 1 29  ? 15.357  47.879  -5.409  1.00 59.95  ? 29  SER C H      1 
ATOM   5260 H  HA     . SER C 1 29  ? 13.822  49.513  -6.810  1.00 47.22  ? 29  SER C HA     1 
ATOM   5261 H  HB2    . SER C 1 29  ? 14.586  51.179  -5.363  1.00 59.18  ? 29  SER C HB2    1 
ATOM   5262 H  HB3    . SER C 1 29  ? 14.182  49.898  -4.512  1.00 59.18  ? 29  SER C HB3    1 
ATOM   5263 H  HG     . SER C 1 29  ? 16.365  49.405  -4.545  1.00 49.34  ? 29  SER C HG     1 
ATOM   5264 N  N      . GLY C 1 30  ? 16.778  49.311  -7.777  1.00 60.56  ? 30  GLY C N      1 
ATOM   5265 C  CA     . GLY C 1 30  ? 17.705  49.799  -8.778  1.00 66.47  ? 30  GLY C CA     1 
ATOM   5266 C  C      . GLY C 1 30  ? 18.686  50.829  -8.266  1.00 61.75  ? 30  GLY C C      1 
ATOM   5267 O  O      . GLY C 1 30  ? 19.184  51.644  -9.049  1.00 82.50  ? 30  GLY C O      1 
ATOM   5268 H  H      . GLY C 1 30  ? 16.997  48.556  -7.428  1.00 72.88  ? 30  GLY C H      1 
ATOM   5269 H  HA2    . GLY C 1 30  ? 18.214  49.050  -9.126  1.00 79.97  ? 30  GLY C HA2    1 
ATOM   5270 H  HA3    . GLY C 1 30  ? 17.201  50.202  -9.502  1.00 79.97  ? 30  GLY C HA3    1 
ATOM   5271 N  N      . ARG C 1 31  ? 18.985  50.812  -6.971  1.00 51.69  ? 31  ARG C N      1 
ATOM   5272 C  CA     . ARG C 1 31  ? 19.913  51.756  -6.362  1.00 63.11  ? 31  ARG C CA     1 
ATOM   5273 C  C      . ARG C 1 31  ? 21.352  51.260  -6.395  1.00 81.45  ? 31  ARG C C      1 
ATOM   5274 O  O      . ARG C 1 31  ? 22.253  51.980  -5.949  1.00 69.19  ? 31  ARG C O      1 
ATOM   5275 C  CB     . ARG C 1 31  ? 19.494  51.996  -4.907  1.00 62.77  ? 31  ARG C CB     1 
ATOM   5276 C  CG     . ARG C 1 31  ? 18.133  52.656  -4.740  1.00 69.07  ? 31  ARG C CG     1 
ATOM   5277 C  CD     . ARG C 1 31  ? 17.711  52.673  -3.270  1.00 57.23  ? 31  ARG C CD     1 
ATOM   5278 N  NE     . ARG C 1 31  ? 18.445  53.604  -2.414  1.00 50.38  ? 31  ARG C NE     1 
ATOM   5279 C  CZ     . ARG C 1 31  ? 18.082  54.861  -2.175  1.00 37.11  ? 31  ARG C CZ     1 
ATOM   5280 N  NH1    . ARG C 1 31  ? 16.983  55.362  -2.725  1.00 24.01  ? 31  ARG C NH1    1 
ATOM   5281 N  NH2    . ARG C 1 31  ? 18.817  55.617  -1.369  1.00 26.76  ? 31  ARG C NH2    1 
ATOM   5282 H  H      . ARG C 1 31  ? 18.654  50.249  -6.412  1.00 62.25  ? 31  ARG C H      1 
ATOM   5283 H  HA     . ARG C 1 31  ? 19.877  52.599  -6.841  1.00 75.95  ? 31  ARG C HA     1 
ATOM   5284 H  HB2    . ARG C 1 31  ? 19.463  51.141  -4.450  1.00 75.54  ? 31  ARG C HB2    1 
ATOM   5285 H  HB3    . ARG C 1 31  ? 20.152  52.573  -4.488  1.00 75.54  ? 31  ARG C HB3    1 
ATOM   5286 H  HG2    . ARG C 1 31  ? 18.176  53.572  -5.058  1.00 83.10  ? 31  ARG C HG2    1 
ATOM   5287 H  HG3    . ARG C 1 31  ? 17.469  52.161  -5.245  1.00 83.10  ? 31  ARG C HG3    1 
ATOM   5288 H  HD2    . ARG C 1 31  ? 16.774  52.918  -3.223  1.00 68.89  ? 31  ARG C HD2    1 
ATOM   5289 H  HD3    . ARG C 1 31  ? 17.840  51.784  -2.905  1.00 68.89  ? 31  ARG C HD3    1 
ATOM   5290 H  HE     . ARG C 1 31  ? 19.163  53.318  -2.037  1.00 60.67  ? 31  ARG C HE     1 
ATOM   5291 H  HH11   . ARG C 1 31  ? 16.499  54.872  -3.241  1.00 29.03  ? 31  ARG C HH11   1 
ATOM   5292 H  HH12   . ARG C 1 31  ? 16.755  56.176  -2.567  1.00 29.03  ? 31  ARG C HH12   1 
ATOM   5293 H  HH21   . ARG C 1 31  ? 19.524  55.294  -1.003  1.00 32.33  ? 31  ARG C HH21   1 
ATOM   5294 H  HH22   . ARG C 1 31  ? 18.585  56.431  -1.213  1.00 32.33  ? 31  ARG C HH22   1 
ATOM   5295 N  N      . LEU C 1 32  ? 21.589  50.065  -6.932  1.00 85.36  ? 32  LEU C N      1 
ATOM   5296 C  CA     . LEU C 1 32  ? 22.921  49.480  -6.987  1.00 104.92 ? 32  LEU C CA     1 
ATOM   5297 C  C      . LEU C 1 32  ? 23.614  49.830  -8.297  1.00 97.35  ? 32  LEU C C      1 
ATOM   5298 O  O      . LEU C 1 32  ? 23.010  49.782  -9.372  1.00 83.76  ? 32  LEU C O      1 
ATOM   5299 C  CB     . LEU C 1 32  ? 22.861  47.959  -6.822  1.00 79.25  ? 32  LEU C CB     1 
ATOM   5300 C  CG     . LEU C 1 32  ? 24.207  47.228  -6.925  1.00 57.99  ? 32  LEU C CG     1 
ATOM   5301 C  CD1    . LEU C 1 32  ? 25.195  47.713  -5.875  1.00 64.53  ? 32  LEU C CD1    1 
ATOM   5302 C  CD2    . LEU C 1 32  ? 24.013  45.729  -6.802  1.00 54.72  ? 32  LEU C CD2    1 
ATOM   5303 H  H      . LEU C 1 32  ? 20.980  49.566  -7.277  1.00 102.65 ? 32  LEU C H      1 
ATOM   5304 H  HA     . LEU C 1 32  ? 23.450  49.845  -6.260  1.00 126.12 ? 32  LEU C HA     1 
ATOM   5305 H  HB2    . LEU C 1 32  ? 22.491  47.762  -5.947  1.00 95.32  ? 32  LEU C HB2    1 
ATOM   5306 H  HB3    . LEU C 1 32  ? 22.284  47.600  -7.514  1.00 95.32  ? 32  LEU C HB3    1 
ATOM   5307 H  HG     . LEU C 1 32  ? 24.585  47.423  -7.796  1.00 69.81  ? 32  LEU C HG     1 
ATOM   5308 H  HD11   . LEU C 1 32  ? 26.016  47.204  -5.955  1.00 77.66  ? 32  LEU C HD11   1 
ATOM   5309 H  HD12   . LEU C 1 32  ? 25.374  48.655  -6.021  1.00 77.66  ? 32  LEU C HD12   1 
ATOM   5310 H  HD13   . LEU C 1 32  ? 24.809  47.583  -4.994  1.00 77.66  ? 32  LEU C HD13   1 
ATOM   5311 H  HD21   . LEU C 1 32  ? 24.879  45.294  -6.848  1.00 65.88  ? 32  LEU C HD21   1 
ATOM   5312 H  HD22   . LEU C 1 32  ? 23.589  45.534  -5.952  1.00 65.88  ? 32  LEU C HD22   1 
ATOM   5313 H  HD23   . LEU C 1 32  ? 23.450  45.422  -7.530  1.00 65.88  ? 32  LEU C HD23   1 
ATOM   5314 N  N      . GLU C 1 33  ? 24.887  50.198  -8.190  1.00 98.38  ? 33  GLU C N      1 
ATOM   5315 C  CA     . GLU C 1 33  ? 25.694  50.499  -9.362  1.00 105.34 ? 33  GLU C CA     1 
ATOM   5316 C  C      . GLU C 1 33  ? 25.906  49.246  -10.204 1.00 110.16 ? 33  GLU C C      1 
ATOM   5317 O  O      . GLU C 1 33  ? 26.219  48.173  -9.678  1.00 104.61 ? 33  GLU C O      1 
ATOM   5318 C  CB     . GLU C 1 33  ? 27.037  51.074  -8.922  1.00 90.04  ? 33  GLU C CB     1 
ATOM   5319 C  CG     . GLU C 1 33  ? 26.909  52.372  -8.149  1.00 90.11  ? 33  GLU C CG     1 
ATOM   5320 C  CD     . GLU C 1 33  ? 28.241  52.880  -7.640  1.00 112.28 ? 33  GLU C CD     1 
ATOM   5321 O  OE1    . GLU C 1 33  ? 29.269  52.221  -7.902  1.00 105.73 ? 33  GLU C OE1    1 
ATOM   5322 O  OE2    . GLU C 1 33  ? 28.258  53.944  -6.984  1.00 108.33 ? 33  GLU C OE2    1 
ATOM   5323 H  H      . GLU C 1 33  ? 25.309  50.282  -7.445  1.00 118.27 ? 33  GLU C H      1 
ATOM   5324 H  HA     . GLU C 1 33  ? 25.238  51.153  -9.914  1.00 126.63 ? 33  GLU C HA     1 
ATOM   5325 H  HB2    . GLU C 1 33  ? 27.482  50.429  -8.350  1.00 108.26 ? 33  GLU C HB2    1 
ATOM   5326 H  HB3    . GLU C 1 33  ? 27.576  51.248  -9.709  1.00 108.26 ? 33  GLU C HB3    1 
ATOM   5327 H  HG2    . GLU C 1 33  ? 26.531  53.051  -8.730  1.00 108.35 ? 33  GLU C HG2    1 
ATOM   5328 H  HG3    . GLU C 1 33  ? 26.329  52.230  -7.384  1.00 108.35 ? 33  GLU C HG3    1 
ATOM   5329 N  N      . LYS C 1 34  ? 25.727  49.386  -11.519 1.00 109.24 ? 34  LYS C N      1 
ATOM   5330 C  CA     . LYS C 1 34  ? 25.865  48.246  -12.417 1.00 123.53 ? 34  LYS C CA     1 
ATOM   5331 C  C      . LYS C 1 34  ? 27.265  47.649  -12.352 1.00 124.80 ? 34  LYS C C      1 
ATOM   5332 O  O      . LYS C 1 34  ? 27.448  46.458  -12.631 1.00 115.52 ? 34  LYS C O      1 
ATOM   5333 C  CB     . LYS C 1 34  ? 25.528  48.670  -13.848 1.00 120.53 ? 34  LYS C CB     1 
ATOM   5334 C  CG     . LYS C 1 34  ? 24.053  48.989  -14.073 1.00 100.26 ? 34  LYS C CG     1 
ATOM   5335 C  CD     . LYS C 1 34  ? 23.763  49.380  -15.520 1.00 97.31  ? 34  LYS C CD     1 
ATOM   5336 C  CE     . LYS C 1 34  ? 22.296  49.751  -15.715 1.00 105.86 ? 34  LYS C CE     1 
ATOM   5337 N  NZ     . LYS C 1 34  ? 21.970  50.102  -17.127 1.00 95.12  ? 34  LYS C NZ     1 
ATOM   5338 H  H      . LYS C 1 34  ? 25.526  50.124  -11.913 1.00 131.30 ? 34  LYS C H      1 
ATOM   5339 H  HA     . LYS C 1 34  ? 25.236  47.556  -12.151 1.00 148.45 ? 34  LYS C HA     1 
ATOM   5340 H  HB2    . LYS C 1 34  ? 26.038  49.466  -14.064 1.00 144.85 ? 34  LYS C HB2    1 
ATOM   5341 H  HB3    . LYS C 1 34  ? 25.769  47.949  -14.451 1.00 144.85 ? 34  LYS C HB3    1 
ATOM   5342 H  HG2    . LYS C 1 34  ? 23.522  48.206  -13.860 1.00 120.53 ? 34  LYS C HG2    1 
ATOM   5343 H  HG3    . LYS C 1 34  ? 23.797  49.730  -13.502 1.00 120.53 ? 34  LYS C HG3    1 
ATOM   5344 H  HD2    . LYS C 1 34  ? 24.306  50.148  -15.761 1.00 116.99 ? 34  LYS C HD2    1 
ATOM   5345 H  HD3    . LYS C 1 34  ? 23.969  48.633  -16.103 1.00 116.99 ? 34  LYS C HD3    1 
ATOM   5346 H  HE2    . LYS C 1 34  ? 21.743  48.996  -15.459 1.00 127.25 ? 34  LYS C HE2    1 
ATOM   5347 H  HE3    . LYS C 1 34  ? 22.087  50.518  -15.160 1.00 127.25 ? 34  LYS C HE3    1 
ATOM   5348 H  HZ1    . LYS C 1 34  ? 21.107  50.309  -17.198 1.00 114.36 ? 34  LYS C HZ1    1 
ATOM   5349 H  HZ2    . LYS C 1 34  ? 22.456  50.801  -17.387 1.00 114.36 ? 34  LYS C HZ2    1 
ATOM   5350 H  HZ3    . LYS C 1 34  ? 22.147  49.412  -17.661 1.00 114.36 ? 34  LYS C HZ3    1 
ATOM   5351 N  N      . ARG C 1 35  ? 28.267  48.459  -12.002 1.00 122.63 ? 35  ARG C N      1 
ATOM   5352 C  CA     . ARG C 1 35  ? 29.646  47.988  -11.972 1.00 118.70 ? 35  ARG C CA     1 
ATOM   5353 C  C      . ARG C 1 35  ? 29.945  47.065  -10.795 1.00 125.60 ? 35  ARG C C      1 
ATOM   5354 O  O      . ARG C 1 35  ? 30.975  46.383  -10.812 1.00 129.06 ? 35  ARG C O      1 
ATOM   5355 C  CB     . ARG C 1 35  ? 30.601  49.182  -11.943 1.00 92.77  ? 35  ARG C CB     1 
ATOM   5356 H  H      . ARG C 1 35  ? 28.173  49.284  -11.777 1.00 147.37 ? 35  ARG C H      1 
ATOM   5357 H  HA     . ARG C 1 35  ? 29.807  47.480  -12.783 1.00 142.66 ? 35  ARG C HA     1 
ATOM   5358 N  N      . MET C 1 36  ? 29.088  47.031  -9.773  1.00 111.52 ? 36  MET C N      1 
ATOM   5359 C  CA     . MET C 1 36  ? 29.400  46.268  -8.570  1.00 108.16 ? 36  MET C CA     1 
ATOM   5360 C  C      . MET C 1 36  ? 29.127  44.776  -8.718  1.00 108.62 ? 36  MET C C      1 
ATOM   5361 O  O      . MET C 1 36  ? 29.660  43.984  -7.932  1.00 116.96 ? 36  MET C O      1 
ATOM   5362 C  CB     . MET C 1 36  ? 28.616  46.826  -7.380  1.00 97.51  ? 36  MET C CB     1 
ATOM   5363 C  CG     . MET C 1 36  ? 29.130  48.184  -6.917  1.00 112.35 ? 36  MET C CG     1 
ATOM   5364 S  SD     . MET C 1 36  ? 30.785  48.128  -6.195  1.00 120.15 ? 36  MET C SD     1 
ATOM   5365 C  CE     . MET C 1 36  ? 31.031  49.856  -5.786  1.00 101.11 ? 36  MET C CE     1 
ATOM   5366 H  H      . MET C 1 36  ? 28.329  47.436  -9.754  1.00 134.04 ? 36  MET C H      1 
ATOM   5367 H  HA     . MET C 1 36  ? 30.345  46.378  -8.378  1.00 130.01 ? 36  MET C HA     1 
ATOM   5368 H  HB2    . MET C 1 36  ? 27.686  46.928  -7.635  1.00 117.23 ? 36  MET C HB2    1 
ATOM   5369 H  HB3    . MET C 1 36  ? 28.690  46.208  -6.636  1.00 117.23 ? 36  MET C HB3    1 
ATOM   5370 H  HG2    . MET C 1 36  ? 29.161  48.782  -7.680  1.00 135.04 ? 36  MET C HG2    1 
ATOM   5371 H  HG3    . MET C 1 36  ? 28.526  48.534  -6.244  1.00 135.04 ? 36  MET C HG3    1 
ATOM   5372 H  HE1    . MET C 1 36  ? 31.923  49.971  -5.424  1.00 121.55 ? 36  MET C HE1    1 
ATOM   5373 H  HE2    . MET C 1 36  ? 30.930  50.388  -6.591  1.00 121.55 ? 36  MET C HE2    1 
ATOM   5374 H  HE3    . MET C 1 36  ? 30.369  50.123  -5.129  1.00 121.55 ? 36  MET C HE3    1 
ATOM   5375 N  N      . SER C 1 37  ? 28.316  44.371  -9.693  1.00 58.37  ? 37  SER C N      1 
ATOM   5376 C  CA     . SER C 1 37  ? 28.027  42.956  -9.893  1.00 63.20  ? 37  SER C CA     1 
ATOM   5377 C  C      . SER C 1 37  ? 27.381  42.739  -11.255 1.00 75.79  ? 37  SER C C      1 
ATOM   5378 O  O      . SER C 1 37  ? 26.326  43.310  -11.549 1.00 82.85  ? 37  SER C O      1 
ATOM   5379 C  CB     . SER C 1 37  ? 27.126  42.425  -8.776  1.00 72.48  ? 37  SER C CB     1 
ATOM   5380 O  OG     . SER C 1 37  ? 26.869  41.040  -8.939  1.00 51.70  ? 37  SER C OG     1 
ATOM   5381 H  H      . SER C 1 37  ? 27.923  44.896  -10.250 1.00 70.27  ? 37  SER C H      1 
ATOM   5382 H  HA     . SER C 1 37  ? 28.855  42.452  -9.864  1.00 76.05  ? 37  SER C HA     1 
ATOM   5383 H  HB2    . SER C 1 37  ? 27.568  42.564  -7.923  1.00 87.19  ? 37  SER C HB2    1 
ATOM   5384 H  HB3    . SER C 1 37  ? 26.284  42.906  -8.795  1.00 87.19  ? 37  SER C HB3    1 
ATOM   5385 H  HG     . SER C 1 37  ? 27.590  40.609  -8.918  1.00 62.25  ? 37  SER C HG     1 
ATOM   5386 N  N      . SER C 1 38  ? 28.015  41.920  -12.096 1.00 85.30  ? 38  SER C N      1 
ATOM   5387 C  CA     . SER C 1 38  ? 27.471  41.665  -13.425 1.00 71.44  ? 38  SER C CA     1 
ATOM   5388 C  C      . SER C 1 38  ? 26.183  40.854  -13.355 1.00 57.56  ? 38  SER C C      1 
ATOM   5389 O  O      . SER C 1 38  ? 25.234  41.121  -14.103 1.00 80.78  ? 38  SER C O      1 
ATOM   5390 C  CB     . SER C 1 38  ? 28.511  40.941  -14.280 1.00 59.98  ? 38  SER C CB     1 
ATOM   5391 O  OG     . SER C 1 38  ? 28.008  40.666  -15.575 1.00 57.33  ? 38  SER C OG     1 
ATOM   5392 H  H      . SER C 1 38  ? 28.749  41.506  -11.926 1.00 102.57 ? 38  SER C H      1 
ATOM   5393 H  HA     . SER C 1 38  ? 27.265  42.515  -13.846 1.00 85.94  ? 38  SER C HA     1 
ATOM   5394 H  HB2    . SER C 1 38  ? 29.298  41.502  -14.361 1.00 72.19  ? 38  SER C HB2    1 
ATOM   5395 H  HB3    . SER C 1 38  ? 28.744  40.103  -13.849 1.00 72.19  ? 38  SER C HB3    1 
ATOM   5396 H  HG     . SER C 1 38  ? 28.569  40.222  -16.013 1.00 69.01  ? 38  SER C HG     1 
ATOM   5397 N  N      . VAL C 1 39  ? 26.119  39.874  -12.452 1.00 60.48  ? 39  VAL C N      1 
ATOM   5398 C  CA     . VAL C 1 39  ? 24.920  39.049  -12.338 1.00 68.89  ? 39  VAL C CA     1 
ATOM   5399 C  C      . VAL C 1 39  ? 23.731  39.906  -11.925 1.00 79.28  ? 39  VAL C C      1 
ATOM   5400 O  O      . VAL C 1 39  ? 22.635  39.796  -12.487 1.00 78.89  ? 39  VAL C O      1 
ATOM   5401 C  CB     . VAL C 1 39  ? 25.149  37.893  -11.347 1.00 57.79  ? 39  VAL C CB     1 
ATOM   5402 C  CG1    . VAL C 1 39  ? 23.909  37.013  -11.271 1.00 58.03  ? 39  VAL C CG1    1 
ATOM   5403 C  CG2    . VAL C 1 39  ? 26.370  37.082  -11.741 1.00 59.34  ? 39  VAL C CG2    1 
ATOM   5404 H  H      . VAL C 1 39  ? 26.747  39.670  -11.901 1.00 72.79  ? 39  VAL C H      1 
ATOM   5405 H  HA     . VAL C 1 39  ? 24.730  38.663  -13.208 1.00 82.89  ? 39  VAL C HA     1 
ATOM   5406 H  HB     . VAL C 1 39  ? 25.313  38.261  -10.465 1.00 69.56  ? 39  VAL C HB     1 
ATOM   5407 H  HG11   . VAL C 1 39  ? 24.115  36.221  -10.750 1.00 69.85  ? 39  VAL C HG11   1 
ATOM   5408 H  HG12   . VAL C 1 39  ? 23.194  37.512  -10.845 1.00 69.85  ? 39  VAL C HG12   1 
ATOM   5409 H  HG13   . VAL C 1 39  ? 23.645  36.760  -12.169 1.00 69.85  ? 39  VAL C HG13   1 
ATOM   5410 H  HG21   . VAL C 1 39  ? 26.395  36.271  -11.209 1.00 71.43  ? 39  VAL C HG21   1 
ATOM   5411 H  HG22   . VAL C 1 39  ? 26.310  36.858  -12.683 1.00 71.43  ? 39  VAL C HG22   1 
ATOM   5412 H  HG23   . VAL C 1 39  ? 27.166  37.610  -11.576 1.00 71.43  ? 39  VAL C HG23   1 
ATOM   5413 N  N      . ILE C 1 40  ? 23.930  40.772  -10.929 1.00 65.21  ? 40  ILE C N      1 
ATOM   5414 C  CA     . ILE C 1 40  ? 22.835  41.599  -10.434 1.00 60.51  ? 40  ILE C CA     1 
ATOM   5415 C  C      . ILE C 1 40  ? 22.402  42.607  -11.491 1.00 69.51  ? 40  ILE C C      1 
ATOM   5416 O  O      . ILE C 1 40  ? 21.210  42.908  -11.625 1.00 84.32  ? 40  ILE C O      1 
ATOM   5417 C  CB     . ILE C 1 40  ? 23.246  42.290  -9.121  1.00 62.80  ? 40  ILE C CB     1 
ATOM   5418 C  CG1    . ILE C 1 40  ? 23.622  41.238  -8.071  1.00 58.25  ? 40  ILE C CG1    1 
ATOM   5419 C  CG2    . ILE C 1 40  ? 22.117  43.182  -8.616  1.00 69.44  ? 40  ILE C CG2    1 
ATOM   5420 C  CD1    . ILE C 1 40  ? 24.152  41.813  -6.779  1.00 45.45  ? 40  ILE C CD1    1 
ATOM   5421 H  H      . ILE C 1 40  ? 24.680  40.898  -10.527 1.00 78.47  ? 40  ILE C H      1 
ATOM   5422 H  HA     . ILE C 1 40  ? 22.076  41.025  -10.248 1.00 72.83  ? 40  ILE C HA     1 
ATOM   5423 H  HB     . ILE C 1 40  ? 24.022  42.848  -9.289  1.00 75.58  ? 40  ILE C HB     1 
ATOM   5424 H  HG12   . ILE C 1 40  ? 22.832  40.716  -7.859  1.00 70.11  ? 40  ILE C HG12   1 
ATOM   5425 H  HG13   . ILE C 1 40  ? 24.310  40.663  -8.441  1.00 70.11  ? 40  ILE C HG13   1 
ATOM   5426 H  HG21   . ILE C 1 40  ? 22.332  43.489  -7.721  1.00 83.54  ? 40  ILE C HG21   1 
ATOM   5427 H  HG22   . ILE C 1 40  ? 22.023  43.941  -9.213  1.00 83.54  ? 40  ILE C HG22   1 
ATOM   5428 H  HG23   . ILE C 1 40  ? 21.293  42.669  -8.600  1.00 83.54  ? 40  ILE C HG23   1 
ATOM   5429 H  HD11   . ILE C 1 40  ? 24.577  41.105  -6.269  1.00 54.75  ? 40  ILE C HD11   1 
ATOM   5430 H  HD12   . ILE C 1 40  ? 24.798  42.506  -6.984  1.00 54.75  ? 40  ILE C HD12   1 
ATOM   5431 H  HD13   . ILE C 1 40  ? 23.414  42.187  -6.274  1.00 54.75  ? 40  ILE C HD13   1 
ATOM   5432 N  N      . ALA C 1 41  ? 23.351  43.140  -12.263 1.00 61.98  ? 41  ALA C N      1 
ATOM   5433 C  CA     . ALA C 1 41  ? 22.996  44.068  -13.333 1.00 63.91  ? 41  ALA C CA     1 
ATOM   5434 C  C      . ALA C 1 41  ? 22.174  43.369  -14.409 1.00 68.80  ? 41  ALA C C      1 
ATOM   5435 O  O      . ALA C 1 41  ? 21.152  43.896  -14.872 1.00 77.90  ? 41  ALA C O      1 
ATOM   5436 C  CB     . ALA C 1 41  ? 24.260  44.685  -13.931 1.00 79.77  ? 41  ALA C CB     1 
ATOM   5437 H  H      . ALA C 1 41  ? 24.193  42.983  -12.191 1.00 74.60  ? 41  ALA C H      1 
ATOM   5438 H  HA     . ALA C 1 41  ? 22.460  44.787  -12.962 1.00 76.91  ? 41  ALA C HA     1 
ATOM   5439 H  HB1    . ALA C 1 41  ? 24.008  45.298  -14.639 1.00 95.94  ? 41  ALA C HB1    1 
ATOM   5440 H  HB2    . ALA C 1 41  ? 24.738  45.164  -13.235 1.00 95.94  ? 41  ALA C HB2    1 
ATOM   5441 H  HB3    . ALA C 1 41  ? 24.819  43.977  -14.288 1.00 95.94  ? 41  ALA C HB3    1 
ATOM   5442 N  N      . LYS C 1 42  ? 22.608  42.177  -14.824 1.00 59.01  ? 42  LYS C N      1 
ATOM   5443 C  CA     . LYS C 1 42  ? 21.838  41.412  -15.797 1.00 81.07  ? 42  LYS C CA     1 
ATOM   5444 C  C      . LYS C 1 42  ? 20.452  41.088  -15.254 1.00 72.36  ? 42  LYS C C      1 
ATOM   5445 O  O      . LYS C 1 42  ? 19.468  41.078  -16.002 1.00 71.79  ? 42  LYS C O      1 
ATOM   5446 C  CB     . LYS C 1 42  ? 22.585  40.128  -16.163 1.00 85.22  ? 42  LYS C CB     1 
ATOM   5447 C  CG     . LYS C 1 42  ? 21.894  39.269  -17.217 1.00 79.21  ? 42  LYS C CG     1 
ATOM   5448 C  CD     . LYS C 1 42  ? 22.737  38.055  -17.587 1.00 84.62  ? 42  LYS C CD     1 
ATOM   5449 C  CE     . LYS C 1 42  ? 22.025  37.162  -18.594 1.00 88.19  ? 42  LYS C CE     1 
ATOM   5450 N  NZ     . LYS C 1 42  ? 20.796  36.530  -18.033 1.00 83.86  ? 42  LYS C NZ     1 
ATOM   5451 H  H      . LYS C 1 42  ? 23.333  41.796  -14.563 1.00 71.03  ? 42  LYS C H      1 
ATOM   5452 H  HA     . LYS C 1 42  ? 21.734  41.937  -16.606 1.00 97.50  ? 42  LYS C HA     1 
ATOM   5453 H  HB2    . LYS C 1 42  ? 23.460  40.367  -16.507 1.00 102.48 ? 42  LYS C HB2    1 
ATOM   5454 H  HB3    . LYS C 1 42  ? 22.681  39.588  -15.362 1.00 102.48 ? 42  LYS C HB3    1 
ATOM   5455 H  HG2    . LYS C 1 42  ? 21.044  38.956  -16.871 1.00 95.26  ? 42  LYS C HG2    1 
ATOM   5456 H  HG3    . LYS C 1 42  ? 21.752  39.796  -18.019 1.00 95.26  ? 42  LYS C HG3    1 
ATOM   5457 H  HD2    . LYS C 1 42  ? 23.573  38.352  -17.980 1.00 101.76 ? 42  LYS C HD2    1 
ATOM   5458 H  HD3    . LYS C 1 42  ? 22.914  37.532  -16.789 1.00 101.76 ? 42  LYS C HD3    1 
ATOM   5459 H  HE2    . LYS C 1 42  ? 21.765  37.695  -19.362 1.00 106.05 ? 42  LYS C HE2    1 
ATOM   5460 H  HE3    . LYS C 1 42  ? 22.627  36.453  -18.871 1.00 106.05 ? 42  LYS C HE3    1 
ATOM   5461 H  HZ1    . LYS C 1 42  ? 20.432  35.984  -18.634 1.00 100.85 ? 42  LYS C HZ1    1 
ATOM   5462 H  HZ2    . LYS C 1 42  ? 21.000  36.062  -17.304 1.00 100.85 ? 42  LYS C HZ2    1 
ATOM   5463 H  HZ3    . LYS C 1 42  ? 20.203  37.158  -17.816 1.00 100.85 ? 42  LYS C HZ3    1 
ATOM   5464 N  N      . PHE C 1 43  ? 20.357  40.817  -13.949 1.00 64.61  ? 43  PHE C N      1 
ATOM   5465 C  CA     . PHE C 1 43  ? 19.062  40.526  -13.345 1.00 77.48  ? 43  PHE C CA     1 
ATOM   5466 C  C      . PHE C 1 43  ? 18.155  41.752  -13.356 1.00 94.23  ? 43  PHE C C      1 
ATOM   5467 O  O      . PHE C 1 43  ? 16.957  41.641  -13.645 1.00 73.36  ? 43  PHE C O      1 
ATOM   5468 C  CB     . PHE C 1 43  ? 19.260  40.013  -11.919 1.00 64.33  ? 43  PHE C CB     1 
ATOM   5469 C  CG     . PHE C 1 43  ? 17.981  39.654  -11.225 1.00 72.04  ? 43  PHE C CG     1 
ATOM   5470 C  CD1    . PHE C 1 43  ? 17.440  38.386  -11.368 1.00 61.00  ? 43  PHE C CD1    1 
ATOM   5471 C  CD2    . PHE C 1 43  ? 17.315  40.578  -10.438 1.00 70.65  ? 43  PHE C CD2    1 
ATOM   5472 C  CE1    . PHE C 1 43  ? 16.261  38.045  -10.737 1.00 61.18  ? 43  PHE C CE1    1 
ATOM   5473 C  CE2    . PHE C 1 43  ? 16.134  40.243  -9.804  1.00 67.19  ? 43  PHE C CE2    1 
ATOM   5474 C  CZ     . PHE C 1 43  ? 15.607  38.973  -9.955  1.00 63.72  ? 43  PHE C CZ     1 
ATOM   5475 H  H      . PHE C 1 43  ? 21.019  40.795  -13.400 1.00 77.75  ? 43  PHE C H      1 
ATOM   5476 H  HA     . PHE C 1 43  ? 18.625  39.830  -13.860 1.00 93.19  ? 43  PHE C HA     1 
ATOM   5477 H  HB2    . PHE C 1 43  ? 19.815  39.219  -11.947 1.00 77.41  ? 43  PHE C HB2    1 
ATOM   5478 H  HB3    . PHE C 1 43  ? 19.696  40.705  -11.397 1.00 77.41  ? 43  PHE C HB3    1 
ATOM   5479 H  HD1    . PHE C 1 43  ? 17.877  37.757  -11.895 1.00 73.41  ? 43  PHE C HD1    1 
ATOM   5480 H  HD2    . PHE C 1 43  ? 17.667  41.433  -10.334 1.00 85.00  ? 43  PHE C HD2    1 
ATOM   5481 H  HE1    . PHE C 1 43  ? 15.909  37.191  -10.840 1.00 73.63  ? 43  PHE C HE1    1 
ATOM   5482 H  HE2    . PHE C 1 43  ? 15.695  40.870  -9.277  1.00 80.84  ? 43  PHE C HE2    1 
ATOM   5483 H  HZ     . PHE C 1 43  ? 14.812  38.746  -9.530  1.00 76.68  ? 43  PHE C HZ     1 
ATOM   5484 N  N      . MET C 1 44  ? 18.710  42.934  -13.063 1.00 84.38  ? 44  MET C N      1 
ATOM   5485 C  CA     . MET C 1 44  ? 17.902  44.148  -13.046 1.00 69.84  ? 44  MET C CA     1 
ATOM   5486 C  C      . MET C 1 44  ? 17.505  44.589  -14.449 1.00 79.71  ? 44  MET C C      1 
ATOM   5487 O  O      . MET C 1 44  ? 16.503  45.295  -14.602 1.00 81.83  ? 44  MET C O      1 
ATOM   5488 C  CB     . MET C 1 44  ? 18.655  45.287  -12.356 1.00 57.45  ? 44  MET C CB     1 
ATOM   5489 C  CG     . MET C 1 44  ? 18.699  45.195  -10.838 1.00 88.04  ? 44  MET C CG     1 
ATOM   5490 S  SD     . MET C 1 44  ? 17.091  45.452  -10.057 1.00 108.22 ? 44  MET C SD     1 
ATOM   5491 C  CE     . MET C 1 44  ? 16.585  43.762  -9.727  1.00 62.17  ? 44  MET C CE     1 
ATOM   5492 H  H      . MET C 1 44  ? 19.540  43.056  -12.873 1.00 101.48 ? 44  MET C H      1 
ATOM   5493 H  HA     . MET C 1 44  ? 17.102  43.966  -12.528 1.00 84.03  ? 44  MET C HA     1 
ATOM   5494 H  HB2    . MET C 1 44  ? 19.571  45.288  -12.675 1.00 69.15  ? 44  MET C HB2    1 
ATOM   5495 H  HB3    . MET C 1 44  ? 18.223  46.125  -12.585 1.00 69.15  ? 44  MET C HB3    1 
ATOM   5496 H  HG2    . MET C 1 44  ? 19.014  44.312  -10.587 1.00 105.87 ? 44  MET C HG2    1 
ATOM   5497 H  HG3    . MET C 1 44  ? 19.306  45.872  -10.500 1.00 105.87 ? 44  MET C HG3    1 
ATOM   5498 H  HE1    . MET C 1 44  ? 15.727  43.772  -9.275  1.00 74.82  ? 44  MET C HE1    1 
ATOM   5499 H  HE2    . MET C 1 44  ? 16.511  43.285  -10.568 1.00 74.82  ? 44  MET C HE2    1 
ATOM   5500 H  HE3    . MET C 1 44  ? 17.251  43.337  -9.164  1.00 74.82  ? 44  MET C HE3    1 
ATOM   5501 N  N      . GLU C 1 45  ? 18.263  44.191  -15.474 1.00 95.93  ? 45  GLU C N      1 
ATOM   5502 C  CA     . GLU C 1 45  ? 17.859  44.516  -16.840 1.00 90.47  ? 45  GLU C CA     1 
ATOM   5503 C  C      . GLU C 1 45  ? 16.503  43.906  -17.178 1.00 82.07  ? 45  GLU C C      1 
ATOM   5504 O  O      . GLU C 1 45  ? 15.766  44.453  -18.007 1.00 71.39  ? 45  GLU C O      1 
ATOM   5505 C  CB     . GLU C 1 45  ? 18.919  44.048  -17.839 1.00 102.65 ? 45  GLU C CB     1 
ATOM   5506 C  CG     . GLU C 1 45  ? 20.178  44.904  -17.843 1.00 96.31  ? 45  GLU C CG     1 
ATOM   5507 C  CD     . GLU C 1 45  ? 21.216  44.425  -18.839 1.00 86.38  ? 45  GLU C CD     1 
ATOM   5508 O  OE1    . GLU C 1 45  ? 20.944  43.446  -19.565 1.00 90.40  ? 45  GLU C OE1    1 
ATOM   5509 O  OE2    . GLU C 1 45  ? 22.298  45.044  -18.907 1.00 96.15  ? 45  GLU C OE2    1 
ATOM   5510 H  H      . GLU C 1 45  ? 18.995  43.744  -15.409 1.00 115.34 ? 45  GLU C H      1 
ATOM   5511 H  HA     . GLU C 1 45  ? 17.787  45.480  -16.920 1.00 108.78 ? 45  GLU C HA     1 
ATOM   5512 H  HB2    . GLU C 1 45  ? 19.178  43.140  -17.616 1.00 123.40 ? 45  GLU C HB2    1 
ATOM   5513 H  HB3    . GLU C 1 45  ? 18.539  44.075  -18.731 1.00 123.40 ? 45  GLU C HB3    1 
ATOM   5514 H  HG2    . GLU C 1 45  ? 19.939  45.815  -18.076 1.00 115.79 ? 45  GLU C HG2    1 
ATOM   5515 H  HG3    . GLU C 1 45  ? 20.578  44.881  -16.960 1.00 115.79 ? 45  GLU C HG3    1 
ATOM   5516 N  N      . SER C 1 46  ? 16.161  42.777  -16.557 1.00 89.45  ? 46  SER C N      1 
ATOM   5517 C  CA     . SER C 1 46  ? 14.908  42.066  -16.813 1.00 92.22  ? 46  SER C CA     1 
ATOM   5518 C  C      . SER C 1 46  ? 13.865  42.340  -15.734 1.00 97.97  ? 46  SER C C      1 
ATOM   5519 O  O      . SER C 1 46  ? 13.187  41.420  -15.260 1.00 98.82  ? 46  SER C O      1 
ATOM   5520 C  CB     . SER C 1 46  ? 15.162  40.566  -16.920 1.00 91.93  ? 46  SER C CB     1 
ATOM   5521 O  OG     . SER C 1 46  ? 15.706  40.050  -15.714 1.00 106.83 ? 46  SER C OG     1 
ATOM   5522 H  H      . SER C 1 46  ? 16.655  42.394  -15.966 1.00 107.56 ? 46  SER C H      1 
ATOM   5523 H  HA     . SER C 1 46  ? 14.553  42.377  -17.661 1.00 110.88 ? 46  SER C HA     1 
ATOM   5524 H  HB2    . SER C 1 46  ? 14.322  40.117  -17.104 1.00 110.54 ? 46  SER C HB2    1 
ATOM   5525 H  HB3    . SER C 1 46  ? 15.789  40.404  -17.642 1.00 110.54 ? 46  SER C HB3    1 
ATOM   5526 H  HG     . SER C 1 46  ? 16.426  40.442  -15.533 1.00 128.41 ? 46  SER C HG     1 
ATOM   5527 N  N      . VAL C 1 47  ? 13.708  43.599  -15.338 1.00 103.87 ? 47  VAL C N      1 
ATOM   5528 C  CA     . VAL C 1 47  ? 12.751  44.004  -14.322 1.00 105.07 ? 47  VAL C CA     1 
ATOM   5529 C  C      . VAL C 1 47  ? 11.949  45.150  -14.915 1.00 109.10 ? 47  VAL C C      1 
ATOM   5530 O  O      . VAL C 1 47  ? 12.512  46.035  -15.571 1.00 92.96  ? 47  VAL C O      1 
ATOM   5531 C  CB     . VAL C 1 47  ? 13.461  44.446  -13.023 1.00 94.66  ? 47  VAL C CB     1 
ATOM   5532 C  CG1    . VAL C 1 47  ? 12.500  45.190  -12.110 1.00 93.05  ? 47  VAL C CG1    1 
ATOM   5533 C  CG2    . VAL C 1 47  ? 14.056  43.258  -12.308 1.00 98.70  ? 47  VAL C CG2    1 
ATOM   5534 H  H      . VAL C 1 47  ? 14.162  44.255  -15.658 1.00 124.86 ? 47  VAL C H      1 
ATOM   5535 H  HA     . VAL C 1 47  ? 12.155  43.272  -14.098 1.00 126.30 ? 47  VAL C HA     1 
ATOM   5536 H  HB     . VAL C 1 47  ? 14.183  45.050  -13.257 1.00 113.81 ? 47  VAL C HB     1 
ATOM   5537 H  HG11   . VAL C 1 47  ? 12.882  45.235  -11.219 1.00 111.87 ? 47  VAL C HG11   1 
ATOM   5538 H  HG12   . VAL C 1 47  ? 12.364  46.085  -12.457 1.00 111.87 ? 47  VAL C HG12   1 
ATOM   5539 H  HG13   . VAL C 1 47  ? 11.656  44.713  -12.084 1.00 111.87 ? 47  VAL C HG13   1 
ATOM   5540 H  HG21   . VAL C 1 47  ? 14.315  43.525  -11.412 1.00 118.65 ? 47  VAL C HG21   1 
ATOM   5541 H  HG22   . VAL C 1 47  ? 13.393  42.551  -12.264 1.00 118.65 ? 47  VAL C HG22   1 
ATOM   5542 H  HG23   . VAL C 1 47  ? 14.834  42.951  -12.799 1.00 118.65 ? 47  VAL C HG23   1 
ATOM   5543 N  N      . GLU C 1 48  ? 10.646  45.133  -14.696 1.00 119.02 ? 48  GLU C N      1 
ATOM   5544 C  CA     . GLU C 1 48  ? 9.787   46.173  -15.236 1.00 105.12 ? 48  GLU C CA     1 
ATOM   5545 C  C      . GLU C 1 48  ? 10.159  47.530  -14.634 1.00 114.65 ? 48  GLU C C      1 
ATOM   5546 O  O      . GLU C 1 48  ? 10.209  47.662  -13.403 1.00 115.95 ? 48  GLU C O      1 
ATOM   5547 C  CB     . GLU C 1 48  ? 8.340   45.840  -14.881 1.00 107.00 ? 48  GLU C CB     1 
ATOM   5548 C  CG     . GLU C 1 48  ? 7.783   44.540  -15.421 1.00 117.31 ? 48  GLU C CG     1 
ATOM   5549 C  CD     . GLU C 1 48  ? 8.363   43.311  -14.707 1.00 118.38 ? 48  GLU C CD     1 
ATOM   5550 O  OE1    . GLU C 1 48  ? 9.288   43.439  -13.866 1.00 126.40 ? 48  GLU C OE1    1 
ATOM   5551 O  OE2    . GLU C 1 48  ? 7.874   42.200  -14.987 1.00 98.26  ? 48  GLU C OE2    1 
ATOM   5552 H  H      . GLU C 1 48  ? 10.232  44.533  -14.239 1.00 143.04 ? 48  GLU C H      1 
ATOM   5553 H  HA     . GLU C 1 48  ? 9.891   46.229  -16.199 1.00 126.36 ? 48  GLU C HA     1 
ATOM   5554 H  HB2    . GLU C 1 48  ? 8.272   45.796  -13.914 1.00 128.61 ? 48  GLU C HB2    1 
ATOM   5555 H  HB3    . GLU C 1 48  ? 7.777   46.552  -15.221 1.00 128.61 ? 48  GLU C HB3    1 
ATOM   5556 H  HG2    . GLU C 1 48  ? 6.820   44.533  -15.299 1.00 140.99 ? 48  GLU C HG2    1 
ATOM   5557 H  HG3    . GLU C 1 48  ? 7.998   44.470  -16.364 1.00 140.99 ? 48  GLU C HG3    1 
ATOM   5558 N  N      . PRO C 1 49  ? 10.427  48.545  -15.421 1.00 115.40 ? 49  PRO C N      1 
ATOM   5559 C  CA     . PRO C 1 49  ? 10.667  49.904  -14.935 1.00 115.17 ? 49  PRO C CA     1 
ATOM   5560 C  C      . PRO C 1 49  ? 9.430   50.503  -14.257 1.00 113.86 ? 49  PRO C C      1 
ATOM   5561 O  O      . PRO C 1 49  ? 8.556   51.088  -14.908 1.00 96.20  ? 49  PRO C O      1 
ATOM   5562 C  CB     . PRO C 1 49  ? 11.093  50.641  -16.193 1.00 93.41  ? 49  PRO C CB     1 
ATOM   5563 C  CG     . PRO C 1 49  ? 10.545  49.828  -17.315 1.00 91.67  ? 49  PRO C CG     1 
ATOM   5564 C  CD     . PRO C 1 49  ? 10.544  48.413  -16.867 1.00 97.75  ? 49  PRO C CD     1 
ATOM   5565 H  HA     . PRO C 1 49  ? 11.402  49.935  -14.303 1.00 138.42 ? 49  PRO C HA     1 
ATOM   5566 H  HB2    . PRO C 1 49  ? 10.718  51.536  -16.196 1.00 112.31 ? 49  PRO C HB2    1 
ATOM   5567 H  HB3    . PRO C 1 49  ? 12.061  50.687  -16.238 1.00 112.31 ? 49  PRO C HB3    1 
ATOM   5568 H  HG2    . PRO C 1 49  ? 9.642   50.121  -17.514 1.00 110.22 ? 49  PRO C HG2    1 
ATOM   5569 H  HG3    . PRO C 1 49  ? 11.108  49.935  -18.098 1.00 110.22 ? 49  PRO C HG3    1 
ATOM   5570 H  HD2    . PRO C 1 49  ? 9.788   47.931  -17.235 1.00 117.52 ? 49  PRO C HD2    1 
ATOM   5571 H  HD3    . PRO C 1 49  ? 11.372  47.970  -17.111 1.00 117.52 ? 49  PRO C HD3    1 
ATOM   5572 N  N      . GLY C 1 50  ? 9.362   50.325  -12.953 1.00 116.81 ? 50  GLY C N      1 
ATOM   5573 C  CA     . GLY C 1 50  ? 8.232   50.711  -12.117 1.00 107.21 ? 50  GLY C CA     1 
ATOM   5574 C  C      . GLY C 1 50  ? 8.241   49.704  -10.993 1.00 120.85 ? 50  GLY C C      1 
ATOM   5575 O  O      . GLY C 1 50  ? 8.846   48.653  -11.110 1.00 114.73 ? 50  GLY C O      1 
ATOM   5576 H  H      . GLY C 1 50  ? 9.993   49.961  -12.498 1.00 140.39 ? 50  GLY C H      1 
ATOM   5577 H  HA2    . GLY C 1 50  ? 8.342   51.609  -11.769 1.00 128.86 ? 50  GLY C HA2    1 
ATOM   5578 H  HA3    . GLY C 1 50  ? 7.397   50.663  -12.609 1.00 128.86 ? 50  GLY C HA3    1 
ATOM   5579 N  N      . ARG C 1 51  ? 7.553   50.017  -9.890  1.00 124.76 ? 51  ARG C N      1 
ATOM   5580 C  CA     . ARG C 1 51  ? 7.619   49.108  -8.754  1.00 128.09 ? 51  ARG C CA     1 
ATOM   5581 C  C      . ARG C 1 51  ? 6.275   48.419  -8.582  1.00 116.67 ? 51  ARG C C      1 
ATOM   5582 O  O      . ARG C 1 51  ? 5.220   48.971  -8.906  1.00 107.77 ? 51  ARG C O      1 
ATOM   5583 C  CB     . ARG C 1 51  ? 7.994   49.839  -7.462  1.00 111.99 ? 51  ARG C CB     1 
ATOM   5584 C  CG     . ARG C 1 51  ? 7.024   50.917  -7.038  1.00 90.82  ? 51  ARG C CG     1 
ATOM   5585 C  CD     . ARG C 1 51  ? 7.475   51.534  -5.739  1.00 80.12  ? 51  ARG C CD     1 
ATOM   5586 N  NE     . ARG C 1 51  ? 8.075   52.853  -5.914  1.00 85.13  ? 51  ARG C NE     1 
ATOM   5587 C  CZ     . ARG C 1 51  ? 9.001   53.366  -5.107  1.00 81.71  ? 51  ARG C CZ     1 
ATOM   5588 N  NH1    . ARG C 1 51  ? 9.448   52.664  -4.073  1.00 92.29  ? 51  ARG C NH1    1 
ATOM   5589 N  NH2    . ARG C 1 51  ? 9.489   54.577  -5.337  1.00 57.54  ? 51  ARG C NH2    1 
ATOM   5590 H  H      . ARG C 1 51  ? 7.066   50.719  -9.788  1.00 149.92 ? 51  ARG C H      1 
ATOM   5591 H  HA     . ARG C 1 51  ? 8.301   48.437  -8.918  1.00 153.92 ? 51  ARG C HA     1 
ATOM   5592 H  HB2    . ARG C 1 51  ? 8.040   49.189  -6.743  1.00 134.61 ? 51  ARG C HB2    1 
ATOM   5593 H  HB3    . ARG C 1 51  ? 8.860   50.258  -7.586  1.00 134.61 ? 51  ARG C HB3    1 
ATOM   5594 H  HG2    . ARG C 1 51  ? 6.988   51.610  -7.716  1.00 109.20 ? 51  ARG C HG2    1 
ATOM   5595 H  HG3    . ARG C 1 51  ? 6.143   50.532  -6.910  1.00 109.20 ? 51  ARG C HG3    1 
ATOM   5596 H  HD2    . ARG C 1 51  ? 6.709   51.630  -5.152  1.00 96.36  ? 51  ARG C HD2    1 
ATOM   5597 H  HD3    . ARG C 1 51  ? 8.137   50.957  -5.328  1.00 96.36  ? 51  ARG C HD3    1 
ATOM   5598 H  HE     . ARG C 1 51  ? 7.814   53.329  -6.581  1.00 102.37 ? 51  ARG C HE     1 
ATOM   5599 H  HH11   . ARG C 1 51  ? 9.139   51.876  -3.922  1.00 110.96 ? 51  ARG C HH11   1 
ATOM   5600 H  HH12   . ARG C 1 51  ? 10.046  52.999  -3.553  1.00 110.96 ? 51  ARG C HH12   1 
ATOM   5601 H  HH21   . ARG C 1 51  ? 9.208   55.033  -6.009  1.00 69.26  ? 51  ARG C HH21   1 
ATOM   5602 H  HH22   . ARG C 1 51  ? 10.088  54.905  -4.813  1.00 69.26  ? 51  ARG C HH22   1 
ATOM   5603 N  N      . VAL C 1 52  ? 6.340   47.200  -8.066  1.00 110.42 ? 52  VAL C N      1 
ATOM   5604 C  CA     . VAL C 1 52  ? 5.166   46.414  -7.711  1.00 109.02 ? 52  VAL C CA     1 
ATOM   5605 C  C      . VAL C 1 52  ? 4.996   46.379  -6.194  1.00 101.17 ? 52  VAL C C      1 
ATOM   5606 O  O      . VAL C 1 52  ? 3.985   46.829  -5.660  1.00 86.79  ? 52  VAL C O      1 
ATOM   5607 C  CB     . VAL C 1 52  ? 5.251   44.993  -8.308  1.00 109.46 ? 52  VAL C CB     1 
ATOM   5608 C  CG1    . VAL C 1 52  ? 4.024   44.173  -7.945  1.00 95.22  ? 52  VAL C CG1    1 
ATOM   5609 C  CG2    . VAL C 1 52  ? 5.421   45.056  -9.831  1.00 82.09  ? 52  VAL C CG2    1 
ATOM   5610 H  H      . VAL C 1 52  ? 7.081   46.793  -7.907  1.00 132.72 ? 52  VAL C H      1 
ATOM   5611 H  HA     . VAL C 1 52  ? 4.376   46.833  -8.087  1.00 131.04 ? 52  VAL C HA     1 
ATOM   5612 H  HB     . VAL C 1 52  ? 6.029   44.552  -7.932  1.00 131.57 ? 52  VAL C HB     1 
ATOM   5613 H  HG11   . VAL C 1 52  ? 4.002   43.377  -8.498  1.00 114.48 ? 52  VAL C HG11   1 
ATOM   5614 H  HG12   . VAL C 1 52  ? 4.076   43.925  -7.009  1.00 114.48 ? 52  VAL C HG12   1 
ATOM   5615 H  HG13   . VAL C 1 52  ? 3.230   44.707  -8.102  1.00 114.48 ? 52  VAL C HG13   1 
ATOM   5616 H  HG21   . VAL C 1 52  ? 5.420   44.153  -10.186 1.00 98.72  ? 52  VAL C HG21   1 
ATOM   5617 H  HG22   . VAL C 1 52  ? 4.684   45.560  -10.210 1.00 98.72  ? 52  VAL C HG22   1 
ATOM   5618 H  HG23   . VAL C 1 52  ? 6.262   45.492  -10.038 1.00 98.72  ? 52  VAL C HG23   1 
ATOM   5619 N  N      . MET C 1 53  ? 5.988   45.842  -5.488  1.00 112.72 ? 53  MET C N      1 
ATOM   5620 C  CA     . MET C 1 53  ? 5.970   45.754  -4.035  1.00 103.01 ? 53  MET C CA     1 
ATOM   5621 C  C      . MET C 1 53  ? 6.941   46.777  -3.457  1.00 95.83  ? 53  MET C C      1 
ATOM   5622 O  O      . MET C 1 53  ? 8.066   46.918  -3.948  1.00 87.90  ? 53  MET C O      1 
ATOM   5623 C  CB     . MET C 1 53  ? 6.361   44.349  -3.575  1.00 97.11  ? 53  MET C CB     1 
ATOM   5624 C  CG     . MET C 1 53  ? 5.700   43.229  -4.372  1.00 105.81 ? 53  MET C CG     1 
ATOM   5625 S  SD     . MET C 1 53  ? 6.885   42.344  -5.412  1.00 99.16  ? 53  MET C SD     1 
ATOM   5626 C  CE     . MET C 1 53  ? 6.923   40.752  -4.593  1.00 66.26  ? 53  MET C CE     1 
ATOM   5627 H  H      . MET C 1 53  ? 6.700   45.515  -5.842  1.00 135.48 ? 53  MET C H      1 
ATOM   5628 H  HA     . MET C 1 53  ? 5.076   45.939  -3.705  1.00 123.82 ? 53  MET C HA     1 
ATOM   5629 H  HB2    . MET C 1 53  ? 7.321   44.248  -3.664  1.00 116.75 ? 53  MET C HB2    1 
ATOM   5630 H  HB3    . MET C 1 53  ? 6.101   44.242  -2.646  1.00 116.75 ? 53  MET C HB3    1 
ATOM   5631 H  HG2    . MET C 1 53  ? 5.302   42.592  -3.758  1.00 127.18 ? 53  MET C HG2    1 
ATOM   5632 H  HG3    . MET C 1 53  ? 5.017   43.608  -4.947  1.00 127.18 ? 53  MET C HG3    1 
ATOM   5633 H  HE1    . MET C 1 53  ? 7.412   40.124  -5.147  1.00 79.73  ? 53  MET C HE1    1 
ATOM   5634 H  HE2    . MET C 1 53  ? 7.364   40.849  -3.735  1.00 79.73  ? 53  MET C HE2    1 
ATOM   5635 H  HE3    . MET C 1 53  ? 6.013   40.441  -4.465  1.00 79.73  ? 53  MET C HE3    1 
ATOM   5636 N  N      . THR C 1 54  ? 6.513   47.489  -2.420  1.00 68.09  ? 54  THR C N      1 
ATOM   5637 C  CA     . THR C 1 54  ? 7.385   48.434  -1.713  1.00 45.55  ? 54  THR C CA     1 
ATOM   5638 C  C      . THR C 1 54  ? 7.849   47.847  -0.386  1.00 33.74  ? 54  THR C C      1 
ATOM   5639 O  O      . THR C 1 54  ? 7.745   48.448  0.682   1.00 25.75  ? 54  THR C O      1 
ATOM   5640 C  CB     . THR C 1 54  ? 6.682   49.768  -1.513  1.00 40.12  ? 54  THR C CB     1 
ATOM   5641 O  OG1    . THR C 1 54  ? 6.127   50.200  -2.760  1.00 59.11  ? 54  THR C OG1    1 
ATOM   5642 C  CG2    . THR C 1 54  ? 7.674   50.817  -1.020  1.00 53.39  ? 54  THR C CG2    1 
ATOM   5643 H  H      . THR C 1 54  ? 5.716   47.444  -2.101  1.00 81.92  ? 54  THR C H      1 
ATOM   5644 H  HA     . THR C 1 54  ? 8.168   48.606  -2.260  1.00 54.87  ? 54  THR C HA     1 
ATOM   5645 H  HB     . THR C 1 54  ? 5.976   49.672  -0.855  1.00 48.36  ? 54  THR C HB     1 
ATOM   5646 H  HG1    . THR C 1 54  ? 5.790   50.965  -2.675  1.00 71.15  ? 54  THR C HG1    1 
ATOM   5647 H  HG21   . THR C 1 54  ? 7.846   50.693  -0.074  1.00 64.29  ? 54  THR C HG21   1 
ATOM   5648 H  HG22   . THR C 1 54  ? 8.510   50.736  -1.505  1.00 64.29  ? 54  THR C HG22   1 
ATOM   5649 H  HG23   . THR C 1 54  ? 7.314   51.706  -1.161  1.00 64.29  ? 54  THR C HG23   1 
ATOM   5650 N  N      . ARG C 1 55  ? 8.352   46.629  -0.466  1.00 42.18  ? 55  ARG C N      1 
ATOM   5651 C  CA     . ARG C 1 55  ? 8.863   45.911  0.687   1.00 40.47  ? 55  ARG C CA     1 
ATOM   5652 C  C      . ARG C 1 55  ? 9.890   46.745  1.440   1.00 42.49  ? 55  ARG C C      1 
ATOM   5653 O  O      . ARG C 1 55  ? 10.593  47.571  0.837   1.00 33.06  ? 55  ARG C O      1 
ATOM   5654 C  CB     . ARG C 1 55  ? 9.485   44.606  0.212   1.00 51.83  ? 55  ARG C CB     1 
ATOM   5655 C  CG     . ARG C 1 55  ? 8.476   43.623  -0.344  1.00 54.54  ? 55  ARG C CG     1 
ATOM   5656 C  CD     . ARG C 1 55  ? 9.197   42.487  -1.021  1.00 65.46  ? 55  ARG C CD     1 
ATOM   5657 N  NE     . ARG C 1 55  ? 9.824   43.002  -2.236  1.00 62.30  ? 55  ARG C NE     1 
ATOM   5658 C  CZ     . ARG C 1 55  ? 10.718  42.351  -2.969  1.00 44.34  ? 55  ARG C CZ     1 
ATOM   5659 N  NH1    . ARG C 1 55  ? 11.117  41.135  -2.622  1.00 57.88  ? 55  ARG C NH1    1 
ATOM   5660 N  NH2    . ARG C 1 55  ? 11.217  42.928  -4.052  1.00 39.89  ? 55  ARG C NH2    1 
ATOM   5661 H  H      . ARG C 1 55  ? 8.410   46.182  -1.198  1.00 50.83  ? 55  ARG C H      1 
ATOM   5662 H  HA     . ARG C 1 55  ? 8.141   45.726  1.308   1.00 48.78  ? 55  ARG C HA     1 
ATOM   5663 H  HB2    . ARG C 1 55  ? 10.126  44.802  -0.489  1.00 62.41  ? 55  ARG C HB2    1 
ATOM   5664 H  HB3    . ARG C 1 55  ? 9.931   44.181  0.961   1.00 62.41  ? 55  ARG C HB3    1 
ATOM   5665 H  HG2    . ARG C 1 55  ? 7.934   43.265  0.376   1.00 65.66  ? 55  ARG C HG2    1 
ATOM   5666 H  HG3    . ARG C 1 55  ? 7.910   44.066  -0.996  1.00 65.66  ? 55  ARG C HG3    1 
ATOM   5667 H  HD2    . ARG C 1 55  ? 9.882   42.130  -0.435  1.00 78.76  ? 55  ARG C HD2    1 
ATOM   5668 H  HD3    . ARG C 1 55  ? 8.568   41.788  -1.259  1.00 78.76  ? 55  ARG C HD3    1 
ATOM   5669 H  HE     . ARG C 1 55  ? 9.597   43.790  -2.496  1.00 74.98  ? 55  ARG C HE     1 
ATOM   5670 H  HH11   . ARG C 1 55  ? 10.796  40.762  -1.916  1.00 69.68  ? 55  ARG C HH11   1 
ATOM   5671 H  HH12   . ARG C 1 55  ? 11.697  40.719  -3.102  1.00 69.68  ? 55  ARG C HH12   1 
ATOM   5672 H  HH21   . ARG C 1 55  ? 10.962  43.718  -4.274  1.00 48.08  ? 55  ARG C HH21   1 
ATOM   5673 H  HH22   . ARG C 1 55  ? 11.797  42.512  -4.532  1.00 48.08  ? 55  ARG C HH22   1 
ATOM   5674 N  N      . PRO C 1 56  ? 10.012  46.564  2.753   1.00 34.41  ? 56  PRO C N      1 
ATOM   5675 C  CA     . PRO C 1 56  ? 11.057  47.275  3.495   1.00 35.78  ? 56  PRO C CA     1 
ATOM   5676 C  C      . PRO C 1 56  ? 12.437  46.893  2.985   1.00 28.29  ? 56  PRO C C      1 
ATOM   5677 O  O      . PRO C 1 56  ? 12.712  45.728  2.695   1.00 34.83  ? 56  PRO C O      1 
ATOM   5678 C  CB     . PRO C 1 56  ? 10.837  46.822  4.945   1.00 36.71  ? 56  PRO C CB     1 
ATOM   5679 C  CG     . PRO C 1 56  ? 10.041  45.580  4.857   1.00 22.67  ? 56  PRO C CG     1 
ATOM   5680 C  CD     . PRO C 1 56  ? 9.188   45.722  3.638   1.00 26.87  ? 56  PRO C CD     1 
ATOM   5681 H  HA     . PRO C 1 56  ? 10.938  48.235  3.435   1.00 43.15  ? 56  PRO C HA     1 
ATOM   5682 H  HB2    . PRO C 1 56  ? 11.693  46.655  5.369   1.00 44.27  ? 56  PRO C HB2    1 
ATOM   5683 H  HB3    . PRO C 1 56  ? 10.354  47.508  5.432   1.00 44.27  ? 56  PRO C HB3    1 
ATOM   5684 H  HG2    . PRO C 1 56  ? 10.635  44.817  4.774   1.00 27.42  ? 56  PRO C HG2    1 
ATOM   5685 H  HG3    . PRO C 1 56  ? 9.492   45.487  5.651   1.00 27.42  ? 56  PRO C HG3    1 
ATOM   5686 H  HD2    . PRO C 1 56  ? 9.017   44.858  3.232   1.00 32.46  ? 56  PRO C HD2    1 
ATOM   5687 H  HD3    . PRO C 1 56  ? 8.349   46.161  3.851   1.00 32.46  ? 56  PRO C HD3    1 
ATOM   5688 N  N      . MET C 1 57  ? 13.300  47.904  2.852   1.00 32.60  ? 57  MET C N      1 
ATOM   5689 C  CA     . MET C 1 57  ? 14.661  47.718  2.375   1.00 27.48  ? 57  MET C CA     1 
ATOM   5690 C  C      . MET C 1 57  ? 15.630  48.432  3.304   1.00 22.99  ? 57  MET C C      1 
ATOM   5691 O  O      . MET C 1 57  ? 15.285  49.428  3.946   1.00 21.90  ? 57  MET C O      1 
ATOM   5692 C  CB     . MET C 1 57  ? 14.865  48.267  0.953   1.00 32.70  ? 57  MET C CB     1 
ATOM   5693 C  CG     . MET C 1 57  ? 14.686  49.772  0.833   1.00 42.91  ? 57  MET C CG     1 
ATOM   5694 S  SD     . MET C 1 57  ? 14.827  50.374  -0.864  1.00 36.48  ? 57  MET C SD     1 
ATOM   5695 C  CE     . MET C 1 57  ? 13.410  49.572  -1.615  1.00 46.82  ? 57  MET C CE     1 
ATOM   5696 H  H      . MET C 1 57  ? 13.110  48.722  3.037   1.00 39.34  ? 57  MET C H      1 
ATOM   5697 H  HA     . MET C 1 57  ? 14.846  46.766  2.364   1.00 33.19  ? 57  MET C HA     1 
ATOM   5698 H  HB2    . MET C 1 57  ? 15.766  48.054  0.665   1.00 39.46  ? 57  MET C HB2    1 
ATOM   5699 H  HB3    . MET C 1 57  ? 14.220  47.846  0.363   1.00 39.46  ? 57  MET C HB3    1 
ATOM   5700 H  HG2    . MET C 1 57  ? 13.805  50.011  1.162   1.00 51.71  ? 57  MET C HG2    1 
ATOM   5701 H  HG3    . MET C 1 57  ? 15.369  50.213  1.363   1.00 51.71  ? 57  MET C HG3    1 
ATOM   5702 H  HE1    . MET C 1 57  ? 13.259  49.955  -2.493  1.00 56.40  ? 57  MET C HE1    1 
ATOM   5703 H  HE2    . MET C 1 57  ? 13.590  48.622  -1.695  1.00 56.40  ? 57  MET C HE2    1 
ATOM   5704 H  HE3    . MET C 1 57  ? 12.632  49.715  -1.053  1.00 56.40  ? 57  MET C HE3    1 
ATOM   5705 N  N      . CYS C 1 58  ? 16.855  47.920  3.350   1.00 30.36  ? 58  CYS C N      1 
ATOM   5706 C  CA     . CYS C 1 58  ? 17.903  48.501  4.171   1.00 30.13  ? 58  CYS C CA     1 
ATOM   5707 C  C      . CYS C 1 58  ? 18.375  49.817  3.559   1.00 36.67  ? 58  CYS C C      1 
ATOM   5708 O  O      . CYS C 1 58  ? 17.927  50.234  2.488   1.00 34.74  ? 58  CYS C O      1 
ATOM   5709 C  CB     . CYS C 1 58  ? 19.055  47.511  4.293   1.00 45.38  ? 58  CYS C CB     1 
ATOM   5710 S  SG     . CYS C 1 58  ? 19.573  46.890  2.676   1.00 21.28  ? 58  CYS C SG     1 
ATOM   5711 H  H      . CYS C 1 58  ? 17.106  47.227  2.908   1.00 36.64  ? 58  CYS C H      1 
ATOM   5712 H  HA     . CYS C 1 58  ? 17.556  48.687  5.058   1.00 36.37  ? 58  CYS C HA     1 
ATOM   5713 H  HB2    . CYS C 1 58  ? 19.813  47.953  4.707   1.00 54.67  ? 58  CYS C HB2    1 
ATOM   5714 H  HB3    . CYS C 1 58  ? 18.773  46.757  4.834   1.00 54.67  ? 58  CYS C HB3    1 
ATOM   5715 H  HG     . CYS C 1 58  ? 20.501  46.143  2.824   1.00 25.75  ? 58  CYS C HG     1 
ATOM   5716 N  N      . ASN C 1 59  ? 19.314  50.470  4.240   1.00 43.16  ? 59  ASN C N      1 
ATOM   5717 C  CA     . ASN C 1 59  ? 19.925  51.675  3.704   1.00 35.17  ? 59  ASN C CA     1 
ATOM   5718 C  C      . ASN C 1 59  ? 20.917  51.297  2.605   1.00 41.52  ? 59  ASN C C      1 
ATOM   5719 O  O      . ASN C 1 59  ? 21.056  50.128  2.231   1.00 31.14  ? 59  ASN C O      1 
ATOM   5720 C  CB     . ASN C 1 59  ? 20.602  52.473  4.817   1.00 23.48  ? 59  ASN C CB     1 
ATOM   5721 C  CG     . ASN C 1 59  ? 21.727  51.708  5.484   1.00 38.41  ? 59  ASN C CG     1 
ATOM   5722 O  OD1    . ASN C 1 59  ? 22.414  50.907  4.850   1.00 47.96  ? 59  ASN C OD1    1 
ATOM   5723 N  ND2    . ASN C 1 59  ? 21.936  51.968  6.768   1.00 34.05  ? 59  ASN C ND2    1 
ATOM   5724 H  H      . ASN C 1 59  ? 19.610  50.234  5.012   1.00 52.01  ? 59  ASN C H      1 
ATOM   5725 H  HA     . ASN C 1 59  ? 19.234  52.237  3.320   1.00 42.42  ? 59  ASN C HA     1 
ATOM   5726 H  HB2    . ASN C 1 59  ? 20.974  53.286  4.441   1.00 28.40  ? 59  ASN C HB2    1 
ATOM   5727 H  HB3    . ASN C 1 59  ? 19.944  52.691  5.495   1.00 28.40  ? 59  ASN C HB3    1 
ATOM   5728 H  HD21   . ASN C 1 59  ? 22.563  51.561  7.193   1.00 41.08  ? 59  ASN C HD21   1 
ATOM   5729 H  HD22   . ASN C 1 59  ? 21.445  52.545  7.176   1.00 41.08  ? 59  ASN C HD22   1 
ATOM   5730 N  N      . ASP C 1 60  ? 21.623  52.298  2.077   1.00 42.96  ? 60  ASP C N      1 
ATOM   5731 C  CA     . ASP C 1 60  ? 22.542  52.048  0.974   1.00 43.25  ? 60  ASP C CA     1 
ATOM   5732 C  C      . ASP C 1 60  ? 23.836  51.403  1.450   1.00 41.17  ? 60  ASP C C      1 
ATOM   5733 O  O      . ASP C 1 60  ? 24.400  50.563  0.742   1.00 32.12  ? 60  ASP C O      1 
ATOM   5734 C  CB     . ASP C 1 60  ? 22.837  53.352  0.233   1.00 27.68  ? 60  ASP C CB     1 
ATOM   5735 C  CG     . ASP C 1 60  ? 21.619  53.892  -0.493  1.00 42.76  ? 60  ASP C CG     1 
ATOM   5736 O  OD1    . ASP C 1 60  ? 20.575  53.204  -0.486  1.00 33.90  ? 60  ASP C OD1    1 
ATOM   5737 O  OD2    . ASP C 1 60  ? 21.698  55.002  -1.064  1.00 39.67  ? 60  ASP C OD2    1 
ATOM   5738 H  H      . ASP C 1 60  ? 21.587  53.118  2.335   1.00 51.77  ? 60  ASP C H      1 
ATOM   5739 H  HA     . ASP C 1 60  ? 22.124  51.440  0.344   1.00 52.11  ? 60  ASP C HA     1 
ATOM   5740 H  HB2    . ASP C 1 60  ? 23.128  54.022  0.871   1.00 33.43  ? 60  ASP C HB2    1 
ATOM   5741 H  HB3    . ASP C 1 60  ? 23.533  53.194  -0.423  1.00 33.43  ? 60  ASP C HB3    1 
ATOM   5742 N  N      . ASP C 1 61  ? 24.309  51.758  2.646   1.00 29.58  ? 61  ASP C N      1 
ATOM   5743 C  CA     . ASP C 1 61  ? 25.537  51.165  3.162   1.00 27.93  ? 61  ASP C CA     1 
ATOM   5744 C  C      . ASP C 1 61  ? 25.364  49.667  3.388   1.00 40.24  ? 61  ASP C C      1 
ATOM   5745 O  O      . ASP C 1 61  ? 26.125  48.850  2.852   1.00 47.24  ? 61  ASP C O      1 
ATOM   5746 C  CB     . ASP C 1 61  ? 25.940  51.858  4.467   1.00 38.95  ? 61  ASP C CB     1 
ATOM   5747 C  CG     . ASP C 1 61  ? 26.139  53.353  4.299   1.00 51.98  ? 61  ASP C CG     1 
ATOM   5748 O  OD1    . ASP C 1 61  ? 25.301  53.999  3.631   1.00 56.00  ? 61  ASP C OD1    1 
ATOM   5749 O  OD2    . ASP C 1 61  ? 27.145  53.878  4.821   1.00 48.62  ? 61  ASP C OD2    1 
ATOM   5750 H  H      . ASP C 1 61  ? 23.942  52.332  3.171   1.00 35.71  ? 61  ASP C H      1 
ATOM   5751 H  HA     . ASP C 1 61  ? 26.246  51.298  2.513   1.00 33.73  ? 61  ASP C HA     1 
ATOM   5752 H  HB2    . ASP C 1 61  ? 25.242  51.720  5.127   1.00 46.96  ? 61  ASP C HB2    1 
ATOM   5753 H  HB3    . ASP C 1 61  ? 26.775  51.477  4.783   1.00 46.96  ? 61  ASP C HB3    1 
ATOM   5754 N  N      . ASP C 1 62  ? 24.358  49.288  4.182   1.00 39.27  ? 62  ASP C N      1 
ATOM   5755 C  CA     . ASP C 1 62  ? 24.097  47.874  4.428   1.00 30.10  ? 62  ASP C CA     1 
ATOM   5756 C  C      . ASP C 1 62  ? 23.764  47.144  3.134   1.00 28.87  ? 62  ASP C C      1 
ATOM   5757 O  O      . ASP C 1 62  ? 24.195  46.004  2.928   1.00 26.74  ? 62  ASP C O      1 
ATOM   5758 C  CB     . ASP C 1 62  ? 22.959  47.717  5.439   1.00 36.78  ? 62  ASP C CB     1 
ATOM   5759 C  CG     . ASP C 1 62  ? 23.280  48.338  6.786   1.00 39.71  ? 62  ASP C CG     1 
ATOM   5760 O  OD1    . ASP C 1 62  ? 24.423  48.805  6.971   1.00 60.65  ? 62  ASP C OD1    1 
ATOM   5761 O  OD2    . ASP C 1 62  ? 22.382  48.370  7.654   1.00 47.69  ? 62  ASP C OD2    1 
ATOM   5762 H  H      . ASP C 1 62  ? 23.820  49.823  4.586   1.00 47.34  ? 62  ASP C H      1 
ATOM   5763 H  HA     . ASP C 1 62  ? 24.893  47.470  4.807   1.00 36.33  ? 62  ASP C HA     1 
ATOM   5764 H  HB2    . ASP C 1 62  ? 22.164  48.150  5.090   1.00 44.35  ? 62  ASP C HB2    1 
ATOM   5765 H  HB3    . ASP C 1 62  ? 22.787  46.772  5.577   1.00 44.35  ? 62  ASP C HB3    1 
ATOM   5766 N  N      . GLY C 1 63  ? 22.988  47.779  2.255   1.00 34.00  ? 63  GLY C N      1 
ATOM   5767 C  CA     . GLY C 1 63  ? 22.659  47.150  0.986   1.00 25.07  ? 63  GLY C CA     1 
ATOM   5768 C  C      . GLY C 1 63  ? 23.891  46.820  0.166   1.00 35.50  ? 63  GLY C C      1 
ATOM   5769 O  O      . GLY C 1 63  ? 24.040  45.700  -0.330  1.00 40.32  ? 63  GLY C O      1 
ATOM   5770 H  H      . GLY C 1 63  ? 22.645  48.560  2.368   1.00 41.01  ? 63  GLY C H      1 
ATOM   5771 H  HA2    . GLY C 1 63  ? 22.173  46.328  1.152   1.00 30.30  ? 63  GLY C HA2    1 
ATOM   5772 H  HA3    . GLY C 1 63  ? 22.099  47.749  0.468   1.00 30.30  ? 63  GLY C HA3    1 
ATOM   5773 N  N      . MET C 1 64  ? 24.799  47.790  0.020   1.00 49.06  ? 64  MET C N      1 
ATOM   5774 C  CA     . MET C 1 64  ? 26.014  47.560  -0.755  1.00 39.98  ? 64  MET C CA     1 
ATOM   5775 C  C      . MET C 1 64  ? 26.896  46.510  -0.088  1.00 35.54  ? 64  MET C C      1 
ATOM   5776 O  O      . MET C 1 64  ? 27.527  45.695  -0.772  1.00 37.29  ? 64  MET C O      1 
ATOM   5777 C  CB     . MET C 1 64  ? 26.797  48.861  -0.928  1.00 54.57  ? 64  MET C CB     1 
ATOM   5778 C  CG     . MET C 1 64  ? 27.906  48.775  -1.977  1.00 67.80  ? 64  MET C CG     1 
ATOM   5779 S  SD     . MET C 1 64  ? 28.100  50.220  -3.052  1.00 101.41 ? 64  MET C SD     1 
ATOM   5780 C  CE     . MET C 1 64  ? 26.475  50.441  -3.770  1.00 72.52  ? 64  MET C CE     1 
ATOM   5781 H  H      . MET C 1 64  ? 24.735  48.580  0.354   1.00 59.08  ? 64  MET C H      1 
ATOM   5782 H  HA     . MET C 1 64  ? 25.754  47.251  -1.637  1.00 48.19  ? 64  MET C HA     1 
ATOM   5783 H  HB2    . MET C 1 64  ? 26.183  49.560  -1.202  1.00 65.69  ? 64  MET C HB2    1 
ATOM   5784 H  HB3    . MET C 1 64  ? 27.208  49.093  -0.080  1.00 65.69  ? 64  MET C HB3    1 
ATOM   5785 H  HG2    . MET C 1 64  ? 28.750  48.647  -1.516  1.00 81.58  ? 64  MET C HG2    1 
ATOM   5786 H  HG3    . MET C 1 64  ? 27.723  48.015  -2.551  1.00 81.58  ? 64  MET C HG3    1 
ATOM   5787 H  HE1    . MET C 1 64  ? 26.523  51.125  -4.456  1.00 87.24  ? 64  MET C HE1    1 
ATOM   5788 H  HE2    . MET C 1 64  ? 26.185  49.601  -4.160  1.00 87.24  ? 64  MET C HE2    1 
ATOM   5789 H  HE3    . MET C 1 64  ? 25.857  50.713  -3.074  1.00 87.24  ? 64  MET C HE3    1 
ATOM   5790 N  N      . LEU C 1 65  ? 26.974  46.527  1.245   1.00 27.76  ? 65  LEU C N      1 
ATOM   5791 C  CA     . LEU C 1 65  ? 27.772  45.529  1.951   1.00 20.74  ? 65  LEU C CA     1 
ATOM   5792 C  C      . LEU C 1 65  ? 27.234  44.124  1.700   1.00 35.37  ? 65  LEU C C      1 
ATOM   5793 O  O      . LEU C 1 65  ? 27.992  43.198  1.375   1.00 38.80  ? 65  LEU C O      1 
ATOM   5794 C  CB     . LEU C 1 65  ? 27.787  45.847  3.447   1.00 22.75  ? 65  LEU C CB     1 
ATOM   5795 C  CG     . LEU C 1 65  ? 28.633  44.957  4.360   1.00 38.05  ? 65  LEU C CG     1 
ATOM   5796 C  CD1    . LEU C 1 65  ? 29.073  45.725  5.597   1.00 29.80  ? 65  LEU C CD1    1 
ATOM   5797 C  CD2    . LEU C 1 65  ? 27.866  43.707  4.773   1.00 30.18  ? 65  LEU C CD2    1 
ATOM   5798 H  H      . LEU C 1 65  ? 26.580  47.096  1.755   1.00 33.52  ? 65  LEU C H      1 
ATOM   5799 H  HA     . LEU C 1 65  ? 28.686  45.561  1.625   1.00 25.11  ? 65  LEU C HA     1 
ATOM   5800 H  HB2    . LEU C 1 65  ? 28.119  46.752  3.553   1.00 27.51  ? 65  LEU C HB2    1 
ATOM   5801 H  HB3    . LEU C 1 65  ? 26.873  45.790  3.769   1.00 27.51  ? 65  LEU C HB3    1 
ATOM   5802 H  HG     . LEU C 1 65  ? 29.422  44.680  3.869   1.00 45.88  ? 65  LEU C HG     1 
ATOM   5803 H  HD11   . LEU C 1 65  ? 29.588  45.135  6.169   1.00 35.98  ? 65  LEU C HD11   1 
ATOM   5804 H  HD12   . LEU C 1 65  ? 29.619  46.479  5.323   1.00 35.98  ? 65  LEU C HD12   1 
ATOM   5805 H  HD13   . LEU C 1 65  ? 28.287  46.041  6.070   1.00 35.98  ? 65  LEU C HD13   1 
ATOM   5806 H  HD21   . LEU C 1 65  ? 28.295  43.315  5.550   1.00 36.43  ? 65  LEU C HD21   1 
ATOM   5807 H  HD22   . LEU C 1 65  ? 26.953  43.953  4.989   1.00 36.43  ? 65  LEU C HD22   1 
ATOM   5808 H  HD23   . LEU C 1 65  ? 27.873  43.075  4.038   1.00 36.43  ? 65  LEU C HD23   1 
ATOM   5809 N  N      . ILE C 1 66  ? 25.921  43.946  1.851   1.00 35.40  ? 66  ILE C N      1 
ATOM   5810 C  CA     . ILE C 1 66  ? 25.315  42.640  1.611   1.00 31.65  ? 66  ILE C CA     1 
ATOM   5811 C  C      . ILE C 1 66  ? 25.513  42.233  0.159   1.00 33.97  ? 66  ILE C C      1 
ATOM   5812 O  O      . ILE C 1 66  ? 25.709  41.052  -0.147  1.00 29.79  ? 66  ILE C O      1 
ATOM   5813 C  CB     . ILE C 1 66  ? 23.825  42.662  1.994   1.00 22.61  ? 66  ILE C CB     1 
ATOM   5814 C  CG1    . ILE C 1 66  ? 23.661  42.987  3.477   1.00 27.68  ? 66  ILE C CG1    1 
ATOM   5815 C  CG2    . ILE C 1 66  ? 23.181  41.320  1.692   1.00 24.49  ? 66  ILE C CG2    1 
ATOM   5816 C  CD1    . ILE C 1 66  ? 22.238  43.312  3.868   1.00 29.89  ? 66  ILE C CD1    1 
ATOM   5817 H  H      . ILE C 1 66  ? 25.364  44.557  2.087   1.00 42.70  ? 66  ILE C H      1 
ATOM   5818 H  HA     . ILE C 1 66  ? 25.757  41.985  2.174   1.00 38.20  ? 66  ILE C HA     1 
ATOM   5819 H  HB     . ILE C 1 66  ? 23.389  43.351  1.468   1.00 27.34  ? 66  ILE C HB     1 
ATOM   5820 H  HG12   . ILE C 1 66  ? 23.945  42.220  3.998   1.00 33.44  ? 66  ILE C HG12   1 
ATOM   5821 H  HG13   . ILE C 1 66  ? 24.211  43.757  3.691   1.00 33.44  ? 66  ILE C HG13   1 
ATOM   5822 H  HG21   . ILE C 1 66  ? 22.297  41.298  2.091   1.00 29.61  ? 66  ILE C HG21   1 
ATOM   5823 H  HG22   . ILE C 1 66  ? 23.114  41.211  0.731   1.00 29.61  ? 66  ILE C HG22   1 
ATOM   5824 H  HG23   . ILE C 1 66  ? 23.731  40.615  2.067   1.00 29.61  ? 66  ILE C HG23   1 
ATOM   5825 H  HD11   . ILE C 1 66  ? 22.240  43.742  4.737   1.00 36.09  ? 66  ILE C HD11   1 
ATOM   5826 H  HD12   . ILE C 1 66  ? 21.856  43.908  3.205   1.00 36.09  ? 66  ILE C HD12   1 
ATOM   5827 H  HD13   . ILE C 1 66  ? 21.726  42.489  3.908   1.00 36.09  ? 66  ILE C HD13   1 
ATOM   5828 N  N      . SER C 1 67  ? 25.454  43.201  -0.760  1.00 35.45  ? 67  SER C N      1 
ATOM   5829 C  CA     . SER C 1 67  ? 25.665  42.898  -2.171  1.00 29.12  ? 67  SER C CA     1 
ATOM   5830 C  C      . SER C 1 67  ? 27.082  42.396  -2.415  1.00 33.64  ? 67  SER C C      1 
ATOM   5831 O  O      . SER C 1 67  ? 27.285  41.418  -3.141  1.00 27.77  ? 67  SER C O      1 
ATOM   5832 C  CB     . SER C 1 67  ? 25.370  44.135  -3.016  1.00 26.15  ? 67  SER C CB     1 
ATOM   5833 O  OG     . SER C 1 67  ? 23.995  44.469  -2.944  1.00 29.61  ? 67  SER C OG     1 
ATOM   5834 H  H      . SER C 1 67  ? 25.295  44.030  -0.594  1.00 42.76  ? 67  SER C H      1 
ATOM   5835 H  HA     . SER C 1 67  ? 25.051  42.197  -2.443  1.00 35.16  ? 67  SER C HA     1 
ATOM   5836 H  HB2    . SER C 1 67  ? 25.895  44.879  -2.682  1.00 31.60  ? 67  SER C HB2    1 
ATOM   5837 H  HB3    . SER C 1 67  ? 25.604  43.951  -3.939  1.00 31.60  ? 67  SER C HB3    1 
ATOM   5838 H  HG     . SER C 1 67  ? 23.782  44.641  -2.150  1.00 35.74  ? 67  SER C HG     1 
ATOM   5839 N  N      . GLN C 1 68  ? 28.075  43.059  -1.826  1.00 31.61  ? 68  GLN C N      1 
ATOM   5840 C  CA     . GLN C 1 68  ? 29.450  42.582  -1.938  1.00 31.91  ? 68  GLN C CA     1 
ATOM   5841 C  C      . GLN C 1 68  ? 29.582  41.165  -1.390  1.00 40.84  ? 68  GLN C C      1 
ATOM   5842 O  O      . GLN C 1 68  ? 30.216  40.302  -2.009  1.00 53.31  ? 68  GLN C O      1 
ATOM   5843 C  CB     . GLN C 1 68  ? 30.404  43.530  -1.214  1.00 33.76  ? 68  GLN C CB     1 
ATOM   5844 C  CG     . GLN C 1 68  ? 30.539  44.891  -1.869  1.00 36.65  ? 68  GLN C CG     1 
ATOM   5845 C  CD     . GLN C 1 68  ? 31.472  45.808  -1.108  1.00 43.69  ? 68  GLN C CD     1 
ATOM   5846 O  OE1    . GLN C 1 68  ? 31.065  46.853  -0.602  1.00 67.35  ? 68  GLN C OE1    1 
ATOM   5847 N  NE2    . GLN C 1 68  ? 32.739  45.420  -1.030  1.00 54.54  ? 68  GLN C NE2    1 
ATOM   5848 H  H      . GLN C 1 68  ? 27.984  43.777  -1.361  1.00 38.15  ? 68  GLN C H      1 
ATOM   5849 H  HA     . GLN C 1 68  ? 29.697  42.571  -2.876  1.00 38.51  ? 68  GLN C HA     1 
ATOM   5850 H  HB2    . GLN C 1 68  ? 30.079  43.668  -0.311  1.00 40.72  ? 68  GLN C HB2    1 
ATOM   5851 H  HB3    . GLN C 1 68  ? 31.286  43.126  -1.191  1.00 40.72  ? 68  GLN C HB3    1 
ATOM   5852 H  HG2    . GLN C 1 68  ? 30.891  44.779  -2.766  1.00 44.20  ? 68  GLN C HG2    1 
ATOM   5853 H  HG3    . GLN C 1 68  ? 29.666  45.313  -1.907  1.00 44.20  ? 68  GLN C HG3    1 
ATOM   5854 H  HE21   . GLN C 1 68  ? 32.987  44.685  -1.401  1.00 65.66  ? 68  GLN C HE21   1 
ATOM   5855 H  HE22   . GLN C 1 68  ? 33.312  45.904  -0.609  1.00 65.66  ? 68  GLN C HE22   1 
ATOM   5856 N  N      . VAL C 1 69  ? 28.995  40.909  -0.219  1.00 40.93  ? 69  VAL C N      1 
ATOM   5857 C  CA     . VAL C 1 69  ? 29.087  39.579  0.383   1.00 38.62  ? 69  VAL C CA     1 
