data_6P59
# 
_entry.id   6P59 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6P59         
WWPDB D_1000241508 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6P59 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Binning, J.M.'   1 0000-0001-5871-686X 
'Chesarino, N.M.' 2 ?                   
'Emerman, M.'     3 ?                   
'Gross, J.D.'     4 0000-0002-1377-4705 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Host Microbe' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1934-6069 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            26 
_citation.language                  ? 
_citation.page_first                739 
_citation.page_last                 747.e4 
_citation.title                     
'Structural Basis for a Species-Specific Determinant of an SIV Vif Protein toward Hominid APOBEC3G Antagonism.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.chom.2019.10.014 
_citation.pdbx_database_id_PubMed   31830442 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Binning, J.M.'   1 ? 
primary 'Chesarino, N.M.' 2 ? 
primary 'Emerman, M.'     3 ? 
primary 'Gross, J.D.'     4 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6P59 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     110.220 
_cell.length_a_esd                 ? 
_cell.length_b                     112.489 
_cell.length_b_esd                 ? 
_cell.length_c                     125.697 
_cell.length_c_esd                 ? 
_cell.volume                       1558458.978 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6P59 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Core-binding factor subunit beta'     19701.965 2 ? ? ? ? 
2 polymer     man Elongin-B                              13147.781 2 ? ? ? ? 
3 polymer     man Elongin-C                              12485.135 2 ? ? ? ? 
4 polymer     man 'Virion infectivity factor'            25624.660 2 ? ? ? ? 
5 non-polymer syn 'ZINC ION'                             65.409    2 ? ? ? ? 
6 non-polymer syn GLYCEROL                               92.094    2 ? ? ? ? 
7 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   1 ? ? ? ? 
8 water       nat water                                  18.015    7 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;CBF-beta,Polyomavirus enhancer-binding protein 2 beta subunit,PEBP2-beta,SL3-3 enhancer factor 1 subunit beta,SL3/AKV core-binding factor beta subunit
;
2 
;EloB,Elongin 18 kDa subunit,RNA polymerase II transcription factor SIII subunit B,SIII p18,Transcription elongation factor B polypeptide 2
;
3 
;EloC,Elongin 15 kDa subunit,RNA polymerase II transcription factor SIII subunit C,SIII p15,Transcription elongation factor B polypeptide 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT
PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSH
REEME
;
;MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT
PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSH
REEME
;
C,A ? 
2 'polypeptide(L)' no no 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
W,D ? 
3 'polypeptide(L)' no no 
;MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK
VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
;
;MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK
VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
;
Z,E ? 
4 'polypeptide(L)' no no 
;MAEKMWIVRPVWRVDRRKIEQWHSLVKYHMYKGKKEAREWEYVPHFKVPWGWWSHSEVHIPLGNNTKIKVTTYWNLTTEK
GWLGTYGAALAYIDQKCDPPYFTDIDPIVADSLIHKIYFPCFTDKAIRQAILGEKVLLCGFQRGHRDQVGTLQYLAIQAW
AREQVKKHGRKSARGPHWGWRSRVPALVGQNAVRNKSGSQVTLPSRVHFPSLAYLCGTLA
;
;MAEKMWIVRPVWRVDRRKIEQWHSLVKYHMYKGKKEAREWEYVPHFKVPWGWWSHSEVHIPLGNNTKIKVTTYWNLTTEK
GWLGTYGAALAYIDQKCDPPYFTDIDPIVADSLIHKIYFPCFTDKAIRQAILGEKVLLCGFQRGHRDQVGTLQYLAIQAW
AREQVKKHGRKSARGPHWGWRSRVPALVGQNAVRNKSGSQVTLPSRVHFPSLAYLCGTLA
;
F,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ARG n 
1 4   VAL n 
1 5   VAL n 
1 6   PRO n 
1 7   ASP n 
1 8   GLN n 
1 9   ARG n 
1 10  SER n 
1 11  LYS n 
1 12  PHE n 
1 13  GLU n 
1 14  ASN n 
1 15  GLU n 
1 16  GLU n 
1 17  PHE n 
1 18  PHE n 
1 19  ARG n 
1 20  LYS n 
1 21  LEU n 
1 22  SER n 
1 23  ARG n 
1 24  GLU n 
1 25  CYS n 
1 26  GLU n 
1 27  ILE n 
1 28  LYS n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  PHE n 
1 33  ARG n 
1 34  ASP n 
1 35  ARG n 
1 36  PRO n 
1 37  HIS n 
1 38  GLU n 
1 39  GLU n 
1 40  ARG n 
1 41  GLN n 
1 42  ALA n 
1 43  ARG n 
1 44  PHE n 
1 45  GLN n 
1 46  ASN n 
1 47  ALA n 
1 48  CYS n 
1 49  ARG n 
1 50  ASP n 
1 51  GLY n 
1 52  ARG n 
1 53  SER n 