ATOM   5858 C  C      . VAL C 1 69  ? 28.480  38.531  -0.545  1.00 43.14  ? 69  VAL C C      1 
ATOM   5859 O  O      . VAL C 1 69  ? 29.092  37.493  -0.836  1.00 47.07  ? 69  VAL C O      1 
ATOM   5860 C  CB     . VAL C 1 69  ? 28.396  39.565  1.758   1.00 37.86  ? 69  VAL C CB     1 
ATOM   5861 C  CG1    . VAL C 1 69  ? 28.288  38.144  2.275   1.00 39.31  ? 69  VAL C CG1    1 
ATOM   5862 C  CG2    . VAL C 1 69  ? 29.148  40.437  2.745   1.00 39.89  ? 69  VAL C CG2    1 
ATOM   5863 H  H      . VAL C 1 69  ? 28.544  41.478  0.242   1.00 49.34  ? 69  VAL C H      1 
ATOM   5864 H  HA     . VAL C 1 69  ? 30.025  39.365  0.509   1.00 46.56  ? 69  VAL C HA     1 
ATOM   5865 H  HB     . VAL C 1 69  ? 27.500  39.926  1.664   1.00 45.64  ? 69  VAL C HB     1 
ATOM   5866 H  HG11   . VAL C 1 69  ? 28.143  38.167  3.234   1.00 47.39  ? 69  VAL C HG11   1 
ATOM   5867 H  HG12   . VAL C 1 69  ? 27.541  37.705  1.839   1.00 47.39  ? 69  VAL C HG12   1 
ATOM   5868 H  HG13   . VAL C 1 69  ? 29.112  37.672  2.076   1.00 47.39  ? 69  VAL C HG13   1 
ATOM   5869 H  HG21   . VAL C 1 69  ? 28.782  40.298  3.632   1.00 48.09  ? 69  VAL C HG21   1 
ATOM   5870 H  HG22   . VAL C 1 69  ? 30.086  40.192  2.732   1.00 48.09  ? 69  VAL C HG22   1 
ATOM   5871 H  HG23   . VAL C 1 69  ? 29.046  41.367  2.487   1.00 48.09  ? 69  VAL C HG23   1 
ATOM   5872 N  N      . VAL C 1 70  ? 27.253  38.781  -1.008  1.00 46.16  ? 70  VAL C N      1 
ATOM   5873 C  CA     . VAL C 1 70  ? 26.545  37.816  -1.842  1.00 42.50  ? 70  VAL C CA     1 
ATOM   5874 C  C      . VAL C 1 70  ? 27.279  37.614  -3.159  1.00 39.51  ? 70  VAL C C      1 
ATOM   5875 O  O      . VAL C 1 70  ? 27.318  36.503  -3.698  1.00 33.77  ? 70  VAL C O      1 
ATOM   5876 C  CB     . VAL C 1 70  ? 25.091  38.272  -2.064  1.00 34.63  ? 70  VAL C CB     1 
ATOM   5877 C  CG1    . VAL C 1 70  ? 24.394  37.370  -3.074  1.00 41.29  ? 70  VAL C CG1    1 
ATOM   5878 C  CG2    . VAL C 1 70  ? 24.340  38.281  -0.748  1.00 41.86  ? 70  VAL C CG2    1 
ATOM   5879 H  H      . VAL C 1 70  ? 26.809  39.501  -0.853  1.00 55.61  ? 70  VAL C H      1 
ATOM   5880 H  HA     . VAL C 1 70  ? 26.525  36.964  -1.380  1.00 51.21  ? 70  VAL C HA     1 
ATOM   5881 H  HB     . VAL C 1 70  ? 25.095  39.173  -2.422  1.00 41.78  ? 70  VAL C HB     1 
ATOM   5882 H  HG11   . VAL C 1 70  ? 23.436  37.515  -3.018  1.00 49.76  ? 70  VAL C HG11   1 
ATOM   5883 H  HG12   . VAL C 1 70  ? 24.709  37.591  -3.965  1.00 49.76  ? 70  VAL C HG12   1 
ATOM   5884 H  HG13   . VAL C 1 70  ? 24.601  36.446  -2.869  1.00 49.76  ? 70  VAL C HG13   1 
ATOM   5885 H  HG21   . VAL C 1 70  ? 23.460  38.665  -0.889  1.00 50.45  ? 70  VAL C HG21   1 
ATOM   5886 H  HG22   . VAL C 1 70  ? 24.255  37.370  -0.426  1.00 50.45  ? 70  VAL C HG22   1 
ATOM   5887 H  HG23   . VAL C 1 70  ? 24.834  38.814  -0.106  1.00 50.45  ? 70  VAL C HG23   1 
ATOM   5888 N  N      . ASP C 1 71  ? 27.863  38.681  -3.707  1.00 48.70  ? 71  ASP C N      1 
ATOM   5889 C  CA     . ASP C 1 71  ? 28.591  38.557  -4.963  1.00 45.70  ? 71  ASP C CA     1 
ATOM   5890 C  C      . ASP C 1 71  ? 29.854  37.731  -4.778  1.00 35.67  ? 71  ASP C C      1 
ATOM   5891 O  O      . ASP C 1 71  ? 30.183  36.894  -5.624  1.00 48.20  ? 71  ASP C O      1 
ATOM   5892 C  CB     . ASP C 1 71  ? 28.934  39.943  -5.507  1.00 41.76  ? 71  ASP C CB     1 
ATOM   5893 C  CG     . ASP C 1 71  ? 29.581  39.887  -6.871  1.00 63.23  ? 71  ASP C CG     1 
ATOM   5894 O  OD1    . ASP C 1 71  ? 28.848  39.689  -7.863  1.00 86.23  ? 71  ASP C OD1    1 
ATOM   5895 O  OD2    . ASP C 1 71  ? 30.819  40.029  -6.952  1.00 61.87  ? 71  ASP C OD2    1 
ATOM   5896 H  H      . ASP C 1 71  ? 27.853  39.475  -3.377  1.00 58.65  ? 71  ASP C H      1 
ATOM   5897 H  HA     . ASP C 1 71  ? 28.026  38.110  -5.613  1.00 55.05  ? 71  ASP C HA     1 
ATOM   5898 H  HB2    . ASP C 1 71  ? 28.119  40.464  -5.582  1.00 50.32  ? 71  ASP C HB2    1 
ATOM   5899 H  HB3    . ASP C 1 71  ? 29.551  40.378  -4.899  1.00 50.32  ? 71  ASP C HB3    1 
ATOM   5900 N  N      . SER C 1 72  ? 30.570  37.942  -3.670  1.00 39.54  ? 72  SER C N      1 
ATOM   5901 C  CA     . SER C 1 72  ? 31.779  37.170  -3.413  1.00 40.82  ? 72  SER C CA     1 
ATOM   5902 C  C      . SER C 1 72  ? 31.469  35.707  -3.128  1.00 40.88  ? 72  SER C C      1 
ATOM   5903 O  O      . SER C 1 72  ? 32.309  34.839  -3.386  1.00 60.27  ? 72  SER C O      1 
ATOM   5904 C  CB     . SER C 1 72  ? 32.546  37.774  -2.239  1.00 45.94  ? 72  SER C CB     1 
ATOM   5905 O  OG     . SER C 1 72  ? 31.910  37.467  -1.012  1.00 48.29  ? 72  SER C OG     1 
ATOM   5906 H  H      . SER C 1 72  ? 30.379  38.519  -3.061  1.00 47.67  ? 72  SER C H      1 
ATOM   5907 H  HA     . SER C 1 72  ? 32.341  37.212  -4.203  1.00 49.20  ? 72  SER C HA     1 
ATOM   5908 H  HB2    . SER C 1 72  ? 33.445  37.410  -2.229  1.00 55.34  ? 72  SER C HB2    1 
ATOM   5909 H  HB3    . SER C 1 72  ? 32.580  38.738  -2.345  1.00 55.34  ? 72  SER C HB3    1 
ATOM   5910 H  HG     . SER C 1 72  ? 31.140  37.804  -0.995  1.00 58.17  ? 72  SER C HG     1 
ATOM   5911 N  N      . VAL C 1 73  ? 30.290  35.413  -2.584  1.00 49.62  ? 73  VAL C N      1 
ATOM   5912 C  CA     . VAL C 1 73  ? 29.972  34.034  -2.226  1.00 43.17  ? 73  VAL C CA     1 
ATOM   5913 C  C      . VAL C 1 73  ? 29.273  33.268  -3.349  1.00 37.69  ? 73  VAL C C      1 
ATOM   5914 O  O      . VAL C 1 73  ? 29.435  32.048  -3.454  1.00 47.41  ? 73  VAL C O      1 
ATOM   5915 C  CB     . VAL C 1 73  ? 29.130  34.007  -0.940  1.00 36.58  ? 73  VAL C CB     1 
ATOM   5916 C  CG1    . VAL C 1 73  ? 28.668  32.594  -0.642  1.00 41.18  ? 73  VAL C CG1    1 
ATOM   5917 C  CG2    . VAL C 1 73  ? 29.936  34.555  0.230   1.00 48.97  ? 73  VAL C CG2    1 
ATOM   5918 H  H      . VAL C 1 73  ? 29.668  35.982  -2.415  1.00 59.75  ? 73  VAL C H      1 
ATOM   5919 H  HA     . VAL C 1 73  ? 30.808  33.572  -2.058  1.00 52.02  ? 73  VAL C HA     1 
ATOM   5920 H  HB     . VAL C 1 73  ? 28.347  34.566  -1.064  1.00 44.12  ? 73  VAL C HB     1 
ATOM   5921 H  HG11   . VAL C 1 73  ? 28.421  32.534  0.294   1.00 49.64  ? 73  VAL C HG11   1 
ATOM   5922 H  HG12   . VAL C 1 73  ? 27.903  32.388  -1.201  1.00 49.64  ? 73  VAL C HG12   1 
ATOM   5923 H  HG13   . VAL C 1 73  ? 29.393  31.978  -0.833  1.00 49.64  ? 73  VAL C HG13   1 
ATOM   5924 H  HG21   . VAL C 1 73  ? 29.389  34.527  1.030   1.00 58.97  ? 73  VAL C HG21   1 
ATOM   5925 H  HG22   . VAL C 1 73  ? 30.728  34.008  0.351   1.00 58.97  ? 73  VAL C HG22   1 
ATOM   5926 H  HG23   . VAL C 1 73  ? 30.192  35.470  0.035   1.00 58.97  ? 73  VAL C HG23   1 
ATOM   5927 N  N      . MET C 1 74  ? 28.495  33.946  -4.189  1.00 50.17  ? 74  MET C N      1 
ATOM   5928 C  CA     . MET C 1 74  ? 27.601  33.290  -5.134  1.00 52.23  ? 74  MET C CA     1 
ATOM   5929 C  C      . MET C 1 74  ? 28.068  33.386  -6.578  1.00 59.48  ? 74  MET C C      1 
ATOM   5930 O  O      . MET C 1 74  ? 27.380  32.879  -7.471  1.00 54.38  ? 74  MET C O      1 
ATOM   5931 C  CB     . MET C 1 74  ? 26.192  33.883  -5.015  1.00 40.75  ? 74  MET C CB     1 
ATOM   5932 C  CG     . MET C 1 74  ? 25.591  33.745  -3.632  1.00 34.91  ? 74  MET C CG     1 
ATOM   5933 S  SD     . MET C 1 74  ? 25.277  32.030  -3.166  1.00 39.52  ? 74  MET C SD     1 
ATOM   5934 C  CE     . MET C 1 74  ? 24.030  31.570  -4.370  1.00 36.17  ? 74  MET C CE     1 
ATOM   5935 H  H      . MET C 1 74  ? 28.469  34.805  -4.229  1.00 60.42  ? 74  MET C H      1 
ATOM   5936 H  HA     . MET C 1 74  ? 27.555  32.350  -4.897  1.00 62.89  ? 74  MET C HA     1 
ATOM   5937 H  HB2    . MET C 1 74  ? 26.232  34.828  -5.228  1.00 49.12  ? 74  MET C HB2    1 
ATOM   5938 H  HB3    . MET C 1 74  ? 25.607  33.426  -5.640  1.00 49.12  ? 74  MET C HB3    1 
ATOM   5939 H  HG2    . MET C 1 74  ? 26.205  34.123  -2.983  1.00 42.11  ? 74  MET C HG2    1 
ATOM   5940 H  HG3    . MET C 1 74  ? 24.747  34.221  -3.606  1.00 42.11  ? 74  MET C HG3    1 
ATOM   5941 H  HE1    . MET C 1 74  ? 23.776  30.645  -4.224  1.00 43.62  ? 74  MET C HE1    1 
ATOM   5942 H  HE2    . MET C 1 74  ? 23.257  32.146  -4.260  1.00 43.62  ? 74  MET C HE2    1 
ATOM   5943 H  HE3    . MET C 1 74  ? 24.397  31.675  -5.261  1.00 43.62  ? 74  MET C HE3    1 
ATOM   5944 N  N      . TYR C 1 75  ? 29.213  34.020  -6.832  1.00 64.61  ? 75  TYR C N      1 
ATOM   5945 C  CA     . TYR C 1 75  ? 29.728  34.161  -8.189  1.00 69.43  ? 75  TYR C CA     1 
ATOM   5946 C  C      . TYR C 1 75  ? 30.065  32.808  -8.803  1.00 56.42  ? 75  TYR C C      1 
ATOM   5947 O  O      . TYR C 1 75  ? 30.298  32.733  -10.014 1.00 54.11  ? 75  TYR C O      1 
ATOM   5948 C  CB     . TYR C 1 75  ? 30.957  35.082  -8.165  1.00 60.61  ? 75  TYR C CB     1 
ATOM   5949 C  CG     . TYR C 1 75  ? 32.204  34.399  -7.662  1.00 59.63  ? 75  TYR C CG     1 
ATOM   5950 C  CD1    . TYR C 1 75  ? 32.293  33.962  -6.349  1.00 64.67  ? 75  TYR C CD1    1 
ATOM   5951 C  CD2    . TYR C 1 75  ? 33.320  34.257  -8.476  1.00 70.33  ? 75  TYR C CD2    1 
ATOM   5952 C  CE1    . TYR C 1 75  ? 33.426  33.340  -5.879  1.00 69.02  ? 75  TYR C CE1    1 
ATOM   5953 C  CE2    . TYR C 1 75  ? 34.469  33.645  -8.009  1.00 66.60  ? 75  TYR C CE2    1 
ATOM   5954 C  CZ     . TYR C 1 75  ? 34.513  33.191  -6.707  1.00 71.66  ? 75  TYR C CZ     1 
ATOM   5955 O  OH     . TYR C 1 75  ? 35.638  32.580  -6.222  1.00 77.71  ? 75  TYR C OH     1 
ATOM   5956 H  H      . TYR C 1 75  ? 29.714  34.379  -6.232  1.00 77.75  ? 75  TYR C H      1 
ATOM   5957 H  HA     . TYR C 1 75  ? 29.067  34.580  -8.762  1.00 83.53  ? 75  TYR C HA     1 
ATOM   5958 H  HB2    . TYR C 1 75  ? 31.132  35.395  -9.066  1.00 72.94  ? 75  TYR C HB2    1 
ATOM   5959 H  HB3    . TYR C 1 75  ? 30.774  35.835  -7.582  1.00 72.94  ? 75  TYR C HB3    1 
ATOM   5960 H  HD1    . TYR C 1 75  ? 31.572  34.093  -5.776  1.00 77.82  ? 75  TYR C HD1    1 
ATOM   5961 H  HD2    . TYR C 1 75  ? 33.294  34.577  -9.349  1.00 84.61  ? 75  TYR C HD2    1 
ATOM   5962 H  HE1    . TYR C 1 75  ? 33.457  33.021  -5.006  1.00 83.04  ? 75  TYR C HE1    1 
ATOM   5963 H  HE2    . TYR C 1 75  ? 35.205  33.540  -8.567  1.00 80.13  ? 75  TYR C HE2    1 
ATOM   5964 H  HH     . TYR C 1 75  ? 35.525  32.364  -5.418  1.00 93.47  ? 75  TYR C HH     1 
ATOM   5965 N  N      . ILE C 1 76  ? 30.093  31.745  -7.996  1.00 60.14  ? 76  ILE C N      1 
ATOM   5966 C  CA     . ILE C 1 76  ? 30.483  30.427  -8.482  1.00 62.87  ? 76  ILE C CA     1 
ATOM   5967 C  C      . ILE C 1 76  ? 29.336  29.747  -9.217  1.00 79.68  ? 76  ILE C C      1 
ATOM   5968 O  O      . ILE C 1 76  ? 29.485  29.318  -10.367 1.00 86.07  ? 76  ILE C O      1 
ATOM   5969 C  CB     . ILE C 1 76  ? 30.932  29.555  -7.296  1.00 63.41  ? 76  ILE C CB     1 
ATOM   5970 C  CG1    . ILE C 1 76  ? 32.241  30.049  -6.692  1.00 70.57  ? 76  ILE C CG1    1 
ATOM   5971 C  CG2    . ILE C 1 76  ? 31.009  28.099  -7.725  1.00 78.89  ? 76  ILE C CG2    1 
ATOM   5972 C  CD1    . ILE C 1 76  ? 32.385  29.636  -5.248  1.00 78.72  ? 76  ILE C CD1    1 
ATOM   5973 H  H      . ILE C 1 76  ? 29.890  31.761  -7.160  1.00 72.38  ? 76  ILE C H      1 
ATOM   5974 H  HA     . ILE C 1 76  ? 31.218  30.543  -9.105  1.00 75.65  ? 76  ILE C HA     1 
ATOM   5975 H  HB     . ILE C 1 76  ? 30.268  29.629  -6.593  1.00 76.31  ? 76  ILE C HB     1 
ATOM   5976 H  HG12   . ILE C 1 76  ? 32.984  29.676  -7.191  1.00 84.90  ? 76  ILE C HG12   1 
ATOM   5977 H  HG13   . ILE C 1 76  ? 32.267  31.018  -6.734  1.00 84.90  ? 76  ILE C HG13   1 
ATOM   5978 H  HG21   . ILE C 1 76  ? 31.588  27.619  -7.113  1.00 94.89  ? 76  ILE C HG21   1 
ATOM   5979 H  HG22   . ILE C 1 76  ? 30.118  27.717  -7.706  1.00 94.89  ? 76  ILE C HG22   1 
ATOM   5980 H  HG23   . ILE C 1 76  ? 31.369  28.054  -8.625  1.00 94.89  ? 76  ILE C HG23   1 
ATOM   5981 H  HD11   . ILE C 1 76  ? 33.303  29.366  -5.087  1.00 94.68  ? 76  ILE C HD11   1 
ATOM   5982 H  HD12   . ILE C 1 76  ? 32.157  30.388  -4.680  1.00 94.68  ? 76  ILE C HD12   1 
ATOM   5983 H  HD13   . ILE C 1 76  ? 31.786  28.894  -5.071  1.00 94.68  ? 76  ILE C HD13   1 
ATOM   5984 N  N      . ASP C 1 77  ? 28.174  29.657  -8.575  1.00 62.60  ? 77  ASP C N      1 
ATOM   5985 C  CA     . ASP C 1 77  ? 27.015  28.947  -9.115  1.00 54.90  ? 77  ASP C CA     1 
ATOM   5986 C  C      . ASP C 1 77  ? 26.017  29.996  -9.591  1.00 52.04  ? 77  ASP C C      1 
ATOM   5987 O  O      . ASP C 1 77  ? 25.181  30.473  -8.823  1.00 58.16  ? 77  ASP C O      1 
ATOM   5988 C  CB     . ASP C 1 77  ? 26.400  28.014  -8.075  1.00 43.45  ? 77  ASP C CB     1 
ATOM   5989 C  CG     . ASP C 1 77  ? 25.394  27.041  -8.679  1.00 70.47  ? 77  ASP C CG     1 
ATOM   5990 O  OD1    . ASP C 1 77  ? 24.761  27.388  -9.700  1.00 71.03  ? 77  ASP C OD1    1 
ATOM   5991 O  OD2    . ASP C 1 77  ? 25.224  25.935  -8.121  1.00 55.01  ? 77  ASP C OD2    1 
ATOM   5992 H  H      . ASP C 1 77  ? 28.030  30.010  -7.804  1.00 75.33  ? 77  ASP C H      1 
ATOM   5993 H  HA     . ASP C 1 77  ? 27.293  28.411  -9.874  1.00 66.10  ? 77  ASP C HA     1 
ATOM   5994 H  HB2    . ASP C 1 77  ? 27.106  27.496  -7.659  1.00 52.36  ? 77  ASP C HB2    1 
ATOM   5995 H  HB3    . ASP C 1 77  ? 25.940  28.545  -7.407  1.00 52.36  ? 77  ASP C HB3    1 
ATOM   5996 N  N      . LYS C 1 78  ? 26.106  30.349  -10.874 1.00 51.66  ? 78  LYS C N      1 
ATOM   5997 C  CA     . LYS C 1 78  ? 25.247  31.401  -11.399 1.00 51.19  ? 78  LYS C CA     1 
ATOM   5998 C  C      . LYS C 1 78  ? 23.781  31.003  -11.314 1.00 43.36  ? 78  LYS C C      1 
ATOM   5999 O  O      . LYS C 1 78  ? 22.907  31.868  -11.193 1.00 33.87  ? 78  LYS C O      1 
ATOM   6000 C  CB     . LYS C 1 78  ? 25.617  31.716  -12.847 1.00 49.06  ? 78  LYS C CB     1 
ATOM   6001 C  CG     . LYS C 1 78  ? 27.087  32.045  -13.060 1.00 61.95  ? 78  LYS C CG     1 
ATOM   6002 C  CD     . LYS C 1 78  ? 27.554  33.189  -12.181 1.00 55.27  ? 78  LYS C CD     1 
ATOM   6003 C  CE     . LYS C 1 78  ? 28.964  33.618  -12.545 1.00 66.74  ? 78  LYS C CE     1 
ATOM   6004 N  NZ     . LYS C 1 78  ? 28.991  34.289  -13.880 1.00 60.10  ? 78  LYS C NZ     1 
ATOM   6005 H  H      . LYS C 1 78  ? 26.645  30.002  -11.448 1.00 62.21  ? 78  LYS C H      1 
ATOM   6006 H  HA     . LYS C 1 78  ? 25.383  32.205  -10.875 1.00 61.64  ? 78  LYS C HA     1 
ATOM   6007 H  HB2    . LYS C 1 78  ? 25.406  30.945  -13.396 1.00 59.08  ? 78  LYS C HB2    1 
ATOM   6008 H  HB3    . LYS C 1 78  ? 25.100  32.483  -13.139 1.00 59.08  ? 78  LYS C HB3    1 
ATOM   6009 H  HG2    . LYS C 1 78  ? 27.621  31.263  -12.848 1.00 74.55  ? 78  LYS C HG2    1 
ATOM   6010 H  HG3    . LYS C 1 78  ? 27.225  32.300  -13.986 1.00 74.55  ? 78  LYS C HG3    1 
ATOM   6011 H  HD2    . LYS C 1 78  ? 26.963  33.948  -12.298 1.00 66.54  ? 78  LYS C HD2    1 
ATOM   6012 H  HD3    . LYS C 1 78  ? 27.550  32.905  -11.253 1.00 66.54  ? 78  LYS C HD3    1 
ATOM   6013 H  HE2    . LYS C 1 78  ? 29.293  34.244  -11.880 1.00 80.30  ? 78  LYS C HE2    1 
ATOM   6014 H  HE3    . LYS C 1 78  ? 29.541  32.839  -12.581 1.00 80.30  ? 78  LYS C HE3    1 
ATOM   6015 H  HZ1    . LYS C 1 78  ? 28.455  35.000  -13.874 1.00 72.33  ? 78  LYS C HZ1    1 
ATOM   6016 H  HZ2    . LYS C 1 78  ? 29.819  34.553  -14.071 1.00 72.33  ? 78  LYS C HZ2    1 
ATOM   6017 H  HZ3    . LYS C 1 78  ? 28.715  33.724  -14.510 1.00 72.33  ? 78  LYS C HZ3    1 
ATOM   6018 N  N      . LYS C 1 79  ? 23.490  29.703  -11.387 1.00 55.07  ? 79  LYS C N      1 
ATOM   6019 C  CA     . LYS C 1 79  ? 22.113  29.242  -11.253 1.00 51.64  ? 79  LYS C CA     1 
ATOM   6020 C  C      . LYS C 1 79  ? 21.589  29.516  -9.847  1.00 48.53  ? 79  LYS C C      1 
ATOM   6021 O  O      . LYS C 1 79  ? 20.482  30.041  -9.677  1.00 61.21  ? 79  LYS C O      1 
ATOM   6022 C  CB     . LYS C 1 79  ? 22.035  27.754  -11.606 1.00 56.66  ? 79  LYS C CB     1 
ATOM   6023 C  CG     . LYS C 1 79  ? 20.624  27.197  -11.716 1.00 52.37  ? 79  LYS C CG     1 
ATOM   6024 C  CD     . LYS C 1 79  ? 20.646  25.712  -12.058 1.00 79.64  ? 79  LYS C CD     1 
ATOM   6025 C  CE     . LYS C 1 79  ? 19.240  25.142  -12.172 1.00 78.69  ? 79  LYS C CE     1 
ATOM   6026 N  NZ     . LYS C 1 79  ? 19.249  23.692  -12.520 1.00 95.52  ? 79  LYS C NZ     1 
ATOM   6027 H  H      . LYS C 1 79  ? 24.065  29.076  -11.511 1.00 66.30  ? 79  LYS C H      1 
ATOM   6028 H  HA     . LYS C 1 79  ? 21.544  29.719  -11.877 1.00 62.18  ? 79  LYS C HA     1 
ATOM   6029 H  HB2    . LYS C 1 79  ? 22.470  27.618  -12.462 1.00 68.21  ? 79  LYS C HB2    1 
ATOM   6030 H  HB3    . LYS C 1 79  ? 22.494  27.250  -10.916 1.00 68.21  ? 79  LYS C HB3    1 
ATOM   6031 H  HG2    . LYS C 1 79  ? 20.165  27.310  -10.869 1.00 63.06  ? 79  LYS C HG2    1 
ATOM   6032 H  HG3    . LYS C 1 79  ? 20.146  27.666  -12.418 1.00 63.06  ? 79  LYS C HG3    1 
ATOM   6033 H  HD2    . LYS C 1 79  ? 21.095  25.586  -12.908 1.00 95.78  ? 79  LYS C HD2    1 
ATOM   6034 H  HD3    . LYS C 1 79  ? 21.114  25.229  -11.360 1.00 95.78  ? 79  LYS C HD3    1 
ATOM   6035 H  HE2    . LYS C 1 79  ? 18.784  25.246  -11.322 1.00 94.64  ? 79  LYS C HE2    1 
ATOM   6036 H  HE3    . LYS C 1 79  ? 18.759  25.617  -12.868 1.00 94.64  ? 79  LYS C HE3    1 
ATOM   6037 H  HZ1    . LYS C 1 79  ? 19.465  23.585  -13.376 1.00 114.84 ? 79  LYS C HZ1    1 
ATOM   6038 H  HZ2    . LYS C 1 79  ? 18.444  23.340  -12.379 1.00 114.84 ? 79  LYS C HZ2    1 
ATOM   6039 H  HZ3    . LYS C 1 79  ? 19.844  23.262  -12.016 1.00 114.84 ? 79  LYS C HZ3    1 
ATOM   6040 N  N      . ALA C 1 80  ? 22.375  29.173  -8.822  1.00 43.56  ? 80  ALA C N      1 
ATOM   6041 C  CA     . ALA C 1 80  ? 21.965  29.455  -7.450  1.00 44.59  ? 80  ALA C CA     1 
ATOM   6042 C  C      . ALA C 1 80  ? 21.873  30.956  -7.203  1.00 39.14  ? 80  ALA C C      1 
ATOM   6043 O  O      . ALA C 1 80  ? 21.007  31.416  -6.453  1.00 48.28  ? 80  ALA C O      1 
ATOM   6044 C  CB     . ALA C 1 80  ? 22.938  28.813  -6.463  1.00 47.39  ? 80  ALA C CB     1 
ATOM   6045 H  H      . ALA C 1 80  ? 23.138  28.783  -8.893  1.00 52.48  ? 80  ALA C H      1 
ATOM   6046 H  HA     . ALA C 1 80  ? 21.088  29.067  -7.303  1.00 53.72  ? 80  ALA C HA     1 
ATOM   6047 H  HB1    . ALA C 1 80  ? 22.651  29.015  -5.559  1.00 57.08  ? 80  ALA C HB1    1 
ATOM   6048 H  HB2    . ALA C 1 80  ? 22.940  27.853  -6.602  1.00 57.08  ? 80  ALA C HB2    1 
ATOM   6049 H  HB3    . ALA C 1 80  ? 23.826  29.171  -6.617  1.00 57.08  ? 80  ALA C HB3    1 
ATOM   6050 N  N      . PHE C 1 81  ? 22.767  31.734  -7.816  1.00 45.43  ? 81  PHE C N      1 
ATOM   6051 C  CA     . PHE C 1 81  ? 22.699  33.188  -7.697  1.00 51.35  ? 81  PHE C CA     1 
ATOM   6052 C  C      . PHE C 1 81  ? 21.390  33.714  -8.275  1.00 37.34  ? 81  PHE C C      1 
ATOM   6053 O  O      . PHE C 1 81  ? 20.706  34.542  -7.660  1.00 51.55  ? 81  PHE C O      1 
ATOM   6054 C  CB     . PHE C 1 81  ? 23.903  33.813  -8.406  1.00 45.07  ? 81  PHE C CB     1 
ATOM   6055 C  CG     . PHE C 1 81  ? 24.309  35.161  -7.870  1.00 45.15  ? 81  PHE C CG     1 
ATOM   6056 C  CD1    . PHE C 1 81  ? 23.406  35.974  -7.204  1.00 55.00  ? 81  PHE C CD1    1 
ATOM   6057 C  CD2    . PHE C 1 81  ? 25.611  35.609  -8.029  1.00 43.20  ? 81  PHE C CD2    1 
ATOM   6058 C  CE1    . PHE C 1 81  ? 23.792  37.207  -6.713  1.00 49.11  ? 81  PHE C CE1    1 
ATOM   6059 C  CE2    . PHE C 1 81  ? 26.002  36.837  -7.540  1.00 46.56  ? 81  PHE C CE2    1 
ATOM   6060 C  CZ     . PHE C 1 81  ? 25.092  37.638  -6.881  1.00 56.10  ? 81  PHE C CZ     1 
ATOM   6061 H  H      . PHE C 1 81  ? 23.416  31.449  -8.303  1.00 54.74  ? 81  PHE C H      1 
ATOM   6062 H  HA     . PHE C 1 81  ? 22.735  33.441  -6.761  1.00 61.84  ? 81  PHE C HA     1 
ATOM   6063 H  HB2    . PHE C 1 81  ? 24.663  33.218  -8.310  1.00 54.30  ? 81  PHE C HB2    1 
ATOM   6064 H  HB3    . PHE C 1 81  ? 23.686  33.924  -9.345  1.00 54.30  ? 81  PHE C HB3    1 
ATOM   6065 H  HD1    . PHE C 1 81  ? 22.529  35.687  -7.087  1.00 66.22  ? 81  PHE C HD1    1 
ATOM   6066 H  HD2    . PHE C 1 81  ? 26.229  35.073  -8.471  1.00 52.05  ? 81  PHE C HD2    1 
ATOM   6067 H  HE1    . PHE C 1 81  ? 23.177  37.746  -6.270  1.00 59.14  ? 81  PHE C HE1    1 
ATOM   6068 H  HE2    . PHE C 1 81  ? 26.879  37.126  -7.655  1.00 56.09  ? 81  PHE C HE2    1 
ATOM   6069 H  HZ     . PHE C 1 81  ? 25.355  38.467  -6.550  1.00 67.54  ? 81  PHE C HZ     1 
ATOM   6070 N  N      . GLY C 1 82  ? 21.023  33.233  -9.462  1.00 34.21  ? 82  GLY C N      1 
ATOM   6071 C  CA     . GLY C 1 82  ? 19.769  33.648  -10.062 1.00 35.42  ? 82  GLY C CA     1 
ATOM   6072 C  C      . GLY C 1 82  ? 18.570  33.228  -9.237  1.00 39.60  ? 82  GLY C C      1 
ATOM   6073 O  O      . GLY C 1 82  ? 17.589  33.965  -9.132  1.00 51.26  ? 82  GLY C O      1 
ATOM   6074 H  H      . GLY C 1 82  ? 21.476  32.673  -9.933  1.00 41.26  ? 82  GLY C H      1 
ATOM   6075 H  HA2    . GLY C 1 82  ? 19.759  34.614  -10.148 1.00 42.71  ? 82  GLY C HA2    1 
ATOM   6076 H  HA3    . GLY C 1 82  ? 19.688  33.252  -10.943 1.00 42.71  ? 82  GLY C HA3    1 
ATOM   6077 N  N      . ILE C 1 83  ? 18.625  32.031  -8.652  1.00 38.33  ? 83  ILE C N      1 
ATOM   6078 C  CA     . ILE C 1 83  ? 17.538  31.580  -7.785  1.00 54.34  ? 83  ILE C CA     1 
ATOM   6079 C  C      . ILE C 1 83  ? 17.413  32.496  -6.573  1.00 64.06  ? 83  ILE C C      1 
ATOM   6080 O  O      . ILE C 1 83  ? 16.312  32.917  -6.197  1.00 50.75  ? 83  ILE C O      1 
ATOM   6081 C  CB     . ILE C 1 83  ? 17.761  30.116  -7.366  1.00 55.28  ? 83  ILE C CB     1 
ATOM   6082 C  CG1    . ILE C 1 83  ? 17.567  29.192  -8.573  1.00 58.43  ? 83  ILE C CG1    1 
ATOM   6083 C  CG2    . ILE C 1 83  ? 16.831  29.747  -6.212  1.00 50.17  ? 83  ILE C CG2    1 
ATOM   6084 C  CD1    . ILE C 1 83  ? 17.919  27.743  -8.301  1.00 60.86  ? 83  ILE C CD1    1 
ATOM   6085 H  H      . ILE C 1 83  ? 19.269  31.469  -8.738  1.00 46.21  ? 83  ILE C H      1 
ATOM   6086 H  HA     . ILE C 1 83  ? 16.706  31.627  -8.282  1.00 65.42  ? 83  ILE C HA     1 
ATOM   6087 H  HB     . ILE C 1 83  ? 18.672  30.008  -7.053  1.00 66.56  ? 83  ILE C HB     1 
ATOM   6088 H  HG12   . ILE C 1 83  ? 16.636  29.224  -8.842  1.00 70.33  ? 83  ILE C HG12   1 
ATOM   6089 H  HG13   . ILE C 1 83  ? 18.133  29.503  -9.297  1.00 70.33  ? 83  ILE C HG13   1 
ATOM   6090 H  HG21   . ILE C 1 83  ? 16.795  28.781  -6.132  1.00 60.42  ? 83  ILE C HG21   1 
ATOM   6091 H  HG22   . ILE C 1 83  ? 17.176  30.134  -5.392  1.00 60.42  ? 83  ILE C HG22   1 
ATOM   6092 H  HG23   . ILE C 1 83  ? 15.945  30.097  -6.396  1.00 60.42  ? 83  ILE C HG23   1 
ATOM   6093 H  HD11   . ILE C 1 83  ? 18.045  27.284  -9.147  1.00 73.24  ? 83  ILE C HD11   1 
ATOM   6094 H  HD12   . ILE C 1 83  ? 18.738  27.709  -7.782  1.00 73.24  ? 83  ILE C HD12   1 
ATOM   6095 H  HD13   . ILE C 1 83  ? 17.195  27.329  -7.805  1.00 73.24  ? 83  ILE C HD13   1 
ATOM   6096 N  N      . LEU C 1 84  ? 18.545  32.806  -5.936  1.00 58.36  ? 84  LEU C N      1 
ATOM   6097 C  CA     . LEU C 1 84  ? 18.534  33.697  -4.783  1.00 44.22  ? 84  LEU C CA     1 
ATOM   6098 C  C      . LEU C 1 84  ? 17.940  35.048  -5.149  1.00 40.09  ? 84  LEU C C      1 
ATOM   6099 O  O      . LEU C 1 84  ? 17.161  35.624  -4.379  1.00 55.11  ? 84  LEU C O      1 
ATOM   6100 C  CB     . LEU C 1 84  ? 19.954  33.861  -4.240  1.00 38.46  ? 84  LEU C CB     1 
ATOM   6101 C  CG     . LEU C 1 84  ? 20.099  34.488  -2.853  1.00 35.77  ? 84  LEU C CG     1 
ATOM   6102 C  CD1    . LEU C 1 84  ? 19.619  33.531  -1.775  1.00 37.52  ? 84  LEU C CD1    1 
ATOM   6103 C  CD2    . LEU C 1 84  ? 21.543  34.888  -2.600  1.00 35.51  ? 84  LEU C CD2    1 
ATOM   6104 H  H      . LEU C 1 84  ? 19.326  32.517  -6.151  1.00 70.25  ? 84  LEU C H      1 
ATOM   6105 H  HA     . LEU C 1 84  ? 17.989  33.307  -4.082  1.00 53.28  ? 84  LEU C HA     1 
ATOM   6106 H  HB2    . LEU C 1 84  ? 20.360  32.982  -4.197  1.00 46.37  ? 84  LEU C HB2    1 
ATOM   6107 H  HB3    . LEU C 1 84  ? 20.446  34.425  -4.858  1.00 46.37  ? 84  LEU C HB3    1 
ATOM   6108 H  HG     . LEU C 1 84  ? 19.548  35.285  -2.811  1.00 43.14  ? 84  LEU C HG     1 
ATOM   6109 H  HD11   . LEU C 1 84  ? 19.767  33.936  -0.905  1.00 45.24  ? 84  LEU C HD11   1 
ATOM   6110 H  HD12   . LEU C 1 84  ? 18.673  33.359  -1.903  1.00 45.24  ? 84  LEU C HD12   1 
ATOM   6111 H  HD13   . LEU C 1 84  ? 20.119  32.703  -1.843  1.00 45.24  ? 84  LEU C HD13   1 
ATOM   6112 H  HD21   . LEU C 1 84  ? 21.613  35.280  -1.716  1.00 42.83  ? 84  LEU C HD21   1 
ATOM   6113 H  HD22   . LEU C 1 84  ? 22.104  34.099  -2.658  1.00 42.83  ? 84  LEU C HD22   1 
ATOM   6114 H  HD23   . LEU C 1 84  ? 21.813  35.536  -3.270  1.00 42.83  ? 84  LEU C HD23   1 
ATOM   6115 N  N      . LEU C 1 85  ? 18.303  35.576  -6.319  1.00 42.37  ? 85  LEU C N      1 
ATOM   6116 C  CA     . LEU C 1 85  ? 17.768  36.865  -6.741  1.00 48.48  ? 85  LEU C CA     1 
ATOM   6117 C  C      . LEU C 1 85  ? 16.269  36.777  -7.008  1.00 46.47  ? 85  LEU C C      1 
ATOM   6118 O  O      . LEU C 1 85  ? 15.499  37.641  -6.573  1.00 45.95  ? 85  LEU C O      1 
ATOM   6119 C  CB     . LEU C 1 85  ? 18.508  37.356  -7.984  1.00 47.70  ? 85  LEU C CB     1 
ATOM   6120 C  CG     . LEU C 1 85  ? 19.965  37.769  -7.760  1.00 47.81  ? 85  LEU C CG     1 
ATOM   6121 C  CD1    . LEU C 1 85  ? 20.644  38.045  -9.090  1.00 67.33  ? 85  LEU C CD1    1 
ATOM   6122 C  CD2    . LEU C 1 85  ? 20.075  38.970  -6.843  1.00 34.32  ? 85  LEU C CD2    1 
ATOM   6123 H  H      . LEU C 1 85  ? 18.849  35.214  -6.877  1.00 51.06  ? 85  LEU C H      1 
ATOM   6124 H  HA     . LEU C 1 85  ? 17.910  37.510  -6.030  1.00 58.40  ? 85  LEU C HA     1 
ATOM   6125 H  HB2    . LEU C 1 85  ? 18.507  36.643  -8.642  1.00 57.45  ? 85  LEU C HB2    1 
ATOM   6126 H  HB3    . LEU C 1 85  ? 18.038  38.130  -8.333  1.00 57.45  ? 85  LEU C HB3    1 
ATOM   6127 H  HG     . LEU C 1 85  ? 20.427  37.036  -7.323  1.00 57.59  ? 85  LEU C HG     1 
ATOM   6128 H  HD11   . LEU C 1 85  ? 21.572  38.277  -8.929  1.00 81.01  ? 85  LEU C HD11   1 
ATOM   6129 H  HD12   . LEU C 1 85  ? 20.593  37.248  -9.641  1.00 81.01  ? 85  LEU C HD12   1 
ATOM   6130 H  HD13   . LEU C 1 85  ? 20.190  38.781  -9.529  1.00 81.01  ? 85  LEU C HD13   1 
ATOM   6131 H  HD21   . LEU C 1 85  ? 21.005  39.241  -6.787  1.00 41.40  ? 85  LEU C HD21   1 
ATOM   6132 H  HD22   . LEU C 1 85  ? 19.541  39.694  -7.205  1.00 41.40  ? 85  LEU C HD22   1 
ATOM   6133 H  HD23   . LEU C 1 85  ? 19.748  38.726  -5.963  1.00 41.40  ? 85  LEU C HD23   1 
ATOM   6134 N  N      . SER C 1 86  ? 15.831  35.733  -7.717  1.00 46.01  ? 86  SER C N      1 
ATOM   6135 C  CA     . SER C 1 86  ? 14.409  35.576  -8.004  1.00 46.38  ? 86  SER C CA     1 
ATOM   6136 C  C      . SER C 1 86  ? 13.600  35.462  -6.722  1.00 42.28  ? 86  SER C C      1 
ATOM   6137 O  O      . SER C 1 86  ? 12.466  35.948  -6.649  1.00 52.01  ? 86  SER C O      1 
ATOM   6138 C  CB     . SER C 1 86  ? 14.180  34.352  -8.889  1.00 50.83  ? 86  SER C CB     1 
ATOM   6139 O  OG     . SER C 1 86  ? 14.797  34.516  -10.153 1.00 76.08  ? 86  SER C OG     1 
ATOM   6140 H  H      . SER C 1 86  ? 16.330  35.111  -8.039  1.00 55.43  ? 86  SER C H      1 
ATOM   6141 H  HA     . SER C 1 86  ? 14.102  36.358  -8.489  1.00 55.87  ? 86  SER C HA     1 
ATOM   6142 H  HB2    . SER C 1 86  ? 14.558  33.572  -8.452  1.00 61.21  ? 86  SER C HB2    1 
ATOM   6143 H  HB3    . SER C 1 86  ? 13.226  34.230  -9.017  1.00 61.21  ? 86  SER C HB3    1 
ATOM   6144 H  HG     . SER C 1 86  ? 15.622  34.640  -10.056 1.00 91.51  ? 86  SER C HG     1 
ATOM   6145 N  N      . TYR C 1 87  ? 14.160  34.815  -5.701  1.00 38.40  ? 87  TYR C N      1 
ATOM   6146 C  CA     . TYR C 1 87  ? 13.435  34.650  -4.448  1.00 35.44  ? 87  TYR C CA     1 
ATOM   6147 C  C      . TYR C 1 87  ? 13.401  35.950  -3.654  1.00 41.15  ? 87  TYR C C      1 
ATOM   6148 O  O      . TYR C 1 87  ? 12.327  36.427  -3.270  1.00 47.49  ? 87  TYR C O      1 
ATOM   6149 C  CB     . TYR C 1 87  ? 14.066  33.541  -3.613  1.00 43.52  ? 87  TYR C CB     1 
ATOM   6150 C  CG     . TYR C 1 87  ? 13.339  33.285  -2.313  1.00 35.03  ? 87  TYR C CG     1 
ATOM   6151 C  CD1    . TYR C 1 87  ? 13.822  33.806  -1.121  1.00 31.08  ? 87  TYR C CD1    1 
ATOM   6152 C  CD2    . TYR C 1 87  ? 12.163  32.554  -2.278  1.00 23.29  ? 87  TYR C CD2    1 
ATOM   6153 C  CE1    . TYR C 1 87  ? 13.169  33.589  0.070   1.00 43.53  ? 87  TYR C CE1    1 
ATOM   6154 C  CE2    . TYR C 1 87  ? 11.501  32.329  -1.087  1.00 37.61  ? 87  TYR C CE2    1 
ATOM   6155 C  CZ     . TYR C 1 87  ? 12.007  32.851  0.084   1.00 34.53  ? 87  TYR C CZ     1 
ATOM   6156 O  OH     . TYR C 1 87  ? 11.351  32.633  1.275   1.00 39.53  ? 87  TYR C OH     1 
ATOM   6157 H  H      . TYR C 1 87  ? 14.947  34.467  -5.708  1.00 46.30  ? 87  TYR C H      1 
ATOM   6158 H  HA     . TYR C 1 87  ? 12.522  34.392  -4.652  1.00 42.74  ? 87  TYR C HA     1 
ATOM   6159 H  HB2    . TYR C 1 87  ? 14.057  32.718  -4.127  1.00 52.44  ? 87  TYR C HB2    1 
ATOM   6160 H  HB3    . TYR C 1 87  ? 14.979  33.790  -3.400  1.00 52.44  ? 87  TYR C HB3    1 
ATOM   6161 H  HD1    . TYR C 1 87  ? 14.603  34.312  -1.128  1.00 37.51  ? 87  TYR C HD1    1 
ATOM   6162 H  HD2    . TYR C 1 87  ? 11.814  32.210  -3.068  1.00 28.17  ? 87  TYR C HD2    1 
ATOM   6163 H  HE1    . TYR C 1 87  ? 13.511  33.939  0.861   1.00 52.46  ? 87  TYR C HE1    1 
ATOM   6164 H  HE2    . TYR C 1 87  ? 10.718  31.827  -1.075  1.00 45.35  ? 87  TYR C HE2    1 
ATOM   6165 H  HH     . TYR C 1 87  ? 10.671  32.158  1.146   1.00 47.65  ? 87  TYR C HH     1 
ATOM   6166 N  N      . TYR C 1 88  ? 14.569  36.533  -3.397  1.00 31.10  ? 88  TYR C N      1 
ATOM   6167 C  CA     . TYR C 1 88  ? 14.664  37.691  -2.519  1.00 32.09  ? 88  TYR C CA     1 
ATOM   6168 C  C      . TYR C 1 88  ? 14.436  39.008  -3.249  1.00 32.13  ? 88  TYR C C      1 
ATOM   6169 O  O      . TYR C 1 88  ? 13.798  39.910  -2.699  1.00 44.40  ? 88  TYR C O      1 
ATOM   6170 C  CB     . TYR C 1 88  ? 16.029  37.706  -1.830  1.00 27.48  ? 88  TYR C CB     1 
ATOM   6171 C  CG     . TYR C 1 88  ? 16.173  36.685  -0.722  1.00 27.09  ? 88  TYR C CG     1 
ATOM   6172 C  CD1    . TYR C 1 88  ? 16.874  35.506  -0.923  1.00 32.88  ? 88  TYR C CD1    1 
ATOM   6173 C  CD2    . TYR C 1 88  ? 15.584  36.892  0.518   1.00 28.05  ? 88  TYR C CD2    1 
ATOM   6174 C  CE1    . TYR C 1 88  ? 17.001  34.571  0.085   1.00 35.57  ? 88  TYR C CE1    1 
ATOM   6175 C  CE2    . TYR C 1 88  ? 15.710  35.966  1.533   1.00 25.78  ? 88  TYR C CE2    1 
ATOM   6176 C  CZ     . TYR C 1 88  ? 16.416  34.806  1.310   1.00 29.92  ? 88  TYR C CZ     1 
ATOM   6177 O  OH     . TYR C 1 88  ? 16.542  33.876  2.316   1.00 29.94  ? 88  TYR C OH     1 
ATOM   6178 H  H      . TYR C 1 88  ? 15.323  36.274  -3.720  1.00 37.54  ? 88  TYR C H      1 
ATOM   6179 H  HA     . TYR C 1 88  ? 13.978  37.619  -1.836  1.00 38.72  ? 88  TYR C HA     1 
ATOM   6180 H  HB2    . TYR C 1 88  ? 16.713  37.520  -2.492  1.00 33.19  ? 88  TYR C HB2    1 
ATOM   6181 H  HB3    . TYR C 1 88  ? 16.172  38.583  -1.443  1.00 33.19  ? 88  TYR C HB3    1 
ATOM   6182 H  HD1    . TYR C 1 88  ? 17.265  35.342  -1.751  1.00 39.68  ? 88  TYR C HD1    1 
ATOM   6183 H  HD2    . TYR C 1 88  ? 15.095  37.669  0.667   1.00 33.88  ? 88  TYR C HD2    1 
ATOM   6184 H  HE1    . TYR C 1 88  ? 17.479  33.787  -0.063  1.00 42.90  ? 88  TYR C HE1    1 
ATOM   6185 H  HE2    . TYR C 1 88  ? 15.321  36.124  2.362   1.00 31.15  ? 88  TYR C HE2    1 
ATOM   6186 H  HH     . TYR C 1 88  ? 16.157  34.150  3.010   1.00 36.14  ? 88  TYR C HH     1 
ATOM   6187 N  N      . ALA C 1 89  ? 14.964  39.155  -4.464  1.00 41.16  ? 89  ALA C N      1 
ATOM   6188 C  CA     . ALA C 1 89  ? 14.829  40.419  -5.183  1.00 34.85  ? 89  ALA C CA     1 
ATOM   6189 C  C      . ALA C 1 89  ? 13.481  40.524  -5.891  1.00 36.12  ? 89  ALA C C      1 
ATOM   6190 O  O      . ALA C 1 89  ? 12.731  41.482  -5.681  1.00 50.19  ? 89  ALA C O      1 
ATOM   6191 C  CB     . ALA C 1 89  ? 15.975  40.581  -6.185  1.00 37.32  ? 89  ALA C CB     1 
ATOM   6192 H  H      . ALA C 1 89  ? 15.399  38.547  -4.889  1.00 49.61  ? 89  ALA C H      1 
ATOM   6193 H  HA     . ALA C 1 89  ? 14.884  41.142  -4.539  1.00 42.04  ? 89  ALA C HA     1 
ATOM   6194 H  HB1    . ALA C 1 89  ? 15.926  41.465  -6.580  1.00 45.00  ? 89  ALA C HB1    1 
ATOM   6195 H  HB2    . ALA C 1 89  ? 16.819  40.473  -5.720  1.00 45.00  ? 89  ALA C HB2    1 
ATOM   6196 H  HB3    . ALA C 1 89  ? 15.889  39.904  -6.875  1.00 45.00  ? 89  ALA C HB3    1 
ATOM   6197 N  N      . HIS C 1 90  ? 13.156  39.543  -6.734  1.00 35.28  ? 90  HIS C N      1 
ATOM   6198 C  CA     . HIS C 1 90  ? 11.909  39.585  -7.489  1.00 47.22  ? 90  HIS C CA     1 
ATOM   6199 C  C      . HIS C 1 90  ? 10.702  39.228  -6.634  1.00 48.23  ? 90  HIS C C      1 
ATOM   6200 O  O      . HIS C 1 90  ? 9.575   39.588  -6.991  1.00 53.83  ? 90  HIS C O      1 
ATOM   6201 C  CB     . HIS C 1 90  ? 11.992  38.637  -8.690  1.00 53.46  ? 90  HIS C CB     1 
ATOM   6202 C  CG     . HIS C 1 90  ? 10.850  38.768  -9.652  1.00 67.18  ? 90  HIS C CG     1 
ATOM   6203 N  ND1    . HIS C 1 90  ? 9.656   38.099  -9.488  1.00 74.58  ? 90  HIS C ND1    1 
ATOM   6204 C  CD2    . HIS C 1 90  ? 10.728  39.479  -10.797 1.00 65.69  ? 90  HIS C CD2    1 
ATOM   6205 C  CE1    . HIS C 1 90  ? 8.844   38.400  -10.486 1.00 53.34  ? 90  HIS C CE1    1 
ATOM   6206 N  NE2    . HIS C 1 90  ? 9.471   39.235  -11.295 1.00 78.92  ? 90  HIS C NE2    1 
ATOM   6207 H  H      . HIS C 1 90  ? 13.638  38.847  -6.885  1.00 42.55  ? 90  HIS C H      1 
ATOM   6208 H  HA     . HIS C 1 90  ? 11.777  40.483  -7.831  1.00 56.88  ? 90  HIS C HA     1 
ATOM   6209 H  HB2    . HIS C 1 90  ? 12.810  38.823  -9.177  1.00 64.36  ? 90  HIS C HB2    1 
ATOM   6210 H  HB3    . HIS C 1 90  ? 12.000  37.723  -8.365  1.00 64.36  ? 90  HIS C HB3    1 
ATOM   6211 H  HD2    . HIS C 1 90  ? 11.374  40.030  -11.177 1.00 79.05  ? 90  HIS C HD2    1 
ATOM   6212 H  HE1    . HIS C 1 90  ? 7.979   38.078  -10.600 1.00 64.22  ? 90  HIS C HE1    1 
ATOM   6213 H  HE2    . HIS C 1 90  ? 9.144   39.572  -12.016 1.00 94.92  ? 90  HIS C HE2    1 
ATOM   6214 N  N      . GLY C 1 91  ? 10.907  38.517  -5.529  1.00 40.94  ? 91  GLY C N      1 
ATOM   6215 C  CA     . GLY C 1 91  ? 9.833   38.173  -4.626  1.00 45.30  ? 91  GLY C CA     1 
ATOM   6216 C  C      . GLY C 1 91  ? 9.099   36.898  -4.965  1.00 47.43  ? 91  GLY C C      1 
ATOM   6217 O  O      . GLY C 1 91  ? 8.117   36.571  -4.287  1.00 59.61  ? 91  GLY C O      1 
ATOM   6218 H  H      . GLY C 1 91  ? 11.676  38.222  -5.283  1.00 49.34  ? 91  GLY C H      1 
ATOM   6219 H  HA2    . GLY C 1 91  ? 10.199  38.075  -3.733  1.00 54.58  ? 91  GLY C HA2    1 
ATOM   6220 H  HA3    . GLY C 1 91  ? 9.186   38.895  -4.625  1.00 54.58  ? 91  GLY C HA3    1 
ATOM   6221 N  N      . SER C 1 92  ? 9.543   36.162  -5.979  1.00 42.12  ? 92  SER C N      1 
ATOM   6222 C  CA     . SER C 1 92  ? 8.898   34.904  -6.316  1.00 41.63  ? 92  SER C CA     1 
ATOM   6223 C  C      . SER C 1 92  ? 9.029   33.921  -5.160  1.00 43.25  ? 92  SER C C      1 
ATOM   6224 O  O      . SER C 1 92  ? 9.949   34.002  -4.343  1.00 52.68  ? 92  SER C O      1 
ATOM   6225 C  CB     . SER C 1 92  ? 9.509   34.311  -7.585  1.00 52.51  ? 92  SER C CB     1 
ATOM   6226 O  OG     . SER C 1 92  ? 9.247   35.135  -8.709  1.00 59.96  ? 92  SER C OG     1 
ATOM   6227 H  H      . SER C 1 92  ? 10.210  36.367  -6.482  1.00 50.76  ? 92  SER C H      1 
ATOM   6228 H  HA     . SER C 1 92  ? 7.955   35.057  -6.484  1.00 50.18  ? 92  SER C HA     1 
ATOM   6229 H  HB2    . SER C 1 92  ? 10.469  34.236  -7.467  1.00 63.23  ? 92  SER C HB2    1 
ATOM   6230 H  HB3    . SER C 1 92  ? 9.124   33.435  -7.741  1.00 63.23  ? 92  SER C HB3    1 
ATOM   6231 H  HG     . SER C 1 92  ? 9.582   35.896  -8.591  1.00 72.16  ? 92  SER C HG     1 
ATOM   6232 N  N      . SER C 1 93  ? 8.082   32.996  -5.090  1.00 43.84  ? 93  SER C N      1 
ATOM   6233 C  CA     . SER C 1 93  ? 8.067   31.966  -4.066  1.00 52.23  ? 93  SER C CA     1 
ATOM   6234 C  C      . SER C 1 93  ? 8.863   30.745  -4.515  1.00 59.70  ? 93  SER C C      1 
ATOM   6235 O  O      . SER C 1 93  ? 9.143   30.554  -5.701  1.00 58.73  ? 93  SER C O      1 
ATOM   6236 C  CB     . SER C 1 93  ? 6.633   31.559  -3.740  1.00 72.87  ? 93  SER C CB     1 
ATOM   6237 O  OG     . SER C 1 93  ? 6.002   31.000  -4.879  1.00 86.98  ? 93  SER C OG     1 
ATOM   6238 H  H      . SER C 1 93  ? 7.422   32.944  -5.639  1.00 52.82  ? 93  SER C H      1 
ATOM   6239 H  HA     . SER C 1 93  ? 8.478   32.314  -3.259  1.00 62.89  ? 93  SER C HA     1 
ATOM   6240 H  HB2    . SER C 1 93  ? 6.645   30.898  -3.029  1.00 87.66  ? 93  SER C HB2    1 
ATOM   6241 H  HB3    . SER C 1 93  ? 6.138   32.343  -3.455  1.00 87.66  ? 93  SER C HB3    1 
ATOM   6242 H  HG     . SER C 1 93  ? 5.210   30.790  -4.694  1.00 104.60 ? 93  SER C HG     1 
ATOM   6243 N  N      . LYS C 1 94  ? 9.227   29.912  -3.536  1.00 60.38  ? 94  LYS C N      1 
ATOM   6244 C  CA     . LYS C 1 94  ? 9.920   28.664  -3.838  1.00 63.12  ? 94  LYS C CA     1 
ATOM   6245 C  C      . LYS C 1 94  ? 9.111   27.808  -4.805  1.00 66.76  ? 94  LYS C C      1 
ATOM   6246 O  O      . LYS C 1 94  ? 9.660   27.229  -5.752  1.00 70.56  ? 94  LYS C O      1 
ATOM   6247 C  CB     . LYS C 1 94  ? 10.171  27.895  -2.542  1.00 41.79  ? 94  LYS C CB     1 
ATOM   6248 C  CG     . LYS C 1 94  ? 11.076  28.601  -1.552  1.00 38.36  ? 94  LYS C CG     1 
ATOM   6249 C  CD     . LYS C 1 94  ? 11.410  27.689  -0.382  1.00 53.08  ? 94  LYS C CD     1 
ATOM   6250 C  CE     . LYS C 1 94  ? 12.311  28.375  0.626   1.00 69.64  ? 94  LYS C CE     1 
ATOM   6251 N  NZ     . LYS C 1 94  ? 12.509  27.535  1.839   1.00 70.59  ? 94  LYS C NZ     1 
ATOM   6252 H  H      . LYS C 1 94  ? 9.086   30.045  -2.698  1.00 72.67  ? 94  LYS C H      1 
ATOM   6253 H  HA     . LYS C 1 94  ? 10.774  28.866  -4.252  1.00 75.97  ? 94  LYS C HA     1 
ATOM   6254 H  HB2    . LYS C 1 94  ? 9.319   27.744  -2.103  1.00 50.36  ? 94  LYS C HB2    1 
ATOM   6255 H  HB3    . LYS C 1 94  ? 10.585  27.046  -2.763  1.00 50.36  ? 94  LYS C HB3    1 
ATOM   6256 H  HG2    . LYS C 1 94  ? 11.903  28.853  -1.991  1.00 46.24  ? 94  LYS C HG2    1 
ATOM   6257 H  HG3    . LYS C 1 94  ? 10.628  29.390  -1.209  1.00 46.24  ? 94  LYS C HG3    1 
ATOM   6258 H  HD2    . LYS C 1 94  ? 10.590  27.432  0.068   1.00 63.91  ? 94  LYS C HD2    1 
ATOM   6259 H  HD3    . LYS C 1 94  ? 11.869  26.900  -0.712  1.00 63.91  ? 94  LYS C HD3    1 
ATOM   6260 H  HE2    . LYS C 1 94  ? 13.178  28.538  0.223   1.00 83.79  ? 94  LYS C HE2    1 
ATOM   6261 H  HE3    . LYS C 1 94  ? 11.908  29.214  0.899   1.00 83.79  ? 94  LYS C HE3    1 
ATOM   6262 H  HZ1    . LYS C 1 94  ? 13.054  27.948  2.409   1.00 84.93  ? 94  LYS C HZ1    1 
ATOM   6263 H  HZ2    . LYS C 1 94  ? 11.728  27.390  2.239   1.00 84.93  ? 94  LYS C HZ2    1 
ATOM   6264 H  HZ3    . LYS C 1 94  ? 12.867  26.753  1.612   1.00 84.93  ? 94  LYS C HZ3    1 
ATOM   6265 N  N      . HIS C 1 95  ? 7.795   27.733  -4.590  1.00 65.00  ? 95  HIS C N      1 
ATOM   6266 C  CA     . HIS C 1 95  ? 6.942   26.933  -5.460  1.00 59.16  ? 95  HIS C CA     1 
ATOM   6267 C  C      . HIS C 1 95  ? 6.959   27.467  -6.886  1.00 61.66  ? 95  HIS C C      1 
ATOM   6268 O  O      . HIS C 1 95  ? 6.997   26.689  -7.845  1.00 64.75  ? 95  HIS C O      1 
ATOM   6269 C  CB     . HIS C 1 95  ? 5.516   26.911  -4.912  1.00 76.96  ? 95  HIS C CB     1 
ATOM   6270 C  CG     . HIS C 1 95  ? 4.598   25.987  -5.650  1.00 83.21  ? 95  HIS C CG     1 
ATOM   6271 N  ND1    . HIS C 1 95  ? 3.719   26.427  -6.616  1.00 83.11  ? 95  HIS C ND1    1 
ATOM   6272 C  CD2    . HIS C 1 95  ? 4.418   24.648  -5.559  1.00 84.75  ? 95  HIS C CD2    1 
ATOM   6273 C  CE1    . HIS C 1 95  ? 3.041   25.398  -7.092  1.00 82.64  ? 95  HIS C CE1    1 
ATOM   6274 N  NE2    . HIS C 1 95  ? 3.445   24.307  -6.467  1.00 78.50  ? 95  HIS C NE2    1 
ATOM   6275 H  H      . HIS C 1 95  ? 7.376   28.132  -3.954  1.00 78.22  ? 95  HIS C H      1 
ATOM   6276 H  HA     . HIS C 1 95  ? 7.274   26.022  -5.476  1.00 71.20  ? 95  HIS C HA     1 
ATOM   6277 H  HB2    . HIS C 1 95  ? 5.542   26.623  -3.986  1.00 92.57  ? 95  HIS C HB2    1 
ATOM   6278 H  HB3    . HIS C 1 95  ? 5.145   27.805  -4.971  1.00 92.57  ? 95  HIS C HB3    1 
ATOM   6279 H  HD2    . HIS C 1 95  ? 4.868   24.068  -4.988  1.00 101.92 ? 95  HIS C HD2    1 
ATOM   6280 H  HE1    . HIS C 1 95  ? 2.389   25.435  -7.755  1.00 99.38  ? 95  HIS C HE1    1 
ATOM   6281 H  HE2    . HIS C 1 95  ? 3.148   23.512  -6.606  1.00 94.42  ? 95  HIS C HE2    1 
ATOM   6282 N  N      . ALA C 1 96  ? 6.942   28.792  -7.047  1.00 61.92  ? 96  ALA C N      1 
ATOM   6283 C  CA     . ALA C 1 96  ? 6.941   29.368  -8.387  1.00 68.19  ? 96  ALA C CA     1 
ATOM   6284 C  C      . ALA C 1 96  ? 8.246   29.078  -9.121  1.00 65.72  ? 96  ALA C C      1 
ATOM   6285 O  O      . ALA C 1 96  ? 8.234   28.733  -10.310 1.00 66.23  ? 96  ALA C O      1 
ATOM   6286 C  CB     . ALA C 1 96  ? 6.698   30.875  -8.302  1.00 56.45  ? 96  ALA C CB     1 
ATOM   6287 H  H      . ALA C 1 96  ? 6.931   29.369  -6.409  1.00 74.52  ? 96  ALA C H      1 
ATOM   6288 H  HA     . ALA C 1 96  ? 6.219   28.971  -8.898  1.00 82.04  ? 96  ALA C HA     1 
ATOM   6289 H  HB1    . ALA C 1 96  ? 6.697   31.246  -9.198  1.00 67.96  ? 96  ALA C HB1    1 
ATOM   6290 H  HB2    . ALA C 1 96  ? 5.841   31.033  -7.877  1.00 67.96  ? 96  ALA C HB2    1 
ATOM   6291 H  HB3    . ALA C 1 96  ? 7.407   31.280  -7.777  1.00 67.96  ? 96  ALA C HB3    1 
ATOM   6292 N  N      . ILE C 1 97  ? 9.381   29.197  -8.428  1.00 68.70  ? 97  ILE C N      1 
ATOM   6293 C  CA     . ILE C 1 97  ? 10.670  28.910  -9.052  1.00 68.28  ? 97  ILE C CA     1 
ATOM   6294 C  C      . ILE C 1 97  ? 10.753  27.439  -9.439  1.00 63.02  ? 97  ILE C C      1 
ATOM   6295 O  O      . ILE C 1 97  ? 11.229  27.090  -10.530 1.00 58.03  ? 97  ILE C O      1 
ATOM   6296 C  CB     . ILE C 1 97  ? 11.819  29.319  -8.112  1.00 54.05  ? 97  ILE C CB     1 
ATOM   6297 C  CG1    . ILE C 1 97  ? 11.755  30.823  -7.832  1.00 62.23  ? 97  ILE C CG1    1 
ATOM   6298 C  CG2    . ILE C 1 97  ? 13.163  28.967  -8.733  1.00 55.90  ? 97  ILE C CG2    1 
ATOM   6299 C  CD1    . ILE C 1 97  ? 12.762  31.306  -6.815  1.00 60.26  ? 97  ILE C CD1    1 
ATOM   6300 H  H      . ILE C 1 97  ? 9.432   29.438  -7.604  1.00 82.65  ? 97  ILE C H      1 
ATOM   6301 H  HA     . ILE C 1 97  ? 10.747  29.436  -9.863  1.00 82.16  ? 97  ILE C HA     1 
ATOM   6302 H  HB     . ILE C 1 97  ? 11.721  28.834  -7.278  1.00 65.08  ? 97  ILE C HB     1 
ATOM   6303 H  HG12   . ILE C 1 97  ? 11.921  31.300  -8.660  1.00 74.89  ? 97  ILE C HG12   1 
ATOM   6304 H  HG13   . ILE C 1 97  ? 10.871  31.038  -7.497  1.00 74.89  ? 97  ILE C HG13   1 
ATOM   6305 H  HG21   . ILE C 1 97  ? 13.872  29.313  -8.170  1.00 67.30  ? 97  ILE C HG21   1 
ATOM   6306 H  HG22   . ILE C 1 97  ? 13.236  28.002  -8.801  1.00 67.30  ? 97  ILE C HG22   1 
ATOM   6307 H  HG23   . ILE C 1 97  ? 13.217  29.365  -9.616  1.00 67.30  ? 97  ILE C HG23   1 
ATOM   6308 H  HD11   . ILE C 1 97  ? 12.509  32.194  -6.517  1.00 72.52  ? 97  ILE C HD11   1 
ATOM   6309 H  HD12   . ILE C 1 97  ? 12.769  30.694  -6.062  1.00 72.52  ? 97  ILE C HD12   1 
ATOM   6310 H  HD13   . ILE C 1 97  ? 13.640  31.333  -7.227  1.00 72.52  ? 97  ILE C HD13   1 
ATOM   6311 N  N      . ALA C 1 98  ? 10.306  26.550  -8.547  1.00 58.58  ? 98  ALA C N      1 
ATOM   6312 C  CA     . ALA C 1 98  ? 10.320  25.126  -8.864  1.00 51.73  ? 98  ALA C CA     1 
ATOM   6313 C  C      . ALA C 1 98  ? 9.425   24.822  -10.059 1.00 64.70  ? 98  ALA C C      1 
ATOM   6314 O  O      . ALA C 1 98  ? 9.795   24.034  -10.936 1.00 76.09  ? 98  ALA C O      1 
ATOM   6315 C  CB     . ALA C 1 98  ? 9.887   24.312  -7.647  1.00 55.56  ? 98  ALA C CB     1 
ATOM   6316 H  H      . ALA C 1 98  ? 9.997   26.741  -7.768  1.00 70.51  ? 98  ALA C H      1 
ATOM   6317 H  HA     . ALA C 1 98  ? 11.226  24.865  -9.091  1.00 62.29  ? 98  ALA C HA     1 
ATOM   6318 H  HB1    . ALA C 1 98  ? 9.900   23.369  -7.876  1.00 66.88  ? 98  ALA C HB1    1 
ATOM   6319 H  HB2    . ALA C 1 98  ? 10.502  24.483  -6.917  1.00 66.88  ? 98  ALA C HB2    1 
ATOM   6320 H  HB3    . ALA C 1 98  ? 8.990   24.578  -7.392  1.00 66.88  ? 98  ALA C HB3    1 
ATOM   6321 N  N      . SER C 1 99  ? 8.243   25.442  -10.116 1.00 57.81  ? 99  SER C N      1 
ATOM   6322 C  CA     . SER C 1 99  ? 7.346   25.224  -11.245 1.00 66.27  ? 99  SER C CA     1 
ATOM   6323 C  C      . SER C 1 99  ? 7.982   25.690  -12.547 1.00 62.01  ? 99  SER C C      1 
ATOM   6324 O  O      . SER C 1 99  ? 7.898   25.001  -13.575 1.00 74.28  ? 99  SER C O      1 
ATOM   6325 C  CB     . SER C 1 99  ? 6.022   25.953  -11.010 1.00 76.54  ? 99  SER C CB     1 
ATOM   6326 O  OG     . SER C 1 99  ? 5.388   25.503  -9.825  1.00 79.26  ? 99  SER C OG     1 
ATOM   6327 H  H      . SER C 1 99  ? 7.942   25.987  -9.523  1.00 69.59  ? 99  SER C H      1 
ATOM   6328 H  HA     . SER C 1 99  ? 7.160   24.275  -11.319 1.00 79.74  ? 99  SER C HA     1 
ATOM   6329 H  HB2    . SER C 1 99  ? 6.197   26.904  -10.931 1.00 92.06  ? 99  SER C HB2    1 
ATOM   6330 H  HB3    . SER C 1 99  ? 5.434   25.785  -11.763 1.00 92.06  ? 99  SER C HB3    1 
ATOM   6331 H  HG     . SER C 1 99  ? 5.891   25.632  -9.164  1.00 95.33  ? 99  SER C HG     1 
ATOM   6332 N  N      . TYR C 1 100 ? 8.618   26.863  -12.528 1.00 69.48  ? 100 TYR C N      1 
ATOM   6333 C  CA     . TYR C 1 100 ? 9.297   27.349  -13.723 1.00 82.56  ? 100 TYR C CA     1 
ATOM   6334 C  C      . TYR C 1 100 ? 10.374  26.371  -14.173 1.00 79.22  ? 100 TYR C C      1 
ATOM   6335 O  O      . TYR C 1 100 ? 10.427  25.986  -15.347 1.00 81.13  ? 100 TYR C O      1 
ATOM   6336 C  CB     . TYR C 1 100 ? 9.896   28.733  -13.473 1.00 67.70  ? 100 TYR C CB     1 
ATOM   6337 C  CG     . TYR C 1 100 ? 10.856  29.156  -14.559 1.00 51.99  ? 100 TYR C CG     1 
ATOM   6338 C  CD1    . TYR C 1 100 ? 12.228  29.044  -14.381 1.00 65.32  ? 100 TYR C CD1    1 
ATOM   6339 C  CD2    . TYR C 1 100 ? 10.392  29.671  -15.761 1.00 60.48  ? 100 TYR C CD2    1 
ATOM   6340 C  CE1    . TYR C 1 100 ? 13.112  29.428  -15.372 1.00 65.23  ? 100 TYR C CE1    1 
ATOM   6341 C  CE2    . TYR C 1 100 ? 11.268  30.052  -16.761 1.00 66.40  ? 100 TYR C CE2    1 
ATOM   6342 C  CZ     . TYR C 1 100 ? 12.627  29.931  -16.559 1.00 53.49  ? 100 TYR C CZ     1 
ATOM   6343 O  OH     . TYR C 1 100 ? 13.503  30.313  -17.548 1.00 51.12  ? 100 TYR C OH     1 
ATOM   6344 H  H      . TYR C 1 100 ? 8.669   27.388  -11.848 1.00 83.60  ? 100 TYR C H      1 
ATOM   6345 H  HA     . TYR C 1 100 ? 8.644   27.434  -14.435 1.00 99.29  ? 100 TYR C HA     1 
ATOM   6346 H  HB2    . TYR C 1 100 ? 9.179   29.386  -13.435 1.00 81.45  ? 100 TYR C HB2    1 
ATOM   6347 H  HB3    . TYR C 1 100 ? 10.379  28.722  -12.632 1.00 81.45  ? 100 TYR C HB3    1 
ATOM   6348 H  HD1    . TYR C 1 100 ? 12.558  28.705  -13.580 1.00 78.60  ? 100 TYR C HD1    1 
ATOM   6349 H  HD2    . TYR C 1 100 ? 9.477   29.761  -15.897 1.00 72.79  ? 100 TYR C HD2    1 
ATOM   6350 H  HE1    . TYR C 1 100 ? 14.029  29.347  -15.238 1.00 78.49  ? 100 TYR C HE1    1 
ATOM   6351 H  HE2    . TYR C 1 100 ? 10.943  30.388  -17.564 1.00 79.90  ? 100 TYR C HE2    1 
ATOM   6352 H  HH     . TYR C 1 100 ? 13.077  30.547  -18.234 1.00 61.56  ? 100 TYR C HH     1 
ATOM   6353 N  N      . TYR C 1 101 ? 11.243  25.950  -13.251 1.00 74.35  ? 101 TYR C N      1 
ATOM   6354 C  CA     . TYR C 1 101 ? 12.304  25.024  -13.627 1.00 69.41  ? 101 TYR C CA     1 
ATOM   6355 C  C      . TYR C 1 101 ? 11.767  23.654  -14.022 1.00 80.42  ? 101 TYR C C      1 
ATOM   6356 O  O      . TYR C 1 101 ? 12.474  22.901  -14.698 1.00 94.36  ? 101 TYR C O      1 
ATOM   6357 C  CB     . TYR C 1 101 ? 13.313  24.872  -12.488 1.00 57.33  ? 101 TYR C CB     1 
ATOM   6358 C  CG     . TYR C 1 101 ? 14.322  26.000  -12.380 1.00 64.27  ? 101 TYR C CG     1 
ATOM   6359 C  CD1    . TYR C 1 101 ? 14.683  26.758  -13.490 1.00 68.93  ? 101 TYR C CD1    1 
ATOM   6360 C  CD2    . TYR C 1 101 ? 14.921  26.299  -11.166 1.00 77.02  ? 101 TYR C CD2    1 
ATOM   6361 C  CE1    . TYR C 1 101 ? 15.605  27.781  -13.391 1.00 62.55  ? 101 TYR C CE1    1 
ATOM   6362 C  CE2    . TYR C 1 101 ? 15.845  27.322  -11.058 1.00 80.06  ? 101 TYR C CE2    1 
ATOM   6363 C  CZ     . TYR C 1 101 ? 16.183  28.058  -12.173 1.00 64.62  ? 101 TYR C CZ     1 
ATOM   6364 O  OH     . TYR C 1 101 ? 17.102  29.076  -12.068 1.00 80.50  ? 101 TYR C OH     1 
ATOM   6365 H  H      . TYR C 1 101 ? 11.239  26.181  -12.423 1.00 89.43  ? 101 TYR C H      1 
ATOM   6366 H  HA     . TYR C 1 101 ? 12.773  25.395  -14.391 1.00 83.51  ? 101 TYR C HA     1 
ATOM   6367 H  HB2    . TYR C 1 101 ? 12.828  24.834  -11.649 1.00 69.01  ? 101 TYR C HB2    1 
ATOM   6368 H  HB3    . TYR C 1 101 ? 13.808  24.049  -12.622 1.00 69.01  ? 101 TYR C HB3    1 
ATOM   6369 H  HD1    . TYR C 1 101 ? 14.296  26.572  -14.315 1.00 82.93  ? 101 TYR C HD1    1 
ATOM   6370 H  HD2    . TYR C 1 101 ? 14.698  25.803  -10.412 1.00 92.65  ? 101 TYR C HD2    1 
ATOM   6371 H  HE1    . TYR C 1 101 ? 15.834  28.279  -14.142 1.00 75.27  ? 101 TYR C HE1    1 
ATOM   6372 H  HE2    . TYR C 1 101 ? 16.237  27.512  -10.236 1.00 96.29  ? 101 TYR C HE2    1 
ATOM   6373 H  HH     . TYR C 1 101 ? 17.221  29.434  -12.819 1.00 96.82  ? 101 TYR C HH     1 
ATOM   6374 N  N      . HIS C 1 102 ? 10.541  23.311  -13.621 1.00 77.99  ? 102 HIS C N      1 
ATOM   6375 C  CA     . HIS C 1 102 ? 9.975   22.038  -14.049 1.00 76.27  ? 102 HIS C CA     1 
ATOM   6376 C  C      . HIS C 1 102 ? 9.402   22.129  -15.459 1.00 85.16  ? 102 HIS C C      1 
ATOM   6377 O  O      . HIS C 1 102 ? 9.540   21.186  -16.247 1.00 90.49  ? 102 HIS C O      1 
ATOM   6378 C  CB     . HIS C 1 102 ? 8.888   21.578  -13.076 1.00 69.17  ? 102 HIS C CB     1 
ATOM   6379 C  CG     . HIS C 1 102 ? 8.189   20.326  -13.508 1.00 90.02  ? 102 HIS C CG     1 
ATOM   6380 N  ND1    . HIS C 1 102 ? 7.216   20.312  -14.484 1.00 91.36  ? 102 HIS C ND1    1 
ATOM   6381 C  CD2    . HIS C 1 102 ? 8.335   19.041  -13.104 1.00 90.53  ? 102 HIS C CD2    1 
ATOM   6382 C  CE1    . HIS C 1 102 ? 6.789   19.074  -14.660 1.00 84.26  ? 102 HIS C CE1    1 
ATOM   6383 N  NE2    . HIS C 1 102 ? 7.451   18.283  -13.835 1.00 79.06  ? 102 HIS C NE2    1 
ATOM   6384 H  H      . HIS C 1 102 ? 10.032  23.785  -13.115 1.00 93.80  ? 102 HIS C H      1 
ATOM   6385 H  HA     . HIS C 1 102 ? 10.681  21.374  -14.044 1.00 91.74  ? 102 HIS C HA     1 
ATOM   6386 H  HB2    . HIS C 1 102 ? 9.294   21.409  -12.211 1.00 83.22  ? 102 HIS C HB2    1 
ATOM   6387 H  HB3    . HIS C 1 102 ? 8.221   22.279  -12.999 1.00 83.22  ? 102 HIS C HB3    1 
ATOM   6388 H  HD2    . HIS C 1 102 ? 8.923   18.729  -12.455 1.00 108.86 ? 102 HIS C HD2    1 
ATOM   6389 H  HE1    . HIS C 1 102 ? 6.134   18.805  -15.262 1.00 101.33 ? 102 HIS C HE1    1 
ATOM   6390 H  HE2    . HIS C 1 102 ? 7.346   17.433  -13.765 1.00 95.08  ? 102 HIS C HE2    1 
ATOM   6391 N  N      . ARG C 1 103 ? 8.761   23.251  -15.799 1.00 87.87  ? 103 ARG C N      1 
ATOM   6392 C  CA     . ARG C 1 103 ? 8.231   23.404  -17.151 1.00 83.18  ? 103 ARG C CA     1 
ATOM   6393 C  C      . ARG C 1 103 ? 9.356   23.379  -18.183 1.00 74.07  ? 103 ARG C C      1 
ATOM   6394 O  O      . ARG C 1 103 ? 9.254   22.701  -19.212 1.00 76.65  ? 103 ARG C O      1 
ATOM   6395 C  CB     . ARG C 1 103 ? 7.424   24.697  -17.258 1.00 87.15  ? 103 ARG C CB     1 
ATOM   6396 C  CG     . ARG C 1 103 ? 6.142   24.714  -16.423 1.00 90.25  ? 103 ARG C CG     1 
ATOM   6397 C  CD     . ARG C 1 103 ? 5.507   26.089  -16.468 1.00 91.78  ? 103 ARG C CD     1 
ATOM   6398 N  NE     . ARG C 1 103 ? 5.269   26.467  -17.857 1.00 114.28 ? 103 ARG C NE     1 
ATOM   6399 C  CZ     . ARG C 1 103 ? 6.011   27.333  -18.544 1.00 95.99  ? 103 ARG C CZ     1 
ATOM   6400 N  NH1    . ARG C 1 103 ? 7.048   27.944  -17.979 1.00 90.09  ? 103 ARG C NH1    1 
ATOM   6401 N  NH2    . ARG C 1 103 ? 5.712   27.590  -19.810 1.00 80.28  ? 103 ARG C NH2    1 
ATOM   6402 H  H      . ARG C 1 103 ? 8.624   23.921  -15.278 1.00 105.66 ? 103 ARG C H      1 
ATOM   6403 H  HA     . ARG C 1 103 ? 7.632   22.665  -17.339 1.00 100.04 ? 103 ARG C HA     1 
ATOM   6404 H  HB2    . ARG C 1 103 ? 7.980   25.433  -16.957 1.00 104.80 ? 103 ARG C HB2    1 
ATOM   6405 H  HB3    . ARG C 1 103 ? 7.173   24.828  -18.185 1.00 104.80 ? 103 ARG C HB3    1 
ATOM   6406 H  HG2    . ARG C 1 103 ? 5.511   24.069  -16.781 1.00 108.51 ? 103 ARG C HG2    1 
ATOM   6407 H  HG3    . ARG C 1 103 ? 6.350   24.498  -15.501 1.00 108.51 ? 103 ARG C HG3    1 
ATOM   6408 H  HD2    . ARG C 1 103 ? 4.659   26.076  -15.997 1.00 110.35 ? 103 ARG C HD2    1 
ATOM   6409 H  HD3    . ARG C 1 103 ? 6.101   26.740  -16.063 1.00 110.35 ? 103 ARG C HD3    1 
ATOM   6410 H  HE     . ARG C 1 103 ? 4.603   26.104  -18.261 1.00 137.35 ? 103 ARG C HE     1 
ATOM   6411 H  HH11   . ARG C 1 103 ? 7.247   27.782  -17.159 1.00 108.33 ? 103 ARG C HH11   1 
ATOM   6412 H  HH12   . ARG C 1 103 ? 7.518   28.502  -18.435 1.00 108.33 ? 103 ARG C HH12   1 
ATOM   6413 H  HH21   . ARG C 1 103 ? 5.043   27.198  -20.182 1.00 96.55  ? 103 ARG C HH21   1 
ATOM   6414 H  HH22   . ARG C 1 103 ? 6.187   28.148  -20.259 1.00 96.55  ? 103 ARG C HH22   1 
ATOM   6415 N  N      . VAL C 1 104 ? 10.437  24.121  -17.927 1.00 76.71  ? 104 VAL C N      1 
ATOM   6416 C  CA     . VAL C 1 104 ? 11.606  24.136  -18.807 1.00 87.03  ? 104 VAL C CA     1 
ATOM   6417 C  C      . VAL C 1 104 ? 12.739  23.334  -18.173 1.00 89.97  ? 104 VAL C C      1 
ATOM   6418 O  O      . VAL C 1 104 ? 13.739  23.890  -17.703 1.00 93.03  ? 104 VAL C O      1 
ATOM   6419 C  CB     . VAL C 1 104 ? 12.049  25.573  -19.151 1.00 88.38  ? 104 VAL C CB     1 
ATOM   6420 C  CG1    . VAL C 1 104 ? 13.469  25.598  -19.729 1.00 92.75  ? 104 VAL C CG1    1 
ATOM   6421 C  CG2    . VAL C 1 104 ? 11.124  26.153  -20.208 1.00 81.83  ? 104 VAL C CG2    1 
ATOM   6422 H  H      . VAL C 1 104 ? 10.517  24.631  -17.239 1.00 92.27  ? 104 VAL C H      1 
ATOM   6423 H  HA     . VAL C 1 104 ? 11.367  23.700  -19.640 1.00 104.65 ? 104 VAL C HA     1 
ATOM   6424 H  HB     . VAL C 1 104 ? 12.023  26.094  -18.334 1.00 106.27 ? 104 VAL C HB     1 
ATOM   6425 H  HG11   . VAL C 1 104 ? 13.560  26.369  -20.311 1.00 111.52 ? 104 VAL C HG11   1 
ATOM   6426 H  HG12   . VAL C 1 104 ? 14.106  25.657  -19.000 1.00 111.52 ? 104 VAL C HG12   1 
ATOM   6427 H  HG13   . VAL C 1 104 ? 13.619  24.784  -20.235 1.00 111.52 ? 104 VAL C HG13   1 
ATOM   6428 H  HG21   . VAL C 1 104 ? 11.425  27.046  -20.436 1.00 98.41  ? 104 VAL C HG21   1 
ATOM   6429 H  HG22   . VAL C 1 104 ? 11.147  25.586  -20.994 1.00 98.41  ? 104 VAL C HG22   1 
ATOM   6430 H  HG23   . VAL C 1 104 ? 10.222  26.188  -19.853 1.00 98.41  ? 104 VAL C HG23   1 
ATOM   6431 N  N      . ALA C 1 105 ? 12.562  22.018  -18.109 1.00 86.37  ? 105 ALA C N      1 
ATOM   6432 C  CA     . ALA C 1 105 ? 13.590  21.104  -17.624 1.00 93.83  ? 105 ALA C CA     1 
ATOM   6433 C  C      . ALA C 1 105 ? 13.735  19.994  -18.652 1.00 98.98  ? 105 ALA C C      1 
ATOM   6434 O  O      . ALA C 1 105 ? 12.781  19.246  -18.882 1.00 102.59 ? 105 ALA C O      1 
ATOM   6435 C  CB     . ALA C 1 105 ? 13.225  20.534  -16.252 1.00 93.66  ? 105 ALA C CB     1 
ATOM   6436 H  H      . ALA C 1 105 ? 11.836  21.623  -18.347 1.00 103.85 ? 105 ALA C H      1 
ATOM   6437 H  HA     . ALA C 1 105 ? 14.437  21.568  -17.535 1.00 112.82 ? 105 ALA C HA     1 
ATOM   6438 H  HB1    . ALA C 1 105 ? 13.486  19.600  -16.219 1.00 112.61 ? 105 ALA C HB1    1 
ATOM   6439 H  HB2    . ALA C 1 105 ? 13.697  21.033  -15.567 1.00 112.61 ? 105 ALA C HB2    1 
ATOM   6440 H  HB3    . ALA C 1 105 ? 12.268  20.615  -16.120 1.00 112.61 ? 105 ALA C HB3    1 
ATOM   6441 N  N      . ARG C 1 106 ? 14.909  19.879  -19.271 1.00 100.72 ? 106 ARG C N      1 
ATOM   6442 C  CA     . ARG C 1 106 ? 15.079  18.815  -20.251 1.00 104.59 ? 106 ARG C CA     1 
ATOM   6443 C  C      . ARG C 1 106 ? 15.183  17.469  -19.532 1.00 115.00 ? 106 ARG C C      1 
ATOM   6444 O  O      . ARG C 1 106 ? 15.864  17.360  -18.508 1.00 102.02 ? 106 ARG C O      1 
ATOM   6445 C  CB     . ARG C 1 106 ? 16.311  19.058  -21.127 1.00 96.42  ? 106 ARG C CB     1 
ATOM   6446 C  CG     . ARG C 1 106 ? 16.148  20.243  -22.079 1.00 86.92  ? 106 ARG C CG     1 
ATOM   6447 C  CD     . ARG C 1 106 ? 17.292  20.372  -23.084 1.00 112.03 ? 106 ARG C CD     1 
ATOM   6448 N  NE     . ARG C 1 106 ? 17.322  19.264  -24.038 1.00 130.35 ? 106 ARG C NE     1 
ATOM   6449 C  CZ     . ARG C 1 106 ? 18.195  19.154  -25.037 1.00 121.44 ? 106 ARG C CZ     1 
ATOM   6450 N  NH1    . ARG C 1 106 ? 19.123  20.084  -25.224 1.00 104.72 ? 106 ARG C NH1    1 
ATOM   6451 N  NH2    . ARG C 1 106 ? 18.138  18.111  -25.854 1.00 127.36 ? 106 ARG C NH2    1 
ATOM   6452 H  H      . ARG C 1 106 ? 15.594  20.383  -19.148 1.00 121.08 ? 106 ARG C H      1 
ATOM   6453 H  HA     . ARG C 1 106 ? 14.311  18.790  -20.842 1.00 125.73 ? 106 ARG C HA     1 
ATOM   6454 H  HB2    . ARG C 1 106 ? 17.073  19.237  -20.554 1.00 115.92 ? 106 ARG C HB2    1 
ATOM   6455 H  HB3    . ARG C 1 106 ? 16.477  18.266  -21.662 1.00 115.92 ? 106 ARG C HB3    1 
ATOM   6456 H  HG2    . ARG C 1 106 ? 15.324  20.134  -22.578 1.00 104.52 ? 106 ARG C HG2    1 
ATOM   6457 H  HG3    . ARG C 1 106 ? 16.116  21.061  -21.559 1.00 104.52 ? 106 ARG C HG3    1 