1 54  GLU n 
1 55  ILE n 
1 56  ALA n 
1 57  PHE n 
1 58  VAL n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  THR n 
1 63  ASN n 
1 64  LEU n 
1 65  SER n 
1 66  LEU n 
1 67  GLN n 
1 68  PHE n 
1 69  PHE n 
1 70  PRO n 
1 71  ALA n 
1 72  SER n 
1 73  TRP n 
1 74  GLN n 
1 75  GLY n 
1 76  GLU n 
1 77  GLN n 
1 78  ARG n 
1 79  GLN n 
1 80  THR n 
1 81  PRO n 
1 82  SER n 
1 83  ARG n 
1 84  GLU n 
1 85  TYR n 
1 86  VAL n 
1 87  ASP n 
1 88  LEU n 
1 89  GLU n 
1 90  ARG n 
1 91  GLU n 
1 92  ALA n 
1 93  GLY n 
1 94  LYS n 
1 95  VAL n 
1 96  TYR n 
1 97  LEU n 
1 98  LYS n 
1 99  ALA n 
1 100 PRO n 
1 101 MET n 
1 102 ILE n 
1 103 LEU n 
1 104 ASN n 
1 105 GLY n 
1 106 VAL n 
1 107 CYS n 
1 108 VAL n 
1 109 ILE n 
1 110 TRP n 
1 111 LYS n 
1 112 GLY n 
1 113 TRP n 
1 114 ILE n 
1 115 ASP n 
1 116 LEU n 
1 117 GLN n 
1 118 ARG n 
1 119 LEU n 
1 120 ASP n 
1 121 GLY n 
1 122 MET n 
1 123 GLY n 
1 124 CYS n 
1 125 LEU n 
1 126 GLU n 
1 127 PHE n 
1 128 ASP n 
1 129 GLU n 
1 130 GLU n 
1 131 ARG n 
1 132 ALA n 
1 133 GLN n 
1 134 GLN n 
1 135 GLU n 
1 136 ASP n 
1 137 ALA n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 GLN n 
1 142 ALA n 
1 143 PHE n 
1 144 GLU n 
1 145 GLU n 
1 146 ALA n 
1 147 ARG n 
1 148 ARG n 
1 149 ARG n 
1 150 THR n 
1 151 ARG n 
1 152 GLU n 
1 153 PHE n 
1 154 GLU n 
1 155 ASP n 
1 156 ARG n 
1 157 ASP n 
1 158 ARG n 
1 159 SER n 
1 160 HIS n 
1 161 ARG n 
1 162 GLU n 
1 163 GLU n 
1 164 MET n 
1 165 GLU n 
2 1   MET n 
2 2   ASP n 
2 3   VAL n 
2 4   PHE n 
2 5   LEU n 
2 6   MET n 
2 7   ILE n 
2 8   ARG n 
2 9   ARG n 
2 10  HIS n 
2 11  LYS n 
2 12  THR n 
2 13  THR n 
2 14  ILE n 
2 15  PHE n 
2 16  THR n 
2 17  ASP n 
2 18  ALA n 
2 19  LYS n 
2 20  GLU n 
2 21  SER n 
2 22  SER n 
2 23  THR n 
2 24  VAL n 
2 25  PHE n 
2 26  GLU n 
2 27  LEU n 
2 28  LYS n 
2 29  ARG n 
2 30  ILE n 
2 31  VAL n 
2 32  GLU n 
2 33  GLY n 
2 34  ILE n 
2 35  LEU n 
2 36  LYS n 
2 37  ARG n 
2 38  PRO n 
2 39  PRO n 
2 40  ASP n 
2 41  GLU n 
2 42  GLN n 
2 43  ARG n 
2 44  LEU n 
2 45  TYR n 
2 46  LYS n 
2 47  ASP n 
2 48  ASP n 
2 49  GLN n 
2 50  LEU n 
2 51  LEU n 
2 52  ASP n 
2 53  ASP n 
2 54  GLY n 
2 55  LYS n 
2 56  THR n 
2 57  LEU n 
2 58  GLY n 
2 59  GLU n 
2 60  CYS n 
2 61  GLY n 
2 62  PHE n 
2 63  THR n 
2 64  SER n 
2 65  GLN n 
2 66  THR n 
2 67  ALA n 
2 68  ARG n 
2 69  PRO n 
2 70  GLN n 
2 71  ALA n 
2 72  PRO n 
2 73  ALA n 
2 74  THR n 
2 75  VAL n 
2 76  GLY n 
2 77  LEU n 
2 78  ALA n 
2 79  PHE n 
2 80  ARG n 
2 81  ALA n 
2 82  ASP n 
2 83  ASP n 
2 84  THR n 
2 85  PHE n 
2 86  GLU n 
2 87  ALA n 
2 88  LEU n 
2 89  CYS n 
2 90  ILE n 
2 91  GLU n 
2 92  PRO n 
2 93  PHE n 
2 94  SER n 
2 95  SER n 
2 96  PRO n 
2 97  PRO n 
2 98  GLU n 
2 99  LEU n 
2 100 PRO n 
2 101 ASP n 
2 102 VAL n 
2 103 MET n 
2 104 LYS n 
2 105 PRO n 
2 106 GLN n 
2 107 ASP n 
2 108 SER n 
2 109 GLY n 
2 110 SER n 
2 111 SER n 
2 112 ALA n 
2 113 ASN n 
2 114 GLU n 
2 115 GLN n 
2 116 ALA n 
2 117 VAL n 
2 118 GLN n 
3 1   MET n 
3 2   ASP n 
3 3   GLY n 
3 4   GLU n 
3 5   GLU n 
3 6   LYS n 
3 7   THR n 
3 8   TYR n 
3 9   GLY n 
3 10  GLY n 
3 11  CYS n 
3 12  GLU n 
3 13  GLY n 
3 14  PRO n 
3 15  ASP n 
3 16  ALA n 
3 17  MET n 
3 18  TYR n 
3 19  VAL n 
3 20  LYS n 
3 21  LEU n 
3 22  ILE n 
3 23  SER n 
3 24  SER n 
3 25  ASP n 
3 26  GLY n 
3 27  HIS n 
3 28  GLU n 
3 29  PHE n 
3 30  ILE n 
3 31  VAL n 
3 32  LYS n 
3 33  ARG n 
3 34  GLU n 
3 35  HIS n 
3 36  ALA n 
3 37  LEU n 
3 38  THR n 
3 39  SER n 
3 40  GLY n 
3 41  THR n 
3 42  ILE n 
3 43  LYS n 
3 44  ALA n 
3 45  MET n 
3 46  LEU n 
3 47  SER n 
3 48  GLY n 
3 49  PRO n 
3 50  GLY n 
3 51  GLN n 
3 52  PHE n 
3 53  ALA n 
3 54  GLU n 
3 55  ASN n 
3 56  GLU n 
3 57  THR n 
3 58  ASN n 
3 59  GLU n 
3 60  VAL n 
3 61  ASN n 
3 62  PHE n 
3 63  ARG n 
3 64  GLU n 
3 65  ILE n 
3 66  PRO n 
3 67  SER n 
3 68  HIS n 
3 69  VAL n 
3 70  LEU n 
3 71  SER n 
3 72  LYS n 
3 73  VAL n 
3 74  CYS n 
3 75  MET n 
3 76  TYR n 
3 77  PHE n 
3 78  THR n 
3 79  TYR n 
3 80  LYS n 
3 81  VAL n 
3 82  ARG n 
3 83  TYR n 
3 84  THR n 
3 85  ASN n 
3 86  SER n 
3 87  SER n 
3 88  THR n 
3 89  GLU n 
3 90  ILE n 
3 91  PRO n 
3 92  GLU n 
3 93  PHE n 
3 94  PRO n 
3 95  ILE n 
3 96  ALA n 
3 97  PRO n 
3 98  GLU n 
3 99  ILE n 
3 100 ALA n 
3 101 LEU n 
3 102 GLU n 
3 103 LEU n 
3 104 LEU n 
3 105 MET n 
3 106 ALA n 
3 107 ALA n 
3 108 ASN n 
3 109 PHE n 
3 110 LEU n 
3 111 ASP n 
3 112 CYS n 
4 1   MET n 
4 2   ALA n 
4 3   GLU n 