ATOM   6458 H  HD2    . ARG C 1 106 ? 17.185  21.197  -23.583 1.00 134.65 ? 106 ARG C HD2    1 
ATOM   6459 H  HD3    . ARG C 1 106 ? 18.136  20.381  -22.606 1.00 134.65 ? 106 ARG C HD3    1 
ATOM   6460 H  HE     . ARG C 1 106 ? 16.735  18.642  -23.947 1.00 156.63 ? 106 ARG C HE     1 
ATOM   6461 H  HH11   . ARG C 1 106 ? 19.164  20.763  -24.698 1.00 125.88 ? 106 ARG C HH11   1 
ATOM   6462 H  HH12   . ARG C 1 106 ? 19.684  20.007  -25.871 1.00 125.88 ? 106 ARG C HH12   1 
ATOM   6463 H  HH21   . ARG C 1 106 ? 17.537  17.506  -25.739 1.00 153.05 ? 106 ARG C HH21   1 
ATOM   6464 H  HH22   . ARG C 1 106 ? 18.701  18.039  -26.500 1.00 153.05 ? 106 ARG C HH22   1 
ATOM   6465 N  N      . PRO C 1 107 ? 14.530  16.428  -20.050 1.00 128.05 ? 107 PRO C N      1 
ATOM   6466 C  CA     . PRO C 1 107 ? 14.590  15.111  -19.398 1.00 123.64 ? 107 PRO C CA     1 
ATOM   6467 C  C      . PRO C 1 107 ? 16.001  14.562  -19.229 1.00 111.44 ? 107 PRO C C      1 
ATOM   6468 O  O      . PRO C 1 107 ? 16.832  14.624  -20.137 1.00 110.28 ? 107 PRO C O      1 
ATOM   6469 C  CB     . PRO C 1 107 ? 13.751  14.227  -20.329 1.00 123.63 ? 107 PRO C CB     1 
ATOM   6470 C  CG     . PRO C 1 107 ? 12.797  15.172  -20.972 1.00 110.05 ? 107 PRO C CG     1 
ATOM   6471 C  CD     . PRO C 1 107 ? 13.539  16.459  -21.141 1.00 119.23 ? 107 PRO C CD     1 
ATOM   6472 H  HA     . PRO C 1 107 ? 14.187  15.175  -18.519 1.00 148.58 ? 107 PRO C HA     1 
ATOM   6473 H  HB2    . PRO C 1 107 ? 14.322  13.803  -20.990 1.00 148.57 ? 107 PRO C HB2    1 
ATOM   6474 H  HB3    . PRO C 1 107 ? 13.282  13.552  -19.814 1.00 148.57 ? 107 PRO C HB3    1 
ATOM   6475 H  HG2    . PRO C 1 107 ? 12.519  14.821  -21.833 1.00 132.28 ? 107 PRO C HG2    1 
ATOM   6476 H  HG3    . PRO C 1 107 ? 12.023  15.294  -20.399 1.00 132.28 ? 107 PRO C HG3    1 
ATOM   6477 H  HD2    . PRO C 1 107 ? 13.978  16.493  -22.005 1.00 143.29 ? 107 PRO C HD2    1 
ATOM   6478 H  HD3    . PRO C 1 107 ? 12.942  17.217  -21.042 1.00 143.29 ? 107 PRO C HD3    1 
ATOM   6479 N  N      . ARG C 1 108 ? 16.252  14.018  -18.037 1.00 99.66  ? 108 ARG C N      1 
ATOM   6480 C  CA     . ARG C 1 108 ? 17.518  13.399  -17.657 1.00 114.23 ? 108 ARG C CA     1 
ATOM   6481 C  C      . ARG C 1 108 ? 17.219  12.157  -16.820 1.00 120.28 ? 108 ARG C C      1 
ATOM   6482 O  O      . ARG C 1 108 ? 16.077  11.904  -16.428 1.00 121.77 ? 108 ARG C O      1 
ATOM   6483 C  CB     . ARG C 1 108 ? 18.442  14.382  -16.921 1.00 99.88  ? 108 ARG C CB     1 
ATOM   6484 C  CG     . ARG C 1 108 ? 19.779  13.778  -16.477 1.00 96.17  ? 108 ARG C CG     1 
ATOM   6485 C  CD     . ARG C 1 108 ? 20.883  14.795  -16.259 1.00 103.26 ? 108 ARG C CD     1 
ATOM   6486 N  NE     . ARG C 1 108 ? 21.287  15.499  -17.475 1.00 129.33 ? 108 ARG C NE     1 
ATOM   6487 C  CZ     . ARG C 1 108 ? 22.170  16.496  -17.499 1.00 138.56 ? 108 ARG C CZ     1 
ATOM   6488 N  NH1    . ARG C 1 108 ? 22.741  16.908  -16.374 1.00 123.03 ? 108 ARG C NH1    1 
ATOM   6489 N  NH2    . ARG C 1 108 ? 22.495  17.076  -18.646 1.00 130.72 ? 108 ARG C NH2    1 
ATOM   6490 H  H      . ARG C 1 108 ? 15.674  13.996  -17.401 1.00 119.80 ? 108 ARG C H      1 
ATOM   6491 H  HA     . ARG C 1 108 ? 17.994  13.112  -18.452 1.00 137.29 ? 108 ARG C HA     1 
ATOM   6492 H  HB2    . ARG C 1 108 ? 18.637  15.126  -17.513 1.00 120.07 ? 108 ARG C HB2    1 
ATOM   6493 H  HB3    . ARG C 1 108 ? 17.985  14.702  -16.127 1.00 120.07 ? 108 ARG C HB3    1 
ATOM   6494 H  HG2    . ARG C 1 108 ? 19.644  13.309  -15.639 1.00 115.62 ? 108 ARG C HG2    1 
ATOM   6495 H  HG3    . ARG C 1 108 ? 20.081  13.159  -17.159 1.00 115.62 ? 108 ARG C HG3    1 
ATOM   6496 H  HD2    . ARG C 1 108 ? 20.575  15.459  -15.623 1.00 124.13 ? 108 ARG C HD2    1 
ATOM   6497 H  HD3    . ARG C 1 108 ? 21.664  14.338  -15.910 1.00 124.13 ? 108 ARG C HD3    1 
ATOM   6498 H  HE     . ARG C 1 108 ? 20.933  15.255  -18.220 1.00 155.41 ? 108 ARG C HE     1 
ATOM   6499 H  HH11   . ARG C 1 108 ? 22.540  16.531  -15.627 1.00 147.85 ? 108 ARG C HH11   1 
ATOM   6500 H  HH12   . ARG C 1 108 ? 23.311  17.552  -16.392 1.00 147.85 ? 108 ARG C HH12   1 
ATOM   6501 H  HH21   . ARG C 1 108 ? 22.136  16.809  -19.380 1.00 157.08 ? 108 ARG C HH21   1 
ATOM   6502 H  HH22   . ARG C 1 108 ? 23.066  17.719  -18.656 1.00 157.08 ? 108 ARG C HH22   1 
ATOM   6503 N  N      . LYS C 1 109 ? 18.264  11.378  -16.549 1.00 113.97 ? 109 LYS C N      1 
ATOM   6504 C  CA     . LYS C 1 109 ? 18.150  10.090  -15.868 1.00 112.09 ? 109 LYS C CA     1 
ATOM   6505 C  C      . LYS C 1 109 ? 17.905  10.255  -14.371 1.00 113.25 ? 109 LYS C C      1 
ATOM   6506 O  O      . LYS C 1 109 ? 18.836  10.459  -13.589 1.00 109.01 ? 109 LYS C O      1 
ATOM   6507 C  CB     . LYS C 1 109 ? 19.414  9.271   -16.109 1.00 102.45 ? 109 LYS C CB     1 
ATOM   6508 H  H      . LYS C 1 109 ? 19.074  11.580  -16.756 1.00 136.98 ? 109 LYS C H      1 
ATOM   6509 H  HA     . LYS C 1 109 ? 17.369  9.640   -16.227 1.00 134.72 ? 109 LYS C HA     1 
ATOM   6510 N  N      . MET C 1 110 ? 16.638  10.157  -13.975 1.00 113.68 ? 110 MET C N      1 
ATOM   6511 C  CA     . MET C 1 110 ? 16.261  10.086  -12.570 1.00 106.13 ? 110 MET C CA     1 
ATOM   6512 C  C      . MET C 1 110 ? 16.446  8.657   -12.080 1.00 111.82 ? 110 MET C C      1 
ATOM   6513 O  O      . MET C 1 110 ? 16.080  7.702   -12.770 1.00 124.08 ? 110 MET C O      1 
ATOM   6514 C  CB     . MET C 1 110 ? 14.812  10.532  -12.375 1.00 154.08 ? 110 MET C CB     1 
ATOM   6515 C  CG     . MET C 1 110 ? 14.537  11.993  -12.713 1.00 168.34 ? 110 MET C CG     1 
ATOM   6516 S  SD     . MET C 1 110 ? 15.437  13.167  -11.667 1.00 130.93 ? 110 MET C SD     1 
ATOM   6517 C  CE     . MET C 1 110 ? 17.095  13.134  -12.342 1.00 156.66 ? 110 MET C CE     1 
ATOM   6518 H  H      . MET C 1 110 ? 15.966  10.129  -14.512 1.00 136.63 ? 110 MET C H      1 
ATOM   6519 H  HA     . MET C 1 110 ? 16.814  10.687  -12.047 1.00 127.57 ? 110 MET C HA     1 
ATOM   6520 H  HB2    . MET C 1 110 ? 14.244  9.990   -12.945 1.00 185.11 ? 110 MET C HB2    1 
ATOM   6521 H  HB3    . MET C 1 110 ? 14.572  10.398  -11.445 1.00 185.11 ? 110 MET C HB3    1 
ATOM   6522 H  HG2    . MET C 1 110 ? 14.798  12.155  -13.632 1.00 202.23 ? 110 MET C HG2    1 
ATOM   6523 H  HG3    . MET C 1 110 ? 13.589  12.165  -12.602 1.00 202.23 ? 110 MET C HG3    1 
ATOM   6524 H  HE1    . MET C 1 110 ? 17.417  14.044  -12.433 1.00 188.21 ? 110 MET C HE1    1 
ATOM   6525 H  HE2    . MET C 1 110 ? 17.671  12.637  -11.741 1.00 188.21 ? 110 MET C HE2    1 
ATOM   6526 H  HE3    . MET C 1 110 ? 17.073  12.702  -13.211 1.00 188.21 ? 110 MET C HE3    1 
ATOM   6527 N  N      . LEU C 1 111 ? 16.994  8.510   -10.876 1.00 115.05 ? 111 LEU C N      1 
ATOM   6528 C  CA     . LEU C 1 111 ? 17.429  7.210   -10.397 1.00 101.51 ? 111 LEU C CA     1 
ATOM   6529 C  C      . LEU C 1 111 ? 16.425  6.667   -9.383  1.00 89.78  ? 111 LEU C C      1 
ATOM   6530 O  O      . LEU C 1 111 ? 15.394  7.278   -9.094  1.00 96.15  ? 111 LEU C O      1 
ATOM   6531 C  CB     . LEU C 1 111 ? 18.822  7.309   -9.769  1.00 92.64  ? 111 LEU C CB     1 
ATOM   6532 C  CG     . LEU C 1 111 ? 19.902  8.045   -10.570 1.00 107.50 ? 111 LEU C CG     1 
ATOM   6533 C  CD1    . LEU C 1 111 ? 21.244  7.997   -9.833  1.00 105.82 ? 111 LEU C CD1    1 
ATOM   6534 C  CD2    . LEU C 1 111 ? 20.033  7.521   -11.993 1.00 103.07 ? 111 LEU C CD2    1 
ATOM   6535 H  H      . LEU C 1 111 ? 17.122  9.155   -10.321 1.00 138.27 ? 111 LEU C H      1 
ATOM   6536 H  HA     . LEU C 1 111 ? 17.472  6.603   -11.152 1.00 122.03 ? 111 LEU C HA     1 
ATOM   6537 H  HB2    . LEU C 1 111 ? 18.734  7.773   -8.922  1.00 111.38 ? 111 LEU C HB2    1 
ATOM   6538 H  HB3    . LEU C 1 111 ? 19.146  6.407   -9.622  1.00 111.38 ? 111 LEU C HB3    1 
ATOM   6539 H  HG     . LEU C 1 111 ? 19.633  8.973   -10.649 1.00 129.22 ? 111 LEU C HG     1 
ATOM   6540 H  HD11   . LEU C 1 111 ? 21.902  8.495   -10.343 1.00 127.20 ? 111 LEU C HD11   1 
ATOM   6541 H  HD12   . LEU C 1 111 ? 21.136  8.395   -8.955  1.00 127.20 ? 111 LEU C HD12   1 
ATOM   6542 H  HD13   . LEU C 1 111 ? 21.524  7.073   -9.746  1.00 127.20 ? 111 LEU C HD13   1 
ATOM   6543 H  HD21   . LEU C 1 111 ? 20.822  7.909   -12.402 1.00 123.90 ? 111 LEU C HD21   1 
ATOM   6544 H  HD22   . LEU C 1 111 ? 20.115  6.555   -11.968 1.00 123.90 ? 111 LEU C HD22   1 
ATOM   6545 H  HD23   . LEU C 1 111 ? 19.243  7.773   -12.496 1.00 123.90 ? 111 LEU C HD23   1 
ATOM   6546 N  N      . CYS C 1 112 ? 16.729  5.486   -8.847  1.00 97.43  ? 112 CYS C N      1 
ATOM   6547 C  CA     . CYS C 1 112 ? 15.924  4.895   -7.785  1.00 97.39  ? 112 CYS C CA     1 
ATOM   6548 C  C      . CYS C 1 112 ? 14.479  4.720   -8.242  1.00 94.75  ? 112 CYS C C      1 
ATOM   6549 O  O      . CYS C 1 112 ? 14.166  3.775   -8.973  1.00 109.80 ? 112 CYS C O      1 
ATOM   6550 C  CB     . CYS C 1 112 ? 15.992  5.754   -6.522  1.00 88.47  ? 112 CYS C CB     1 
ATOM   6551 S  SG     . CYS C 1 112 ? 17.530  5.570   -5.597  1.00 102.79 ? 112 CYS C SG     1 
ATOM   6552 H  H      . CYS C 1 112 ? 17.401  5.005   -9.084  1.00 117.13 ? 112 CYS C H      1 
ATOM   6553 H  HA     . CYS C 1 112 ? 16.278  4.019   -7.566  1.00 117.09 ? 112 CYS C HA     1 
ATOM   6554 H  HB2    . CYS C 1 112 ? 15.908  6.687   -6.775  1.00 106.38 ? 112 CYS C HB2    1 
ATOM   6555 H  HB3    . CYS C 1 112 ? 15.262  5.503   -5.935  1.00 106.38 ? 112 CYS C HB3    1 
ATOM   6556 H  HG     . CYS C 1 112 ? 17.492  6.281   -4.631  1.00 123.57 ? 112 CYS C HG     1 
ATOM   6557 N  N      . ARG C 1 113 ? 13.596  5.635   -7.831  1.00 86.48  ? 113 ARG C N      1 
ATOM   6558 C  CA     . ARG C 1 113 ? 12.173  5.490   -8.128  1.00 88.75  ? 113 ARG C CA     1 
ATOM   6559 C  C      . ARG C 1 113 ? 11.922  5.407   -9.628  1.00 89.78  ? 113 ARG C C      1 
ATOM   6560 O  O      . ARG C 1 113 ? 11.061  4.640   -10.075 1.00 99.59  ? 113 ARG C O      1 
ATOM   6561 C  CB     . ARG C 1 113 ? 11.397  6.657   -7.522  1.00 99.03  ? 113 ARG C CB     1 
ATOM   6562 C  CG     . ARG C 1 113 ? 9.887   6.592   -7.709  1.00 108.64 ? 113 ARG C CG     1 
ATOM   6563 C  CD     . ARG C 1 113 ? 9.258   5.428   -6.962  1.00 99.64  ? 113 ARG C CD     1 
ATOM   6564 N  NE     . ARG C 1 113 ? 7.827   5.641   -6.760  1.00 114.24 ? 113 ARG C NE     1 
ATOM   6565 C  CZ     . ARG C 1 113 ? 6.898   5.458   -7.695  1.00 114.26 ? 113 ARG C CZ     1 
ATOM   6566 N  NH1    . ARG C 1 113 ? 7.239   5.057   -8.912  1.00 120.48 ? 113 ARG C NH1    1 
ATOM   6567 N  NH2    . ARG C 1 113 ? 5.623   5.682   -7.411  1.00 107.47 ? 113 ARG C NH2    1 
ATOM   6568 H  H      . ARG C 1 113 ? 13.792  6.342   -7.382  1.00 103.99 ? 113 ARG C H      1 
ATOM   6569 H  HA     . ARG C 1 113 ? 11.854  4.667   -7.727  1.00 106.71 ? 113 ARG C HA     1 
ATOM   6570 H  HB2    . ARG C 1 113 ? 11.571  6.678   -6.568  1.00 119.06 ? 113 ARG C HB2    1 
ATOM   6571 H  HB3    . ARG C 1 113 ? 11.706  7.478   -7.935  1.00 119.06 ? 113 ARG C HB3    1 
ATOM   6572 H  HG2    . ARG C 1 113 ? 9.491   7.413   -7.376  1.00 130.59 ? 113 ARG C HG2    1 
ATOM   6573 H  HG3    . ARG C 1 113 ? 9.688   6.487   -8.653  1.00 130.59 ? 113 ARG C HG3    1 
ATOM   6574 H  HD2    . ARG C 1 113 ? 9.377   4.614   -7.476  1.00 119.78 ? 113 ARG C HD2    1 
ATOM   6575 H  HD3    . ARG C 1 113 ? 9.680   5.337   -6.094  1.00 119.78 ? 113 ARG C HD3    1 
ATOM   6576 H  HE     . ARG C 1 113 ? 7.567   5.901   -5.983  1.00 137.31 ? 113 ARG C HE     1 
ATOM   6577 H  HH11   . ARG C 1 113 ? 8.065   4.913   -9.101  1.00 144.79 ? 113 ARG C HH11   1 
ATOM   6578 H  HH12   . ARG C 1 113 ? 6.634   4.941   -9.512  1.00 144.79 ? 113 ARG C HH12   1 
ATOM   6579 H  HH21   . ARG C 1 113 ? 5.397   5.945   -6.624  1.00 129.18 ? 113 ARG C HH21   1 
ATOM   6580 H  HH22   . ARG C 1 113 ? 5.021   5.565   -8.014  1.00 129.18 ? 113 ARG C HH22   1 
ATOM   6581 N  N      . GLY C 1 114 ? 12.645  6.197   -10.419 1.00 91.57  ? 114 GLY C N      1 
ATOM   6582 C  CA     . GLY C 1 114 ? 12.527  6.083   -11.858 1.00 106.35 ? 114 GLY C CA     1 
ATOM   6583 C  C      . GLY C 1 114 ? 13.634  5.211   -12.404 1.00 102.94 ? 114 GLY C C      1 
ATOM   6584 O  O      . GLY C 1 114 ? 14.328  5.588   -13.353 1.00 98.72  ? 114 GLY C O      1 
ATOM   6585 H  H      . GLY C 1 114 ? 13.200  6.795   -10.146 1.00 110.10 ? 114 GLY C H      1 
ATOM   6586 H  HA2    . GLY C 1 114 ? 11.672  5.688   -12.088 1.00 127.84 ? 114 GLY C HA2    1 
ATOM   6587 H  HA3    . GLY C 1 114 ? 12.588  6.962   -12.265 1.00 127.84 ? 114 GLY C HA3    1 
ATOM   6588 N  N      . GLY C 1 115 ? 13.755  4.007   -11.844 1.00 103.94 ? 115 GLY C N      1 
ATOM   6589 C  CA     . GLY C 1 115 ? 14.841  3.110   -12.183 1.00 98.82  ? 115 GLY C CA     1 
ATOM   6590 C  C      . GLY C 1 115 ? 16.137  3.870   -12.355 1.00 99.91  ? 115 GLY C C      1 
ATOM   6591 O  O      . GLY C 1 115 ? 16.709  4.393   -11.394 1.00 102.36 ? 115 GLY C O      1 
ATOM   6592 H  H      . GLY C 1 115 ? 13.212  3.688   -11.258 1.00 124.95 ? 115 GLY C H      1 
ATOM   6593 H  HA2    . GLY C 1 115 ? 14.955  2.454   -11.478 1.00 118.81 ? 115 GLY C HA2    1 
ATOM   6594 H  HA3    . GLY C 1 115 ? 14.637  2.650   -13.013 1.00 118.81 ? 115 GLY C HA3    1 
ATOM   6595 N  N      . GLY C 1 116 ? 16.602  3.925   -13.596 1.00 111.08 ? 116 GLY C N      1 
ATOM   6596 C  CA     . GLY C 1 116 ? 17.749  4.713   -13.993 1.00 95.83  ? 116 GLY C CA     1 
ATOM   6597 C  C      . GLY C 1 116 ? 17.426  5.275   -15.361 1.00 110.57 ? 116 GLY C C      1 
ATOM   6598 O  O      . GLY C 1 116 ? 18.315  5.509   -16.186 1.00 109.04 ? 116 GLY C O      1 
ATOM   6599 H  H      . GLY C 1 116 ? 16.252  3.495   -14.254 1.00 133.51 ? 116 GLY C H      1 
ATOM   6600 H  HA2    . GLY C 1 116 ? 17.903  5.437   -13.365 1.00 115.21 ? 116 GLY C HA2    1 
ATOM   6601 H  HA3    . GLY C 1 116 ? 18.545  4.162   -14.041 1.00 115.21 ? 116 GLY C HA3    1 
ATOM   6602 N  N      . ARG C 1 117 ? 16.135  5.503   -15.594 1.00 121.02 ? 117 ARG C N      1 
ATOM   6603 C  CA     . ARG C 1 117 ? 15.621  5.876   -16.902 1.00 114.00 ? 117 ARG C CA     1 
ATOM   6604 C  C      . ARG C 1 117 ? 15.533  7.387   -17.065 1.00 117.53 ? 117 ARG C C      1 
ATOM   6605 O  O      . ARG C 1 117 ? 15.314  8.134   -16.107 1.00 133.16 ? 117 ARG C O      1 
ATOM   6606 C  CB     . ARG C 1 117 ? 14.242  5.252   -17.130 1.00 106.42 ? 117 ARG C CB     1 
ATOM   6607 H  H      . ARG C 1 117 ? 15.523  5.445   -14.991 1.00 145.45 ? 117 ARG C H      1 
ATOM   6608 H  HA     . ARG C 1 117 ? 16.233  5.546   -17.579 1.00 137.02 ? 117 ARG C HA     1 
ATOM   6609 N  N      . ILE C 1 118 ? 15.716  7.822   -18.307 1.00 112.62 ? 118 ILE C N      1 
ATOM   6610 C  CA     . ILE C 1 118 ? 15.702  9.234   -18.675 1.00 124.14 ? 118 ILE C CA     1 
ATOM   6611 C  C      . ILE C 1 118 ? 14.272  9.749   -18.771 1.00 129.03 ? 118 ILE C C      1 
ATOM   6612 O  O      . ILE C 1 118 ? 13.461  9.233   -19.547 1.00 120.62 ? 118 ILE C O      1 
ATOM   6613 C  CB     . ILE C 1 118 ? 16.468  9.440   -19.992 1.00 120.71 ? 118 ILE C CB     1 
ATOM   6614 C  CG1    . ILE C 1 118 ? 17.971  9.486   -19.702 1.00 114.67 ? 118 ILE C CG1    1 
ATOM   6615 C  CG2    . ILE C 1 118 ? 15.999  10.701  -20.708 1.00 110.11 ? 118 ILE C CG2    1 
ATOM   6616 C  CD1    . ILE C 1 118 ? 18.533  8.188   -19.160 1.00 97.54  ? 118 ILE C CD1    1 
ATOM   6617 H  H      . ILE C 1 118 ? 15.856  7.302   -18.977 1.00 135.36 ? 118 ILE C H      1 
ATOM   6618 H  HA     . ILE C 1 118 ? 16.127  9.746   -17.969 1.00 149.18 ? 118 ILE C HA     1 
ATOM   6619 H  HB     . ILE C 1 118 ? 16.285  8.693   -20.584 1.00 145.07 ? 118 ILE C HB     1 
ATOM   6620 H  HG12   . ILE C 1 118 ? 18.441  9.690   -20.526 1.00 137.82 ? 118 ILE C HG12   1 
ATOM   6621 H  HG13   . ILE C 1 118 ? 18.140  10.179  -19.044 1.00 137.82 ? 118 ILE C HG13   1 
ATOM   6622 H  HG21   . ILE C 1 118 ? 16.644  10.934  -21.394 1.00 132.35 ? 118 ILE C HG21   1 
ATOM   6623 H  HG22   . ILE C 1 118 ? 15.134  10.531  -21.113 1.00 132.35 ? 118 ILE C HG22   1 
ATOM   6624 H  HG23   . ILE C 1 118 ? 15.927  11.422  -20.063 1.00 132.35 ? 118 ILE C HG23   1 
ATOM   6625 H  HD11   . ILE C 1 118 ? 19.500  8.207   -19.234 1.00 117.26 ? 118 ILE C HD11   1 
ATOM   6626 H  HD12   . ILE C 1 118 ? 18.274  8.096   -18.230 1.00 117.26 ? 118 ILE C HD12   1 
ATOM   6627 H  HD13   . ILE C 1 118 ? 18.176  7.449   -19.677 1.00 117.26 ? 118 ILE C HD13   1 
ATOM   6628 N  N      . GLN C 1 119 ? 13.960  10.763  -17.966 1.00 128.87 ? 119 GLN C N      1 
ATOM   6629 C  CA     . GLN C 1 119 ? 12.678  11.455  -18.008 1.00 130.55 ? 119 GLN C CA     1 
ATOM   6630 C  C      . GLN C 1 119 ? 12.835  12.752  -17.227 1.00 122.03 ? 119 GLN C C      1 
ATOM   6631 O  O      . GLN C 1 119 ? 13.785  12.918  -16.457 1.00 118.81 ? 119 GLN C O      1 
ATOM   6632 C  CB     . GLN C 1 119 ? 11.538  10.609  -17.433 1.00 118.25 ? 119 GLN C CB     1 
ATOM   6633 C  CG     . GLN C 1 119 ? 11.710  10.206  -15.979 1.00 102.10 ? 119 GLN C CG     1 
ATOM   6634 C  CD     . GLN C 1 119 ? 10.566  9.342   -15.486 1.00 110.94 ? 119 GLN C CD     1 
ATOM   6635 O  OE1    . GLN C 1 119 ? 9.706   8.929   -16.264 1.00 110.68 ? 119 GLN C OE1    1 
ATOM   6636 N  NE2    . GLN C 1 119 ? 10.539  9.078   -14.185 1.00 115.44 ? 119 GLN C NE2    1 
ATOM   6637 H  H      . GLN C 1 119 ? 14.493  11.078  -17.368 1.00 154.86 ? 119 GLN C H      1 
ATOM   6638 H  HA     . GLN C 1 119 ? 12.450  11.662  -18.928 1.00 156.88 ? 119 GLN C HA     1 
ATOM   6639 H  HB2    . GLN C 1 119 ? 10.715  11.117  -17.499 1.00 142.12 ? 119 GLN C HB2    1 
ATOM   6640 H  HB3    . GLN C 1 119 ? 11.468  9.794   -17.954 1.00 142.12 ? 119 GLN C HB3    1 
ATOM   6641 H  HG2    . GLN C 1 119 ? 12.533  9.701   -15.884 1.00 122.73 ? 119 GLN C HG2    1 
ATOM   6642 H  HG3    . GLN C 1 119 ? 11.745  11.004  -15.430 1.00 122.73 ? 119 GLN C HG3    1 
ATOM   6643 H  HE21   . GLN C 1 119 ? 11.151  9.394   -13.669 1.00 138.74 ? 119 GLN C HE21   1 
ATOM   6644 H  HE22   . GLN C 1 119 ? 9.910   8.592   -13.857 1.00 138.74 ? 119 GLN C HE22   1 
ATOM   6645 N  N      . LYS C 1 120 ? 11.892  13.667  -17.427 1.00 115.89 ? 120 LYS C N      1 
ATOM   6646 C  CA     . LYS C 1 120 ? 11.959  14.948  -16.740 1.00 111.99 ? 120 LYS C CA     1 
ATOM   6647 C  C      . LYS C 1 120 ? 11.665  14.763  -15.252 1.00 108.65 ? 120 LYS C C      1 
ATOM   6648 O  O      . LYS C 1 120 ? 10.769  13.995  -14.886 1.00 114.59 ? 120 LYS C O      1 
ATOM   6649 C  CB     . LYS C 1 120 ? 10.975  15.948  -17.346 1.00 109.49 ? 120 LYS C CB     1 
ATOM   6650 C  CG     . LYS C 1 120 ? 9.530   15.481  -17.376 1.00 109.27 ? 120 LYS C CG     1 
ATOM   6651 C  CD     . LYS C 1 120 ? 8.564   16.661  -17.406 1.00 100.91 ? 120 LYS C CD     1 
ATOM   6652 C  CE     . LYS C 1 120 ? 8.815   17.580  -18.595 1.00 109.42 ? 120 LYS C CE     1 
ATOM   6653 N  NZ     . LYS C 1 120 ? 8.639   16.881  -19.897 1.00 113.67 ? 120 LYS C NZ     1 
ATOM   6654 H  H      . LYS C 1 120 ? 11.214  13.573  -17.947 1.00 139.28 ? 120 LYS C H      1 
ATOM   6655 H  HA     . LYS C 1 120 ? 12.852  15.314  -16.835 1.00 134.60 ? 120 LYS C HA     1 
ATOM   6656 H  HB2    . LYS C 1 120 ? 11.007  16.766  -16.824 1.00 131.61 ? 120 LYS C HB2    1 
ATOM   6657 H  HB3    . LYS C 1 120 ? 11.243  16.128  -18.261 1.00 131.61 ? 120 LYS C HB3    1 
ATOM   6658 H  HG2    . LYS C 1 120 ? 9.381   14.945  -18.171 1.00 131.34 ? 120 LYS C HG2    1 
ATOM   6659 H  HG3    . LYS C 1 120 ? 9.345   14.956  -16.582 1.00 131.34 ? 120 LYS C HG3    1 
ATOM   6660 H  HD2    . LYS C 1 120 ? 7.656   16.327  -17.469 1.00 121.31 ? 120 LYS C HD2    1 
ATOM   6661 H  HD3    . LYS C 1 120 ? 8.672   17.181  -16.595 1.00 121.31 ? 120 LYS C HD3    1 
ATOM   6662 H  HE2    . LYS C 1 120 ? 8.188   18.319  -18.563 1.00 131.52 ? 120 LYS C HE2    1 
ATOM   6663 H  HE3    . LYS C 1 120 ? 9.725   17.914  -18.552 1.00 131.52 ? 120 LYS C HE3    1 
ATOM   6664 H  HZ1    . LYS C 1 120 ? 7.810   16.566  -19.964 1.00 136.62 ? 120 LYS C HZ1    1 
ATOM   6665 H  HZ2    . LYS C 1 120 ? 8.789   17.445  -20.568 1.00 136.62 ? 120 LYS C HZ2    1 
ATOM   6666 H  HZ3    . LYS C 1 120 ? 9.212   16.202  -19.957 1.00 136.62 ? 120 LYS C HZ3    1 
ATOM   6667 N  N      . PRO C 1 121 ? 12.400  15.441  -14.370 1.00 88.23  ? 121 PRO C N      1 
ATOM   6668 C  CA     . PRO C 1 121 ? 12.135  15.287  -12.935 1.00 89.60  ? 121 PRO C CA     1 
ATOM   6669 C  C      . PRO C 1 121 ? 10.768  15.836  -12.564 1.00 94.11  ? 121 PRO C C      1 
ATOM   6670 O  O      . PRO C 1 121 ? 10.323  16.860  -13.087 1.00 91.64  ? 121 PRO C O      1 
ATOM   6671 C  CB     . PRO C 1 121 ? 13.260  16.094  -12.275 1.00 101.33 ? 121 PRO C CB     1 
ATOM   6672 C  CG     . PRO C 1 121 ? 13.680  17.080  -13.309 1.00 113.99 ? 121 PRO C CG     1 
ATOM   6673 C  CD     . PRO C 1 121 ? 13.484  16.405  -14.633 1.00 85.89  ? 121 PRO C CD     1 
ATOM   6674 H  HA     . PRO C 1 121 ? 12.200  14.357  -12.669 1.00 107.73 ? 121 PRO C HA     1 
ATOM   6675 H  HB2    . PRO C 1 121 ? 12.924  16.543  -11.483 1.00 121.81 ? 121 PRO C HB2    1 
ATOM   6676 H  HB3    . PRO C 1 121 ? 13.994  15.506  -12.038 1.00 121.81 ? 121 PRO C HB3    1 
ATOM   6677 H  HG2    . PRO C 1 121 ? 13.128  17.875  -13.244 1.00 137.00 ? 121 PRO C HG2    1 
ATOM   6678 H  HG3    . PRO C 1 121 ? 14.613  17.312  -13.177 1.00 137.00 ? 121 PRO C HG3    1 
ATOM   6679 H  HD2    . PRO C 1 121 ? 13.218  17.046  -15.311 1.00 103.29 ? 121 PRO C HD2    1 
ATOM   6680 H  HD3    . PRO C 1 121 ? 14.293  15.947  -14.910 1.00 103.29 ? 121 PRO C HD3    1 
ATOM   6681 N  N      . SER C 1 122 ? 10.100  15.136  -11.652 1.00 83.87  ? 122 SER C N      1 
ATOM   6682 C  CA     . SER C 1 122 ? 8.786   15.556  -11.198 1.00 85.49  ? 122 SER C CA     1 
ATOM   6683 C  C      . SER C 1 122 ? 8.887   16.907  -10.488 1.00 85.21  ? 122 SER C C      1 
ATOM   6684 O  O      . SER C 1 122 ? 9.972   17.388  -10.148 1.00 76.01  ? 122 SER C O      1 
ATOM   6685 C  CB     . SER C 1 122 ? 8.173   14.498  -10.282 1.00 79.26  ? 122 SER C CB     1 
ATOM   6686 O  OG     . SER C 1 122 ? 8.966   14.288  -9.128  1.00 78.90  ? 122 SER C OG     1 
ATOM   6687 H  H      . SER C 1 122 ? 10.387  14.414  -11.281 1.00 100.86 ? 122 SER C H      1 
ATOM   6688 H  HA     . SER C 1 122 ? 8.193   15.661  -11.959 1.00 102.80 ? 122 SER C HA     1 
ATOM   6689 H  HB2    . SER C 1 122 ? 7.292   14.796  -10.006 1.00 95.33  ? 122 SER C HB2    1 
ATOM   6690 H  HB3    . SER C 1 122 ? 8.103   13.663  -10.771 1.00 95.33  ? 122 SER C HB3    1 
ATOM   6691 H  HG     . SER C 1 122 ? 9.720   13.989  -9.348  1.00 94.89  ? 122 SER C HG     1 
ATOM   6692 N  N      . LEU C 1 123 ? 7.726   17.528  -10.272 1.00 85.18  ? 123 LEU C N      1 
ATOM   6693 C  CA     . LEU C 1 123 ? 7.696   18.823  -9.602  1.00 81.73  ? 123 LEU C CA     1 
ATOM   6694 C  C      . LEU C 1 123 ? 8.245   18.727  -8.184  1.00 74.63  ? 123 LEU C C      1 
ATOM   6695 O  O      . LEU C 1 123 ? 8.846   19.686  -7.683  1.00 86.09  ? 123 LEU C O      1 
ATOM   6696 C  CB     . LEU C 1 123 ? 6.266   19.367  -9.588  1.00 78.76  ? 123 LEU C CB     1 
ATOM   6697 C  CG     . LEU C 1 123 ? 6.066   20.767  -9.004  1.00 75.33  ? 123 LEU C CG     1 
ATOM   6698 C  CD1    . LEU C 1 123 ? 6.823   21.788  -9.842  1.00 71.84  ? 123 LEU C CD1    1 
ATOM   6699 C  CD2    . LEU C 1 123 ? 4.587   21.123  -8.929  1.00 66.09  ? 123 LEU C CD2    1 
ATOM   6700 H  H      . LEU C 1 123 ? 6.953   17.226  -10.500 1.00 102.43 ? 123 LEU C H      1 
ATOM   6701 H  HA     . LEU C 1 123 ? 8.250   19.448  -10.095 1.00 98.30  ? 123 LEU C HA     1 
ATOM   6702 H  HB2    . LEU C 1 123 ? 5.947   19.393  -10.503 1.00 94.72  ? 123 LEU C HB2    1 
ATOM   6703 H  HB3    . LEU C 1 123 ? 5.721   18.760  -9.063  1.00 94.72  ? 123 LEU C HB3    1 
ATOM   6704 H  HG     . LEU C 1 123 ? 6.414   20.788  -8.099  1.00 90.61  ? 123 LEU C HG     1 
ATOM   6705 H  HD11   . LEU C 1 123 ? 6.583   22.680  -9.546  1.00 86.42  ? 123 LEU C HD11   1 
ATOM   6706 H  HD12   . LEU C 1 123 ? 7.776   21.646  -9.727  1.00 86.42  ? 123 LEU C HD12   1 
ATOM   6707 H  HD13   . LEU C 1 123 ? 6.582   21.673  -10.774 1.00 86.42  ? 123 LEU C HD13   1 
ATOM   6708 H  HD21   . LEU C 1 123 ? 4.496   22.025  -8.584  1.00 79.52  ? 123 LEU C HD21   1 
ATOM   6709 H  HD22   . LEU C 1 123 ? 4.203   21.068  -9.818  1.00 79.52  ? 123 LEU C HD22   1 
ATOM   6710 H  HD23   . LEU C 1 123 ? 4.141   20.496  -8.337  1.00 79.52  ? 123 LEU C HD23   1 
ATOM   6711 N  N      . ALA C 1 124 ? 8.056   17.582  -7.524  1.00 60.09  ? 124 ALA C N      1 
ATOM   6712 C  CA     . ALA C 1 124 ? 8.576   17.412  -6.172  1.00 71.49  ? 124 ALA C CA     1 
ATOM   6713 C  C      . ALA C 1 124 ? 10.098  17.491  -6.152  1.00 70.61  ? 124 ALA C C      1 
ATOM   6714 O  O      . ALA C 1 124 ? 10.684  18.137  -5.274  1.00 85.47  ? 124 ALA C O      1 
ATOM   6715 C  CB     . ALA C 1 124 ? 8.099   16.079  -5.595  1.00 90.19  ? 124 ALA C CB     1 
ATOM   6716 H  H      . ALA C 1 124 ? 7.636   16.898  -7.832  1.00 72.32  ? 124 ALA C H      1 
ATOM   6717 H  HA     . ALA C 1 124 ? 8.232   18.125  -5.611  1.00 86.00  ? 124 ALA C HA     1 
ATOM   6718 H  HB1    . ALA C 1 124 ? 8.403   16.005  -4.677  1.00 108.45 ? 124 ALA C HB1    1 
ATOM   6719 H  HB2    . ALA C 1 124 ? 7.130   16.050  -5.626  1.00 108.45 ? 124 ALA C HB2    1 
ATOM   6720 H  HB3    . ALA C 1 124 ? 8.469   15.355  -6.125  1.00 108.45 ? 124 ALA C HB3    1 
ATOM   6721 N  N      . THR C 1 125 ? 10.757  16.844  -7.115  1.00 57.37  ? 125 THR C N      1 
ATOM   6722 C  CA     . THR C 1 125 ? 12.215  16.893  -7.173  1.00 74.95  ? 125 THR C CA     1 
ATOM   6723 C  C      . THR C 1 125 ? 12.703  18.313  -7.430  1.00 76.39  ? 125 THR C C      1 
ATOM   6724 O  O      . THR C 1 125 ? 13.738  18.729  -6.896  1.00 78.74  ? 125 THR C O      1 
ATOM   6725 C  CB     . THR C 1 125 ? 12.727  15.932  -8.246  1.00 88.64  ? 125 THR C CB     1 
ATOM   6726 O  OG1    . THR C 1 125 ? 12.445  14.584  -7.850  1.00 89.79  ? 125 THR C OG1    1 
ATOM   6727 C  CG2    . THR C 1 125 ? 14.232  16.090  -8.454  1.00 72.70  ? 125 THR C CG2    1 
ATOM   6728 H  H      . THR C 1 125 ? 10.391  16.376  -7.737  1.00 69.06  ? 125 THR C H      1 
ATOM   6729 H  HA     . THR C 1 125 ? 12.578  16.604  -6.321  1.00 90.16  ? 125 THR C HA     1 
ATOM   6730 H  HB     . THR C 1 125 ? 12.287  16.129  -9.088  1.00 106.58 ? 125 THR C HB     1 
ATOM   6731 H  HG1    . THR C 1 125 ? 11.640  14.514  -7.621  1.00 107.97 ? 125 THR C HG1    1 
ATOM   6732 H  HG21   . THR C 1 125 ? 14.539  15.476  -9.139  1.00 87.46  ? 125 THR C HG21   1 
ATOM   6733 H  HG22   . THR C 1 125 ? 14.436  16.997  -8.730  1.00 87.46  ? 125 THR C HG22   1 
ATOM   6734 H  HG23   . THR C 1 125 ? 14.703  15.900  -7.627  1.00 87.46  ? 125 THR C HG23   1 
ATOM   6735 N  N      . CYS C 1 126 ? 11.974  19.074  -8.248  1.00 77.10  ? 126 CYS C N      1 
ATOM   6736 C  CA     . CYS C 1 126 ? 12.353  20.462  -8.491  1.00 73.93  ? 126 CYS C CA     1 
ATOM   6737 C  C      . CYS C 1 126 ? 12.196  21.306  -7.231  1.00 61.88  ? 126 CYS C C      1 
ATOM   6738 O  O      . CYS C 1 126 ? 13.057  22.140  -6.923  1.00 65.25  ? 126 CYS C O      1 
ATOM   6739 C  CB     . CYS C 1 126 ? 11.516  21.031  -9.635  1.00 82.05  ? 126 CYS C CB     1 
ATOM   6740 S  SG     . CYS C 1 126 ? 11.915  20.320  -11.245 1.00 86.51  ? 126 CYS C SG     1 
ATOM   6741 H  H      . CYS C 1 126 ? 11.269  18.816  -8.668  1.00 92.74  ? 126 CYS C H      1 
ATOM   6742 H  HA     . CYS C 1 126 ? 13.285  20.495  -8.755  1.00 88.93  ? 126 CYS C HA     1 
ATOM   6743 H  HB2    . CYS C 1 126 ? 10.580  20.853  -9.455  1.00 98.68  ? 126 CYS C HB2    1 
ATOM   6744 H  HB3    . CYS C 1 126 ? 11.668  21.988  -9.686  1.00 98.68  ? 126 CYS C HB3    1 
ATOM   6745 H  HG     . CYS C 1 126 ? 11.712  19.138  -11.211 1.00 104.03 ? 126 CYS C HG     1 
ATOM   6746 N  N      . ARG C 1 127 ? 11.105  21.104  -6.488  1.00 57.91  ? 127 ARG C N      1 
ATOM   6747 C  CA     . ARG C 1 127 ? 10.944  21.798  -5.215  1.00 58.06  ? 127 ARG C CA     1 
ATOM   6748 C  C      . ARG C 1 127 ? 12.100  21.479  -4.276  1.00 49.12  ? 127 ARG C C      1 
ATOM   6749 O  O      . ARG C 1 127 ? 12.650  22.371  -3.619  1.00 64.91  ? 127 ARG C O      1 
ATOM   6750 C  CB     . ARG C 1 127 ? 9.605   21.429  -4.572  1.00 60.25  ? 127 ARG C CB     1 
ATOM   6751 C  CG     . ARG C 1 127 ? 8.396   21.969  -5.319  1.00 70.49  ? 127 ARG C CG     1 
ATOM   6752 C  CD     . ARG C 1 127 ? 7.079   21.578  -4.659  1.00 75.15  ? 127 ARG C CD     1 
ATOM   6753 N  NE     . ARG C 1 127 ? 6.984   22.071  -3.286  1.00 71.06  ? 127 ARG C NE     1 
ATOM   6754 C  CZ     . ARG C 1 127 ? 6.017   21.744  -2.433  1.00 73.78  ? 127 ARG C CZ     1 
ATOM   6755 N  NH1    . ARG C 1 127 ? 5.041   20.927  -2.804  1.00 88.29  ? 127 ARG C NH1    1 
ATOM   6756 N  NH2    . ARG C 1 127 ? 6.022   22.242  -1.203  1.00 82.34  ? 127 ARG C NH2    1 
ATOM   6757 H  H      . ARG C 1 127 ? 10.456  20.579  -6.695  1.00 69.71  ? 127 ARG C H      1 
ATOM   6758 H  HA     . ARG C 1 127 ? 10.937  22.754  -5.378  1.00 69.89  ? 127 ARG C HA     1 
ATOM   6759 H  HB2    . ARG C 1 127 ? 9.528   20.462  -4.544  1.00 72.51  ? 127 ARG C HB2    1 
ATOM   6760 H  HB3    . ARG C 1 127 ? 9.581   21.789  -3.671  1.00 72.51  ? 127 ARG C HB3    1 
ATOM   6761 H  HG2    . ARG C 1 127 ? 8.444   22.938  -5.343  1.00 84.80  ? 127 ARG C HG2    1 
ATOM   6762 H  HG3    . ARG C 1 127 ? 8.396   21.615  -6.222  1.00 84.80  ? 127 ARG C HG3    1 
ATOM   6763 H  HD2    . ARG C 1 127 ? 6.343   21.955  -5.167  1.00 90.40  ? 127 ARG C HD2    1 
ATOM   6764 H  HD3    . ARG C 1 127 ? 7.007   20.611  -4.640  1.00 90.40  ? 127 ARG C HD3    1 
ATOM   6765 H  HE     . ARG C 1 127 ? 7.596   22.609  -3.011  1.00 85.49  ? 127 ARG C HE     1 
ATOM   6766 H  HH11   . ARG C 1 127 ? 5.030   20.604  -3.601  1.00 106.16 ? 127 ARG C HH11   1 
ATOM   6767 H  HH12   . ARG C 1 127 ? 4.419   20.720  -2.247  1.00 106.16 ? 127 ARG C HH12   1 
ATOM   6768 H  HH21   . ARG C 1 127 ? 6.650   22.775  -0.958  1.00 99.02  ? 127 ARG C HH21   1 
ATOM   6769 H  HH22   . ARG C 1 127 ? 5.397   22.031  -0.652  1.00 99.02  ? 127 ARG C HH22   1 
ATOM   6770 N  N      . ARG C 1 128 ? 12.468  20.199  -4.186  1.00 50.84  ? 128 ARG C N      1 
ATOM   6771 C  CA     . ARG C 1 128 ? 13.567  19.800  -3.312  1.00 40.80  ? 128 ARG C CA     1 
ATOM   6772 C  C      . ARG C 1 128 ? 14.875  20.452  -3.743  1.00 39.10  ? 128 ARG C C      1 
ATOM   6773 O  O      . ARG C 1 128 ? 15.660  20.906  -2.899  1.00 54.88  ? 128 ARG C O      1 
ATOM   6774 C  CB     . ARG C 1 128 ? 13.697  18.279  -3.308  1.00 54.79  ? 128 ARG C CB     1 
ATOM   6775 C  CG     . ARG C 1 128 ? 12.503  17.575  -2.696  1.00 46.30  ? 128 ARG C CG     1 
ATOM   6776 C  CD     . ARG C 1 128 ? 12.750  16.094  -2.515  1.00 55.12  ? 128 ARG C CD     1 
ATOM   6777 N  NE     . ARG C 1 128 ? 11.548  15.423  -2.031  1.00 69.85  ? 128 ARG C NE     1 
ATOM   6778 C  CZ     . ARG C 1 128 ? 10.620  14.886  -2.820  1.00 77.43  ? 128 ARG C CZ     1 
ATOM   6779 N  NH1    . ARG C 1 128 ? 10.744  14.937  -4.141  1.00 80.61  ? 128 ARG C NH1    1 
ATOM   6780 N  NH2    . ARG C 1 128 ? 9.559   14.298  -2.285  1.00 83.02  ? 128 ARG C NH2    1 
ATOM   6781 H  H      . ARG C 1 128 ? 12.104  19.550  -4.616  1.00 61.23  ? 128 ARG C H      1 
ATOM   6782 H  HA     . ARG C 1 128 ? 13.374  20.089  -2.406  1.00 49.17  ? 128 ARG C HA     1 
ATOM   6783 H  HB2    . ARG C 1 128 ? 13.787  17.971  -4.223  1.00 65.96  ? 128 ARG C HB2    1 
ATOM   6784 H  HB3    . ARG C 1 128 ? 14.483  18.033  -2.796  1.00 65.96  ? 128 ARG C HB3    1 
ATOM   6785 H  HG2    . ARG C 1 128 ? 12.317  17.959  -1.825  1.00 55.78  ? 128 ARG C HG2    1 
ATOM   6786 H  HG3    . ARG C 1 128 ? 11.734  17.684  -3.277  1.00 55.78  ? 128 ARG C HG3    1 
ATOM   6787 H  HD2    . ARG C 1 128 ? 13.000  15.701  -3.366  1.00 66.36  ? 128 ARG C HD2    1 
ATOM   6788 H  HD3    . ARG C 1 128 ? 13.459  15.960  -1.867  1.00 66.36  ? 128 ARG C HD3    1 
ATOM   6789 H  HE     . ARG C 1 128 ? 11.431  15.371  -1.180  1.00 84.04  ? 128 ARG C HE     1 
ATOM   6790 H  HH11   . ARG C 1 128 ? 11.428  15.320  -4.495  1.00 96.95  ? 128 ARG C HH11   1 
ATOM   6791 H  HH12   . ARG C 1 128 ? 10.140  14.587  -4.644  1.00 96.95  ? 128 ARG C HH12   1 
ATOM   6792 H  HH21   . ARG C 1 128 ? 9.471   14.265  -1.431  1.00 99.85  ? 128 ARG C HH21   1 
ATOM   6793 H  HH22   . ARG C 1 128 ? 8.958   13.951  -2.793  1.00 99.85  ? 128 ARG C HH22   1 
ATOM   6794 N  N      . GLU C 1 129 ? 15.132  20.502  -5.053  1.00 36.53  ? 129 GLU C N      1 
ATOM   6795 C  CA     . GLU C 1 129 ? 16.358  21.126  -5.534  1.00 49.48  ? 129 GLU C CA     1 
ATOM   6796 C  C      . GLU C 1 129 ? 16.389  22.609  -5.195  1.00 63.45  ? 129 GLU C C      1 
ATOM   6797 O  O      . GLU C 1 129 ? 17.426  23.136  -4.778  1.00 53.27  ? 129 GLU C O      1 
ATOM   6798 C  CB     . GLU C 1 129 ? 16.500  20.945  -7.046  1.00 74.07  ? 129 GLU C CB     1 
ATOM   6799 C  CG     . GLU C 1 129 ? 16.856  19.547  -7.504  1.00 70.22  ? 129 GLU C CG     1 
ATOM   6800 C  CD     . GLU C 1 129 ? 17.116  19.494  -8.997  1.00 78.82  ? 129 GLU C CD     1 
ATOM   6801 O  OE1    . GLU C 1 129 ? 16.846  20.506  -9.680  1.00 66.19  ? 129 GLU C OE1    1 
ATOM   6802 O  OE2    . GLU C 1 129 ? 17.589  18.447  -9.488  1.00 87.88  ? 129 GLU C OE2    1 
ATOM   6803 H  H      . GLU C 1 129 ? 14.622  20.189  -5.671  1.00 44.06  ? 129 GLU C H      1 
ATOM   6804 H  HA     . GLU C 1 129 ? 17.108  20.687  -5.103  1.00 59.59  ? 129 GLU C HA     1 
ATOM   6805 H  HB2    . GLU C 1 129 ? 15.656  21.179  -7.461  1.00 89.10  ? 129 GLU C HB2    1 
ATOM   6806 H  HB3    . GLU C 1 129 ? 17.200  21.538  -7.360  1.00 89.10  ? 129 GLU C HB3    1 
ATOM   6807 H  HG2    . GLU C 1 129 ? 17.659  19.254  -7.045  1.00 84.48  ? 129 GLU C HG2    1 
ATOM   6808 H  HG3    . GLU C 1 129 ? 16.121  18.947  -7.303  1.00 84.48  ? 129 GLU C HG3    1 
ATOM   6809 N  N      . VAL C 1 130 ? 15.258  23.298  -5.357  1.00 67.31  ? 130 VAL C N      1 
ATOM   6810 C  CA     . VAL C 1 130 ? 15.209  24.724  -5.040  1.00 41.36  ? 130 VAL C CA     1 
ATOM   6811 C  C      . VAL C 1 130 ? 15.454  24.942  -3.551  1.00 40.06  ? 130 VAL C C      1 
ATOM   6812 O  O      . VAL C 1 130 ? 16.245  25.807  -3.149  1.00 50.10  ? 130 VAL C O      1 
ATOM   6813 C  CB     . VAL C 1 130 ? 13.859  25.322  -5.478  1.00 40.52  ? 130 VAL C CB     1 
ATOM   6814 C  CG1    . VAL C 1 130 ? 13.702  26.734  -4.941  1.00 62.24  ? 130 VAL C CG1    1 
ATOM   6815 C  CG2    . VAL C 1 130 ? 13.729  25.302  -6.992  1.00 51.79  ? 130 VAL C CG2    1 
ATOM   6816 H  H      . VAL C 1 130 ? 14.517  22.971  -5.645  1.00 80.99  ? 130 VAL C H      1 
ATOM   6817 H  HA     . VAL C 1 130 ? 15.914  25.174  -5.530  1.00 49.85  ? 130 VAL C HA     1 
ATOM   6818 H  HB     . VAL C 1 130 ? 13.144  24.779  -5.111  1.00 48.84  ? 130 VAL C HB     1 
ATOM   6819 H  HG11   . VAL C 1 130 ? 12.992  27.180  -5.428  1.00 74.90  ? 130 VAL C HG11   1 
ATOM   6820 H  HG12   . VAL C 1 130 ? 13.479  26.691  -3.998  1.00 74.90  ? 130 VAL C HG12   1 
ATOM   6821 H  HG13   . VAL C 1 130 ? 14.538  27.212  -5.061  1.00 74.90  ? 130 VAL C HG13   1 
ATOM   6822 H  HG21   . VAL C 1 130 ? 12.835  25.590  -7.236  1.00 62.36  ? 130 VAL C HG21   1 
ATOM   6823 H  HG22   . VAL C 1 130 ? 14.386  25.904  -7.374  1.00 62.36  ? 130 VAL C HG22   1 
ATOM   6824 H  HG23   . VAL C 1 130 ? 13.883  24.399  -7.311  1.00 62.36  ? 130 VAL C HG23   1 
ATOM   6825 N  N      . ASP C 1 131 ? 14.779  24.155  -2.709  1.00 39.76  ? 131 ASP C N      1 
ATOM   6826 C  CA     . ASP C 1 131 ? 14.963  24.288  -1.268  1.00 46.45  ? 131 ASP C CA     1 
ATOM   6827 C  C      . ASP C 1 131 ? 16.420  24.079  -0.874  1.00 55.56  ? 131 ASP C C      1 
ATOM   6828 O  O      . ASP C 1 131 ? 16.986  24.879  -0.120  1.00 62.11  ? 131 ASP C O      1 
ATOM   6829 C  CB     . ASP C 1 131 ? 14.064  23.292  -0.529  1.00 48.08  ? 131 ASP C CB     1 
ATOM   6830 C  CG     . ASP C 1 131 ? 12.587  23.605  -0.692  1.00 64.55  ? 131 ASP C CG     1 
ATOM   6831 O  OD1    . ASP C 1 131 ? 12.248  24.454  -1.545  1.00 58.22  ? 131 ASP C OD1    1 
ATOM   6832 O  OD2    . ASP C 1 131 ? 11.766  22.999  0.031   1.00 59.51  ? 131 ASP C OD2    1 
ATOM   6833 H  H      . ASP C 1 131 ? 14.218  23.547  -2.943  1.00 47.93  ? 131 ASP C H      1 
ATOM   6834 H  HA     . ASP C 1 131 ? 14.704  25.186  -1.007  1.00 55.96  ? 131 ASP C HA     1 
ATOM   6835 H  HB2    . ASP C 1 131 ? 14.223  22.401  -0.880  1.00 57.91  ? 131 ASP C HB2    1 
ATOM   6836 H  HB3    . ASP C 1 131 ? 14.274  23.318  0.418   1.00 57.91  ? 131 ASP C HB3    1 
ATOM   6837 N  N      . GLU C 1 132 ? 17.043  23.004  -1.363  1.00 47.21  ? 132 GLU C N      1 
ATOM   6838 C  CA     . GLU C 1 132 ? 18.431  22.739  -1.001  1.00 53.25  ? 132 GLU C CA     1 
ATOM   6839 C  C      . GLU C 1 132 ? 19.376  23.805  -1.544  1.00 41.99  ? 132 GLU C C      1 
ATOM   6840 O  O      . GLU C 1 132 ? 20.330  24.191  -0.864  1.00 38.49  ? 132 GLU C O      1 
ATOM   6841 C  CB     . GLU C 1 132 ? 18.851  21.340  -1.451  1.00 59.09  ? 132 GLU C CB     1 
ATOM   6842 C  CG     . GLU C 1 132 ? 18.305  20.257  -0.517  1.00 87.02  ? 132 GLU C CG     1 
ATOM   6843 C  CD     . GLU C 1 132 ? 18.795  18.860  -0.845  1.00 105.53 ? 132 GLU C CD     1 
ATOM   6844 O  OE1    . GLU C 1 132 ? 19.321  18.651  -1.956  1.00 117.76 ? 132 GLU C OE1    1 
ATOM   6845 O  OE2    . GLU C 1 132 ? 18.679  17.977  0.034   1.00 105.77 ? 132 GLU C OE2    1 
ATOM   6846 H  H      . GLU C 1 132 ? 16.692  22.425  -1.893  1.00 56.87  ? 132 GLU C H      1 
ATOM   6847 H  HA     . GLU C 1 132 ? 18.499  22.762  -0.034  1.00 64.12  ? 132 GLU C HA     1 
ATOM   6848 H  HB2    . GLU C 1 132 ? 18.507  21.174  -2.343  1.00 71.12  ? 132 GLU C HB2    1 
ATOM   6849 H  HB3    . GLU C 1 132 ? 19.819  21.281  -1.452  1.00 71.12  ? 132 GLU C HB3    1 
ATOM   6850 H  HG2    . GLU C 1 132 ? 18.579  20.461  0.391   1.00 104.64 ? 132 GLU C HG2    1 
ATOM   6851 H  HG3    . GLU C 1 132 ? 17.336  20.252  -0.578  1.00 104.64 ? 132 GLU C HG3    1 
ATOM   6852 N  N      . ILE C 1 133 ? 19.155  24.278  -2.774  1.00 41.62  ? 133 ILE C N      1 
ATOM   6853 C  CA     . ILE C 1 133 ? 20.004  25.340  -3.307  1.00 41.09  ? 133 ILE C CA     1 
ATOM   6854 C  C      . ILE C 1 133 ? 19.933  26.566  -2.406  1.00 54.88  ? 133 ILE C C      1 
ATOM   6855 O  O      . ILE C 1 133 ? 20.958  27.162  -2.053  1.00 41.47  ? 133 ILE C O      1 
ATOM   6856 C  CB     . ILE C 1 133 ? 19.593  25.694  -4.750  1.00 41.26  ? 133 ILE C CB     1 
ATOM   6857 C  CG1    . ILE C 1 133 ? 20.011  24.583  -5.711  1.00 45.53  ? 133 ILE C CG1    1 
ATOM   6858 C  CG2    . ILE C 1 133 ? 20.194  27.032  -5.156  1.00 38.28  ? 133 ILE C CG2    1 
ATOM   6859 C  CD1    . ILE C 1 133 ? 19.481  24.757  -7.115  1.00 37.44  ? 133 ILE C CD1    1 
ATOM   6860 H  H      . ILE C 1 133 ? 18.536  24.007  -3.306  1.00 50.16  ? 133 ILE C H      1 
ATOM   6861 H  HA     . ILE C 1 133 ? 20.920  25.020  -3.323  1.00 49.52  ? 133 ILE C HA     1 
ATOM   6862 H  HB     . ILE C 1 133 ? 18.627  25.773  -4.788  1.00 49.72  ? 133 ILE C HB     1 
ATOM   6863 H  HG12   . ILE C 1 133 ? 20.979  24.562  -5.761  1.00 54.85  ? 133 ILE C HG12   1 
ATOM   6864 H  HG13   . ILE C 1 133 ? 19.678  23.737  -5.373  1.00 54.85  ? 133 ILE C HG13   1 
ATOM   6865 H  HG21   . ILE C 1 133 ? 20.170  27.109  -6.123  1.00 46.16  ? 133 ILE C HG21   1 
ATOM   6866 H  HG22   . ILE C 1 133 ? 19.674  27.747  -4.755  1.00 46.16  ? 133 ILE C HG22   1 
ATOM   6867 H  HG23   . ILE C 1 133 ? 21.111  27.075  -4.844  1.00 46.16  ? 133 ILE C HG23   1 
ATOM   6868 H  HD11   . ILE C 1 133 ? 19.580  23.920  -7.596  1.00 45.15  ? 133 ILE C HD11   1 
ATOM   6869 H  HD12   . ILE C 1 133 ? 18.544  25.004  -7.071  1.00 45.15  ? 133 ILE C HD12   1 
ATOM   6870 H  HD13   . ILE C 1 133 ? 19.987  25.456  -7.559  1.00 45.15  ? 133 ILE C HD13   1 
ATOM   6871 N  N      . LEU C 1 134 ? 18.718  26.958  -2.017  1.00 48.13  ? 134 LEU C N      1 
ATOM   6872 C  CA     . LEU C 1 134 ? 18.560  28.126  -1.157  1.00 39.93  ? 134 LEU C CA     1 
ATOM   6873 C  C      . LEU C 1 134 ? 19.217  27.900  0.200   1.00 38.13  ? 134 LEU C C      1 
ATOM   6874 O  O      . LEU C 1 134 ? 19.916  28.780  0.721   1.00 38.89  ? 134 LEU C O      1 
ATOM   6875 C  CB     . LEU C 1 134 ? 17.074  28.437  -0.993  1.00 44.03  ? 134 LEU C CB     1 
ATOM   6876 C  CG     . LEU C 1 134 ? 16.394  29.059  -2.213  1.00 29.77  ? 134 LEU C CG     1 
ATOM   6877 C  CD1    . LEU C 1 134 ? 14.888  29.094  -2.023  1.00 38.83  ? 134 LEU C CD1    1 
ATOM   6878 C  CD2    . LEU C 1 134 ? 16.933  30.454  -2.487  1.00 42.35  ? 134 LEU C CD2    1 
ATOM   6879 H  H      . LEU C 1 134 ? 17.981  26.572  -2.234  1.00 57.98  ? 134 LEU C H      1 
ATOM   6880 H  HA     . LEU C 1 134 ? 18.988  28.892  -1.571  1.00 48.13  ? 134 LEU C HA     1 
ATOM   6881 H  HB2    . LEU C 1 134 ? 16.610  27.609  -0.794  1.00 53.05  ? 134 LEU C HB2    1 
ATOM   6882 H  HB3    . LEU C 1 134 ? 16.972  29.060  -0.256  1.00 53.05  ? 134 LEU C HB3    1 
ATOM   6883 H  HG     . LEU C 1 134 ? 16.589  28.512  -2.990  1.00 35.94  ? 134 LEU C HG     1 
ATOM   6884 H  HD11   . LEU C 1 134 ? 14.478  29.463  -2.820  1.00 46.81  ? 134 LEU C HD11   1 
ATOM   6885 H  HD12   . LEU C 1 134 ? 14.568  28.190  -1.874  1.00 46.81  ? 134 LEU C HD12   1 
ATOM   6886 H  HD13   . LEU C 1 134 ? 14.680  29.650  -1.256  1.00 46.81  ? 134 LEU C HD13   1 
ATOM   6887 H  HD21   . LEU C 1 134 ? 16.403  30.865  -3.188  1.00 51.03  ? 134 LEU C HD21   1 
ATOM   6888 H  HD22   . LEU C 1 134 ? 16.873  30.980  -1.675  1.00 51.03  ? 134 LEU C HD22   1 
ATOM   6889 H  HD23   . LEU C 1 134 ? 17.858  30.385  -2.770  1.00 51.03  ? 134 LEU C HD23   1 
ATOM   6890 N  N      . ASN C 1 135 ? 19.003  26.721  0.788   1.00 44.40  ? 135 ASN C N      1 
ATOM   6891 C  CA     . ASN C 1 135 ? 19.578  26.420  2.092   1.00 48.55  ? 135 ASN C CA     1 
ATOM   6892 C  C      . ASN C 1 135 ? 21.100  26.444  2.038   1.00 36.37  ? 135 ASN C C      1 
ATOM   6893 O  O      . ASN C 1 135 ? 21.755  26.985  2.937   1.00 37.73  ? 135 ASN C O      1 
ATOM   6894 C  CB     . ASN C 1 135 ? 19.077  25.054  2.564   1.00 50.81  ? 135 ASN C CB     1 
ATOM   6895 C  CG     . ASN C 1 135 ? 17.601  25.065  2.912   1.00 45.24  ? 135 ASN C CG     1 
ATOM   6896 O  OD1    . ASN C 1 135 ? 16.861  25.963  2.509   1.00 44.46  ? 135 ASN C OD1    1 
ATOM   6897 N  ND2    . ASN C 1 135 ? 17.159  24.050  3.641   1.00 76.75  ? 135 ASN C ND2    1 
ATOM   6898 H  H      . ASN C 1 135 ? 18.532  26.084  0.455   1.00 53.50  ? 135 ASN C H      1 
ATOM   6899 H  HA     . ASN C 1 135 ? 19.293  27.089  2.734   1.00 58.48  ? 135 ASN C HA     1 
ATOM   6900 H  HB2    . ASN C 1 135 ? 19.214  24.405  1.856   1.00 61.18  ? 135 ASN C HB2    1 
ATOM   6901 H  HB3    . ASN C 1 135 ? 19.571  24.791  3.356   1.00 61.18  ? 135 ASN C HB3    1 
ATOM   6902 H  HD21   . ASN C 1 135 ? 16.330  24.010  3.865   1.00 92.32  ? 135 ASN C HD21   1 
ATOM   6903 H  HD22   . ASN C 1 135 ? 17.702  23.431  3.890   1.00 92.32  ? 135 ASN C HD22   1 
ATOM   6904 N  N      . ALA C 1 136 ? 21.683  25.870  0.984   1.00 47.36  ? 136 ALA C N      1 
ATOM   6905 C  CA     . ALA C 1 136 ? 23.134  25.852  0.850   1.00 53.93  ? 136 ALA C CA     1 
ATOM   6906 C  C      . ALA C 1 136 ? 23.676  27.255  0.618   1.00 45.61  ? 136 ALA C C      1 
ATOM   6907 O  O      . ALA C 1 136 ? 24.720  27.622  1.172   1.00 47.02  ? 136 ALA C O      1 
ATOM   6908 C  CB     . ALA C 1 136 ? 23.541  24.919  -0.291  1.00 55.39  ? 136 ALA C CB     1 
ATOM   6909 H  H      . ALA C 1 136 ? 21.264  25.487  0.338   1.00 57.04  ? 136 ALA C H      1 
ATOM   6910 H  HA     . ALA C 1 136 ? 23.524  25.510  1.669   1.00 64.93  ? 136 ALA C HA     1 
ATOM   6911 H  HB1    . ALA C 1 136 ? 24.508  24.920  -0.370  1.00 66.69  ? 136 ALA C HB1    1 
ATOM   6912 H  HB2    . ALA C 1 136 ? 23.226  24.023  -0.094  1.00 66.69  ? 136 ALA C HB2    1 
ATOM   6913 H  HB3    . ALA C 1 136 ? 23.142  25.237  -1.116  1.00 66.69  ? 136 ALA C HB3    1 
ATOM   6914 N  N      . SER C 1 137 ? 22.982  28.056  -0.192  1.00 26.31  ? 137 SER C N      1 
ATOM   6915 C  CA     . SER C 1 137 ? 23.402  29.435  -0.404  1.00 34.88  ? 137 SER C CA     1 
ATOM   6916 C  C      . SER C 1 137 ? 23.425  30.193  0.915   1.00 38.98  ? 137 SER C C      1 
ATOM   6917 O  O      . SER C 1 137 ? 24.382  30.915  1.217   1.00 43.93  ? 137 SER C O      1 
ATOM   6918 C  CB     . SER C 1 137 ? 22.466  30.119  -1.402  1.00 35.16  ? 137 SER C CB     1 
ATOM   6919 O  OG     . SER C 1 137 ? 22.452  29.439  -2.645  1.00 38.00  ? 137 SER C OG     1 
ATOM   6920 H  H      . SER C 1 137 ? 22.275  27.828  -0.625  1.00 31.79  ? 137 SER C H      1 
ATOM   6921 H  HA     . SER C 1 137 ? 24.296  29.441  -0.780  1.00 42.07  ? 137 SER C HA     1 
ATOM   6922 H  HB2    . SER C 1 137 ? 21.568  30.124  -1.036  1.00 42.40  ? 137 SER C HB2    1 
ATOM   6923 H  HB3    . SER C 1 137 ? 22.771  31.029  -1.545  1.00 42.40  ? 137 SER C HB3    1 
ATOM   6924 H  HG     . SER C 1 137 ? 22.127  28.671  -2.548  1.00 45.82  ? 137 SER C HG     1 
ATOM   6925 N  N      . LEU C 1 138 ? 22.376  30.034  1.723   1.00 34.65  ? 138 LEU C N      1 
ATOM   6926 C  CA     . LEU C 1 138 ? 22.330  30.729  3.005   1.00 25.73  ? 138 LEU C CA     1 
ATOM   6927 C  C      . LEU C 1 138 ? 23.419  30.228  3.946   1.00 28.61  ? 138 LEU C C      1 
ATOM   6928 O  O      . LEU C 1 138 ? 24.053  31.026  4.648   1.00 35.03  ? 138 LEU C O      1 
ATOM   6929 C  CB     . LEU C 1 138 ? 20.948  30.560  3.634   1.00 30.12  ? 138 LEU C CB     1 
ATOM   6930 C  CG     . LEU C 1 138 ? 19.951  31.679  3.334   1.00 27.56  ? 138 LEU C CG     1 
ATOM   6931 C  CD1    . LEU C 1 138 ? 19.756  31.839  1.835   1.00 29.77  ? 138 LEU C CD1    1 
ATOM   6932 C  CD2    . LEU C 1 138 ? 18.622  31.390  4.011   1.00 43.20  ? 138 LEU C CD2    1 
ATOM   6933 H  H      . LEU C 1 138 ? 21.691  29.541  1.557   1.00 41.80  ? 138 LEU C H      1 
ATOM   6934 H  HA     . LEU C 1 138 ? 22.480  31.676  2.857   1.00 31.09  ? 138 LEU C HA     1 
ATOM   6935 H  HB2    . LEU C 1 138 ? 20.563  29.732  3.306   1.00 36.36  ? 138 LEU C HB2    1 
ATOM   6936 H  HB3    . LEU C 1 138 ? 21.055  30.517  4.597   1.00 36.36  ? 138 LEU C HB3    1 
ATOM   6937 H  HG     . LEU C 1 138 ? 20.300  32.515  3.681   1.00 33.29  ? 138 LEU C HG     1 
ATOM   6938 H  HD11   . LEU C 1 138 ? 19.118  32.552  1.674   1.00 35.94  ? 138 LEU C HD11   1 
ATOM   6939 H  HD12   . LEU C 1 138 ? 20.608  32.060  1.428   1.00 35.94  ? 138 LEU C HD12   1 
ATOM   6940 H  HD13   . LEU C 1 138 ? 19.420  31.006  1.469   1.00 35.94  ? 138 LEU C HD13   1 
ATOM   6941 H  HD21   . LEU C 1 138 ? 17.994  32.096  3.790   1.00 52.06  ? 138 LEU C HD21   1 
ATOM   6942 H  HD22   . LEU C 1 138 ? 18.285  30.537  3.694   1.00 52.06  ? 138 LEU C HD22   1 
ATOM   6943 H  HD23   . LEU C 1 138 ? 18.757  31.356  4.971   1.00 52.06  ? 138 LEU C HD23   1 
ATOM   6944 N  N      . PHE C 1 139 ? 23.651  28.911  3.978   1.00 37.81  ? 139 PHE C N      1 
ATOM   6945 C  CA     . PHE C 1 139 ? 24.687  28.353  4.843   1.00 52.11  ? 139 PHE C CA     1 
ATOM   6946 C  C      . PHE C 1 139 ? 26.066  28.858  4.443   1.00 45.09  ? 139 PHE C C      1 
ATOM   6947 O  O      . PHE C 1 139 ? 26.943  29.030  5.299   1.00 46.11  ? 139 PHE C O      1 
ATOM   6948 C  CB     . PHE C 1 139 ? 24.643  26.825  4.802   1.00 53.59  ? 139 PHE C CB     1 
ATOM   6949 C  CG     . PHE C 1 139 ? 25.667  26.162  5.685   1.00 57.16  ? 139 PHE C CG     1 
ATOM   6950 C  CD1    . PHE C 1 139 ? 25.405  25.947  7.028   1.00 67.74  ? 139 PHE C CD1    1 
ATOM   6951 C  CD2    . PHE C 1 139 ? 26.884  25.749  5.173   1.00 64.35  ? 139 PHE C CD2    1 
ATOM   6952 C  CE1    . PHE C 1 139 ? 26.340  25.337  7.844   1.00 66.66  ? 139 PHE C CE1    1 
ATOM   6953 C  CE2    . PHE C 1 139 ? 27.822  25.138  5.985   1.00 71.07  ? 139 PHE C CE2    1 
ATOM   6954 C  CZ     . PHE C 1 139 ? 27.548  24.932  7.322   1.00 69.88  ? 139 PHE C CZ     1 
ATOM   6955 H  H      . PHE C 1 139 ? 23.226  28.325  3.513   1.00 45.59  ? 139 PHE C H      1 
ATOM   6956 H  HA     . PHE C 1 139 ? 24.517  28.628  5.758   1.00 62.75  ? 139 PHE C HA     1 
ATOM   6957 H  HB2    . PHE C 1 139 ? 23.766  26.530  5.094   1.00 64.52  ? 139 PHE C HB2    1 
ATOM   6958 H  HB3    . PHE C 1 139 ? 24.805  26.533  3.891   1.00 64.52  ? 139 PHE C HB3    1 
ATOM   6959 H  HD1    . PHE C 1 139 ? 24.590  26.216  7.386   1.00 81.51  ? 139 PHE C HD1    1 
ATOM   6960 H  HD2    . PHE C 1 139 ? 27.074  25.884  4.273   1.00 77.43  ? 139 PHE C HD2    1 
ATOM   6961 H  HE1    . PHE C 1 139 ? 26.152  25.200  8.744   1.00 80.21  ? 139 PHE C HE1    1 
ATOM   6962 H  HE2    . PHE C 1 139 ? 28.638  24.866  5.631   1.00 85.50  ? 139 PHE C HE2    1 
ATOM   6963 H  HZ     . PHE C 1 139 ? 28.178  24.521  7.869   1.00 84.08  ? 139 PHE C HZ     1 
ATOM   6964 N  N      . MET C 1 140 ? 26.289  29.060  3.145   1.00 47.21  ? 140 MET C N      1 
ATOM   6965 C  CA     . MET C 1 140 ? 27.566  29.581  2.679   1.00 40.60  ? 140 MET C CA     1 
ATOM   6966 C  C      . MET C 1 140 ? 27.700  31.077  2.923   1.00 41.10  ? 140 MET C C      1 
ATOM   6967 O  O      . MET C 1 140 ? 28.811  31.567  3.153   1.00 41.86  ? 140 MET C O      1 
ATOM   6968 C  CB     . MET C 1 140 ? 27.740  29.299  1.186   1.00 51.13  ? 140 MET C CB     1 
ATOM   6969 C  CG     . MET C 1 140 ? 27.897  27.833  0.842   1.00 53.45  ? 140 MET C CG     1 
ATOM   6970 S  SD     . MET C 1 140 ? 29.600  27.277  1.056   1.00 81.91  ? 140 MET C SD     1 
ATOM   6971 C  CE     . MET C 1 140 ? 30.454  28.211  -0.216  1.00 78.28  ? 140 MET C CE     1 
ATOM   6972 H  H      . MET C 1 140 ? 25.721  28.904  2.519   1.00 56.87  ? 140 MET C H      1 
ATOM   6973 H  HA     . MET C 1 140 ? 28.269  29.117  3.160   1.00 48.94  ? 140 MET C HA     1 
ATOM   6974 H  HB2    . MET C 1 140 ? 26.958  29.630  0.715   1.00 61.57  ? 140 MET C HB2    1 
ATOM   6975 H  HB3    . MET C 1 140 ? 28.534  29.761  0.874   1.00 61.57  ? 140 MET C HB3    1 
ATOM   6976 H  HG2    . MET C 1 140 ? 27.328  27.306  1.424   1.00 64.36  ? 140 MET C HG2    1 
ATOM   6977 H  HG3    . MET C 1 140 ? 27.644  27.693  -0.084  1.00 64.36  ? 140 MET C HG3    1 
ATOM   6978 H  HE1    . MET C 1 140 ? 31.388  27.950  -0.225  1.00 94.15  ? 140 MET C HE1    1 
ATOM   6979 H  HE2    . MET C 1 140 ? 30.048  28.018  -1.075  1.00 94.15  ? 140 MET C HE2    1 
ATOM   6980 H  HE3    . MET C 1 140 ? 30.377  29.157  -0.018  1.00 94.15  ? 140 MET C HE3    1 
ATOM   6981 N  N      . ILE C 1 141 ? 26.590  31.813  2.874   1.00 43.55  ? 141 ILE C N      1 
ATOM   6982 C  CA     . ILE C 1 141 ? 26.659  33.263  3.002   1.00 35.20  ? 141 ILE C CA     1 
ATOM   6983 C  C      . ILE C 1 141 ? 26.764  33.686  4.463   1.00 41.42  ? 141 ILE C C      1 
ATOM   6984 O  O      . ILE C 1 141 ? 27.380  34.714  4.767   1.00 47.33  ? 141 ILE C O      1 
ATOM   6985 C  CB     . ILE C 1 141 ? 25.442  33.910  2.323   1.00 27.78  ? 141 ILE C CB     1 
ATOM   6986 C  CG1    . ILE C 1 141 ? 25.515  33.717  0.809   1.00 24.08  ? 141 ILE C CG1    1 
ATOM   6987 C  CG2    . ILE C 1 141 ? 25.402  35.396  2.643   1.00 31.18  ? 141 ILE C CG2    1 
ATOM   6988 C  CD1    . ILE C 1 141 ? 24.238  34.097  0.073   1.00 32.09  ? 141 ILE C CD1    1 
ATOM   6989 H  H      . ILE C 1 141 ? 25.795  31.502  2.770   1.00 52.48  ? 141 ILE C H      1 
ATOM   6990 H  HA     . ILE C 1 141 ? 27.460  33.571  2.550   1.00 42.46  ? 141 ILE C HA     1 
ATOM   6991 H  HB     . ILE C 1 141 ? 24.639  33.483  2.659   1.00 33.56  ? 141 ILE C HB     1 
ATOM   6992 H  HG12   . ILE C 1 141 ? 26.232  34.268  0.459   1.00 29.11  ? 141 ILE C HG12   1 
ATOM   6993 H  HG13   . ILE C 1 141 ? 25.694  32.781  0.623   1.00 29.11  ? 141 ILE C HG13   1 
ATOM   6994 H  HG21   . ILE C 1 141 ? 24.831  35.843  1.999   1.00 37.63  ? 141 ILE C HG21   1 
ATOM   6995 H  HG22   . ILE C 1 141 ? 25.048  35.517  3.538   1.00 37.63  ? 141 ILE C HG22   1 
ATOM   6996 H  HG23   . ILE C 1 141 ? 26.302  35.755  2.592   1.00 37.63  ? 141 ILE C HG23   1 
ATOM   6997 H  HD11   . ILE C 1 141 ? 24.289  33.768  -0.838  1.00 38.72  ? 141 ILE C HD11   1 
ATOM   6998 H  HD12   . ILE C 1 141 ? 23.481  33.697  0.528   1.00 38.72  ? 141 ILE C HD12   1 
ATOM   6999 H  HD13   . ILE C 1 141 ? 24.151  35.063  0.072   1.00 38.72  ? 141 ILE C HD13   1 
ATOM   7000 N  N      . TYR C 1 142 ? 26.151  32.932  5.383   1.00 32.95  ? 142 TYR C N      1 
ATOM   7001 C  CA     . TYR C 1 142 ? 26.049  33.357  6.775   1.00 42.14  ? 142 TYR C CA     1 
ATOM   7002 C  C      . TYR C 1 142 ? 27.381  33.813  7.362   1.00 40.55  ? 142 TYR C C      1 
ATOM   7003 O  O      . TYR C 1 142 ? 27.502  34.974  7.779   1.00 41.89  ? 142 TYR C O      1 
ATOM   7004 C  CB     . TYR C 1 142 ? 25.469  32.230  7.638   1.00 30.63  ? 142 TYR C CB     1 
ATOM   7005 C  CG     . TYR C 1 142 ? 25.545  32.518  9.118   1.00 26.92  ? 142 TYR C CG     1 
ATOM   7006 C  CD1    . TYR C 1 142 ? 24.583  33.292  9.751   1.00 52.06  ? 142 TYR C CD1    1 
ATOM   7007 C  CD2    . TYR C 1 142 ? 26.589  32.018  9.883   1.00 31.54  ? 142 TYR C CD2    1 
ATOM   7008 C  CE1    . TYR C 1 142 ? 24.661  33.560  11.107  1.00 57.55  ? 142 TYR C CE1    1 
ATOM   7009 C  CE2    . TYR C 1 142 ? 26.675  32.279  11.235  1.00 42.76  ? 142 TYR C CE2    1 
ATOM   7010 C  CZ     . TYR C 1 142 ? 25.710  33.049  11.843  1.00 52.16  ? 142 TYR C CZ     1 
ATOM   7011 O  OH     . TYR C 1 142 ? 25.798  33.306  13.191  1.00 60.59  ? 142 TYR C OH     1 
ATOM   7012 H  H      . TYR C 1 142 ? 25.787  32.169  5.221   1.00 39.76  ? 142 TYR C H      1 
ATOM   7013 H  HA     . TYR C 1 142 ? 25.460  34.128  6.793   1.00 50.78  ? 142 TYR C HA     1 
ATOM   7014 H  HB2    . TYR C 1 142 ? 24.535  32.105  7.406   1.00 36.97  ? 142 TYR C HB2    1 
ATOM   7015 H  HB3    . TYR C 1 142 ? 25.965  31.415  7.466   1.00 36.97  ? 142 TYR C HB3    1 
ATOM   7016 H  HD1    . TYR C 1 142 ? 23.875  33.637  9.256   1.00 62.69  ? 142 TYR C HD1    1 
ATOM   7017 H  HD2    . TYR C 1 142 ? 27.243  31.496  9.476   1.00 38.07  ? 142 TYR C HD2    1 
ATOM   7018 H  HE1    . TYR C 1 142 ? 24.010  34.081  11.519  1.00 69.27  ? 142 TYR C HE1    1 
ATOM   7019 H  HE2    . TYR C 1 142 ? 27.382  31.936  11.733  1.00 51.53  ? 142 TYR C HE2    1 
ATOM   7020 H  HH     . TYR C 1 142 ? 26.478  32.931  13.511  1.00 72.93  ? 142 TYR C HH     1 
ATOM   7021 N  N      . PRO C 1 143 ? 28.399  32.950  7.416   1.00 36.85  ? 143 PRO C N      1 
ATOM   7022 C  CA     . PRO C 1 143 ? 29.640  33.359  8.094   1.00 32.84  ? 143 PRO C CA     1 
ATOM   7023 C  C      . PRO C 1 143 ? 30.289  34.569  7.452   1.00 34.50  ? 143 PRO C C      1 
ATOM   7024 O  O      . PRO C 1 143 ? 30.829  35.428  8.160   1.00 40.78  ? 143 PRO C O      1 
ATOM   7025 C  CB     . PRO C 1 143 ? 30.519  32.103  8.002   1.00 25.18  ? 143 PRO C CB     1 
ATOM   7026 C  CG     . PRO C 1 143 ? 29.991  31.351  6.838   1.00 39.14  ? 143 PRO C CG     1 
ATOM   7027 C  CD     . PRO C 1 143 ? 28.515  31.606  6.821   1.00 39.06  ? 143 PRO C CD     1 
ATOM   7028 H  HA     . PRO C 1 143 ? 29.464  33.548  9.029   1.00 39.63  ? 143 PRO C HA     1 
ATOM   7029 H  HB2    . PRO C 1 143 ? 31.445  32.357  7.861   1.00 30.43  ? 143 PRO C HB2    1 
ATOM   7030 H  HB3    . PRO C 1 143 ? 30.439  31.583  8.817   1.00 30.43  ? 143 PRO C HB3    1 
ATOM   7031 H  HG2    . PRO C 1 143 ? 30.405  31.677  6.023   1.00 47.18  ? 143 PRO C HG2    1 
ATOM   7032 H  HG3    . PRO C 1 143 ? 30.176  30.406  6.948   1.00 47.18  ? 143 PRO C HG3    1 
ATOM   7033 H  HD2    . PRO C 1 143 ? 28.173  31.599  5.913   1.00 47.09  ? 143 PRO C HD2    1 
ATOM   7034 H  HD3    . PRO C 1 143 ? 28.045  30.949  7.358   1.00 47.09  ? 143 PRO C HD3    1 
ATOM   7035 N  N      . VAL C 1 144 ? 30.246  34.666  6.124   1.00 34.69  ? 144 VAL C N      1 
ATOM   7036 C  CA     . VAL C 1 144 ? 30.857  35.804  5.443   1.00 37.46  ? 144 VAL C CA     1 
ATOM   7037 C  C      . VAL C 1 144 ? 30.171  37.099  5.862   1.00 38.30  ? 144 VAL C C      1 
ATOM   7038 O  O      . VAL C 1 144 ? 30.829  38.093  6.188   1.00 43.59  ? 144 VAL C O      1 
ATOM   7039 C  CB     . VAL C 1 144 ? 30.804  35.606  3.918   1.00 39.63  ? 144 VAL C CB     1 
ATOM   7040 C  CG1    . VAL C 1 144 ? 31.504  36.754  3.206   1.00 33.42  ? 144 VAL C CG1    1 
ATOM   7041 C  CG2    . VAL C 1 144 ? 31.427  34.274  3.533   1.00 38.51  ? 144 VAL C CG2    1 
ATOM   7042 H  H      . VAL C 1 144 ? 29.874  34.095  5.599   1.00 41.84  ? 144 VAL C H      1 
ATOM   7043 H  HA     . VAL C 1 144 ? 31.789  35.859  5.708   1.00 45.17  ? 144 VAL C HA     1 
ATOM   7044 H  HB     . VAL C 1 144 ? 29.877  35.598  3.633   1.00 47.77  ? 144 VAL C HB     1 
ATOM   7045 H  HG11   . VAL C 1 144 ? 31.551  36.556  2.258   1.00 40.32  ? 144 VAL C HG11   1 
ATOM   7046 H  HG12   . VAL C 1 144 ? 30.999  37.570  3.349   1.00 40.32  ? 144 VAL C HG12   1 
ATOM   7047 H  HG13   . VAL C 1 144 ? 32.399  36.852  3.568   1.00 40.32  ? 144 VAL C HG13   1 
ATOM   7048 H  HG21   . VAL C 1 144 ? 31.526  34.238  2.569   1.00 46.43  ? 144 VAL C HG21   1 
ATOM   7049 H  HG22   . VAL C 1 144 ? 32.296  34.197  3.957   1.00 46.43  ? 144 VAL C HG22   1 
ATOM   7050 H  HG23   . VAL C 1 144 ? 30.848  33.556  3.834   1.00 46.43  ? 144 VAL C HG23   1 
ATOM   7051 N  N      . LEU C 1 145 ? 28.835  37.101  5.875   1.00 53.85  ? 145 LEU C N      1 
ATOM   7052 C  CA     . LEU C 1 145 ? 28.091  38.305  6.238   1.00 46.05  ? 145 LEU C CA     1 
ATOM   7053 C  C      . LEU C 1 145 ? 28.306  38.670  7.701   1.00 32.66  ? 145 LEU C C      1 
ATOM   7054 O  O      . LEU C 1 145 ? 28.451  39.853  8.041   1.00 37.71  ? 145 LEU C O      1 
ATOM   7055 C  CB     . LEU C 1 145 ? 26.603  38.098  5.959   1.00 35.07  ? 145 LEU C CB     1 
ATOM   7056 C  CG     . LEU C 1 145 ? 25.682  39.267  6.305   1.00 33.16  ? 145 LEU C CG     1 
ATOM   7057 C  CD1    . LEU C 1 145 ? 26.077  40.502  5.518   1.00 31.90  ? 145 LEU C CD1    1 
ATOM   7058 C  CD2    . LEU C 1 145 ? 24.229  38.896  6.047   1.00 28.58  ? 145 LEU C CD2    1 
ATOM   7059 H  H      . LEU C 1 145 ? 28.339  36.425  5.681   1.00 64.84  ? 145 LEU C H      1 
ATOM   7060 H  HA     . LEU C 1 145 ? 28.408  39.042  5.693   1.00 55.47  ? 145 LEU C HA     1 
ATOM   7061 H  HB2    . LEU C 1 145 ? 26.495  37.921  5.011   1.00 42.30  ? 145 LEU C HB2    1 
ATOM   7062 H  HB3    . LEU C 1 145 ? 26.302  37.334  6.475   1.00 42.30  ? 145 LEU C HB3    1 
ATOM   7063 H  HG     . LEU C 1 145 ? 25.770  39.475  7.248   1.00 40.00  ? 145 LEU C HG     1 
ATOM   7064 H  HD11   . LEU C 1 145 ? 25.411  41.193  5.659   1.00 38.49  ? 145 LEU C HD11   1 
ATOM   7065 H  HD12   . LEU C 1 145 ? 26.944  40.810  5.827   1.00 38.49  ? 145 LEU C HD12   1 
ATOM   7066 H  HD13   . LEU C 1 145 ? 26.124  40.275  4.576   1.00 38.49  ? 145 LEU C HD13   1 
ATOM   7067 H  HD21   . LEU C 1 145 ? 23.667  39.661  6.249   1.00 34.51  ? 145 LEU C HD21   1 
ATOM   7068 H  HD22   . LEU C 1 145 ? 24.127  38.648  5.115   1.00 34.51  ? 145 LEU C HD22   1 
ATOM   7069 H  HD23   . LEU C 1 145 ? 23.987  38.149  6.617   1.00 34.51  ? 145 LEU C HD23   1 
ATOM   7070 N  N      . ASP C 1 146 ? 28.318  37.668  8.582   1.00 36.61  ? 146 ASP C N      1 
ATOM   7071 C  CA     . ASP C 1 146 ? 28.564  37.933  9.995   1.00 50.54  ? 146 ASP C CA     1 
ATOM   7072 C  C      . ASP C 1 146 ? 29.944  38.548  10.194  1.00 50.90  ? 146 ASP C C      1 
ATOM   7073 O  O      . ASP C 1 146 ? 30.100  39.541  10.916  1.00 61.20  ? 146 ASP C O      1 
ATOM   7074 C  CB     . ASP C 1 146 ? 28.422  36.648  10.808  1.00 47.91  ? 146 ASP C CB     1 
ATOM   7075 C  CG     . ASP C 1 146 ? 28.590  36.887  12.289  1.00 41.77  ? 146 ASP C CG     1 
ATOM   7076 O  OD1    . ASP C 1 146 ? 28.479  38.058  12.705  1.00 52.70  ? 146 ASP C OD1    1 
ATOM   7077 O  OD2    . ASP C 1 146 ? 28.830  35.916  13.036  1.00 46.75  ? 146 ASP C OD2    1 
ATOM   7078 H  H      . ASP C 1 146 ? 28.188  36.839  8.391   1.00 44.15  ? 146 ASP C H      1 
ATOM   7079 H  HA     . ASP C 1 146 ? 27.898  38.561  10.317  1.00 60.86  ? 146 ASP C HA     1 
ATOM   7080 H  HB2    . ASP C 1 146 ? 27.539  36.274  10.661  1.00 57.71  ? 146 ASP C HB2    1 
ATOM   7081 H  HB3    . ASP C 1 146 ? 29.102  36.016  10.525  1.00 57.71  ? 146 ASP C HB3    1 
ATOM   7082 N  N      . SER C 1 147 ? 30.964  37.958  9.566   1.00 55.83  ? 147 SER C N      1 
ATOM   7083 C  CA     . SER C 1 147 ? 32.310  38.505  9.674   1.00 49.12  ? 147 SER C CA     1 
ATOM   7084 C  C      . SER C 1 147 ? 32.372  39.910  9.094   1.00 45.90  ? 147 SER C C      1 
ATOM   7085 O  O      . SER C 1 147 ? 33.078  40.773  9.621   1.00 44.24  ? 147 SER C O      1 
ATOM   7086 C  CB     . SER C 1 147 ? 33.305  37.588  8.964   1.00 43.14  ? 147 SER C CB     1 
ATOM   7087 O  OG     . SER C 1 147 ? 33.320  36.299  9.554   1.00 66.16  ? 147 SER C OG     1 
ATOM   7088 H  H      . SER C 1 147 ? 30.904  37.252  9.079   1.00 67.21  ? 147 SER C H      1 
ATOM   7089 H  HA     . SER C 1 147 ? 32.559  38.550  10.610  1.00 59.16  ? 147 SER C HA     1 
ATOM   7090 H  HB2    . SER C 1 147 ? 33.048  37.504  8.033   1.00 51.98  ? 147 SER C HB2    1 
ATOM   7091 H  HB3    . SER C 1 147 ? 34.192  37.974  9.030   1.00 51.98  ? 147 SER C HB3    1 
ATOM   7092 H  HG     . SER C 1 147 ? 32.566  35.938  9.473   1.00 79.61  ? 147 SER C HG     1 
ATOM   7093 N  N      . ALA C 1 148 ? 31.628  40.165  8.016   1.00 42.96  ? 148 ALA C N      1 
ATOM   7094 C  CA     . ALA C 1 148 ? 31.621  41.495  7.419   1.00 44.59  ? 148 ALA C CA     1 
ATOM   7095 C  C      . ALA C 1 148 ? 31.071  42.523  8.396   1.00 49.63  ? 148 ALA C C      1 
ATOM   7096 O  O      . ALA C 1 148 ? 31.648  43.602  8.575   1.00 43.01  ? 148 ALA C O      1 
ATOM   7097 C  CB     . ALA C 1 148 ? 30.794  41.486  6.132   1.00 45.41  ? 148 ALA C CB     1 
ATOM   7098 H  H      . ALA C 1 148 ? 31.124  39.593  7.617   1.00 51.76  ? 148 ALA C H      1 
ATOM   7099 H  HA     . ALA C 1 148 ? 32.531  41.744  7.192   1.00 53.72  ? 148 ALA C HA     1 
ATOM   7100 H  HB1    . ALA C 1 148 ? 30.794  42.378  5.751   1.00 54.71  ? 148 ALA C HB1    1 
ATOM   7101 H  HB2    . ALA C 1 148 ? 31.190  40.859  5.507   1.00 54.71  ? 148 ALA C HB2    1 
ATOM   7102 H  HB3    . ALA C 1 148 ? 29.887  41.216  6.342   1.00 54.71  ? 148 ALA C HB3    1 
ATOM   7103 N  N      . PHE C 1 149 ? 29.941  42.207  9.031   1.00 62.58  ? 149 PHE C N      1 
ATOM   7104 C  CA     . PHE C 1 149 ? 29.363  43.121  10.012  1.00 51.43  ? 149 PHE C CA     1 
ATOM   7105 C  C      . PHE C 1 149 ? 30.307  43.329  11.193  1.00 43.53  ? 149 PHE C C      1 
ATOM   7106 O  O      . PHE C 1 149 ? 30.499  44.462  11.657  1.00 49.81  ? 149 PHE C O      1 
ATOM   7107 C  CB     . PHE C 1 149 ? 28.014  42.578  10.482  1.00 34.91  ? 149 PHE C CB     1 
ATOM   7108 C  CG     . PHE C 1 149 ? 26.874  42.883  9.544   1.00 31.26  ? 149 PHE C CG     1 
ATOM   7109 C  CD1    . PHE C 1 149 ? 26.723  44.141  8.985   1.00 20.64  ? 149 PHE C CD1    1 
ATOM   7110 C  CD2    . PHE C 1 149 ? 25.971  41.890  9.193   1.00 46.61  ? 149 PHE C CD2    1 
ATOM   7111 C  CE1    . PHE C 1 149 ? 25.682  44.409  8.117   1.00 19.03  ? 149 PHE C CE1    1 
ATOM   7112 C  CE2    . PHE C 1 149 ? 24.929  42.153  8.323   1.00 20.14  ? 149 PHE C CE2    1 
ATOM   7113 C  CZ     . PHE C 1 149 ? 24.785  43.412  7.785   1.00 20.43  ? 149 PHE C CZ     1 
ATOM   7114 H  H      . PHE C 1 149 ? 29.496  41.480  8.915   1.00 75.31  ? 149 PHE C H      1 
ATOM   7115 H  HA     . PHE C 1 149 ? 29.214  43.985  9.597   1.00 61.93  ? 149 PHE C HA     1 
ATOM   7116 H  HB2    . PHE C 1 149 ? 28.078  41.614  10.566  1.00 42.11  ? 149 PHE C HB2    1 
ATOM   7117 H  HB3    . PHE C 1 149 ? 27.802  42.973  11.342  1.00 42.11  ? 149 PHE C HB3    1 
ATOM   7118 H  HD1    . PHE C 1 149 ? 27.330  44.813  9.196   1.00 24.99  ? 149 PHE C HD1    1 
ATOM   7119 H  HD2    . PHE C 1 149 ? 26.069  41.036  9.548   1.00 56.15  ? 149 PHE C HD2    1 
ATOM   7120 H  HE1    . PHE C 1 149 ? 25.584  45.261  7.757   1.00 23.06  ? 149 PHE C HE1    1 
ATOM   7121 H  HE2    . PHE C 1 149 ? 24.326  41.480  8.101   1.00 24.39  ? 149 PHE C HE2    1 
ATOM   7122 H  HZ     . PHE C 1 149 ? 24.086  43.591  7.199   1.00 24.73  ? 149 PHE C HZ     1 
ATOM   7123 N  N      . LYS C 1 150 ? 30.936  42.252  11.671  1.00 47.82  ? 150 LYS C N      1 
ATOM   7124 C  CA     . LYS C 1 150 ? 31.841  42.379  12.809  1.00 47.08  ? 150 LYS C CA     1 
ATOM   7125 C  C      . LYS C 1 150 ? 33.055  43.232  12.455  1.00 65.77  ? 150 LYS C C      1 
ATOM   7126 O  O      . LYS C 1 150 ? 33.484  44.075  13.253  1.00 77.33  ? 150 LYS C O      1 
ATOM   7127 C  CB     . LYS C 1 150 ? 32.277  40.996  13.292  1.00 44.14  ? 150 LYS C CB     1 
ATOM   7128 C  CG     . LYS C 1 150 ? 31.170  40.194  13.965  1.00 49.46  ? 150 LYS C CG     1 
ATOM   7129 C  CD     . LYS C 1 150 ? 31.669  38.830  14.430  1.00 71.20  ? 150 LYS C CD     1 
ATOM   7130 C  CE     . LYS C 1 150 ? 30.584  38.051  15.165  1.00 68.88  ? 150 LYS C CE     1 
ATOM   7131 N  NZ     . LYS C 1 150 ? 31.038  36.690  15.573  1.00 83.28  ? 150 LYS C NZ     1 
ATOM   7132 H  H      . LYS C 1 150 ? 30.859  41.453  11.361  1.00 57.60  ? 150 LYS C H      1 
ATOM   7133 H  HA     . LYS C 1 150 ? 31.369  42.814  13.537  1.00 56.72  ? 150 LYS C HA     1 
ATOM   7134 H  HB2    . LYS C 1 150 ? 32.588  40.484  12.529  1.00 53.19  ? 150 LYS C HB2    1 
ATOM   7135 H  HB3    . LYS C 1 150 ? 32.995  41.103  13.935  1.00 53.19  ? 150 LYS C HB3    1 
ATOM   7136 H  HG2    . LYS C 1 150 ? 30.847  40.681  14.740  1.00 59.57  ? 150 LYS C HG2    1 
ATOM   7137 H  HG3    . LYS C 1 150 ? 30.445  40.055  13.336  1.00 59.57  ? 150 LYS C HG3    1 
ATOM   7138 H  HD2    . LYS C 1 150 ? 31.946  38.311  13.659  1.00 85.66  ? 150 LYS C HD2    1 
ATOM   7139 H  HD3    . LYS C 1 150 ? 32.418  38.952  15.035  1.00 85.66  ? 150 LYS C HD3    1 
ATOM   7140 H  HE2    . LYS C 1 150 ? 30.331  38.537  15.965  1.00 82.87  ? 150 LYS C HE2    1 
ATOM   7141 H  HE3    . LYS C 1 150 ? 29.816  37.949  14.581  1.00 82.87  ? 150 LYS C HE3    1 
ATOM   7142 H  HZ1    . LYS C 1 150 ? 30.380  36.262  15.992  1.00 100.15 ? 150 LYS C HZ1    1 
ATOM   7143 H  HZ2    . LYS C 1 150 ? 31.277  36.220  14.856  1.00 100.15 ? 150 LYS C HZ2    1 
ATOM   7144 H  HZ3    . LYS C 1 150 ? 31.736  36.754  16.122  1.00 100.15 ? 150 LYS C HZ3    1 
ATOM   7145 N  N      . ASN C 1 151 ? 33.614  43.040  11.257  1.00 65.30  ? 151 ASN C N      1 
ATOM   7146 C  CA     . ASN C 1 151 ? 34.797  43.795  10.864  1.00 55.68  ? 151 ASN C CA     1 
ATOM   7147 C  C      . ASN C 1 151 ? 34.453  45.246  10.563  1.00 61.92  ? 151 ASN C C      1 
ATOM   7148 O  O      . ASN C 1 151 ? 35.286  46.133  10.777  1.00 78.09  ? 151 ASN C O      1 
ATOM   7149 C  CB     . ASN C 1 151 ? 35.451  43.143  9.644   1.00 58.56  ? 151 ASN C CB     1 
ATOM   7150 C  CG     . ASN C 1 151 ? 35.922  41.722  9.919   1.00 69.34  ? 151 ASN C CG     1 
ATOM   7151 O  OD1    . ASN C 1 151 ? 36.230  41.368  11.057  1.00 67.37  ? 151 ASN C OD1    1 
ATOM   7152 N  ND2    . ASN C 1 151 ? 35.968  40.900  8.875   1.00 60.92  ? 151 ASN C ND2    1 
ATOM   7153 H  H      . ASN C 1 151 ? 33.332  42.486  10.663  1.00 78.58  ? 151 ASN C H      1 
ATOM   7154 H  HA     . ASN C 1 151 ? 35.436  43.781  11.593  1.00 67.03  ? 151 ASN C HA     1 
ATOM   7155 H  HB2    . ASN C 1 151 ? 34.807  43.110  8.919   1.00 70.49  ? 151 ASN C HB2    1 
ATOM   7156 H  HB3    . ASN C 1 151 ? 36.222  43.668  9.380   1.00 70.49  ? 151 ASN C HB3    1 
ATOM   7157 H  HD21   . ASN C 1 151 ? 36.227  40.086  8.979   1.00 73.32  ? 151 ASN C HD21   1 
ATOM   7158 H  HD22   . ASN C 1 151 ? 35.738  41.181  8.095   1.00 73.32  ? 151 ASN C HD22   1 
ATOM   7159 N  N      . ARG C 1 152 ? 33.237  45.516  10.081  1.00 61.65  ? 152 ARG C N      1 
ATOM   7160 C  CA     . ARG C 1 152 ? 32.818  46.902  9.913   1.00 51.86  ? 152 ARG C CA     1 
ATOM   7161 C  C      . ARG C 1 152 ? 32.680  47.576  11.270  1.00 51.49  ? 152 ARG C C      1 
ATOM   7162 O  O      . ARG C 1 152 ? 33.037  48.748  11.428  1.00 84.43  ? 152 ARG C O      1 
ATOM   7163 C  CB     . ARG C 1 152 ? 31.506  46.981  9.135   1.00 52.94  ? 152 ARG C CB     1 
ATOM   7164 C  CG     . ARG C 1 152 ? 31.087  48.406  8.800   1.00 39.99  ? 152 ARG C CG     1 
ATOM   7165 C  CD     . ARG C 1 152 ? 29.787  48.451  8.010   1.00 32.01  ? 152 ARG C CD     1 
ATOM   7166 N  NE     . ARG C 1 152 ? 28.650  47.987  8.798   1.00 37.01  ? 152 ARG C NE     1 
ATOM   7167 C  CZ     . ARG C 1 152 ? 27.383  48.060  8.403   1.00 26.14  ? 152 ARG C CZ     1 
ATOM   7168 N  NH1    . ARG C 1 152 ? 27.074  48.577  7.221   1.00 41.51  ? 152 ARG C NH1    1 
ATOM   7169 N  NH2    . ARG C 1 152 ? 26.419  47.613  9.194   1.00 50.98  ? 152 ARG C NH2    1 
ATOM   7170 H  H      . ARG C 1 152 ? 32.651  44.930  9.851   1.00 74.20  ? 152 ARG C H      1 
ATOM   7171 H  HA     . ARG C 1 152 ? 33.486  47.375  9.393   1.00 62.45  ? 152 ARG C HA     1 
ATOM   7172 H  HB2    . ARG C 1 152 ? 31.608  46.496  8.301   1.00 63.75  ? 152 ARG C HB2    1 
ATOM   7173 H  HB3    . ARG C 1 152 ? 30.801  46.580  9.668   1.00 63.75  ? 152 ARG C HB3    1 
ATOM   7174 H  HG2    . ARG C 1 152 ? 30.957  48.902  9.623   1.00 48.20  ? 152 ARG C HG2    1 
ATOM   7175 H  HG3    . ARG C 1 152 ? 31.780  48.825  8.266   1.00 48.20  ? 152 ARG C HG3    1 
ATOM   7176 H  HD2    . ARG C 1 152 ? 29.613  49.365  7.735   1.00 38.63  ? 152 ARG C HD2    1 
ATOM   7177 H  HD3    . ARG C 1 152 ? 29.868  47.880  7.230   1.00 38.63  ? 152 ARG C HD3    1 
ATOM   7178 H  HE     . ARG C 1 152 ? 28.810  47.644  9.571   1.00 44.63  ? 152 ARG C HE     1 
ATOM   7179 H  HH11   . ARG C 1 152 ? 27.696  48.868  6.704   1.00 50.03  ? 152 ARG C HH11   1 
ATOM   7180 H  HH12   . ARG C 1 152 ? 26.252  48.620  6.972   1.00 50.03  ? 152 ARG C HH12   1 
ATOM   7181 H  HH21   . ARG C 1 152 ? 26.614  47.278  9.961   1.00 61.40  ? 152 ARG C HH21   1 
ATOM   7182 H  HH22   . ARG C 1 152 ? 25.599  47.659  8.940   1.00 61.40  ? 152 ARG C HH22   1 
ATOM   7183 N  N      . LYS C 1 153 ? 32.147  46.850  12.258  1.00 67.67  ? 153 LYS C N      1 
ATOM   7184 C  CA     . LYS C 1 153 ? 32.034  47.407  13.602  1.00 82.98  ? 153 LYS C CA     1 
ATOM   7185 C  C      . LYS C 1 153 ? 33.410  47.671  14.202  1.00 91.62  ? 153 LYS C C      1 
ATOM   7186 O  O      . LYS C 1 153 ? 33.621  48.692  14.867  1.00 95.06  ? 153 LYS C O      1 
ATOM   7187 C  CB     . LYS C 1 153 ? 31.233  46.459  14.497  1.00 79.75  ? 153 LYS C CB     1 
ATOM   7188 C  CG     . LYS C 1 153 ? 30.952  47.013  15.889  1.00 93.38  ? 153 LYS C CG     1 
ATOM   7189 C  CD     . LYS C 1 153 ? 30.146  46.040  16.747  1.00 86.61  ? 153 LYS C CD     1 
ATOM   7190 C  CE     . LYS C 1 153 ? 30.943  44.792  17.109  1.00 84.76  ? 153 LYS C CE     1 
ATOM   7191 N  NZ     . LYS C 1 153 ? 32.205  45.109  17.838  1.00 82.50  ? 153 LYS C NZ     1 
ATOM   7192 H  H      . LYS C 1 153 ? 31.848  46.048  12.177  1.00 81.42  ? 153 LYS C H      1 
ATOM   7193 H  HA     . LYS C 1 153 ? 31.556  48.250  13.553  1.00 99.79  ? 153 LYS C HA     1 
ATOM   7194 H  HB2    . LYS C 1 153 ? 30.379  46.278  14.073  1.00 95.91  ? 153 LYS C HB2    1 
ATOM   7195 H  HB3    . LYS C 1 153 ? 31.733  45.635  14.602  1.00 95.91  ? 153 LYS C HB3    1 
ATOM   7196 H  HG2    . LYS C 1 153 ? 31.794  47.185  16.339  1.00 112.27 ? 153 LYS C HG2    1 
ATOM   7197 H  HG3    . LYS C 1 153 ? 30.445  47.836  15.809  1.00 112.27 ? 153 LYS C HG3    1 
ATOM   7198 H  HD2    . LYS C 1 153 ? 29.886  46.482  17.571  1.00 104.15 ? 153 LYS C HD2    1 
ATOM   7199 H  HD3    . LYS C 1 153 ? 29.357  45.762  16.256  1.00 104.15 ? 153 LYS C HD3    1 
ATOM   7200 H  HE2    . LYS C 1 153 ? 30.401  44.224  17.679  1.00 101.93 ? 153 LYS C HE2    1 
ATOM   7201 H  HE3    . LYS C 1 153 ? 31.177  44.319  16.296  1.00 101.93 ? 153 LYS C HE3    1 
ATOM   7202 H  HZ1    . LYS C 1 153 ? 32.606  44.357  18.094  1.00 99.21  ? 153 LYS C HZ1    1 
ATOM   7203 H  HZ2    . LYS C 1 153 ? 32.756  45.566  17.309  1.00 99.21  ? 153 LYS C HZ2    1 
ATOM   7204 H  HZ3    . LYS C 1 153 ? 32.025  45.600  18.559  1.00 99.21  ? 153 LYS C HZ3    1 
ATOM   7205 N  N      . ARG C 1 154 ? 34.360  46.760  13.978  1.00 95.99  ? 154 ARG C N      1 
ATOM   7206 C  CA     . ARG C 1 154 ? 35.693  46.922  14.552  1.00 100.51 ? 154 ARG C CA     1 
ATOM   7207 C  C      . ARG C 1 154 ? 36.443  48.070  13.884  1.00 106.59 ? 154 ARG C C      1 
ATOM   7208 O  O      . ARG C 1 154 ? 36.892  49.008  14.553  1.00 113.79 ? 154 ARG C O      1 
ATOM   7209 C  CB     . ARG C 1 154 ? 36.487  45.618  14.427  1.00 93.02  ? 154 ARG C CB     1 
ATOM   7210 C  CG     . ARG C 1 154 ? 37.771  45.608  15.250  1.00 89.14  ? 154 ARG C CG     1 
ATOM   7211 C  CD     . ARG C 1 154 ? 38.635  44.380  14.981  1.00 104.88 ? 154 ARG C CD     1 
ATOM   7212 N  NE     . ARG C 1 154 ? 39.365  44.477  13.717  1.00 111.63 ? 154 ARG C NE     1 
ATOM   7213 C  CZ     . ARG C 1 154 ? 38.978  43.928  12.567  1.00 105.09 ? 154 ARG C CZ     1 
ATOM   7214 N  NH1    . ARG C 1 154 ? 37.856  43.223  12.495  1.00 89.06  ? 154 ARG C NH1    1 
ATOM   7215 N  NH2    . ARG C 1 154 ? 39.723  44.083  11.480  1.00 104.65 ? 154 ARG C NH2    1 
ATOM   7216 H  H      . ARG C 1 154 ? 34.260  46.049  13.505  1.00 115.40 ? 154 ARG C H      1 
ATOM   7217 H  HA     . ARG C 1 154 ? 35.599  47.127  15.495  1.00 120.83 ? 154 ARG C HA     1 
ATOM   7218 H  HB2    . ARG C 1 154 ? 35.933  44.883  14.732  1.00 111.84 ? 154 ARG C HB2    1 
ATOM   7219 H  HB3    . ARG C 1 154 ? 36.730  45.487  13.496  1.00 111.84 ? 154 ARG C HB3    1 
ATOM   7220 H  HG2    . ARG C 1 154 ? 38.294  46.395  15.032  1.00 107.18 ? 154 ARG C HG2    1 
ATOM   7221 H  HG3    . ARG C 1 154 ? 37.543  45.613  16.193  1.00 107.18 ? 154 ARG C HG3    1 
ATOM   7222 H  HD2    . ARG C 1 154 ? 39.283  44.284  15.696  1.00 126.07 ? 154 ARG C HD2    1 
ATOM   7223 H  HD3    . ARG C 1 154 ? 38.067  43.595  14.940  1.00 126.07 ? 154 ARG C HD3    1 
ATOM   7224 H  HE     . ARG C 1 154 ? 40.101  44.923  13.716  1.00 134.17 ? 154 ARG C HE     1 
ATOM   7225 H  HH11   . ARG C 1 154 ? 37.369  43.117  13.196  1.00 107.08 ? 154 ARG C HH11   1 
ATOM   7226 H  HH12   . ARG C 1 154 ? 37.615  42.872  11.748  1.00 107.08 ? 154 ARG C HH12   1 
ATOM   7227 H  HH21   . ARG C 1 154 ? 40.452  44.537  11.520  1.00 125.79 ? 154 ARG C HH21   1 
ATOM   7228 H  HH22   . ARG C 1 154 ? 39.476  43.730  10.736  1.00 125.79 ? 154 ARG C HH22   1 
ATOM   7229 N  N      . VAL C 1 155 ? 36.588  48.013  12.557  1.00 106.59 ? 155 VAL C N      1 
ATOM   7230 C  CA     . VAL C 1 155 ? 37.377  49.015  11.839  1.00 106.23 ? 155 VAL C CA     1 
ATOM   7231 C  C      . VAL C 1 155 ? 36.858  50.416  12.143  1.00 103.95 ? 155 VAL C C      1 
ATOM   7232 O  O      . VAL C 1 155 ? 37.597  51.283  12.624  1.00 116.76 ? 155 VAL C O      1 
ATOM   7233 C  CB     . VAL C 1 155 ? 37.365  48.728  10.326  1.00 100.98 ? 155 VAL C CB     1 
ATOM   7234 C  CG1    . VAL C 1 155 ? 38.014  49.872  9.558   1.00 80.06  ? 155 VAL C CG1    1 
ATOM   7235 C  CG2    . VAL C 1 155 ? 38.076  47.410  10.023  1.00 92.27  ? 155 VAL C CG2    1 
ATOM   7236 H  H      . VAL C 1 155 ? 36.243  47.409  12.051  1.00 128.13 ? 155 VAL C H      1 
ATOM   7237 H  HA     . VAL C 1 155 ? 38.295  48.963  12.149  1.00 127.69 ? 155 VAL C HA     1 
ATOM   7238 H  HB     . VAL C 1 155 ? 36.444  48.649  10.033  1.00 121.39 ? 155 VAL C HB     1 
ATOM   7239 H  HG11   . VAL C 1 155 ? 38.237  49.567  8.665   1.00 96.28  ? 155 VAL C HG11   1 
ATOM   7240 H  HG12   . VAL C 1 155 ? 37.389  50.613  9.509   1.00 96.28  ? 155 VAL C HG12   1 
ATOM   7241 H  HG13   . VAL C 1 155 ? 38.818  50.149  10.024  1.00 96.28  ? 155 VAL C HG13   1 
ATOM   7242 H  HG21   . VAL C 1 155 ? 38.023  47.234  9.071   1.00 110.94 ? 155 VAL C HG21   1 
ATOM   7243 H  HG22   . VAL C 1 155 ? 39.005  47.482  10.295  1.00 110.94 ? 155 VAL C HG22   1 
ATOM   7244 H  HG23   . VAL C 1 155 ? 37.642  46.696  10.516  1.00 110.94 ? 155 VAL C HG23   1 
ATOM   7245 N  N      . GLU C 1 156 ? 35.582  50.656  11.867  1.00 97.82  ? 156 GLU C N      1 
ATOM   7246 C  CA     . GLU C 1 156 ? 34.991  51.970  12.091  1.00 97.61  ? 156 GLU C CA     1 
ATOM   7247 C  C      . GLU C 1 156 ? 34.850  52.244  13.584  1.00 96.52  ? 156 GLU C C      1 
ATOM   7248 O  O      . GLU C 1 156 ? 34.759  51.317  14.388  1.00 97.28  ? 156 GLU C O      1 
ATOM   7249 C  CB     . GLU C 1 156 ? 33.629  52.070  11.403  1.00 99.09  ? 156 GLU C CB     1 
ATOM   7250 C  CG     . GLU C 1 156 ? 33.013  53.459  11.445  1.00 103.58 ? 156 GLU C CG     1 
ATOM   7251 C  CD     . GLU C 1 156 ? 31.688  53.528  10.712  1.00 105.68 ? 156 GLU C CD     1 
ATOM   7252 O  OE1    . GLU C 1 156 ? 31.257  52.490  10.167  1.00 103.46 ? 156 GLU C OE1    1 
ATOM   7253 O  OE2    . GLU C 1 156 ? 31.079  54.619  10.679  1.00 86.12  ? 156 GLU C OE2    1 
ATOM   7254 H  H      . GLU C 1 156 ? 35.035  50.073  11.548  1.00 117.60 ? 156 GLU C H      1 
ATOM   7255 H  HA     . GLU C 1 156 ? 35.566  52.651  11.708  1.00 117.34 ? 156 GLU C HA     1 
ATOM   7256 H  HB2    . GLU C 1 156 ? 33.732  51.822  10.471  1.00 119.13 ? 156 GLU C HB2    1 
ATOM   7257 H  HB3    . GLU C 1 156 ? 33.014  51.462  11.842  1.00 119.13 ? 156 GLU C HB3    1 
ATOM   7258 H  HG2    . GLU C 1 156 ? 32.859  53.710  12.370  1.00 124.51 ? 156 GLU C HG2    1 
ATOM   7259 H  HG3    . GLU C 1 156 ? 33.621  54.089  11.028  1.00 124.51 ? 156 GLU C HG3    1 
ATOM   7260 P  P      . DC  D 2 1   ? -52.274 30.088  20.435  1.00 114.35 ? 1   DC  D P      1 
ATOM   7261 O  OP1    . DC  D 2 1   ? -53.217 29.778  19.336  1.00 94.46  ? 1   DC  D OP1    1 
ATOM   7262 O  OP2    . DC  D 2 1   ? -52.058 29.105  21.523  1.00 79.34  ? 1   DC  D OP2    1 
ATOM   7263 O  "O5'"  . DC  D 2 1   ? -52.652 31.500  21.101  1.00 78.46  ? 1   DC  D "O5'"  1 
ATOM   7264 C  "C5'"  . DC  D 2 1   ? -53.676 32.323  20.531  1.00 67.90  ? 1   DC  D "C5'"  1 
ATOM   7265 C  "C4'"  . DC  D 2 1   ? -53.771 33.652  21.264  1.00 60.04  ? 1   DC  D "C4'"  1 
ATOM   7266 O  "O4'"  . DC  D 2 1   ? -54.366 33.445  22.574  1.00 61.20  ? 1   DC  D "O4'"  1 
ATOM   7267 C  "C3'"  . DC  D 2 1   ? -52.431 34.324  21.525  1.00 70.29  ? 1   DC  D "C3'"  1 
ATOM   7268 O  "O3'"  . DC  D 2 1   ? -52.537 35.734  21.519  1.00 78.57  ? 1   DC  D "O3'"  1 
ATOM   7269 C  "C2'"  . DC  D 2 1   ? -52.057 33.801  22.903  1.00 81.83  ? 1   DC  D "C2'"  1 
ATOM   7270 C  "C1'"  . DC  D 2 1   ? -53.413 33.706  23.594  1.00 58.81  ? 1   DC  D "C1'"  1 
ATOM   7271 N  N1     . DC  D 2 1   ? -53.482 32.620  24.616  1.00 37.21  ? 1   DC  D N1     1 
ATOM   7272 C  C2     . DC  D 2 1   ? -53.536 32.951  25.973  1.00 39.79  ? 1   DC  D C2     1 
ATOM   7273 O  O2     . DC  D 2 1   ? -53.558 34.143  26.298  1.00 54.58  ? 1   DC  D O2     1 
ATOM   7274 N  N3     . DC  D 2 1   ? -53.596 31.954  26.890  1.00 37.41  ? 1   DC  D N3     1 
ATOM   7275 C  C4     . DC  D 2 1   ? -53.579 30.679  26.493  1.00 49.92  ? 1   DC  D C4     1 
ATOM   7276 N  N4     . DC  D 2 1   ? -53.637 29.726  27.430  1.00 60.80  ? 1   DC  D N4     1 
ATOM   7277 C  C5     . DC  D 2 1   ? -53.506 30.324  25.115  1.00 52.47  ? 1   DC  D C5     1 
ATOM   7278 C  C6     . DC  D 2 1   ? -53.455 31.316  24.222  1.00 51.07  ? 1   DC  D C6     1 
ATOM   7279 H  "H5'"  . DC  D 2 1   ? -54.528 31.862  20.593  1.00 81.69  ? 1   DC  D "H5'"  1 
ATOM   7280 H  "H5''" . DC  D 2 1   ? -53.473 32.486  19.597  1.00 81.69  ? 1   DC  D "H5''" 1 
ATOM   7281 H  "H4'"  . DC  D 2 1   ? -54.338 34.255  20.760  1.00 72.26  ? 1   DC  D "H4'"  1 
ATOM   7282 H  "H3'"  . DC  D 2 1   ? -51.792 34.038  20.853  1.00 84.56  ? 1   DC  D "H3'"  1 
ATOM   7283 H  "H2'"  . DC  D 2 1   ? -51.627 32.933  22.847  1.00 98.42  ? 1   DC  D "H2'"  1 
ATOM   7284 H  "H2''" . DC  D 2 1   ? -51.467 34.416  23.366  1.00 98.42  ? 1   DC  D "H2''" 1 
ATOM   7285 H  "H1'"  . DC  D 2 1   ? -53.628 34.553  24.015  1.00 70.79  ? 1   DC  D "H1'"  1 
ATOM   7286 H  H41    . DC  D 2 1   ? -53.627 28.897  27.201  1.00 73.18  ? 1   DC  D H41    1 
ATOM   7287 H  H42    . DC  D 2 1   ? -53.683 29.943  28.261  1.00 73.18  ? 1   DC  D H42    1 
ATOM   7288 H  H5     . DC  D 2 1   ? -53.494 29.434  24.848  1.00 63.18  ? 1   DC  D H5     1 
ATOM   7289 H  H6     . DC  D 2 1   ? -53.401 31.113  23.316  1.00 61.50  ? 1   DC  D H6     1 
ATOM   7290 P  P      . DT  D 2 2   ? -51.219 36.632  21.322  1.00 105.48 ? 2   DT  D P      1 
ATOM   7291 O  OP1    . DT  D 2 2   ? -51.635 37.826  20.551  1.00 83.76  ? 2   DT  D OP1    1 
ATOM   7292 O  OP2    . DT  D 2 2   ? -50.128 35.763  20.833  1.00 81.83  ? 2   DT  D OP2    1 
ATOM   7293 O  "O5'"  . DT  D 2 2   ? -50.815 37.095  22.801  1.00 72.71  ? 2   DT  D "O5'"  1 
ATOM   7294 C  "C5'"  . DT  D 2 2   ? -51.770 37.710  23.640  1.00 66.15  ? 2   DT  D "C5'"  1 
ATOM   7295 C  "C4'"  . DT  D 2 2   ? -51.119 38.303  24.878  1.00 65.63  ? 2   DT  D "C4'"  1 
ATOM   7296 O  "O4'"  . DT  D 2 2   ? -51.120 37.338  25.968  1.00 62.31  ? 2   DT  D "O4'"  1 
ATOM   7297 C  "C3'"  . DT  D 2 2   ? -49.657 38.713  24.712  1.00 72.41  ? 2   DT  D "C3'"  1 
ATOM   7298 O  "O3'"  . DT  D 2 2   ? -49.384 39.860  25.505  1.00 71.90  ? 2   DT  D "O3'"  1 
ATOM   7299 C  "C2'"  . DT  D 2 2   ? -48.887 37.475  25.179  1.00 68.91  ? 2   DT  D "C2'"  1 
ATOM   7300 C  "C1'"  . DT  D 2 2   ? -49.789 36.918  26.280  1.00 61.18  ? 2   DT  D "C1'"  1 
ATOM   7301 N  N1     . DT  D 2 2   ? -49.801 35.417  26.430  1.00 52.39  ? 2   DT  D N1     1 
ATOM   7302 C  C2     . DT  D 2 2   ? -49.925 34.885  27.694  1.00 52.59  ? 2   DT  D C2     1 
ATOM   7303 O  O2     . DT  D 2 2   ? -50.036 35.568  28.698  1.00 55.22  ? 2   DT  D O2     1 
ATOM   7304 N  N3     . DT  D 2 2   ? -49.945 33.518  27.744  1.00 43.06  ? 2   DT  D N3     1 
ATOM   7305 C  C4     . DT  D 2 2   ? -49.838 32.643  26.684  1.00 44.96  ? 2   DT  D C4     1 
ATOM   7306 O  O4     . DT  D 2 2   ? -49.860 31.427  26.832  1.00 51.67  ? 2   DT  D O4     1 
ATOM   7307 C  C5     . DT  D 2 2   ? -49.698 33.257  25.390  1.00 40.34  ? 2   DT  D C5     1 
ATOM   7308 C  C7     . DT  D 2 2   ? -49.566 32.399  24.175  1.00 55.41  ? 2   DT  D C7     1 
ATOM   7309 C  C6     . DT  D 2 2   ? -49.686 34.600  25.321  1.00 49.77  ? 2   DT  D C6     1 
ATOM   7310 H  "H5'"  . DT  D 2 2   ? -52.426 37.049  23.912  1.00 79.60  ? 2   DT  D "H5'"  1 
ATOM   7311 H  "H5''" . DT  D 2 2   ? -52.218 38.416  23.148  1.00 79.60  ? 2   DT  D "H5''" 1 
ATOM   7312 H  "H4'"  . DT  D 2 2   ? -51.640 39.075  25.150  1.00 78.98  ? 2   DT  D "H4'"  1 
ATOM   7313 H  "H3'"  . DT  D 2 2   ? -49.453 38.886  23.780  1.00 87.11  ? 2   DT  D "H3'"  1 
ATOM   7314 H  "H2'"  . DT  D 2 2   ? -48.775 36.836  24.458  1.00 82.91  ? 2   DT  D "H2'"  1 
ATOM   7315 H  "H2''" . DT  D 2 2   ? -48.014 37.714  25.527  1.00 82.91  ? 2   DT  D "H2''" 1 
ATOM   7316 H  "H1'"  . DT  D 2 2   ? -49.497 37.304  27.120  1.00 73.63  ? 2   DT  D "H1'"  1 
ATOM   7317 H  H3     . DT  D 2 2   ? -50.035 33.165  28.523  1.00 51.89  ? 2   DT  D H3     1 
ATOM   7318 H  H71    . DT  D 2 2   ? -49.533 32.967  23.390  1.00 66.71  ? 2   DT  D H71    1 
ATOM   7319 H  H72    . DT  D 2 2   ? -48.749 31.880  24.243  1.00 66.71  ? 2   DT  D H72    1 
ATOM   7320 H  H73    . DT  D 2 2   ? -50.332 31.806  24.123  1.00 66.71  ? 2   DT  D H73    1 
ATOM   7321 H  H6     . DT  D 2 2   ? -49.596 34.999  24.485  1.00 59.94  ? 2   DT  D H6     1 
ATOM   7322 P  P      . DC  D 2 3   ? -47.940 40.560  25.477  1.00 71.62  ? 3   DC  D P      1 
ATOM   7323 O  OP1    . DC  D 2 3   ? -48.161 42.009  25.674  1.00 41.25  ? 3   DC  D OP1    1 
ATOM   7324 O  OP2    . DC  D 2 3   ? -47.198 40.066  24.294  1.00 72.35  ? 3   DC  D OP2    1 
ATOM   7325 O  "O5'"  . DC  D 2 3   ? -47.235 39.963  26.780  1.00 72.28  ? 3   DC  D "O5'"  1 
ATOM   7326 C  "C5'"  . DC  D 2 3   ? -47.928 40.007  28.016  1.00 61.96  ? 3   DC  D "C5'"  1 
ATOM   7327 C  "C4'"  . DC  D 2 3   ? -47.201 39.223  29.088  1.00 69.26  ? 3   DC  D "C4'"  1 
ATOM   7328 O  "O4'"  . DC  D 2 3   ? -47.441 37.789  28.914  1.00 76.02  ? 3   DC  D "O4'"  1 
ATOM   7329 C  "C3'"  . DC  D 2 3   ? -45.678 39.380  29.092  1.00 78.72  ? 3   DC  D "C3'"  1 
ATOM   7330 O  "O3'"  . DC  D 2 3   ? -45.226 39.454  30.426  1.00 68.86  ? 3   DC  D "O3'"  1 
ATOM   7331 C  "C2'"  . DC  D 2 3   ? -45.199 38.119  28.383  1.00 71.97  ? 3   DC  D "C2'"  1 
ATOM   7332 C  "C1'"  . DC  D 2 3   ? -46.196 37.105  28.922  1.00 61.95  ? 3   DC  D "C1'"  1 
ATOM   7333 N  N1     . DC  D 2 3   ? -46.311 35.832  28.147  1.00 51.78  ? 3   DC  D N1     1 
ATOM   7334 C  C2     . DC  D 2 3   ? -46.540 34.637  28.845  1.00 63.95  ? 3   DC  D C2     1 
ATOM   7335 O  O2     . DC  D 2 3   ? -46.646 34.677  30.076  1.00 67.87  ? 3   DC  D O2     1 
ATOM   7336 N  N3     . DC  D 2 3   ? -46.643 33.476  28.151  1.00 55.27  ? 3   DC  D N3     1 
ATOM   7337 C  C4     . DC  D 2 3   ? -46.525 33.483  26.822  1.00 63.40  ? 3   DC  D C4     1 
ATOM   7338 N  N4     . DC  D 2 3   ? -46.635 32.315  26.178  1.00 57.57  ? 3   DC  D N4     1 
ATOM   7339 C  C5     . DC  D 2 3   ? -46.290 34.690  26.093  1.00 60.69  ? 3   DC  D C5     1 
ATOM   7340 C  C6     . DC  D 2 3   ? -46.191 35.829  26.791  1.00 43.63  ? 3   DC  D C6     1 
ATOM   7341 H  "H5'"  . DC  D 2 3   ? -48.815 39.633  27.895  1.00 74.56  ? 3   DC  D "H5'"  1 
ATOM   7342 H  "H5''" . DC  D 2 3   ? -48.010 40.931  28.300  1.00 74.56  ? 3   DC  D "H5''" 1 
ATOM   7343 H  "H4'"  . DC  D 2 3   ? -47.551 39.492  29.951  1.00 83.33  ? 3   DC  D "H4'"  1 
ATOM   7344 H  "H3'"  . DC  D 2 3   ? -45.400 40.160  28.586  1.00 94.68  ? 3   DC  D "H3'"  1 
ATOM   7345 H  "H2'"  . DC  D 2 3   ? -45.257 38.203  27.418  1.00 86.59  ? 3   DC  D "H2'"  1 
ATOM   7346 H  "H2''" . DC  D 2 3   ? -44.288 37.892  28.626  1.00 86.59  ? 3   DC  D "H2''" 1 
ATOM   7347 H  "H1'"  . DC  D 2 3   ? -45.951 36.855  29.826  1.00 74.56  ? 3   DC  D "H1'"  1 
ATOM   7348 H  H41    . DC  D 2 3   ? -46.563 32.288  25.321  1.00 69.30  ? 3   DC  D H41    1 
ATOM   7349 H  H42    . DC  D 2 3   ? -46.777 31.591  26.621  1.00 69.30  ? 3   DC  D H42    1 
ATOM   7350 H  H5     . DC  D 2 3   ? -46.209 34.685  25.167  1.00 73.05  ? 3   DC  D H5     1 
ATOM   7351 H  H6     . DC  D 2 3   ? -46.038 36.630  26.342  1.00 52.57  ? 3   DC  D H6     1 
ATOM   7352 P  P      . DA  D 2 4   ? -44.216 40.604  30.902  1.00 85.79  ? 4   DA  D P      1 
ATOM   7353 O  OP1    . DA  D 2 4   ? -44.993 41.862  30.972  1.00 52.35  ? 4   DA  D OP1    1 
ATOM   7354 O  OP2    . DA  D 2 4   ? -43.009 40.534  30.045  1.00 61.50  ? 4   DA  D OP2    1 
ATOM   7355 O  "O5'"  . DA  D 2 4   ? -43.803 40.111  32.368  1.00 55.90  ? 4   DA  D "O5'"  1 
ATOM   7356 C  "C5'"  . DA  D 2 4   ? -44.824 39.928  33.356  1.00 54.21  ? 4   DA  D "C5'"  1 
ATOM   7357 C  "C4'"  . DA  D 2 4   ? -44.587 38.657  34.159  1.00 58.53  ? 4   DA  D "C4'"  1 
ATOM   7358 O  "O4'"  . DA  D 2 4   ? -44.785 37.499  33.300  1.00 67.77  ? 4   DA  D "O4'"  1 
ATOM   7359 C  "C3'"  . DA  D 2 4   ? -43.185 38.517  34.745  1.00 65.77  ? 4   DA  D "C3'"  1 
ATOM   7360 O  "O3'"  . DA  D 2 4   ? -43.251 38.011  36.074  1.00 54.71  ? 4   DA  D "O3'"  1 
ATOM   7361 C  "C2'"  . DA  D 2 4   ? -42.487 37.556  33.788  1.00 66.72  ? 4   DA  D "C2'"  1 
ATOM   7362 C  "C1'"  . DA  D 2 4   ? -43.636 36.670  33.326  1.00 71.60  ? 4   DA  D "C1'"  1 
ATOM   7363 N  N9     . DA  D 2 4   ? -43.453 36.092  31.996  1.00 72.56  ? 4   DA  D N9     1 
ATOM   7364 C  C8     . DA  D 2 4   ? -43.216 36.765  30.830  1.00 67.57  ? 4   DA  D C8     1 
ATOM   7365 N  N7     . DA  D 2 4   ? -43.093 35.986  29.781  1.00 47.14  ? 4   DA  D N7     1 
ATOM   7366 C  C5     . DA  D 2 4   ? -43.253 34.710  30.294  1.00 41.15  ? 4   DA  D C5     1 
ATOM   7367 C  C6     . DA  D 2 4   ? -43.229 33.437  29.691  1.00 50.35  ? 4   DA  D C6     1 
ATOM   7368 N  N6     . DA  D 2 4   ? -43.025 33.246  28.382  1.00 60.29  ? 4   DA  D N6     1 
ATOM   7369 N  N1     . DA  D 2 4   ? -43.422 32.365  30.487  1.00 40.81  ? 4   DA  D N1     1 
ATOM   7370 C  C2     . DA  D 2 4   ? -43.624 32.562  31.797  1.00 44.56  ? 4   DA  D C2     1 
ATOM   7371 N  N3     . DA  D 2 4   ? -43.669 33.708  32.476  1.00 46.93  ? 4   DA  D N3     1 
ATOM   7372 C  C4     . DA  D 2 4   ? -43.474 34.755  31.658  1.00 52.44  ? 4   DA  D C4     1 
ATOM   7373 H  "H5'"  . DA  D 2 4   ? -45.687 39.871  32.915  1.00 65.27  ? 4   DA  D "H5'"  1 
ATOM   7374 H  "H5''" . DA  D 2 4   ? -44.826 40.689  33.957  1.00 65.27  ? 4   DA  D "H5''" 1 
ATOM   7375 H  "H4'"  . DA  D 2 4   ? -45.228 38.613  34.885  1.00 70.45  ? 4   DA  D "H4'"  1 
ATOM   7376 H  "H3'"  . DA  D 2 4   ? -42.732 39.375  34.730  1.00 79.14  ? 4   DA  D "H3'"  1 
ATOM   7377 H  "H2'"  . DA  D 2 4   ? -42.084 38.029  33.043  1.00 80.27  ? 4   DA  D "H2'"  1 
ATOM   7378 H  "H2''" . DA  D 2 4   ? -41.803 37.040  34.242  1.00 80.27  ? 4   DA  D "H2''" 1 
ATOM   7379 H  "H1'"  . DA  D 2 4   ? -43.760 35.952  33.966  1.00 86.13  ? 4   DA  D "H1'"  1 
ATOM   7380 H  H8     . DA  D 2 4   ? -43.148 37.692  30.785  1.00 81.30  ? 4   DA  D H8     1 
ATOM   7381 H  H61    . DA  D 2 4   ? -43.018 32.449  28.060  1.00 72.56  ? 4   DA  D H61    1 
ATOM   7382 H  H62    . DA  D 2 4   ? -42.900 33.921  27.864  1.00 72.56  ? 4   DA  D H62    1 
ATOM   7383 H  H2     . DA  D 2 4   ? -43.750 31.791  32.302  1.00 53.69  ? 4   DA  D H2     1 
ATOM   7384 P  P      . DT  D 2 5   ? -41.914 37.909  36.956  1.00 78.80  ? 5   DT  D P      1 
ATOM   7385 O  OP1    . DT  D 2 5   ? -42.303 38.220  38.350  1.00 53.97  ? 5   DT  D OP1    1 
ATOM   7386 O  OP2    . DT  D 2 5   ? -40.857 38.684  36.269  1.00 65.15  ? 5   DT  D OP2    1 
ATOM   7387 O  "O5'"  . DT  D 2 5   ? -41.512 36.365  36.889  1.00 73.40  ? 5   DT  D "O5'"  1 
ATOM   7388 C  "C5'"  . DT  D 2 5   ? -42.426 35.381  37.327  1.00 67.02  ? 5   DT  D "C5'"  1 
ATOM   7389 C  "C4'"  . DT  D 2 5   ? -41.889 33.986  37.066  1.00 63.07  ? 5   DT  D "C4'"  1 
ATOM   7390 O  "O4'"  . DT  D 2 5   ? -41.922 33.701  35.640  1.00 67.56  ? 5   DT  D "O4'"  1 
ATOM   7391 C  "C3'"  . DT  D 2 5   ? -40.439 33.760  37.508  1.00 42.33  ? 5   DT  D "C3'"  1 
ATOM   7392 O  "O3'"  . DT  D 2 5   ? -40.346 32.571  38.274  1.00 30.45  ? 5   DT  D "O3'"  1 
ATOM   7393 C  "C2'"  . DT  D 2 5   ? -39.661 33.667  36.194  1.00 47.41  ? 5   DT  D "C2'"  1 
ATOM   7394 C  "C1'"  . DT  D 2 5   ? -40.706 33.089  35.254  1.00 56.23  ? 5   DT  D "C1'"  1 
ATOM   7395 N  N1     . DT  D 2 5   ? -40.475 33.341  33.792  1.00 48.13  ? 5   DT  D N1     1 
ATOM   7396 C  C2     . DT  D 2 5   ? -40.441 32.266  32.930  1.00 37.63  ? 5   DT  D C2     1 
ATOM   7397 O  O2     . DT  D 2 5   ? -40.576 31.111  33.294  1.00 42.33  ? 5   DT  D O2     1 
ATOM   7398 N  N3     . DT  D 2 5   ? -40.240 32.588  31.616  1.00 35.63  ? 5   DT  D N3     1 
ATOM   7399 C  C4     . DT  D 2 5   ? -40.076 33.851  31.081  1.00 44.34  ? 5   DT  D C4     1 
ATOM   7400 O  O4     . DT  D 2 5   ? -39.900 34.036  29.878  1.00 41.66  ? 5   DT  D O4     1 
ATOM   7401 C  C5     . DT  D 2 5   ? -40.125 34.935  32.034  1.00 41.24  ? 5   DT  D C5     1 
ATOM   7402 C  C7     . DT  D 2 5   ? -39.957 36.347  31.572  1.00 44.03  ? 5   DT  D C7     1 
ATOM   7403 C  C6     . DT  D 2 5   ? -40.327 34.633  33.329  1.00 46.72  ? 5   DT  D C6     1 
ATOM   7404 H  "H5'"  . DT  D 2 5   ? -43.266 35.493  36.855  1.00 80.64  ? 5   DT  D "H5'"  1 
ATOM   7405 H  "H5''" . DT  D 2 5   ? -42.581 35.491  38.278  1.00 80.64  ? 5   DT  D "H5''" 1 
ATOM   7406 H  "H4'"  . DT  D 2 5   ? -42.457 33.342  37.517  1.00 75.91  ? 5   DT  D "H4'"  1 
ATOM   7407 H  "H3'"  . DT  D 2 5   ? -40.121 34.523  38.014  1.00 51.01  ? 5   DT  D "H3'"  1 
ATOM   7408 H  "H2'"  . DT  D 2 5   ? -39.361 34.541  35.896  1.00 57.10  ? 5   DT  D "H2'"  1 
ATOM   7409 H  "H2''" . DT  D 2 5   ? -38.893 33.081  36.276  1.00 57.10  ? 5   DT  D "H2''" 1 
ATOM   7410 H  "H1'"  . DT  D 2 5   ? -40.749 32.127  35.377  1.00 67.69  ? 5   DT  D "H1'"  1 
ATOM   7411 H  H3     . DT  D 2 5   ? -40.213 31.932  31.061  1.00 42.97  ? 5   DT  D H3     1 
ATOM   7412 H  H71    . DT  D 2 5   ? -40.711 36.872  31.881  1.00 53.05  ? 5   DT  D H71    1 
ATOM   7413 H  H72    . DT  D 2 5   ? -39.133 36.703  31.939  1.00 53.05  ? 5   DT  D H72    1 
ATOM   7414 H  H73    . DT  D 2 5   ? -39.920 36.359  30.602  1.00 53.05  ? 5   DT  D H73    1 
ATOM   7415 H  H6     . DT  D 2 5   ? -40.368 35.330  33.944  1.00 56.28  ? 5   DT  D H6     1 
ATOM   7416 P  P      . DT  D 2 6   ? -39.057 32.282  39.185  1.00 63.08  ? 6   DT  D P      1 
ATOM   7417 O  OP1    . DT  D 2 6   ? -39.511 31.901  40.542  1.00 30.97  ? 6   DT  D OP1    1 
ATOM   7418 O  OP2    . DT  D 2 6   ? -38.126 33.420  39.010  1.00 70.74  ? 6   DT  D OP2    1 
ATOM   7419 O  "O5'"  . DT  D 2 6   ? -38.427 30.980  38.506  1.00 71.96  ? 6   DT  D "O5'"  1 
ATOM   7420 C  "C5'"  . DT  D 2 6   ? -39.232 29.818  38.346  1.00 54.72  ? 6   DT  D "C5'"  1 
ATOM   7421 C  "C4'"  . DT  D 2 6   ? -38.664 28.894  37.280  1.00 45.95  ? 6   DT  D "C4'"  1 
ATOM   7422 O  "O4'"  . DT  D 2 6   ? -38.702 29.546  35.992  1.00 40.37  ? 6   DT  D "O4'"  1 
ATOM   7423 C  "C3'"  . DT  D 2 6   ? -37.208 28.491  37.513  1.00 36.98  ? 6   DT  D "C3'"  1 
ATOM   7424 O  "O3'"  . DT  D 2 6   ? -37.139 27.099  37.780  1.00 31.53  ? 6   DT  D "O3'"  1 
ATOM   7425 C  "C2'"  . DT  D 2 6   ? -36.472 28.888  36.219  1.00 38.03  ? 6   DT  D "C2'"  1 
ATOM   7426 C  "C1'"  . DT  D 2 6   ? -37.598 29.118  35.224  1.00 39.20  ? 6   DT  D "C1'"  1 
ATOM   7427 N  N1     . DT  D 2 6   ? -37.336 30.162  34.174  1.00 34.20  ? 6   DT  D N1     1 
ATOM   7428 C  C2     . DT  D 2 6   ? -37.209 29.780  32.851  1.00 47.34  ? 6   DT  D C2     1 
ATOM   7429 O  O2     . DT  D 2 6   ? -37.263 28.619  32.480  1.00 53.99  ? 6   DT  D O2     1 
ATOM   7430 N  N3     . DT  D 2 6   ? -37.001 30.815  31.974  1.00 31.14  ? 6   DT  D N3     1 
ATOM   7431 C  C4     . DT  D 2 6   ? -36.922 32.159  32.274  1.00 29.63  ? 6   DT  D C4     1 
ATOM   7432 O  O4     . DT  D 2 6   ? -36.732 33.015  31.417  1.00 23.12  ? 6   DT  D O4     1 
ATOM   7433 C  C5     . DT  D 2 6   ? -37.076 32.490  33.667  1.00 27.68  ? 6   DT  D C5     1 
ATOM   7434 C  C7     . DT  D 2 6   ? -37.003 33.915  34.103  1.00 43.53  ? 6   DT  D C7     1 
ATOM   7435 C  C6     . DT  D 2 6   ? -37.281 31.490  34.541  1.00 22.75  ? 6   DT  D C6     1 
ATOM   7436 H  "H5'"  . DT  D 2 6   ? -40.128 30.085  38.090  1.00 65.88  ? 6   DT  D "H5'"  1 
ATOM   7437 H  "H5''" . DT  D 2 6   ? -39.273 29.342  39.190  1.00 65.88  ? 6   DT  D "H5''" 1 
ATOM   7438 H  "H4'"  . DT  D 2 6   ? -39.210 28.094  37.222  1.00 55.35  ? 6   DT  D "H4'"  1 
ATOM   7439 H  "H3'"  . DT  D 2 6   ? -36.835 29.008  38.244  1.00 44.59  ? 6   DT  D "H3'"  1 
ATOM   7440 H  "H2'"  . DT  D 2 6   ? -35.951 29.696  36.348  1.00 45.85  ? 6   DT  D "H2'"  1 
ATOM   7441 H  "H2''" . DT  D 2 6   ? -35.883 28.177  35.921  1.00 45.85  ? 6   DT  D "H2''" 1 
ATOM   7442 H  "H1'"  . DT  D 2 6   ? -37.787 28.279  34.776  1.00 47.26  ? 6   DT  D "H1'"  1 
ATOM   7443 H  H3     . DT  D 2 6   ? -36.910 30.602  31.145  1.00 37.58  ? 6   DT  D H3     1 
ATOM   7444 H  H71    . DT  D 2 6   ? -36.615 34.444  33.388  1.00 52.45  ? 6   DT  D H71    1 
ATOM   7445 H  H72    . DT  D 2 6   ? -37.899 34.231  34.300  1.00 52.45  ? 6   DT  D H72    1 
ATOM   7446 H  H73    . DT  D 2 6   ? -36.449 33.974  34.896  1.00 52.45  ? 6   DT  D H73    1 
ATOM   7447 H  H6     . DT  D 2 6   ? -37.392 31.705  35.439  1.00 27.51  ? 6   DT  D H6     1 
ATOM   7448 P  P      . DG  D 2 7   ? -35.749 26.416  38.188  1.00 53.63  ? 7   DG  D P      1 
ATOM   7449 O  OP1    . DG  D 2 7   ? -36.064 25.210  38.989  1.00 41.66  ? 7   DG  D OP1    1 
ATOM   7450 O  OP2    . DG  D 2 7   ? -34.882 27.468  38.766  1.00 55.29  ? 7   DG  D OP2    1 
ATOM   7451 O  "O5'"  . DG  D 2 7   ? -35.147 25.964  36.782  1.00 69.75  ? 7   DG  D "O5'"  1 
ATOM   7452 C  "C5'"  . DG  D 2 7   ? -35.962 25.238  35.885  1.00 51.19  ? 7   DG  D "C5'"  1 
ATOM   7453 C  "C4'"  . DG  D 2 7   ? -35.213 24.898  34.613  1.00 59.43  ? 7   DG  D "C4'"  1 
ATOM   7454 O  "O4'"  . DG  D 2 7   ? -35.235 26.036  33.705  1.00 39.47  ? 7   DG  D "O4'"  1 
ATOM   7455 C  "C3'"  . DG  D 2 7   ? -33.742 24.543  34.811  1.00 50.81  ? 7   DG  D "C3'"  1 
ATOM   7456 O  "O3'"  . DG  D 2 7   ? -33.418 23.408  34.025  1.00 44.42  ? 7   DG  D "O3'"  1 
ATOM   7457 C  "C2'"  . DG  D 2 7   ? -33.001 25.807  34.372  1.00 40.15  ? 7   DG  D "C2'"  1 
ATOM   7458 C  "C1'"  . DG  D 2 7   ? -33.918 26.364  33.297  1.00 34.72  ? 7   DG  D "C1'"  1 
ATOM   7459 N  N9     . DG  D 2 7   ? -33.841 27.807  33.117  1.00 27.48  ? 7   DG  D N9     1 
ATOM   7460 C  C8     . DG  D 2 7   ? -33.970 28.771  34.083  1.00 42.12  ? 7   DG  D C8     1 
ATOM   7461 N  N7     . DG  D 2 7   ? -33.885 29.987  33.619  1.00 37.17  ? 7   DG  D N7     1 
ATOM   7462 C  C5     . DG  D 2 7   ? -33.709 29.818  32.253  1.00 20.73  ? 7   DG  D C5     1 
ATOM   7463 C  C6     . DG  D 2 7   ? -33.561 30.781  31.228  1.00 32.61  ? 7   DG  D C6     1 
ATOM   7464 O  O6     . DG  D 2 7   ? -33.555 32.015  31.329  1.00 34.82  ? 7   DG  D O6     1 
ATOM   7465 N  N1     . DG  D 2 7   ? -33.407 30.186  29.980  1.00 30.21  ? 7   DG  D N1     1 
ATOM   7466 C  C2     . DG  D 2 7   ? -33.399 28.832  29.753  1.00 36.87  ? 7   DG  D C2     1 
ATOM   7467 N  N2     . DG  D 2 7   ? -33.237 28.441  28.483  1.00 49.28  ? 7   DG  D N2     1 
ATOM   7468 N  N3     . DG  D 2 7   ? -33.538 27.920  30.705  1.00 39.49  ? 7   DG  D N3     1 
ATOM   7469 C  C4     . DG  D 2 7   ? -33.688 28.484  31.926  1.00 23.93  ? 7   DG  D C4     1 
ATOM   7470 H  "H5'"  . DG  D 2 7   ? -36.742 25.770  35.663  1.00 61.64  ? 7   DG  D "H5'"  1 
ATOM   7471 H  "H5''" . DG  D 2 7   ? -36.252 24.417  36.313  1.00 61.64  ? 7   DG  D "H5''" 1 
ATOM   7472 H  "H4'"  . DG  D 2 7   ? -35.658 24.155  34.174  1.00 71.54  ? 7   DG  D "H4'"  1 
ATOM   7473 H  "H3'"  . DG  D 2 7   ? -33.551 24.377  35.747  1.00 61.19  ? 7   DG  D "H3'"  1 
ATOM   7474 H  "H2'"  . DG  D 2 7   ? -32.899 26.431  35.108  1.00 48.40  ? 7   DG  D "H2'"  1 
ATOM   7475 H  "H2''" . DG  D 2 7   ? -32.125 25.596  34.013  1.00 48.40  ? 7   DG  D "H2''" 1 
ATOM   7476 H  "H1'"  . DG  D 2 7   ? -33.710 25.936  32.452  1.00 41.88  ? 7   DG  D "H1'"  1 
ATOM   7477 H  H8     . DG  D 2 7   ? -34.105 28.577  34.982  1.00 50.76  ? 7   DG  D H8     1 
ATOM   7478 H  H1     . DG  D 2 7   ? -33.308 30.704  29.301  1.00 36.47  ? 7   DG  D H1     1 
ATOM   7479 H  H21    . DG  D 2 7   ? -33.223 27.603  28.289  1.00 59.35  ? 7   DG  D H21    1 
ATOM   7480 H  H22    . DG  D 2 7   ? -33.147 29.027  27.860  1.00 59.35  ? 7   DG  D H22    1 
ATOM   7481 P  P      . DA  D 2 8   ? -31.959 22.749  34.106  1.00 49.26  ? 8   DA  D P      1 
ATOM   7482 O  OP1    . DA  D 2 8   ? -32.105 21.324  33.733  1.00 62.63  ? 8   DA  D OP1    1 
ATOM   7483 O  OP2    . DA  D 2 8   ? -31.383 23.106  35.425  1.00 44.83  ? 8   DA  D OP2    1 
ATOM   7484 O  "O5'"  . DA  D 2 8   ? -31.149 23.508  32.952  1.00 57.96  ? 8   DA  D "O5'"  1 
ATOM   7485 C  "C5'"  . DA  D 2 8   ? -31.666 23.529  31.619  1.00 44.37  ? 8   DA  D "C5'"  1 
ATOM   7486 C  "C4'"  . DA  D 2 8   ? -30.721 24.256  30.670  1.00 52.54  ? 8   DA  D "C4'"  1 
ATOM   7487 O  "O4'"  . DA  D 2 8   ? -31.011 25.672  30.688  1.00 50.90  ? 8   DA  D "O4'"  1 
ATOM   7488 C  "C3'"  . DA  D 2 8   ? -29.235 24.126  31.012  1.00 53.66  ? 8   DA  D "C3'"  1 
ATOM   7489 O  "O3'"  . DA  D 2 8   ? -28.587 23.295  30.043  1.00 66.02  ? 8   DA  D "O3'"  1 
ATOM   7490 C  "C2'"  . DA  D 2 8   ? -28.693 25.565  31.020  1.00 45.03  ? 8   DA  D "C2'"  1 
ATOM   7491 C  "C1'"  . DA  D 2 8   ? -29.829 26.392  30.426  1.00 42.71  ? 8   DA  D "C1'"  1 
ATOM   7492 N  N9     . DA  D 2 8   ? -29.962 27.726  31.008  1.00 37.14  ? 8   DA  D N9     1 
ATOM   7493 C  C8     . DA  D 2 8   ? -30.167 28.030  32.325  1.00 42.62  ? 8   DA  D C8     1 
ATOM   7494 N  N7     . DA  D 2 8   ? -30.265 29.318  32.563  1.00 45.94  ? 8   DA  D N7     1 
ATOM   7495 C  C5     . DA  D 2 8   ? -30.126 29.901  31.314  1.00 29.62  ? 8   DA  D C5     1 
ATOM   7496 C  C6     . DA  D 2 8   ? -30.140 31.245  30.886  1.00 37.20  ? 8   DA  D C6     1 
ATOM   7497 N  N6     . DA  D 2 8   ? -30.307 32.278  31.718  1.00 24.21  ? 8   DA  D N6     1 
ATOM   7498 N  N1     . DA  D 2 8   ? -29.975 31.484  29.568  1.00 23.96  ? 8   DA  D N1     1 
ATOM   7499 C  C2     . DA  D 2 8   ? -29.809 30.446  28.741  1.00 33.47  ? 8   DA  D C2     1 
ATOM   7500 N  N3     . DA  D 2 8   ? -29.779 29.142  29.026  1.00 37.11  ? 8   DA  D N3     1 
ATOM   7501 C  C4     . DA  D 2 8   ? -29.944 28.935  30.341  1.00 24.45  ? 8   DA  D C4     1 
ATOM   7502 H  "H5'"  . DA  D 2 8   ? -32.525 23.979  31.619  1.00 53.46  ? 8   DA  D "H5'"  1 
ATOM   7503 H  "H5''" . DA  D 2 8   ? -31.786 22.618  31.310  1.00 53.46  ? 8   DA  D "H5''" 1 
ATOM   7504 H  "H4'"  . DA  D 2 8   ? -30.863 23.926  29.769  1.00 63.26  ? 8   DA  D "H4'"  1 
ATOM   7505 H  "H3'"  . DA  D 2 8   ? -29.139 23.762  31.906  1.00 64.61  ? 8   DA  D "H3'"  1 
ATOM   7506 H  "H2'"  . DA  D 2 8   ? -28.490 25.854  31.924  1.00 54.25  ? 8   DA  D "H2'"  1 
ATOM   7507 H  "H2''" . DA  D 2 8   ? -27.892 25.637  30.478  1.00 54.25  ? 8   DA  D "H2''" 1 
ATOM   7508 H  "H1'"  . DA  D 2 8   ? -29.698 26.477  29.469  1.00 51.46  ? 8   DA  D "H1'"  1 
ATOM   7509 H  H8     . DA  D 2 8   ? -30.230 27.385  32.991  1.00 51.36  ? 8   DA  D H8     1 
ATOM   7510 H  H61    . DA  D 2 8   ? -30.307 33.082  31.411  1.00 29.27  ? 8   DA  D H61    1 
ATOM   7511 H  H62    . DA  D 2 8   ? -30.413 32.140  32.560  1.00 29.27  ? 8   DA  D H62    1 
ATOM   7512 H  H2     . DA  D 2 8   ? -29.699 30.662  27.843  1.00 40.38  ? 8   DA  D H2     1 
ATOM   7513 P  P      . DG  D 2 9   ? -27.006 23.032  30.119  1.00 57.32  ? 9   DG  D P      1 
ATOM   7514 O  OP1    . DG  D 2 9   ? -26.744 21.747  29.434  1.00 68.42  ? 9   DG  D OP1    1 
ATOM   7515 O  OP2    . DG  D 2 9   ? -26.581 23.223  31.523  1.00 61.89  ? 9   DG  D OP2    1 
ATOM   7516 O  "O5'"  . DG  D 2 9   ? -26.396 24.224  29.253  1.00 39.34  ? 9   DG  D "O5'"  1 
ATOM   7517 C  "C5'"  . DG  D 2 9   ? -27.078 24.654  28.091  1.00 54.78  ? 9   DG  D "C5'"  1 
ATOM   7518 C  "C4'"  . DG  D 2 9   ? -26.543 25.987  27.608  1.00 59.83  ? 9   DG  D "C4'"  1 
ATOM   7519 O  "O4'"  . DG  D 2 9   ? -27.065 27.061  28.432  1.00 63.68  ? 9   DG  D "O4'"  1 
ATOM   7520 C  "C3'"  . DG  D 2 9   ? -25.017 26.124  27.660  1.00 52.14  ? 9   DG  D "C3'"  1 
ATOM   7521 O  "O3'"  . DG  D 2 9   ? -24.501 26.273  26.347  1.00 75.59  ? 9   DG  D "O3'"  1 
ATOM   7522 C  "C2'"  . DG  D 2 9   ? -24.768 27.363  28.530  1.00 53.05  ? 9   DG  D "C2'"  1 
ATOM   7523 C  "C1'"  . DG  D 2 9   ? -26.107 28.090  28.473  1.00 49.17  ? 9   DG  D "C1'"  1 
ATOM   7524 N  N9     . DG  D 2 9   ? -26.365 28.967  29.610  1.00 40.00  ? 9   DG  D N9     1 
ATOM   7525 C  C8     . DG  D 2 9   ? -26.538 28.608  30.924  1.00 39.22  ? 9   DG  D C8     1 
ATOM   7526 N  N7     . DG  D 2 9   ? -26.759 29.624  31.716  1.00 44.67  ? 9   DG  D N7     1 
ATOM   7527 C  C5     . DG  D 2 9   ? -26.737 30.726  30.872  1.00 16.17  ? 9   DG  D C5     1 
ATOM   7528 C  C6     . DG  D 2 9   ? -26.918 32.100  31.159  1.00 32.04  ? 9   DG  D C6     1 
ATOM   7529 O  O6     . DG  D 2 9   ? -27.141 32.633  32.255  1.00 35.28  ? 9   DG  D O6     1 
ATOM   7530 N  N1     . DG  D 2 9   ? -26.818 32.886  30.010  1.00 29.43  ? 9   DG  D N1     1 
ATOM   7531 C  C2     . DG  D 2 9   ? -26.575 32.402  28.749  1.00 28.11  ? 9   DG  D C2     1 
ATOM   7532 N  N2     . DG  D 2 9   ? -26.510 33.305  27.759  1.00 34.66  ? 9   DG  D N2     1 
ATOM   7533 N  N3     . DG  D 2 9   ? -26.403 31.117  28.469  1.00 30.04  ? 9   DG  D N3     1 
ATOM   7534 C  C4     . DG  D 2 9   ? -26.497 30.341  29.574  1.00 19.37  ? 9   DG  D C4     1 
ATOM   7535 H  "H5'"  . DG  D 2 9   ? -28.023 24.744  28.290  1.00 65.96  ? 9   DG  D "H5'"  1 
ATOM   7536 H  "H5''" . DG  D 2 9   ? -26.964 23.993  27.391  1.00 65.96  ? 9   DG  D "H5''" 1 
ATOM   7537 H  "H4'"  . DG  D 2 9   ? -26.843 26.132  26.697  1.00 72.01  ? 9   DG  D "H4'"  1 
ATOM   7538 H  "H3'"  . DG  D 2 9   ? -24.633 25.350  28.102  1.00 62.78  ? 9   DG  D "H3'"  1 
ATOM   7539 H  "H2'"  . DG  D 2 9   ? -24.541 27.114  29.440  1.00 63.87  ? 9   DG  D "H2'"  1 
ATOM   7540 H  "H2''" . DG  D 2 9   ? -24.055 27.911  28.166  1.00 63.87  ? 9   DG  D "H2''" 1 
ATOM   7541 H  "H1'"  . DG  D 2 9   ? -26.167 28.632  27.671  1.00 59.22  ? 9   DG  D "H1'"  1 
ATOM   7542 H  H8     . DG  D 2 9   ? -26.502 27.727  31.221  1.00 47.27  ? 9   DG  D H8     1 
ATOM   7543 H  H1     . DG  D 2 9   ? -26.915 33.735  30.098  1.00 35.54  ? 9   DG  D H1     1 
ATOM   7544 H  H21    . DG  D 2 9   ? -26.358 33.049  26.952  1.00 41.80  ? 9   DG  D H21    1 
ATOM   7545 H  H22    . DG  D 2 9   ? -26.620 34.140  27.931  1.00 41.80  ? 9   DG  D H22    1 
ATOM   7546 P  P      . DC  D 2 10  ? -22.918 26.328  26.091  1.00 72.05  ? 10  DC  D P      1 
ATOM   7547 O  OP1    . DC  D 2 10  ? -22.603 25.276  25.099  1.00 64.49  ? 10  DC  D OP1    1 
ATOM   7548 O  OP2    . DC  D 2 10  ? -22.227 26.341  27.402  1.00 61.78  ? 10  DC  D OP2    1 
ATOM   7549 O  "O5'"  . DC  D 2 10  ? -22.703 27.761  25.423  1.00 24.67  ? 10  DC  D "O5'"  1 
ATOM   7550 C  "C5'"  . DC  D 2 10  ? -23.708 28.303  24.576  1.00 44.22  ? 10  DC  D "C5'"  1 
ATOM   7551 C  "C4'"  . DC  D 2 10  ? -23.335 29.706  24.144  1.00 48.52  ? 10  DC  D "C4'"  1 
ATOM   7552 O  "O4'"  . DC  D 2 10  ? -23.771 30.664  25.153  1.00 45.76  ? 10  DC  D "O4'"  1 
ATOM   7553 C  "C3'"  . DC  D 2 10  ? -21.837 29.924  23.982  1.00 56.10  ? 10  DC  D "C3'"  1 
ATOM   7554 O  "O3'"  . DC  D 2 10  ? -21.566 30.853  22.944  1.00 65.21  ? 10  DC  D "O3'"  1 
ATOM   7555 C  "C2'"  . DC  D 2 10  ? -21.434 30.449  25.355  1.00 47.86  ? 10  DC  D "C2'"  1 
ATOM   7556 C  "C1'"  . DC  D 2 10  ? -22.647 31.299  25.741  1.00 38.23  ? 10  DC  D "C1'"  1 
ATOM   7557 N  N1     . DC  D 2 10  ? -22.874 31.411  27.225  1.00 29.03  ? 10  DC  D N1     1 
ATOM   7558 C  C2     . DC  D 2 10  ? -23.102 32.669  27.813  1.00 23.40  ? 10  DC  D C2     1 
ATOM   7559 O  O2     . DC  D 2 10  ? -23.119 33.681  27.100  1.00 29.56  ? 10  DC  D O2     1 
ATOM   7560 N  N3     . DC  D 2 10  ? -23.302 32.735  29.155  1.00 17.44  ? 10  DC  D N3     1 
ATOM   7561 C  C4     . DC  D 2 10  ? -23.279 31.620  29.889  1.00 23.66  ? 10  DC  D C4     1 
ATOM   7562 N  N4     . DC  D 2 10  ? -23.477 31.728  31.206  1.00 31.88  ? 10  DC  D N4     1 
ATOM   7563 C  C5     . DC  D 2 10  ? -23.047 30.343  29.309  1.00 25.30  ? 10  DC  D C5     1 
ATOM   7564 C  C6     . DC  D 2 10  ? -22.855 30.286  27.991  1.00 30.86  ? 10  DC  D C6     1 
ATOM   7565 H  "H5'"  . DC  D 2 10  ? -24.552 28.328  25.053  1.00 53.28  ? 10  DC  D "H5'"  1 
ATOM   7566 H  "H5''" . DC  D 2 10  ? -23.805 27.741  23.791  1.00 53.28  ? 10  DC  D "H5''" 1 
ATOM   7567 H  "H4'"  . DC  D 2 10  ? -23.785 29.920  23.312  1.00 58.45  ? 10  DC  D "H4'"  1 
ATOM   7568 H  "H3'"  . DC  D 2 10  ? -21.390 29.085  23.791  1.00 67.53  ? 10  DC  D "H3'"  1 
ATOM   7569 H  "H2'"  . DC  D 2 10  ? -21.294 29.724  25.985  1.00 57.65  ? 10  DC  D "H2'"  1 
ATOM   7570 H  "H2''" . DC  D 2 10  ? -20.627 30.984  25.307  1.00 57.65  ? 10  DC  D "H2''" 1 
ATOM   7571 H  "H1'"  . DC  D 2 10  ? -22.546 32.191  25.375  1.00 46.09  ? 10  DC  D "H1'"  1 
ATOM   7572 H  H41    . DC  D 2 10  ? -23.467 31.025  31.702  1.00 38.48  ? 10  DC  D H41    1 
ATOM   7573 H  H42    . DC  D 2 10  ? -23.614 32.501  31.559  1.00 38.48  ? 10  DC  D H42    1 
ATOM   7574 H  H5     . DC  D 2 10  ? -23.031 29.573  29.831  1.00 30.57  ? 10  DC  D H5     1 
ATOM   7575 H  H6     . DC  D 2 10  ? -22.704 29.462  27.587  1.00 37.25  ? 10  DC  D H6     1 
ATOM   7576 P  P      . DA  D 2 11  ? -20.086 30.966  22.325  1.00 63.96  ? 11  DA  D P      1 
ATOM   7577 O  OP1    . DA  D 2 11  ? -20.210 30.591  20.899  1.00 47.87  ? 11  DA  D OP1    1 
ATOM   7578 O  OP2    . DA  D 2 11  ? -19.126 30.241  23.190  1.00 30.04  ? 11  DA  D OP2    1 
ATOM   7579 O  "O5'"  . DA  D 2 11  ? -19.745 32.526  22.434  1.00 44.67  ? 11  DA  D "O5'"  1 
ATOM   7580 C  "C5'"  . DA  D 2 11  ? -20.701 33.497  22.017  1.00 53.66  ? 11  DA  D "C5'"  1 
ATOM   7581 C  "C4'"  . DA  D 2 11  ? -20.251 34.896  22.400  1.00 46.22  ? 11  DA  D "C4'"  1 
ATOM   7582 O  "O4'"  . DA  D 2 11  ? -20.544 35.141  23.801  1.00 58.30  ? 11  DA  D "O4'"  1 
ATOM   7583 C  "C3'"  . DA  D 2 11  ? -18.760 35.148  22.235  1.00 47.71  ? 11  DA  D "C3'"  1 
ATOM   7584 O  "O3'"  . DA  D 2 11  ? -18.522 36.474  21.786  1.00 38.76  ? 11  DA  D "O3'"  1 
ATOM   7585 C  "C2'"  . DA  D 2 11  ? -18.195 34.886  23.631  1.00 44.40  ? 11  DA  D "C2'"  1 
ATOM   7586 C  "C1'"  . DA  D 2 11  ? -19.345 35.293  24.548  1.00 45.47  ? 11  DA  D "C1'"  1 
ATOM   7587 N  N9     . DA  D 2 11  ? -19.462 34.479  25.757  1.00 35.06  ? 11  DA  D N9     1 
ATOM   7588 C  C8     . DA  D 2 11  ? -19.415 33.119  25.834  1.00 35.85  ? 11  DA  D C8     1 
ATOM   7589 N  N7     . DA  D 2 11  ? -19.569 32.648  27.049  1.00 18.43  ? 11  DA  D N7     1 
ATOM   7590 C  C5     . DA  D 2 11  ? -19.738 33.780  27.823  1.00 21.66  ? 11  DA  D C5     1 
ATOM   7591 C  C6     . DA  D 2 11  ? -19.950 33.959  29.201  1.00 21.67  ? 11  DA  D C6     1 
ATOM   7592 N  N6     . DA  D 2 11  ? -20.027 32.947  30.068  1.00 27.07  ? 11  DA  D N6     1 
ATOM   7593 N  N1     . DA  D 2 11  ? -20.077 35.221  29.657  1.00 23.04  ? 11  DA  D N1     1 
ATOM   7594 C  C2     . DA  D 2 11  ? -19.999 36.232  28.783  1.00 25.12  ? 11  DA  D C2     1 
ATOM   7595 N  N3     . DA  D 2 11  ? -19.805 36.188  27.464  1.00 18.20  ? 11  DA  D N3     1 
ATOM   7596 C  C4     . DA  D 2 11  ? -19.681 34.920  27.044  1.00 23.36  ? 11  DA  D C4     1 
ATOM   7597 H  "H5'"  . DA  D 2 11  ? -21.553 33.308  22.440  1.00 64.60  ? 11  DA  D "H5'"  1 
ATOM   7598 H  "H5''" . DA  D 2 11  ? -20.808 33.448  21.055  1.00 64.60  ? 11  DA  D "H5''" 1 
ATOM   7599 H  "H4'"  . DA  D 2 11  ? -20.741 35.545  21.870  1.00 55.68  ? 11  DA  D "H4'"  1 
ATOM   7600 H  "H3'"  . DA  D 2 11  ? -18.382 34.510  21.608  1.00 57.47  ? 11  DA  D "H3'"  1 
ATOM   7601 H  "H2'"  . DA  D 2 11  ? -17.968 33.950  23.747  1.00 53.50  ? 11  DA  D "H2'"  1 
ATOM   7602 H  "H2''" . DA  D 2 11  ? -17.406 35.426  23.797  1.00 53.50  ? 11  DA  D "H2''" 1 
ATOM   7603 H  "H1'"  . DA  D 2 11  ? -19.228 36.224  24.793  1.00 54.78  ? 11  DA  D "H1'"  1 
ATOM   7604 H  H8     . DA  D 2 11  ? -19.285 32.573  25.093  1.00 43.24  ? 11  DA  D H8     1 
ATOM   7605 H  H61    . DA  D 2 11  ? -20.156 33.104  30.903  1.00 32.70  ? 11  DA  D H61    1 
ATOM   7606 H  H62    . DA  D 2 11  ? -19.947 32.136  29.790  1.00 32.70  ? 11  DA  D H62    1 
ATOM   7607 H  H2     . DA  D 2 11  ? -20.093 37.083  29.146  1.00 30.36  ? 11  DA  D H2     1 
ATOM   7608 P  P      . DA  D 2 12  ? -17.019 36.966  21.510  1.00 75.25  ? 12  DA  D P      1 
ATOM   7609 O  OP1    . DA  D 2 12  ? -17.039 37.807  20.292  1.00 67.63  ? 12  DA  D OP1    1 
ATOM   7610 O  OP2    . DA  D 2 12  ? -16.145 35.772  21.580  1.00 43.27  ? 12  DA  D OP2    1 
ATOM   7611 O  "O5'"  . DA  D 2 12  ? -16.689 37.890  22.773  1.00 67.35  ? 12  DA  D "O5'"  1 
ATOM   7612 C  "C5'"  . DA  D 2 12  ? -17.619 38.886  23.174  1.00 61.20  ? 12  DA  D "C5'"  1 
ATOM   7613 C  "C4'"  . DA  D 2 12  ? -17.271 39.443  24.545  1.00 24.13  ? 12  DA  D "C4'"  1 
ATOM   7614 O  "O4'"  . DA  D 2 12  ? -17.594 38.462  25.566  1.00 29.53  ? 12  DA  D "O4'"  1 
ATOM   7615 C  "C3'"  . DA  D 2 12  ? -15.795 39.791  24.743  1.00 29.96  ? 12  DA  D "C3'"  1 
ATOM   7616 O  "O3'"  . DA  D 2 12  ? -15.666 41.108  25.279  1.00 20.75  ? 12  DA  D "O3'"  1 
ATOM   7617 C  "C2'"  . DA  D 2 12  ? -15.275 38.715  25.696  1.00 27.73  ? 12  DA  D "C2'"  1 
ATOM   7618 C  "C1'"  . DA  D 2 12  ? -16.519 38.354  26.482  1.00 37.93  ? 12  DA  D "C1'"  1 
ATOM   7619 N  N9     . DA  D 2 12  ? -16.522 37.011  27.042  1.00 25.87  ? 12  DA  D N9     1 
ATOM   7620 C  C8     . DA  D 2 12  ? -16.418 35.833  26.363  1.00 37.29  ? 12  DA  D C8     1 
ATOM   7621 N  N7     . DA  D 2 12  ? -16.476 34.770  27.132  1.00 37.36  ? 12  DA  D N7     1 
ATOM   7622 C  C5     . DA  D 2 12  ? -16.640 35.289  28.405  1.00 27.69  ? 12  DA  D C5     1 
ATOM   7623 C  C6     . DA  D 2 12  ? -16.770 34.680  29.667  1.00 22.00  ? 12  DA  D C6     1 
ATOM   7624 N  N6     . DA  D 2 12  ? -16.755 33.356  29.847  1.00 27.61  ? 12  DA  D N6     1 
ATOM   7625 N  N1     . DA  D 2 12  ? -16.922 35.485  30.739  1.00 20.97  ? 12  DA  D N1     1 
ATOM   7626 C  C2     . DA  D 2 12  ? -16.938 36.812  30.550  1.00 29.40  ? 12  DA  D C2     1 
ATOM   7627 N  N3     . DA  D 2 12  ? -16.827 37.499  29.413  1.00 24.69  ? 12  DA  D N3     1 
ATOM   7628 C  C4     . DA  D 2 12  ? -16.676 36.670  28.368  1.00 27.27  ? 12  DA  D C4     1 
ATOM   7629 H  "H5'"  . DA  D 2 12  ? -18.508 38.498  23.205  1.00 73.66  ? 12  DA  D "H5'"  1 
ATOM   7630 H  "H5''" . DA  D 2 12  ? -17.612 39.608  22.527  1.00 73.66  ? 12  DA  D "H5''" 1 
ATOM   7631 H  "H4'"  . DA  D 2 12  ? -17.801 40.239  24.709  1.00 29.18  ? 12  DA  D "H4'"  1 
ATOM   7632 H  "H3'"  . DA  D 2 12  ? -15.323 39.717  23.899  1.00 36.17  ? 12  DA  D "H3'"  1 
ATOM   7633 H  "H2'"  . DA  D 2 12  ? -14.929 37.950  25.210  1.00 33.50  ? 12  DA  D "H2'"  1 
ATOM   7634 H  "H2''" . DA  D 2 12  ? -14.578 39.062  26.275  1.00 33.50  ? 12  DA  D "H2''" 1 
ATOM   7635 H  "H1'"  . DA  D 2 12  ? -16.630 38.987  27.209  1.00 45.73  ? 12  DA  D "H1'"  1 
ATOM   7636 H  H8     . DA  D 2 12  ? -16.315 35.786  25.440  1.00 44.96  ? 12  DA  D H8     1 
ATOM   7637 H  H61    . DA  D 2 12  ? -16.842 33.029  30.637  1.00 33.34  ? 12  DA  D H61    1 
ATOM   7638 H  H62    . DA  D 2 12  ? -16.659 32.832  29.172  1.00 33.34  ? 12  DA  D H62    1 
ATOM   7639 H  H2     . DA  D 2 12  ? -17.042 37.324  31.319  1.00 35.49  ? 12  DA  D H2     1 
ATOM   7640 P  P      . DA  D 2 13  ? -14.214 41.770  25.450  1.00 34.30  ? 13  DA  D P      1 
ATOM   7641 O  OP1    . DA  D 2 13  ? -14.336 43.194  25.070  1.00 37.11  ? 13  DA  D OP1    1 
ATOM   7642 O  OP2    . DA  D 2 13  ? -13.221 40.884  24.803  1.00 23.10  ? 13  DA  D OP2    1 
ATOM   7643 O  "O5'"  . DA  D 2 13  ? -13.939 41.732  27.019  1.00 31.54  ? 13  DA  D "O5'"  1 
ATOM   7644 C  "C5'"  . DA  D 2 13  ? -14.890 42.278  27.908  1.00 27.38  ? 13  DA  D "C5'"  1 
ATOM   7645 C  "C4'"  . DA  D 2 13  ? -14.528 41.952  29.343  1.00 11.90  ? 13  DA  D "C4'"  1 
ATOM   7646 O  "O4'"  . DA  D 2 13  ? -14.738 40.543  29.588  1.00 28.57  ? 13  DA  D "O4'"  1 
ATOM   7647 C  "C3'"  . DA  D 2 13  ? -13.076 42.241  29.719  1.00 16.55  ? 13  DA  D "C3'"  1 
ATOM   7648 O  "O3'"  . DA  D 2 13  ? -13.031 43.033  30.899  1.00 17.40  ? 13  DA  D "O3'"  1 
ATOM   7649 C  "C2'"  . DA  D 2 13  ? -12.441 40.859  29.912  1.00 23.52  ? 13  DA  D "C2'"  1 
ATOM   7650 C  "C1'"  . DA  D 2 13  ? -13.632 39.998  30.284  1.00 21.96  ? 13  DA  D "C1'"  1 
ATOM   7651 N  N9     . DA  D 2 13  ? -13.531 38.590  29.915  1.00 20.81  ? 13  DA  D N9     1 
ATOM   7652 C  C8     . DA  D 2 13  ? -13.420 38.069  28.659  1.00 20.62  ? 13  DA  D C8     1 
ATOM   7653 N  N7     . DA  D 2 13  ? -13.389 36.756  28.630  1.00 17.54  ? 13  DA  D N7     1 
ATOM   7654 C  C5     . DA  D 2 13  ? -13.510 36.392  29.959  1.00 18.60  ? 13  DA  D C5     1 
ATOM   7655 C  C6     . DA  D 2 13  ? -13.551 35.137  30.606  1.00 23.10  ? 13  DA  D C6     1 