4 4   LYS n 
4 5   MET n 
4 6   TRP n 
4 7   ILE n 
4 8   VAL n 
4 9   ARG n 
4 10  PRO n 
4 11  VAL n 
4 12  TRP n 
4 13  ARG n 
4 14  VAL n 
4 15  ASP n 
4 16  ARG n 
4 17  ARG n 
4 18  LYS n 
4 19  ILE n 
4 20  GLU n 
4 21  GLN n 
4 22  TRP n 
4 23  HIS n 
4 24  SER n 
4 25  LEU n 
4 26  VAL n 
4 27  LYS n 
4 28  TYR n 
4 29  HIS n 
4 30  MET n 
4 31  TYR n 
4 32  LYS n 
4 33  GLY n 
4 34  LYS n 
4 35  LYS n 
4 36  GLU n 
4 37  ALA n 
4 38  ARG n 
4 39  GLU n 
4 40  TRP n 
4 41  GLU n 
4 42  TYR n 
4 43  VAL n 
4 44  PRO n 
4 45  HIS n 
4 46  PHE n 
4 47  LYS n 
4 48  VAL n 
4 49  PRO n 
4 50  TRP n 
4 51  GLY n 
4 52  TRP n 
4 53  TRP n 
4 54  SER n 
4 55  HIS n 
4 56  SER n 
4 57  GLU n 
4 58  VAL n 
4 59  HIS n 
4 60  ILE n 
4 61  PRO n 
4 62  LEU n 
4 63  GLY n 
4 64  ASN n 
4 65  ASN n 
4 66  THR n 
4 67  LYS n 
4 68  ILE n 
4 69  LYS n 
4 70  VAL n 
4 71  THR n 
4 72  THR n 
4 73  TYR n 
4 74  TRP n 
4 75  ASN n 
4 76  LEU n 
4 77  THR n 
4 78  THR n 
4 79  GLU n 
4 80  LYS n 
4 81  GLY n 
4 82  TRP n 
4 83  LEU n 
4 84  GLY n 
4 85  THR n 
4 86  TYR n 
4 87  GLY n 
4 88  ALA n 
4 89  ALA n 
4 90  LEU n 
4 91  ALA n 
4 92  TYR n 
4 93  ILE n 
4 94  ASP n 
4 95  GLN n 
4 96  LYS n 
4 97  CYS n 
4 98  ASP n 
4 99  PRO n 
4 100 PRO n 
4 101 TYR n 
4 102 PHE n 
4 103 THR n 
4 104 ASP n 
4 105 ILE n 
4 106 ASP n 
4 107 PRO n 
4 108 ILE n 
4 109 VAL n 
4 110 ALA n 
4 111 ASP n 
4 112 SER n 
4 113 LEU n 
4 114 ILE n 
4 115 HIS n 
4 116 LYS n 
4 117 ILE n 
4 118 TYR n 
4 119 PHE n 
4 120 PRO n 
4 121 CYS n 
4 122 PHE n 
4 123 THR n 
4 124 ASP n 
4 125 LYS n 
4 126 ALA n 
4 127 ILE n 
4 128 ARG n 
4 129 GLN n 
4 130 ALA n 
4 131 ILE n 
4 132 LEU n 
4 133 GLY n 
4 134 GLU n 
4 135 LYS n 
4 136 VAL n 
4 137 LEU n 
4 138 LEU n 
4 139 CYS n 
4 140 GLY n 
4 141 PHE n 
4 142 GLN n 
4 143 ARG n 
4 144 GLY n 
4 145 HIS n 
4 146 ARG n 
4 147 ASP n 
4 148 GLN n 
4 149 VAL n 
4 150 GLY n 
4 151 THR n 
4 152 LEU n 
4 153 GLN n 
4 154 TYR n 
4 155 LEU n 
4 156 ALA n 
4 157 ILE n 
4 158 GLN n 
4 159 ALA n 
4 160 TRP n 
4 161 ALA n 
4 162 ARG n 
4 163 GLU n 
4 164 GLN n 
4 165 VAL n 
4 166 LYS n 
4 167 LYS n 
4 168 HIS n 
4 169 GLY n 
4 170 ARG n 
4 171 LYS n 
4 172 SER n 
4 173 ALA n 
4 174 ARG n 
4 175 GLY n 
4 176 PRO n 
4 177 HIS n 
4 178 TRP n 
4 179 GLY n 
4 180 TRP n 
4 181 ARG n 
4 182 SER n 
4 183 ARG n 
4 184 VAL n 
4 185 PRO n 
4 186 ALA n 
4 187 LEU n 
4 188 VAL n 
4 189 GLY n 
4 190 GLN n 
4 191 ASN n 
4 192 ALA n 
4 193 VAL n 
4 194 ARG n 
4 195 ASN n 
4 196 LYS n 
4 197 SER n 
4 198 GLY n 
4 199 SER n 
4 200 GLN n 
4 201 VAL n 
4 202 THR n 
4 203 LEU n 
4 204 PRO n 
4 205 SER n 
4 206 ARG n 
4 207 VAL n 
4 208 HIS n 
4 209 PHE n 
4 210 PRO n 
4 211 SER n 
4 212 LEU n 
4 213 ALA n 
4 214 TYR n 
4 215 LEU n 
4 216 CYS n 
4 217 GLY n 
4 218 THR n 
4 219 LEU n 
4 220 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 165 Human ? CBFB          ? ? ? ? ? ? 'Homo sapiens'                  9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 118 Human ? 'ELOB, TCEB2' ? ? ? ? ? ? 'Homo sapiens'                  9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 112 Human ? 'ELOC, TCEB1' ? ? ? ? ? ? 'Homo sapiens'                  9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 220 SIV   ? vif           ? ? ? ? ? ? 'Simian immunodeficiency virus' 11723 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PEBB_HUMAN Q13951 Q13951-2 1 
;MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT
PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSH
REEME
;
1 
2 UNP ELOB_HUMAN Q15370 ?        2 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
1 
3 UNP ELOC_HUMAN Q15369 ?        3 
;MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK
VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
;
1 
4 UNP E1ANT9_SIV E1ANT9 ?        4 
;MAEKMWIVRPVWRVDRRKIEQWHSLVKYHMYKGKKEAREWEYVPHFKVPWGWWSHSEVHIPLGNNTKIKVTTYWNLTTEK
GWLGTYGAALAYIDQKCDPPYFTDIDPIVADSLIHKIYFPCFTDKAIRQAILGEKVLLCGFQRGHRDQVGTLQYLAIQAW
AREQVKKHGRKSARGPHWGWRSRVPALVGQNAVRNKSGSQVTLPSRVHFPSLAYLCGTLA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6P59 C 1 ? 165 ? Q13951 1 ? 165 ? 1 165 
2 2 6P59 W 1 ? 118 ? Q15370 1 ? 118 ? 1 118 
3 3 6P59 Z 1 ? 112 ? Q15369 1 ? 112 ? 1 112 
4 4 6P59 F 1 ? 220 ? E1ANT9 1 ? 220 ? 1 220 
5 1 6P59 A 1 ? 165 ? Q13951 1 ? 165 ? 1 165 
6 2 6P59 D 1 ? 118 ? Q15370 1 ? 118 ? 1 118 
7 3 6P59 E 1 ? 112 ? Q15369 1 ? 112 ? 1 112 
8 4 6P59 B 1 ? 220 ? E1ANT9 1 ? 220 ? 1 220 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                               ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                              ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                               'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?                               'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                             ?                               'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6P59 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'MES (pH 6), PEG 6000, Dichloromethane' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-09-03 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.11583 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.11583 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            85.66762804 
_reflns.entry_id                         6P59 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.94 
_reflns.d_resolution_low                 49.12 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33445 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.27 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.94 
_reflns_shell.d_res_low                   3.047 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3146 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               98.7828845439 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6P59 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.94221405643 
_refine.ls_d_res_low                             49.116978298 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33428 
_refine.ls_number_reflns_R_free                  1679 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.7679125425 
_refine.ls_percent_reflns_R_free                 5.02273543137 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.236271019504 
_refine.ls_R_factor_R_free                       0.268464117183 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.234530316465 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.32565720389 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4N9F 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.7423150686 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.433819171318 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.94221405643 
_refine_hist.d_res_low                        49.116978298 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               8925 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        8892 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00584046488986 ? 9138  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.861758095378   ? 12338 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0496410848198  ? 1288  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00586079735771 ? 1596  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 17.9662983175    ? 5480  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9422 3.0288  . . 126 2460 92.7879440258 . . . 0.438574304691 . 0.374767598294 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0288 3.1265  . . 148 2632 99.9640417116 . . . 0.363123938382 . 0.338787436898 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1265 3.2382  . . 136 2639 99.9639769452 . . . 0.335897805937 . 0.309054436597 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2382 3.3679  . . 138 2628 99.9277456647 . . . 0.335098591282 . 0.306954800842 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3679 3.5211  . . 138 2664 99.9643239386 . . . 0.315060121781 . 0.306100846364 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5211 3.7067  . . 137 2540 96.3642908567 . . . 0.435744130526 . 0.363145216605 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7067 3.9388  . . 141 2586 96.8738898757 . . . 0.328458823856 . 0.278968730452 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9388 4.2428  . . 137 2665 99.9643239386 . . . 0.23285969735  . 0.219217881644 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2428 4.6695  . . 146 2683 99.8940677966 . . . 0.200711105702 . 0.178877675422 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6695 5.3444  . . 143 2674 99.9645138396 . . . 0.220350836199 . 0.184875961474 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3444 6.7307  . . 143 2740 99.9653259362 . . . 0.282769572321 . 0.212716561516 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.7307 49.1238 . . 146 2838 99.4666666667 . . . 0.203016429375 . 0.186129266058 . . . . . . . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 1 ? 