ATOM   7656 N  N6     . DA  D 2 13  ? -13.466 33.966  29.964  1.00 26.22  ? 13  DA  D N6     1 
ATOM   7657 N  N1     . DA  D 2 13  ? -13.681 35.132  31.949  1.00 19.10  ? 13  DA  D N1     1 
ATOM   7658 C  C2     . DA  D 2 13  ? -13.763 36.300  32.594  1.00 20.87  ? 13  DA  D C2     1 
ATOM   7659 N  N3     . DA  D 2 13  ? -13.740 37.535  32.098  1.00 28.74  ? 13  DA  D N3     1 
ATOM   7660 C  C4     . DA  D 2 13  ? -13.609 37.511  30.763  1.00 23.68  ? 13  DA  D C4     1 
ATOM   7661 H  "H5'"  . DA  D 2 13  ? -15.765 41.910  27.707  1.00 33.07  ? 13  DA  D "H5'"  1 
ATOM   7662 H  "H5''" . DA  D 2 13  ? -14.919 43.241  27.795  1.00 33.07  ? 13  DA  D "H5''" 1 
ATOM   7663 H  "H4'"  . DA  D 2 13  ? -15.106 42.452  29.941  1.00 14.49  ? 13  DA  D "H4'"  1 
ATOM   7664 H  "H3'"  . DA  D 2 13  ? -12.628 42.686  28.983  1.00 20.08  ? 13  DA  D "H3'"  1 
ATOM   7665 H  "H2'"  . DA  D 2 13  ? -12.022 40.547  29.095  1.00 28.44  ? 13  DA  D "H2'"  1 
ATOM   7666 H  "H2''" . DA  D 2 13  ? -11.780 40.872  30.622  1.00 28.44  ? 13  DA  D "H2''" 1 
ATOM   7667 H  "H1'"  . DA  D 2 13  ? -13.758 40.057  31.244  1.00 26.57  ? 13  DA  D "H1'"  1 
ATOM   7668 H  H8     . DA  D 2 13  ? -13.371 38.595  27.893  1.00 24.96  ? 13  DA  D H8     1 
ATOM   7669 H  H61    . DA  D 2 13  ? -13.495 33.229  30.406  1.00 31.69  ? 13  DA  D H61    1 
ATOM   7670 H  H62    . DA  D 2 13  ? -13.383 33.950  29.108  1.00 31.69  ? 13  DA  D H62    1 
ATOM   7671 H  H2     . DA  D 2 13  ? -13.847 36.241  33.519  1.00 25.26  ? 13  DA  D H2     1 
ATOM   7672 P  P      . DT  D 2 14  ? -11.652 43.703  31.369  1.00 29.60  ? 14  DT  D P      1 
ATOM   7673 O  OP1    . DT  D 2 14  ? -12.012 44.886  32.183  1.00 16.30  ? 14  DT  D OP1    1 
ATOM   7674 O  OP2    . DT  D 2 14  ? -10.749 43.813  30.199  1.00 30.92  ? 14  DT  D OP2    1 
ATOM   7675 O  "O5'"  . DT  D 2 14  ? -11.031 42.634  32.370  1.00 19.94  ? 14  DT  D "O5'"  1 
ATOM   7676 C  "C5'"  . DT  D 2 14  ? -11.757 42.279  33.509  1.00 24.84  ? 14  DT  D "C5'"  1 
ATOM   7677 C  "C4'"  . DT  D 2 14  ? -11.122 41.109  34.225  1.00 20.83  ? 14  DT  D "C4'"  1 
ATOM   7678 O  "O4'"  . DT  D 2 14  ? -11.259 39.916  33.441  1.00 19.56  ? 14  DT  D "O4'"  1 
ATOM   7679 C  "C3'"  . DT  D 2 14  ? -9.622  41.250  34.503  1.00 16.48  ? 14  DT  D "C3'"  1 
ATOM   7680 O  "O3'"  . DT  D 2 14  ? -9.422  41.472  35.892  1.00 11.79  ? 14  DT  D "O3'"  1 
ATOM   7681 C  "C2'"  . DT  D 2 14  ? -9.003  39.922  34.017  1.00 19.51  ? 14  DT  D "C2'"  1 
ATOM   7682 C  "C1'"  . DT  D 2 14  ? -10.219 39.033  33.792  1.00 17.30  ? 14  DT  D "C1'"  1 
ATOM   7683 N  N1     . DT  D 2 14  ? -10.104 37.998  32.724  1.00 9.72   ? 14  DT  D N1     1 
ATOM   7684 C  C2     . DT  D 2 14  ? -10.107 36.673  33.090  1.00 13.68  ? 14  DT  D C2     1 
ATOM   7685 O  O2     . DT  D 2 14  ? -10.180 36.300  34.243  1.00 26.66  ? 14  DT  D O2     1 
ATOM   7686 N  N3     . DT  D 2 14  ? -10.026 35.788  32.055  1.00 20.94  ? 14  DT  D N3     1 
ATOM   7687 C  C4     . DT  D 2 14  ? -9.943  36.084  30.709  1.00 31.50  ? 14  DT  D C4     1 
ATOM   7688 O  O4     . DT  D 2 14  ? -9.871  35.208  29.852  1.00 27.33  ? 14  DT  D O4     1 
ATOM   7689 C  C5     . DT  D 2 14  ? -9.953  37.493  30.386  1.00 39.39  ? 14  DT  D C5     1 
ATOM   7690 C  C7     . DT  D 2 14  ? -9.868  37.939  28.960  1.00 24.43  ? 14  DT  D C7     1 
ATOM   7691 C  C6     . DT  D 2 14  ? -10.039 38.374  31.401  1.00 41.41  ? 14  DT  D C6     1 
ATOM   7692 H  "H5'"  . DT  D 2 14  ? -12.660 42.039  33.247  1.00 30.03  ? 14  DT  D "H5'"  1 
ATOM   7693 H  "H5''" . DT  D 2 14  ? -11.794 43.039  34.111  1.00 30.03  ? 14  DT  D "H5''" 1 
ATOM   7694 H  "H4'"  . DT  D 2 14  ? -11.585 40.978  35.067  1.00 25.22  ? 14  DT  D "H4'"  1 
ATOM   7695 H  "H3'"  . DT  D 2 14  ? -9.249  41.970  33.972  1.00 19.99  ? 14  DT  D "H3'"  1 
ATOM   7696 H  "H2'"  . DT  D 2 14  ? -8.505  40.049  33.195  1.00 23.62  ? 14  DT  D "H2'"  1 
ATOM   7697 H  "H2''" . DT  D 2 14  ? -8.413  39.545  34.689  1.00 23.62  ? 14  DT  D "H2''" 1 
ATOM   7698 H  "H1'"  . DT  D 2 14  ? -10.410 38.567  34.620  1.00 20.97  ? 14  DT  D "H1'"  1 
ATOM   7699 H  H3     . DT  D 2 14  ? -10.025 34.954  32.264  1.00 25.34  ? 14  DT  D H3     1 
ATOM   7700 H  H71    . DT  D 2 14  ? -10.618 38.523  28.766  1.00 29.53  ? 14  DT  D H71    1 
ATOM   7701 H  H72    . DT  D 2 14  ? -9.035  38.417  28.827  1.00 29.53  ? 14  DT  D H72    1 
ATOM   7702 H  H73    . DT  D 2 14  ? -9.898  37.160  28.383  1.00 29.53  ? 14  DT  D H73    1 
ATOM   7703 H  H6     . DT  D 2 14  ? -10.055 39.281  31.198  1.00 49.91  ? 14  DT  D H6     1 
ATOM   7704 P  P      . DG  D 2 15  ? -7.960  41.751  36.488  1.00 23.47  ? 15  DG  D P      1 
ATOM   7705 O  OP1    . DG  D 2 15  ? -8.167  42.616  37.674  1.00 19.51  ? 15  DG  D OP1    1 
ATOM   7706 O  OP2    . DG  D 2 15  ? -7.034  42.155  35.405  1.00 22.69  ? 15  DG  D OP2    1 
ATOM   7707 O  "O5'"  . DG  D 2 15  ? -7.495  40.318  36.994  1.00 16.43  ? 15  DG  D "O5'"  1 
ATOM   7708 C  "C5'"  . DG  D 2 15  ? -8.328  39.602  37.870  1.00 23.10  ? 15  DG  D "C5'"  1 
ATOM   7709 C  "C4'"  . DG  D 2 15  ? -7.747  38.239  38.172  1.00 22.45  ? 15  DG  D "C4'"  1 
ATOM   7710 O  "O4'"  . DG  D 2 15  ? -7.952  37.352  37.045  1.00 28.15  ? 15  DG  D "O4'"  1 
ATOM   7711 C  "C3'"  . DG  D 2 15  ? -6.247  38.241  38.455  1.00 19.69  ? 15  DG  D "C3'"  1 
ATOM   7712 O  "O3'"  . DG  D 2 15  ? -5.997  37.516  39.641  1.00 19.02  ? 15  DG  D "O3'"  1 
ATOM   7713 C  "C2'"  . DG  D 2 15  ? -5.628  37.591  37.211  1.00 16.83  ? 15  DG  D "C2'"  1 
ATOM   7714 C  "C1'"  . DG  D 2 15  ? -6.744  36.686  36.722  1.00 21.19  ? 15  DG  D "C1'"  1 
ATOM   7715 N  N9     . DG  D 2 15  ? -6.747  36.427  35.287  1.00 15.52  ? 15  DG  D N9     1 
ATOM   7716 C  C8     . DG  D 2 15  ? -6.754  37.354  34.275  1.00 22.28  ? 15  DG  D C8     1 
ATOM   7717 N  N7     . DG  D 2 15  ? -6.795  36.822  33.082  1.00 24.18  ? 15  DG  D N7     1 
ATOM   7718 C  C5     . DG  D 2 15  ? -6.840  35.455  33.322  1.00 15.55  ? 15  DG  D C5     1 
ATOM   7719 C  C6     . DG  D 2 15  ? -6.899  34.372  32.416  1.00 18.64  ? 15  DG  D C6     1 
ATOM   7720 O  O6     . DG  D 2 15  ? -6.924  34.407  31.178  1.00 20.53  ? 15  DG  D O6     1 
ATOM   7721 N  N1     . DG  D 2 15  ? -6.931  33.146  33.079  1.00 25.40  ? 15  DG  D N1     1 
ATOM   7722 C  C2     . DG  D 2 15  ? -6.910  32.993  34.444  1.00 21.33  ? 15  DG  D C2     1 
ATOM   7723 N  N2     . DG  D 2 15  ? -6.948  31.739  34.910  1.00 27.93  ? 15  DG  D N2     1 
ATOM   7724 N  N3     . DG  D 2 15  ? -6.855  34.000  35.301  1.00 20.01  ? 15  DG  D N3     1 
ATOM   7725 C  C4     . DG  D 2 15  ? -6.822  35.197  34.673  1.00 16.71  ? 15  DG  D C4     1 
ATOM   7726 H  "H5'"  . DG  D 2 15  ? -9.202  39.494  37.462  1.00 27.94  ? 15  DG  D "H5'"  1 
ATOM   7727 H  "H5''" . DG  D 2 15  ? -8.425  40.100  38.697  1.00 27.94  ? 15  DG  D "H5''" 1 
ATOM   7728 H  "H4'"  . DG  D 2 15  ? -8.209  37.855  38.934  1.00 27.16  ? 15  DG  D "H4'"  1 
ATOM   7729 H  "H3'"  . DG  D 2 15  ? -5.912  39.149  38.525  1.00 23.84  ? 15  DG  D "H3'"  1 
ATOM   7730 H  "H2'"  . DG  D 2 15  ? -5.396  38.256  36.545  1.00 20.41  ? 15  DG  D "H2'"  1 
ATOM   7731 H  "H2''" . DG  D 2 15  ? -4.834  37.081  37.438  1.00 20.41  ? 15  DG  D "H2''" 1 
ATOM   7732 H  "H1'"  . DG  D 2 15  ? -6.680  35.839  37.189  1.00 25.65  ? 15  DG  D "H1'"  1 
ATOM   7733 H  H8     . DG  D 2 15  ? -6.731  38.271  34.424  1.00 26.96  ? 15  DG  D H8     1 
ATOM   7734 H  H1     . DG  D 2 15  ? -6.967  32.434  32.599  1.00 30.69  ? 15  DG  D H1     1 
ATOM   7735 H  H21    . DG  D 2 15  ? -6.936  31.594  35.758  1.00 33.73  ? 15  DG  D H21    1 
ATOM   7736 H  H22    . DG  D 2 15  ? -6.984  31.077  34.362  1.00 33.73  ? 15  DG  D H22    1 
ATOM   7737 P  P      . DA  D 2 16  ? -4.541  37.518  40.303  1.00 32.51  ? 16  DA  D P      1 
ATOM   7738 O  OP1    . DA  D 2 16  ? -4.746  37.369  41.763  1.00 28.93  ? 16  DA  D OP1    1 
ATOM   7739 O  OP2    . DA  D 2 16  ? -3.786  38.673  39.762  1.00 26.34  ? 16  DA  D OP2    1 
ATOM   7740 O  "O5'"  . DA  D 2 16  ? -3.896  36.168  39.756  1.00 26.12  ? 16  DA  D "O5'"  1 
ATOM   7741 C  "C5'"  . DA  D 2 16  ? -4.575  34.951  39.961  1.00 22.49  ? 16  DA  D "C5'"  1 
ATOM   7742 C  "C4'"  . DA  D 2 16  ? -3.937  33.828  39.172  1.00 25.28  ? 16  DA  D "C4'"  1 
ATOM   7743 O  "O4'"  . DA  D 2 16  ? -4.309  33.924  37.784  1.00 36.29  ? 16  DA  D "O4'"  1 
ATOM   7744 C  "C3'"  . DA  D 2 16  ? -2.409  33.825  39.185  1.00 23.40  ? 16  DA  D "C3'"  1 
ATOM   7745 O  "O3'"  . DA  D 2 16  ? -1.942  32.818  40.064  1.00 35.12  ? 16  DA  D "O3'"  1 
ATOM   7746 C  "C2'"  . DA  D 2 16  ? -1.999  33.570  37.723  1.00 28.75  ? 16  DA  D "C2'"  1 
ATOM   7747 C  "C1'"  . DA  D 2 16  ? -3.321  33.284  37.017  1.00 28.78  ? 16  DA  D "C1'"  1 
ATOM   7748 N  N9     . DA  D 2 16  ? -3.380  33.784  35.651  1.00 16.80  ? 16  DA  D N9     1 
ATOM   7749 C  C8     . DA  D 2 16  ? -3.378  35.088  35.252  1.00 20.28  ? 16  DA  D C8     1 
ATOM   7750 N  N7     . DA  D 2 16  ? -3.449  35.243  33.952  1.00 19.95  ? 16  DA  D N7     1 
ATOM   7751 C  C5     . DA  D 2 16  ? -3.518  33.949  33.466  1.00 15.73  ? 16  DA  D C5     1 
ATOM   7752 C  C6     . DA  D 2 16  ? -3.615  33.428  32.160  1.00 19.91  ? 16  DA  D C6     1 
ATOM   7753 N  N6     . DA  D 2 16  ? -3.659  34.194  31.065  1.00 12.11  ? 16  DA  D N6     1 
ATOM   7754 N  N1     . DA  D 2 16  ? -3.665  32.087  32.024  1.00 22.67  ? 16  DA  D N1     1 
ATOM   7755 C  C2     . DA  D 2 16  ? -3.620  31.326  33.124  1.00 23.47  ? 16  DA  D C2     1 
ATOM   7756 N  N3     . DA  D 2 16  ? -3.530  31.701  34.399  1.00 17.08  ? 16  DA  D N3     1 
ATOM   7757 C  C4     . DA  D 2 16  ? -3.483  33.037  34.501  1.00 13.05  ? 16  DA  D C4     1 
ATOM   7758 H  "H5'"  . DA  D 2 16  ? -5.498  35.051  39.682  1.00 27.20  ? 16  DA  D "H5'"  1 
ATOM   7759 H  "H5''" . DA  D 2 16  ? -4.553  34.729  40.905  1.00 27.20  ? 16  DA  D "H5''" 1 
ATOM   7760 H  "H4'"  . DA  D 2 16  ? -4.261  32.982  39.518  1.00 30.55  ? 16  DA  D "H4'"  1 
ATOM   7761 H  "H3'"  . DA  D 2 16  ? -2.081  34.700  39.446  1.00 28.29  ? 16  DA  D "H3'"  1 
ATOM   7762 H  "H2'"  . DA  D 2 16  ? -1.564  34.350  37.343  1.00 34.71  ? 16  DA  D "H2'"  1 
ATOM   7763 H  "H2''" . DA  D 2 16  ? -1.399  32.811  37.658  1.00 34.71  ? 16  DA  D "H2''" 1 
ATOM   7764 H  "H1'"  . DA  D 2 16  ? -3.489  32.329  37.003  1.00 34.75  ? 16  DA  D "H1'"  1 
ATOM   7765 H  H8     . DA  D 2 16  ? -3.331  35.801  35.847  1.00 24.55  ? 16  DA  D H8     1 
ATOM   7766 H  H61    . DA  D 2 16  ? -3.717  33.830  30.288  1.00 14.74  ? 16  DA  D H61    1 
ATOM   7767 H  H62    . DA  D 2 16  ? -3.628  35.050  31.137  1.00 14.74  ? 16  DA  D H62    1 
ATOM   7768 H  H2     . DA  D 2 16  ? -3.656  30.408  32.977  1.00 28.37  ? 16  DA  D H2     1 
ATOM   7769 P  P      . DG  D 2 17  ? -0.371  32.564  40.260  1.00 54.84  ? 17  DG  D P      1 
ATOM   7770 O  OP1    . DG  D 2 17  ? -0.192  31.858  41.549  1.00 50.25  ? 17  DG  D OP1    1 
ATOM   7771 O  OP2    . DG  D 2 17  ? 0.337   33.840  40.005  1.00 41.14  ? 17  DG  D OP2    1 
ATOM   7772 O  "O5'"  . DG  D 2 17  ? -0.024  31.576  39.058  1.00 34.02  ? 17  DG  D "O5'"  1 
ATOM   7773 C  "C5'"  . DG  D 2 17  ? -0.859  30.458  38.820  1.00 37.16  ? 17  DG  D "C5'"  1 
ATOM   7774 C  "C4'"  . DG  D 2 17  ? -0.563  29.843  37.466  1.00 53.28  ? 17  DG  D "C4'"  1 
ATOM   7775 O  "O4'"  . DG  D 2 17  ? -0.966  30.748  36.417  1.00 39.87  ? 17  DG  D "O4'"  1 
ATOM   7776 C  "C3'"  . DG  D 2 17  ? 0.917   29.550  37.204  1.00 51.91  ? 17  DG  D "C3'"  1 
ATOM   7777 O  "O3'"  . DG  D 2 17  ? 1.196   28.151  37.387  1.00 81.98  ? 17  DG  D "O3'"  1 
ATOM   7778 C  "C2'"  . DG  D 2 17  ? 1.153   30.014  35.751  1.00 50.39  ? 17  DG  D "C2'"  1 
ATOM   7779 C  "C1'"  . DG  D 2 17  ? -0.238  30.422  35.261  1.00 38.42  ? 17  DG  D "C1'"  1 
ATOM   7780 N  N9     . DG  D 2 17  ? -0.238  31.564  34.345  1.00 28.23  ? 17  DG  D N9     1 
ATOM   7781 C  C8     . DG  D 2 17  ? -0.186  32.897  34.675  1.00 31.94  ? 17  DG  D C8     1 
ATOM   7782 N  N7     . DG  D 2 17  ? -0.207  33.690  33.637  1.00 24.68  ? 17  DG  D N7     1 
ATOM   7783 C  C5     . DG  D 2 17  ? -0.287  32.830  32.551  1.00 11.87  ? 17  DG  D C5     1 
ATOM   7784 C  C6     . DG  D 2 17  ? -0.342  33.115  31.165  1.00 21.18  ? 17  DG  D C6     1 
ATOM   7785 O  O6     . DG  D 2 17  ? -0.333  34.222  30.607  1.00 25.08  ? 17  DG  D O6     1 
ATOM   7786 N  N1     . DG  D 2 17  ? -0.414  31.952  30.400  1.00 25.90  ? 17  DG  D N1     1 
ATOM   7787 C  C2     . DG  D 2 17  ? -0.433  30.675  30.912  1.00 26.78  ? 17  DG  D C2     1 
ATOM   7788 N  N2     . DG  D 2 17  ? -0.507  29.673  30.021  1.00 29.17  ? 17  DG  D N2     1 
ATOM   7789 N  N3     . DG  D 2 17  ? -0.381  30.396  32.210  1.00 19.62  ? 17  DG  D N3     1 
ATOM   7790 C  C4     . DG  D 2 17  ? -0.309  31.518  32.967  1.00 16.41  ? 17  DG  D C4     1 
ATOM   7791 H  "H5'"  . DG  D 2 17  ? -1.786  30.739  38.848  1.00 44.81  ? 17  DG  D "H5'"  1 
ATOM   7792 H  "H5''" . DG  D 2 17  ? -0.709  29.795  39.512  1.00 44.81  ? 17  DG  D "H5''" 1 
ATOM   7793 H  "H4'"  . DG  D 2 17  ? -1.073  29.022  37.379  1.00 64.15  ? 17  DG  D "H4'"  1 
ATOM   7794 H  "H3'"  . DG  D 2 17  ? 1.462   30.088  37.800  1.00 62.50  ? 17  DG  D "H3'"  1 
ATOM   7795 H  "H2'"  . DG  D 2 17  ? 1.765   30.766  35.723  1.00 60.69  ? 17  DG  D "H2'"  1 
ATOM   7796 H  "H2''" . DG  D 2 17  ? 1.513   29.293  35.211  1.00 60.69  ? 17  DG  D "H2''" 1 
ATOM   7797 H  "H1'"  . DG  D 2 17  ? -0.663  29.676  34.811  1.00 46.32  ? 17  DG  D "H1'"  1 
ATOM   7798 H  H8     . DG  D 2 17  ? -0.140  33.204  35.551  1.00 38.55  ? 17  DG  D H8     1 
ATOM   7799 H  H1     . DG  D 2 17  ? -0.450  32.039  29.545  1.00 31.30  ? 17  DG  D H1     1 
ATOM   7800 H  H21    . DG  D 2 17  ? -0.520  28.857  30.292  1.00 35.22  ? 17  DG  D H21    1 
ATOM   7801 H  H22    . DG  D 2 17  ? -0.540  29.847  29.180  1.00 35.22  ? 17  DG  D H22    1 
ATOM   7802 P  P      . DC  D 2 18  ? 2.686   27.575  37.212  1.00 62.50  ? 18  DC  D P      1 
ATOM   7803 O  OP1    . DC  D 2 18  ? 2.765   26.315  37.984  1.00 68.63  ? 18  DC  D OP1    1 
ATOM   7804 O  OP2    . DC  D 2 18  ? 3.647   28.665  37.493  1.00 47.41  ? 18  DC  D OP2    1 
ATOM   7805 O  "O5'"  . DC  D 2 18  ? 2.776   27.204  35.659  1.00 29.94  ? 18  DC  D "O5'"  1 
ATOM   7806 C  "C5'"  . DC  D 2 18  ? 1.720   26.465  35.045  1.00 45.91  ? 18  DC  D "C5'"  1 
ATOM   7807 C  "C4'"  . DC  D 2 18  ? 2.072   26.102  33.611  1.00 57.66  ? 18  DC  D "C4'"  1 
ATOM   7808 O  "O4'"  . DC  D 2 18  ? 1.775   27.216  32.722  1.00 56.09  ? 18  DC  D "O4'"  1 
ATOM   7809 C  "C3'"  . DC  D 2 18  ? 3.544   25.762  33.400  1.00 47.93  ? 18  DC  D "C3'"  1 
ATOM   7810 O  "O3'"  . DC  D 2 18  ? 3.683   24.631  32.557  1.00 54.39  ? 18  DC  D "O3'"  1 
ATOM   7811 C  "C2'"  . DC  D 2 18  ? 4.112   27.038  32.780  1.00 39.37  ? 18  DC  D "C2'"  1 
ATOM   7812 C  "C1'"  . DC  D 2 18  ? 2.929   27.574  31.982  1.00 32.10  ? 18  DC  D "C1'"  1 
ATOM   7813 N  N1     . DC  D 2 18  ? 2.933   29.063  31.793  1.00 28.72  ? 18  DC  D N1     1 
ATOM   7814 C  C2     . DC  D 2 18  ? 2.893   29.608  30.498  1.00 29.54  ? 18  DC  D C2     1 
ATOM   7815 O  O2     . DC  D 2 18  ? 2.851   28.848  29.523  1.00 27.45  ? 18  DC  D O2     1 
ATOM   7816 N  N3     . DC  D 2 18  ? 2.895   30.961  30.356  1.00 21.66  ? 18  DC  D N3     1 
ATOM   7817 C  C4     . DC  D 2 18  ? 2.939   31.747  31.434  1.00 23.55  ? 18  DC  D C4     1 
ATOM   7818 N  N4     . DC  D 2 18  ? 2.943   33.072  31.250  1.00 18.20  ? 18  DC  D N4     1 
ATOM   7819 C  C5     . DC  D 2 18  ? 2.984   31.209  32.753  1.00 33.62  ? 18  DC  D C5     1 
ATOM   7820 C  C6     . DC  D 2 18  ? 2.977   29.879  32.883  1.00 32.11  ? 18  DC  D C6     1 
ATOM   7821 H  "H5'"  . DC  D 2 18  ? 0.911   27.000  35.049  1.00 55.30  ? 18  DC  D "H5'"  1 
ATOM   7822 H  "H5''" . DC  D 2 18  ? 1.563   25.652  35.551  1.00 55.30  ? 18  DC  D "H5''" 1 
ATOM   7823 H  "H4'"  . DC  D 2 18  ? 1.527   25.352  33.325  1.00 69.40  ? 18  DC  D "H4'"  1 
ATOM   7824 H  "H3'"  . DC  D 2 18  ? 3.975   25.593  34.253  1.00 57.73  ? 18  DC  D "H3'"  1 
ATOM   7825 H  "H2'"  . DC  D 2 18  ? 4.391   27.668  33.463  1.00 47.46  ? 18  DC  D "H2'"  1 
ATOM   7826 H  "H2''" . DC  D 2 18  ? 4.868   26.843  32.203  1.00 47.46  ? 18  DC  D "H2''" 1 
ATOM   7827 H  "H1'"  . DC  D 2 18  ? 2.910   27.151  31.109  1.00 38.73  ? 18  DC  D "H1'"  1 
ATOM   7828 H  H41    . DC  D 2 18  ? 2.971   33.601  31.928  1.00 22.06  ? 18  DC  D H41    1 
ATOM   7829 H  H42    . DC  D 2 18  ? 2.919   33.396  30.453  1.00 22.06  ? 18  DC  D H42    1 
ATOM   7830 H  H5     . DC  D 2 18  ? 3.016   31.765  33.497  1.00 40.56  ? 18  DC  D H5     1 
ATOM   7831 H  H6     . DC  D 2 18  ? 3.003   29.503  33.734  1.00 38.75  ? 18  DC  D H6     1 
ATOM   7832 P  P      . DA  D 2 19  ? 5.061   23.808  32.546  1.00 62.99  ? 19  DA  D P      1 
ATOM   7833 O  OP1    . DA  D 2 19  ? 4.726   22.394  32.831  1.00 63.85  ? 19  DA  D OP1    1 
ATOM   7834 O  OP2    . DA  D 2 19  ? 6.023   24.538  33.406  1.00 42.96  ? 19  DA  D OP2    1 
ATOM   7835 O  "O5'"  . DA  D 2 19  ? 5.556   23.925  31.034  1.00 55.29  ? 19  DA  D "O5'"  1 
ATOM   7836 C  "C5'"  . DA  D 2 19  ? 4.699   23.483  29.988  1.00 62.68  ? 19  DA  D "C5'"  1 
ATOM   7837 C  "C4'"  . DA  D 2 19  ? 5.312   23.771  28.634  1.00 63.73  ? 19  DA  D "C4'"  1 
ATOM   7838 O  "O4'"  . DA  D 2 19  ? 5.207   25.194  28.357  1.00 76.97  ? 19  DA  D "O4'"  1 
ATOM   7839 C  "C3'"  . DA  D 2 19  ? 6.790   23.433  28.519  1.00 73.68  ? 19  DA  D "C3'"  1 
ATOM   7840 O  "O3'"  . DA  D 2 19  ? 7.092   22.975  27.217  1.00 70.47  ? 19  DA  D "O3'"  1 
ATOM   7841 C  "C2'"  . DA  D 2 19  ? 7.469   24.755  28.849  1.00 53.62  ? 19  DA  D "C2'"  1 
ATOM   7842 C  "C1'"  . DA  D 2 19  ? 6.498   25.771  28.257  1.00 56.55  ? 19  DA  D "C1'"  1 
ATOM   7843 N  N9     . DA  D 2 19  ? 6.480   27.047  28.964  1.00 45.02  ? 19  DA  D N9     1 
ATOM   7844 C  C8     . DA  D 2 19  ? 6.518   27.234  30.315  1.00 50.83  ? 19  DA  D C8     1 
ATOM   7845 N  N7     . DA  D 2 19  ? 6.473   28.492  30.679  1.00 38.41  ? 19  DA  D N7     1 
ATOM   7846 C  C5     . DA  D 2 19  ? 6.389   29.179  29.483  1.00 32.28  ? 19  DA  D C5     1 
ATOM   7847 C  C6     . DA  D 2 19  ? 6.310   30.551  29.185  1.00 36.91  ? 19  DA  D C6     1 
ATOM   7848 N  N6     . DA  D 2 19  ? 6.301   31.506  30.120  1.00 34.74  ? 19  DA  D N6     1 
ATOM   7849 N  N1     . DA  D 2 19  ? 6.238   30.905  27.884  1.00 39.72  ? 19  DA  D N1     1 
ATOM   7850 C  C2     . DA  D 2 19  ? 6.247   29.943  26.954  1.00 56.08  ? 19  DA  D C2     1 
ATOM   7851 N  N3     . DA  D 2 19  ? 6.317   28.621  27.113  1.00 58.30  ? 19  DA  D N3     1 
ATOM   7852 C  C4     . DA  D 2 19  ? 6.386   28.303  28.414  1.00 34.14  ? 19  DA  D C4     1 
ATOM   7853 H  "H5'"  . DA  D 2 19  ? 3.847   23.940  30.058  1.00 75.43  ? 19  DA  D "H5'"  1 
ATOM   7854 H  "H5''" . DA  D 2 19  ? 4.554   22.528  30.077  1.00 75.43  ? 19  DA  D "H5''" 1 
ATOM   7855 H  "H4'"  . DA  D 2 19  ? 4.827   23.283  27.951  1.00 76.69  ? 19  DA  D "H4'"  1 
ATOM   7856 H  "H3'"  . DA  D 2 19  ? 7.039   22.762  29.173  1.00 88.63  ? 19  DA  D "H3'"  1 
ATOM   7857 H  "H2'"  . DA  D 2 19  ? 7.565   24.874  29.807  1.00 64.56  ? 19  DA  D "H2'"  1 
ATOM   7858 H  "H2''" . DA  D 2 19  ? 8.343   24.818  28.434  1.00 64.56  ? 19  DA  D "H2''" 1 
ATOM   7859 H  "H1'"  . DA  D 2 19  ? 6.719   25.921  27.324  1.00 68.07  ? 19  DA  D "H1'"  1 
ATOM   7860 H  H8     . DA  D 2 19  ? 6.571   26.532  30.922  1.00 61.21  ? 19  DA  D H8     1 
ATOM   7861 H  H61    . DA  D 2 19  ? 6.251   32.333  29.890  1.00 41.90  ? 19  DA  D H61    1 
ATOM   7862 H  H62    . DA  D 2 19  ? 6.346   31.294  30.952  1.00 41.90  ? 19  DA  D H62    1 
ATOM   7863 H  H2     . DA  D 2 19  ? 6.197   30.237  26.073  1.00 67.51  ? 19  DA  D H2     1 
ATOM   7864 P  P      . DA  D 2 20  ? 8.554   22.406  26.881  1.00 92.00  ? 20  DA  D P      1 
ATOM   7865 O  OP1    . DA  D 2 20  ? 8.382   21.022  26.386  1.00 93.26  ? 20  DA  D OP1    1 
ATOM   7866 O  OP2    . DA  D 2 20  ? 9.423   22.669  28.053  1.00 57.45  ? 20  DA  D OP2    1 
ATOM   7867 O  "O5'"  . DA  D 2 20  ? 9.035   23.333  25.672  1.00 64.42  ? 20  DA  D "O5'"  1 
ATOM   7868 C  "C5'"  . DA  D 2 20  ? 8.192   23.490  24.538  1.00 70.51  ? 20  DA  D "C5'"  1 
ATOM   7869 C  "C4'"  . DA  D 2 20  ? 8.615   24.687  23.708  1.00 63.82  ? 20  DA  D "C4'"  1 
ATOM   7870 O  "O4'"  . DA  D 2 20  ? 8.371   25.908  24.460  1.00 55.44  ? 20  DA  D "O4'"  1 
ATOM   7871 C  "C3'"  . DA  D 2 20  ? 10.092  24.706  23.330  1.00 70.21  ? 20  DA  D "C3'"  1 
ATOM   7872 O  "O3'"  . DA  D 2 20  ? 10.242  25.110  21.976  1.00 70.01  ? 20  DA  D "O3'"  1 
ATOM   7873 C  "C2'"  . DA  D 2 20  ? 10.706  25.696  24.319  1.00 71.53  ? 20  DA  D "C2'"  1 
ATOM   7874 C  "C1'"  . DA  D 2 20  ? 9.561   26.669  24.565  1.00 69.25  ? 20  DA  D "C1'"  1 
ATOM   7875 N  N9     . DA  D 2 20  ? 9.585   27.302  25.883  1.00 56.40  ? 20  DA  D N9     1 
ATOM   7876 C  C8     . DA  D 2 20  ? 9.628   26.677  27.096  1.00 58.16  ? 20  DA  D C8     1 
ATOM   7877 N  N7     . DA  D 2 20  ? 9.627   27.499  28.119  1.00 41.64  ? 20  DA  D N7     1 
ATOM   7878 C  C5     . DA  D 2 20  ? 9.568   28.753  27.538  1.00 42.66  ? 20  DA  D C5     1 
ATOM   7879 C  C6     . DA  D 2 20  ? 9.534   30.054  28.083  1.00 41.07  ? 20  DA  D C6     1 
ATOM   7880 N  N6     . DA  D 2 20  ? 9.558   30.307  29.398  1.00 30.87  ? 20  DA  D N6     1 
ATOM   7881 N  N1     . DA  D 2 20  ? 9.477   31.089  27.222  1.00 25.55  ? 20  DA  D N1     1 
ATOM   7882 C  C2     . DA  D 2 20  ? 9.455   30.835  25.908  1.00 49.68  ? 20  DA  D C2     1 
ATOM   7883 N  N3     . DA  D 2 20  ? 9.479   29.660  25.278  1.00 43.98  ? 20  DA  D N3     1 
ATOM   7884 C  C4     . DA  D 2 20  ? 9.536   28.651  26.158  1.00 42.03  ? 20  DA  D C4     1 
ATOM   7885 H  "H5'"  . DA  D 2 20  ? 7.277   23.616  24.836  1.00 84.83  ? 20  DA  D "H5'"  1 
ATOM   7886 H  "H5''" . DA  D 2 20  ? 8.238   22.690  23.992  1.00 84.83  ? 20  DA  D "H5''" 1 
ATOM   7887 H  "H4'"  . DA  D 2 20  ? 8.087   24.720  22.895  1.00 76.80  ? 20  DA  D "H4'"  1 
ATOM   7888 H  "H3'"  . DA  D 2 20  ? 10.490  23.832  23.468  1.00 84.46  ? 20  DA  D "H3'"  1 
ATOM   7889 H  "H2'"  . DA  D 2 20  ? 10.975  25.253  25.139  1.00 86.05  ? 20  DA  D "H2'"  1 
ATOM   7890 H  "H2''" . DA  D 2 20  ? 11.475  26.146  23.936  1.00 86.05  ? 20  DA  D "H2''" 1 
ATOM   7891 H  "H1'"  . DA  D 2 20  ? 9.576   27.358  23.883  1.00 83.32  ? 20  DA  D "H1'"  1 
ATOM   7892 H  H8     . DA  D 2 20  ? 9.656   25.752  27.188  1.00 70.01  ? 20  DA  D H8     1 
ATOM   7893 H  H61    . DA  D 2 20  ? 9.538   31.119  29.680  1.00 37.26  ? 20  DA  D H61    1 
ATOM   7894 H  H62    . DA  D 2 20  ? 9.594   29.657  29.960  1.00 37.26  ? 20  DA  D H62    1 
ATOM   7895 H  H2     . DA  D 2 20  ? 9.416   31.583  25.356  1.00 59.83  ? 20  DA  D H2     1 
ATOM   7896 P  P      . DG  D 2 21  ? 11.652  24.939  21.233  1.00 92.49  ? 21  DG  D P      1 
ATOM   7897 O  OP1    . DG  D 2 21  ? 11.361  24.430  19.873  1.00 72.64  ? 21  DG  D OP1    1 
ATOM   7898 O  OP2    . DG  D 2 21  ? 12.548  24.183  22.139  1.00 72.22  ? 21  DG  D OP2    1 
ATOM   7899 O  "O5'"  . DG  D 2 21  ? 12.209  26.434  21.137  1.00 71.62  ? 21  DG  D "O5'"  1 
ATOM   7900 C  "C5'"  . DG  D 2 21  ? 11.422  27.439  20.520  1.00 54.57  ? 21  DG  D "C5'"  1 
ATOM   7901 C  "C4'"  . DG  D 2 21  ? 11.973  28.819  20.831  1.00 61.86  ? 21  DG  D "C4'"  1 
ATOM   7902 O  "O4'"  . DG  D 2 21  ? 11.698  29.145  22.218  1.00 60.67  ? 21  DG  D "O4'"  1 
ATOM   7903 C  "C3'"  . DG  D 2 21  ? 13.487  28.958  20.650  1.00 61.66  ? 21  DG  D "C3'"  1 
ATOM   7904 O  "O3'"  . DG  D 2 21  ? 13.783  30.011  19.739  1.00 76.44  ? 21  DG  D "O3'"  1 
ATOM   7905 C  "C2'"  . DG  D 2 21  ? 14.022  29.242  22.059  1.00 54.90  ? 21  DG  D "C2'"  1 
ATOM   7906 C  "C1'"  . DG  D 2 21  ? 12.807  29.818  22.769  1.00 50.68  ? 21  DG  D "C1'"  1 
ATOM   7907 N  N9     . DG  D 2 21  ? 12.808  29.619  24.212  1.00 45.65  ? 21  DG  D N9     1 
ATOM   7908 C  C8     . DG  D 2 21  ? 12.822  28.422  24.883  1.00 43.42  ? 21  DG  D C8     1 
ATOM   7909 N  N7     . DG  D 2 21  ? 12.811  28.553  26.180  1.00 33.60  ? 21  DG  D N7     1 
ATOM   7910 C  C5     . DG  D 2 21  ? 12.781  29.925  26.384  1.00 31.19  ? 21  DG  D C5     1 
ATOM   7911 C  C6     . DG  D 2 21  ? 12.757  30.667  27.588  1.00 37.91  ? 21  DG  D C6     1 
ATOM   7912 O  O6     . DG  D 2 21  ? 12.756  30.240  28.750  1.00 40.90  ? 21  DG  D O6     1 
ATOM   7913 N  N1     . DG  D 2 21  ? 12.731  32.038  27.349  1.00 32.95  ? 21  DG  D N1     1 
ATOM   7914 C  C2     . DG  D 2 21  ? 12.731  32.620  26.103  1.00 44.60  ? 21  DG  D C2     1 
ATOM   7915 N  N2     . DG  D 2 21  ? 12.704  33.961  26.068  1.00 44.84  ? 21  DG  D N2     1 
ATOM   7916 N  N3     . DG  D 2 21  ? 12.752  31.934  24.966  1.00 44.96  ? 21  DG  D N3     1 
ATOM   7917 C  C4     . DG  D 2 21  ? 12.777  30.597  25.182  1.00 32.63  ? 21  DG  D C4     1 
ATOM   7918 H  "H5'"  . DG  D 2 21  ? 10.511  27.377  20.845  1.00 65.71  ? 21  DG  D "H5'"  1 
ATOM   7919 H  "H5''" . DG  D 2 21  ? 11.425  27.303  19.559  1.00 65.71  ? 21  DG  D "H5''" 1 
ATOM   7920 H  "H4'"  . DG  D 2 21  ? 11.533  29.478  20.271  1.00 74.45  ? 21  DG  D "H4'"  1 
ATOM   7921 H  "H3'"  . DG  D 2 21  ? 13.852  28.115  20.337  1.00 74.21  ? 21  DG  D "H3'"  1 
ATOM   7922 H  "HO3'" . DG  D 2 21  ? 14.199  29.847  19.028  1.00 91.95  ? 21  DG  D "HO3'" 1 
ATOM   7923 H  "H2'"  . DG  D 2 21  ? 14.328  28.429  22.490  1.00 66.10  ? 21  DG  D "H2'"  1 
ATOM   7924 H  "H2''" . DG  D 2 21  ? 14.751  29.881  22.036  1.00 66.10  ? 21  DG  D "H2''" 1 
ATOM   7925 H  "H1'"  . DG  D 2 21  ? 12.743  30.769  22.590  1.00 61.03  ? 21  DG  D "H1'"  1 
ATOM   7926 H  H8     . DG  D 2 21  ? 12.838  27.597  24.454  1.00 52.33  ? 21  DG  D H8     1 
ATOM   7927 H  H1     . DG  D 2 21  ? 12.715  32.561  28.032  1.00 39.75  ? 21  DG  D H1     1 
ATOM   7928 H  H21    . DG  D 2 21  ? 12.702  34.371  25.312  1.00 54.02  ? 21  DG  D H21    1 
ATOM   7929 H  H22    . DG  D 2 21  ? 12.690  34.410  26.801  1.00 54.02  ? 21  DG  D H22    1 
ATOM   7930 O  "O5'"  . DC  E 3 1   ? 13.002  38.754  33.678  1.00 60.72  ? 1   DC  E "O5'"  1 
ATOM   7931 C  "C5'"  . DC  E 3 1   ? 14.193  39.168  33.014  1.00 61.20  ? 1   DC  E "C5'"  1 
ATOM   7932 C  "C4'"  . DC  E 3 1   ? 13.979  39.227  31.513  1.00 47.85  ? 1   DC  E "C4'"  1 
ATOM   7933 O  "O4'"  . DC  E 3 1   ? 14.227  37.913  30.933  1.00 35.45  ? 1   DC  E "O4'"  1 
ATOM   7934 C  "C3'"  . DC  E 3 1   ? 12.565  39.608  31.082  1.00 43.20  ? 1   DC  E "C3'"  1 
ATOM   7935 O  "O3'"  . DC  E 3 1   ? 12.599  40.402  29.907  1.00 34.34  ? 1   DC  E "O3'"  1 
ATOM   7936 C  "C2'"  . DC  E 3 1   ? 11.903  38.256  30.853  1.00 58.66  ? 1   DC  E "C2'"  1 
ATOM   7937 C  "C1'"  . DC  E 3 1   ? 13.058  37.440  30.284  1.00 52.04  ? 1   DC  E "C1'"  1 
ATOM   7938 N  N1     . DC  E 3 1   ? 12.944  35.967  30.517  1.00 47.20  ? 1   DC  E N1     1 
ATOM   7939 C  C2     . DC  E 3 1   ? 12.968  35.085  29.426  1.00 40.21  ? 1   DC  E C2     1 
ATOM   7940 O  O2     . DC  E 3 1   ? 13.079  35.543  28.282  1.00 52.80  ? 1   DC  E O2     1 
ATOM   7941 N  N3     . DC  E 3 1   ? 12.868  33.753  29.658  1.00 22.47  ? 1   DC  E N3     1 
ATOM   7942 C  C4     . DC  E 3 1   ? 12.753  33.302  30.906  1.00 30.74  ? 1   DC  E C4     1 
ATOM   7943 N  N4     . DC  E 3 1   ? 12.661  31.981  31.090  1.00 40.29  ? 1   DC  E N4     1 
ATOM   7944 C  C5     . DC  E 3 1   ? 12.729  34.183  32.027  1.00 32.59  ? 1   DC  E C5     1 
ATOM   7945 C  C6     . DC  E 3 1   ? 12.829  35.493  31.789  1.00 28.64  ? 1   DC  E C6     1 
ATOM   7946 H  "H5'"  . DC  E 3 1   ? 14.905  38.539  33.211  1.00 73.65  ? 1   DC  E "H5'"  1 
ATOM   7947 H  "H5''" . DC  E 3 1   ? 14.450  40.047  33.335  1.00 73.65  ? 1   DC  E "H5''" 1 
ATOM   7948 H  "H4'"  . DC  E 3 1   ? 14.605  39.860  31.127  1.00 57.64  ? 1   DC  E "H4'"  1 
ATOM   7949 H  "H3'"  . DC  E 3 1   ? 12.110  40.085  31.794  1.00 52.05  ? 1   DC  E "H3'"  1 
ATOM   7950 H  "H2'"  . DC  E 3 1   ? 11.574  37.876  31.683  1.00 70.61  ? 1   DC  E "H2'"  1 
ATOM   7951 H  "H2''" . DC  E 3 1   ? 11.169  38.322  30.223  1.00 70.61  ? 1   DC  E "H2''" 1 
ATOM   7952 H  "H1'"  . DC  E 3 1   ? 13.123  37.599  29.329  1.00 62.66  ? 1   DC  E "H1'"  1 
ATOM   7953 H  H41    . DC  E 3 1   ? 12.586  31.661  31.885  1.00 48.57  ? 1   DC  E H41    1 
ATOM   7954 H  H42    . DC  E 3 1   ? 12.677  31.450  30.413  1.00 48.57  ? 1   DC  E H42    1 
ATOM   7955 H  H5     . DC  E 3 1   ? 12.645  33.857  32.894  1.00 39.32  ? 1   DC  E H5     1 
ATOM   7956 H  H6     . DC  E 3 1   ? 12.821  36.090  32.501  1.00 34.58  ? 1   DC  E H6     1 
ATOM   7957 H  "HO5'" . DC  E 3 1   ? 13.050  38.309  34.389  1.00 73.08  ? 1   DC  E "HO5'" 1 
ATOM   7958 P  P      . DT  E 3 2   ? 11.261  41.093  29.348  1.00 46.41  ? 2   DT  E P      1 
ATOM   7959 O  OP1    . DT  E 3 2   ? 11.479  42.556  29.365  1.00 31.27  ? 2   DT  E OP1    1 
ATOM   7960 O  OP2    . DT  E 3 2   ? 10.090  40.502  30.036  1.00 36.40  ? 2   DT  E OP2    1 
ATOM   7961 O  "O5'"  . DT  E 3 2   ? 11.204  40.602  27.832  1.00 24.92  ? 2   DT  E "O5'"  1 
ATOM   7962 C  "C5'"  . DT  E 3 2   ? 11.363  39.222  27.543  1.00 23.98  ? 2   DT  E "C5'"  1 
ATOM   7963 C  "C4'"  . DT  E 3 2   ? 10.886  38.908  26.144  1.00 26.63  ? 2   DT  E "C4'"  1 
ATOM   7964 O  "O4'"  . DT  E 3 2   ? 10.853  37.474  25.957  1.00 27.53  ? 2   DT  E "O4'"  1 
ATOM   7965 C  "C3'"  . DT  E 3 2   ? 9.480   39.386  25.840  1.00 34.13  ? 2   DT  E "C3'"  1 
ATOM   7966 O  "O3'"  . DT  E 3 2   ? 9.337   39.680  24.471  1.00 22.88  ? 2   DT  E "O3'"  1 
ATOM   7967 C  "C2'"  . DT  E 3 2   ? 8.609   38.210  26.280  1.00 35.34  ? 2   DT  E "C2'"  1 
ATOM   7968 C  "C1'"  . DT  E 3 2   ? 9.521   36.996  26.062  1.00 38.66  ? 2   DT  E "C1'"  1 
ATOM   7969 N  N1     . DT  E 3 2   ? 9.471   35.966  27.165  1.00 31.58  ? 2   DT  E N1     1 
ATOM   7970 C  C2     . DT  E 3 2   ? 9.509   34.632  26.833  1.00 36.49  ? 2   DT  E C2     1 
ATOM   7971 O  O2     . DT  E 3 2   ? 9.569   34.231  25.684  1.00 36.99  ? 2   DT  E O2     1 
ATOM   7972 N  N3     . DT  E 3 2   ? 9.464   33.775  27.897  1.00 39.04  ? 2   DT  E N3     1 
ATOM   7973 C  C4     . DT  E 3 2   ? 9.396   34.107  29.236  1.00 32.70  ? 2   DT  E C4     1 
ATOM   7974 O  O4     . DT  E 3 2   ? 9.363   33.260  30.122  1.00 34.84  ? 2   DT  E O4     1 
ATOM   7975 C  C5     . DT  E 3 2   ? 9.366   35.518  29.519  1.00 16.92  ? 2   DT  E C5     1 
ATOM   7976 C  C7     . DT  E 3 2   ? 9.291   35.996  30.931  1.00 27.72  ? 2   DT  E C7     1 
ATOM   7977 C  C6     . DT  E 3 2   ? 9.410   36.372  28.485  1.00 30.22  ? 2   DT  E C6     1 
ATOM   7978 H  "H5'"  . DT  E 3 2   ? 10.849  38.701  28.180  1.00 29.00  ? 2   DT  E "H5'"  1 
ATOM   7979 H  "H5''" . DT  E 3 2   ? 12.300  38.984  27.623  1.00 29.00  ? 2   DT  E "H5''" 1 
ATOM   7980 H  "H4'"  . DT  E 3 2   ? 11.503  39.293  25.502  1.00 32.17  ? 2   DT  E "H4'"  1 
ATOM   7981 H  "H3'"  . DT  E 3 2   ? 9.271   40.169  26.372  1.00 41.17  ? 2   DT  E "H3'"  1 
ATOM   7982 H  "H2'"  . DT  E 3 2   ? 8.354   38.293  27.212  1.00 42.62  ? 2   DT  E "H2'"  1 
ATOM   7983 H  "H2''" . DT  E 3 2   ? 7.807   38.146  25.737  1.00 42.62  ? 2   DT  E "H2''" 1 
ATOM   7984 H  "H1'"  . DT  E 3 2   ? 9.268   36.578  25.224  1.00 46.61  ? 2   DT  E "H1'"  1 
ATOM   7985 H  H3     . DT  E 3 2   ? 9.481   32.935  27.712  1.00 47.06  ? 2   DT  E H3     1 
ATOM   7986 H  H71    . DT  E 3 2   ? 9.477   36.947  30.953  1.00 33.48  ? 2   DT  E H71    1 
ATOM   7987 H  H72    . DT  E 3 2   ? 8.401   35.824  31.276  1.00 33.48  ? 2   DT  E H72    1 
ATOM   7988 H  H73    . DT  E 3 2   ? 9.949   35.518  31.461  1.00 33.48  ? 2   DT  E H73    1 
ATOM   7989 H  H6     . DT  E 3 2   ? 9.399   37.284  28.666  1.00 36.47  ? 2   DT  E H6     1 
ATOM   7990 P  P      . DT  E 3 3   ? 7.965   40.314  23.939  1.00 38.30  ? 3   DT  E P      1 
ATOM   7991 O  OP1    . DT  E 3 3   ? 8.277   41.196  22.792  1.00 45.17  ? 3   DT  E OP1    1 
ATOM   7992 O  OP2    . DT  E 3 3   ? 7.254   40.860  25.118  1.00 33.03  ? 3   DT  E OP2    1 
ATOM   7993 O  "O5'"  . DT  E 3 3   ? 7.154   39.048  23.413  1.00 20.38  ? 3   DT  E "O5'"  1 
ATOM   7994 C  "C5'"  . DT  E 3 3   ? 7.725   38.211  22.431  1.00 18.86  ? 3   DT  E "C5'"  1 
ATOM   7995 C  "C4'"  . DT  E 3 3   ? 6.923   36.933  22.286  1.00 26.96  ? 3   DT  E "C4'"  1 
ATOM   7996 O  "O4'"  . DT  E 3 3   ? 7.144   36.101  23.437  1.00 32.20  ? 3   DT  E "O4'"  1 
ATOM   7997 C  "C3'"  . DT  E 3 3   ? 5.416   37.153  22.196  1.00 32.37  ? 3   DT  E "C3'"  1 
ATOM   7998 O  "O3'"  . DT  E 3 3   ? 4.971   36.952  20.854  1.00 38.54  ? 3   DT  E "O3'"  1 
ATOM   7999 C  "C2'"  . DT  E 3 3   ? 4.803   36.140  23.183  1.00 33.35  ? 3   DT  E "C2'"  1 
ATOM   8000 C  "C1'"  . DT  E 3 3   ? 5.995   35.328  23.687  1.00 33.84  ? 3   DT  E "C1'"  1 
ATOM   8001 N  N1     . DT  E 3 3   ? 5.972   35.023  25.158  1.00 24.65  ? 3   DT  E N1     1 
ATOM   8002 C  C2     . DT  E 3 3   ? 6.057   33.716  25.580  1.00 31.39  ? 3   DT  E C2     1 
ATOM   8003 O  O2     . DT  E 3 3   ? 6.126   32.770  24.818  1.00 44.43  ? 3   DT  E O2     1 
ATOM   8004 N  N3     . DT  E 3 3   ? 6.047   33.552  26.938  1.00 25.79  ? 3   DT  E N3     1 
ATOM   8005 C  C4     . DT  E 3 3   ? 5.974   34.541  27.898  1.00 28.90  ? 3   DT  E C4     1 
ATOM   8006 O  O4     . DT  E 3 3   ? 5.972   34.292  29.100  1.00 36.94  ? 3   DT  E O4     1 
ATOM   8007 C  C5     . DT  E 3 3   ? 5.900   35.888  27.391  1.00 24.72  ? 3   DT  E C5     1 
ATOM   8008 C  C7     . DT  E 3 3   ? 5.812   37.042  28.340  1.00 25.59  ? 3   DT  E C7     1 
ATOM   8009 C  C6     . DT  E 3 3   ? 5.910   36.064  26.061  1.00 21.80  ? 3   DT  E C6     1 
ATOM   8010 H  "H5'"  . DT  E 3 3   ? 8.634   37.991  22.687  1.00 22.85  ? 3   DT  E "H5'"  1 
ATOM   8011 H  "H5''" . DT  E 3 3   ? 7.740   38.678  21.582  1.00 22.85  ? 3   DT  E "H5''" 1 
ATOM   8012 H  "H4'"  . DT  E 3 3   ? 7.217   36.444  21.501  1.00 32.56  ? 3   DT  E "H4'"  1 
ATOM   8013 H  "H3'"  . DT  E 3 3   ? 5.201   38.048  22.503  1.00 39.06  ? 3   DT  E "H3'"  1 
ATOM   8014 H  "H2'"  . DT  E 3 3   ? 4.362   36.596  23.916  1.00 40.24  ? 3   DT  E "H2'"  1 
ATOM   8015 H  "H2''" . DT  E 3 3   ? 4.161   35.567  22.735  1.00 40.24  ? 3   DT  E "H2''" 1 
ATOM   8016 H  "H1'"  . DT  E 3 3   ? 6.029   34.498  23.185  1.00 40.82  ? 3   DT  E "H1'"  1 
ATOM   8017 H  H3     . DT  E 3 3   ? 6.092   32.743  27.226  1.00 31.17  ? 3   DT  E H3     1 
ATOM   8018 H  H71    . DT  E 3 3   ? 6.690   37.446  28.429  1.00 30.92  ? 3   DT  E H71    1 
ATOM   8019 H  H72    . DT  E 3 3   ? 5.183   37.692  27.990  1.00 30.92  ? 3   DT  E H72    1 
ATOM   8020 H  H73    . DT  E 3 3   ? 5.508   36.719  29.203  1.00 30.92  ? 3   DT  E H73    1 
ATOM   8021 H  H6     . DT  E 3 3   ? 5.872   36.933  25.731  1.00 26.38  ? 3   DT  E H6     1 
ATOM   8022 P  P      . DG  E 3 4   ? 3.459   37.290  20.431  1.00 37.33  ? 4   DG  E P      1 
ATOM   8023 O  OP1    . DG  E 3 4   ? 3.462   37.720  19.016  1.00 34.98  ? 4   DG  E OP1    1 
ATOM   8024 O  OP2    . DG  E 3 4   ? 2.870   38.177  21.460  1.00 51.92  ? 4   DG  E OP2    1 
ATOM   8025 O  "O5'"  . DG  E 3 4   ? 2.734   35.877  20.517  1.00 46.48  ? 4   DG  E "O5'"  1 
ATOM   8026 C  "C5'"  . DG  E 3 4   ? 3.348   34.746  19.937  1.00 41.75  ? 4   DG  E "C5'"  1 
ATOM   8027 C  "C4'"  . DG  E 3 4   ? 2.809   33.477  20.559  1.00 39.95  ? 4   DG  E "C4'"  1 
ATOM   8028 O  "O4'"  . DG  E 3 4   ? 3.136   33.460  21.975  1.00 48.58  ? 4   DG  E "O4'"  1 
ATOM   8029 C  "C3'"  . DG  E 3 4   ? 1.289   33.320  20.465  1.00 27.18  ? 4   DG  E "C3'"  1 
ATOM   8030 O  "O3'"  . DG  E 3 4   ? 0.957   32.059  19.894  1.00 60.64  ? 4   DG  E "O3'"  1 
ATOM   8031 C  "C2'"  . DG  E 3 4   ? 0.807   33.455  21.909  1.00 39.95  ? 4   DG  E "C2'"  1 
ATOM   8032 C  "C1'"  . DG  E 3 4   ? 2.023   33.010  22.710  1.00 46.51  ? 4   DG  E "C1'"  1 
ATOM   8033 N  N9     . DG  E 3 4   ? 2.068   33.565  24.056  1.00 30.07  ? 4   DG  E N9     1 
ATOM   8034 C  C8     . DG  E 3 4   ? 1.982   34.888  24.410  1.00 32.44  ? 4   DG  E C8     1 
ATOM   8035 N  N7     . DG  E 3 4   ? 2.058   35.089  25.696  1.00 24.91  ? 4   DG  E N7     1 
ATOM   8036 C  C5     . DG  E 3 4   ? 2.217   33.816  26.231  1.00 23.31  ? 4   DG  E C5     1 
ATOM   8037 C  C6     . DG  E 3 4   ? 2.360   33.405  27.577  1.00 29.50  ? 4   DG  E C6     1 
ATOM   8038 O  O6     . DG  E 3 4   ? 2.375   34.110  28.596  1.00 24.95  ? 4   DG  E O6     1 
ATOM   8039 N  N1     . DG  E 3 4   ? 2.496   32.024  27.684  1.00 26.09  ? 4   DG  E N1     1 
ATOM   8040 C  C2     . DG  E 3 4   ? 2.495   31.151  26.624  1.00 22.08  ? 4   DG  E C2     1 
ATOM   8041 N  N2     . DG  E 3 4   ? 2.639   29.852  26.920  1.00 39.17  ? 4   DG  E N2     1 
ATOM   8042 N  N3     . DG  E 3 4   ? 2.360   31.523  25.355  1.00 14.04  ? 4   DG  E N3     1 
ATOM   8043 C  C4     . DG  E 3 4   ? 2.226   32.866  25.235  1.00 16.94  ? 4   DG  E C4     1 
ATOM   8044 H  "H5'"  . DG  E 3 4   ? 4.306   34.792  20.080  1.00 50.31  ? 4   DG  E "H5'"  1 
ATOM   8045 H  "H5''" . DG  E 3 4   ? 3.171   34.737  18.984  1.00 50.31  ? 4   DG  E "H5''" 1 
ATOM   8046 H  "H4'"  . DG  E 3 4   ? 3.224   32.706  20.141  1.00 48.16  ? 4   DG  E "H4'"  1 
ATOM   8047 H  "H3'"  . DG  E 3 4   ? 0.916   34.044  19.938  1.00 32.83  ? 4   DG  E "H3'"  1 
ATOM   8048 H  "H2'"  . DG  E 3 4   ? 0.565   34.372  22.115  1.00 48.15  ? 4   DG  E "H2'"  1 
ATOM   8049 H  "H2''" . DG  E 3 4   ? 0.043   32.882  22.080  1.00 48.15  ? 4   DG  E "H2''" 1 
ATOM   8050 H  "H1'"  . DG  E 3 4   ? 2.051   32.043  22.778  1.00 56.02  ? 4   DG  E "H1'"  1 
ATOM   8051 H  H8     . DG  E 3 4   ? 1.879   35.576  23.792  1.00 39.14  ? 4   DG  E H8     1 
ATOM   8052 H  H1     . DG  E 3 4   ? 2.588   31.693  28.473  1.00 31.52  ? 4   DG  E H1     1 
ATOM   8053 H  H21    . DG  E 3 4   ? 2.644   29.265  26.291  1.00 47.22  ? 4   DG  E H21    1 
ATOM   8054 H  H22    . DG  E 3 4   ? 2.727   29.605  27.739  1.00 47.22  ? 4   DG  E H22    1 
ATOM   8055 P  P      . DC  E 3 5   ? -0.554  31.731  19.463  1.00 60.22  ? 5   DC  E P      1 
ATOM   8056 O  OP1    . DC  E 3 5   ? -0.537  30.419  18.777  1.00 56.89  ? 5   DC  E OP1    1 
ATOM   8057 O  OP2    . DC  E 3 5   ? -1.111  32.921  18.784  1.00 42.48  ? 5   DC  E OP2    1 
ATOM   8058 O  "O5'"  . DC  E 3 5   ? -1.322  31.611  20.858  1.00 41.32  ? 5   DC  E "O5'"  1 
ATOM   8059 C  "C5'"  . DC  E 3 5   ? -2.135  30.490  21.131  1.00 59.14  ? 5   DC  E "C5'"  1 
ATOM   8060 C  "C4'"  . DC  E 3 5   ? -1.603  29.730  22.329  1.00 48.24  ? 5   DC  E "C4'"  1 
ATOM   8061 O  "O4'"  . DC  E 3 5   ? -0.785  30.602  23.135  1.00 34.20  ? 5   DC  E "O4'"  1 
ATOM   8062 C  "C3'"  . DC  E 3 5   ? -2.662  29.215  23.282  1.00 52.47  ? 5   DC  E "C3'"  1 
ATOM   8063 O  "O3'"  . DC  E 3 5   ? -3.132  27.950  22.862  1.00 49.13  ? 5   DC  E "O3'"  1 
ATOM   8064 C  "C2'"  . DC  E 3 5   ? -1.939  29.150  24.628  1.00 39.15  ? 5   DC  E "C2'"  1 
ATOM   8065 C  "C1'"  . DC  E 3 5   ? -0.796  30.157  24.482  1.00 30.27  ? 5   DC  E "C1'"  1 
ATOM   8066 N  N1     . DC  E 3 5   ? -0.900  31.356  25.383  1.00 29.26  ? 5   DC  E N1     1 
ATOM   8067 C  C2     . DC  E 3 5   ? -0.833  31.194  26.776  1.00 25.48  ? 5   DC  E C2     1 
ATOM   8068 O  O2     . DC  E 3 5   ? -0.704  30.058  27.248  1.00 25.74  ? 5   DC  E O2     1 
ATOM   8069 N  N3     . DC  E 3 5   ? -0.905  32.295  27.567  1.00 19.02  ? 5   DC  E N3     1 
ATOM   8070 C  C4     . DC  E 3 5   ? -1.039  33.504  27.020  1.00 27.24  ? 5   DC  E C4     1 
ATOM   8071 N  N4     . DC  E 3 5   ? -1.106  34.561  27.838  1.00 31.85  ? 5   DC  E N4     1 
ATOM   8072 C  C5     . DC  E 3 5   ? -1.109  33.687  25.609  1.00 25.13  ? 5   DC  E C5     1 
ATOM   8073 C  C6     . DC  E 3 5   ? -1.034  32.599  24.837  1.00 31.90  ? 5   DC  E C6     1 
ATOM   8074 H  "H5'"  . DC  E 3 5   ? -2.145  29.904  20.358  1.00 71.18  ? 5   DC  E "H5'"  1 
ATOM   8075 H  "H5''" . DC  E 3 5   ? -3.040  30.786  21.315  1.00 71.18  ? 5   DC  E "H5''" 1 
ATOM   8076 H  "H4'"  . DC  E 3 5   ? -1.065  28.989  22.009  1.00 58.10  ? 5   DC  E "H4'"  1 
ATOM   8077 H  "H3'"  . DC  E 3 5   ? -3.395  29.848  23.336  1.00 63.18  ? 5   DC  E "H3'"  1 
ATOM   8078 H  "H2'"  . DC  E 3 5   ? -2.532  29.402  25.353  1.00 47.19  ? 5   DC  E "H2'"  1 
ATOM   8079 H  "H2''" . DC  E 3 5   ? -1.596  28.258  24.796  1.00 47.19  ? 5   DC  E "H2''" 1 
ATOM   8080 H  "H1'"  . DC  E 3 5   ? 0.037   29.695  24.665  1.00 36.53  ? 5   DC  E "H1'"  1 
ATOM   8081 H  H41    . DC  E 3 5   ? -1.193  35.352  27.512  1.00 38.43  ? 5   DC  E H41    1 
ATOM   8082 H  H42    . DC  E 3 5   ? -1.062  34.450  28.690  1.00 38.43  ? 5   DC  E H42    1 
ATOM   8083 H  H5     . DC  E 3 5   ? -1.202  34.535  25.237  1.00 30.37  ? 5   DC  E H5     1 
ATOM   8084 H  H6     . DC  E 3 5   ? -1.074  32.690  23.912  1.00 38.50  ? 5   DC  E H6     1 
ATOM   8085 P  P      . DT  E 3 6   ? -4.649  27.523  23.158  1.00 53.45  ? 6   DT  E P      1 
ATOM   8086 O  OP1    . DT  E 3 6   ? -4.948  26.381  22.266  1.00 52.29  ? 6   DT  E OP1    1 
ATOM   8087 O  OP2    . DT  E 3 6   ? -5.485  28.746  23.134  1.00 33.26  ? 6   DT  E OP2    1 
ATOM   8088 O  "O5'"  . DT  E 3 6   ? -4.610  27.007  24.667  1.00 32.76  ? 6   DT  E "O5'"  1 
ATOM   8089 C  "C5'"  . DT  E 3 6   ? -3.659  26.032  25.045  1.00 34.72  ? 6   DT  E "C5'"  1 
ATOM   8090 C  "C4'"  . DT  E 3 6   ? -3.741  25.753  26.534  1.00 44.68  ? 6   DT  E "C4'"  1 
ATOM   8091 O  "O4'"  . DT  E 3 6   ? -3.278  26.914  27.268  1.00 36.80  ? 6   DT  E "O4'"  1 
ATOM   8092 C  "C3'"  . DT  E 3 6   ? -5.147  25.451  27.039  1.00 56.94  ? 6   DT  E "C3'"  1 
ATOM   8093 O  "O3'"  . DT  E 3 6   ? -5.143  24.283  27.838  1.00 55.21  ? 6   DT  E "O3'"  1 
ATOM   8094 C  "C2'"  . DT  E 3 6   ? -5.551  26.694  27.830  1.00 42.81  ? 6   DT  E "C2'"  1 
ATOM   8095 C  "C1'"  . DT  E 3 6   ? -4.215  27.282  28.260  1.00 30.42  ? 6   DT  E "C1'"  1 
ATOM   8096 N  N1     . DT  E 3 6   ? -4.224  28.771  28.363  1.00 31.46  ? 6   DT  E N1     1 
ATOM   8097 C  C2     . DT  E 3 6   ? -4.142  29.372  29.602  1.00 33.39  ? 6   DT  E C2     1 
ATOM   8098 O  O2     . DT  E 3 6   ? -4.047  28.747  30.646  1.00 30.43  ? 6   DT  E O2     1 
ATOM   8099 N  N3     . DT  E 3 6   ? -4.156  30.744  29.572  1.00 24.61  ? 6   DT  E N3     1 
ATOM   8100 C  C4     . DT  E 3 6   ? -4.254  31.554  28.455  1.00 24.19  ? 6   DT  E C4     1 
ATOM   8101 O  O4     . DT  E 3 6   ? -4.262  32.778  28.528  1.00 24.50  ? 6   DT  E O4     1 
ATOM   8102 C  C5     . DT  E 3 6   ? -4.346  30.861  27.195  1.00 24.72  ? 6   DT  E C5     1 
ATOM   8103 C  C7     . DT  E 3 6   ? -4.455  31.637  25.921  1.00 31.54  ? 6   DT  E C7     1 
ATOM   8104 C  C6     . DT  E 3 6   ? -4.332  29.520  27.209  1.00 27.91  ? 6   DT  E C6     1 
ATOM   8105 H  "H5'"  . DT  E 3 6   ? -2.769  26.351  24.828  1.00 41.88  ? 6   DT  E "H5'"  1 
ATOM   8106 H  "H5''" . DT  E 3 6   ? -3.828  25.212  24.556  1.00 41.88  ? 6   DT  E "H5''" 1 
ATOM   8107 H  "H4'"  . DT  E 3 6   ? -3.164  25.008  26.761  1.00 53.83  ? 6   DT  E "H4'"  1 
ATOM   8108 H  "H3'"  . DT  E 3 6   ? -5.746  25.351  26.282  1.00 68.55  ? 6   DT  E "H3'"  1 
ATOM   8109 H  "H2'"  . DT  E 3 6   ? -6.044  27.317  27.275  1.00 51.59  ? 6   DT  E "H2'"  1 
ATOM   8110 H  "H2''" . DT  E 3 6   ? -6.093  26.459  28.599  1.00 51.59  ? 6   DT  E "H2''" 1 
ATOM   8111 H  "H1'"  . DT  E 3 6   ? -3.955  26.898  29.112  1.00 36.72  ? 6   DT  E "H1'"  1 
ATOM   8112 H  H3     . DT  E 3 6   ? -4.096  31.144  30.331  1.00 29.75  ? 6   DT  E H3     1 
ATOM   8113 H  H71    . DT  E 3 6   ? -3.665  31.474  25.383  1.00 38.07  ? 6   DT  E H71    1 
ATOM   8114 H  H72    . DT  E 3 6   ? -5.247  31.347  25.442  1.00 38.07  ? 6   DT  E H72    1 
ATOM   8115 H  H73    . DT  E 3 6   ? -4.524  32.582  26.131  1.00 38.07  ? 6   DT  E H73    1 
ATOM   8116 H  H6     . DT  E 3 6   ? -4.399  29.070  26.397  1.00 33.71  ? 6   DT  E H6     1 
ATOM   8117 P  P      . DC  E 3 7   ? -6.529  23.577  28.219  1.00 51.77  ? 7   DC  E P      1 
ATOM   8118 O  OP1    . DC  E 3 7   ? -6.231  22.154  28.494  1.00 55.61  ? 7   DC  E OP1    1 
ATOM   8119 O  OP2    . DC  E 3 7   ? -7.534  23.959  27.198  1.00 29.35  ? 7   DC  E OP2    1 
ATOM   8120 O  "O5'"  . DC  E 3 7   ? -6.926  24.267  29.597  1.00 32.73  ? 7   DC  E "O5'"  1 
ATOM   8121 C  "C5'"  . DC  E 3 7   ? -6.039  24.173  30.694  1.00 38.09  ? 7   DC  E "C5'"  1 
ATOM   8122 C  "C4'"  . DC  E 3 7   ? -6.581  24.935  31.884  1.00 42.54  ? 7   DC  E "C4'"  1 
ATOM   8123 O  "O4'"  . DC  E 3 7   ? -6.297  26.345  31.722  1.00 50.91  ? 7   DC  E "O4'"  1 
ATOM   8124 C  "C3'"  . DC  E 3 7   ? -8.094  24.811  32.073  1.00 40.40  ? 7   DC  E "C3'"  1 
ATOM   8125 O  "O3'"  . DC  E 3 7   ? -8.394  24.394  33.394  1.00 49.34  ? 7   DC  E "O3'"  1 
ATOM   8126 C  "C2'"  . DC  E 3 7   ? -8.620  26.218  31.770  1.00 47.57  ? 7   DC  E "C2'"  1 
ATOM   8127 C  "C1'"  . DC  E 3 7   ? -7.422  27.097  32.108  1.00 39.53  ? 7   DC  E "C1'"  1 
ATOM   8128 N  N1     . DC  E 3 7   ? -7.395  28.406  31.389  1.00 22.73  ? 7   DC  E N1     1 
ATOM   8129 C  C2     . DC  E 3 7   ? -7.295  29.592  32.125  1.00 26.35  ? 7   DC  E C2     1 
ATOM   8130 O  O2     . DC  E 3 7   ? -7.208  29.525  33.358  1.00 29.68  ? 7   DC  E O2     1 
ATOM   8131 N  N3     . DC  E 3 7   ? -7.275  30.776  31.463  1.00 18.99  ? 7   DC  E N3     1 
ATOM   8132 C  C4     . DC  E 3 7   ? -7.366  30.796  30.130  1.00 25.19  ? 7   DC  E C4     1 
ATOM   8133 N  N4     . DC  E 3 7   ? -7.351  31.984  29.514  1.00 29.44  ? 7   DC  E N4     1 
ATOM   8134 C  C5     . DC  E 3 7   ? -7.479  29.597  29.368  1.00 24.23  ? 7   DC  E C5     1 
ATOM   8135 C  C6     . DC  E 3 7   ? -7.491  28.438  30.032  1.00 23.24  ? 7   DC  E C6     1 
ATOM   8136 H  "H5'"  . DC  E 3 7   ? -5.178  24.543  30.442  1.00 45.93  ? 7   DC  E "H5'"  1 
ATOM   8137 H  "H5''" . DC  E 3 7   ? -5.924  23.241  30.935  1.00 45.93  ? 7   DC  E "H5''" 1 
ATOM   8138 H  "H4'"  . DC  E 3 7   ? -6.143  24.634  32.696  1.00 51.27  ? 7   DC  E "H4'"  1 
ATOM   8139 H  "H3'"  . DC  E 3 7   ? -8.458  24.186  31.426  1.00 48.69  ? 7   DC  E "H3'"  1 
ATOM   8140 H  "H2'"  . DC  E 3 7   ? -8.872  26.308  30.837  1.00 57.30  ? 7   DC  E "H2'"  1 
ATOM   8141 H  "H2''" . DC  E 3 7   ? -9.385  26.436  32.325  1.00 57.30  ? 7   DC  E "H2''" 1 
ATOM   8142 H  "H1'"  . DC  E 3 7   ? -7.400  27.273  33.061  1.00 47.65  ? 7   DC  E "H1'"  1 
ATOM   8143 H  H41    . DC  E 3 7   ? -7.408  32.026  28.657  1.00 35.54  ? 7   DC  E H41    1 
ATOM   8144 H  H42    . DC  E 3 7   ? -7.285  32.707  29.976  1.00 35.54  ? 7   DC  E H42    1 
ATOM   8145 H  H5     . DC  E 3 7   ? -7.541  29.621  28.440  1.00 29.30  ? 7   DC  E H5     1 
ATOM   8146 H  H6     . DC  E 3 7   ? -7.566  27.641  29.559  1.00 28.10  ? 7   DC  E H6     1 
ATOM   8147 P  P      . DA  E 3 8   ? -9.903  24.038  33.802  1.00 37.06  ? 8   DA  E P      1 
ATOM   8148 O  OP1    . DA  E 3 8   ? -9.852  22.776  34.574  1.00 53.05  ? 8   DA  E OP1    1 
ATOM   8149 O  OP2    . DA  E 3 8   ? -10.745 24.142  32.587  1.00 31.09  ? 8   DA  E OP2    1 
ATOM   8150 O  "O5'"  . DA  E 3 8   ? -10.309 25.219  34.790  1.00 43.99  ? 8   DA  E "O5'"  1 
ATOM   8151 C  "C5'"  . DA  E 3 8   ? -9.457  25.553  35.871  1.00 44.71  ? 8   DA  E "C5'"  1 
ATOM   8152 C  "C4'"  . DA  E 3 8   ? -9.918  26.839  36.535  1.00 43.97  ? 8   DA  E "C4'"  1 
ATOM   8153 O  "O4'"  . DA  E 3 8   ? -9.626  27.968  35.666  1.00 30.68  ? 8   DA  E "O4'"  1 
ATOM   8154 C  "C3'"  . DA  E 3 8   ? -11.420 26.887  36.820  1.00 39.88  ? 8   DA  E "C3'"  1 
ATOM   8155 O  "O3'"  . DA  E 3 8   ? -11.663 27.301  38.158  1.00 37.73  ? 8   DA  E "O3'"  1 
ATOM   8156 C  "C2'"  . DA  E 3 8   ? -11.966 27.874  35.787  1.00 42.53  ? 8   DA  E "C2'"  1 
ATOM   8157 C  "C1'"  . DA  E 3 8   ? -10.772 28.779  35.517  1.00 33.56  ? 8   DA  E "C1'"  1 
ATOM   8158 N  N9     . DA  E 3 8   ? -10.773 29.374  34.181  1.00 23.20  ? 8   DA  E N9     1 
ATOM   8159 C  C8     . DA  E 3 8   ? -10.876 28.728  32.980  1.00 32.13  ? 8   DA  E C8     1 
ATOM   8160 N  N7     . DA  E 3 8   ? -10.842 29.533  31.940  1.00 22.64  ? 8   DA  E N7     1 
ATOM   8161 C  C5     . DA  E 3 8   ? -10.693 30.791  32.502  1.00 16.43  ? 8   DA  E C5     1 
ATOM   8162 C  C6     . DA  E 3 8   ? -10.582 32.079  31.937  1.00 20.39  ? 8   DA  E C6     1 
ATOM   8163 N  N6     . DA  E 3 8   ? -10.605 32.316  30.621  1.00 28.16  ? 8   DA  E N6     1 
ATOM   8164 N  N1     . DA  E 3 8   ? -10.441 33.119  32.782  1.00 19.89  ? 8   DA  E N1     1 
ATOM   8165 C  C2     . DA  E 3 8   ? -10.413 32.881  34.097  1.00 28.81  ? 8   DA  E C2     1 
ATOM   8166 N  N3     . DA  E 3 8   ? -10.507 31.721  34.742  1.00 23.14  ? 8   DA  E N3     1 
ATOM   8167 C  C4     . DA  E 3 8   ? -10.646 30.708  33.880  1.00 12.99  ? 8   DA  E C4     1 
ATOM   8168 H  "H5'"  . DA  E 3 8   ? -8.552  25.668  35.543  1.00 53.87  ? 8   DA  E "H5'"  1 
ATOM   8169 H  "H5''" . DA  E 3 8   ? -9.468  24.834  36.522  1.00 53.87  ? 8   DA  E "H5''" 1 
ATOM   8170 H  "H4'"  . DA  E 3 8   ? -9.435  26.973  37.365  1.00 52.98  ? 8   DA  E "H4'"  1 
ATOM   8171 H  "H3'"  . DA  E 3 8   ? -11.811 26.014  36.661  1.00 48.07  ? 8   DA  E "H3'"  1 
ATOM   8172 H  "H2'"  . DA  E 3 8   ? -12.250 27.416  34.980  1.00 51.25  ? 8   DA  E "H2'"  1 
ATOM   8173 H  "H2''" . DA  E 3 8   ? -12.715 28.377  36.143  1.00 51.25  ? 8   DA  E "H2''" 1 
ATOM   8174 H  "H1'"  . DA  E 3 8   ? -10.745 29.492  36.173  1.00 40.49  ? 8   DA  E "H1'"  1 
ATOM   8175 H  H8     . DA  E 3 8   ? -10.963 27.805  32.906  1.00 38.77  ? 8   DA  E H8     1 
ATOM   8176 H  H61    . DA  E 3 8   ? -10.530 33.121  30.328  1.00 34.01  ? 8   DA  E H61    1 
ATOM   8177 H  H62    . DA  E 3 8   ? -10.694 31.663  30.069  1.00 34.01  ? 8   DA  E H62    1 
ATOM   8178 H  H2     . DA  E 3 8   ? -10.314 33.631  34.637  1.00 34.78  ? 8   DA  E H2     1 
ATOM   8179 P  P      . DT  E 3 9   ? -13.159 27.302  38.742  1.00 60.25  ? 9   DT  E P      1 
ATOM   8180 O  OP1    . DT  E 3 9   ? -13.102 26.872  40.158  1.00 40.20  ? 9   DT  E OP1    1 
ATOM   8181 O  OP2    . DT  E 3 9   ? -14.015 26.562  37.784  1.00 29.20  ? 9   DT  E OP2    1 
ATOM   8182 O  "O5'"  . DT  E 3 9   ? -13.560 28.848  38.699  1.00 38.78  ? 9   DT  E "O5'"  1 
ATOM   8183 C  "C5'"  . DT  E 3 9   ? -12.730 29.793  39.359  1.00 29.84  ? 9   DT  E "C5'"  1 
ATOM   8184 C  "C4'"  . DT  E 3 9   ? -13.189 31.215  39.090  1.00 29.00  ? 9   DT  E "C4'"  1 
ATOM   8185 O  "O4'"  . DT  E 3 9   ? -12.910 31.580  37.713  1.00 27.78  ? 9   DT  E "O4'"  1 
ATOM   8186 C  "C3'"  . DT  E 3 9   ? -14.685 31.451  39.299  1.00 32.95  ? 9   DT  E "C3'"  1 
ATOM   8187 O  "O3'"  . DT  E 3 9   ? -14.892 32.573  40.126  1.00 25.89  ? 9   DT  E "O3'"  1 
ATOM   8188 C  "C2'"  . DT  E 3 9   ? -15.236 31.683  37.894  1.00 31.08  ? 9   DT  E "C2'"  1 
ATOM   8189 C  "C1'"  . DT  E 3 9   ? -14.028 32.251  37.169  1.00 19.62  ? 9   DT  E "C1'"  1 
ATOM   8190 N  N1     . DT  E 3 9   ? -14.043 32.069  35.698  1.00 17.94  ? 9   DT  E N1     1 
ATOM   8191 C  C2     . DT  E 3 9   ? -13.900 33.174  34.893  1.00 17.99  ? 9   DT  E C2     1 
ATOM   8192 O  O2     . DT  E 3 9   ? -13.760 34.304  35.324  1.00 24.87  ? 9   DT  E O2     1 
ATOM   8193 N  N3     . DT  E 3 9   ? -13.924 32.912  33.553  1.00 18.94  ? 9   DT  E N3     1 
ATOM   8194 C  C4     . DT  E 3 9   ? -14.073 31.684  32.946  1.00 20.25  ? 9   DT  E C4     1 
ATOM   8195 O  O4     . DT  E 3 9   ? -14.079 31.556  31.727  1.00 26.34  ? 9   DT  E O4     1 
ATOM   8196 C  C5     . DT  E 3 9   ? -14.219 30.566  33.846  1.00 16.90  ? 9   DT  E C5     1 
ATOM   8197 C  C7     . DT  E 3 9   ? -14.388 29.185  33.305  1.00 21.19  ? 9   DT  E C7     1 
ATOM   8198 C  C6     . DT  E 3 9   ? -14.197 30.809  35.165  1.00 23.22  ? 9   DT  E C6     1 
ATOM   8199 H  "H5'"  . DT  E 3 9   ? -11.818 29.689  39.045  1.00 36.02  ? 9   DT  E "H5'"  1 
ATOM   8200 H  "H5''" . DT  E 3 9   ? -12.756 29.627  40.314  1.00 36.02  ? 9   DT  E "H5''" 1 
ATOM   8201 H  "H4'"  . DT  E 3 9   ? -12.691 31.820  39.661  1.00 35.02  ? 9   DT  E "H4'"  1 
ATOM   8202 H  "H3'"  . DT  E 3 9   ? -15.084 30.653  39.679  1.00 39.76  ? 9   DT  E "H3'"  1 
ATOM   8203 H  "H2'"  . DT  E 3 9   ? -15.534 30.854  37.489  1.00 37.51  ? 9   DT  E "H2'"  1 
ATOM   8204 H  "H2''" . DT  E 3 9   ? -15.973 32.313  37.902  1.00 37.51  ? 9   DT  E "H2''" 1 
ATOM   8205 H  "H1'"  . DT  E 3 9   ? -13.960 33.202  37.349  1.00 23.76  ? 9   DT  E "H1'"  1 
ATOM   8206 H  H3     . DT  E 3 9   ? -13.835 33.589  33.030  1.00 22.94  ? 9   DT  E H3     1 
ATOM   8207 H  H71    . DT  E 3 9   ? -13.661 28.628  33.627  1.00 25.64  ? 9   DT  E H71    1 
ATOM   8208 H  H72    . DT  E 3 9   ? -15.237 28.828  33.608  1.00 25.64  ? 9   DT  E H72    1 
ATOM   8209 H  H73    . DT  E 3 9   ? -14.371 29.221  32.336  1.00 25.64  ? 9   DT  E H73    1 
ATOM   8210 H  H6     . DT  E 3 9   ? -14.290 30.091  35.749  1.00 28.08  ? 9   DT  E H6     1 
ATOM   8211 P  P      . DT  E 3 10  ? -16.351 32.887  40.717  1.00 26.91  ? 10  DT  E P      1 
ATOM   8212 O  OP1    . DT  E 3 10  ? -16.153 33.334  42.115  1.00 20.73  ? 10  DT  E OP1    1 
ATOM   8213 O  OP2    . DT  E 3 10  ? -17.293 31.797  40.375  1.00 18.23  ? 10  DT  E OP2    1 
ATOM   8214 O  "O5'"  . DT  E 3 10  ? -16.823 34.148  39.875  1.00 17.97  ? 10  DT  E "O5'"  1 
ATOM   8215 C  "C5'"  . DT  E 3 10  ? -16.036 35.311  39.867  1.00 19.07  ? 10  DT  E "C5'"  1 
ATOM   8216 C  "C4'"  . DT  E 3 10  ? -16.611 36.316  38.898  1.00 14.83  ? 10  DT  E "C4'"  1 
ATOM   8217 O  "O4'"  . DT  E 3 10  ? -16.388 35.858  37.549  1.00 14.60  ? 10  DT  E "O4'"  1 
ATOM   8218 C  "C3'"  . DT  E 3 10  ? -18.119 36.524  39.045  1.00 18.51  ? 10  DT  E "C3'"  1 
ATOM   8219 O  "O3'"  . DT  E 3 10  ? -18.394 37.889  39.321  1.00 11.07  ? 10  DT  E "O3'"  1 
ATOM   8220 C  "C2'"  . DT  E 3 10  ? -18.713 36.061  37.707  1.00 19.78  ? 10  DT  E "C2'"  1 
ATOM   8221 C  "C1'"  . DT  E 3 10  ? -17.527 36.125  36.763  1.00 14.14  ? 10  DT  E "C1'"  1 
ATOM   8222 N  N1     . DT  E 3 10  ? -17.544 35.140  35.638  1.00 15.83  ? 10  DT  E N1     1 
ATOM   8223 C  C2     . DT  E 3 10  ? -17.349 35.594  34.355  1.00 19.46  ? 10  DT  E C2     1 
ATOM   8224 O  O2     . DT  E 3 10  ? -17.204 36.770  34.079  1.00 20.34  ? 10  DT  E O2     1 
ATOM   8225 N  N3     . DT  E 3 10  ? -17.357 34.618  33.393  1.00 18.54  ? 10  DT  E N3     1 
ATOM   8226 C  C4     . DT  E 3 10  ? -17.516 33.262  33.585  1.00 19.61  ? 10  DT  E C4     1 
ATOM   8227 O  O4     . DT  E 3 10  ? -17.506 32.464  32.654  1.00 25.00  ? 10  DT  E O4     1 
ATOM   8228 C  C5     . DT  E 3 10  ? -17.696 32.849  34.956  1.00 13.83  ? 10  DT  E C5     1 
ATOM   8229 C  C7     . DT  E 3 10  ? -17.877 31.404  35.286  1.00 23.38  ? 10  DT  E C7     1 
ATOM   8230 C  C6     . DT  E 3 10  ? -17.691 33.796  35.908  1.00 16.61  ? 10  DT  E C6     1 
ATOM   8231 H  "H5'"  . DT  E 3 10  ? -15.130 35.087  39.600  1.00 23.09  ? 10  DT  E "H5'"  1 
ATOM   8232 H  "H5''" . DT  E 3 10  ? -16.017 35.694  40.757  1.00 23.09  ? 10  DT  E "H5''" 1 
ATOM   8233 H  "H4'"  . DT  E 3 10  ? -16.165 37.171  39.000  1.00 18.01  ? 10  DT  E "H4'"  1 
ATOM   8234 H  "H3'"  . DT  E 3 10  ? -18.462 35.951  39.749  1.00 22.43  ? 10  DT  E "H3'"  1 
ATOM   8235 H  "H2'"  . DT  E 3 10  ? -19.060 35.157  37.773  1.00 23.96  ? 10  DT  E "H2'"  1 
ATOM   8236 H  "H2''" . DT  E 3 10  ? -19.425 36.652  37.416  1.00 23.96  ? 10  DT  E "H2''" 1 
ATOM   8237 H  "H1'"  . DT  E 3 10  ? -17.488 37.019  36.388  1.00 17.19  ? 10  DT  E "H1'"  1 
ATOM   8238 H  H3     . DT  E 3 10  ? -17.251 34.881  32.581  1.00 22.47  ? 10  DT  E H3     1 
ATOM   8239 H  H71    . DT  E 3 10  ? -17.134 31.111  35.837  1.00 28.27  ? 10  DT  E H71    1 
ATOM   8240 H  H72    . DT  E 3 10  ? -18.711 31.293  35.769  1.00 28.27  ? 10  DT  E H72    1 
ATOM   8241 H  H73    . DT  E 3 10  ? -17.901 30.893  34.463  1.00 28.27  ? 10  DT  E H73    1 
ATOM   8242 H  H6     . DT  E 3 10  ? -17.791 33.531  36.794  1.00 20.15  ? 10  DT  E H6     1 
ATOM   8243 P  P      . DT  E 3 11  ? -19.856 38.347  39.798  1.00 15.81  ? 11  DT  E P      1 
ATOM   8244 O  OP1    . DT  E 3 11  ? -19.651 39.421  40.799  1.00 12.19  ? 11  DT  E OP1    1 
ATOM   8245 O  OP2    . DT  E 3 11  ? -20.675 37.159  40.122  1.00 15.78  ? 11  DT  E OP2    1 
ATOM   8246 O  "O5'"  . DT  E 3 11  ? -20.481 39.005  38.485  1.00 22.05  ? 11  DT  E "O5'"  1 
ATOM   8247 C  "C5'"  . DT  E 3 11  ? -19.729 39.955  37.767  1.00 16.71  ? 11  DT  E "C5'"  1 
ATOM   8248 C  "C4'"  . DT  E 3 11  ? -20.263 40.144  36.362  1.00 14.82  ? 11  DT  E "C4'"  1 
ATOM   8249 O  "O4'"  . DT  E 3 11  ? -19.925 39.003  35.548  1.00 9.48   ? 11  DT  E "O4'"  1 
ATOM   8250 C  "C3'"  . DT  E 3 11  ? -21.780 40.289  36.269  1.00 17.13  ? 11  DT  E "C3'"  1 
ATOM   8251 O  "O3'"  . DT  E 3 11  ? -22.116 41.621  35.954  1.00 13.76  ? 11  DT  E "O3'"  1 
ATOM   8252 C  "C2'"  . DT  E 3 11  ? -22.214 39.312  35.159  1.00 25.46  ? 11  DT  E "C2'"  1 
ATOM   8253 C  "C1'"  . DT  E 3 11  ? -20.897 38.865  34.536  1.00 10.51  ? 11  DT  E "C1'"  1 
ATOM   8254 N  N1     . DT  E 3 11  ? -20.868 37.454  34.064  1.00 13.11  ? 11  DT  E N1     1 