1 2 ? 
2 2 ? 
1 3 ? 
2 3 ? 
1 4 ? 
2 4 ? 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 F 3   F 5   
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
1 ? ? ? ? ? ? ? ? ? 
1 1 F 7   F 49  
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
2 ? ? ? ? ? ? ? ? ? 
1 1 F 51  F 79  
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
3 ? ? ? ? ? ? ? ? ? 
1 1 F 81  F 97  
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
4 ? ? ? ? ? ? ? ? ? 
1 1 F 99  F 134 
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
5 ? ? ? ? ? ? ? ? ? 
1 1 F 136 F 166 
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
6 ? ? ? ? ? ? ? ? ? 
1 1 F 200 F 205 
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
7 ? ? ? ? ? ? ? ? ? 
1 1 F 207 F 218 
;(chain F and (resseq 3:5 or (resid 7 and (name O or name N or name CA or name C or name CB or name CG1 or name CG2)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name O or name N or name CA or name C or name CB or name CG or name CD )) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
8 ? ? ? ? ? ? ? ? ? 
1 2 B 3   B 5   
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
1 ? ? ? ? ? ? ? ? ? 
1 2 B 7   B 49  
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
2 ? ? ? ? ? ? ? ? ? 
1 2 B 51  B 79  
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
3 ? ? ? ? ? ? ? ? ? 
1 2 B 81  B 97  
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
4 ? ? ? ? ? ? ? ? ? 
1 2 B 99  B 134 
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
5 ? ? ? ? ? ? ? ? ? 
1 2 B 136 B 166 
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
6 ? ? ? ? ? ? ? ? ? 
1 2 B 200 B 205 
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
7 ? ? ? ? ? ? ? ? ? 
1 2 B 207 B 218 
;(chain B and (resseq 3:5 or (resid 7 and (name N or name CA or name C or name CB or name CG1 or name CG2 or name CD1)) or resseq 8:21 or (resid 22 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name CE2 or name CE3 or name CZ2 or name CZ3 or name CH2)) or resseq 23:49 or resseq 51:79 or resseq 81:82 or (resid 83 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 84:97 or resseq 99:101 or (resid 102 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 103:118 or (resid 119 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 120:134 or resseq 136:146 or (resid 147 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 148:151 or (resid 152 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 153:163 or (resid 164 and (name N or name CA or name C or name CB or name CG or name CD or name OE1)) or resseq 165:166 or resseq 200:202 or (resid 203 and (name O or name N or name CA or name C or name CB or name CG or name CD1)) or resseq 204:205 or resseq 207:208 or (resid 209 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 210:218))
;
8 ? ? ? ? ? ? ? ? ? 
2 1 Z 18  Z 110 
;(chain Z and (resseq 18:51 or (resid 52 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 53:110))
;
1 ? ? ? ? ? ? ? ? ? 
2 2 E 18  E 110 
;(chain E and (resseq 18:51 or (resid 52 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 53:110))
;
1 ? ? ? ? ? ? ? ? ? 
3 1 A 6   A 14  
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
1 ? ? ? ? ? ? ? ? ? 
3 1 A 16  A 22  
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
2 ? ? ? ? ? ? ? ? ? 
3 1 A 24  A 72  
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
3 ? ? ? ? ? ? ? ? ? 
3 1 A 74  A 88  
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
4 ? ? ? ? ? ? ? ? ? 
3 1 A 90  A 133 
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
5 ? ? ? ? ? ? ? ? ? 
3 1 A 137 A 140 
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
6 ? ? ? ? ? ? ? ? ? 
3 1 A 142 A 148 
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
7 ? ? ? ? ? ? ? ? ? 
3 1 A 150 A 157 
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
8 ? ? ? ? ? ? ? ? ? 
3 1 A 159 A 159 
;(chain A and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 17 and (name O or name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1)) or (resid 18 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 19 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 20 and (name O or name N or name CA or name C or name CB or name CG or name CD or name CE )) or resseq 21 or (resid 22 and (name N or name CA or name C or name CB or name OG )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name N or name CA or name C or name CB or name OG )) or (resid 83 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 84 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name N or name CA or name C or name CB )) or resseq 140 or (resid 142 and (name N or name CA or name C or name CB )) or (resid 143 and (name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or (resid 144 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 145 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 146 and (name N or name CA or name C or name CB )) or (resid 147 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 148 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 150 and (name N or name CA or name C or name CB or name CG2)) or (resid 151 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 152 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 153 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 154 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 155 and (name N or name CA or name C or name CB or name CG or name OD2 or name OD1)) or (resid 156 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 157 or resseq 159))
;
9 ? ? ? ? ? ? ? ? ? 
3 2 C 6   C 14  
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
1 ? ? ? ? ? ? ? ? ? 
3 2 C 16  C 22  
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
2 ? ? ? ? ? ? ? ? ? 
3 2 C 24  C 72  
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
3 ? ? ? ? ? ? ? ? ? 
3 2 C 74  C 88  
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
4 ? ? ? ? ? ? ? ? ? 
3 2 C 90  C 133 
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
5 ? ? ? ? ? ? ? ? ? 
3 2 C 137 C 140 
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
6 ? ? ? ? ? ? ? ? ? 
3 2 C 142 C 148 
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
7 ? ? ? ? ? ? ? ? ? 
3 2 C 150 C 157 
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
8 ? ? ? ? ? ? ? ? ? 
3 2 C 159 C 159 
;(chain C and (resseq 6:11 or (resid 12 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ )) or resseq 13:14 or (resid 16 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 17 and (name N or name CA or name C or name CB or name CG or name CD2 or name CD1 or name CE2 or name CE1 or name CZ )) or (resid 18 and (name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2 or name CZ )) or (resid 19 and (name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 20 and (name N or name CA or name C or name CB or name CG or name CD or name CE or name NZ )) or resseq 21 or (resid 22 and (name O or name N or name CA or name C or name CB )) or resseq 24:28 or (resid 29 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 30:31 or (resid 32 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 33:49 or (resid 50 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 51:72 or resseq 74:81 or (resid 82 and (name O or name N or name CA or name C or name CB )) or (resid 83 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 84 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 85 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 86:88 or resseq 90:119 or (resid 120 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 121:133 or resseq 137:138 or (resid 139 and (name O or name N or name CA or name C )) or resseq 140 or (resid 142 and (name O or name N or name CA or name C )) or (resid 143 and (name O or name N or name CA or name C or name CB or name CD2 or name CE2 or name CE1)) or (resid 144 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 145 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 146 and (name O or name N or name CA or name C )) or (resid 147 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 148 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 150 and (name O or name N or name CA or name C or name OG1)) or (resid 151 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or (resid 152 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 153 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CD2 or name CE1 or name CE2)) or (resid 154 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1)) or (resid 155 and (name O or name N or name CA or name C or name CB or name CG or name OD2)) or (resid 156 and (name O or name N or name CA or name C or name CB or name CG or name CD or name NE or name CZ or name NH1)) or resseq 157 or resseq 159))
;
9 ? ? ? ? ? ? ? ? ? 
4 1 W 1   W 25  
;(chain W and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
1 ? ? ? ? ? ? ? ? ? 
4 1 W 27  W 79  
;(chain W and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
2 ? ? ? ? ? ? ? ? ? 
4 1 W 84  W 84  
;(chain W and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
3 ? ? ? ? ? ? ? ? ? 
4 1 W 86  W 97  
;(chain W and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
4 ? ? ? ? ? ? ? ? ? 
4 2 D 1   D 25  
;(chain D and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
5 ? ? ? ? ? ? ? ? ? 
4 2 D 27  D 79  
;(chain D and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
6 ? ? ? ? ? ? ? ? ? 
4 2 D 84  D 84  
;(chain D and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
7 ? ? ? ? ? ? ? ? ? 
4 2 D 86  D 97  
;(chain D and (resseq 1 or (resid 2 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 3:25 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG or name CD2)) or resseq 28:46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 48 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 49:51 or (resid 52 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or (resid 53 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 54:78 or (resid 79 and (name O or name N or name CA or name C or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 81 or resseq 84 or resseq 86:97))
;
8 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                     6P59 
_struct.title                        'Crystal structure of SIVrcm Vif-CBFbeta-ELOB-ELOC complex' 
_struct.pdbx_descriptor              'Core-binding factor subunit beta, Elongin-B, Elongin-C, Virion infectivity factor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6P59 
_struct_keywords.text            'Complex, Vif, A3G, VIRAL PROTEIN, viral protein-immune system complex' 
_struct_keywords.pdbx_keywords   'viral protein/immune system' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 5 ? 