ATOM   8255 C  C2     . DT  E 3 11  ? -20.591 37.190  32.739  1.00 21.75  ? 11  DT  E C2     1 
ATOM   8256 O  O2     . DT  E 3 11  ? -20.397 38.060  31.908  1.00 24.80  ? 11  DT  E O2     1 
ATOM   8257 N  N3     . DT  E 3 11  ? -20.567 35.859  32.415  1.00 29.48  ? 11  DT  E N3     1 
ATOM   8258 C  C4     . DT  E 3 11  ? -20.773 34.788  33.269  1.00 25.99  ? 11  DT  E C4     1 
ATOM   8259 O  O4     . DT  E 3 11  ? -20.729 33.621  32.885  1.00 24.68  ? 11  DT  E O4     1 
ATOM   8260 C  C5     . DT  E 3 11  ? -21.042 35.138  34.643  1.00 16.88  ? 11  DT  E C5     1 
ATOM   8261 C  C7     . DT  E 3 11  ? -21.281 34.068  35.658  1.00 18.76  ? 11  DT  E C7     1 
ATOM   8262 C  C6     . DT  E 3 11  ? -21.069 36.438  34.971  1.00 18.39  ? 11  DT  E C6     1 
ATOM   8263 H  "H5'"  . DT  E 3 11  ? -18.807 39.657  37.718  1.00 20.26  ? 11  DT  E "H5'"  1 
ATOM   8264 H  "H5''" . DT  E 3 11  ? -19.762 40.804  38.235  1.00 20.26  ? 11  DT  E "H5''" 1 
ATOM   8265 H  "H4'"  . DT  E 3 11  ? -19.846 40.928  35.971  1.00 18.00  ? 11  DT  E "H4'"  1 
ATOM   8266 H  "H3'"  . DT  E 3 11  ? -22.179 40.007  37.107  1.00 20.77  ? 11  DT  E "H3'"  1 
ATOM   8267 H  "H2'"  . DT  E 3 11  ? -22.698 38.557  35.529  1.00 30.77  ? 11  DT  E "H2'"  1 
ATOM   8268 H  "H2''" . DT  E 3 11  ? -22.776 39.756  34.504  1.00 30.77  ? 11  DT  E "H2''" 1 
ATOM   8269 H  "H1'"  . DT  E 3 11  ? -20.698 39.446  33.785  1.00 12.83  ? 11  DT  E "H1'"  1 
ATOM   8270 H  H3     . DT  E 3 11  ? -20.407 35.668  31.592  1.00 35.60  ? 11  DT  E H3     1 
ATOM   8271 H  H71    . DT  E 3 11  ? -21.256 33.204  35.218  1.00 22.72  ? 11  DT  E H71    1 
ATOM   8272 H  H72    . DT  E 3 11  ? -20.588 34.115  36.335  1.00 22.72  ? 11  DT  E H72    1 
ATOM   8273 H  H73    . DT  E 3 11  ? -22.151 34.207  36.064  1.00 22.72  ? 11  DT  E H73    1 
ATOM   8274 H  H6     . DT  E 3 11  ? -21.231 36.664  35.858  1.00 22.28  ? 11  DT  E H6     1 
ATOM   8275 P  P      . DG  E 3 12  ? -23.593 42.178  36.234  1.00 26.17  ? 12  DG  E P      1 
ATOM   8276 O  OP1    . DG  E 3 12  ? -23.457 43.547  36.781  1.00 25.02  ? 12  DG  E OP1    1 
ATOM   8277 O  OP2    . DG  E 3 12  ? -24.356 41.143  36.970  1.00 27.28  ? 12  DG  E OP2    1 
ATOM   8278 O  "O5'"  . DG  E 3 12  ? -24.214 42.313  34.768  1.00 34.11  ? 12  DG  E "O5'"  1 
ATOM   8279 C  "C5'"  . DG  E 3 12  ? -23.448 42.913  33.728  1.00 21.45  ? 12  DG  E "C5'"  1 
ATOM   8280 C  "C4'"  . DG  E 3 12  ? -23.852 42.361  32.372  1.00 19.91  ? 12  DG  E "C4'"  1 
ATOM   8281 O  "O4'"  . DG  E 3 12  ? -23.497 40.962  32.303  1.00 27.43  ? 12  DG  E "O4'"  1 
ATOM   8282 C  "C3'"  . DG  E 3 12  ? -25.348 42.445  32.081  1.00 30.03  ? 12  DG  E "C3'"  1 
ATOM   8283 O  "O3'"  . DG  E 3 12  ? -25.586 43.333  30.988  1.00 48.20  ? 12  DG  E "O3'"  1 
ATOM   8284 C  "C2'"  . DG  E 3 12  ? -25.782 41.008  31.770  1.00 34.78  ? 12  DG  E "C2'"  1 
ATOM   8285 C  "C1'"  . DG  E 3 12  ? -24.469 40.264  31.562  1.00 28.16  ? 12  DG  E "C1'"  1 
ATOM   8286 N  N9     . DG  E 3 12  ? -24.492 38.873  32.018  1.00 25.95  ? 12  DG  E N9     1 
ATOM   8287 C  C8     . DG  E 3 12  ? -24.785 38.423  33.283  1.00 24.27  ? 12  DG  E C8     1 
ATOM   8288 N  N7     . DG  E 3 12  ? -24.725 37.125  33.402  1.00 21.95  ? 12  DG  E N7     1 
ATOM   8289 C  C5     . DG  E 3 12  ? -24.372 36.682  32.134  1.00 27.05  ? 12  DG  E C5     1 
ATOM   8290 C  C6     . DG  E 3 12  ? -24.161 35.365  31.658  1.00 26.90  ? 12  DG  E C6     1 
ATOM   8291 O  O6     . DG  E 3 12  ? -24.248 34.302  32.287  1.00 23.32  ? 12  DG  E O6     1 
ATOM   8292 N  N1     . DG  E 3 12  ? -23.819 35.351  30.310  1.00 26.66  ? 12  DG  E N1     1 
ATOM   8293 C  C2     . DG  E 3 12  ? -23.695 36.469  29.518  1.00 37.35  ? 12  DG  E C2     1 
ATOM   8294 N  N2     . DG  E 3 12  ? -23.357 36.257  28.235  1.00 46.57  ? 12  DG  E N2     1 
ATOM   8295 N  N3     . DG  E 3 12  ? -23.890 37.714  29.953  1.00 24.99  ? 12  DG  E N3     1 
ATOM   8296 C  C4     . DG  E 3 12  ? -24.225 37.743  31.267  1.00 21.82  ? 12  DG  E C4     1 
ATOM   8297 H  "H5'"  . DG  E 3 12  ? -22.507 42.733  33.879  1.00 25.95  ? 12  DG  E "H5'"  1 
ATOM   8298 H  "H5''" . DG  E 3 12  ? -23.591 43.872  33.738  1.00 25.95  ? 12  DG  E "H5''" 1 
ATOM   8299 H  "H4'"  . DG  E 3 12  ? -23.372 42.827  31.670  1.00 24.11  ? 12  DG  E "H4'"  1 
ATOM   8300 H  "H3'"  . DG  E 3 12  ? -25.812 42.740  32.880  1.00 36.25  ? 12  DG  E "H3'"  1 
ATOM   8301 H  "H2'"  . DG  E 3 12  ? -26.282 40.630  32.511  1.00 41.95  ? 12  DG  E "H2'"  1 
ATOM   8302 H  "H2''" . DG  E 3 12  ? -26.330 40.977  30.970  1.00 41.95  ? 12  DG  E "H2''" 1 
ATOM   8303 H  "H1'"  . DG  E 3 12  ? -24.236 40.283  30.620  1.00 34.01  ? 12  DG  E "H1'"  1 
ATOM   8304 H  H8     . DG  E 3 12  ? -25.005 38.990  33.987  1.00 29.34  ? 12  DG  E H8     1 
ATOM   8305 H  H1     . DG  E 3 12  ? -23.675 34.586  29.944  1.00 32.21  ? 12  DG  E H1     1 
ATOM   8306 H  H21    . DG  E 3 12  ? -23.268 36.923  27.698  1.00 56.10  ? 12  DG  E H21    1 
ATOM   8307 H  H22    . DG  E 3 12  ? -23.230 35.455  27.951  1.00 56.10  ? 12  DG  E H22    1 
ATOM   8308 P  P      . DC  E 3 13  ? -27.085 43.664  30.513  1.00 61.16  ? 13  DC  E P      1 
ATOM   8309 O  OP1    . DC  E 3 13  ? -27.021 44.991  29.860  1.00 57.99  ? 13  DC  E OP1    1 
ATOM   8310 O  OP2    . DC  E 3 13  ? -28.020 43.438  31.637  1.00 48.61  ? 13  DC  E OP2    1 
ATOM   8311 O  "O5'"  . DC  E 3 13  ? -27.395 42.544  29.416  1.00 38.35  ? 13  DC  E "O5'"  1 
ATOM   8312 C  "C5'"  . DC  E 3 13  ? -26.489 42.344  28.345  1.00 56.90  ? 13  DC  E "C5'"  1 
ATOM   8313 C  "C4'"  . DC  E 3 13  ? -26.729 41.015  27.658  1.00 54.90  ? 13  DC  E "C4'"  1 
ATOM   8314 O  "O4'"  . DC  E 3 13  ? -26.303 39.927  28.499  1.00 45.59  ? 13  DC  E "O4'"  1 
ATOM   8315 C  "C3'"  . DC  E 3 13  ? -28.184 40.702  27.352  1.00 49.75  ? 13  DC  E "C3'"  1 
ATOM   8316 O  "O3'"  . DC  E 3 13  ? -28.560 41.279  26.112  1.00 65.90  ? 13  DC  E "O3'"  1 
ATOM   8317 C  "C2'"  . DC  E 3 13  ? -28.232 39.167  27.333  1.00 37.36  ? 13  DC  E "C2'"  1 
ATOM   8318 C  "C1'"  . DC  E 3 13  ? -26.957 38.743  28.078  1.00 34.90  ? 13  DC  E "C1'"  1 
ATOM   8319 N  N1     . DC  E 3 13  ? -27.197 37.881  29.275  1.00 30.40  ? 13  DC  E N1     1 
ATOM   8320 C  C2     . DC  E 3 13  ? -27.074 36.490  29.165  1.00 35.48  ? 13  DC  E C2     1 
ATOM   8321 O  O2     . DC  E 3 13  ? -26.783 35.998  28.070  1.00 41.28  ? 13  DC  E O2     1 
ATOM   8322 N  N3     . DC  E 3 13  ? -27.284 35.722  30.265  1.00 29.29  ? 13  DC  E N3     1 
ATOM   8323 C  C4     . DC  E 3 13  ? -27.597 36.292  31.427  1.00 26.85  ? 13  DC  E C4     1 
ATOM   8324 N  N4     . DC  E 3 13  ? -27.793 35.495  32.486  1.00 27.56  ? 13  DC  E N4     1 
ATOM   8325 C  C5     . DC  E 3 13  ? -27.721 37.708  31.559  1.00 20.15  ? 13  DC  E C5     1 
ATOM   8326 C  C6     . DC  E 3 13  ? -27.512 38.455  30.470  1.00 31.07  ? 13  DC  E C6     1 
ATOM   8327 H  "H5'"  . DC  E 3 13  ? -25.582 42.365  28.689  1.00 68.49  ? 13  DC  E "H5'"  1 
ATOM   8328 H  "H5''" . DC  E 3 13  ? -26.598 43.060  27.700  1.00 68.49  ? 13  DC  E "H5''" 1 
ATOM   8329 H  "H4'"  . DC  E 3 13  ? -26.208 41.007  26.840  1.00 66.09  ? 13  DC  E "H4'"  1 
ATOM   8330 H  "H3'"  . DC  E 3 13  ? -28.755 41.031  28.064  1.00 59.91  ? 13  DC  E "H3'"  1 
ATOM   8331 H  "H2'"  . DC  E 3 13  ? -29.024 38.839  27.789  1.00 45.05  ? 13  DC  E "H2'"  1 
ATOM   8332 H  "H2''" . DC  E 3 13  ? -28.230 38.831  26.423  1.00 45.05  ? 13  DC  E "H2''" 1 
ATOM   8333 H  "H1'"  . DC  E 3 13  ? -26.383 38.268  27.456  1.00 42.09  ? 13  DC  E "H1'"  1 
ATOM   8334 H  H41    . DC  E 3 13  ? -27.996 35.836  33.249  1.00 33.29  ? 13  DC  E H41    1 
ATOM   8335 H  H42    . DC  E 3 13  ? -27.716 34.643  32.403  1.00 33.29  ? 13  DC  E H42    1 
ATOM   8336 H  H5     . DC  E 3 13  ? -27.939 38.097  32.375  1.00 24.40  ? 13  DC  E H5     1 
ATOM   8337 H  H6     . DC  E 3 13  ? -27.582 39.380  30.529  1.00 37.50  ? 13  DC  E H6     1 
ATOM   8338 P  P      . DT  E 3 14  ? -29.907 40.812  25.374  1.00 75.99  ? 14  DT  E P      1 
ATOM   8339 O  OP1    . DT  E 3 14  ? -30.435 41.977  24.630  1.00 49.93  ? 14  DT  E OP1    1 
ATOM   8340 O  OP2    . DT  E 3 14  ? -30.760 40.105  26.360  1.00 34.78  ? 14  DT  E OP2    1 
ATOM   8341 O  "O5'"  . DT  E 3 14  ? -29.391 39.744  24.310  1.00 48.76  ? 14  DT  E "O5'"  1 
ATOM   8342 C  "C5'"  . DT  E 3 14  ? -30.316 38.944  23.630  1.00 56.87  ? 14  DT  E "C5'"  1 
ATOM   8343 C  "C4'"  . DT  E 3 14  ? -29.881 37.492  23.628  1.00 45.15  ? 14  DT  E "C4'"  1 
ATOM   8344 O  "O4'"  . DT  E 3 14  ? -29.572 37.081  24.973  1.00 40.94  ? 14  DT  E "O4'"  1 
ATOM   8345 C  "C3'"  . DT  E 3 14  ? -30.954 36.535  23.122  1.00 62.57  ? 14  DT  E "C3'"  1 
ATOM   8346 O  "O3'"  . DT  E 3 14  ? -30.582 36.005  21.857  1.00 60.17  ? 14  DT  E "O3'"  1 
ATOM   8347 C  "C2'"  . DT  E 3 14  ? -31.069 35.450  24.206  1.00 56.06  ? 14  DT  E "C2'"  1 
ATOM   8348 C  "C1'"  . DT  E 3 14  ? -29.882 35.716  25.122  1.00 37.86  ? 14  DT  E "C1'"  1 
ATOM   8349 N  N1     . DT  E 3 14  ? -30.147 35.451  26.573  1.00 31.12  ? 14  DT  E N1     1 
ATOM   8350 C  C2     . DT  E 3 14  ? -30.127 34.155  27.045  1.00 33.03  ? 14  DT  E C2     1 
ATOM   8351 O  O2     . DT  E 3 14  ? -29.914 33.189  26.337  1.00 38.55  ? 14  DT  E O2     1 
ATOM   8352 N  N3     . DT  E 3 14  ? -30.370 34.033  28.390  1.00 30.49  ? 14  DT  E N3     1 
ATOM   8353 C  C4     . DT  E 3 14  ? -30.621 35.055  29.291  1.00 43.91  ? 14  DT  E C4     1 
ATOM   8354 O  O4     . DT  E 3 14  ? -30.827 34.849  30.484  1.00 31.14  ? 14  DT  E O4     1 
ATOM   8355 C  C5     . DT  E 3 14  ? -30.625 36.385  28.729  1.00 35.46  ? 14  DT  E C5     1 
ATOM   8356 C  C7     . DT  E 3 14  ? -30.887 37.569  29.606  1.00 37.27  ? 14  DT  E C7     1 
ATOM   8357 C  C6     . DT  E 3 14  ? -30.390 36.518  27.415  1.00 34.69  ? 14  DT  E C6     1 
ATOM   8358 H  "H5'"  . DT  E 3 14  ? -30.394 39.254  22.714  1.00 68.46  ? 14  DT  E "H5'"  1 
ATOM   8359 H  "H5''" . DT  E 3 14  ? -31.181 39.017  24.063  1.00 68.46  ? 14  DT  E "H5''" 1 
ATOM   8360 H  "H4'"  . DT  E 3 14  ? -29.078 37.386  23.094  1.00 54.39  ? 14  DT  E "H4'"  1 
ATOM   8361 H  "H3'"  . DT  E 3 14  ? -31.800 37.005  23.067  1.00 75.30  ? 14  DT  E "H3'"  1 
ATOM   8362 H  "H2'"  . DT  E 3 14  ? -31.906 35.531  24.690  1.00 67.48  ? 14  DT  E "H2'"  1 
ATOM   8363 H  "H2''" . DT  E 3 14  ? -31.015 34.563  23.816  1.00 67.48  ? 14  DT  E "H2''" 1 
ATOM   8364 H  "H1'"  . DT  E 3 14  ? -29.134 35.170  24.834  1.00 45.65  ? 14  DT  E "H1'"  1 
ATOM   8365 H  H3     . DT  E 3 14  ? -30.366 33.235  28.709  1.00 36.81  ? 14  DT  E H3     1 
ATOM   8366 H  H71    . DT  E 3 14  ? -30.100 38.136  29.614  1.00 44.94  ? 14  DT  E H71    1 
ATOM   8367 H  H72    . DT  E 3 14  ? -31.645 38.061  29.254  1.00 44.94  ? 14  DT  E H72    1 
ATOM   8368 H  H73    . DT  E 3 14  ? -31.081 37.259  30.504  1.00 44.94  ? 14  DT  E H73    1 
ATOM   8369 H  H6     . DT  E 3 14  ? -30.391 37.374  27.052  1.00 41.84  ? 14  DT  E H6     1 
ATOM   8370 P  P      . DC  E 3 15  ? -31.712 35.691  20.762  1.00 70.31  ? 15  DC  E P      1 
ATOM   8371 O  OP1    . DC  E 3 15  ? -31.034 35.529  19.457  1.00 60.40  ? 15  DC  E OP1    1 
ATOM   8372 O  OP2    . DC  E 3 15  ? -32.769 36.721  20.895  1.00 61.75  ? 15  DC  E OP2    1 
ATOM   8373 O  "O5'"  . DC  E 3 15  ? -32.294 34.278  21.234  1.00 34.14  ? 15  DC  E "O5'"  1 
ATOM   8374 C  "C5'"  . DC  E 3 15  ? -31.432 33.149  21.280  1.00 35.78  ? 15  DC  E "C5'"  1 
ATOM   8375 C  "C4'"  . DC  E 3 15  ? -32.108 31.961  21.943  1.00 68.06  ? 15  DC  E "C4'"  1 
ATOM   8376 O  "O4'"  . DC  E 3 15  ? -32.010 32.091  23.383  1.00 70.34  ? 15  DC  E "O4'"  1 
ATOM   8377 C  "C3'"  . DC  E 3 15  ? -33.603 31.809  21.632  1.00 77.82  ? 15  DC  E "C3'"  1 
ATOM   8378 O  "O3'"  . DC  E 3 15  ? -33.844 30.558  20.996  1.00 79.19  ? 15  DC  E "O3'"  1 
ATOM   8379 C  "C2'"  . DC  E 3 15  ? -34.297 31.920  22.995  1.00 66.92  ? 15  DC  E "C2'"  1 
ATOM   8380 C  "C1'"  . DC  E 3 15  ? -33.183 31.582  23.974  1.00 53.48  ? 15  DC  E "C1'"  1 
ATOM   8381 N  N1     . DC  E 3 15  ? -33.338 32.193  25.333  1.00 42.27  ? 15  DC  E N1     1 
ATOM   8382 C  C2     . DC  E 3 15  ? -33.383 31.368  26.468  1.00 46.14  ? 15  DC  E C2     1 
ATOM   8383 O  O2     . DC  E 3 15  ? -33.287 30.145  26.326  1.00 50.67  ? 15  DC  E O2     1 
ATOM   8384 N  N3     . DC  E 3 15  ? -33.517 31.941  27.691  1.00 37.06  ? 15  DC  E N3     1 
ATOM   8385 C  C4     . DC  E 3 15  ? -33.610 33.266  27.801  1.00 37.10  ? 15  DC  E C4     1 
ATOM   8386 N  N4     . DC  E 3 15  ? -33.744 33.788  29.025  1.00 28.87  ? 15  DC  E N4     1 
ATOM   8387 C  C5     . DC  E 3 15  ? -33.571 34.119  26.658  1.00 38.08  ? 15  DC  E C5     1 
ATOM   8388 C  C6     . DC  E 3 15  ? -33.438 33.545  25.458  1.00 37.36  ? 15  DC  E C6     1 
ATOM   8389 H  "H5'"  . DC  E 3 15  ? -30.634 33.379  21.781  1.00 43.15  ? 15  DC  E "H5'"  1 
ATOM   8390 H  "H5''" . DC  E 3 15  ? -31.179 32.905  20.376  1.00 43.15  ? 15  DC  E "H5''" 1 
ATOM   8391 H  "H4'"  . DC  E 3 15  ? -31.653 31.148  21.675  1.00 81.89  ? 15  DC  E "H4'"  1 
ATOM   8392 H  "H3'"  . DC  E 3 15  ? -33.896 32.545  21.073  1.00 93.60  ? 15  DC  E "H3'"  1 
ATOM   8393 H  "H2'"  . DC  E 3 15  ? -34.635 32.817  23.145  1.00 80.52  ? 15  DC  E "H2'"  1 
ATOM   8394 H  "H2''" . DC  E 3 15  ? -35.031 31.291  23.067  1.00 80.52  ? 15  DC  E "H2''" 1 
ATOM   8395 H  "H1'"  . DC  E 3 15  ? -33.124 30.619  24.080  1.00 64.39  ? 15  DC  E "H1'"  1 
ATOM   8396 H  H41    . DC  E 3 15  ? -33.807 34.640  29.125  1.00 34.86  ? 15  DC  E H41    1 
ATOM   8397 H  H42    . DC  E 3 15  ? -33.767 33.271  29.712  1.00 34.86  ? 15  DC  E H42    1 
ATOM   8398 H  H5     . DC  E 3 15  ? -33.637 35.043  26.745  1.00 45.91  ? 15  DC  E H5     1 
ATOM   8399 H  H6     . DC  E 3 15  ? -33.412 34.078  24.697  1.00 45.05  ? 15  DC  E H6     1 
ATOM   8400 P  P      . DA  E 3 16  ? -35.328 30.127  20.556  1.00 95.45  ? 16  DA  E P      1 
ATOM   8401 O  OP1    . DA  E 3 16  ? -35.247 29.519  19.210  1.00 106.71 ? 16  DA  E OP1    1 
ATOM   8402 O  OP2    . DA  E 3 16  ? -36.224 31.284  20.790  1.00 75.96  ? 16  DA  E OP2    1 
ATOM   8403 O  "O5'"  . DA  E 3 16  ? -35.696 28.992  21.619  1.00 52.44  ? 16  DA  E "O5'"  1 
ATOM   8404 C  "C5'"  . DA  E 3 16  ? -34.814 27.886  21.775  1.00 71.88  ? 16  DA  E "C5'"  1 
ATOM   8405 C  "C4'"  . DA  E 3 16  ? -35.317 26.926  22.834  1.00 66.42  ? 16  DA  E "C4'"  1 
ATOM   8406 O  "O4'"  . DA  E 3 16  ? -35.216 27.562  24.142  1.00 58.87  ? 16  DA  E "O4'"  1 
ATOM   8407 C  "C3'"  . DA  E 3 16  ? -36.776 26.509  22.696  1.00 82.81  ? 16  DA  E "C3'"  1 
ATOM   8408 O  "O3'"  . DA  E 3 16  ? -36.934 25.161  23.123  1.00 88.56  ? 16  DA  E "O3'"  1 
ATOM   8409 C  "C2'"  . DA  E 3 16  ? -37.502 27.506  23.590  1.00 78.38  ? 16  DA  E "C2'"  1 
ATOM   8410 C  "C1'"  . DA  E 3 16  ? -36.507 27.677  24.730  1.00 83.56  ? 16  DA  E "C1'"  1 
ATOM   8411 N  N9     . DA  E 3 16  ? -36.589 28.969  25.410  1.00 78.25  ? 16  DA  E N9     1 
ATOM   8412 C  C8     . DA  E 3 16  ? -36.624 30.206  24.828  1.00 62.98  ? 16  DA  E C8     1 
ATOM   8413 N  N7     . DA  E 3 16  ? -36.686 31.196  25.686  1.00 41.77  ? 16  DA  E N7     1 
ATOM   8414 C  C5     . DA  E 3 16  ? -36.691 30.568  26.918  1.00 39.25  ? 16  DA  E C5     1 
ATOM   8415 C  C6     . DA  E 3 16  ? -36.744 31.066  28.232  1.00 40.87  ? 16  DA  E C6     1 
ATOM   8416 N  N6     . DA  E 3 16  ? -36.807 32.370  28.518  1.00 37.32  ? 16  DA  E N6     1 
ATOM   8417 N  N1     . DA  E 3 16  ? -36.733 30.170  29.243  1.00 34.51  ? 16  DA  E N1     1 
ATOM   8418 C  C2     . DA  E 3 16  ? -36.670 28.866  28.947  1.00 54.56  ? 16  DA  E C2     1 
ATOM   8419 N  N3     . DA  E 3 16  ? -36.614 28.278  27.751  1.00 48.58  ? 16  DA  E N3     1 
ATOM   8420 C  C4     . DA  E 3 16  ? -36.628 29.194  26.769  1.00 54.38  ? 16  DA  E C4     1 
ATOM   8421 H  "H5'"  . DA  E 3 16  ? -33.937 28.212  22.033  1.00 86.47  ? 16  DA  E "H5'"  1 
ATOM   8422 H  "H5''" . DA  E 3 16  ? -34.740 27.416  20.930  1.00 86.47  ? 16  DA  E "H5''" 1 
ATOM   8423 H  "H4'"  . DA  E 3 16  ? -34.766 26.128  22.821  1.00 79.91  ? 16  DA  E "H4'"  1 
ATOM   8424 H  "H3'"  . DA  E 3 16  ? -37.084 26.610  21.782  1.00 99.59  ? 16  DA  E "H3'"  1 
ATOM   8425 H  "H2'"  . DA  E 3 16  ? -37.665 28.344  23.129  1.00 94.27  ? 16  DA  E "H2'"  1 
ATOM   8426 H  "H2''" . DA  E 3 16  ? -38.348 27.150  23.906  1.00 94.27  ? 16  DA  E "H2''" 1 
ATOM   8427 H  "H1'"  . DA  E 3 16  ? -36.641 26.971  25.381  1.00 100.49 ? 16  DA  E "H1'"  1 
ATOM   8428 H  H8     . DA  E 3 16  ? -36.605 30.333  23.907  1.00 75.79  ? 16  DA  E H8     1 
ATOM   8429 H  H61    . DA  E 3 16  ? -36.840 32.629  29.337  1.00 44.99  ? 16  DA  E H61    1 
ATOM   8430 H  H62    . DA  E 3 16  ? -36.814 32.950  27.882  1.00 44.99  ? 16  DA  E H62    1 
ATOM   8431 H  H2     . DA  E 3 16  ? -36.663 28.290  29.677  1.00 65.69  ? 16  DA  E H2     1 
ATOM   8432 P  P      . DA  E 3 17  ? -38.250 24.332  22.731  1.00 95.46  ? 17  DA  E P      1 
ATOM   8433 O  OP1    . DA  E 3 17  ? -37.831 23.163  21.924  1.00 118.03 ? 17  DA  E OP1    1 
ATOM   8434 O  OP2    . DA  E 3 17  ? -39.230 25.302  22.189  1.00 63.42  ? 17  DA  E OP2    1 
ATOM   8435 O  "O5'"  . DA  E 3 17  ? -38.787 23.807  24.140  1.00 72.20  ? 17  DA  E "O5'"  1 
ATOM   8436 C  "C5'"  . DA  E 3 17  ? -39.057 24.741  25.167  1.00 75.98  ? 17  DA  E "C5'"  1 
ATOM   8437 C  "C4'"  . DA  E 3 17  ? -39.116 24.072  26.520  1.00 79.09  ? 17  DA  E "C4'"  1 
ATOM   8438 O  "O4'"  . DA  E 3 17  ? -38.805 25.046  27.545  1.00 82.00  ? 17  DA  E "O4'"  1 
ATOM   8439 C  "C3'"  . DA  E 3 17  ? -40.479 23.551  26.925  1.00 78.30  ? 17  DA  E "C3'"  1 
ATOM   8440 O  "O3'"  . DA  E 3 17  ? -40.359 22.568  27.953  1.00 70.06  ? 17  DA  E "O3'"  1 
ATOM   8441 C  "C2'"  . DA  E 3 17  ? -41.172 24.829  27.399  1.00 75.32  ? 17  DA  E "C2'"  1 
ATOM   8442 C  "C1'"  . DA  E 3 17  ? -40.019 25.612  28.036  1.00 81.50  ? 17  DA  E "C1'"  1 
ATOM   8443 N  N9     . DA  E 3 17  ? -40.007 27.039  27.721  1.00 66.69  ? 17  DA  E N9     1 
ATOM   8444 C  C8     . DA  E 3 17  ? -39.995 27.615  26.479  1.00 57.37  ? 17  DA  E C8     1 
ATOM   8445 N  N7     . DA  E 3 17  ? -39.965 28.928  26.505  1.00 50.58  ? 17  DA  E N7     1 
ATOM   8446 C  C5     . DA  E 3 17  ? -39.945 29.231  27.856  1.00 55.41  ? 17  DA  E C5     1 
ATOM   8447 C  C6     . DA  E 3 17  ? -39.911 30.453  28.556  1.00 40.97  ? 17  DA  E C6     1 
ATOM   8448 N  N6     . DA  E 3 17  ? -39.888 31.647  27.954  1.00 30.86  ? 17  DA  E N6     1 
ATOM   8449 N  N1     . DA  E 3 17  ? -39.899 30.400  29.904  1.00 53.75  ? 17  DA  E N1     1 
ATOM   8450 C  C2     . DA  E 3 17  ? -39.920 29.204  30.504  1.00 57.66  ? 17  DA  E C2     1 
ATOM   8451 N  N3     . DA  E 3 17  ? -39.953 27.993  29.956  1.00 56.21  ? 17  DA  E N3     1 
ATOM   8452 C  C4     . DA  E 3 17  ? -39.965 28.077  28.617  1.00 63.73  ? 17  DA  E C4     1 
ATOM   8453 H  "H5'"  . DA  E 3 17  ? -39.908 25.171  24.988  1.00 91.40  ? 17  DA  E "H5'"  1 
ATOM   8454 H  "H5''" . DA  E 3 17  ? -38.358 25.414  25.175  1.00 91.40  ? 17  DA  E "H5''" 1 
ATOM   8455 H  "H4'"  . DA  E 3 17  ? -38.470 23.348  26.531  1.00 95.12  ? 17  DA  E "H4'"  1 
ATOM   8456 H  "H3'"  . DA  E 3 17  ? -40.949 23.168  26.167  1.00 94.17  ? 17  DA  E "H3'"  1 
ATOM   8457 H  "H2'"  . DA  E 3 17  ? -41.561 25.316  26.655  1.00 90.60  ? 17  DA  E "H2'"  1 
ATOM   8458 H  "H2''" . DA  E 3 17  ? -41.867 24.634  28.047  1.00 90.60  ? 17  DA  E "H2''" 1 
ATOM   8459 H  "H1'"  . DA  E 3 17  ? -40.069 25.495  28.998  1.00 98.02  ? 17  DA  E "H1'"  1 
ATOM   8460 H  H8     . DA  E 3 17  ? -40.006 27.123  25.690  1.00 69.06  ? 17  DA  E H8     1 
ATOM   8461 H  H61    . DA  E 3 17  ? -39.866 32.366  28.425  1.00 37.25  ? 17  DA  E H61    1 
ATOM   8462 H  H62    . DA  E 3 17  ? -39.895 31.696  27.095  1.00 37.25  ? 17  DA  E H62    1 
ATOM   8463 H  H2     . DA  E 3 17  ? -39.911 29.222  31.434  1.00 69.41  ? 17  DA  E H2     1 
ATOM   8464 P  P      . DT  E 3 18  ? -41.654 21.751  28.437  1.00 102.04 ? 18  DT  E P      1 
ATOM   8465 O  OP1    . DT  E 3 18  ? -41.212 20.629  29.298  1.00 34.44  ? 18  DT  E OP1    1 
ATOM   8466 O  OP2    . DT  E 3 18  ? -42.499 21.503  27.247  1.00 93.84  ? 18  DT  E OP2    1 
ATOM   8467 O  "O5'"  . DT  E 3 18  ? -42.408 22.791  29.376  1.00 110.50 ? 18  DT  E "O5'"  1 
ATOM   8468 C  "C5'"  . DT  E 3 18  ? -41.776 23.259  30.553  1.00 90.73  ? 18  DT  E "C5'"  1 
ATOM   8469 C  "C4'"  . DT  E 3 18  ? -42.706 24.167  31.331  1.00 80.11  ? 18  DT  E "C4'"  1 
ATOM   8470 O  "O4'"  . DT  E 3 18  ? -42.532 25.548  30.897  1.00 70.19  ? 18  DT  E "O4'"  1 
ATOM   8471 C  "C3'"  . DT  E 3 18  ? -44.191 23.845  31.149  1.00 78.01  ? 18  DT  E "C3'"  1 
ATOM   8472 O  "O3'"  . DT  E 3 18  ? -44.864 23.904  32.380  1.00 74.29  ? 18  DT  E "O3'"  1 
ATOM   8473 C  "C2'"  . DT  E 3 18  ? -44.671 24.929  30.186  1.00 82.59  ? 18  DT  E "C2'"  1 
ATOM   8474 C  "C1'"  . DT  E 3 18  ? -43.794 26.111  30.592  1.00 67.35  ? 18  DT  E "C1'"  1 
ATOM   8475 N  N1     . DT  E 3 18  ? -43.632 27.181  29.546  1.00 53.57  ? 18  DT  E N1     1 
ATOM   8476 C  C2     . DT  E 3 18  ? -43.473 28.488  29.955  1.00 57.18  ? 18  DT  E C2     1 
ATOM   8477 O  O2     . DT  E 3 18  ? -43.442 28.821  31.126  1.00 66.23  ? 18  DT  E O2     1 
ATOM   8478 N  N3     . DT  E 3 18  ? -43.343 29.397  28.939  1.00 42.67  ? 18  DT  E N3     1 
ATOM   8479 C  C4     . DT  E 3 18  ? -43.360 29.138  27.582  1.00 55.12  ? 18  DT  E C4     1 
ATOM   8480 O  O4     . DT  E 3 18  ? -43.234 30.025  26.742  1.00 55.51  ? 18  DT  E O4     1 
ATOM   8481 C  C5     . DT  E 3 18  ? -43.534 27.751  27.221  1.00 54.00  ? 18  DT  E C5     1 
ATOM   8482 C  C7     . DT  E 3 18  ? -43.571 27.348  25.782  1.00 73.73  ? 18  DT  E C7     1 
ATOM   8483 C  C6     . DT  E 3 18  ? -43.663 26.851  28.207  1.00 49.65  ? 18  DT  E C6     1 
ATOM   8484 H  "H5'"  . DT  E 3 18  ? -40.975 23.750  30.313  1.00 109.09 ? 18  DT  E "H5'"  1 
ATOM   8485 H  "H5''" . DT  E 3 18  ? -41.529 22.502  31.107  1.00 109.09 ? 18  DT  E "H5''" 1 
ATOM   8486 H  "H4'"  . DT  E 3 18  ? -42.483 24.124  32.274  1.00 96.35  ? 18  DT  E "H4'"  1 
ATOM   8487 H  "H3'"  . DT  E 3 18  ? -44.293 22.969  30.747  1.00 93.83  ? 18  DT  E "H3'"  1 
ATOM   8488 H  "H2'"  . DT  E 3 18  ? -44.521 24.676  29.261  1.00 99.32  ? 18  DT  E "H2'"  1 
ATOM   8489 H  "H2''" . DT  E 3 18  ? -45.612 25.125  30.311  1.00 99.32  ? 18  DT  E "H2''" 1 
ATOM   8490 H  "H1'"  . DT  E 3 18  ? -44.168 26.536  31.379  1.00 81.04  ? 18  DT  E "H1'"  1 
ATOM   8491 H  H3     . DT  E 3 18  ? -43.239 30.218  29.172  1.00 51.42  ? 18  DT  E H3     1 
ATOM   8492 H  H71    . DT  E 3 18  ? -43.665 28.143  25.233  1.00 88.69  ? 18  DT  E H71    1 
ATOM   8493 H  H72    . DT  E 3 18  ? -42.746 26.889  25.561  1.00 88.69  ? 18  DT  E H72    1 
ATOM   8494 H  H73    . DT  E 3 18  ? -44.327 26.757  25.638  1.00 88.69  ? 18  DT  E H73    1 
ATOM   8495 H  H6     . DT  E 3 18  ? -43.779 25.958  27.976  1.00 59.79  ? 18  DT  E H6     1 
ATOM   8496 P  P      . DG  E 3 19  ? -46.141 22.973  32.657  1.00 98.77  ? 19  DG  E P      1 
ATOM   8497 O  OP1    . DG  E 3 19  ? -45.702 21.794  33.438  1.00 86.43  ? 19  DG  E OP1    1 
ATOM   8498 O  OP2    . DG  E 3 19  ? -46.855 22.786  31.374  1.00 95.63  ? 19  DG  E OP2    1 
ATOM   8499 O  "O5'"  . DG  E 3 19  ? -47.036 23.895  33.598  1.00 109.36 ? 19  DG  E "O5'"  1 
ATOM   8500 C  "C5'"  . DG  E 3 19  ? -46.447 24.477  34.743  1.00 110.92 ? 19  DG  E "C5'"  1 
ATOM   8501 C  "C4'"  . DG  E 3 19  ? -46.887 25.920  34.922  1.00 111.16 ? 19  DG  E "C4'"  1 
ATOM   8502 O  "O4'"  . DG  E 3 19  ? -46.473 26.725  33.774  1.00 95.00  ? 19  DG  E "O4'"  1 
ATOM   8503 C  "C3'"  . DG  E 3 19  ? -48.403 26.105  35.045  1.00 99.33  ? 19  DG  E "C3'"  1 
ATOM   8504 O  "O3'"  . DG  E 3 19  ? -48.693 26.956  36.141  1.00 104.45 ? 19  DG  E "O3'"  1 
ATOM   8505 C  "C2'"  . DG  E 3 19  ? -48.811 26.714  33.703  1.00 77.36  ? 19  DG  E "C2'"  1 
ATOM   8506 C  "C1'"  . DG  E 3 19  ? -47.567 27.501  33.317  1.00 76.93  ? 19  DG  E "C1'"  1 
ATOM   8507 N  N9     . DG  E 3 19  ? -47.429 27.766  31.883  1.00 61.23  ? 19  DG  E N9     1 
ATOM   8508 C  C8     . DG  E 3 19  ? -47.533 26.867  30.849  1.00 66.45  ? 19  DG  E C8     1 
ATOM   8509 N  N7     . DG  E 3 19  ? -47.370 27.409  29.669  1.00 43.12  ? 19  DG  E N7     1 
ATOM   8510 C  C5     . DG  E 3 19  ? -47.162 28.756  29.938  1.00 35.32  ? 19  DG  E C5     1 
ATOM   8511 C  C6     . DG  E 3 19  ? -46.932 29.843  29.053  1.00 49.24  ? 19  DG  E C6     1 
ATOM   8512 O  O6     . DG  E 3 19  ? -46.864 29.828  27.815  1.00 44.98  ? 19  DG  E O6     1 
ATOM   8513 N  N1     . DG  E 3 19  ? -46.774 31.044  29.742  1.00 36.68  ? 19  DG  E N1     1 
ATOM   8514 C  C2     . DG  E 3 19  ? -46.833 31.177  31.110  1.00 46.97  ? 19  DG  E C2     1 
ATOM   8515 N  N2     . DG  E 3 19  ? -46.658 32.410  31.600  1.00 42.81  ? 19  DG  E N2     1 
ATOM   8516 N  N3     . DG  E 3 19  ? -47.045 30.169  31.947  1.00 43.68  ? 19  DG  E N3     1 
ATOM   8517 C  C4     . DG  E 3 19  ? -47.201 28.993  31.294  1.00 37.95  ? 19  DG  E C4     1 
ATOM   8518 H  "H5'"  . DG  E 3 19  ? -45.481 24.449  34.652  1.00 133.32 ? 19  DG  E "H5'"  1 
ATOM   8519 H  "H5''" . DG  E 3 19  ? -46.705 23.967  35.527  1.00 133.32 ? 19  DG  E "H5''" 1 
ATOM   8520 H  "H4'"  . DG  E 3 19  ? -46.454 26.288  35.708  1.00 133.60 ? 19  DG  E "H4'"  1 
ATOM   8521 H  "H3'"  . DG  E 3 19  ? -48.841 25.246  35.148  1.00 119.41 ? 19  DG  E "H3'"  1 
ATOM   8522 H  "H2'"  . DG  E 3 19  ? -49.012 26.026  33.049  1.00 93.05  ? 19  DG  E "H2'"  1 
ATOM   8523 H  "H2''" . DG  E 3 19  ? -49.582 27.294  33.797  1.00 93.05  ? 19  DG  E "H2''" 1 
ATOM   8524 H  "H1'"  . DG  E 3 19  ? -47.567 28.358  33.770  1.00 92.53  ? 19  DG  E "H1'"  1 
ATOM   8525 H  H8     . DG  E 3 19  ? -47.702 25.962  30.975  1.00 79.96  ? 19  DG  E H8     1 
ATOM   8526 H  H1     . DG  E 3 19  ? -46.630 31.754  29.278  1.00 44.23  ? 19  DG  E H1     1 
ATOM   8527 H  H21    . DG  E 3 19  ? -46.683 32.543  32.449  1.00 51.58  ? 19  DG  E H21    1 
ATOM   8528 H  H22    . DG  E 3 19  ? -46.520 33.070  31.065  1.00 51.58  ? 19  DG  E H22    1 
ATOM   8529 P  P      . DA  E 3 20  ? -50.178 27.044  36.739  1.00 109.66 ? 20  DA  E P      1 
ATOM   8530 O  OP1    . DA  E 3 20  ? -50.163 26.414  38.078  1.00 111.75 ? 20  DA  E OP1    1 
ATOM   8531 O  OP2    . DA  E 3 20  ? -51.120 26.546  35.710  1.00 68.43  ? 20  DA  E OP2    1 
ATOM   8532 O  "O5'"  . DA  E 3 20  ? -50.413 28.615  36.911  1.00 96.92  ? 20  DA  E "O5'"  1 
ATOM   8533 C  "C5'"  . DA  E 3 20  ? -49.446 29.407  37.613  1.00 105.23 ? 20  DA  E "C5'"  1 
ATOM   8534 C  "C4'"  . DA  E 3 20  ? -49.709 30.886  37.397  1.00 93.94  ? 20  DA  E "C4'"  1 
ATOM   8535 O  "O4'"  . DA  E 3 20  ? -49.423 31.247  36.023  1.00 75.28  ? 20  DA  E "O4'"  1 
ATOM   8536 C  "C3'"  . DA  E 3 20  ? -51.150 31.299  37.656  1.00 84.90  ? 20  DA  E "C3'"  1 
ATOM   8537 O  "O3'"  . DA  E 3 20  ? -51.208 32.585  38.242  1.00 76.25  ? 20  DA  E "O3'"  1 
ATOM   8538 C  "C2'"  . DA  E 3 20  ? -51.774 31.259  36.260  1.00 78.94  ? 20  DA  E "C2'"  1 
ATOM   8539 C  "C1'"  . DA  E 3 20  ? -50.607 31.668  35.367  1.00 71.35  ? 20  DA  E "C1'"  1 
ATOM   8540 N  N9     . DA  E 3 20  ? -50.615 31.053  34.043  1.00 56.05  ? 20  DA  E N9     1 
ATOM   8541 C  C8     . DA  E 3 20  ? -50.798 29.730  33.751  1.00 58.53  ? 20  DA  E C8     1 
ATOM   8542 N  N7     . DA  E 3 20  ? -50.739 29.457  32.469  1.00 62.14  ? 20  DA  E N7     1 
ATOM   8543 C  C5     . DA  E 3 20  ? -50.497 30.688  31.879  1.00 46.05  ? 20  DA  E C5     1 
ATOM   8544 C  C6     . DA  E 3 20  ? -50.329 31.084  30.536  1.00 42.25  ? 20  DA  E C6     1 
ATOM   8545 N  N6     . DA  E 3 20  ? -50.385 30.236  29.503  1.00 49.28  ? 20  DA  E N6     1 
ATOM   8546 N  N1     . DA  E 3 20  ? -50.103 32.390  30.294  1.00 39.65  ? 20  DA  E N1     1 
ATOM   8547 C  C2     . DA  E 3 20  ? -50.050 33.238  31.327  1.00 45.78  ? 20  DA  E C2     1 
ATOM   8548 N  N3     . DA  E 3 20  ? -50.190 32.986  32.626  1.00 47.98  ? 20  DA  E N3     1 
ATOM   8549 C  C4     . DA  E 3 20  ? -50.414 31.681  32.836  1.00 39.09  ? 20  DA  E C4     1 
ATOM   8550 H  "H5'"  . DA  E 3 20  ? -48.557 29.189  37.290  1.00 126.49 ? 20  DA  E "H5'"  1 
ATOM   8551 H  "H5''" . DA  E 3 20  ? -49.495 29.207  38.561  1.00 126.49 ? 20  DA  E "H5''" 1 
ATOM   8552 H  "H4'"  . DA  E 3 20  ? -49.119 31.408  37.963  1.00 112.94 ? 20  DA  E "H4'"  1 
ATOM   8553 H  "H3'"  . DA  E 3 20  ? -51.586 30.653  38.234  1.00 102.09 ? 20  DA  E "H3'"  1 
ATOM   8554 H  "H2'"  . DA  E 3 20  ? -52.091 30.370  36.041  1.00 94.95  ? 20  DA  E "H2'"  1 
ATOM   8555 H  "H2''" . DA  E 3 20  ? -52.511 31.885  36.186  1.00 94.95  ? 20  DA  E "H2''" 1 
ATOM   8556 H  "H1'"  . DA  E 3 20  ? -50.616 32.634  35.278  1.00 85.83  ? 20  DA  E "H1'"  1 
ATOM   8557 H  H8     . DA  E 3 20  ? -50.949 29.082  34.401  1.00 70.46  ? 20  DA  E H8     1 
ATOM   8558 H  H61    . DA  E 3 20  ? -50.278 30.528  28.701  1.00 59.36  ? 20  DA  E H61    1 
ATOM   8559 H  H62    . DA  E 3 20  ? -50.529 29.399  29.640  1.00 59.36  ? 20  DA  E H62    1 
ATOM   8560 H  H2     . DA  E 3 20  ? -49.892 34.127  31.106  1.00 55.16  ? 20  DA  E H2     1 
ATOM   8561 P  P      . DG  E 3 21  ? -52.609 33.139  38.793  1.00 94.41  ? 21  DG  E P      1 
ATOM   8562 O  OP1    . DG  E 3 21  ? -52.326 33.866  40.051  1.00 100.53 ? 21  DG  E OP1    1 
ATOM   8563 O  OP2    . DG  E 3 21  ? -53.564 32.007  38.791  1.00 58.70  ? 21  DG  E OP2    1 
ATOM   8564 O  "O5'"  . DG  E 3 21  ? -53.073 34.190  37.680  1.00 90.48  ? 21  DG  E "O5'"  1 
ATOM   8565 C  "C5'"  . DG  E 3 21  ? -52.235 35.287  37.335  1.00 74.09  ? 21  DG  E "C5'"  1 
ATOM   8566 C  "C4'"  . DG  E 3 21  ? -52.758 35.988  36.091  1.00 64.76  ? 21  DG  E "C4'"  1 
ATOM   8567 O  "O4'"  . DG  E 3 21  ? -52.545 35.135  34.938  1.00 59.57  ? 21  DG  E "O4'"  1 
ATOM   8568 C  "C3'"  . DG  E 3 21  ? -54.255 36.312  36.125  1.00 72.60  ? 21  DG  E "C3'"  1 
ATOM   8569 O  "O3'"  . DG  E 3 21  ? -54.481 37.687  35.821  1.00 79.22  ? 21  DG  E "O3'"  1 
ATOM   8570 C  "C2'"  . DG  E 3 21  ? -54.867 35.378  35.078  1.00 50.22  ? 21  DG  E "C2'"  1 
ATOM   8571 C  "C1'"  . DG  E 3 21  ? -53.699 35.125  34.132  1.00 58.89  ? 21  DG  E "C1'"  1 
ATOM   8572 N  N9     . DG  E 3 21  ? -53.773 33.846  33.432  1.00 55.00  ? 21  DG  E N9     1 
ATOM   8573 C  C8     . DG  E 3 21  ? -53.940 32.601  33.989  1.00 53.17  ? 21  DG  E C8     1 
ATOM   8574 N  N7     . DG  E 3 21  ? -53.956 31.636  33.111  1.00 44.44  ? 21  DG  E N7     1 
ATOM   8575 C  C5     . DG  E 3 21  ? -53.767 32.280  31.896  1.00 35.67  ? 21  DG  E C5     1 
ATOM   8576 C  C6     . DG  E 3 21  ? -53.688 31.751  30.587  1.00 33.81  ? 21  DG  E C6     1 
ATOM   8577 O  O6     . DG  E 3 21  ? -53.772 30.568  30.231  1.00 37.59  ? 21  DG  E O6     1 
ATOM   8578 N  N1     . DG  E 3 21  ? -53.490 32.751  29.640  1.00 34.30  ? 21  DG  E N1     1 
ATOM   8579 C  C2     . DG  E 3 21  ? -53.383 34.094  29.924  1.00 47.33  ? 21  DG  E C2     1 
ATOM   8580 N  N2     . DG  E 3 21  ? -53.193 34.915  28.882  1.00 45.75  ? 21  DG  E N2     1 
ATOM   8581 N  N3     . DG  E 3 21  ? -53.454 34.600  31.146  1.00 42.73  ? 21  DG  E N3     1 
ATOM   8582 C  C4     . DG  E 3 21  ? -53.645 33.639  32.078  1.00 36.26  ? 21  DG  E C4     1 
ATOM   8583 H  "H5'"  . DG  E 3 21  ? -51.336 34.964  37.167  1.00 89.12  ? 21  DG  E "H5'"  1 
ATOM   8584 H  "H5''" . DG  E 3 21  ? -52.212 35.917  38.072  1.00 89.12  ? 21  DG  E "H5''" 1 
ATOM   8585 H  "H4'"  . DG  E 3 21  ? -52.270 36.814  35.950  1.00 77.93  ? 21  DG  E "H4'"  1 
ATOM   8586 H  "H3'"  . DG  E 3 21  ? -54.613 36.092  36.999  1.00 87.34  ? 21  DG  E "H3'"  1 
ATOM   8587 H  "HO3'" . DG  E 3 21  ? -54.870 38.182  36.377  1.00 95.28  ? 21  DG  E "HO3'" 1 
ATOM   8588 H  "H2'"  . DG  E 3 21  ? -55.178 34.552  35.482  1.00 60.48  ? 21  DG  E "H2'"  1 
ATOM   8589 H  "H2''" . DG  E 3 21  ? -55.607 35.803  34.617  1.00 60.48  ? 21  DG  E "H2''" 1 
ATOM   8590 H  "H1'"  . DG  E 3 21  ? -53.648 35.838  33.475  1.00 70.89  ? 21  DG  E "H1'"  1 
ATOM   8591 H  H8     . DG  E 3 21  ? -54.034 32.459  34.903  1.00 64.02  ? 21  DG  E H8     1 
ATOM   8592 H  H1     . DG  E 3 21  ? -53.430 32.512  28.816  1.00 41.37  ? 21  DG  E H1     1 
ATOM   8593 H  H21    . DG  E 3 21  ? -53.119 35.762  29.010  1.00 55.12  ? 21  DG  E H21    1 
ATOM   8594 H  H22    . DG  E 3 21  ? -53.146 34.595  28.085  1.00 55.12  ? 21  DG  E H22    1 
ATOM   8595 P  P      . DC  F 2 1   ? 41.919  -22.753 11.900  1.00 133.75 ? 1   DC  F P      1 
ATOM   8596 O  OP1    . DC  F 2 1   ? 43.260  -22.196 11.610  1.00 97.21  ? 1   DC  F OP1    1 
ATOM   8597 O  OP2    . DC  F 2 1   ? 41.746  -23.738 12.993  1.00 123.62 ? 1   DC  F OP2    1 
ATOM   8598 O  "O5'"  . DC  F 2 1   ? 40.898  -21.544 12.144  1.00 129.54 ? 1   DC  F "O5'"  1 
ATOM   8599 C  "C5'"  . DC  F 2 1   ? 39.941  -21.200 11.140  1.00 140.09 ? 1   DC  F "C5'"  1 
ATOM   8600 C  "C4'"  . DC  F 2 1   ? 40.626  -20.881 9.823   1.00 151.23 ? 1   DC  F "C4'"  1 
ATOM   8601 O  "O4'"  . DC  F 2 1   ? 40.484  -22.014 8.916   1.00 161.61 ? 1   DC  F "O4'"  1 
ATOM   8602 C  "C3'"  . DC  F 2 1   ? 40.060  -19.684 9.063   1.00 155.55 ? 1   DC  F "C3'"  1 
ATOM   8603 O  "O3'"  . DC  F 2 1   ? 41.115  -19.018 8.355   1.00 159.04 ? 1   DC  F "O3'"  1 
ATOM   8604 C  "C2'"  . DC  F 2 1   ? 39.014  -20.325 8.153   1.00 160.90 ? 1   DC  F "C2'"  1 
ATOM   8605 C  "C1'"  . DC  F 2 1   ? 39.653  -21.665 7.815   1.00 151.81 ? 1   DC  F "C1'"  1 
ATOM   8606 N  N1     . DC  F 2 1   ? 38.680  -22.788 7.602   1.00 141.98 ? 1   DC  F N1     1 
ATOM   8607 C  C2     . DC  F 2 1   ? 38.413  -23.249 6.304   1.00 134.21 ? 1   DC  F C2     1 
ATOM   8608 O  O2     . DC  F 2 1   ? 38.951  -22.691 5.340   1.00 114.62 ? 1   DC  F O2     1 
ATOM   8609 N  N3     . DC  F 2 1   ? 37.543  -24.281 6.140   1.00 142.72 ? 1   DC  F N3     1 
ATOM   8610 C  C4     . DC  F 2 1   ? 36.977  -24.854 7.205   1.00 135.42 ? 1   DC  F C4     1 
ATOM   8611 N  N4     . DC  F 2 1   ? 36.131  -25.871 6.998   1.00 125.74 ? 1   DC  F N4     1 
ATOM   8612 C  C5     . DC  F 2 1   ? 37.254  -24.413 8.532   1.00 129.59 ? 1   DC  F C5     1 
ATOM   8613 C  C6     . DC  F 2 1   ? 38.107  -23.394 8.683   1.00 138.32 ? 1   DC  F C6     1 
ATOM   8614 H  "H5'"  . DC  F 2 1   ? 39.435  -20.425 11.432  1.00 168.32 ? 1   DC  F "H5'"  1 
ATOM   8615 H  "H5''" . DC  F 2 1   ? 39.332  -21.944 11.011  1.00 168.32 ? 1   DC  F "H5''" 1 
ATOM   8616 H  "H4'"  . DC  F 2 1   ? 41.568  -20.725 9.993   1.00 181.70 ? 1   DC  F "H4'"  1 
ATOM   8617 H  "H3'"  . DC  F 2 1   ? 39.618  -19.059 9.659   1.00 186.88 ? 1   DC  F "H3'"  1 
ATOM   8618 H  "H2'"  . DC  F 2 1   ? 38.169  -20.443 8.614   1.00 193.29 ? 1   DC  F "H2'"  1 
ATOM   8619 H  "H2''" . DC  F 2 1   ? 38.867  -19.793 7.355   1.00 193.29 ? 1   DC  F "H2''" 1 
ATOM   8620 H  "H1'"  . DC  F 2 1   ? 40.191  -21.552 7.016   1.00 182.39 ? 1   DC  F "H1'"  1 
ATOM   8621 H  H41    . DC  F 2 1   ? 35.753  -26.258 7.666   1.00 151.10 ? 1   DC  F H41    1 
ATOM   8622 H  H42    . DC  F 2 1   ? 35.966  -26.137 6.197   1.00 151.10 ? 1   DC  F H42    1 
ATOM   8623 H  H5     . DC  F 2 1   ? 36.855  -24.819 9.268   1.00 155.72 ? 1   DC  F H5     1 
ATOM   8624 H  H6     . DC  F 2 1   ? 38.313  -23.093 9.538   1.00 166.21 ? 1   DC  F H6     1 
ATOM   8625 P  P      . DT  F 2 2   ? 40.947  -17.502 7.844   1.00 177.85 ? 2   DT  F P      1 
ATOM   8626 O  OP1    . DT  F 2 2   ? 42.236  -16.814 8.081   1.00 156.79 ? 2   DT  F OP1    1 
ATOM   8627 O  OP2    . DT  F 2 2   ? 39.706  -16.966 8.444   1.00 171.19 ? 2   DT  F OP2    1 
ATOM   8628 O  "O5'"  . DT  F 2 2   ? 40.711  -17.637 6.265   1.00 174.59 ? 2   DT  F "O5'"  1 
ATOM   8629 C  "C5'"  . DT  F 2 2   ? 40.936  -16.506 5.415   1.00 169.81 ? 2   DT  F "C5'"  1 
ATOM   8630 C  "C4'"  . DT  F 2 2   ? 40.522  -16.801 3.983   1.00 169.06 ? 2   DT  F "C4'"  1 
ATOM   8631 O  "O4'"  . DT  F 2 2   ? 39.642  -17.954 3.954   1.00 172.80 ? 2   DT  F "O4'"  1 
ATOM   8632 C  "C3'"  . DT  F 2 2   ? 39.760  -15.685 3.288   1.00 167.76 ? 2   DT  F "C3'"  1 
ATOM   8633 O  "O3'"  . DT  F 2 2   ? 40.044  -15.692 1.889   1.00 167.26 ? 2   DT  F "O3'"  1 
ATOM   8634 C  "C2'"  . DT  F 2 2   ? 38.305  -16.021 3.617   1.00 164.38 ? 2   DT  F "C2'"  1 
ATOM   8635 C  "C1'"  . DT  F 2 2   ? 38.316  -17.550 3.640   1.00 162.83 ? 2   DT  F "C1'"  1 
ATOM   8636 N  N1     . DT  F 2 2   ? 37.417  -18.183 4.664   1.00 156.13 ? 2   DT  F N1     1 
ATOM   8637 C  C2     . DT  F 2 2   ? 36.702  -19.310 4.327   1.00 146.30 ? 2   DT  F C2     1 
ATOM   8638 O  O2     . DT  F 2 2   ? 36.702  -19.793 3.208   1.00 139.36 ? 2   DT  F O2     1 
ATOM   8639 N  N3     . DT  F 2 2   ? 35.939  -19.829 5.339   1.00 146.43 ? 2   DT  F N3     1 
ATOM   8640 C  C4     . DT  F 2 2   ? 35.850  -19.367 6.639   1.00 147.69 ? 2   DT  F C4     1 
ATOM   8641 O  O4     . DT  F 2 2   ? 35.140  -19.908 7.481   1.00 144.35 ? 2   DT  F O4     1 
ATOM   8642 C  C5     . DT  F 2 2   ? 36.652  -18.204 6.937   1.00 151.78 ? 2   DT  F C5     1 
ATOM   8643 C  C7     . DT  F 2 2   ? 36.640  -17.613 8.311   1.00 143.91 ? 2   DT  F C7     1 
ATOM   8644 C  C6     . DT  F 2 2   ? 37.400  -17.684 5.953   1.00 155.84 ? 2   DT  F C6     1 
ATOM   8645 H  "H5'"  . DT  F 2 2   ? 41.878  -16.277 5.433   1.00 203.99 ? 2   DT  F "H5'"  1 
ATOM   8646 H  "H5''" . DT  F 2 2   ? 40.421  -15.753 5.746   1.00 203.99 ? 2   DT  F "H5''" 1 
ATOM   8647 H  "H4'"  . DT  F 2 2   ? 41.317  -17.005 3.466   1.00 203.08 ? 2   DT  F "H4'"  1 
ATOM   8648 H  "H3'"  . DT  F 2 2   ? 39.984  -14.818 3.662   1.00 201.53 ? 2   DT  F "H3'"  1 
ATOM   8649 H  "H2'"  . DT  F 2 2   ? 38.045  -15.658 4.478   1.00 197.47 ? 2   DT  F "H2'"  1 
ATOM   8650 H  "H2''" . DT  F 2 2   ? 37.702  -15.684 2.936   1.00 197.47 ? 2   DT  F "H2''" 1 
ATOM   8651 H  "H1'"  . DT  F 2 2   ? 38.065  -17.852 2.753   1.00 195.61 ? 2   DT  F "H1'"  1 
ATOM   8652 H  H3     . DT  F 2 2   ? 35.463  -20.519 5.145   1.00 175.94 ? 2   DT  F H3     1 
ATOM   8653 H  H71    . DT  F 2 2   ? 35.881  -17.969 8.800   1.00 172.91 ? 2   DT  F H71    1 
ATOM   8654 H  H72    . DT  F 2 2   ? 37.465  -17.849 8.763   1.00 172.91 ? 2   DT  F H72    1 
ATOM   8655 H  H73    . DT  F 2 2   ? 36.565  -16.649 8.239   1.00 172.91 ? 2   DT  F H73    1 
ATOM   8656 H  H6     . DT  F 2 2   ? 37.935  -16.948 6.147   1.00 187.23 ? 2   DT  F H6     1 
ATOM   8657 P  P      . DC  F 2 3   ? 39.486  -14.520 0.944   1.00 173.74 ? 3   DC  F P      1 
ATOM   8658 O  OP1    . DC  F 2 3   ? 40.496  -14.289 -0.112  1.00 145.40 ? 3   DC  F OP1    1 
ATOM   8659 O  OP2    . DC  F 2 3   ? 39.059  -13.405 1.817   1.00 168.85 ? 3   DC  F OP2    1 
ATOM   8660 O  "O5'"  . DC  F 2 3   ? 38.180  -15.145 0.269   1.00 164.29 ? 3   DC  F "O5'"  1 
ATOM   8661 C  "C5'"  . DC  F 2 3   ? 38.243  -16.400 -0.405  1.00 152.22 ? 3   DC  F "C5'"  1 
ATOM   8662 C  "C4'"  . DC  F 2 3   ? 36.848  -16.853 -0.796  1.00 149.80 ? 3   DC  F "C4'"  1 
ATOM   8663 O  "O4'"  . DC  F 2 3   ? 36.190  -17.438 0.365   1.00 145.53 ? 3   DC  F "O4'"  1 
ATOM   8664 C  "C3'"  . DC  F 2 3   ? 35.936  -15.722 -1.279  1.00 150.22 ? 3   DC  F "C3'"  1 
ATOM   8665 O  "O3'"  . DC  F 2 3   ? 35.128  -16.121 -2.384  1.00 150.85 ? 3   DC  F "O3'"  1 
ATOM   8666 C  "C2'"  . DC  F 2 3   ? 35.097  -15.421 -0.038  1.00 146.02 ? 3   DC  F "C2'"  1 
ATOM   8667 C  "C1'"  . DC  F 2 3   ? 34.931  -16.821 0.546   1.00 141.17 ? 3   DC  F "C1'"  1 
ATOM   8668 N  N1     . DC  F 2 3   ? 34.567  -16.861 2.000   1.00 136.53 ? 3   DC  F N1     1 
ATOM   8669 C  C2     . DC  F 2 3   ? 33.727  -17.881 2.469   1.00 138.35 ? 3   DC  F C2     1 
ATOM   8670 O  O2     . DC  F 2 3   ? 33.310  -18.733 1.675   1.00 134.55 ? 3   DC  F O2     1 
ATOM   8671 N  N3     . DC  F 2 3   ? 33.399  -17.908 3.785   1.00 141.51 ? 3   DC  F N3     1 
ATOM   8672 C  C4     . DC  F 2 3   ? 33.870  -16.973 4.610   1.00 140.90 ? 3   DC  F C4     1 
ATOM   8673 N  N4     . DC  F 2 3   ? 33.519  -17.041 5.899   1.00 140.80 ? 3   DC  F N4     1 
ATOM   8674 C  C5     . DC  F 2 3   ? 34.723  -15.927 4.152   1.00 137.48 ? 3   DC  F C5     1 
ATOM   8675 C  C6     . DC  F 2 3   ? 35.040  -15.910 2.854   1.00 139.24 ? 3   DC  F C6     1 
ATOM   8676 H  "H5'"  . DC  F 2 3   ? 38.645  -17.061 0.180   1.00 182.87 ? 3   DC  F "H5'"  1 
ATOM   8677 H  "H5''" . DC  F 2 3   ? 38.788  -16.310 -1.203  1.00 182.87 ? 3   DC  F "H5''" 1 
ATOM   8678 H  "H4'"  . DC  F 2 3   ? 36.903  -17.532 -1.487  1.00 179.97 ? 3   DC  F "H4'"  1 
ATOM   8679 H  "H3'"  . DC  F 2 3   ? 36.475  -14.956 -1.533  1.00 180.48 ? 3   DC  F "H3'"  1 
ATOM   8680 H  "H2'"  . DC  F 2 3   ? 35.562  -14.830 0.575   1.00 175.44 ? 3   DC  F "H2'"  1 
ATOM   8681 H  "H2''" . DC  F 2 3   ? 34.242  -15.026 -0.270  1.00 175.44 ? 3   DC  F "H2''" 1 
ATOM   8682 H  "H1'"  . DC  F 2 3   ? 34.243  -17.302 0.060   1.00 169.62 ? 3   DC  F "H1'"  1 
ATOM   8683 H  H41    . DC  F 2 3   ? 33.808  -16.452 6.455   1.00 169.18 ? 3   DC  F H41    1 
ATOM   8684 H  H42    . DC  F 2 3   ? 33.005  -17.674 6.171   1.00 169.18 ? 3   DC  F H42    1 
ATOM   8685 H  H5     . DC  F 2 3   ? 35.047  -15.279 4.736   1.00 165.20 ? 3   DC  F H5     1 
ATOM   8686 H  H6     . DC  F 2 3   ? 35.594  -15.237 2.528   1.00 167.31 ? 3   DC  F H6     1 
ATOM   8687 P  P      . DA  F 2 4   ? 35.046  -15.180 -3.684  1.00 162.16 ? 4   DA  F P      1 
ATOM   8688 O  OP1    . DA  F 2 4   ? 36.255  -15.445 -4.496  1.00 147.47 ? 4   DA  F OP1    1 
ATOM   8689 O  OP2    . DA  F 2 4   ? 34.761  -13.804 -3.223  1.00 128.86 ? 4   DA  F OP2    1 
ATOM   8690 O  "O5'"  . DA  F 2 4   ? 33.771  -15.718 -4.492  1.00 138.78 ? 4   DA  F "O5'"  1 
ATOM   8691 C  "C5'"  . DA  F 2 4   ? 33.731  -17.051 -4.982  1.00 139.05 ? 4   DA  F "C5'"  1 
ATOM   8692 C  "C4'"  . DA  F 2 4   ? 32.351  -17.664 -4.793  1.00 150.60 ? 4   DA  F "C4'"  1 
ATOM   8693 O  "O4'"  . DA  F 2 4   ? 32.125  -17.931 -3.381  1.00 154.07 ? 4   DA  F "O4'"  1 
ATOM   8694 C  "C3'"  . DA  F 2 4   ? 31.190  -16.779 -5.256  1.00 147.87 ? 4   DA  F "C3'"  1 
ATOM   8695 O  "O3'"  . DA  F 2 4   ? 30.247  -17.539 -6.002  1.00 155.49 ? 4   DA  F "O3'"  1 
ATOM   8696 C  "C2'"  . DA  F 2 4   ? 30.603  -16.236 -3.954  1.00 139.48 ? 4   DA  F "C2'"  1 
ATOM   8697 C  "C1'"  . DA  F 2 4   ? 30.906  -17.351 -2.960  1.00 142.55 ? 4   DA  F "C1'"  1 
ATOM   8698 N  N9     . DA  F 2 4   ? 31.058  -16.891 -1.582  1.00 135.80 ? 4   DA  F N9     1 
ATOM   8699 C  C8     . DA  F 2 4   ? 31.885  -15.903 -1.130  1.00 133.55 ? 4   DA  F C8     1 
ATOM   8700 N  N7     . DA  F 2 4   ? 31.823  -15.711 0.167   1.00 134.57 ? 4   DA  F N7     1 
ATOM   8701 C  C5     . DA  F 2 4   ? 30.904  -16.650 0.599   1.00 141.24 ? 4   DA  F C5     1 
ATOM   8702 C  C6     . DA  F 2 4   ? 30.397  -16.965 1.877   1.00 142.36 ? 4   DA  F C6     1 
ATOM   8703 N  N6     . DA  F 2 4   ? 30.770  -16.331 2.994   1.00 137.49 ? 4   DA  F N6     1 
ATOM   8704 N  N1     . DA  F 2 4   ? 29.489  -17.959 1.961   1.00 138.21 ? 4   DA  F N1     1 
ATOM   8705 C  C2     . DA  F 2 4   ? 29.118  -18.591 0.841   1.00 138.63 ? 4   DA  F C2     1 
ATOM   8706 N  N3     . DA  F 2 4   ? 29.523  -18.385 -0.412  1.00 137.69 ? 4   DA  F N3     1 
ATOM   8707 C  C4     . DA  F 2 4   ? 30.425  -17.391 -0.465  1.00 140.91 ? 4   DA  F C4     1 
ATOM   8708 H  "H5'"  . DA  F 2 4   ? 34.385  -17.585 -4.505  1.00 167.07 ? 4   DA  F "H5'"  1 
ATOM   8709 H  "H5''" . DA  F 2 4   ? 33.952  -17.050 -5.926  1.00 167.07 ? 4   DA  F "H5''" 1 
ATOM   8710 H  "H4'"  . DA  F 2 4   ? 32.306  -18.507 -5.270  1.00 180.93 ? 4   DA  F "H4'"  1 
ATOM   8711 H  "H3'"  . DA  F 2 4   ? 31.530  -16.044 -5.789  1.00 177.66 ? 4   DA  F "H3'"  1 
ATOM   8712 H  "H2'"  . DA  F 2 4   ? 31.032  -15.406 -3.694  1.00 167.59 ? 4   DA  F "H2'"  1 
ATOM   8713 H  "H2''" . DA  F 2 4   ? 29.648  -16.086 -4.034  1.00 167.59 ? 4   DA  F "H2''" 1 
ATOM   8714 H  "H1'"  . DA  F 2 4   ? 30.200  -18.015 -2.994  1.00 171.27 ? 4   DA  F "H1'"  1 
ATOM   8715 H  H8     . DA  F 2 4   ? 32.441  -15.411 -1.690  1.00 160.47 ? 4   DA  F H8     1 
ATOM   8716 H  H61    . DA  F 2 4   ? 30.433  -16.560 3.751   1.00 165.20 ? 4   DA  F H61    1 
ATOM   8717 H  H62    . DA  F 2 4   ? 31.348  -15.695 2.955   1.00 165.20 ? 4   DA  F H62    1 
ATOM   8718 H  H2     . DA  F 2 4   ? 28.490  -19.267 0.952   1.00 166.57 ? 4   DA  F H2     1 
ATOM   8719 P  P      . DT  F 2 5   ? 28.969  -16.828 -6.666  1.00 148.46 ? 5   DT  F P      1 
ATOM   8720 O  OP1    . DT  F 2 5   ? 28.750  -17.432 -7.999  1.00 143.65 ? 5   DT  F OP1    1 
ATOM   8721 O  OP2    . DT  F 2 5   ? 29.159  -15.364 -6.545  1.00 122.27 ? 5   DT  F OP2    1 
ATOM   8722 O  "O5'"  . DT  F 2 5   ? 27.770  -17.245 -5.694  1.00 148.96 ? 5   DT  F "O5'"  1 
ATOM   8723 C  "C5'"  . DT  F 2 5   ? 27.529  -18.628 -5.433  1.00 149.52 ? 5   DT  F "C5'"  1 
ATOM   8724 C  "C4'"  . DT  F 2 5   ? 26.434  -18.808 -4.396  1.00 154.35 ? 5   DT  F "C4'"  1 
ATOM   8725 O  "O4'"  . DT  F 2 5   ? 26.930  -18.377 -3.099  1.00 156.19 ? 5   DT  F "O4'"  1 
ATOM   8726 C  "C3'"  . DT  F 2 5   ? 25.159  -17.999 -4.662  1.00 151.28 ? 5   DT  F "C3'"  1 
ATOM   8727 O  "O3'"  . DT  F 2 5   ? 24.002  -18.839 -4.560  1.00 157.53 ? 5   DT  F "O3'"  1 
ATOM   8728 C  "C2'"  . DT  F 2 5   ? 25.190  -16.906 -3.590  1.00 151.02 ? 5   DT  F "C2'"  1 
ATOM   8729 C  "C1'"  . DT  F 2 5   ? 25.951  -17.587 -2.462  1.00 148.36 ? 5   DT  F "C1'"  1 
ATOM   8730 N  N1     . DT  F 2 5   ? 26.631  -16.652 -1.505  1.00 141.77 ? 5   DT  F N1     1 
ATOM   8731 C  C2     . DT  F 2 5   ? 26.351  -16.758 -0.162  1.00 145.37 ? 5   DT  F C2     1 
ATOM   8732 O  O2     . DT  F 2 5   ? 25.561  -17.565 0.294   1.00 146.66 ? 5   DT  F O2     1 
ATOM   8733 N  N3     . DT  F 2 5   ? 27.021  -15.873 0.637   1.00 141.94 ? 5   DT  F N3     1 
ATOM   8734 C  C4     . DT  F 2 5   ? 27.934  -14.915 0.242   1.00 139.88 ? 5   DT  F C4     1 
ATOM   8735 O  O4     . DT  F 2 5   ? 28.483  -14.166 1.046   1.00 131.59 ? 5   DT  F O4     1 
ATOM   8736 C  C5     . DT  F 2 5   ? 28.193  -14.858 -1.178  1.00 141.20 ? 5   DT  F C5     1 
ATOM   8737 C  C7     . DT  F 2 5   ? 29.164  -13.858 -1.723  1.00 145.65 ? 5   DT  F C7     1 
ATOM   8738 C  C6     . DT  F 2 5   ? 27.541  -15.724 -1.976  1.00 136.79 ? 5   DT  F C6     1 
ATOM   8739 H  "H5'"  . DT  F 2 5   ? 28.346  -19.037 -5.108  1.00 179.64 ? 5   DT  F "H5'"  1 
ATOM   8740 H  "H5''" . DT  F 2 5   ? 27.263  -19.065 -6.257  1.00 179.64 ? 5   DT  F "H5''" 1 
ATOM   8741 H  "H4'"  . DT  F 2 5   ? 26.194  -19.746 -4.336  1.00 185.43 ? 5   DT  F "H4'"  1 
ATOM   8742 H  "H3'"  . DT  F 2 5   ? 25.203  -17.589 -5.540  1.00 181.75 ? 5   DT  F "H3'"  1 
ATOM   8743 H  "H2'"  . DT  F 2 5   ? 25.655  -16.115 -3.903  1.00 181.44 ? 5   DT  F "H2'"  1 
ATOM   8744 H  "H2''" . DT  F 2 5   ? 24.294  -16.656 -3.312  1.00 181.44 ? 5   DT  F "H2''" 1 
ATOM   8745 H  "H1'"  . DT  F 2 5   ? 25.342  -18.145 -1.953  1.00 178.24 ? 5   DT  F "H1'"  1 
ATOM   8746 H  H3     . DT  F 2 5   ? 26.855  -15.918 1.479   1.00 170.55 ? 5   DT  F H3     1 
ATOM   8747 H  H71    . DT  F 2 5   ? 29.881  -14.328 -2.176  1.00 174.99 ? 5   DT  F H71    1 
ATOM   8748 H  H72    . DT  F 2 5   ? 28.703  -13.277 -2.348  1.00 174.99 ? 5   DT  F H72    1 
ATOM   8749 H  H73    . DT  F 2 5   ? 29.524  -13.335 -0.989  1.00 174.99 ? 5   DT  F H73    1 
ATOM   8750 H  H6     . DT  F 2 5   ? 27.711  -15.697 -2.890  1.00 164.36 ? 5   DT  F H6     1 
ATOM   8751 P  P      . DT  F 2 6   ? 22.609  -18.387 -5.222  1.00 166.65 ? 6   DT  F P      1 
ATOM   8752 O  OP1    . DT  F 2 6   ? 22.123  -19.526 -6.033  1.00 151.52 ? 6   DT  F OP1    1 
ATOM   8753 O  OP2    . DT  F 2 6   ? 22.816  -17.070 -5.863  1.00 160.63 ? 6   DT  F OP2    1 
ATOM   8754 O  "O5'"  . DT  F 2 6   ? 21.614  -18.217 -3.978  1.00 166.24 ? 6   DT  F "O5'"  1 
ATOM   8755 C  "C5'"  . DT  F 2 6   ? 21.368  -19.315 -3.101  1.00 162.92 ? 6   DT  F "C5'"  1 
ATOM   8756 C  "C4'"  . DT  F 2 6   ? 20.835  -18.831 -1.760  1.00 157.40 ? 6   DT  F "C4'"  1 
ATOM   8757 O  "O4'"  . DT  F 2 6   ? 21.854  -18.048 -1.096  1.00 153.64 ? 6   DT  F "O4'"  1 
ATOM   8758 C  "C3'"  . DT  F 2 6   ? 19.593  -17.936 -1.834  1.00 150.39 ? 6   DT  F "C3'"  1 
ATOM   8759 O  "O3'"  . DT  F 2 6   ? 18.482  -18.571 -1.196  1.00 142.11 ? 6   DT  F "O3'"  1 
ATOM   8760 C  "C2'"  . DT  F 2 6   ? 19.994  -16.633 -1.133  1.00 152.52 ? 6   DT  F "C2'"  1 
ATOM   8761 C  "C1'"  . DT  F 2 6   ? 21.240  -17.024 -0.351  1.00 156.18 ? 6   DT  F "C1'"  1 
ATOM   8762 N  N1     . DT  F 2 6   ? 22.224  -15.915 -0.171  1.00 155.05 ? 6   DT  F N1     1 
ATOM   8763 C  C2     . DT  F 2 6   ? 22.463  -15.423 1.095   1.00 146.32 ? 6   DT  F C2     1 
ATOM   8764 O  O2     . DT  F 2 6   ? 21.906  -15.843 2.094   1.00 144.08 ? 6   DT  F O2     1 
ATOM   8765 N  N3     . DT  F 2 6   ? 23.387  -14.412 1.151   1.00 140.73 ? 6   DT  F N3     1 
ATOM   8766 C  C4     . DT  F 2 6   ? 24.081  -13.856 0.091   1.00 143.39 ? 6   DT  F C4     1 
ATOM   8767 O  O4     . DT  F 2 6   ? 24.892  -12.949 0.242   1.00 143.40 ? 6   DT  F O4     1 
ATOM   8768 C  C5     . DT  F 2 6   ? 23.785  -14.418 -1.206  1.00 143.86 ? 6   DT  F C5     1 
ATOM   8769 C  C7     . DT  F 2 6   ? 24.474  -13.895 -2.426  1.00 127.98 ? 6   DT  F C7     1 
ATOM   8770 C  C6     . DT  F 2 6   ? 22.882  -15.409 -1.274  1.00 151.08 ? 6   DT  F C6     1 
ATOM   8771 H  "H5'"  . DT  F 2 6   ? 22.195  -19.801 -2.959  1.00 195.72 ? 6   DT  F "H5'"  1 
ATOM   8772 H  "H5''" . DT  F 2 6   ? 20.718  -19.909 -3.507  1.00 195.72 ? 6   DT  F "H5''" 1 
ATOM   8773 H  "H4'"  . DT  F 2 6   ? 20.622  -19.600 -1.208  1.00 189.09 ? 6   DT  F "H4'"  1 
ATOM   8774 H  "H3'"  . DT  F 2 6   ? 19.400  -17.743 -2.764  1.00 180.68 ? 6   DT  F "H3'"  1 
ATOM   8775 H  "H2'"  . DT  F 2 6   ? 20.191  -15.936 -1.778  1.00 183.24 ? 6   DT  F "H2'"  1 
ATOM   8776 H  "H2''" . DT  F 2 6   ? 19.292  -16.325 -0.540  1.00 183.24 ? 6   DT  F "H2''" 1 
ATOM   8777 H  "H1'"  . DT  F 2 6   ? 20.981  -17.356 0.523   1.00 187.63 ? 6   DT  F "H1'"  1 
ATOM   8778 H  H3     . DT  F 2 6   ? 23.554  -14.089 1.930   1.00 169.09 ? 6   DT  F H3     1 
ATOM   8779 H  H71    . DT  F 2 6   ? 24.625  -12.942 -2.320  1.00 153.79 ? 6   DT  F H71    1 
ATOM   8780 H  H72    . DT  F 2 6   ? 25.322  -14.354 -2.531  1.00 153.79 ? 6   DT  F H72    1 
ATOM   8781 H  H73    . DT  F 2 6   ? 23.912  -14.056 -3.200  1.00 153.79 ? 6   DT  F H73    1 
ATOM   8782 H  H6     . DT  F 2 6   ? 22.689  -15.774 -2.107  1.00 181.51 ? 6   DT  F H6     1 
ATOM   8783 P  P      . DG  F 2 7   ? 17.050  -17.845 -1.150  1.00 148.03 ? 7   DG  F P      1 
ATOM   8784 O  OP1    . DG  F 2 7   ? 16.010  -18.895 -1.095  1.00 124.14 ? 7   DG  F OP1    1 
ATOM   8785 O  OP2    . DG  F 2 7   ? 17.025  -16.834 -2.231  1.00 148.00 ? 7   DG  F OP2    1 
ATOM   8786 O  "O5'"  . DG  F 2 7   ? 17.056  -17.065 0.249   1.00 141.98 ? 7   DG  F "O5'"  1 
ATOM   8787 C  "C5'"  . DG  F 2 7   ? 17.416  -17.757 1.445   1.00 131.39 ? 7   DG  F "C5'"  1 
ATOM   8788 C  "C4'"  . DG  F 2 7   ? 17.310  -16.848 2.661   1.00 139.05 ? 7   DG  F "C4'"  1 
ATOM   8789 O  "O4'"  . DG  F 2 7   ? 18.493  -16.007 2.749   1.00 142.57 ? 7   DG  F "O4'"  1 
ATOM   8790 C  "C3'"  . DG  F 2 7   ? 16.114  -15.897 2.654   1.00 143.06 ? 7   DG  F "C3'"  1 
ATOM   8791 O  "O3'"  . DG  F 2 7   ? 15.527  -15.839 3.953   1.00 119.83 ? 7   DG  F "O3'"  1 
ATOM   8792 C  "C2'"  . DG  F 2 7   ? 16.718  -14.562 2.217   1.00 147.01 ? 7   DG  F "C2'"  1 
ATOM   8793 C  "C1'"  . DG  F 2 7   ? 18.117  -14.638 2.805   1.00 142.75 ? 7   DG  F "C1'"  1 
ATOM   8794 N  N9     . DG  F 2 7   ? 19.129  -13.868 2.086   1.00 142.19 ? 7   DG  F N9     1 
ATOM   8795 C  C8     . DG  F 2 7   ? 19.446  -13.955 0.753   1.00 142.59 ? 7   DG  F C8     1 
ATOM   8796 N  N7     . DG  F 2 7   ? 20.411  -13.155 0.394   1.00 138.19 ? 7   DG  F N7     1 
ATOM   8797 C  C5     . DG  F 2 7   ? 20.758  -12.495 1.565   1.00 135.82 ? 7   DG  F C5     1 
ATOM   8798 C  C6     . DG  F 2 7   ? 21.742  -11.506 1.795   1.00 128.98 ? 7   DG  F C6     1 
ATOM   8799 O  O6     . DG  F 2 7   ? 22.526  -11.000 0.980   1.00 125.64 ? 7   DG  F O6     1 
ATOM   8800 N  N1     . DG  F 2 7   ? 21.765  -11.103 3.128   1.00 126.43 ? 7   DG  F N1     1 
ATOM   8801 C  C2     . DG  F 2 7   ? 20.940  -11.596 4.113   1.00 127.74 ? 7   DG  F C2     1 
ATOM   8802 N  N2     . DG  F 2 7   ? 21.103  -11.091 5.343   1.00 126.94 ? 7   DG  F N2     1 
ATOM   8803 N  N3     . DG  F 2 7   ? 20.016  -12.525 3.909   1.00 127.28 ? 7   DG  F N3     1 
ATOM   8804 C  C4     . DG  F 2 7   ? 19.981  -12.926 2.617   1.00 136.91 ? 7   DG  F C4     1 
ATOM   8805 H  "H5'"  . DG  F 2 7   ? 18.328  -18.076 1.365   1.00 157.88 ? 7   DG  F "H5'"  1 
ATOM   8806 H  "H5''" . DG  F 2 7   ? 16.824  -18.516 1.563   1.00 157.88 ? 7   DG  F "H5''" 1 
ATOM   8807 H  "H4'"  . DG  F 2 7   ? 17.265  -17.396 3.460   1.00 167.07 ? 7   DG  F "H4'"  1 
ATOM   8808 H  "H3'"  . DG  F 2 7   ? 15.459  -16.182 1.999   1.00 171.88 ? 7   DG  F "H3'"  1 
ATOM   8809 H  "H2'"  . DG  F 2 7   ? 16.744  -14.485 1.251   1.00 176.63 ? 7   DG  F "H2'"  1 
ATOM   8810 H  "H2''" . DG  F 2 7   ? 16.222  -13.813 2.581   1.00 176.63 ? 7   DG  F "H2''" 1 
ATOM   8811 H  "H1'"  . DG  F 2 7   ? 18.083  -14.330 3.724   1.00 171.51 ? 7   DG  F "H1'"  1 
ATOM   8812 H  H8     . DG  F 2 7   ? 19.015  -14.530 0.163   1.00 171.32 ? 7   DG  F H8     1 
ATOM   8813 H  H1     . DG  F 2 7   ? 22.337  -10.501 3.352   1.00 151.93 ? 7   DG  F H1     1 
ATOM   8814 H  H21    . DG  F 2 7   ? 20.611  -11.370 5.991   1.00 152.54 ? 7   DG  F H21    1 
ATOM   8815 H  H22    . DG  F 2 7   ? 21.700  -10.489 5.485   1.00 152.54 ? 7   DG  F H22    1 
ATOM   8816 P  P      . DA  F 2 8   ? 14.187  -14.991 4.196   1.00 136.74 ? 8   DA  F P      1 
ATOM   8817 O  OP1    . DA  F 2 8   ? 13.527  -15.554 5.395   1.00 117.62 ? 8   DA  F OP1    1 
ATOM   8818 O  OP2    . DA  F 2 8   ? 13.446  -14.922 2.917   1.00 128.07 ? 8   DA  F OP2    1 
ATOM   8819 O  "O5'"  . DA  F 2 8   ? 14.724  -13.531 4.570   1.00 155.65 ? 8   DA  F "O5'"  1 
ATOM   8820 C  "C5'"  . DA  F 2 8   ? 15.632  -13.357 5.656   1.00 145.97 ? 8   DA  F "C5'"  1 
ATOM   8821 C  "C4'"  . DA  F 2 8   ? 15.971  -11.886 5.857   1.00 142.04 ? 8   DA  F "C4'"  1 
ATOM   8822 O  "O4'"  . DA  F 2 8   ? 17.107  -11.532 5.038   1.00 144.64 ? 8   DA  F "O4'"  1 
ATOM   8823 C  "C3'"  . DA  F 2 8   ? 14.854  -10.910 5.474   1.00 152.13 ? 8   DA  F "C3'"  1 
ATOM   8824 O  "O3'"  . DA  F 2 8   ? 14.286  -10.329 6.646   1.00 159.52 ? 8   DA  F "O3'"  1 
ATOM   8825 C  "C2'"  . DA  F 2 8   ? 15.526  -9.865  4.564   1.00 144.68 ? 8   DA  F "C2'"  1 
ATOM   8826 C  "C1'"  . DA  F 2 8   ? 17.015  -10.172 4.686   1.00 141.67 ? 8   DA  F "C1'"  1 
ATOM   8827 N  N9     . DA  F 2 8   ? 17.770  -9.960  3.453   1.00 137.95 ? 8   DA  F N9     1 
ATOM   8828 C  C8     . DA  F 2 8   ? 17.562  -10.570 2.248   1.00 130.57 ? 8   DA  F C8     1 
ATOM   8829 N  N7     . DA  F 2 8   ? 18.399  -10.194 1.311   1.00 130.65 ? 8   DA  F N7     1 
ATOM   8830 C  C5     . DA  F 2 8   ? 19.218  -9.273  1.945   1.00 133.91 ? 8   DA  F C5     1 
ATOM   8831 C  C6     . DA  F 2 8   ? 20.309  -8.508  1.492   1.00 131.51 ? 8   DA  F C6     1 
ATOM   8832 N  N6     . DA  F 2 8   ? 20.772  -8.565  0.240   1.00 131.75 ? 8   DA  F N6     1 
ATOM   8833 N  N1     . DA  F 2 8   ? 20.910  -7.684  2.377   1.00 130.11 ? 8   DA  F N1     1 
ATOM   8834 C  C2     . DA  F 2 8   ? 20.442  -7.635  3.632   1.00 124.52 ? 8   DA  F C2     1 
ATOM   8835 N  N3     . DA  F 2 8   ? 19.422  -8.306  4.174   1.00 115.45 ? 8   DA  F N3     1 
ATOM   8836 C  C4     . DA  F 2 8   ? 18.847  -9.116  3.268   1.00 130.32 ? 8   DA  F C4     1 
ATOM   8837 H  "H5'"  . DA  F 2 8   ? 16.447  -13.849 5.472   1.00 175.38 ? 8   DA  F "H5'"  1 
ATOM   8838 H  "H5''" . DA  F 2 8   ? 15.229  -13.704 6.467   1.00 175.38 ? 8   DA  F "H5''" 1 
ATOM   8839 H  "H4'"  . DA  F 2 8   ? 16.208  -11.739 6.786   1.00 170.67 ? 8   DA  F "H4'"  1 
ATOM   8840 H  "H3'"  . DA  F 2 8   ? 14.182  -11.380 4.956   1.00 182.78 ? 8   DA  F "H3'"  1 
ATOM   8841 H  "H2'"  . DA  F 2 8   ? 15.226  -9.960  3.646   1.00 173.83 ? 8   DA  F "H2'"  1 
ATOM   8842 H  "H2''" . DA  F 2 8   ? 15.332  -8.964  4.868   1.00 173.83 ? 8   DA  F "H2''" 1 
ATOM   8843 H  "H1'"  . DA  F 2 8   ? 17.398  -9.624  5.388   1.00 170.22 ? 8   DA  F "H1'"  1 
ATOM   8844 H  H8     . DA  F 2 8   ? 16.888  -11.194 2.104   1.00 156.90 ? 8   DA  F H8     1 
ATOM   8845 H  H61    . DA  F 2 8   ? 21.443  -8.080  0.007   1.00 158.32 ? 8   DA  F H61    1 
ATOM   8846 H  H62    . DA  F 2 8   ? 20.398  -9.086  -0.334  1.00 158.32 ? 8   DA  F H62    1 
ATOM   8847 H  H2     . DA  F 2 8   ? 20.888  -7.053  4.204   1.00 149.64 ? 8   DA  F H2     1 
ATOM   8848 P  P      . DG  F 2 9   ? 13.143  -9.208  6.527   1.00 164.98 ? 9   DG  F P      1 
ATOM   8849 O  OP1    . DG  F 2 9   ? 12.350  -9.234  7.776   1.00 139.85 ? 9   DG  F OP1    1 
ATOM   8850 O  OP2    . DG  F 2 9   ? 12.468  -9.386  5.221   1.00 145.00 ? 9   DG  F OP2    1 
ATOM   8851 O  "O5'"  . DG  F 2 9   ? 13.968  -7.842  6.471   1.00 159.59 ? 9   DG  F "O5'"  1 
ATOM   8852 C  "C5'"  . DG  F 2 9   ? 15.153  -7.701  7.249   1.00 155.39 ? 9   DG  F "C5'"  1 
ATOM   8853 C  "C4'"  . DG  F 2 9   ? 15.933  -6.469  6.832   1.00 145.55 ? 9   DG  F "C4'"  1 
ATOM   8854 O  "O4'"  . DG  F 2 9   ? 16.629  -6.726  5.587   1.00 139.82 ? 9   DG  F "O4'"  1 
ATOM   8855 C  "C3'"  . DG  F 2 9   ? 15.073  -5.220  6.587   1.00 153.38 ? 9   DG  F "C3'"  1 
ATOM   8856 O  "O3'"  . DG  F 2 9   ? 15.400  -4.204  7.537   1.00 161.19 ? 9   DG  F "O3'"  1 
ATOM   8857 C  "C2'"  . DG  F 2 9   ? 15.400  -4.806  5.143   1.00 141.08 ? 9   DG  F "C2'"  1 
ATOM   8858 C  "C1'"  . DG  F 2 9   ? 16.721  -5.516  4.878   1.00 129.33 ? 9   DG  F "C1'"  1 
ATOM   8859 N  N9     . DG  F 2 9   ? 16.987  -5.797  3.471   1.00 120.59 ? 9   DG  F N9     1 
ATOM   8860 C  C8     . DG  F 2 9   ? 16.304  -6.658  2.647   1.00 123.35 ? 9   DG  F C8     1 
ATOM   8861 N  N7     . DG  F 2 9   ? 16.777  -6.699  1.430   1.00 118.03 ? 9   DG  F N7     1 
ATOM   8862 C  C5     . DG  F 2 9   ? 17.841  -5.805  1.447   1.00 116.07 ? 9   DG  F C5     1 
ATOM   8863 C  C6     . DG  F 2 9   ? 18.736  -5.427  0.414   1.00 109.62 ? 9   DG  F C6     1 
ATOM   8864 O  O6     . DG  F 2 9   ? 18.765  -5.821  -0.759  1.00 110.34 ? 9   DG  F O6     1 
ATOM   8865 N  N1     . DG  F 2 9   ? 19.670  -4.492  0.856   1.00 114.57 ? 9   DG  F N1     1 
ATOM   8866 C  C2     . DG  F 2 9   ? 19.732  -3.986  2.134   1.00 124.56 ? 9   DG  F C2     1 
ATOM   8867 N  N2     . DG  F 2 9   ? 20.700  -3.091  2.381   1.00 116.96 ? 9   DG  F N2     1 
ATOM   8868 N  N3     . DG  F 2 9   ? 18.899  -4.332  3.108   1.00 130.45 ? 9   DG  F N3     1 
ATOM   8869 C  C4     . DG  F 2 9   ? 17.984  -5.242  2.695   1.00 123.15 ? 9   DG  F C4     1 
ATOM   8870 H  "H5'"  . DG  F 2 9   ? 15.708  -8.487  7.129   1.00 186.68 ? 9   DG  F "H5'"  1 
ATOM   8871 H  "H5''" . DG  F 2 9   ? 14.912  -7.625  8.186   1.00 186.68 ? 9   DG  F "H5''" 1 
ATOM   8872 H  "H4'"  . DG  F 2 9   ? 16.596  -6.267  7.511   1.00 174.87 ? 9   DG  F "H4'"  1 
ATOM   8873 H  "H3'"  . DG  F 2 9   ? 14.133  -5.454  6.640   1.00 184.27 ? 9   DG  F "H3'"  1 
ATOM   8874 H  "H2'"  . DG  F 2 9   ? 14.711  -5.104  4.528   1.00 169.51 ? 9   DG  F "H2'"  1 
ATOM   8875 H  "H2''" . DG  F 2 9   ? 15.496  -3.844  5.067   1.00 169.51 ? 9   DG  F "H2''" 1 
ATOM   8876 H  "H1'"  . DG  F 2 9   ? 17.459  -4.985  5.215   1.00 155.41 ? 9   DG  F "H1'"  1 
ATOM   8877 H  H8     . DG  F 2 9   ? 15.575  -7.163  2.929   1.00 148.24 ? 9   DG  F H8     1 
ATOM   8878 H  H1     . DG  F 2 9   ? 20.251  -4.210  0.288   1.00 137.70 ? 9   DG  F H1     1 
ATOM   8879 H  H21    . DG  F 2 9   ? 20.777  -2.747  3.166   1.00 140.57 ? 9   DG  F H21    1 
ATOM   8880 H  H22    . DG  F 2 9   ? 21.243  -2.861  1.756   1.00 140.57 ? 9   DG  F H22    1 
ATOM   8881 P  P      . DC  F 2 10  ? 14.554  -2.840  7.613   1.00 138.84 ? 10  DC  F P      1 
ATOM   8882 O  OP1    . DC  F 2 10  ? 14.105  -2.674  9.014   1.00 102.59 ? 10  DC  F OP1    1 
ATOM   8883 O  OP2    . DC  F 2 10  ? 13.560  -2.835  6.517   1.00 118.08 ? 10  DC  F OP2    1 
ATOM   8884 O  "O5'"  . DC  F 2 10  ? 15.639  -1.714  7.291   1.00 123.13 ? 10  DC  F "O5'"  1 
ATOM   8885 C  "C5'"  . DC  F 2 10  ? 16.989  -1.888  7.709   1.00 124.57 ? 10  DC  F "C5'"  1 
ATOM   8886 C  "C4'"  . DC  F 2 10  ? 17.853  -0.752  7.200   1.00 128.50 ? 10  DC  F "C4'"  1 
ATOM   8887 O  "O4'"  . DC  F 2 10  ? 18.303  -1.045  5.844   1.00 120.12 ? 10  DC  F "O4'"  1 
ATOM   8888 C  "C3'"  . DC  F 2 10  ? 17.137  0.589   7.112   1.00 133.64 ? 10  DC  F "C3'"  1 
ATOM   8889 O  "O3'"  . DC  F 2 10  ? 18.035  1.650   7.379   1.00 138.25 ? 10  DC  F "O3'"  1 
ATOM   8890 C  "C2'"  . DC  F 2 10  ? 16.620  0.595   5.676   1.00 128.57 ? 10  DC  F "C2'"  1 
ATOM   8891 C  "C1'"  . DC  F 2 10  ? 17.754  -0.105  4.928   1.00 115.18 ? 10  DC  F "C1'"  1 
ATOM   8892 N  N1     . DC  F 2 10  ? 17.327  -0.843  3.690   1.00 100.79 ? 10  DC  F N1     1 
ATOM   8893 C  C2     . DC  F 2 10  ? 18.032  -0.669  2.485   1.00 103.97 ? 10  DC  F C2     1 
ATOM   8894 O  O2     . DC  F 2 10  ? 18.999  0.104   2.451   1.00 110.07 ? 10  DC  F O2     1 
ATOM   8895 N  N3     . DC  F 2 10  ? 17.627  -1.357  1.385   1.00 105.31 ? 10  DC  F N3     1 
ATOM   8896 C  C4     . DC  F 2 10  ? 16.581  -2.183  1.461   1.00 112.92 ? 10  DC  F C4     1 
ATOM   8897 N  N4     . DC  F 2 10  ? 16.214  -2.839  0.355   1.00 112.96 ? 10  DC  F N4     1 
ATOM   8898 C  C5     . DC  F 2 10  ? 15.858  -2.372  2.674   1.00 101.86 ? 10  DC  F C5     1 
ATOM   8899 C  C6     . DC  F 2 10  ? 16.263  -1.692  3.750   1.00 104.58 ? 10  DC  F C6     1 
ATOM   8900 H  "H5'"  . DC  F 2 10  ? 17.327  -2.728  7.363   1.00 149.70 ? 10  DC  F "H5'"  1 
ATOM   8901 H  "H5''" . DC  F 2 10  ? 17.025  -1.908  8.678   1.00 149.70 ? 10  DC  F "H5''" 1 
ATOM   8902 H  "H4'"  . DC  F 2 10  ? 18.633  -0.665  7.769   1.00 154.41 ? 10  DC  F "H4'"  1 
ATOM   8903 H  "H3'"  . DC  F 2 10  ? 16.392  0.625   7.733   1.00 160.59 ? 10  DC  F "H3'"  1 
ATOM   8904 H  "H2'"  . DC  F 2 10  ? 15.787  0.104   5.597   1.00 154.50 ? 10  DC  F "H2'"  1 
ATOM   8905 H  "H2''" . DC  F 2 10  ? 16.486  1.499   5.352   1.00 154.50 ? 10  DC  F "H2''" 1 
ATOM   8906 H  "H1'"  . DC  F 2 10  ? 18.423  0.553   4.681   1.00 138.43 ? 10  DC  F "H1'"  1 
ATOM   8907 H  H41    . DC  F 2 10  ? 15.544  -3.377  0.376   1.00 135.77 ? 10  DC  F H41    1 
ATOM   8908 H  H42    . DC  F 2 10  ? 16.649  -2.723  -0.378  1.00 135.77 ? 10  DC  F H42    1 
ATOM   8909 H  H5     . DC  F 2 10  ? 15.130  -2.949  2.716   1.00 122.44 ? 10  DC  F H5     1 
ATOM   8910 H  H6     . DC  F 2 10  ? 15.810  -1.801  4.555   1.00 125.71 ? 10  DC  F H6     1 
ATOM   8911 P  P      . DA  F 2 11  ? 17.485  3.125   7.699   1.00 135.67 ? 11  DA  F P      1 
ATOM   8912 O  OP1    . DA  F 2 11  ? 17.883  3.467   9.084   1.00 105.21 ? 11  DA  F OP1    1 
ATOM   8913 O  OP2    . DA  F 2 11  ? 16.058  3.168   7.308   1.00 114.89 ? 11  DA  F OP2    1 
ATOM   8914 O  "O5'"  . DA  F 2 11  ? 18.297  4.040   6.672   1.00 123.20 ? 11  DA  F "O5'"  1 
ATOM   8915 C  "C5'"  . DA  F 2 11  ? 19.699  3.844   6.516   1.00 119.24 ? 11  DA  F "C5'"  1 
ATOM   8916 C  "C4'"  . DA  F 2 11  ? 20.235  4.650   5.347   1.00 127.61 ? 11  DA  F "C4'"  1 
ATOM   8917 O  "O4'"  . DA  F 2 11  ? 19.959  3.948   4.104   1.00 122.88 ? 11  DA  F "O4'"  1 
ATOM   8918 C  "C3'"  . DA  F 2 11  ? 19.622  6.034   5.196   1.00 128.66 ? 11  DA  F "C3'"  1 
ATOM   8919 O  "O3'"  . DA  F 2 11  ? 20.607  6.965   4.770   1.00 122.13 ? 11  DA  F "O3'"  1 
ATOM   8920 C  "C2'"  . DA  F 2 11  ? 18.512  5.825   4.165   1.00 127.12 ? 11  DA  F "C2'"  1 
ATOM   8921 C  "C1'"  . DA  F 2 11  ? 19.048  4.685   3.301   1.00 125.71 ? 11  DA  F "C1'"  1 
ATOM   8922 N  N9     . DA  F 2 11  ? 18.019  3.755   2.830   1.00 123.86 ? 11  DA  F N9     1 
ATOM   8923 C  C8     . DA  F 2 11  ? 17.022  3.198   3.576   1.00 113.69 ? 11  DA  F C8     1 
ATOM   8924 N  N7     . DA  F 2 11  ? 16.248  2.379   2.905   1.00 102.85 ? 11  DA  F N7     1 
ATOM   8925 C  C5     . DA  F 2 11  ? 16.777  2.392   1.628   1.00 109.47 ? 11  DA  F C5     1 
ATOM   8926 C  C6     . DA  F 2 11  ? 16.405  1.727   0.444   1.00 111.86 ? 11  DA  F C6     1 
ATOM   8927 N  N6     . DA  F 2 11  ? 15.365  0.890   0.368   1.00 109.91 ? 11  DA  F N6     1 
ATOM   8928 N  N1     . DA  F 2 11  ? 17.143  1.958   -0.663  1.00 117.85 ? 11  DA  F N1     1 
ATOM   8929 C  C2     . DA  F 2 11  ? 18.183  2.800   -0.580  1.00 111.51 ? 11  DA  F C2     1 
ATOM   8930 N  N3     . DA  F 2 11  ? 18.630  3.482   0.478   1.00 109.36 ? 11  DA  F N3     1 
ATOM   8931 C  C4     . DA  F 2 11  ? 17.875  3.231   1.561   1.00 115.84 ? 11  DA  F C4     1 
ATOM   8932 H  "H5'"  . DA  F 2 11  ? 19.874  2.903   6.362   1.00 143.31 ? 11  DA  F "H5'"  1 
ATOM   8933 H  "H5''" . DA  F 2 11  ? 20.152  4.120   7.328   1.00 143.31 ? 11  DA  F "H5''" 1 
ATOM   8934 H  "H4'"  . DA  F 2 11  ? 21.197  4.742   5.437   1.00 153.35 ? 11  DA  F "H4'"  1 
ATOM   8935 H  "H3'"  . DA  F 2 11  ? 19.228  6.323   6.034   1.00 154.61 ? 11  DA  F "H3'"  1 
ATOM   8936 H  "H2'"  . DA  F 2 11  ? 17.678  5.577   4.593   1.00 152.76 ? 11  DA  F "H2'"  1 
ATOM   8937 H  "H2''" . DA  F 2 11  ? 18.369  6.626   3.637   1.00 152.76 ? 11  DA  F "H2''" 1 
ATOM   8938 H  "H1'"  . DA  F 2 11  ? 19.515  5.069   2.542   1.00 151.07 ? 11  DA  F "H1'"  1 
ATOM   8939 H  H8     . DA  F 2 11  ? 16.901  3.383   4.479   1.00 136.65 ? 11  DA  F H8     1 
ATOM   8940 H  H61    . DA  F 2 11  ? 15.174  0.508   -0.379  1.00 132.11 ? 11  DA  F H61    1 
ATOM   8941 H  H62    . DA  F 2 11  ? 14.887  0.734   1.065   1.00 132.11 ? 11  DA  F H62    1 
ATOM   8942 H  H2     . DA  F 2 11  ? 18.660  2.926   -1.368  1.00 134.03 ? 11  DA  F H2     1 
ATOM   8943 P  P      . DA  F 2 12  ? 20.228  8.511   4.569   1.00 134.65 ? 12  DA  F P      1 
ATOM   8944 O  OP1    . DA  F 2 12  ? 21.354  9.325   5.079   1.00 117.55 ? 12  DA  F OP1    1 
ATOM   8945 O  OP2    . DA  F 2 12  ? 18.868  8.704   5.123   1.00 102.49 ? 12  DA  F OP2    1 
ATOM   8946 O  "O5'"  . DA  F 2 12  ? 20.141  8.667   2.981   1.00 118.13 ? 12  DA  F "O5'"  1 
ATOM   8947 C  "C5'"  . DA  F 2 12  ? 21.185  8.150   2.161   1.00 96.51  ? 12  DA  F "C5'"  1 
ATOM   8948 C  "C4'"  . DA  F 2 12  ? 20.769  8.142   0.701   1.00 91.80  ? 12  DA  F "C4'"  1 
ATOM   8949 O  "O4'"  . DA  F 2 12  ? 19.835  7.054   0.469   1.00 101.32 ? 12  DA  F "O4'"  1 
ATOM   8950 C  "C3'"  . DA  F 2 12  ? 20.070  9.421   0.238   1.00 90.92  ? 12  DA  F "C3'"  1 
ATOM   8951 O  "O3'"  . DA  F 2 12  ? 20.669  9.912   -0.952  1.00 93.20  ? 12  DA  F "O3'"  1 
ATOM   8952 C  "C2'"  . DA  F 2 12  ? 18.614  8.997   0.022   1.00 94.32  ? 12  DA  F "C2'"  1 
ATOM   8953 C  "C1'"  . DA  F 2 12  ? 18.742  7.514   -0.298  1.00 100.57 ? 12  DA  F "C1'"  1 
ATOM   8954 N  N9     . DA  F 2 12  ? 17.566  6.722   0.053   1.00 96.59  ? 12  DA  F N9     1 
ATOM   8955 C  C8     . DA  F 2 12  ? 16.991  6.606   1.287   1.00 100.64 ? 12  DA  F C8     1 
ATOM   8956 N  N7     . DA  F 2 12  ? 15.950  5.809   1.315   1.00 111.23 ? 12  DA  F N7     1 
ATOM   8957 C  C5     . DA  F 2 12  ? 15.839  5.358   0.011   1.00 103.12 ? 12  DA  F C5     1 
ATOM   8958 C  C6     . DA  F 2 12  ? 14.933  4.479   -0.616  1.00 95.35  ? 12  DA  F C6     1 
ATOM   8959 N  N6     . DA  F 2 12  ? 13.926  3.877   0.028   1.00 89.05  ? 12  DA  F N6     1 
ATOM   8960 N  N1     . DA  F 2 12  ? 15.102  4.241   -1.932  1.00 104.47 ? 12  DA  F N1     1 
ATOM   8961 C  C2     . DA  F 2 12  ? 16.111  4.845   -2.573  1.00 103.71 ? 12  DA  F C2     1 
ATOM   8962 N  N3     . DA  F 2 12  ? 17.026  5.688   -2.092  1.00 94.51  ? 12  DA  F N3     1 
ATOM   8963 C  C4     . DA  F 2 12  ? 16.832  5.905   -0.782  1.00 98.80  ? 12  DA  F C4     1 
ATOM   8964 H  "H5'"  . DA  F 2 12  ? 21.393  7.245   2.440   1.00 116.03 ? 12  DA  F "H5'"  1 
ATOM   8965 H  "H5''" . DA  F 2 12  ? 21.976  8.703   2.265   1.00 116.03 ? 12  DA  F "H5''" 1 
ATOM   8966 H  "H4'"  . DA  F 2 12  ? 21.546  7.991   0.140   1.00 110.37 ? 12  DA  F "H4'"  1 
ATOM   8967 H  "H3'"  . DA  F 2 12  ? 20.110  10.087  0.942   1.00 109.32 ? 12  DA  F "H3'"  1 
ATOM   8968 H  "H2'"  . DA  F 2 12  ? 18.084  9.140   0.822   1.00 113.40 ? 12  DA  F "H2'"  1 
ATOM   8969 H  "H2''" . DA  F 2 12  ? 18.211  9.482   -0.715  1.00 113.40 ? 12  DA  F "H2''" 1 
ATOM   8970 H  "H1'"  . DA  F 2 12  ? 18.922  7.401   -1.244  1.00 120.91 ? 12  DA  F "H1'"  1 
ATOM   8971 H  H8     . DA  F 2 12  ? 17.310  7.051   2.038   1.00 120.98 ? 12  DA  F H8     1 
ATOM   8972 H  H61    . DA  F 2 12  ? 13.398  3.348   -0.398  1.00 107.08 ? 12  DA  F H61    1 
ATOM   8973 H  H62    . DA  F 2 12  ? 13.806  4.020   0.867   1.00 107.08 ? 12  DA  F H62    1 
ATOM   8974 H  H2     . DA  F 2 12  ? 16.185  4.648   -3.479  1.00 124.66 ? 12  DA  F H2     1 
ATOM   8975 P  P      . DA  F 2 13  ? 20.211  11.323  -1.565  1.00 103.14 ? 13  DA  F P      1 
ATOM   8976 O  OP1    . DA  F 2 13  ? 21.414  11.999  -2.100  1.00 105.38 ? 13  DA  F OP1    1 
ATOM   8977 O  OP2    . DA  F 2 13  ? 19.373  11.999  -0.549  1.00 117.69 ? 13  DA  F OP2    1 
ATOM   8978 O  "O5'"  . DA  F 2 13  ? 19.292  10.897  -2.800  1.00 85.08  ? 13  DA  F "O5'"  1 
ATOM   8979 C  "C5'"  . DA  F 2 13  ? 19.790  9.974   -3.756  1.00 85.19  ? 13  DA  F "C5'"  1 
ATOM   8980 C  "C4'"  . DA  F 2 13  ? 18.681  9.499   -4.678  1.00 82.73  ? 13  DA  F "C4'"  1 
ATOM   8981 O  "O4'"  . DA  F 2 13  ? 17.775  8.644   -3.930  1.00 92.52  ? 13  DA  F "O4'"  1 
ATOM   8982 C  "C3'"  . DA  F 2 13  ? 17.831  10.620  -5.272  1.00 82.12  ? 13  DA  F "C3'"  1 
ATOM   8983 O  "O3'"  . DA  F 2 13  ? 17.796  10.517  -6.689  1.00 80.42  ? 13  DA  F "O3'"  1 
ATOM   8984 C  "C2'"  . DA  F 2 13  ? 16.445  10.437  -4.641  1.00 86.69  ? 13  DA  F "C2'"  1 
ATOM   8985 C  "C1'"  . DA  F 2 13  ? 16.437  8.971   -4.238  1.00 84.15  ? 13  DA  F "C1'"  1 
ATOM   8986 N  N9     . DA  F 2 13  ? 15.605  8.681   -3.071  1.00 86.18  ? 13  DA  F N9     1 
ATOM   8987 C  C8     . DA  F 2 13  ? 15.769  9.163   -1.804  1.00 97.09  ? 13  DA  F C8     1 
ATOM   8988 N  N7     . DA  F 2 13  ? 14.875  8.729   -0.950  1.00 90.19  ? 13  DA  F N7     1 
ATOM   8989 C  C5     . DA  F 2 13  ? 14.069  7.899   -1.706  1.00 96.53  ? 13  DA  F C5     1 
ATOM   8990 C  C6     . DA  F 2 13  ? 12.936  7.129   -1.381  1.00 100.37 ? 13  DA  F C6     1 
ATOM   8991 N  N6     . DA  F 2 13  ? 12.410  7.082   -0.152  1.00 84.88  ? 13  DA  F N6     1 
ATOM   8992 N  N1     . DA  F 2 13  ? 12.364  6.411   -2.369  1.00 101.47 ? 13  DA  F N1     1 
ATOM   8993 C  C2     . DA  F 2 13  ? 12.897  6.464   -3.596  1.00 94.25  ? 13  DA  F C2     1 
ATOM   8994 N  N3     . DA  F 2 13  ? 13.958  7.150   -4.021  1.00 93.34  ? 13  DA  F N3     1 
ATOM   8995 C  C4     . DA  F 2 13  ? 14.503  7.854   -3.017  1.00 92.41  ? 13  DA  F C4     1 
ATOM   8996 H  "H5'"  . DA  F 2 13  ? 20.171  9.211   -3.295  1.00 102.44 ? 13  DA  F "H5'"  1 
ATOM   8997 H  "H5''" . DA  F 2 13  ? 20.482  10.403  -4.283  1.00 102.44 ? 13  DA  F "H5''" 1 
ATOM   8998 H  "H4'"  . DA  F 2 13  ? 19.056  8.979   -5.406  1.00 99.50  ? 13  DA  F "H4'"  1 
ATOM   8999 H  "H3'"  . DA  F 2 13  ? 18.192  11.477  -4.995  1.00 98.76  ? 13  DA  F "H3'"  1 
ATOM   9000 H  "H2'"  . DA  F 2 13  ? 16.334  11.013  -3.869  1.00 104.24 ? 13  DA  F "H2'"  1 
ATOM   9001 H  "H2''" . DA  F 2 13  ? 15.742  10.627  -5.281  1.00 104.24 ? 13  DA  F "H2''" 1 
ATOM   9002 H  "H1'"  . DA  F 2 13  ? 16.132  8.431   -4.984  1.00 101.19 ? 13  DA  F "H1'"  1 
ATOM   9003 H  H8     . DA  F 2 13  ? 16.453  9.747   -1.568  1.00 116.72 ? 13  DA  F H8     1 
ATOM   9004 H  H61    . DA  F 2 13  ? 11.716  6.597   0.000   1.00 102.08 ? 13  DA  F H61    1 
ATOM   9005 H  H62    . DA  F 2 13  ? 12.766  7.536   0.486   1.00 102.08 ? 13  DA  F H62    1 
ATOM   9006 H  H2     . DA  F 2 13  ? 12.467  5.951   -4.242  1.00 113.32 ? 13  DA  F H2     1 
ATOM   9007 P  P      . DT  F 2 14  ? 17.217  11.728  -7.570  1.00 98.35  ? 14  DT  F P      1 
ATOM   9008 O  OP1    . DT  F 2 14  ? 17.881  11.692  -8.892  1.00 95.56  ? 14  DT  F OP1    1 
ATOM   9009 O  OP2    . DT  F 2 14  ? 17.283  12.956  -6.747  1.00 101.96 ? 14  DT  F OP2    1 
ATOM   9010 O  "O5'"  . DT  F 2 14  ? 15.677  11.351  -7.749  1.00 82.68  ? 14  DT  F "O5'"  1 
ATOM   9011 C  "C5'"  . DT  F 2 14  ? 15.321  10.121  -8.355  1.00 92.71  ? 14  DT  F "C5'"  1 
ATOM   9012 C  "C4'"  . DT  F 2 14  ? 13.841  9.842   -8.181  1.00 88.71  ? 14  DT  F "C4'"  1 
ATOM   9013 O  "O4'"  . DT  F 2 14  ? 13.563  9.598   -6.785  1.00 85.08  ? 14  DT  F "O4'"  1 
ATOM   9014 C  "C3'"  . DT  F 2 14  ? 12.918  10.992  -8.586  1.00 77.08  ? 14  DT  F "C3'"  1 
ATOM   9015 O  "O3'"  . DT  F 2 14  ? 12.269  10.689  -9.821  1.00 81.32  ? 14  DT  F "O3'"  1 
ATOM   9016 C  "C2'"  . DT  F 2 14  ? 11.927  11.141  -7.417  1.00 83.59  ? 14  DT  F "C2'"  1 
ATOM   9017 C  "C1'"  . DT  F 2 14  ? 12.221  9.929   -6.539  1.00 84.18  ? 14  DT  F "C1'"  1 
ATOM   9018 N  N1     . DT  F 2 14  ? 12.057  10.174  -5.077  1.00 88.65  ? 14  DT  F N1     1 
ATOM   9019 C  C2     . DT  F 2 14  ? 11.023  9.565   -4.405  1.00 88.41  ? 14  DT  F C2     1 
ATOM   9020 O  O2     . DT  F 2 14  ? 10.209  8.839   -4.946  1.00 100.27 ? 14  DT  F O2     1 
ATOM   9021 N  N3     . DT  F 2 14  ? 10.963  9.850   -3.067  1.00 85.35  ? 14  DT  F N3     1 
ATOM   9022 C  C4     . DT  F 2 14  ? 11.823  10.656  -2.346  1.00 87.07  ? 14  DT  F C4     1 
ATOM   9023 O  O4     . DT  F 2 14  ? 11.687  10.849  -1.142  1.00 84.46  ? 14  DT  F O4     1 
ATOM   9024 C  C5     . DT  F 2 14  ? 12.893  11.256  -3.109  1.00 107.11 ? 14  DT  F C5     1 
ATOM   9025 C  C7     . DT  F 2 14  ? 13.887  12.151  -2.438  1.00 99.24  ? 14  DT  F C7     1 
ATOM   9026 C  C6     . DT  F 2 14  ? 12.959  10.986  -4.422  1.00 112.82 ? 14  DT  F C6     1 
ATOM   9027 H  "H5'"  . DT  F 2 14  ? 15.832  9.405   -7.946  1.00 111.47 ? 14  DT  F "H5'"  1 
ATOM   9028 H  "H5''" . DT  F 2 14  ? 15.531  10.159  -9.301  1.00 111.47 ? 14  DT  F "H5''" 1 
ATOM   9029 H  "H4'"  . DT  F 2 14  ? 13.605  9.053   -8.693  1.00 106.67 ? 14  DT  F "H4'"  1 
ATOM   9030 H  "H3'"  . DT  F 2 14  ? 13.435  11.810  -8.657  1.00 92.71  ? 14  DT  F "H3'"  1 
ATOM   9031 H  "H2'"  . DT  F 2 14  ? 12.081  11.967  -6.933  1.00 100.52 ? 14  DT  F "H2'"  1 
ATOM   9032 H  "H2''" . DT  F 2 14  ? 11.010  11.127  -7.734  1.00 100.52 ? 14  DT  F "H2''" 1 
ATOM   9033 H  "H1'"  . DT  F 2 14  ? 11.642  9.195   -6.797  1.00 101.23 ? 14  DT  F "H1'"  1 
ATOM   9034 H  H3     . DT  F 2 14  ? 10.319  9.487   -2.627  1.00 102.64 ? 14  DT  F H3     1 
ATOM   9035 H  H71    . DT  F 2 14  ? 13.583  12.342  -1.537  1.00 119.31 ? 14  DT  F H71    1 
ATOM   9036 H  H72    . DT  F 2 14  ? 14.747  11.702  -2.408  1.00 119.31 ? 14  DT  F H72    1 
ATOM   9037 H  H73    . DT  F 2 14  ? 13.962  12.975  -2.944  1.00 119.31 ? 14  DT  F H73    1 
ATOM   9038 H  H6     . DT  F 2 14  ? 13.650  11.365  -4.916  1.00 135.61 ? 14  DT  F H6     1 
ATOM   9039 P  P      . DG  F 2 15  ? 11.301  11.767  -10.514 1.00 112.81 ? 15  DG  F P      1 
ATOM   9040 O  OP1    . DG  F 2 15  ? 11.434  11.597  -11.978 1.00 92.88  ? 15  DG  F OP1    1 
ATOM   9041 O  OP2    . DG  F 2 15  ? 11.562  13.085  -9.894  1.00 104.88 ? 15  DG  F OP2    1 
ATOM   9042 O  "O5'"  . DG  F 2 15  ? 9.833   11.294  -10.094 1.00 71.40  ? 15  DG  F "O5'"  1 
ATOM   9043 C  "C5'"  . DG  F 2 15  ? 9.414   9.968   -10.386 1.00 79.65  ? 15  DG  F "C5'"  1 
ATOM   9044 C  "C4'"  . DG  F 2 15  ? 8.028   9.697   -9.831  1.00 86.63  ? 15  DG  F "C4'"  1 
ATOM   9045 O  "O4'"  . DG  F 2 15  ? 8.118   9.549   -8.388  1.00 91.96  ? 15  DG  F "O4'"  1 
ATOM   9046 C  "C3'"  . DG  F 2 15  ? 7.004   10.803  -10.091 1.00 91.85  ? 15  DG  F "C3'"  1 
ATOM   9047 O  "O3'"  . DG  F 2 15  ? 5.799   10.251  -10.623 1.00 89.40  ? 15  DG  F "O3'"  1 
ATOM   9048 C  "C2'"  . DG  F 2 15  ? 6.795   11.456  -8.726  1.00 104.26 ? 15  DG  F "C2'"  1 
ATOM   9049 C  "C1'"  . DG  F 2 15  ? 7.123   10.328  -7.761  1.00 96.44  ? 15  DG  F "C1'"  1 
ATOM   9050 N  N9     . DG  F 2 15  ? 7.635   10.782  -6.471  1.00 106.87 ? 15  DG  F N9     1 
ATOM   9051 C  C8     . DG  F 2 15  ? 8.723   11.590  -6.246  1.00 110.80 ? 15  DG  F C8     1 
ATOM   9052 N  N7     . DG  F 2 15  ? 8.942   11.828  -4.982  1.00 105.11 ? 15  DG  F N7     1 
ATOM   9053 C  C5     . DG  F 2 15  ? 7.933   11.135  -4.326  1.00 105.46 ? 15  DG  F C5     1 
ATOM   9054 C  C6     . DG  F 2 15  ? 7.654   11.019  -2.943  1.00 105.65 ? 15  DG  F C6     1 
ATOM   9055 O  O6     . DG  F 2 15  ? 8.265   11.525  -1.992  1.00 109.60 ? 15  DG  F O6     1 
ATOM   9056 N  N1     . DG  F 2 15  ? 6.538   10.222  -2.708  1.00 104.57 ? 15  DG  F N1     1 
ATOM   9057 C  C2     . DG  F 2 15  ? 5.788   9.611   -3.685  1.00 119.53 ? 15  DG  F C2     1 
ATOM   9058 N  N2     . DG  F 2 15  ? 4.744   8.880   -3.270  1.00 126.97 ? 15  DG  F N2     1 
ATOM   9059 N  N3     . DG  F 2 15  ? 6.038   9.712   -4.983  1.00 120.55 ? 15  DG  F N3     1 
ATOM   9060 C  C4     . DG  F 2 15  ? 7.120   10.486  -5.229  1.00 109.28 ? 15  DG  F C4     1 
ATOM   9061 H  "H5'"  . DG  F 2 15  ? 10.043  9.342   -9.994  1.00 95.80  ? 15  DG  F "H5'"  1 
ATOM   9062 H  "H5''" . DG  F 2 15  ? 9.402   9.842   -11.348 1.00 95.80  ? 15  DG  F "H5''" 1 
ATOM   9063 H  "H4'"  . DG  F 2 15  ? 7.682   8.870   -10.204 1.00 104.17 ? 15  DG  F "H4'"  1 
ATOM   9064 H  "H3'"  . DG  F 2 15  ? 7.381   11.457  -10.701 1.00 110.43 ? 15  DG  F "H3'"  1 
ATOM   9065 H  "H2'"  . DG  F 2 15  ? 7.392   12.211  -8.602  1.00 125.33 ? 15  DG  F "H2'"  1 
ATOM   9066 H  "H2''" . DG  F 2 15  ? 5.879   11.757  -8.617  1.00 125.33 ? 15  DG  F "H2''" 1 
ATOM   9067 H  "H1'"  . DG  F 2 15  ? 6.330   9.789   -7.615  1.00 115.94 ? 15  DG  F "H1'"  1 
ATOM   9068 H  H8     . DG  F 2 15  ? 9.253   11.935  -6.928  1.00 133.17 ? 15  DG  F H8     1 
ATOM   9069 H  H1     . DG  F 2 15  ? 6.300   10.103  -1.890  1.00 125.70 ? 15  DG  F H1     1 
ATOM   9070 H  H21    . DG  F 2 15  ? 4.242   8.483   -3.844  1.00 152.58 ? 15  DG  F H21    1 
ATOM   9071 H  H22    . DG  F 2 15  ? 4.575   8.810   -2.430  1.00 152.58 ? 15  DG  F H22    1 
ATOM   9072 P  P      . DA  F 2 16  ? 4.623   11.217  -11.140 1.00 106.50 ? 16  DA  F P      1 
ATOM   9073 O  OP1    . DA  F 2 16  ? 3.958   10.556  -12.285 1.00 86.08  ? 16  DA  F OP1    1 
ATOM   9074 O  OP2    . DA  F 2 16  ? 5.200   12.569  -11.318 1.00 103.67 ? 16  DA  F OP2    1 
ATOM   9075 O  "O5'"  . DA  F 2 16  ? 3.607   11.267  -9.904  1.00 87.13  ? 16  DA  F "O5'"  1 
ATOM   9076 C  "C5'"  . DA  F 2 16  ? 3.095   10.052  -9.354  1.00 84.84  ? 16  DA  F "C5'"  1 
ATOM   9077 C  "C4'"  . DA  F 2 16  ? 2.354   10.309  -8.051  1.00 104.86 ? 16  DA  F "C4'"  1 
ATOM   9078 O  "O4'"  . DA  F 2 16  ? 3.311   10.589  -7.006  1.00 116.84 ? 16  DA  F "O4'"  1 
ATOM   9079 C  "C3'"  . DA  F 2 16  ? 1.405   11.510  -8.070  1.00 113.87 ? 16  DA  F "C3'"  1 
ATOM   9080 O  "O3'"  . DA  F 2 16  ? 0.040   11.079  -8.126  1.00 110.74 ? 16  DA  F "O3'"  1 
ATOM   9081 C  "C2'"  . DA  F 2 16  ? 1.709   12.283  -6.777  1.00 126.50 ? 16  DA  F "C2'"  1 
ATOM   9082 C  "C1'"  . DA  F 2 16  ? 2.682   11.375  -6.028  1.00 127.18 ? 16  DA  F "C1'"  1 
ATOM   9083 N  N9     . DA  F 2 16  ? 3.695   12.107  -5.276  1.00 132.95 ? 16  DA  F N9     1 
ATOM   9084 C  C8     . DA  F 2 16  ? 4.729   12.844  -5.784  1.00 129.90 ? 16  DA  F C8     1 
ATOM   9085 N  N7     . DA  F 2 16  ? 5.478   13.406  -4.865  1.00 128.14 ? 16  DA  F N7     1 
ATOM   9086 C  C5     . DA  F 2 16  ? 4.887   13.022  -3.673  1.00 126.78 ? 16  DA  F C5     1 
ATOM   9087 C  C6     . DA  F 2 16  ? 5.202   13.292  -2.328  1.00 119.25 ? 16  DA  F C6     1 
ATOM   9088 N  N6     . DA  F 2 16  ? 6.240   14.046  -1.953  1.00 114.04 ? 16  DA  F N6     1 
ATOM   9089 N  N1     . DA  F 2 16  ? 4.406   12.755  -1.379  1.00 122.14 ? 16  DA  F N1     1 
ATOM   9090 C  C2     . DA  F 2 16  ? 3.370   11.999  -1.760  1.00 128.37 ? 16  DA  F C2     1 
ATOM   9091 N  N3     . DA  F 2 16  ? 2.974   11.677  -2.990  1.00 122.27 ? 16  DA  F N3     1 
ATOM   9092 C  C4     . DA  F 2 16  ? 3.783   12.225  -3.909  1.00 124.96 ? 16  DA  F C4     1 
ATOM   9093 H  "H5'"  . DA  F 2 16  ? 3.832   9.444   -9.186  1.00 102.02 ? 16  DA  F "H5'"  1 
ATOM   9094 H  "H5''" . DA  F 2 16  ? 2.488   9.646   -9.991  1.00 102.02 ? 16  DA  F "H5''" 1 
ATOM   9095 H  "H4'"  . DA  F 2 16  ? 1.848   9.517   -7.813  1.00 126.05 ? 16  DA  F "H4'"  1 
ATOM   9096 H  "H3'"  . DA  F 2 16  ? 1.625   12.067  -8.833  1.00 136.86 ? 16  DA  F "H3'"  1 
ATOM   9097 H  "H2'"  . DA  F 2 16  ? 2.116   13.141  -6.973  1.00 152.01 ? 16  DA  F "H2'"  1 
ATOM   9098 H  "H2''" . DA  F 2 16  ? 0.901   12.427  -6.260  1.00 152.01 ? 16  DA  F "H2''" 1 
ATOM   9099 H  "H1'"  . DA  F 2 16  ? 2.195   10.797  -5.421  1.00 152.83 ? 16  DA  F "H1'"  1 
ATOM   9100 H  H8     . DA  F 2 16  ? 4.886   12.938  -6.696  1.00 156.10 ? 16  DA  F H8     1 
ATOM   9101 H  H61    . DA  F 2 16  ? 6.393   14.183  -1.118  1.00 137.07 ? 16  DA  F H61    1 
ATOM   9102 H  H62    . DA  F 2 16  ? 6.755   14.394  -2.547  1.00 137.07 ? 16  DA  F H62    1 
ATOM   9103 H  H2     . DA  F 2 16  ? 2.854   11.650  -1.069  1.00 154.26 ? 16  DA  F H2     1 
ATOM   9104 P  P      . DG  F 2 17  ? -1.146  12.163  -8.174  1.00 133.39 ? 17  DG  F P      1 
ATOM   9105 O  OP1    . DG  F 2 17  ? -2.339  11.474  -8.717  1.00 102.39 ? 17  DG  F OP1    1 
ATOM   9106 O  OP2    . DG  F 2 17  ? -0.623  13.380  -8.833  1.00 119.60 ? 17  DG  F OP2    1 
ATOM   9107 O  "O5'"  . DG  F 2 17  ? -1.432  12.520  -6.638  1.00 107.47 ? 17  DG  F "O5'"  1 
ATOM   9108 C  "C5'"  . DG  F 2 17  ? -1.642  11.479  -5.695  1.00 121.70 ? 17  DG  F "C5'"  1 
ATOM   9109 C  "C4'"  . DG  F 2 17  ? -1.579  12.001  -4.269  1.00 129.23 ? 17  DG  F "C4'"  1 
ATOM   9110 O  "O4'"  . DG  F 2 17  ? -0.238  12.445  -3.970  1.00 124.17 ? 17  DG  F "O4'"  1 
ATOM   9111 C  "C3'"  . DG  F 2 17  ? -2.473  13.209  -3.975  1.00 126.90 ? 17  DG  F "C3'"  1 
ATOM   9112 O  "O3'"  . DG  F 2 17  ? -3.659  12.805  -3.288  1.00 129.36 ? 17  DG  F "O3'"  1 
ATOM   9113 C  "C2'"  . DG  F 2 17  ? -1.603  14.150  -3.123  1.00 127.52 ? 17  DG  F "C2'"  1 
ATOM   9114 C  "C1'"  . DG  F 2 17  ? -0.312  13.362  -2.908  1.00 131.44 ? 17  DG  F "C1'"  1 
ATOM   9115 N  N9     . DG  F 2 17  ? 0.888   14.191  -2.904  1.00 133.66 ? 17  DG  F N9     1 
ATOM   9116 C  C8     . DG  F 2 17  ? 1.588   14.643  -3.996  1.00 125.19 ? 17  DG  F C8     1 
ATOM   9117 N  N7     . DG  F 2 17  ? 2.625   15.370  -3.684  1.00 125.48 ? 17  DG  F N7     1 
ATOM   9118 C  C5     . DG  F 2 17  ? 2.611   15.406  -2.295  1.00 128.05 ? 17  DG  F C5     1 
ATOM   9119 C  C6     . DG  F 2 17  ? 3.492   16.046  -1.391  1.00 125.39 ? 17  DG  F C6     1 
ATOM   9120 O  O6     . DG  F 2 17  ? 4.491   16.730  -1.649  1.00 113.17 ? 17  DG  F O6     1 
ATOM   9121 N  N1     . DG  F 2 17  ? 3.118   15.831  -0.065  1.00 127.98 ? 17  DG  F N1     1 
ATOM   9122 C  C2     . DG  F 2 17  ? 2.029   15.091  0.335   1.00 123.14 ? 17  DG  F C2     1 
ATOM   9123 N  N2     . DG  F 2 17  ? 1.824   14.991  1.658   1.00 115.02 ? 17  DG  F N2     1 
ATOM   9124 N  N3     . DG  F 2 17  ? 1.197   14.486  -0.504  1.00 132.97 ? 17  DG  F N3     1 
ATOM   9125 C  C4     . DG  F 2 17  ? 1.547   14.687  -1.799  1.00 135.56 ? 17  DG  F C4     1 
ATOM   9126 H  "H5'"  . DG  F 2 17  ? -0.960  10.801  -5.815  1.00 146.25 ? 17  DG  F "H5'"  1 
ATOM   9127 H  "H5''" . DG  F 2 17  ? -2.513  11.082  -5.850  1.00 146.25 ? 17  DG  F "H5''" 1 
ATOM   9128 H  "H4'"  . DG  F 2 17  ? -1.816  11.277  -3.667  1.00 155.29 ? 17  DG  F "H4'"  1 
ATOM   9129 H  "H3'"  . DG  F 2 17  ? -2.689  13.650  -4.812  1.00 152.49 ? 17  DG  F "H3'"  1 
ATOM   9130 H  "H2'"  . DG  F 2 17  ? -1.428  14.981  -3.592  1.00 153.25 ? 17  DG  F "H2'"  1 
ATOM   9131 H  "H2''" . DG  F 2 17  ? -2.033  14.350  -2.277  1.00 153.25 ? 17  DG  F "H2''" 1 
ATOM   9132 H  "H1'"  . DG  F 2 17  ? -0.356  12.876  -2.069  1.00 157.95 ? 17  DG  F "H1'"  1 
ATOM   9133 H  H8     . DG  F 2 17  ? 1.346   14.449  -4.873  1.00 150.44 ? 17  DG  F H8     1 
ATOM   9134 H  H1     . DG  F 2 17  ? 3.604   16.187  0.549   1.00 153.80 ? 17  DG  F H1     1 
ATOM   9135 H  H21    . DG  F 2 17  ? 1.158   14.537  1.956   1.00 138.24 ? 17  DG  F H21    1 
ATOM   9136 H  H22    . DG  F 2 17  ? 2.360   15.380  2.206   1.00 138.24 ? 17  DG  F H22    1 
ATOM   9137 P  P      . DC  F 2 18  ? -4.756  13.897  -2.855  1.00 127.48 ? 18  DC  F P      1 
ATOM   9138 O  OP1    . DC  F 2 18  ? -6.073  13.227  -2.764  1.00 101.71 ? 18  DC  F OP1    1 
ATOM   9139 O  OP2    . DC  F 2 18  ? -4.586  15.064  -3.748  1.00 122.16 ? 18  DC  F OP2    1 
ATOM   9140 O  "O5'"  . DC  F 2 18  ? -4.289  14.343  -1.391  1.00 111.87 ? 18  DC  F "O5'"  1 
ATOM   9141 C  "C5'"  . DC  F 2 18  ? -3.931  13.355  -0.428  1.00 117.82 ? 18  DC  F "C5'"  1 
ATOM   9142 C  "C4'"  . DC  F 2 18  ? -3.629  13.985  0.922   1.00 115.56 ? 18  DC  F "C4'"  1 
ATOM   9143 O  "O4'"  . DC  F 2 18  ? -2.291  14.563  0.901   1.00 125.63 ? 18  DC  F "O4'"  1 
ATOM   9144 C  "C3'"  . DC  F 2 18  ? -4.568  15.118  1.329   1.00 114.07 ? 18  DC  F "C3'"  1 
ATOM   9145 O  "O3'"  . DC  F 2 18  ? -4.889  15.024  2.711   1.00 107.17 ? 18  DC  F "O3'"  1 
ATOM   9146 C  "C2'"  . DC  F 2 18  ? -3.777  16.381  1.014   1.00 124.73 ? 18  DC  F "C2'"  1 
ATOM   9147 C  "C1'"  . DC  F 2 18  ? -2.346  15.931  1.268   1.00 129.83 ? 18  DC  F "C1'"  1 
ATOM   9148 N  N1     . DC  F 2 18  ? -1.324  16.677  0.479   1.00 133.07 ? 18  DC  F N1     1 
ATOM   9149 C  C2     . DC  F 2 18  ? -0.308  17.385  1.140   1.00 118.72 ? 18  DC  F C2     1 
ATOM   9150 O  O2     . DC  F 2 18  ? -0.281  17.395  2.377   1.00 97.46  ? 18  DC  F O2     1 
ATOM   9151 N  N3     . DC  F 2 18  ? 0.615   18.049  0.397   1.00 130.35 ? 18  DC  F N3     1 
ATOM   9152 C  C4     . DC  F 2 18  ? 0.549   18.014  -0.936  1.00 135.57 ? 18  DC  F C4     1 
ATOM   9153 N  N4     . DC  F 2 18  ? 1.478   18.677  -1.631  1.00 130.82 ? 18  DC  F N4     1 
ATOM   9154 C  C5     . DC  F 2 18  ? -0.472  17.294  -1.620  1.00 131.93 ? 18  DC  F C5     1 
ATOM   9155 C  C6     . DC  F 2 18  ? -1.374  16.645  -0.881  1.00 134.56 ? 18  DC  F C6     1 
ATOM   9156 H  "H5'"  . DC  F 2 18  ? -3.145  12.878  -0.739  1.00 141.60 ? 18  DC  F "H5'"  1 
ATOM   9157 H  "H5''" . DC  F 2 18  ? -4.663  12.726  -0.329  1.00 141.60 ? 18  DC  F "H5''" 1 
ATOM   9158 H  "H4'"  . DC  F 2 18  ? -3.658  13.298  1.606   1.00 138.89 ? 18  DC  F "H4'"  1 
ATOM   9159 H  "H3'"  . DC  F 2 18  ? -5.371  15.089  0.785   1.00 137.10 ? 18  DC  F "H3'"  1 
ATOM   9160 H  "H2'"  . DC  F 2 18  ? -3.903  16.657  0.093   1.00 149.89 ? 18  DC  F "H2'"  1 
ATOM   9161 H  "H2''" . DC  F 2 18  ? -4.028  17.112  1.600   1.00 149.89 ? 18  DC  F "H2''" 1 
ATOM   9162 H  "H1'"  . DC  F 2 18  ? -2.143  16.025  2.212   1.00 156.02 ? 18  DC  F "H1'"  1 
ATOM   9163 H  H41    . DC  F 2 18  ? 1.459   18.671  -2.491  1.00 157.20 ? 18  DC  F H41    1 
ATOM   9164 H  H42    . DC  F 2 18  ? 2.096   19.110  -1.218  1.00 157.20 ? 18  DC  F H42    1 
ATOM   9165 H  H5     . DC  F 2 18  ? -0.509  17.276  -2.549  1.00 158.53 ? 18  DC  F H5     1 
ATOM   9166 H  H6     . DC  F 2 18  ? -2.049  16.163  -1.302  1.00 161.69 ? 18  DC  F H6     1 
ATOM   9167 P  P      . DA  F 2 19  ? -6.176  15.784  3.296   1.00 132.34 ? 19  DA  F P      1 
ATOM   9168 O  OP1    . DA  F 2 19  ? -6.963  14.788  4.055   1.00 132.47 ? 19  DA  F OP1    1 
ATOM   9169 O  OP2    . DA  F 2 19  ? -6.811  16.529  2.186   1.00 123.26 ? 19  DA  F OP2    1 
ATOM   9170 O  "O5'"  . DA  F 2 19  ? -5.563  16.851  4.324   1.00 110.53 ? 19  DA  F "O5'"  1 
ATOM   9171 C  "C5'"  . DA  F 2 19  ? -4.729  16.420  5.394   1.00 99.40  ? 19  DA  F "C5'"  1 
ATOM   9172 C  "C4'"  . DA  F 2 19  ? -4.213  17.603  6.198   1.00 110.54 ? 19  DA  F "C4'"  1 
ATOM   9173 O  "O4'"  . DA  F 2 19  ? -3.170  18.296  5.452   1.00 118.67 ? 19  DA  F "O4'"  1 
ATOM   9174 C  "C3'"  . DA  F 2 19  ? -5.264  18.664  6.518   1.00 117.16 ? 19  DA  F "C3'"  1 
ATOM   9175 O  "O3'"  . DA  F 2 19  ? -5.036  19.225  7.811   1.00 129.68 ? 19  DA  F "O3'"  1 
ATOM   9176 C  "C2'"  . DA  F 2 19  ? -5.077  19.685  5.398   1.00 119.08 ? 19  DA  F "C2'"  1 
ATOM   9177 C  "C1'"  . DA  F 2 19  ? -3.570  19.632  5.169   1.00 124.44 ? 19  DA  F "C1'"  1 
ATOM   9178 N  N9     . DA  F 2 19  ? -3.146  19.970  3.810   1.00 124.13 ? 19  DA  F N9     1 
ATOM   9179 C  C8     . DA  F 2 19  ? -3.711  19.553  2.637   1.00 120.23 ? 19  DA  F C8     1 
ATOM   9180 N  N7     . DA  F 2 19  ? -3.110  20.012  1.565   1.00 112.65 ? 19  DA  F N7     1 
ATOM   9181 C  C5     . DA  F 2 19  ? -2.078  20.786  2.067   1.00 112.93 ? 19  DA  F C5     1 
ATOM   9182 C  C6     . DA  F 2 19  ? -1.073  21.547  1.439   1.00 105.78 ? 19  DA  F C6     1 
ATOM   9183 N  N6     . DA  F 2 19  ? -0.950  21.649  0.112   1.00 100.28 ? 19  DA  F N6     1 
ATOM   9184 N  N1     . DA  F 2 19  ? -0.196  22.202  2.230   1.00 102.41 ? 19  DA  F N1     1 
ATOM   9185 C  C2     . DA  F 2 19  ? -0.324  22.095  3.559   1.00 101.80 ? 19  DA  F C2     1 
ATOM   9186 N  N3     . DA  F 2 19  ? -1.226  21.410  4.264   1.00 106.95 ? 19  DA  F N3     1 
ATOM   9187 C  C4     . DA  F 2 19  ? -2.082  20.771  3.449   1.00 115.37 ? 19  DA  F C4     1 
ATOM   9188 H  "H5'"  . DA  F 2 19  ? -3.975  15.928  5.032   1.00 119.49 ? 19  DA  F "H5'"  1 
ATOM   9189 H  "H5''" . DA  F 2 19  ? -5.237  15.835  5.978   1.00 119.49 ? 19  DA  F "H5''" 1 
ATOM   9190 H  "H4'"  . DA  F 2 19  ? -3.829  17.275  7.026   1.00 132.86 ? 19  DA  F "H4'"  1 
ATOM   9191 H  "H3'"  . DA  F 2 19  ? -6.154  18.282  6.473   1.00 140.81 ? 19  DA  F "H3'"  1 
ATOM   9192 H  "H2'"  . DA  F 2 19  ? -5.566  19.429  4.600   1.00 143.11 ? 19  DA  F "H2'"  1 
ATOM   9193 H  "H2''" . DA  F 2 19  ? -5.362  20.570  5.673   1.00 143.11 ? 19  DA  F "H2''" 1 
ATOM   9194 H  "H1'"  . DA  F 2 19  ? -3.138  20.242  5.786   1.00 149.54 ? 19  DA  F "H1'"  1 
ATOM   9195 H  H8     . DA  F 2 19  ? -4.455  18.996  2.603   1.00 144.50 ? 19  DA  F H8     1 
ATOM   9196 H  H61    . DA  F 2 19  ? -0.320  22.126  -0.227  1.00 120.55 ? 19  DA  F H61    1 
ATOM   9197 H  H62    . DA  F 2 19  ? -1.502  21.237  -0.404  1.00 120.55 ? 19  DA  F H62    1 
ATOM   9198 H  H2     . DA  F 2 19  ? 0.304   22.564  4.061   1.00 122.38 ? 19  DA  F H2     1 
ATOM   9199 P  P      . DA  F 2 20  ? -6.097  20.248  8.452   1.00 142.08 ? 20  DA  F P      1 
ATOM   9200 O  OP1    . DA  F 2 20  ? -6.558  19.674  9.736   1.00 122.34 ? 20  DA  F OP1    1 
ATOM   9201 O  OP2    . DA  F 2 20  ? -7.084  20.593  7.405   1.00 134.95 ? 20  DA  F OP2    1 
ATOM   9202 O  "O5'"  . DA  F 2 20  ? -5.232  21.558  8.762   1.00 146.89 ? 20  DA  F "O5'"  1 
ATOM   9203 C  "C5'"  . DA  F 2 20  ? -4.033  21.458  9.525   1.00 132.81 ? 20  DA  F "C5'"  1 
ATOM   9204 C  "C4'"  . DA  F 2 20  ? -3.186  22.712  9.378   1.00 130.11 ? 20  DA  F "C4'"  1 
ATOM   9205 O  "O4'"  . DA  F 2 20  ? -2.668  22.796  8.021   1.00 131.47 ? 20  DA  F "O4'"  1 
ATOM   9206 C  "C3'"  . DA  F 2 20  ? -3.932  24.023  9.629   1.00 127.87 ? 20  DA  F "C3'"  1 
ATOM   9207 O  "O3'"  . DA  F 2 20  ? -3.134  24.914  10.395  1.00 127.77 ? 20  DA  F "O3'"  1 
ATOM   9208 C  "C2'"  . DA  F 2 20  ? -4.210  24.560  8.227   1.00 122.93 ? 20  DA  F "C2'"  1 
ATOM   9209 C  "C1'"  . DA  F 2 20  ? -3.017  24.040  7.440   1.00 121.63 ? 20  DA  F "C1'"  1 
ATOM   9210 N  N9     . DA  F 2 20  ? -3.282  23.830  6.020   1.00 120.22 ? 20  DA  F N9     1 
ATOM   9211 C  C8     . DA  F 2 20  ? -4.263  23.056  5.467   1.00 117.40 ? 20  DA  F C8     1 
ATOM   9212 N  N7     . DA  F 2 20  ? -4.256  23.049  4.155   1.00 110.18 ? 20  DA  F N7     1 
ATOM   9213 C  C5     . DA  F 2 20  ? -3.194  23.873  3.824   1.00 110.38 ? 20  DA  F C5     1 
ATOM   9214 C  C6     . DA  F 2 20  ? -2.656  24.278  2.588   1.00 102.25 ? 20  DA  F C6     1 
ATOM   9215 N  N6     . DA  F 2 20  ? -3.145  23.885  1.406   1.00 91.00  ? 20  DA  F N6     1 
ATOM   9216 N  N1     . DA  F 2 20  ? -1.591  25.106  2.613   1.00 103.45 ? 20  DA  F N1     1 
ATOM   9217 C  C2     . DA  F 2 20  ? -1.104  25.498  3.796   1.00 92.01  ? 20  DA  F C2     1 
ATOM   9218 N  N3     . DA  F 2 20  ? -1.523  25.184  5.019   1.00 96.28  ? 20  DA  F N3     1 
ATOM   9219 C  C4     . DA  F 2 20  ? -2.580  24.361  4.963   1.00 114.53 ? 20  DA  F C4     1 
ATOM   9220 H  "H5'"  . DA  F 2 20  ? -3.523  20.691  9.219   1.00 159.58 ? 20  DA  F "H5'"  1 
ATOM   9221 H  "H5''" . DA  F 2 20  ? -4.259  21.334  10.460  1.00 159.58 ? 20  DA  F "H5''" 1 
ATOM   9222 H  "H4'"  . DA  F 2 20  ? -2.433  22.662  9.988   1.00 156.35 ? 20  DA  F "H4'"  1 
ATOM   9223 H  "H3'"  . DA  F 2 20  ? -4.771  23.840  10.081  1.00 153.66 ? 20  DA  F "H3'"  1 
ATOM   9224 H  "H2'"  . DA  F 2 20  ? -5.045  24.213  7.875   1.00 147.73 ? 20  DA  F "H2'"  1 
ATOM   9225 H  "H2''" . DA  F 2 20  ? -4.243  25.529  8.220   1.00 147.73 ? 20  DA  F "H2''" 1 
ATOM   9226 H  "H1'"  . DA  F 2 20  ? -2.280  24.662  7.533   1.00 146.18 ? 20  DA  F "H1'"  1 
ATOM   9227 H  H8     . DA  F 2 20  ? -4.879  22.578  5.975   1.00 141.10 ? 20  DA  F H8     1 
ATOM   9228 H  H61    . DA  F 2 20  ? -2.781  24.160  0.677   1.00 109.41 ? 20  DA  F H61    1 
ATOM   9229 H  H62    . DA  F 2 20  ? -3.823  23.357  1.376   1.00 109.41 ? 20  DA  F H62    1 
ATOM   9230 H  H2     . DA  F 2 20  ? -0.370  26.068  3.758   1.00 110.63 ? 20  DA  F H2     1 
ATOM   9231 P  P      . DG  F 2 21  ? -3.777  26.251  11.008  1.00 151.19 ? 21  DG  F P      1 
ATOM   9232 O  OP1    . DG  F 2 21  ? -3.244  26.419  12.378  1.00 128.65 ? 21  DG  F OP1    1 
ATOM   9233 O  OP2    . DG  F 2 21  ? -5.240  26.196  10.786  1.00 114.83 ? 21  DG  F OP2    1 
ATOM   9234 O  "O5'"  . DG  F 2 21  ? -3.185  27.416  10.085  1.00 133.33 ? 21  DG  F "O5'"  1 
ATOM   9235 C  "C5'"  . DG  F 2 21  ? -1.775  27.551  9.928   1.00 113.14 ? 21  DG  F "C5'"  1 
ATOM   9236 C  "C4'"  . DG  F 2 21  ? -1.443  28.510  8.796   1.00 113.25 ? 21  DG  F "C4'"  1 
ATOM   9237 O  "O4'"  . DG  F 2 21  ? -1.751  27.881  7.525   1.00 115.26 ? 21  DG  F "O4'"  1 
ATOM   9238 C  "C3'"  . DG  F 2 21  ? -2.226  29.828  8.826   1.00 122.99 ? 21  DG  F "C3'"  1 
ATOM   9239 O  "O3'"  . DG  F 2 21  ? -1.332  30.944  8.836   1.00 114.92 ? 21  DG  F "O3'"  1 
ATOM   9240 C  "C2'"  . DG  F 2 21  ? -3.092  29.789  7.563   1.00 107.73 ? 21  DG  F "C2'"  1 
ATOM   9241 C  "C1'"  . DG  F 2 21  ? -2.322  28.835  6.662   1.00 110.03 ? 21  DG  F "C1'"  1 
ATOM   9242 N  N9     . DG  F 2 21  ? -3.148  28.153  5.671   1.00 109.21 ? 21  DG  F N9     1 
ATOM   9243 C  C8     . DG  F 2 21  ? -4.204  27.306  5.905   1.00 112.89 ? 21  DG  F C8     1 
ATOM   9244 N  N7     . DG  F 2 21  ? -4.751  26.845  4.813   1.00 107.44 ? 21  DG  F N7     1 
ATOM   9245 C  C5     . DG  F 2 21  ? -4.010  27.423  3.790   1.00 101.10 ? 21  DG  F C5     1 
ATOM   9246 C  C6     . DG  F 2 21  ? -4.135  27.295  2.385   1.00 97.28  ? 21  DG  F C6     1 
ATOM   9247 O  O6     . DG  F 2 21  ? -4.955  26.624  1.744   1.00 93.41  ? 21  DG  F O6     1 
ATOM   9248 N  N1     . DG  F 2 21  ? -3.179  28.053  1.712   1.00 98.96  ? 21  DG  F N1     1 
ATOM   9249 C  C2     . DG  F 2 21  ? -2.223  28.834  2.321   1.00 104.56 ? 21  DG  F C2     1 
ATOM   9250 N  N2     . DG  F 2 21  ? -1.383  29.494  1.510   1.00 106.34 ? 21  DG  F N2     1 
ATOM   9251 N  N3     . DG  F 2 21  ? -2.096  28.960  3.634   1.00 93.48  ? 21  DG  F N3     1 
ATOM   9252 C  C4     . DG  F 2 21  ? -3.019  28.230  4.303   1.00 98.78  ? 21  DG  F C4     1 
ATOM   9253 H  "H5'"  . DG  F 2 21  ? -1.391  26.682  9.733   1.00 135.98 ? 21  DG  F "H5'"  1 
ATOM   9254 H  "H5''" . DG  F 2 21  ? -1.393  27.888  10.753  1.00 135.98 ? 21  DG  F "H5''" 1 
ATOM   9255 H  "H4'"  . DG  F 2 21  ? -0.495  28.713  8.810   1.00 136.12 ? 21  DG  F "H4'"  1 
ATOM   9256 H  "H3'"  . DG  F 2 21  ? -2.801  29.841  9.607   1.00 147.80 ? 21  DG  F "H3'"  1 
ATOM   9257 H  "HO3'" . DG  F 2 21  ? -1.349  31.501  8.207   1.00 138.12 ? 21  DG  F "HO3'" 1 
ATOM   9258 H  "H2'"  . DG  F 2 21  ? -3.981  29.451  7.756   1.00 129.50 ? 21  DG  F "H2'"  1 
ATOM   9259 H  "H2''" . DG  F 2 21  ? -3.169  30.668  7.162   1.00 129.50 ? 21  DG  F "H2''" 1 
ATOM   9260 H  "H1'"  . DG  F 2 21  ? -1.622  29.316  6.194   1.00 132.26 ? 21  DG  F "H1'"  1 
ATOM   9261 H  H8     . DG  F 2 21  ? -4.500  27.083  6.758   1.00 135.69 ? 21  DG  F H8     1 
ATOM   9262 H  H1     . DG  F 2 21  ? -3.186  28.030  0.852   1.00 118.97 ? 21  DG  F H1     1 
ATOM   9263 H  H21    . DG  F 2 21  ? -0.768  29.994  1.843   1.00 127.83 ? 21  DG  F H21    1 
ATOM   9264 H  H22    . DG  F 2 21  ? -1.460  29.417  0.657   1.00 127.83 ? 21  DG  F H22    1 
ATOM   9265 P  P      . DC  G 3 1   ? -1.740  29.002  -8.861  1.00 203.26 ? 1   DC  G P      1 
ATOM   9266 O  OP1    . DC  G 3 1   ? -1.778  30.134  -9.817  1.00 183.75 ? 1   DC  G OP1    1 
ATOM   9267 O  OP2    . DC  G 3 1   ? -0.449  28.342  -8.564  1.00 175.75 ? 1   DC  G OP2    1 
ATOM   9268 O  "O5'"  . DC  G 3 1   ? -2.424  29.431  -7.472  1.00 159.68 ? 1   DC  G "O5'"  1 
ATOM   9269 C  "C5'"  . DC  G 3 1   ? -2.521  30.811  -7.123  1.00 145.29 ? 1   DC  G "C5'"  1 
ATOM   9270 C  "C4'"  . DC  G 3 1   ? -1.616  31.151  -5.949  1.00 124.87 ? 1   DC  G "C4'"  1 
ATOM   9271 O  "O4'"  . DC  G 3 1   ? -2.345  30.979  -4.701  1.00 104.60 ? 1   DC  G "O4'"  1 
ATOM   9272 C  "C3'"  . DC  G 3 1   ? -0.361  30.283  -5.832  1.00 135.58 ? 1   DC  G "C3'"  1 
ATOM   9273 O  "O3'"  . DC  G 3 1   ? 0.756   31.069  -5.411  1.00 138.41 ? 1   DC  G "O3'"  1 
ATOM   9274 C  "C2'"  . DC  G 3 1   ? -0.771  29.234  -4.797  1.00 125.88 ? 1   DC  G "C2'"  1 
ATOM   9275 C  "C1'"  . DC  G 3 1   ? -1.681  30.038  -3.874  1.00 116.12 ? 1   DC  G "C1'"  1 
ATOM   9276 N  N1     . DC  G 3 1   ? -2.714  29.230  -3.144  1.00 113.72 ? 1   DC  G N1     1 
ATOM   9277 C  C2     . DC  G 3 1   ? -2.760  29.276  -1.744  1.00 99.77  ? 1   DC  G C2     1 
ATOM   9278 O  O2     . DC  G 3 1   ? -1.943  29.975  -1.135  1.00 86.44  ? 1   DC  G O2     1 
ATOM   9279 N  N3     . DC  G 3 1   ? -3.701  28.549  -1.092  1.00 100.57 ? 1   DC  G N3     1 
ATOM   9280 C  C4     . DC  G 3 1   ? -4.568  27.807  -1.782  1.00 113.97 ? 1   DC  G C4     1 
ATOM   9281 N  N4     . DC  G 3 1   ? -5.478  27.107  -1.095  1.00 128.68 ? 1   DC  G N4     1 
ATOM   9282 C  C5     . DC  G 3 1   ? -4.541  27.749  -3.208  1.00 114.13 ? 1   DC  G C5     1 
ATOM   9283 C  C6     . DC  G 3 1   ? -3.609  28.472  -3.842  1.00 112.53 ? 1   DC  G C6     1 
ATOM   9284 H  "H5'"  . DC  G 3 1   ? -3.440  31.014  -6.886  1.00 174.56 ? 1   DC  G "H5'"  1 
ATOM   9285 H  "H5''" . DC  G 3 1   ? -2.266  31.350  -7.888  1.00 174.56 ? 1   DC  G "H5''" 1 
ATOM   9286 H  "H4'"  . DC  G 3 1   ? -1.346  32.080  -6.017  1.00 150.06 ? 1   DC  G "H4'"  1 
ATOM   9287 H  "H3'"  . DC  G 3 1   ? -0.161  29.854  -6.678  1.00 162.91 ? 1   DC  G "H3'"  1 
ATOM   9288 H  "H2'"  . DC  G 3 1   ? -1.247  28.496  -5.209  1.00 151.27 ? 1   DC  G "H2'"  1 
ATOM   9289 H  "H2''" . DC  G 3 1   ? -0.001  28.886  -4.320  1.00 151.27 ? 1   DC  G "H2''" 1 
ATOM   9290 H  "H1'"  . DC  G 3 1   ? -1.135  30.498  -3.218  1.00 139.56 ? 1   DC  G "H1'"  1 
ATOM   9291 H  H41    . DC  G 3 1   ? -6.051  26.620  -1.512  1.00 154.64 ? 1   DC  G H41    1 
ATOM   9292 H  H42    . DC  G 3 1   ? -5.490  27.145  -0.235  1.00 154.64 ? 1   DC  G H42    1 
ATOM   9293 H  H5     . DC  G 3 1   ? -5.150  27.229  -3.681  1.00 137.17 ? 1   DC  G H5     1 
ATOM   9294 H  H6     . DC  G 3 1   ? -3.570  28.456  -4.771  1.00 135.26 ? 1   DC  G H6     1 
ATOM   9295 P  P      . DT  G 3 2   ? 2.242   30.454  -5.426  1.00 111.27 ? 2   DT  G P      1 
ATOM   9296 O  OP1    . DT  G 3 2   ? 3.036   31.240  -6.395  1.00 101.18 ? 2   DT  G OP1    1 
ATOM   9297 O  OP2    . DT  G 3 2   ? 2.133   28.986  -5.581  1.00 84.11  ? 2   DT  G OP2    1 
ATOM   9298 O  "O5'"  . DT  G 3 2   ? 2.794   30.754  -3.956  1.00 87.83  ? 2   DT  G "O5'"  1 
ATOM   9299 C  "C5'"  . DT  G 3 2   ? 2.013   30.408  -2.829  1.00 83.43  ? 2   DT  G "C5'"  1 
ATOM   9300 C  "C4'"  . DT  G 3 2   ? 2.848   30.418  -1.564  1.00 66.25  ? 2   DT  G "C4'"  1 
ATOM   9301 O  "O4'"  . DT  G 3 2   ? 2.076   29.836  -0.485  1.00 58.39  ? 2   DT  G "O4'"  1 
ATOM   9302 C  "C3'"  . DT  G 3 2   ? 4.127   29.599  -1.624  1.00 81.01  ? 2   DT  G "C3'"  1 
ATOM   9303 O  "O3'"  . DT  G 3 2   ? 5.119   30.144  -0.758  1.00 81.42  ? 2   DT  G "O3'"  1 
ATOM   9304 C  "C2'"  . DT  G 3 2   ? 3.669   28.207  -1.191  1.00 88.26  ? 2   DT  G "C2'"  1 
ATOM   9305 C  "C1'"  . DT  G 3 2   ? 2.493   28.499  -0.249  1.00 83.90  ? 2   DT  G "C1'"  1 
ATOM   9306 N  N1     . DT  G 3 2   ? 1.298   27.594  -0.437  1.00 102.79 ? 2   DT  G N1     1 
ATOM   9307 C  C2     . DT  G 3 2   ? 0.600   27.173  0.671   1.00 94.59  ? 2   DT  G C2     1 
ATOM   9308 O  O2     . DT  G 3 2   ? 0.900   27.487  1.810   1.00 81.84  ? 2   DT  G O2     1 
ATOM   9309 N  N3     . DT  G 3 2   ? -0.470  26.361  0.401   1.00 95.13  ? 2   DT  G N3     1 
ATOM   9310 C  C4     . DT  G 3 2   ? -0.907  25.938  -0.839  1.00 93.78  ? 2   DT  G C4     1 
ATOM   9311 O  O4     . DT  G 3 2   ? -1.883  25.206  -0.975  1.00 93.67  ? 2   DT  G O4     1 
ATOM   9312 C  C5     . DT  G 3 2   ? -0.137  26.416  -1.961  1.00 94.48  ? 2   DT  G C5     1 
ATOM   9313 C  C7     . DT  G 3 2   ? -0.515  26.023  -3.353  1.00 94.90  ? 2   DT  G C7     1 
ATOM   9314 C  C6     . DT  G 3 2   ? 0.914   27.215  -1.712  1.00 99.44  ? 2   DT  G C6     1 
ATOM   9315 H  "H5'"  . DT  G 3 2   ? 1.641   29.522  -2.958  1.00 100.34 ? 2   DT  G "H5'"  1 
ATOM   9316 H  "H5''" . DT  G 3 2   ? 1.287   31.045  -2.736  1.00 100.34 ? 2   DT  G "H5''" 1 
ATOM   9317 H  "H4'"  . DT  G 3 2   ? 3.075   31.335  -1.344  1.00 79.72  ? 2   DT  G "H4'"  1 
ATOM   9318 H  "H3'"  . DT  G 3 2   ? 4.461   29.569  -2.534  1.00 97.43  ? 2   DT  G "H3'"  1 
ATOM   9319 H  "H2'"  . DT  G 3 2   ? 3.384   27.680  -1.954  1.00 106.13 ? 2   DT  G "H2'"  1 
ATOM   9320 H  "H2''" . DT  G 3 2   ? 4.379   27.734  -0.729  1.00 106.13 ? 2   DT  G "H2''" 1 
ATOM   9321 H  "H1'"  . DT  G 3 2   ? 2.815   28.422  0.663   1.00 100.89 ? 2   DT  G "H1'"  1 
ATOM   9322 H  H3     . DT  G 3 2   ? -0.920  26.085  1.080   1.00 114.37 ? 2   DT  G H3     1 
ATOM   9323 H  H71    . DT  G 3 2   ? -0.981  25.173  -3.326  1.00 114.09 ? 2   DT  G H71    1 
ATOM   9324 H  H72    . DT  G 3 2   ? -1.093  26.706  -3.728  1.00 114.09 ? 2   DT  G H72    1 
ATOM   9325 H  H73    . DT  G 3 2   ? 0.291   25.941  -3.887  1.00 114.09 ? 2   DT  G H73    1 
ATOM   9326 H  H6     . DT  G 3 2   ? 1.408   27.530  -2.434  1.00 119.55 ? 2   DT  G H6     1 
ATOM   9327 P  P      . DT  G 3 3   ? 6.596   29.511  -0.727  1.00 77.90  ? 3   DT  G P      1 
ATOM   9328 O  OP1    . DT  G 3 3   ? 7.549   30.610  -0.447  1.00 74.46  ? 3   DT  G OP1    1 
ATOM   9329 O  OP2    . DT  G 3 3   ? 6.751   28.699  -1.954  1.00 62.53  ? 3   DT  G OP2    1 
ATOM   9330 O  "O5'"  . DT  G 3 3   ? 6.557   28.505  0.517   1.00 50.27  ? 3   DT  G "O5'"  1 
ATOM   9331 C  "C5'"  . DT  G 3 3   ? 6.210   28.985  1.811   1.00 54.75  ? 3   DT  G "C5'"  1 
ATOM   9332 C  "C4'"  . DT  G 3 3   ? 5.911   27.828  2.752   1.00 76.53  ? 3   DT  G "C4'"  1 
ATOM   9333 O  "O4'"  . DT  G 3 3   ? 4.671   27.205  2.354   1.00 82.60  ? 3   DT  G "O4'"  1 
ATOM   9334 C  "C3'"  . DT  G 3 3   ? 6.957   26.716  2.764   1.00 78.80  ? 3   DT  G "C3'"  1 
ATOM   9335 O  "O3'"  . DT  G 3 3   ? 7.676   26.742  3.998   1.00 72.65  ? 3   DT  G "O3'"  1 
ATOM   9336 C  "C2'"  . DT  G 3 3   ? 6.177   25.409  2.570   1.00 88.00  ? 3   DT  G "C2'"  1 
ATOM   9337 C  "C1'"  . DT  G 3 3   ? 4.715   25.831  2.657   1.00 77.76  ? 3   DT  G "C1'"  1 
ATOM   9338 N  N1     . DT  G 3 3   ? 3.803   25.116  1.710   1.00 77.87  ? 3   DT  G N1     1 
ATOM   9339 C  C2     . DT  G 3 3   ? 2.715   24.434  2.209   1.00 84.56  ? 3   DT  G C2     1 
ATOM   9340 O  O2     . DT  G 3 3   ? 2.460   24.361  3.397   1.00 87.48  ? 3   DT  G O2     1 
ATOM   9341 N  N3     . DT  G 3 3   ? 1.936   23.826  1.261   1.00 94.69  ? 3   DT  G N3     1 
ATOM   9342 C  C4     . DT  G 3 3   ? 2.126   23.838  -0.110  1.00 96.00  ? 3   DT  G C4     1 
ATOM   9343 O  O4     . DT  G 3 3   ? 1.367   23.260  -0.883  1.00 91.57  ? 3   DT  G O4     1 
ATOM   9344 C  C5     . DT  G 3 3   ? 3.278   24.578  -0.568  1.00 90.96  ? 3   DT  G C5     1 
ATOM   9345 C  C7     . DT  G 3 3   ? 3.583   24.660  -2.031  1.00 83.54  ? 3   DT  G C7     1 
ATOM   9346 C  C6     . DT  G 3 3   ? 4.050   25.179  0.352   1.00 85.74  ? 3   DT  G C6     1 
ATOM   9347 H  "H5'"  . DT  G 3 3   ? 5.427   29.553  1.743   1.00 65.91  ? 3   DT  G "H5'"  1 
ATOM   9348 H  "H5''" . DT  G 3 3   ? 6.947   29.505  2.168   1.00 65.91  ? 3   DT  G "H5''" 1 
ATOM   9349 H  "H4'"  . DT  G 3 3   ? 5.815   28.167  3.656   1.00 92.05  ? 3   DT  G "H4'"  1 
ATOM   9350 H  "H3'"  . DT  G 3 3   ? 7.549   26.828  2.004   1.00 94.78  ? 3   DT  G "H3'"  1 
ATOM   9351 H  "H2'"  . DT  G 3 3   ? 6.372   25.014  1.705   1.00 105.81 ? 3   DT  G "H2'"  1 
ATOM   9352 H  "H2''" . DT  G 3 3   ? 6.395   24.769  3.265   1.00 105.81 ? 3   DT  G "H2''" 1 
ATOM   9353 H  "H1'"  . DT  G 3 3   ? 4.406   25.684  3.565   1.00 93.52  ? 3   DT  G "H1'"  1 
ATOM   9354 H  H3     . DT  G 3 3   ? 1.254   23.388  1.549   1.00 113.84 ? 3   DT  G H3     1 
ATOM   9355 H  H71    . DT  G 3 3   ? 3.138   23.930  -2.488  1.00 100.47 ? 3   DT  G H71    1 
ATOM   9356 H  H72    . DT  G 3 3   ? 3.263   25.509  -2.373  1.00 100.47 ? 3   DT  G H72    1 
ATOM   9357 H  H73    . DT  G 3 3   ? 4.543   24.593  -2.157  1.00 100.47 ? 3   DT  G H73    1 
ATOM   9358 H  H6     . DT  G 3 3   ? 4.789   25.661  0.060   1.00 103.11 ? 3   DT  G H6     1 
ATOM   9359 P  P      . DG  G 3 4   ? 8.923   25.763  4.236   1.00 71.21  ? 4   DG  G P      1 
ATOM   9360 O  OP1    . DG  G 3 4   ? 9.888   26.481  5.099   1.00 76.70  ? 4   DG  G OP1    1 
ATOM   9361 O  OP2    . DG  G 3 4   ? 9.353   25.260  2.912   1.00 63.59  ? 4   DG  G OP2    1 
ATOM   9362 O  "O5'"  . DG  G 3 4   ? 8.296   24.544  5.067   1.00 94.24  ? 4   DG  G "O5'"  1 
ATOM   9363 C  "C5'"  . DG  G 3 4   ? 7.460   24.811  6.198   1.00 91.39  ? 4   DG  G "C5'"  1 
ATOM   9364 C  "C4'"  . DG  G 3 4   ? 6.565   23.620  6.517   1.00 102.58 ? 4   DG  G "C4'"  1 
ATOM   9365 O  "O4'"  . DG  G 3 4   ? 5.672   23.372  5.396   1.00 105.94 ? 4   DG  G "O4'"  1 
ATOM   9366 C  "C3'"  . DG  G 3 4   ? 7.319   22.308  6.774   1.00 103.91 ? 4   DG  G "C3'"  1 
ATOM   9367 O  "O3'"  . DG  G 3 4   ? 6.933   21.733  8.028   1.00 115.83 ? 4   DG  G "O3'"  1 
ATOM   9368 C  "C2'"  . DG  G 3 4   ? 6.936   21.416  5.591   1.00 95.89  ? 4   DG  G "C2'"  1 
ATOM   9369 C  "C1'"  . DG  G 3 4   ? 5.590   21.986  5.163   1.00 96.13  ? 4   DG  G "C1'"  1 
ATOM   9370 N  N9     . DG  G 3 4   ? 5.278   21.745  3.759   1.00 81.97  ? 4   DG  G N9     1 
ATOM   9371 C  C8     . DG  G 3 4   ? 6.029   22.115  2.671   1.00 82.85  ? 4   DG  G C8     1 
ATOM   9372 N  N7     . DG  G 3 4   ? 5.516   21.742  1.533   1.00 82.58  ? 4   DG  G N7     1 
ATOM   9373 C  C5     . DG  G 3 4   ? 4.360   21.061  1.886   1.00 90.32  ? 4   DG  G C5     1 
ATOM   9374 C  C6     . DG  G 3 4   ? 3.394   20.426  1.070   1.00 100.23 ? 4   DG  G C6     1 
ATOM   9375 O  O6     . DG  G 3 4   ? 3.373   20.342  -0.166  1.00 102.02 ? 4   DG  G O6     1 
ATOM   9376 N  N1     . DG  G 3 4   ? 2.376   19.852  1.825   1.00 105.39 ? 4   DG  G N1     1 
ATOM   9377 C  C2     . DG  G 3 4   ? 2.300   19.885  3.199   1.00 103.00 ? 4   DG  G C2     1 
ATOM   9378 N  N2     . DG  G 3 4   ? 1.240   19.274  3.751   1.00 107.35 ? 4   DG  G N2     1 
ATOM   9379 N  N3     . DG  G 3 4   ? 3.200   20.478  3.978   1.00 102.44 ? 4   DG  G N3     1 
ATOM   9380 C  C4     . DG  G 3 4   ? 4.200   21.043  3.254   1.00 92.77  ? 4   DG  G C4     1 
ATOM   9381 H  "H5'"  . DG  G 3 4   ? 6.905   25.583  6.007   1.00 109.88 ? 4   DG  G "H5'"  1 
ATOM   9382 H  "H5''" . DG  G 3 4   ? 8.018   25.005  6.967   1.00 109.88 ? 4   DG  G "H5''" 1 
ATOM   9383 H  "H4'"  . DG  G 3 4   ? 6.022   23.819  7.296   1.00 123.31 ? 4   DG  G "H4'"  1 
ATOM   9384 H  "H3'"  . DG  G 3 4   ? 8.274   22.480  6.756   1.00 124.90 ? 4   DG  G "H3'"  1 
ATOM   9385 H  "H2'"  . DG  G 3 4   ? 7.588   21.481  4.876   1.00 115.29 ? 4   DG  G "H2'"  1 
ATOM   9386 H  "H2''" . DG  G 3 4   ? 6.854   20.489  5.862   1.00 115.29 ? 4   DG  G "H2''" 1 
ATOM   9387 H  "H1'"  . DG  G 3 4   ? 4.878   21.614  5.706   1.00 115.57 ? 4   DG  G "H1'"  1 
ATOM   9388 H  H8     . DG  G 3 4   ? 6.827   22.586  2.740   1.00 99.64  ? 4   DG  G H8     1 
ATOM   9389 H  H1     . DG  G 3 4   ? 1.746   19.447  1.402   1.00 126.68 ? 4   DG  G H1     1 
ATOM   9390 H  H21    . DG  G 3 4   ? 1.144   19.267  4.605   1.00 129.04 ? 4   DG  G H21    1 
ATOM   9391 H  H22    . DG  G 3 4   ? 0.656   18.890  3.250   1.00 129.04 ? 4   DG  G H22    1 
ATOM   9392 P  P      . DC  G 3 5   ? 7.784   20.524  8.663   1.00 117.19 ? 5   DC  G P      1 
ATOM   9393 O  OP1    . DC  G 3 5   ? 7.212   20.243  9.999   1.00 88.19  ? 5   DC  G OP1    1 
ATOM   9394 O  OP2    . DC  G 3 5   ? 9.220   20.861  8.540   1.00 103.90 ? 5   DC  G OP2    1 
ATOM   9395 O  "O5'"  . DC  G 3 5   ? 7.501   19.293  7.678   1.00 121.04 ? 5   DC  G "O5'"  1 
ATOM   9396 C  "C5'"  . DC  G 3 5   ? 7.123   18.018  8.193   1.00 116.56 ? 5   DC  G "C5'"  1 
ATOM   9397 C  "C4'"  . DC  G 3 5   ? 5.750   17.611  7.688   1.00 112.46 ? 5   DC  G "C4'"  1 
ATOM   9398 O  "O4'"  . DC  G 3 5   ? 5.431   18.353  6.491   1.00 108.15 ? 5   DC  G "O4'"  1 
ATOM   9399 C  "C3'"  . DC  G 3 5   ? 5.626   16.153  7.282   1.00 116.03 ? 5   DC  G "C3'"  1 
ATOM   9400 O  "O3'"  . DC  G 3 5   ? 5.303   15.339  8.403   1.00 116.61 ? 5   DC  G "O3'"  1 
ATOM   9401 C  "C2'"  . DC  G 3 5   ? 4.509   16.170  6.235   1.00 113.12 ? 5   DC  G "C2'"  1 
ATOM   9402 C  "C1'"  . DC  G 3 5   ? 4.535   17.603  5.689   1.00 103.15 ? 5   DC  G "C1'"  1 
ATOM   9403 N  N1     . DC  G 3 5   ? 4.991   17.696  4.265   1.00 95.24  ? 5   DC  G N1     1 
ATOM   9404 C  C2     . DC  G 3 5   ? 4.248   17.079  3.250   1.00 103.30 ? 5   DC  G C2     1 
ATOM   9405 O  O2     . DC  G 3 5   ? 3.224   16.454  3.550   1.00 110.37 ? 5   DC  G O2     1 
ATOM   9406 N  N3     . DC  G 3 5   ? 4.681   17.180  1.967   1.00 95.80  ? 5   DC  G N3     1 
ATOM   9407 C  C4     . DC  G 3 5   ? 5.792   17.864  1.689   1.00 88.33  ? 5   DC  G C4     1 
ATOM   9408 N  N4     . DC  G 3 5   ? 6.182   17.942  0.412   1.00 95.08  ? 5   DC  G N4     1 
ATOM   9409 C  C5     . DC  G 3 5   ? 6.557   18.501  2.709   1.00 91.48  ? 5   DC  G C5     1 
ATOM   9410 C  C6     . DC  G 3 5   ? 6.124   18.394  3.967   1.00 95.87  ? 5   DC  G C6     1 
ATOM   9411 H  "H5'"  . DC  G 3 5   ? 7.108   18.058  9.162   1.00 140.09 ? 5   DC  G "H5'"  1 
ATOM   9412 H  "H5''" . DC  G 3 5   ? 7.775   17.356  7.914   1.00 140.09 ? 5   DC  G "H5''" 1 
ATOM   9413 H  "H4'"  . DC  G 3 5   ? 5.096   17.815  8.374   1.00 135.17 ? 5   DC  G "H4'"  1 
ATOM   9414 H  "H3'"  . DC  G 3 5   ? 6.454   15.851  6.879   1.00 139.45 ? 5   DC  G "H3'"  1 
ATOM   9415 H  "H2'"  . DC  G 3 5   ? 4.685   15.527  5.530   1.00 135.96 ? 5   DC  G "H2'"  1 
ATOM   9416 H  "H2''" . DC  G 3 5   ? 3.650   15.968  6.639   1.00 135.96 ? 5   DC  G "H2''" 1 
ATOM   9417 H  "H1'"  . DC  G 3 5   ? 3.646   17.981  5.778   1.00 124.00 ? 5   DC  G "H1'"  1 
ATOM   9418 H  H41    . DC  G 3 5   ? 6.895   18.376  0.206   1.00 114.32 ? 5   DC  G H41    1 
ATOM   9419 H  H42    . DC  G 3 5   ? 5.720   17.557  -0.203  1.00 114.32 ? 5   DC  G H42    1 
ATOM   9420 H  H5     . DC  G 3 5   ? 7.330   18.976  2.505   1.00 109.99 ? 5   DC  G H5     1 
ATOM   9421 H  H6     . DC  G 3 5   ? 6.603   18.802  4.652   1.00 115.26 ? 5   DC  G H6     1 
ATOM   9422 P  P      . DT  G 3 6   ? 5.828   13.821  8.480   1.00 123.30 ? 6   DT  G P      1 
ATOM   9423 O  OP1    . DT  G 3 6   ? 5.703   13.383  9.887   1.00 113.99 ? 6   DT  G OP1    1 
ATOM   9424 O  OP2    . DT  G 3 6   ? 7.144   13.751  7.807   1.00 102.33 ? 6   DT  G OP2    1 
ATOM   9425 O  "O5'"  . DT  G 3 6   ? 4.785   13.008  7.579   1.00 125.00 ? 6   DT  G "O5'"  1 
ATOM   9426 C  "C5'"  . DT  G 3 6   ? 3.384   13.143  7.806   1.00 105.49 ? 6   DT  G "C5'"  1 
ATOM   9427 C  "C4'"  . DT  G 3 6   ? 2.593   12.338  6.785   1.00 115.66 ? 6   DT  G "C4'"  1 
ATOM   9428 O  "O4'"  . DT  G 3 6   ? 2.749   12.939  5.473   1.00 114.18 ? 6   DT  G "O4'"  1 
ATOM   9429 C  "C3'"  . DT  G 3 6   ? 3.035   10.879  6.658   1.00 139.34 ? 6   DT  G "C3'"  1 
ATOM   9430 O  "O3'"  . DT  G 3 6   ? 1.907   10.004  6.719   1.00 143.82 ? 6   DT  G "O3'"  1 
ATOM   9431 C  "C2'"  . DT  G 3 6   ? 3.752   10.813  5.310   1.00 133.95 ? 6   DT  G "C2'"  1 
ATOM   9432 C  "C1'"  . DT  G 3 6   ? 3.130   11.961  4.528   1.00 124.59 ? 6   DT  G "C1'"  1 
ATOM   9433 N  N1     . DT  G 3 6   ? 4.064   12.587  3.548   1.00 115.68 ? 6   DT  G N1     1 
ATOM   9434 C  C2     . DT  G 3 6   ? 3.896   12.351  2.203   1.00 114.61 ? 6   DT  G C2     1 
ATOM   9435 O  O2     . DT  G 3 6   ? 3.019   11.634  1.754   1.00 106.92 ? 6   DT  G O2     1 
ATOM   9436 N  N3     . DT  G 3 6   ? 4.812   12.975  1.396   1.00 120.61 ? 6   DT  G N3     1 
ATOM   9437 C  C4     . DT  G 3 6   ? 5.847   13.802  1.791   1.00 109.91 ? 6   DT  G C4     1 
ATOM   9438 O  O4     . DT  G 3 6   ? 6.617   14.321  0.988   1.00 102.23 ? 6   DT  G O4     1 
ATOM   9439 C  C5     . DT  G 3 6   ? 5.960   14.013  3.213   1.00 110.24 ? 6   DT  G C5     1 
ATOM   9440 C  C7     . DT  G 3 6   ? 7.041   14.890  3.760   1.00 109.51 ? 6   DT  G C7     1 
ATOM   9441 C  C6     . DT  G 3 6   ? 5.074   13.403  4.014   1.00 112.86 ? 6   DT  G C6     1 
ATOM   9442 H  "H5'"  . DT  G 3 6   ? 3.137   14.079  7.736   1.00 126.80 ? 6   DT  G "H5'"  1 
ATOM   9443 H  "H5''" . DT  G 3 6   ? 3.171   12.827  8.698   1.00 126.80 ? 6   DT  G "H5''" 1 
ATOM   9444 H  "H4'"  . DT  G 3 6   ? 1.650   12.355  7.010   1.00 139.00 ? 6   DT  G "H4'"  1 
ATOM   9445 H  "H3'"  . DT  G 3 6   ? 3.667   10.672  7.364   1.00 167.42 ? 6   DT  G "H3'"  1 
ATOM   9446 H  "H2'"  . DT  G 3 6   ? 4.708   10.939  5.415   1.00 160.95 ? 6   DT  G "H2'"  1 
ATOM   9447 H  "H2''" . DT  G 3 6   ? 3.592   9.963   4.870   1.00 160.95 ? 6   DT  G "H2''" 1 
ATOM   9448 H  "H1'"  . DT  G 3 6   ? 2.340   11.643  4.065   1.00 149.72 ? 6   DT  G "H1'"  1 
ATOM   9449 H  H3     . DT  G 3 6   ? 4.734   12.837  0.551   1.00 144.94 ? 6   DT  G H3     1 
ATOM   9450 H  H71    . DT  G 3 6   ? 6.638   15.594  4.292   1.00 131.63 ? 6   DT  G H71    1 
ATOM   9451 H  H72    . DT  G 3 6   ? 7.632   14.355  4.313   1.00 131.63 ? 6   DT  G H72    1 
ATOM   9452 H  H73    . DT  G 3 6   ? 7.538   15.276  3.022   1.00 131.63 ? 6   DT  G H73    1 