M N N 6 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 7   ? ASN A 14  ? ASP C 7   ASN C 14  1 ? 8  
HELX_P HELX_P2  AA2 PRO A 36  ? ASP A 50  ? PRO C 36  ASP C 50  1 ? 15 
HELX_P HELX_P3  AA3 SER A 72  ? GLN A 74  ? SER C 72  GLN C 74  5 ? 3  
HELX_P HELX_P4  AA4 ASP A 128 ? GLU A 135 ? ASP C 128 GLU C 135 1 ? 8  
HELX_P HELX_P5  AA5 ASP A 136 ? LEU A 138 ? ASP C 136 LEU C 138 5 ? 3  
HELX_P HELX_P6  AA6 ALA A 139 ? ARG A 149 ? ALA C 139 ARG C 149 1 ? 11 
HELX_P HELX_P7  AA7 THR B 23  ? LYS B 36  ? THR W 23  LYS W 36  1 ? 14 
HELX_P HELX_P8  AA8 PRO B 38  ? GLN B 42  ? PRO W 38  GLN W 42  5 ? 5  
HELX_P HELX_P9  AA9 THR B 56  ? GLY B 61  ? THR W 56  GLY W 61  1 ? 6  
HELX_P HELX_P10 AB1 ARG C 33  ? LEU C 37  ? ARG Z 33  LEU Z 37  1 ? 5  
HELX_P HELX_P11 AB2 SER C 39  ? SER C 47  ? SER Z 39  SER Z 47  1 ? 9  
HELX_P HELX_P12 AB3 PRO C 66  ? TYR C 83  ? PRO Z 66  TYR Z 83  1 ? 18 
HELX_P HELX_P13 AB4 ALA C 96  ? ASP C 111 ? ALA Z 96  ASP Z 111 1 ? 16 
HELX_P HELX_P14 AB5 ASP D 15  ? LYS D 32  ? ASP F 15  LYS F 32  1 ? 18 
HELX_P HELX_P15 AB6 ASP D 106 ? LYS D 116 ? ASP F 106 LYS F 116 1 ? 11 
HELX_P HELX_P16 AB7 LYS D 125 ? GLY D 133 ? LYS F 125 GLY F 133 1 ? 9  
HELX_P HELX_P17 AB8 PHE D 141 ? HIS D 145 ? PHE F 141 HIS F 145 5 ? 5  
HELX_P HELX_P18 AB9 THR D 151 ? LYS D 167 ? THR F 151 LYS F 167 1 ? 17 
HELX_P HELX_P19 AC1 SER D 211 ? GLY D 217 ? SER F 211 GLY F 217 1 ? 7  
HELX_P HELX_P20 AC2 PRO E 6   ? ASN E 14  ? PRO A 6   ASN A 14  1 ? 9  
HELX_P HELX_P21 AC3 PRO E 36  ? ASP E 50  ? PRO A 36  ASP A 50  1 ? 15 
HELX_P HELX_P22 AC4 SER E 72  ? GLN E 74  ? SER A 72  GLN A 74  5 ? 3  
HELX_P HELX_P23 AC5 ASP E 128 ? GLN E 134 ? ASP A 128 GLN A 134 1 ? 7  
HELX_P HELX_P24 AC6 LEU E 138 ? ARG E 149 ? LEU A 138 ARG A 149 1 ? 12 
HELX_P HELX_P25 AC7 THR F 23  ? LYS F 36  ? THR D 23  LYS D 36  1 ? 14 
HELX_P HELX_P26 AC8 PRO F 38  ? GLN F 42  ? PRO D 38  GLN D 42  5 ? 5  
HELX_P HELX_P27 AC9 THR F 56  ? GLY F 61  ? THR D 56  GLY D 61  1 ? 6  
HELX_P HELX_P28 AD1 ARG G 33  ? LEU G 37  ? ARG E 33  LEU E 37  1 ? 5  
HELX_P HELX_P29 AD2 SER G 39  ? SER G 47  ? SER E 39  SER E 47  1 ? 9  
HELX_P HELX_P30 AD3 ALA G 53  ? THR G 57  ? ALA E 53  THR E 57  5 ? 5  
HELX_P HELX_P31 AD4 PRO G 66  ? TYR G 83  ? PRO E 66  TYR E 83  1 ? 18 
HELX_P HELX_P32 AD5 ALA G 96  ? LEU G 110 ? ALA E 96  LEU E 110 1 ? 15 
HELX_P HELX_P33 AD6 ASP H 15  ? LYS H 32  ? ASP B 15  LYS B 32  1 ? 18 
HELX_P HELX_P34 AD7 PRO H 44  ? VAL H 48  ? PRO B 44  VAL B 48  5 ? 5  
HELX_P HELX_P35 AD8 ASP H 106 ? HIS H 115 ? ASP B 106 HIS B 115 1 ? 10 
HELX_P HELX_P36 AD9 LYS H 125 ? GLY H 133 ? LYS B 125 GLY B 133 1 ? 9  
HELX_P HELX_P37 AE1 PHE H 141 ? HIS H 145 ? PHE B 141 HIS B 145 5 ? 5  
HELX_P HELX_P38 AE2 THR H 151 ? VAL H 165 ? THR B 151 VAL B 165 1 ? 15 
HELX_P HELX_P39 AE3 SER H 211 ? GLY H 217 ? SER B 211 GLY B 217 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D HIS 115 NE2 ? ? ? 1_555 I ZN . ZN ? ? F HIS 115 F ZN 301 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc2 metalc ? ? D CYS 121 SG  ? ? ? 1_555 I ZN . ZN ? ? F CYS 121 F ZN 301 1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc3 metalc ? ? D CYS 139 SG  ? ? ? 1_555 I ZN . ZN ? ? F CYS 139 F ZN 301 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc4 metalc ? ? H HIS 115 NE2 ? ? ? 1_555 L ZN . ZN ? ? B HIS 115 B ZN 301 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc5 metalc ? ? H CYS 121 SG  ? ? ? 1_555 L ZN . ZN ? ? B CYS 121 B ZN 301 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc6 metalc ? ? H CYS 139 SG  ? ? ? 1_555 L ZN . ZN ? ? B CYS 139 B ZN 301 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc7 metalc ? ? H HIS 145 NE2 ? ? ? 1_555 L ZN . ZN ? ? B HIS 145 B ZN 301 1_555 ? ? ? ? ? ? ? 1.920 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 12 ? 