ATOM   9453 H  H6     . DT  G 3 6   ? 5.145   13.537  4.931   1.00 135.65 ? 6   DT  G H6     1 
ATOM   9454 P  P      . DC  G 3 7   ? 2.119   8.428   6.948   1.00 127.00 ? 7   DC  G P      1 
ATOM   9455 O  OP1    . DC  G 3 7   ? 0.894   7.901   7.590   1.00 133.39 ? 7   DC  G OP1    1 
ATOM   9456 O  OP2    . DC  G 3 7   ? 3.433   8.236   7.600   1.00 116.57 ? 7   DC  G OP2    1 
ATOM   9457 O  "O5'"  . DC  G 3 7   ? 2.219   7.834   5.468   1.00 104.15 ? 7   DC  G "O5'"  1 
ATOM   9458 C  "C5'"  . DC  G 3 7   ? 1.141   8.012   4.561   1.00 108.14 ? 7   DC  G "C5'"  1 
ATOM   9459 C  "C4'"  . DC  G 3 7   ? 1.469   7.421   3.202   1.00 134.29 ? 7   DC  G "C4'"  1 
ATOM   9460 O  "O4'"  . DC  G 3 7   ? 2.317   8.342   2.461   1.00 128.51 ? 7   DC  G "O4'"  1 
ATOM   9461 C  "C3'"  . DC  G 3 7   ? 2.224   6.085   3.239   1.00 137.64 ? 7   DC  G "C3'"  1 
ATOM   9462 O  "O3'"  . DC  G 3 7   ? 1.539   5.112   2.447   1.00 131.75 ? 7   DC  G "O3'"  1 
ATOM   9463 C  "C2'"  . DC  G 3 7   ? 3.612   6.414   2.688   1.00 127.99 ? 7   DC  G "C2'"  1 
ATOM   9464 C  "C1'"  . DC  G 3 7   ? 3.327   7.612   1.798   1.00 123.79 ? 7   DC  G "C1'"  1 
ATOM   9465 N  N1     . DC  G 3 7   ? 4.500   8.501   1.559   1.00 117.30 ? 7   DC  G N1     1 
ATOM   9466 C  C2     . DC  G 3 7   ? 4.943   8.714   0.248   1.00 126.00 ? 7   DC  G C2     1 
ATOM   9467 O  O2     . DC  G 3 7   ? 4.365   8.139   -0.682  1.00 133.41 ? 7   DC  G O2     1 
ATOM   9468 N  N3     . DC  G 3 7   ? 6.008   9.528   0.038   1.00 120.72 ? 7   DC  G N3     1 
ATOM   9469 C  C4     . DC  G 3 7   ? 6.606   10.122  1.072   1.00 111.08 ? 7   DC  G C4     1 
ATOM   9470 N  N4     . DC  G 3 7   ? 7.648   10.922  0.819   1.00 101.09 ? 7   DC  G N4     1 
ATOM   9471 C  C5     . DC  G 3 7   ? 6.161   9.926   2.413   1.00 107.94 ? 7   DC  G C5     1 
ATOM   9472 C  C6     . DC  G 3 7   ? 5.113   9.118   2.607   1.00 108.43 ? 7   DC  G C6     1 
ATOM   9473 H  "H5'"  . DC  G 3 7   ? 0.962   8.961   4.462   1.00 129.99 ? 7   DC  G "H5'"  1 
ATOM   9474 H  "H5''" . DC  G 3 7   ? 0.351   7.577   4.916   1.00 129.99 ? 7   DC  G "H5''" 1 
ATOM   9475 H  "H4'"  . DC  G 3 7   ? 0.645   7.295   2.705   1.00 161.36 ? 7   DC  G "H4'"  1 
ATOM   9476 H  "H3'"  . DC  G 3 7   ? 2.315   5.784   4.156   1.00 165.38 ? 7   DC  G "H3'"  1 
ATOM   9477 H  "H2'"  . DC  G 3 7   ? 4.230   6.642   3.400   1.00 153.80 ? 7   DC  G "H2'"  1 
ATOM   9478 H  "H2''" . DC  G 3 7   ? 3.976   5.674   2.178   1.00 153.80 ? 7   DC  G "H2''" 1 
ATOM   9479 H  "H1'"  . DC  G 3 7   ? 3.002   7.307   0.937   1.00 148.76 ? 7   DC  G "H1'"  1 
ATOM   9480 H  H41    . DC  G 3 7   ? 8.053   11.318  1.466   1.00 121.53 ? 7   DC  G H41    1 
ATOM   9481 H  H42    . DC  G 3 7   ? 7.913   11.039  0.009   1.00 121.53 ? 7   DC  G H42    1 
ATOM   9482 H  H5     . DC  G 3 7   ? 6.585   10.345  3.128   1.00 129.75 ? 7   DC  G H5     1 
ATOM   9483 H  H6     . DC  G 3 7   ? 4.798   8.976   3.471   1.00 130.34 ? 7   DC  G H6     1 
ATOM   9484 P  P      . DA  G 3 8   ? 2.068   3.597   2.368   1.00 137.71 ? 8   DA  G P      1 
ATOM   9485 O  OP1    . DA  G 3 8   ? 0.909   2.706   2.591   1.00 132.20 ? 8   DA  G OP1    1 
ATOM   9486 O  OP2    . DA  G 3 8   ? 3.262   3.480   3.236   1.00 115.79 ? 8   DA  G OP2    1 
ATOM   9487 O  "O5'"  . DA  G 3 8   ? 2.550   3.440   0.849   1.00 125.07 ? 8   DA  G "O5'"  1 
ATOM   9488 C  "C5'"  . DA  G 3 8   ? 1.676   3.818   -0.222  1.00 118.48 ? 8   DA  G "C5'"  1 
ATOM   9489 C  "C4'"  . DA  G 3 8   ? 2.410   3.795   -1.555  1.00 129.73 ? 8   DA  G "C4'"  1 
ATOM   9490 O  "O4'"  . DA  G 3 8   ? 3.364   4.891   -1.590  1.00 126.15 ? 8   DA  G "O4'"  1 
ATOM   9491 C  "C3'"  . DA  G 3 8   ? 3.202   2.516   -1.827  1.00 136.65 ? 8   DA  G "C3'"  1 
ATOM   9492 O  "O3'"  . DA  G 3 8   ? 2.970   2.048   -3.157  1.00 133.44 ? 8   DA  G "O3'"  1 
ATOM   9493 C  "C2'"  . DA  G 3 8   ? 4.656   2.926   -1.605  1.00 134.29 ? 8   DA  G "C2'"  1 
ATOM   9494 C  "C1'"  . DA  G 3 8   ? 4.641   4.409   -1.953  1.00 128.39 ? 8   DA  G "C1'"  1 
ATOM   9495 N  N9     . DA  G 3 8   ? 5.648   5.189   -1.239  1.00 127.97 ? 8   DA  G N9     1 
ATOM   9496 C  C8     . DA  G 3 8   ? 5.816   5.271   0.116   1.00 127.06 ? 8   DA  G C8     1 
ATOM   9497 N  N7     . DA  G 3 8   ? 6.809   6.046   0.482   1.00 118.63 ? 8   DA  G N7     1 
ATOM   9498 C  C5     . DA  G 3 8   ? 7.337   6.497   -0.716  1.00 123.43 ? 8   DA  G C5     1 
ATOM   9499 C  C6     . DA  G 3 8   ? 8.415   7.354   -1.014  1.00 111.88 ? 8   DA  G C6     1 
ATOM   9500 N  N6     . DA  G 3 8   ? 9.178   7.928   -0.078  1.00 110.87 ? 8   DA  G N6     1 
ATOM   9501 N  N1     . DA  G 3 8   ? 8.677   7.600   -2.315  1.00 110.50 ? 8   DA  G N1     1 
ATOM   9502 C  C2     . DA  G 3 8   ? 7.909   7.025   -3.248  1.00 113.84 ? 8   DA  G C2     1 
ATOM   9503 N  N3     . DA  G 3 8   ? 6.870   6.203   -3.091  1.00 115.62 ? 8   DA  G N3     1 
ATOM   9504 C  C4     . DA  G 3 8   ? 6.634   5.978   -1.789  1.00 126.39 ? 8   DA  G C4     1 
ATOM   9505 H  "H5'"  . DA  G 3 8   ? 1.338   4.712   -0.058  1.00 142.39 ? 8   DA  G "H5'"  1 
ATOM   9506 H  "H5''" . DA  G 3 8   ? 0.929   3.199   -0.258  1.00 142.39 ? 8   DA  G "H5''" 1 
ATOM   9507 H  "H4'"  . DA  G 3 8   ? 1.778   3.920   -2.280  1.00 155.89 ? 8   DA  G "H4'"  1 
ATOM   9508 H  "H3'"  . DA  G 3 8   ? 2.953   1.837   -1.180  1.00 164.19 ? 8   DA  G "H3'"  1 
ATOM   9509 H  "H2'"  . DA  G 3 8   ? 4.925   2.784   -0.684  1.00 161.37 ? 8   DA  G "H2'"  1 
ATOM   9510 H  "H2''" . DA  G 3 8   ? 5.253   2.434   -2.189  1.00 161.37 ? 8   DA  G "H2''" 1 
ATOM   9511 H  "H1'"  . DA  G 3 8   ? 4.768   4.516   -2.909  1.00 154.29 ? 8   DA  G "H1'"  1 
ATOM   9512 H  H8     . DA  G 3 8   ? 5.275   4.818   0.722   1.00 152.69 ? 8   DA  G H8     1 
ATOM   9513 H  H61    . DA  G 3 8   ? 9.825   8.446   -0.309  1.00 133.25 ? 8   DA  G H61    1 
ATOM   9514 H  H62    . DA  G 3 8   ? 9.022   7.780   0.754   1.00 133.25 ? 8   DA  G H62    1 
ATOM   9515 H  H2     . DA  G 3 8   ? 8.130   7.226   -4.129  1.00 136.82 ? 8   DA  G H2     1 
ATOM   9516 P  P      . DT  G 3 9   ? 3.537   0.618   -3.624  1.00 140.41 ? 9   DT  G P      1 
ATOM   9517 O  OP1    . DT  G 3 9   ? 2.555   0.042   -4.569  1.00 148.97 ? 9   DT  G OP1    1 
ATOM   9518 O  OP2    . DT  G 3 9   ? 3.924   -0.142  -2.415  1.00 105.68 ? 9   DT  G OP2    1 
ATOM   9519 O  "O5'"  . DT  G 3 9   ? 4.875   0.971   -4.429  1.00 138.15 ? 9   DT  G "O5'"  1 
ATOM   9520 C  "C5'"  . DT  G 3 9   ? 4.840   1.881   -5.528  1.00 124.43 ? 9   DT  G "C5'"  1 
ATOM   9521 C  "C4'"  . DT  G 3 9   ? 6.248   2.166   -6.028  1.00 119.05 ? 9   DT  G "C4'"  1 
ATOM   9522 O  "O4'"  . DT  G 3 9   ? 6.946   2.941   -5.019  1.00 124.70 ? 9   DT  G "O4'"  1 
ATOM   9523 C  "C3'"  . DT  G 3 9   ? 7.095   0.917   -6.290  1.00 127.48 ? 9   DT  G "C3'"  1 
ATOM   9524 O  "O3'"  . DT  G 3 9   ? 7.650   0.949   -7.615  1.00 126.68 ? 9   DT  G "O3'"  1 
ATOM   9525 C  "C2'"  . DT  G 3 9   ? 8.160   0.945   -5.190  1.00 127.26 ? 9   DT  G "C2'"  1 
ATOM   9526 C  "C1'"  . DT  G 3 9   ? 8.241   2.423   -4.826  1.00 125.95 ? 9   DT  G "C1'"  1 
ATOM   9527 N  N1     . DT  G 3 9   ? 8.639   2.679   -3.398  1.00 127.25 ? 9   DT  G N1     1 
ATOM   9528 C  C2     . DT  G 3 9   ? 9.709   3.504   -3.132  1.00 118.74 ? 9   DT  G C2     1 
ATOM   9529 O  O2     . DT  G 3 9   ? 10.374  4.040   -4.001  1.00 107.83 ? 9   DT  G O2     1 
ATOM   9530 N  N3     . DT  G 3 9   ? 9.985   3.673   -1.800  1.00 123.17 ? 9   DT  G N3     1 
ATOM   9531 C  C4     . DT  G 3 9   ? 9.308   3.119   -0.728  1.00 130.08 ? 9   DT  G C4     1 
ATOM   9532 O  O4     . DT  G 3 9   ? 9.632   3.333   0.436   1.00 129.15 ? 9   DT  G O4     1 
ATOM   9533 C  C5     . DT  G 3 9   ? 8.192   2.273   -1.074  1.00 122.44 ? 9   DT  G C5     1 
ATOM   9534 C  C7     . DT  G 3 9   ? 7.384   1.619   0.004   1.00 112.30 ? 9   DT  G C7     1 
ATOM   9535 C  C6     . DT  G 3 9   ? 7.911   2.097   -2.375  1.00 125.19 ? 9   DT  G C6     1 
ATOM   9536 H  "H5'"  . DT  G 3 9   ? 4.425   2.711   -5.245  1.00 149.53 ? 9   DT  G "H5'"  1 
ATOM   9537 H  "H5''" . DT  G 3 9   ? 4.315   1.495   -6.247  1.00 149.53 ? 9   DT  G "H5''" 1 
ATOM   9538 H  "H4'"  . DT  G 3 9   ? 6.215   2.684   -6.848  1.00 143.08 ? 9   DT  G "H4'"  1 
ATOM   9539 H  "H3'"  . DT  G 3 9   ? 6.551   0.122   -6.176  1.00 153.19 ? 9   DT  G "H3'"  1 
ATOM   9540 H  "H2'"  . DT  G 3 9   ? 7.890   0.410   -4.427  1.00 152.93 ? 9   DT  G "H2'"  1 
ATOM   9541 H  "H2''" . DT  G 3 9   ? 9.012   0.618   -5.519  1.00 152.93 ? 9   DT  G "H2''" 1 
ATOM   9542 H  "H1'"  . DT  G 3 9   ? 8.869   2.865   -5.418  1.00 151.36 ? 9   DT  G "H1'"  1 
ATOM   9543 H  H3     . DT  G 3 9   ? 10.653  4.180   -1.609  1.00 148.02 ? 9   DT  G H3     1 
ATOM   9544 H  H71    . DT  G 3 9   ? 7.986   1.228   0.657   1.00 134.97 ? 9   DT  G H71    1 
ATOM   9545 H  H72    . DT  G 3 9   ? 6.825   2.288   0.429   1.00 134.97 ? 9   DT  G H72    1 
ATOM   9546 H  H73    . DT  G 3 9   ? 6.831   0.927   -0.391  1.00 134.97 ? 9   DT  G H73    1 
ATOM   9547 H  H6     . DT  G 3 9   ? 7.190   1.555   -2.602  1.00 150.44 ? 9   DT  G H6     1 
ATOM   9548 P  P      . DT  G 3 10  ? 8.313   -0.374  -8.244  1.00 140.06 ? 10  DT  G P      1 
ATOM   9549 O  OP1    . DT  G 3 10  ? 7.770   -0.529  -9.612  1.00 120.98 ? 10  DT  G OP1    1 
ATOM   9550 O  OP2    . DT  G 3 10  ? 8.153   -1.464  -7.255  1.00 117.73 ? 10  DT  G OP2    1 
ATOM   9551 O  "O5'"  . DT  G 3 10  ? 9.868   -0.024  -8.345  1.00 113.21 ? 10  DT  G "O5'"  1 
ATOM   9552 C  "C5'"  . DT  G 3 10  ? 10.282  1.078   -9.137  1.00 98.33  ? 10  DT  G "C5'"  1 
ATOM   9553 C  "C4'"  . DT  G 3 10  ? 11.758  1.374   -8.935  1.00 110.60 ? 10  DT  G "C4'"  1 
ATOM   9554 O  "O4'"  . DT  G 3 10  ? 11.946  1.994   -7.642  1.00 118.17 ? 10  DT  G "O4'"  1 
ATOM   9555 C  "C3'"  . DT  G 3 10  ? 12.680  0.152   -8.970  1.00 104.83 ? 10  DT  G "C3'"  1 
ATOM   9556 O  "O3'"  . DT  G 3 10  ? 13.653  0.324   -10.000 1.00 114.79 ? 10  DT  G "O3'"  1 
ATOM   9557 C  "C2'"  . DT  G 3 10  ? 13.296  0.082   -7.565  1.00 101.12 ? 10  DT  G "C2'"  1 
ATOM   9558 C  "C1'"  . DT  G 3 10  ? 13.119  1.498   -7.033  1.00 107.31 ? 10  DT  G "C1'"  1 
ATOM   9559 N  N1     . DT  G 3 10  ? 12.930  1.610   -5.548  1.00 117.99 ? 10  DT  G N1     1 
ATOM   9560 C  C2     . DT  G 3 10  ? 13.671  2.535   -4.841  1.00 107.07 ? 10  DT  G C2     1 
ATOM   9561 O  O2     . DT  G 3 10  ? 14.500  3.265   -5.357  1.00 92.44  ? 10  DT  G O2     1 
ATOM   9562 N  N3     . DT  G 3 10  ? 13.406  2.575   -3.498  1.00 118.64 ? 10  DT  G N3     1 
ATOM   9563 C  C4     . DT  G 3 10  ? 12.491  1.804   -2.803  1.00 120.27 ? 10  DT  G C4     1 
ATOM   9564 O  O4     . DT  G 3 10  ? 12.326  1.913   -1.591  1.00 121.76 ? 10  DT  G O4     1 
ATOM   9565 C  C5     . DT  G 3 10  ? 11.742  0.863   -3.603  1.00 113.77 ? 10  DT  G C5     1 
ATOM   9566 C  C7     . DT  G 3 10  ? 10.724  -0.027  -2.962  1.00 106.43 ? 10  DT  G C7     1 
ATOM   9567 C  C6     . DT  G 3 10  ? 11.989  0.816   -4.922  1.00 118.58 ? 10  DT  G C6     1 
ATOM   9568 H  "H5'"  . DT  G 3 10  ? 9.764   1.859   -8.889  1.00 118.22 ? 10  DT  G "H5'"  1 
ATOM   9569 H  "H5''" . DT  G 3 10  ? 10.122  0.876   -10.072 1.00 118.22 ? 10  DT  G "H5''" 1 
ATOM   9570 H  "H4'"  . DT  G 3 10  ? 12.057  1.993   -9.620  1.00 132.93 ? 10  DT  G "H4'"  1 
ATOM   9571 H  "H3'"  . DT  G 3 10  ? 12.161  -0.655  -9.111  1.00 126.02 ? 10  DT  G "H3'"  1 
ATOM   9572 H  "H2'"  . DT  G 3 10  ? 12.828  -0.561  -7.009  1.00 121.56 ? 10  DT  G "H2'"  1 
ATOM   9573 H  "H2''" . DT  G 3 10  ? 14.234  -0.161  -7.606  1.00 121.56 ? 10  DT  G "H2''" 1 
ATOM   9574 H  "H1'"  . DT  G 3 10  ? 13.897  2.017   -7.290  1.00 128.98 ? 10  DT  G "H1'"  1 
ATOM   9575 H  H3     . DT  G 3 10  ? 13.857  3.143   -3.035  1.00 142.58 ? 10  DT  G H3     1 
ATOM   9576 H  H71    . DT  G 3 10  ? 9.838   0.273   -3.215  1.00 127.93 ? 10  DT  G H71    1 
ATOM   9577 H  H72    . DT  G 3 10  ? 10.865  -0.938  -3.265  1.00 127.93 ? 10  DT  G H72    1 
ATOM   9578 H  H73    . DT  G 3 10  ? 10.827  0.020   -1.998  1.00 127.93 ? 10  DT  G H73    1 
ATOM   9579 H  H6     . DT  G 3 10  ? 11.502  0.218   -5.441  1.00 142.51 ? 10  DT  G H6     1 
ATOM   9580 P  P      . DT  G 3 11  ? 14.592  -0.893  -10.460 1.00 135.17 ? 11  DT  G P      1 
ATOM   9581 O  OP1    . DT  G 3 11  ? 14.680  -0.837  -11.937 1.00 108.63 ? 11  DT  G OP1    1 
ATOM   9582 O  OP2    . DT  G 3 11  ? 14.092  -2.118  -9.796  1.00 132.14 ? 11  DT  G OP2    1 
ATOM   9583 O  "O5'"  . DT  G 3 11  ? 16.014  -0.523  -9.824  1.00 122.34 ? 11  DT  G "O5'"  1 
ATOM   9584 C  "C5'"  . DT  G 3 11  ? 16.532  0.793   -9.997  1.00 108.60 ? 11  DT  G "C5'"  1 
ATOM   9585 C  "C4'"  . DT  G 3 11  ? 17.602  1.105   -8.965  1.00 110.40 ? 11  DT  G "C4'"  1 
ATOM   9586 O  "O4'"  . DT  G 3 11  ? 16.981  1.279   -7.678  1.00 109.72 ? 11  DT  G "O4'"  1 
ATOM   9587 C  "C3'"  . DT  G 3 11  ? 18.664  0.022   -8.782  1.00 94.02  ? 11  DT  G "C3'"  1 
ATOM   9588 O  "O3'"  . DT  G 3 11  ? 19.906  0.497   -9.305  1.00 101.03 ? 11  DT  G "O3'"  1 
ATOM   9589 C  "C2'"  . DT  G 3 11  ? 18.707  -0.246  -7.267  1.00 82.51  ? 11  DT  G "C2'"  1 
ATOM   9590 C  "C1'"  . DT  G 3 11  ? 17.887  0.894   -6.673  1.00 107.00 ? 11  DT  G "C1'"  1 
ATOM   9591 N  N1     . DT  G 3 11  ? 17.085  0.544   -5.459  1.00 107.25 ? 11  DT  G N1     1 
ATOM   9592 C  C2     . DT  G 3 11  ? 17.287  1.249   -4.290  1.00 106.66 ? 11  DT  G C2     1 
ATOM   9593 O  O2     . DT  G 3 11  ? 18.119  2.133   -4.175  1.00 103.49 ? 11  DT  G O2     1 
ATOM   9594 N  N3     . DT  G 3 11  ? 16.484  0.869   -3.247  1.00 102.16 ? 11  DT  G N3     1 
ATOM   9595 C  C4     . DT  G 3 11  ? 15.511  -0.114  -3.258  1.00 105.45 ? 11  DT  G C4     1 
ATOM   9596 O  O4     . DT  G 3 11  ? 14.839  -0.384  -2.268  1.00 104.25 ? 11  DT  G O4     1 
ATOM   9597 C  C5     . DT  G 3 11  ? 15.339  -0.801  -4.517  1.00 101.86 ? 11  DT  G C5     1 
ATOM   9598 C  C7     . DT  G 3 11  ? 14.315  -1.885  -4.647  1.00 99.21  ? 11  DT  G C7     1 
ATOM   9599 C  C6     . DT  G 3 11  ? 16.119  -0.438  -5.547  1.00 95.35  ? 11  DT  G C6     1 
ATOM   9600 H  "H5'"  . DT  G 3 11  ? 15.810  1.434   -9.910  1.00 130.54 ? 11  DT  G "H5'"  1 
ATOM   9601 H  "H5''" . DT  G 3 11  ? 16.916  0.869   -10.885 1.00 130.54 ? 11  DT  G "H5''" 1 
ATOM   9602 H  "H4'"  . DT  G 3 11  ? 18.048  1.931   -9.208  1.00 132.69 ? 11  DT  G "H4'"  1 
ATOM   9603 H  "H3'"  . DT  G 3 11  ? 18.388  -0.799  -9.219  1.00 113.03 ? 11  DT  G "H3'"  1 
ATOM   9604 H  "H2'"  . DT  G 3 11  ? 18.312  -1.106  -7.054  1.00 99.23  ? 11  DT  G "H2'"  1 
ATOM   9605 H  "H2''" . DT  G 3 11  ? 19.619  -0.227  -6.936  1.00 99.23  ? 11  DT  G "H2''" 1 
ATOM   9606 H  "H1'"  . DT  G 3 11  ? 18.492  1.617   -6.448  1.00 128.61 ? 11  DT  G "H1'"  1 
ATOM   9607 H  H3     . DT  G 3 11  ? 16.598  1.286   -2.504  1.00 122.81 ? 11  DT  G H3     1 
ATOM   9608 H  H71    . DT  G 3 11  ? 13.610  -1.584  -5.242  1.00 119.27 ? 11  DT  G H71    1 
ATOM   9609 H  H72    . DT  G 3 11  ? 14.739  -2.678  -5.012  1.00 119.27 ? 11  DT  G H72    1 
ATOM   9610 H  H73    . DT  G 3 11  ? 13.948  -2.079  -3.771  1.00 119.27 ? 11  DT  G H73    1 
ATOM   9611 H  H6     . DT  G 3 11  ? 16.003  -0.870  -6.363  1.00 114.64 ? 11  DT  G H6     1 
ATOM   9612 P  P      . DG  G 3 12  ? 21.050  -0.526  -9.770  1.00 123.45 ? 12  DG  G P      1 
ATOM   9613 O  OP1    . DG  G 3 12  ? 21.539  -0.054  -11.085 1.00 98.46  ? 12  DG  G OP1    1 
ATOM   9614 O  OP2    . DG  G 3 12  ? 20.510  -1.896  -9.625  1.00 123.75 ? 12  DG  G OP2    1 
ATOM   9615 O  "O5'"  . DG  G 3 12  ? 22.201  -0.337  -8.679  1.00 111.30 ? 12  DG  G "O5'"  1 
ATOM   9616 C  "C5'"  . DG  G 3 12  ? 22.598  0.969   -8.290  1.00 106.11 ? 12  DG  G "C5'"  1 
ATOM   9617 C  "C4'"  . DG  G 3 12  ? 23.104  0.969   -6.859  1.00 110.07 ? 12  DG  G "C4'"  1 
ATOM   9618 O  "O4'"  . DG  G 3 12  ? 22.005  0.680   -5.969  1.00 115.51 ? 12  DG  G "O4'"  1 
ATOM   9619 C  "C3'"  . DG  G 3 12  ? 24.179  -0.076  -6.573  1.00 93.96  ? 12  DG  G "C3'"  1 
ATOM   9620 O  "O3'"  . DG  G 3 12  ? 25.417  0.560   -6.282  1.00 106.58 ? 12  DG  G "O3'"  1 
ATOM   9621 C  "C2'"  . DG  G 3 12  ? 23.650  -0.890  -5.383  1.00 100.90 ? 12  DG  G "C2'"  1 
ATOM   9622 C  "C1'"  . DG  G 3 12  ? 22.464  -0.079  -4.876  1.00 105.85 ? 12  DG  G "C1'"  1 
ATOM   9623 N  N9     . DG  G 3 12  ? 21.348  -0.894  -4.398  1.00 99.46  ? 12  DG  G N9     1 
ATOM   9624 C  C8     . DG  G 3 12  ? 20.680  -1.860  -5.109  1.00 106.06 ? 12  DG  G C8     1 
ATOM   9625 N  N7     . DG  G 3 12  ? 19.715  -2.423  -4.442  1.00 103.83 ? 12  DG  G N7     1 
ATOM   9626 C  C5     . DG  G 3 12  ? 19.732  -1.785  -3.210  1.00 99.40  ? 12  DG  G C5     1 
ATOM   9627 C  C6     . DG  G 3 12  ? 18.908  -1.981  -2.078  1.00 104.94 ? 12  DG  G C6     1 
ATOM   9628 O  O6     . DG  G 3 12  ? 17.975  -2.783  -1.943  1.00 107.85 ? 12  DG  G O6     1 
ATOM   9629 N  N1     . DG  G 3 12  ? 19.255  -1.132  -1.031  1.00 104.90 ? 12  DG  G N1     1 
ATOM   9630 C  C2     . DG  G 3 12  ? 20.272  -0.206  -1.073  1.00 115.65 ? 12  DG  G C2     1 
ATOM   9631 N  N2     . DG  G 3 12  ? 20.457  0.527   0.038   1.00 111.34 ? 12  DG  G N2     1 
ATOM   9632 N  N3     . DG  G 3 12  ? 21.056  -0.011  -2.133  1.00 118.81 ? 12  DG  G N3     1 
ATOM   9633 C  C4     . DG  G 3 12  ? 20.728  -0.836  -3.163  1.00 105.91 ? 12  DG  G C4     1 
ATOM   9634 H  "H5'"  . DG  G 3 12  ? 21.839  1.570   -8.362  1.00 127.55 ? 12  DG  G "H5'"  1 
ATOM   9635 H  "H5''" . DG  G 3 12  ? 23.303  1.279   -8.880  1.00 127.55 ? 12  DG  G "H5''" 1 
ATOM   9636 H  "H4'"  . DG  G 3 12  ? 23.456  1.844   -6.633  1.00 132.30 ? 12  DG  G "H4'"  1 
ATOM   9637 H  "H3'"  . DG  G 3 12  ? 24.257  -0.667  -7.339  1.00 112.97 ? 12  DG  G "H3'"  1 
ATOM   9638 H  "H2'"  . DG  G 3 12  ? 23.370  -1.774  -5.665  1.00 121.29 ? 12  DG  G "H2'"  1 
ATOM   9639 H  "H2''" . DG  G 3 12  ? 24.328  -0.978  -4.695  1.00 121.29 ? 12  DG  G "H2''" 1 
ATOM   9640 H  "H1'"  . DG  G 3 12  ? 22.764  0.509   -4.166  1.00 127.24 ? 12  DG  G "H1'"  1 
ATOM   9641 H  H8     . DG  G 3 12  ? 20.897  -2.090  -5.983  1.00 127.49 ? 12  DG  G H8     1 
ATOM   9642 H  H1     . DG  G 3 12  ? 18.799  -1.190  -0.304  1.00 126.09 ? 12  DG  G H1     1 
ATOM   9643 H  H21    . DG  G 3 12  ? 21.079  1.120   0.063   1.00 133.82 ? 12  DG  G H21    1 
ATOM   9644 H  H22    . DG  G 3 12  ? 19.952  0.403   0.724   1.00 133.82 ? 12  DG  G H22    1 
ATOM   9645 P  P      . DC  G 3 13  ? 26.729  -0.318  -5.997  1.00 131.12 ? 13  DC  G P      1 
ATOM   9646 O  OP1    . DC  G 3 13  ? 27.914  0.498   -6.342  1.00 117.04 ? 13  DC  G OP1    1 
ATOM   9647 O  OP2    . DC  G 3 13  ? 26.525  -1.631  -6.650  1.00 133.90 ? 13  DC  G OP2    1 
ATOM   9648 O  "O5'"  . DC  G 3 13  ? 26.687  -0.539  -4.414  1.00 127.09 ? 13  DC  G "O5'"  1 
ATOM   9649 C  "C5'"  . DC  G 3 13  ? 26.534  0.582   -3.551  1.00 130.42 ? 13  DC  G "C5'"  1 
ATOM   9650 C  "C4'"  . DC  G 3 13  ? 26.096  0.147   -2.167  1.00 138.73 ? 13  DC  G "C4'"  1 
ATOM   9651 O  "O4'"  . DC  G 3 13  ? 24.734  -0.322  -2.210  1.00 131.93 ? 13  DC  G "O4'"  1 
ATOM   9652 C  "C3'"  . DC  G 3 13  ? 26.876  -1.015  -1.576  1.00 135.72 ? 13  DC  G "C3'"  1 
ATOM   9653 O  "O3'"  . DC  G 3 13  ? 28.041  -0.542  -0.901  1.00 145.55 ? 13  DC  G "O3'"  1 
ATOM   9654 C  "C2'"  . DC  G 3 13  ? 25.870  -1.685  -0.629  1.00 124.64 ? 13  DC  G "C2'"  1 
ATOM   9655 C  "C1'"  . DC  G 3 13  ? 24.503  -1.165  -1.099  1.00 117.40 ? 13  DC  G "C1'"  1 
ATOM   9656 N  N1     . DC  G 3 13  ? 23.550  -2.245  -1.519  1.00 121.26 ? 13  DC  G N1     1 
ATOM   9657 C  C2     . DC  G 3 13  ? 22.581  -2.707  -0.620  1.00 121.90 ? 13  DC  G C2     1 
ATOM   9658 O  O2     . DC  G 3 13  ? 22.536  -2.222  0.515   1.00 119.92 ? 13  DC  G O2     1 
ATOM   9659 N  N3     . DC  G 3 13  ? 21.723  -3.681  -1.024  1.00 125.43 ? 13  DC  G N3     1 
ATOM   9660 C  C4     . DC  G 3 13  ? 21.808  -4.178  -2.261  1.00 122.89 ? 13  DC  G C4     1 
ATOM   9661 N  N4     . DC  G 3 13  ? 20.944  -5.135  -2.617  1.00 123.24 ? 13  DC  G N4     1 
ATOM   9662 C  C5     . DC  G 3 13  ? 22.786  -3.714  -3.189  1.00 122.22 ? 13  DC  G C5     1 
ATOM   9663 C  C6     . DC  G 3 13  ? 23.625  -2.757  -2.781  1.00 128.12 ? 13  DC  G C6     1 
ATOM   9664 H  "H5'"  . DC  G 3 13  ? 25.868  1.182   -3.922  1.00 156.72 ? 13  DC  G "H5'"  1 
ATOM   9665 H  "H5''" . DC  G 3 13  ? 27.380  1.051   -3.485  1.00 156.72 ? 13  DC  G "H5''" 1 
ATOM   9666 H  "H4'"  . DC  G 3 13  ? 26.157  0.914   -1.576  1.00 166.69 ? 13  DC  G "H4'"  1 
ATOM   9667 H  "H3'"  . DC  G 3 13  ? 27.124  -1.640  -2.276  1.00 163.08 ? 13  DC  G "H3'"  1 
ATOM   9668 H  "H2'"  . DC  G 3 13  ? 25.916  -2.651  -0.703  1.00 149.78 ? 13  DC  G "H2'"  1 
ATOM   9669 H  "H2''" . DC  G 3 13  ? 26.039  -1.430  0.292   1.00 149.78 ? 13  DC  G "H2''" 1 
ATOM   9670 H  "H1'"  . DC  G 3 13  ? 24.108  -0.645  -0.382  1.00 141.10 ? 13  DC  G "H1'"  1 
ATOM   9671 H  H41    . DC  G 3 13  ? 20.977  -5.472  -3.408  1.00 148.10 ? 13  DC  G H41    1 
ATOM   9672 H  H42    . DC  G 3 13  ? 20.355  -5.413  -2.056  1.00 148.10 ? 13  DC  G H42    1 
ATOM   9673 H  H5     . DC  G 3 13  ? 22.837  -4.065  -4.048  1.00 146.88 ? 13  DC  G H5     1 
ATOM   9674 H  H6     . DC  G 3 13  ? 24.271  -2.435  -3.367  1.00 153.96 ? 13  DC  G H6     1 
ATOM   9675 P  P      . DT  G 3 14  ? 28.846  -1.504  0.102   1.00 145.85 ? 14  DT  G P      1 
ATOM   9676 O  OP1    . DT  G 3 14  ? 30.274  -1.125  0.030   1.00 139.25 ? 14  DT  G OP1    1 
ATOM   9677 O  OP2    . DT  G 3 14  ? 28.443  -2.902  -0.172  1.00 138.16 ? 14  DT  G OP2    1 
ATOM   9678 O  "O5'"  . DT  G 3 14  ? 28.277  -1.102  1.540   1.00 132.62 ? 14  DT  G "O5'"  1 
ATOM   9679 C  "C5'"  . DT  G 3 14  ? 28.567  -1.907  2.668   1.00 124.22 ? 14  DT  G "C5'"  1 
ATOM   9680 C  "C4'"  . DT  G 3 14  ? 27.305  -2.184  3.469   1.00 123.62 ? 14  DT  G "C4'"  1 
ATOM   9681 O  "O4'"  . DT  G 3 14  ? 26.269  -2.671  2.584   1.00 120.77 ? 14  DT  G "O4'"  1 
ATOM   9682 C  "C3'"  . DT  G 3 14  ? 27.465  -3.242  4.561   1.00 125.07 ? 14  DT  G "C3'"  1 
ATOM   9683 O  "O3'"  . DT  G 3 14  ? 27.361  -2.642  5.855   1.00 125.91 ? 14  DT  G "O3'"  1 
ATOM   9684 C  "C2'"  . DT  G 3 14  ? 26.351  -4.265  4.301   1.00 133.54 ? 14  DT  G "C2'"  1 
ATOM   9685 C  "C1'"  . DT  G 3 14  ? 25.450  -3.577  3.284   1.00 132.50 ? 14  DT  G "C1'"  1 
ATOM   9686 N  N1     . DT  G 3 14  ? 24.816  -4.513  2.301   1.00 131.61 ? 14  DT  G N1     1 
ATOM   9687 C  C2     . DT  G 3 14  ? 23.730  -5.271  2.688   1.00 124.44 ? 14  DT  G C2     1 
ATOM   9688 O  O2     . DT  G 3 14  ? 23.254  -5.234  3.809   1.00 123.03 ? 14  DT  G O2     1 
ATOM   9689 N  N3     . DT  G 3 14  ? 23.225  -6.088  1.708   1.00 121.46 ? 14  DT  G N3     1 
ATOM   9690 C  C4     . DT  G 3 14  ? 23.683  -6.213  0.408   1.00 130.86 ? 14  DT  G C4     1 
ATOM   9691 O  O4     . DT  G 3 14  ? 23.163  -6.973  -0.403  1.00 121.17 ? 14  DT  G O4     1 
ATOM   9692 C  C5     . DT  G 3 14  ? 24.818  -5.387  0.070   1.00 132.26 ? 14  DT  G C5     1 
ATOM   9693 C  C7     . DT  G 3 14  ? 25.400  -5.439  -1.308  1.00 124.31 ? 14  DT  G C7     1 
ATOM   9694 C  C6     . DT  G 3 14  ? 25.323  -4.587  1.020   1.00 128.54 ? 14  DT  G C6     1 
ATOM   9695 H  "H5'"  . DT  G 3 14  ? 29.210  -1.450  3.232   1.00 149.27 ? 14  DT  G "H5'"  1 
ATOM   9696 H  "H5''" . DT  G 3 14  ? 28.949  -2.748  2.372   1.00 149.27 ? 14  DT  G "H5''" 1 
ATOM   9697 H  "H4'"  . DT  G 3 14  ? 26.993  -1.361  3.876   1.00 148.57 ? 14  DT  G "H4'"  1 
ATOM   9698 H  "H3'"  . DT  G 3 14  ? 28.321  -3.684  4.448   1.00 150.30 ? 14  DT  G "H3'"  1 
ATOM   9699 H  "H2'"  . DT  G 3 14  ? 26.714  -5.089  3.941   1.00 160.47 ? 14  DT  G "H2'"  1 
ATOM   9700 H  "H2''" . DT  G 3 14  ? 25.865  -4.464  5.116   1.00 160.47 ? 14  DT  G "H2''" 1 
ATOM   9701 H  "H1'"  . DT  G 3 14  ? 24.752  -3.090  3.748   1.00 159.22 ? 14  DT  G "H1'"  1 
ATOM   9702 H  H3     . DT  G 3 14  ? 22.550  -6.575  1.926   1.00 145.96 ? 14  DT  G H3     1 
ATOM   9703 H  H71    . DT  G 3 14  ? 25.401  -4.545  -1.685  1.00 149.39 ? 14  DT  G H71    1 
ATOM   9704 H  H72    . DT  G 3 14  ? 26.308  -5.776  -1.254  1.00 149.39 ? 14  DT  G H72    1 
ATOM   9705 H  H73    . DT  G 3 14  ? 24.861  -6.029  -1.857  1.00 149.39 ? 14  DT  G H73    1 
ATOM   9706 H  H6     . DT  G 3 14  ? 26.054  -4.053  0.804   1.00 154.46 ? 14  DT  G H6     1 
ATOM   9707 P  P      . DC  G 3 15  ? 28.191  -3.238  7.095   1.00 134.43 ? 15  DC  G P      1 
ATOM   9708 O  OP1    . DC  G 3 15  ? 28.227  -2.207  8.155   1.00 102.34 ? 15  DC  G OP1    1 
ATOM   9709 O  OP2    . DC  G 3 15  ? 29.462  -3.782  6.566   1.00 126.88 ? 15  DC  G OP2    1 
ATOM   9710 O  "O5'"  . DC  G 3 15  ? 27.295  -4.468  7.595   1.00 140.59 ? 15  DC  G "O5'"  1 
ATOM   9711 C  "C5'"  . DC  G 3 15  ? 25.965  -4.237  8.073   1.00 129.79 ? 15  DC  G "C5'"  1 
ATOM   9712 C  "C4'"  . DC  G 3 15  ? 25.225  -5.551  8.291   1.00 140.91 ? 15  DC  G "C4'"  1 
ATOM   9713 O  "O4'"  . DC  G 3 15  ? 24.695  -6.025  7.029   1.00 146.89 ? 15  DC  G "O4'"  1 
ATOM   9714 C  "C3'"  . DC  G 3 15  ? 26.086  -6.691  8.853   1.00 147.56 ? 15  DC  G "C3'"  1 
ATOM   9715 O  "O3'"  . DC  G 3 15  ? 25.541  -7.180  10.086  1.00 140.35 ? 15  DC  G "O3'"  1 
ATOM   9716 C  "C2'"  . DC  G 3 15  ? 26.068  -7.759  7.752   1.00 146.04 ? 15  DC  G "C2'"  1 
ATOM   9717 C  "C1'"  . DC  G 3 15  ? 24.790  -7.428  6.994   1.00 143.96 ? 15  DC  G "C1'"  1 
ATOM   9718 N  N1     . DC  G 3 15  ? 24.774  -7.885  5.574   1.00 138.18 ? 15  DC  G N1     1 
ATOM   9719 C  C2     . DC  G 3 15  ? 23.797  -8.798  5.156   1.00 135.90 ? 15  DC  G C2     1 
ATOM   9720 O  O2     . DC  G 3 15  ? 22.975  -9.213  5.981   1.00 135.84 ? 15  DC  G O2     1 
ATOM   9721 N  N3     . DC  G 3 15  ? 23.790  -9.203  3.861   1.00 131.70 ? 15  DC  G N3     1 
ATOM   9722 C  C4     . DC  G 3 15  ? 24.700  -8.726  3.008   1.00 128.04 ? 15  DC  G C4     1 
ATOM   9723 N  N4     . DC  G 3 15  ? 24.656  -9.150  1.740   1.00 121.23 ? 15  DC  G N4     1 
ATOM   9724 C  C5     . DC  G 3 15  ? 25.697  -7.793  3.416   1.00 122.78 ? 15  DC  G C5     1 
ATOM   9725 C  C6     . DC  G 3 15  ? 25.694  -7.403  4.695   1.00 129.96 ? 15  DC  G C6     1 
ATOM   9726 H  "H5'"  . DC  G 3 15  ? 25.482  -3.703  7.424   1.00 155.97 ? 15  DC  G "H5'"  1 
ATOM   9727 H  "H5''" . DC  G 3 15  ? 26.008  -3.753  8.912   1.00 155.97 ? 15  DC  G "H5''" 1 
ATOM   9728 H  "H4'"  . DC  G 3 15  ? 24.481  -5.402  8.895   1.00 169.31 ? 15  DC  G "H4'"  1 
ATOM   9729 H  "H3'"  . DC  G 3 15  ? 26.993  -6.372  8.981   1.00 177.29 ? 15  DC  G "H3'"  1 
ATOM   9730 H  "H2'"  . DC  G 3 15  ? 26.847  -7.688  7.179   1.00 175.46 ? 15  DC  G "H2'"  1 
ATOM   9731 H  "H2''" . DC  G 3 15  ? 26.033  -8.652  8.129   1.00 175.46 ? 15  DC  G "H2''" 1 
ATOM   9732 H  "H1'"  . DC  G 3 15  ? 24.028  -7.827  7.443   1.00 172.96 ? 15  DC  G "H1'"  1 
ATOM   9733 H  H41    . DC  G 3 15  ? 25.230  -8.860  1.169   1.00 145.69 ? 15  DC  G H41    1 
ATOM   9734 H  H42    . DC  G 3 15  ? 24.054  -9.714  1.496   1.00 145.69 ? 15  DC  G H42    1 
ATOM   9735 H  H5     . DC  G 3 15  ? 26.326  -7.466  2.815   1.00 147.55 ? 15  DC  G H5     1 
ATOM   9736 H  H6     . DC  G 3 15  ? 26.331  -6.793  4.988   1.00 156.17 ? 15  DC  G H6     1 
ATOM   9737 P  P      . DA  G 3 16  ? 26.317  -8.323  10.908  1.00 146.70 ? 16  DA  G P      1 
ATOM   9738 O  OP1    . DA  G 3 16  ? 26.217  -7.971  12.342  1.00 113.08 ? 16  DA  G OP1    1 
ATOM   9739 O  OP2    . DA  G 3 16  ? 27.649  -8.500  10.291  1.00 133.26 ? 16  DA  G OP2    1 
ATOM   9740 O  "O5'"  . DA  G 3 16  ? 25.468  -9.660  10.653  1.00 148.42 ? 16  DA  G "O5'"  1 
ATOM   9741 C  "C5'"  . DA  G 3 16  ? 24.086  -9.716  10.992  1.00 142.55 ? 16  DA  G "C5'"  1 
ATOM   9742 C  "C4'"  . DA  G 3 16  ? 23.505  -11.090 10.690  1.00 148.57 ? 16  DA  G "C4'"  1 
ATOM   9743 O  "O4'"  . DA  G 3 16  ? 23.342  -11.269 9.254   1.00 144.58 ? 16  DA  G "O4'"  1 
ATOM   9744 C  "C3'"  . DA  G 3 16  ? 24.370  -12.263 11.158  1.00 155.38 ? 16  DA  G "C3'"  1 
ATOM   9745 O  "O3'"  . DA  G 3 16  ? 23.553  -13.335 11.628  1.00 166.98 ? 16  DA  G "O3'"  1 
ATOM   9746 C  "C2'"  . DA  G 3 16  ? 25.151  -12.627 9.893   1.00 143.24 ? 16  DA  G "C2'"  1 
ATOM   9747 C  "C1'"  . DA  G 3 16  ? 24.110  -12.381 8.807   1.00 139.03 ? 16  DA  G "C1'"  1 
ATOM   9748 N  N9     . DA  G 3 16  ? 24.651  -12.070 7.489   1.00 133.85 ? 16  DA  G N9     1 
ATOM   9749 C  C8     . DA  G 3 16  ? 25.624  -11.160 7.189   1.00 141.22 ? 16  DA  G C8     1 
ATOM   9750 N  N7     . DA  G 3 16  ? 25.896  -11.076 5.908   1.00 137.59 ? 16  DA  G N7     1 
ATOM   9751 C  C5     . DA  G 3 16  ? 25.034  -11.988 5.324   1.00 138.42 ? 16  DA  G C5     1 
ATOM   9752 C  C6     . DA  G 3 16  ? 24.827  -12.372 3.984   1.00 139.38 ? 16  DA  G C6     1 
ATOM   9753 N  N6     . DA  G 3 16  ? 25.510  -11.855 2.958   1.00 137.92 ? 16  DA  G N6     1 
ATOM   9754 N  N1     . DA  G 3 16  ? 23.888  -13.310 3.740   1.00 138.50 ? 16  DA  G N1     1 
ATOM   9755 C  C2     . DA  G 3 16  ? 23.207  -13.825 4.772   1.00 132.79 ? 16  DA  G C2     1 
ATOM   9756 N  N3     . DA  G 3 16  ? 23.312  -13.542 6.072   1.00 128.37 ? 16  DA  G N3     1 
ATOM   9757 C  C4     . DA  G 3 16  ? 24.254  -12.607 6.282   1.00 134.18 ? 16  DA  G C4     1 
ATOM   9758 H  "H5'"  . DA  G 3 16  ? 23.605  -9.047  10.481  1.00 171.27 ? 16  DA  G "H5'"  1 
ATOM   9759 H  "H5''" . DA  G 3 16  ? 23.982  -9.527  11.938  1.00 171.27 ? 16  DA  G "H5''" 1 
ATOM   9760 H  "H4'"  . DA  G 3 16  ? 22.628  -11.154 11.099  1.00 178.50 ? 16  DA  G "H4'"  1 
ATOM   9761 H  "H3'"  . DA  G 3 16  ? 24.979  -11.982 11.859  1.00 186.67 ? 16  DA  G "H3'"  1 
ATOM   9762 H  "H2'"  . DA  G 3 16  ? 25.927  -12.056 9.778   1.00 172.11 ? 16  DA  G "H2'"  1 
ATOM   9763 H  "H2''" . DA  G 3 16  ? 25.439  -13.553 9.907   1.00 172.11 ? 16  DA  G "H2''" 1 
ATOM   9764 H  "H1'"  . DA  G 3 16  ? 23.550  -13.169 8.726   1.00 167.05 ? 16  DA  G "H1'"  1 
ATOM   9765 H  H8     . DA  G 3 16  ? 26.053  -10.645 7.834   1.00 169.68 ? 16  DA  G H8     1 
ATOM   9766 H  H61    . DA  G 3 16  ? 25.349  -12.121 2.157   1.00 165.72 ? 16  DA  G H61    1 
ATOM   9767 H  H62    . DA  G 3 16  ? 26.111  -11.256 3.100   1.00 165.72 ? 16  DA  G H62    1 
ATOM   9768 H  H2     . DA  G 3 16  ? 22.573  -14.469 4.552   1.00 159.57 ? 16  DA  G H2     1 
ATOM   9769 P  P      . DA  G 3 17  ? 24.178  -14.500 12.543  1.00 161.86 ? 17  DA  G P      1 
ATOM   9770 O  OP1    . DA  G 3 17  ? 23.489  -14.464 13.853  1.00 147.57 ? 17  DA  G OP1    1 
ATOM   9771 O  OP2    . DA  G 3 17  ? 25.651  -14.376 12.480  1.00 154.18 ? 17  DA  G OP2    1 
ATOM   9772 O  "O5'"  . DA  G 3 17  ? 23.762  -15.843 11.781  1.00 160.98 ? 17  DA  G "O5'"  1 
ATOM   9773 C  "C5'"  . DA  G 3 17  ? 24.132  -16.020 10.421  1.00 152.24 ? 17  DA  G "C5'"  1 
ATOM   9774 C  "C4'"  . DA  G 3 17  ? 23.258  -17.057 9.750   1.00 151.86 ? 17  DA  G "C4'"  1 
ATOM   9775 O  "O4'"  . DA  G 3 17  ? 23.183  -16.768 8.333   1.00 141.82 ? 17  DA  G "O4'"  1 
ATOM   9776 C  "C3'"  . DA  G 3 17  ? 23.769  -18.486 9.802   1.00 160.57 ? 17  DA  G "C3'"  1 
ATOM   9777 O  "O3'"  . DA  G 3 17  ? 22.696  -19.407 9.595   1.00 168.28 ? 17  DA  G "O3'"  1 
ATOM   9778 C  "C2'"  . DA  G 3 17  ? 24.790  -18.495 8.664   1.00 151.07 ? 17  DA  G "C2'"  1 
ATOM   9779 C  "C1'"  . DA  G 3 17  ? 24.161  -17.536 7.643   1.00 146.71 ? 17  DA  G "C1'"  1 
ATOM   9780 N  N9     . DA  G 3 17  ? 25.109  -16.615 7.018   1.00 144.05 ? 17  DA  G N9     1 
ATOM   9781 C  C8     . DA  G 3 17  ? 25.949  -15.734 7.644   1.00 137.23 ? 17  DA  G C8     1 
ATOM   9782 N  N7     . DA  G 3 17  ? 26.682  -15.023 6.816   1.00 131.21 ? 17  DA  G N7     1 
ATOM   9783 C  C5     . DA  G 3 17  ? 26.288  -15.464 5.563   1.00 138.50 ? 17  DA  G C5     1 
ATOM   9784 C  C6     . DA  G 3 17  ? 26.685  -15.106 4.258   1.00 141.04 ? 17  DA  G C6     1 
ATOM   9785 N  N6     . DA  G 3 17  ? 27.614  -14.178 3.994   1.00 134.80 ? 17  DA  G N6     1 
ATOM   9786 N  N1     . DA  G 3 17  ? 26.089  -15.744 3.228   1.00 137.81 ? 17  DA  G N1     1 
ATOM   9787 C  C2     . DA  G 3 17  ? 25.162  -16.670 3.494   1.00 135.39 ? 17  DA  G C2     1 
ATOM   9788 N  N3     . DA  G 3 17  ? 24.709  -17.089 4.670   1.00 132.12 ? 17  DA  G N3     1 
ATOM   9789 C  C4     . DA  G 3 17  ? 25.317  -16.441 5.673   1.00 138.06 ? 17  DA  G C4     1 
ATOM   9790 H  "H5'"  . DA  G 3 17  ? 25.058  -16.307 10.378  1.00 182.91 ? 17  DA  G "H5'"  1 
ATOM   9791 H  "H5''" . DA  G 3 17  ? 24.041  -15.175 9.954   1.00 182.91 ? 17  DA  G "H5''" 1 
ATOM   9792 H  "H4'"  . DA  G 3 17  ? 22.378  -17.016 10.155  1.00 182.45 ? 17  DA  G "H4'"  1 
ATOM   9793 H  "H3'"  . DA  G 3 17  ? 24.203  -18.677 10.648  1.00 192.90 ? 17  DA  G "H3'"  1 
ATOM   9794 H  "H2'"  . DA  G 3 17  ? 25.654  -18.172 8.964   1.00 181.50 ? 17  DA  G "H2'"  1 
ATOM   9795 H  "H2''" . DA  G 3 17  ? 24.896  -19.385 8.293   1.00 181.50 ? 17  DA  G "H2''" 1 
ATOM   9796 H  "H1'"  . DA  G 3 17  ? 23.727  -18.065 6.955   1.00 176.26 ? 17  DA  G "H1'"  1 
ATOM   9797 H  H8     . DA  G 3 17  ? 25.996  -15.646 8.568   1.00 164.89 ? 17  DA  G H8     1 
ATOM   9798 H  H61    . DA  G 3 17  ? 27.822  -13.997 3.180   1.00 161.98 ? 17  DA  G H61    1 
ATOM   9799 H  H62    . DA  G 3 17  ? 28.003  -13.763 4.640   1.00 161.98 ? 17  DA  G H62    1 
ATOM   9800 H  H2     . DA  G 3 17  ? 24.780  -17.077 2.750   1.00 162.68 ? 17  DA  G H2     1 
ATOM   9801 P  P      . DT  G 3 18  ? 22.921  -20.991 9.757   1.00 140.41 ? 18  DT  G P      1 
ATOM   9802 O  OP1    . DT  G 3 18  ? 21.586  -21.622 9.836   1.00 128.48 ? 18  DT  G OP1    1 
ATOM   9803 O  OP2    . DT  G 3 18  ? 23.898  -21.198 10.849  1.00 143.71 ? 18  DT  G OP2    1 
ATOM   9804 O  "O5'"  . DT  G 3 18  ? 23.608  -21.436 8.381   1.00 138.29 ? 18  DT  G "O5'"  1 
ATOM   9805 C  "C5'"  . DT  G 3 18  ? 22.912  -21.254 7.147   1.00 140.90 ? 18  DT  G "C5'"  1 
ATOM   9806 C  "C4'"  . DT  G 3 18  ? 23.689  -21.860 5.989   1.00 151.26 ? 18  DT  G "C4'"  1 
ATOM   9807 O  "O4'"  . DT  G 3 18  ? 24.642  -20.880 5.489   1.00 146.39 ? 18  DT  G "O4'"  1 
ATOM   9808 C  "C3'"  . DT  G 3 18  ? 24.506  -23.107 6.340   1.00 158.30 ? 18  DT  G "C3'"  1 
ATOM   9809 O  "O3'"  . DT  G 3 18  ? 24.387  -24.094 5.300   1.00 171.39 ? 18  DT  G "O3'"  1 
ATOM   9810 C  "C2'"  . DT  G 3 18  ? 25.925  -22.560 6.491   1.00 152.11 ? 18  DT  G "C2'"  1 
ATOM   9811 C  "C1'"  . DT  G 3 18  ? 25.940  -21.447 5.449   1.00 149.34 ? 18  DT  G "C1'"  1 
ATOM   9812 N  N1     . DT  G 3 18  ? 26.944  -20.343 5.686   1.00 144.22 ? 18  DT  G N1     1 
ATOM   9813 C  C2     . DT  G 3 18  ? 27.495  -19.702 4.596   1.00 141.74 ? 18  DT  G C2     1 
ATOM   9814 O  O2     . DT  G 3 18  ? 27.229  -19.995 3.444   1.00 131.58 ? 18  DT  G O2     1 
ATOM   9815 N  N3     . DT  G 3 18  ? 28.385  -18.706 4.904   1.00 142.64 ? 18  DT  G N3     1 
ATOM   9816 C  C4     . DT  G 3 18  ? 28.766  -18.286 6.164   1.00 139.03 ? 18  DT  G C4     1 
ATOM   9817 O  O4     . DT  G 3 18  ? 29.575  -17.378 6.336   1.00 128.85 ? 18  DT  G O4     1 
ATOM   9818 C  C5     . DT  G 3 18  ? 28.147  -18.986 7.263   1.00 133.05 ? 18  DT  G C5     1 
ATOM   9819 C  C7     . DT  G 3 18  ? 28.485  -18.614 8.673   1.00 124.13 ? 18  DT  G C7     1 
ATOM   9820 C  C6     . DT  G 3 18  ? 27.271  -19.967 6.977   1.00 135.11 ? 18  DT  G C6     1 
ATOM   9821 H  "H5'"  . DT  G 3 18  ? 22.789  -20.305 6.987   1.00 169.30 ? 18  DT  G "H5'"  1 
ATOM   9822 H  "H5''" . DT  G 3 18  ? 22.043  -21.680 7.206   1.00 169.30 ? 18  DT  G "H5''" 1 
ATOM   9823 H  "H4'"  . DT  G 3 18  ? 23.074  -22.089 5.275   1.00 181.73 ? 18  DT  G "H4'"  1 
ATOM   9824 H  "H3'"  . DT  G 3 18  ? 24.213  -23.483 7.185   1.00 190.18 ? 18  DT  G "H3'"  1 
ATOM   9825 H  "H2'"  . DT  G 3 18  ? 26.079  -22.213 7.384   1.00 182.75 ? 18  DT  G "H2'"  1 
ATOM   9826 H  "H2''" . DT  G 3 18  ? 26.591  -23.238 6.297   1.00 182.75 ? 18  DT  G "H2''" 1 
ATOM   9827 H  "H1'"  . DT  G 3 18  ? 26.126  -21.837 4.580   1.00 179.42 ? 18  DT  G "H1'"  1 
ATOM   9828 H  H3     . DT  G 3 18  ? 28.746  -18.298 4.239   1.00 171.38 ? 18  DT  G H3     1 
ATOM   9829 H  H71    . DT  G 3 18  ? 29.392  -18.272 8.700   1.00 149.17 ? 18  DT  G H71    1 
ATOM   9830 H  H72    . DT  G 3 18  ? 27.865  -17.932 8.977   1.00 149.17 ? 18  DT  G H72    1 
ATOM   9831 H  H73    . DT  G 3 18  ? 28.412  -19.402 9.234   1.00 149.17 ? 18  DT  G H73    1 
ATOM   9832 H  H6     . DT  G 3 18  ? 26.865  -20.416 7.684   1.00 162.35 ? 18  DT  G H6     1 
ATOM   9833 P  P      . DG  G 3 19  ? 24.432  -25.659 5.666   1.00 159.54 ? 19  DG  G P      1 
ATOM   9834 O  OP1    . DG  G 3 19  ? 23.034  -26.125 5.801   1.00 132.60 ? 19  DG  G OP1    1 
ATOM   9835 O  OP2    . DG  G 3 19  ? 25.376  -25.816 6.794   1.00 144.33 ? 19  DG  G OP2    1 
ATOM   9836 O  "O5'"  . DG  G 3 19  ? 25.089  -26.362 4.383   1.00 166.54 ? 19  DG  G "O5'"  1 
ATOM   9837 C  "C5'"  . DG  G 3 19  ? 24.544  -26.152 3.074   1.00 168.83 ? 19  DG  G "C5'"  1 
ATOM   9838 C  "C4'"  . DG  G 3 19  ? 25.660  -25.974 2.055   1.00 172.52 ? 19  DG  G "C4'"  1 
ATOM   9839 O  "O4'"  . DG  G 3 19  ? 26.448  -24.810 2.424   1.00 174.56 ? 19  DG  G "O4'"  1 
ATOM   9840 C  "C3'"  . DG  G 3 19  ? 26.642  -27.144 1.956   1.00 169.04 ? 19  DG  G "C3'"  1 
ATOM   9841 O  "O3'"  . DG  G 3 19  ? 26.946  -27.451 0.594   1.00 160.71 ? 19  DG  G "O3'"  1 
ATOM   9842 C  "C2'"  . DG  G 3 19  ? 27.867  -26.646 2.719   1.00 167.45 ? 19  DG  G "C2'"  1 
ATOM   9843 C  "C1'"  . DG  G 3 19  ? 27.819  -25.146 2.452   1.00 165.80 ? 19  DG  G "C1'"  1 
ATOM   9844 N  N9     . DG  G 3 19  ? 28.462  -24.344 3.486   1.00 156.59 ? 19  DG  G N9     1 
ATOM   9845 C  C8     . DG  G 3 19  ? 28.328  -24.490 4.844   1.00 150.40 ? 19  DG  G C8     1 
ATOM   9846 N  N7     . DG  G 3 19  ? 29.007  -23.616 5.531   1.00 151.30 ? 19  DG  G N7     1 
ATOM   9847 C  C5     . DG  G 3 19  ? 29.622  -22.829 4.567   1.00 155.59 ? 19  DG  G C5     1 
ATOM   9848 C  C6     . DG  G 3 19  ? 30.485  -21.717 4.713   1.00 153.27 ? 19  DG  G C6     1 
ATOM   9849 O  O6     . DG  G 3 19  ? 30.890  -21.192 5.761   1.00 142.99 ? 19  DG  G O6     1 
ATOM   9850 N  N1     . DG  G 3 19  ? 30.884  -21.209 3.479   1.00 152.81 ? 19  DG  G N1     1 
ATOM   9851 C  C2     . DG  G 3 19  ? 30.496  -21.714 2.258   1.00 148.91 ? 19  DG  G C2     1 
ATOM   9852 N  N2     . DG  G 3 19  ? 30.983  -21.092 1.175   1.00 139.17 ? 19  DG  G N2     1 
ATOM   9853 N  N3     . DG  G 3 19  ? 29.687  -22.755 2.108   1.00 144.65 ? 19  DG  G N3     1 
ATOM   9854 C  C4     . DG  G 3 19  ? 29.291  -23.260 3.301   1.00 151.96 ? 19  DG  G C4     1 
ATOM   9855 H  "H5'"  . DG  G 3 19  ? 23.988  -25.357 3.082   1.00 202.81 ? 19  DG  G "H5'"  1 
ATOM   9856 H  "H5''" . DG  G 3 19  ? 24.001  -26.916 2.825   1.00 202.81 ? 19  DG  G "H5''" 1 
ATOM   9857 H  "H4'"  . DG  G 3 19  ? 25.278  -25.830 1.175   1.00 207.24 ? 19  DG  G "H4'"  1 
ATOM   9858 H  "H3'"  . DG  G 3 19  ? 26.266  -27.921 2.399   1.00 203.06 ? 19  DG  G "H3'"  1 
ATOM   9859 H  "H2'"  . DG  G 3 19  ? 27.798  -26.841 3.666   1.00 201.16 ? 19  DG  G "H2'"  1 
ATOM   9860 H  "H2''" . DG  G 3 19  ? 28.684  -27.041 2.374   1.00 201.16 ? 19  DG  G "H2''" 1 
ATOM   9861 H  "H1'"  . DG  G 3 19  ? 28.231  -24.952 1.596   1.00 199.17 ? 19  DG  G "H1'"  1 
ATOM   9862 H  H8     . DG  G 3 19  ? 27.802  -25.149 5.236   1.00 180.70 ? 19  DG  G H8     1 
ATOM   9863 H  H1     . DG  G 3 19  ? 31.412  -20.530 3.479   1.00 183.59 ? 19  DG  G H1     1 
ATOM   9864 H  H21    . DG  G 3 19  ? 30.771  -21.368 0.389   1.00 167.23 ? 19  DG  G H21    1 
ATOM   9865 H  H22    . DG  G 3 19  ? 31.508  -20.416 1.266   1.00 167.23 ? 19  DG  G H22    1 
ATOM   9866 P  P      . DA  G 3 20  ? 27.665  -28.839 0.218   1.00 176.07 ? 20  DA  G P      1 
ATOM   9867 O  OP1    . DA  G 3 20  ? 26.702  -29.630 -0.581  1.00 153.98 ? 20  DA  G OP1    1 
ATOM   9868 O  OP2    . DA  G 3 20  ? 28.234  -29.408 1.459   1.00 172.32 ? 20  DA  G OP2    1 
ATOM   9869 O  "O5'"  . DA  G 3 20  ? 28.879  -28.395 -0.731  1.00 162.65 ? 20  DA  G "O5'"  1 
ATOM   9870 C  "C5'"  . DA  G 3 20  ? 28.624  -27.586 -1.868  1.00 155.06 ? 20  DA  G "C5'"  1 
ATOM   9871 C  "C4'"  . DA  G 3 20  ? 29.898  -26.943 -2.395  1.00 155.95 ? 20  DA  G "C4'"  1 
ATOM   9872 O  "O4'"  . DA  G 3 20  ? 30.394  -25.992 -1.405  1.00 169.04 ? 20  DA  G "O4'"  1 
ATOM   9873 C  "C3'"  . DA  G 3 20  ? 31.061  -27.896 -2.665  1.00 158.85 ? 20  DA  G "C3'"  1 
ATOM   9874 O  "O3'"  . DA  G 3 20  ? 31.774  -27.485 -3.833  1.00 166.80 ? 20  DA  G "O3'"  1 
ATOM   9875 C  "C2'"  . DA  G 3 20  ? 31.907  -27.808 -1.402  1.00 164.30 ? 20  DA  G "C2'"  1 
ATOM   9876 C  "C1'"  . DA  G 3 20  ? 31.685  -26.369 -0.950  1.00 163.19 ? 20  DA  G "C1'"  1 
ATOM   9877 N  N9     . DA  G 3 20  ? 31.750  -26.196 0.501   1.00 157.48 ? 20  DA  G N9     1 
ATOM   9878 C  C8     . DA  G 3 20  ? 31.141  -26.966 1.452   1.00 145.67 ? 20  DA  G C8     1 
ATOM   9879 N  N7     . DA  G 3 20  ? 31.371  -26.571 2.681   1.00 149.05 ? 20  DA  G N7     1 
ATOM   9880 C  C5     . DA  G 3 20  ? 32.178  -25.458 2.527   1.00 153.93 ? 20  DA  G C5     1 
ATOM   9881 C  C6     . DA  G 3 20  ? 32.765  -24.579 3.457   1.00 147.99 ? 20  DA  G C6     1 
ATOM   9882 N  N6     . DA  G 3 20  ? 32.613  -24.701 4.780   1.00 132.45 ? 20  DA  G N6     1 
ATOM   9883 N  N1     . DA  G 3 20  ? 33.516  -23.566 2.973   1.00 138.66 ? 20  DA  G N1     1 
ATOM   9884 C  C2     . DA  G 3 20  ? 33.663  -23.450 1.647   1.00 133.88 ? 20  DA  G C2     1 
ATOM   9885 N  N3     . DA  G 3 20  ? 33.161  -24.213 0.677   1.00 135.69 ? 20  DA  G N3     1 
ATOM   9886 C  C4     . DA  G 3 20  ? 32.421  -25.209 1.189   1.00 151.14 ? 20  DA  G C4     1 
ATOM   9887 H  "H5'"  . DA  G 3 20  ? 27.995  -26.889 -1.626  1.00 186.29 ? 20  DA  G "H5'"  1 
ATOM   9888 H  "H5''" . DA  G 3 20  ? 28.234  -28.135 -2.566  1.00 186.29 ? 20  DA  G "H5''" 1 
ATOM   9889 H  "H4'"  . DA  G 3 20  ? 29.693  -26.476 -3.220  1.00 187.36 ? 20  DA  G "H4'"  1 
ATOM   9890 H  "H3'"  . DA  G 3 20  ? 30.731  -28.802 -2.767  1.00 190.84 ? 20  DA  G "H3'"  1 
ATOM   9891 H  "H2'"  . DA  G 3 20  ? 31.604  -28.440 -0.731  1.00 197.38 ? 20  DA  G "H2'"  1 
ATOM   9892 H  "H2''" . DA  G 3 20  ? 32.843  -27.976 -1.594  1.00 197.38 ? 20  DA  G "H2''" 1 
ATOM   9893 H  "H1'"  . DA  G 3 20  ? 32.344  -25.793 -1.368  1.00 196.05 ? 20  DA  G "H1'"  1 
ATOM   9894 H  H8     . DA  G 3 20  ? 30.613  -27.703 1.246   1.00 175.01 ? 20  DA  G H8     1 
ATOM   9895 H  H61    . DA  G 3 20  ? 32.991  -24.139 5.310   1.00 159.15 ? 20  DA  G H61    1 
ATOM   9896 H  H62    . DA  G 3 20  ? 32.138  -25.342 5.100   1.00 159.15 ? 20  DA  G H62    1 
ATOM   9897 H  H2     . DA  G 3 20  ? 34.189  -22.737 1.364   1.00 160.88 ? 20  DA  G H2     1 
ATOM   9898 P  P      . DG  G 3 21  ? 32.983  -28.372 -4.414  1.00 169.08 ? 21  DG  G P      1 
ATOM   9899 O  OP1    . DG  G 3 21  ? 32.852  -28.409 -5.887  1.00 141.59 ? 21  DG  G OP1    1 
ATOM   9900 O  OP2    . DG  G 3 21  ? 33.023  -29.639 -3.647  1.00 129.80 ? 21  DG  G OP2    1 
ATOM   9901 O  "O5'"  . DG  G 3 21  ? 34.285  -27.523 -4.028  1.00 150.72 ? 21  DG  G "O5'"  1 
ATOM   9902 C  "C5'"  . DG  G 3 21  ? 34.394  -26.164 -4.461  1.00 127.97 ? 21  DG  G "C5'"  1 
ATOM   9903 C  "C4'"  . DG  G 3 21  ? 35.566  -25.459 -3.792  1.00 139.64 ? 21  DG  G "C4'"  1 
ATOM   9904 O  "O4'"  . DG  G 3 21  ? 35.277  -25.269 -2.380  1.00 146.52 ? 21  DG  G "O4'"  1 
ATOM   9905 C  "C3'"  . DG  G 3 21  ? 36.895  -26.219 -3.864  1.00 132.87 ? 21  DG  G "C3'"  1 
ATOM   9906 O  "O3'"  . DG  G 3 21  ? 37.925  -25.380 -4.389  1.00 126.10 ? 21  DG  G "O3'"  1 
ATOM   9907 C  "C2'"  . DG  G 3 21  ? 37.174  -26.641 -2.421  1.00 130.03 ? 21  DG  G "C2'"  1 
ATOM   9908 C  "C1'"  . DG  G 3 21  ? 36.419  -25.595 -1.615  1.00 140.52 ? 21  DG  G "C1'"  1 
ATOM   9909 N  N9     . DG  G 3 21  ? 35.995  -26.052 -0.295  1.00 138.40 ? 21  DG  G N9     1 
ATOM   9910 C  C8     . DG  G 3 21  ? 35.216  -27.146 -0.008  1.00 133.93 ? 21  DG  G C8     1 
ATOM   9911 N  N7     . DG  G 3 21  ? 35.007  -27.316 1.268   1.00 124.25 ? 21  DG  G N7     1 
ATOM   9912 C  C5     . DG  G 3 21  ? 35.703  -26.274 1.870   1.00 137.35 ? 21  DG  G C5     1 
ATOM   9913 C  C6     . DG  G 3 21  ? 35.846  -25.943 3.240   1.00 141.82 ? 21  DG  G C6     1 
ATOM   9914 O  O6     . DG  G 3 21  ? 35.369  -26.525 4.225   1.00 135.43 ? 21  DG  G O6     1 
ATOM   9915 N  N1     . DG  G 3 21  ? 36.636  -24.808 3.418   1.00 146.00 ? 21  DG  G N1     1 
ATOM   9916 C  C2     . DG  G 3 21  ? 37.215  -24.085 2.401   1.00 129.87 ? 21  DG  G C2     1 
ATOM   9917 N  N2     . DG  G 3 21  ? 37.943  -23.018 2.767   1.00 103.38 ? 21  DG  G N2     1 
ATOM   9918 N  N3     . DG  G 3 21  ? 37.088  -24.384 1.112   1.00 130.72 ? 21  DG  G N3     1 
ATOM   9919 C  C4     . DG  G 3 21  ? 36.321  -25.488 0.922   1.00 141.46 ? 21  DG  G C4     1 
ATOM   9920 H  "H5'"  . DG  G 3 21  ? 33.574  -25.695 -4.241  1.00 153.78 ? 21  DG  G "H5'"  1 
ATOM   9921 H  "H5''" . DG  G 3 21  ? 34.520  -26.147 -5.423  1.00 153.78 ? 21  DG  G "H5''" 1 
ATOM   9922 H  "H4'"  . DG  G 3 21  ? 35.689  -24.585 -4.195  1.00 167.78 ? 21  DG  G "H4'"  1 
ATOM   9923 H  "H3'"  . DG  G 3 21  ? 36.782  -27.011 -4.413  1.00 159.66 ? 21  DG  G "H3'"  1 
ATOM   9924 H  "HO3'" . DG  G 3 21  ? 38.602  -25.205 -3.923  1.00 151.53 ? 21  DG  G "HO3'" 1 
ATOM   9925 H  "H2'"  . DG  G 3 21  ? 36.837  -27.533 -2.243  1.00 156.25 ? 21  DG  G "H2'"  1 
ATOM   9926 H  "H2''" . DG  G 3 21  ? 38.124  -26.617 -2.225  1.00 156.25 ? 21  DG  G "H2''" 1 
ATOM   9927 H  "H1'"  . DG  G 3 21  ? 36.972  -24.806 -1.505  1.00 168.84 ? 21  DG  G "H1'"  1 
ATOM   9928 H  H8     . DG  G 3 21  ? 34.870  -27.712 -0.661  1.00 160.93 ? 21  DG  G H8     1 
ATOM   9929 H  H1     . DG  G 3 21  ? 36.771  -24.540 4.224   1.00 175.42 ? 21  DG  G H1     1 
ATOM   9930 H  H21    . DG  G 3 21  ? 38.325  -22.533 2.168   1.00 124.27 ? 21  DG  G H21    1 
ATOM   9931 H  H22    . DG  G 3 21  ? 38.028  -22.821 3.599   1.00 124.27 ? 21  DG  G H22    1 
HETATM 9932 C  C1     . EDO H 4 .   ? -18.186 50.361  41.518  1.00 49.49  ? 201 EDO A C1     1 
HETATM 9933 O  O1     . EDO H 4 .   ? -18.117 51.113  42.737  1.00 64.40  ? 201 EDO A O1     1 
HETATM 9934 C  C2     . EDO H 4 .   ? -19.622 49.927  41.243  1.00 80.39  ? 201 EDO A C2     1 
HETATM 9935 O  O2     . EDO H 4 .   ? -20.082 50.526  40.025  1.00 71.22  ? 201 EDO A O2     1 
HETATM 9936 H  H11    . EDO H 4 .   ? -17.823 50.972  40.689  1.00 59.60  ? 201 EDO A H11    1 
HETATM 9937 H  H12    . EDO H 4 .   ? -17.545 49.480  41.592  1.00 59.60  ? 201 EDO A H12    1 
HETATM 9938 H  HO1    . EDO H 4 .   ? -17.199 51.366  42.908  1.00 77.49  ? 201 EDO A HO1    1 
HETATM 9939 H  H21    . EDO H 4 .   ? -19.671 48.839  41.163  1.00 96.69  ? 201 EDO A H21    1 
HETATM 9940 H  H22    . EDO H 4 .   ? -20.266 50.231  42.072  1.00 96.69  ? 201 EDO A H22    1 
HETATM 9941 H  HO2    . EDO H 4 .   ? -20.984 50.231  39.841  1.00 85.68  ? 201 EDO A HO2    1 
HETATM 9942 C  C1     . EDO I 4 .   ? -5.710  53.356  21.907  1.00 46.25  ? 202 EDO A C1     1 
HETATM 9943 O  O1     . EDO I 4 .   ? -5.812  51.987  21.497  1.00 46.39  ? 202 EDO A O1     1 
HETATM 9944 C  C2     . EDO I 4 .   ? -5.877  53.472  23.419  1.00 36.32  ? 202 EDO A C2     1 
HETATM 9945 O  O2     . EDO I 4 .   ? -5.071  54.550  23.915  1.00 25.25  ? 202 EDO A O2     1 
HETATM 9946 H  H11    . EDO I 4 .   ? -4.737  53.756  21.614  1.00 55.72  ? 202 EDO A H11    1 
HETATM 9947 H  H12    . EDO I 4 .   ? -6.480  53.947  21.407  1.00 55.72  ? 202 EDO A H12    1 
HETATM 9948 H  HO1    . EDO I 4 .   ? -5.656  51.924  20.545  1.00 55.88  ? 202 EDO A HO1    1 
HETATM 9949 H  H21    . EDO I 4 .   ? -6.927  53.653  23.662  1.00 43.80  ? 202 EDO A H21    1 
HETATM 9950 H  H22    . EDO I 4 .   ? -5.579  52.537  23.897  1.00 43.80  ? 202 EDO A H22    1 
HETATM 9951 H  HO2    . EDO I 4 .   ? -5.181  54.620  24.873  1.00 30.51  ? 202 EDO A HO2    1 
HETATM 9952 C  C1     . EDO J 4 .   ? -23.507 44.272  42.893  1.00 46.11  ? 201 EDO B C1     1 
HETATM 9953 O  O1     . EDO J 4 .   ? -23.488 45.190  43.997  1.00 25.01  ? 201 EDO B O1     1 
HETATM 9954 C  C2     . EDO J 4 .   ? -24.759 44.465  42.042  1.00 45.18  ? 201 EDO B C2     1 
HETATM 9955 O  O2     . EDO J 4 .   ? -25.915 43.987  42.742  1.00 38.88  ? 201 EDO B O2     1 
HETATM 9956 H  H11    . EDO J 4 .   ? -23.477 43.248  43.271  1.00 55.55  ? 201 EDO B H11    1 
HETATM 9957 H  H12    . EDO J 4 .   ? -22.620 44.428  42.275  1.00 55.55  ? 201 EDO B H12    1 
HETATM 9958 H  HO1    . EDO J 4 .   ? -22.685 45.053  44.517  1.00 30.22  ? 201 EDO B HO1    1 
HETATM 9959 H  H21    . EDO J 4 .   ? -24.884 45.524  41.807  1.00 54.43  ? 201 EDO B H21    1 
HETATM 9960 H  H22    . EDO J 4 .   ? -24.650 43.922  41.100  1.00 54.43  ? 201 EDO B H22    1 
HETATM 9961 H  HO2    . EDO J 4 .   ? -26.700 44.113  42.192  1.00 46.87  ? 201 EDO B HO2    1 
HETATM 9962 CL CL     . CL  K 5 .   ? -16.375 56.069  48.030  1.00 59.58  ? 202 CL  B CL     1 
HETATM 9963 CL CL     . CL  L 5 .   ? 17.923  41.119  10.407  1.00 61.69  ? 201 CL  C CL     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  TRP 19  19  19  TRP TRP A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  TRP 23  23  23  TRP TRP A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 LYS 157 157 ?   ?   ?   A . n 
A 1 158 ILE 158 158 ?   ?   ?   A . n 
A 1 159 LYS 159 159 ?   ?   ?   A . n 
A 1 160 HIS 160 160 ?   ?   ?   A . n 
A 1 161 VAL 161 161 ?   ?   ?   A . n 
A 1 162 ALA 162 162 ?   ?   ?   A . n 
B 1 1   SER 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ILE 3   3   ?   ?   ?   B . n 
B 1 4   ARG 4   4   ?   ?   ?   B . n 
B 1 5   GLU 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   ASN 7   7   7   ASN ASN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   THR 9   9   9   THR THR B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  GLN 12  12  12  GLN GLN B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  TRP 15  15  15  TRP TRP B . n 
B 1 16  LEU 16  16  16  LEU LEU B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  TRP 19  19  19  TRP TRP B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  TRP 23  23  23  TRP TRP B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  TRP 26  26  26  TRP TRP B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  SER 29  29  29  SER SER B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  LYS 34  34  34  LYS LYS B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  MET 36  36  36  MET MET B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  VAL 39  39  39  VAL VAL B . n 
B 1 40  ILE 40  40  40  ILE ILE B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  MET 44  44  44  MET MET B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  ARG 51  51  51  ARG ARG B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  MET 53  53  53  MET MET B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ARG 55  55  55  ARG ARG B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  MET 57  57  57  MET MET B . n 
B 1 58  CYS 58  58  58  CYS CYS B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  MET 64  64  64  MET MET B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  MET 74  74  74  MET MET B . n 
B 1 75  TYR 75  75  75  TYR TYR B . n 
B 1 76  ILE 76  76  76  ILE ILE B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  TYR 87  87  87  TYR TYR B . n 
B 1 88  TYR 88  88  88  TYR TYR B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  SER 99  99  99  SER SER B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 HIS 102 102 102 HIS HIS B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 ALA 105 105 105 ALA ALA B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 ARG 108 108 108 ARG ARG B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 MET 110 110 110 MET MET B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 GLN 119 119 119 GLN GLN B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 LEU 123 123 123 LEU LEU B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 THR 125 125 125 THR THR B . n 
B 1 126 CYS 126 126 126 CYS CYS B . n 
B 1 127 ARG 127 127 127 ARG ARG B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 VAL 130 130 130 VAL VAL B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 GLU 132 132 132 GLU GLU B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 ASN 135 135 135 ASN ASN B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 PHE 139 139 139 PHE PHE B . n 
B 1 140 MET 140 140 140 MET MET B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 TYR 142 142 142 TYR TYR B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 ASP 146 146 146 ASP ASP B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 PHE 149 149 149 PHE PHE B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 ASN 151 151 151 ASN ASN B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 ARG 154 154 ?   ?   ?   B . n 
B 1 155 VAL 155 155 ?   ?   ?   B . n 
B 1 156 GLU 156 156 ?   ?   ?   B . n 
B 1 157 LYS 157 157 ?   ?   ?   B . n 
B 1 158 ILE 158 158 ?   ?   ?   B . n 
B 1 159 LYS 159 159 ?   ?   ?   B . n 
B 1 160 HIS 160 160 ?   ?   ?   B . n 
B 1 161 VAL 161 161 ?   ?   ?   B . n 
B 1 162 ALA 162 162 ?   ?   ?   B . n 
C 1 1   SER 1   1   ?   ?   ?   C . n 
C 1 2   GLY 2   2   ?   ?   ?   C . n 
C 1 3   ILE 3   3   ?   ?   ?   C . n 
C 1 4   ARG 4   4   ?   ?   ?   C . n 
C 1 5   GLU 5   5   ?   ?   ?   C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   ASN 7   7   7   ASN ASN C . n 
C 1 8   LEU 8   8   8   LEU LEU C . n 
C 1 9   THR 9   9   9   THR THR C . n 
C 1 10  LYS 10  10  10  LYS LYS C . n 
C 1 11  GLU 11  11  11  GLU GLU C . n 
C 1 12  GLN 12  12  12  GLN GLN C . n 
C 1 13  HIS 13  13  13  HIS HIS C . n 
C 1 14  GLU 14  14  14  GLU GLU C . n 
C 1 15  TRP 15  15  15  TRP TRP C . n 
C 1 16  LEU 16  16  16  LEU LEU C . n 
C 1 17  ASN 17  17  17  ASN ASN C . n 
C 1 18  GLY 18  18  18  GLY GLY C . n 
C 1 19  TRP 19  19  19  TRP TRP C . n 
C 1 20  LEU 20  20  20  LEU LEU C . n 
C 1 21  GLU 21  21  21  GLU GLU C . n 
C 1 22  LEU 22  22  22  LEU LEU C . n 
C 1 23  TRP 23  23  23  TRP TRP C . n 
C 1 24  GLY 24  24  24  GLY GLY C . n 
C 1 25  ALA 25  25  25  ALA ALA C . n 
C 1 26  TRP 26  26  26  TRP TRP C . n 
C 1 27  VAL 27  27  27  VAL VAL C . n 
C 1 28  TYR 28  28  28  TYR TYR C . n 
C 1 29  SER 29  29  29  SER SER C . n 
C 1 30  GLY 30  30  30  GLY GLY C . n 
C 1 31  ARG 31  31  31  ARG ARG C . n 
C 1 32  LEU 32  32  32  LEU LEU C . n 
C 1 33  GLU 33  33  33  GLU GLU C . n 
C 1 34  LYS 34  34  34  LYS LYS C . n 
C 1 35  ARG 35  35  35  ARG ARG C . n 
C 1 36  MET 36  36  36  MET MET C . n 
C 1 37  SER 37  37  37  SER SER C . n 
C 1 38  SER 38  38  38  SER SER C . n 
C 1 39  VAL 39  39  39  VAL VAL C . n 
C 1 40  ILE 40  40  40  ILE ILE C . n 
C 1 41  ALA 41  41  41  ALA ALA C . n 
C 1 42  LYS 42  42  42  LYS LYS C . n 
C 1 43  PHE 43  43  43  PHE PHE C . n 
C 1 44  MET 44  44  44  MET MET C . n 
C 1 45  GLU 45  45  45  GLU GLU C . n 
C 1 46  SER 46  46  46  SER SER C . n 
C 1 47  VAL 47  47  47  VAL VAL C . n 
C 1 48  GLU 48  48  48  GLU GLU C . n 
C 1 49  PRO 49  49  49  PRO PRO C . n 
C 1 50  GLY 50  50  50  GLY GLY C . n 
C 1 51  ARG 51  51  51  ARG ARG C . n 
C 1 52  VAL 52  52  52  VAL VAL C . n 
C 1 53  MET 53  53  53  MET MET C . n 
C 1 54  THR 54  54  54  THR THR C . n 
C 1 55  ARG 55  55  55  ARG ARG C . n 
C 1 56  PRO 56  56  56  PRO PRO C . n 
C 1 57  MET 57  57  57  MET MET C . n 
C 1 58  CYS 58  58  58  CYS CYS C . n 
C 1 59  ASN 59  59  59  ASN ASN C . n 
C 1 60  ASP 60  60  60  ASP ASP C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  ASP 62  62  62  ASP ASP C . n 
C 1 63  GLY 63  63  63  GLY GLY C . n 
C 1 64  MET 64  64  64  MET MET C . n 
C 1 65  LEU 65  65  65  LEU LEU C . n 
C 1 66  ILE 66  66  66  ILE ILE C . n 
C 1 67  SER 67  67  67  SER SER C . n 
C 1 68  GLN 68  68  68  GLN GLN C . n 
C 1 69  VAL 69  69  69  VAL VAL C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  ASP 71  71  71  ASP ASP C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  VAL 73  73  73  VAL VAL C . n 
C 1 74  MET 74  74  74  MET MET C . n 
C 1 75  TYR 75  75  75  TYR TYR C . n 
C 1 76  ILE 76  76  76  ILE ILE C . n 
C 1 77  ASP 77  77  77  ASP ASP C . n 
C 1 78  LYS 78  78  78  LYS LYS C . n 
C 1 79  LYS 79  79  79  LYS LYS C . n 
C 1 80  ALA 80  80  80  ALA ALA C . n 
C 1 81  PHE 81  81  81  PHE PHE C . n 
C 1 82  GLY 82  82  82  GLY GLY C . n 
C 1 83  ILE 83  83  83  ILE ILE C . n 
C 1 84  LEU 84  84  84  LEU LEU C . n 
C 1 85  LEU 85  85  85  LEU LEU C . n 
C 1 86  SER 86  86  86  SER SER C . n 
C 1 87  TYR 87  87  87  TYR TYR C . n 
C 1 88  TYR 88  88  88  TYR TYR C . n 
C 1 89  ALA 89  89  89  ALA ALA C . n 
C 1 90  HIS 90  90  90  HIS HIS C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  SER 92  92  92  SER SER C . n 
C 1 93  SER 93  93  93  SER SER C . n 
C 1 94  LYS 94  94  94  LYS LYS C . n 
C 1 95  HIS 95  95  95  HIS HIS C . n 
C 1 96  ALA 96  96  96  ALA ALA C . n 
C 1 97  ILE 97  97  97  ILE ILE C . n 
C 1 98  ALA 98  98  98  ALA ALA C . n 
C 1 99  SER 99  99  99  SER SER C . n 
C 1 100 TYR 100 100 100 TYR TYR C . n 
C 1 101 TYR 101 101 101 TYR TYR C . n 
C 1 102 HIS 102 102 102 HIS HIS C . n 
C 1 103 ARG 103 103 103 ARG ARG C . n 
C 1 104 VAL 104 104 104 VAL VAL C . n 
C 1 105 ALA 105 105 105 ALA ALA C . n 
C 1 106 ARG 106 106 106 ARG ARG C . n 
C 1 107 PRO 107 107 107 PRO PRO C . n 
C 1 108 ARG 108 108 108 ARG ARG C . n 
C 1 109 LYS 109 109 109 LYS LYS C . n 
C 1 110 MET 110 110 110 MET MET C . n 
C 1 111 LEU 111 111 111 LEU LEU C . n 
C 1 112 CYS 112 112 112 CY