AA2 ? 7  ? 
AA3 ? 8  ? 
AA4 ? 12 ? 
AA5 ? 7  ? 
AA6 ? 8  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA1 11 12 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? parallel      
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? parallel      
AA3 4  5  ? anti-parallel 
AA3 5  6  ? parallel      
AA3 6  7  ? anti-parallel 
AA3 7  8  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA4 5  6  ? anti-parallel 
AA4 6  7  ? anti-parallel 
AA4 7  8  ? anti-parallel 
AA4 8  9  ? anti-parallel 
AA4 9  10 ? anti-parallel 
AA4 10 11 ? anti-parallel 
AA4 11 12 ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA5 3  4  ? anti-parallel 
AA5 4  5  ? anti-parallel 
AA5 5  6  ? anti-parallel 
AA5 6  7  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? parallel      
AA6 4  5  ? anti-parallel 
AA6 5  6  ? parallel      
AA6 6  7  ? anti-parallel 
AA6 7  8  ? parallel      
AA7 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 86  ? ASP A 87  ? VAL C 86  ASP C 87  
AA1 2  LYS A 94  ? LEU A 103 ? LYS C 94  LEU C 103 
AA1 3  VAL A 106 ? ASP A 115 ? VAL C 106 ASP C 115 
AA1 4  ASP A 120 ? PHE A 127 ? ASP C 120 PHE C 127 
AA1 5  GLU A 24  ? LYS A 28  ? GLU C 24  LYS C 28  
AA1 6  ILE A 55  ? ALA A 59  ? ILE C 55  ALA C 59  
AA1 7  LEU A 64  ? PRO A 70  ? LEU C 64  PRO C 70  
AA1 8  TRP D 6   ? VAL D 14  ? TRP F 6   VAL F 14  
AA1 9  THR D 85  ? ASP D 94  ? THR F 85  ASP F 94  
AA1 10 THR D 66  ? LEU D 76  ? THR F 66  LEU F 76  
AA1 11 SER D 54  ? LEU D 62  ? SER F 54  LEU F 62  
AA1 12 GLU D 41  ? VAL D 43  ? GLU F 41  VAL F 43  
AA2 1  VAL A 86  ? ASP A 87  ? VAL C 86  ASP C 87  
AA2 2  LYS A 94  ? LEU A 103 ? LYS C 94  LEU C 103 
AA2 3  TYR D 101 ? ASP D 104 ? TYR F 101 ASP F 104 
AA2 4  THR D 85  ? ASP D 94  ? THR F 85  ASP F 94  
AA2 5  THR D 66  ? LEU D 76  ? THR F 66  LEU F 76  
AA2 6  SER D 54  ? LEU D 62  ? SER F 54  LEU F 62  
AA2 7  GLU D 41  ? VAL D 43  ? GLU F 41  VAL F 43  
AA3 1  GLN B 49  ? LEU B 50  ? GLN W 49  LEU W 50  
AA3 2  LEU B 44  ? LYS B 46  ? LEU W 44  LYS W 46  
AA3 3  ALA B 73  ? LEU B 77  ? ALA W 73  LEU W 77  
AA3 4  ASP B 2   ? ARG B 9   ? ASP W 2   ARG W 9   
AA3 5  THR B 12  ? LYS B 19  ? THR W 12  LYS W 19  
AA3 6  GLU C 28  ? LYS C 32  ? GLU Z 28  LYS Z 32  
AA3 7  TYR C 18  ? ILE C 22  ? TYR Z 18  ILE Z 22  
AA3 8  GLU C 59  ? ASN C 61  ? GLU Z 59  ASN Z 61  
AA4 1  VAL E 86  ? ASP E 87  ? VAL A 86  ASP A 87  
AA4 2  LYS E 94  ? LEU E 103 ? LYS A 94  LEU A 103 
AA4 3  VAL E 106 ? ASP E 115 ? VAL A 106 ASP A 115 
AA4 4  ASP E 120 ? PHE E 127 ? ASP A 120 PHE A 127 
AA4 5  CYS E 25  ? LYS E 28  ? CYS A 25  LYS A 28  
AA4 6  ILE E 55  ? ALA E 59  ? ILE A 55  ALA A 59  
AA4 7  LEU E 64  ? PRO E 70  ? LEU A 64  PRO A 70  
AA4 8  TRP H 6   ? VAL H 14  ? TRP B 6   VAL B 14  
AA4 9  THR H 85  ? ASP H 94  ? THR B 85  ASP B 94  
AA4 10 THR H 66  ? LEU H 76  ? THR B 66  LEU B 76  
AA4 11 SER H 54  ? PRO H 61  ? SER B 54  PRO B 61  
AA4 12 GLU H 41  ? VAL H 43  ? GLU B 41  VAL B 43  
AA5 1  VAL E 86  ? ASP E 87  ? VAL A 86  ASP A 87  
AA5 2  LYS E 94  ? LEU E 103 ? LYS A 94  LEU A 103 
AA5 3  TYR H 101 ? ASP H 104 ? TYR B 101 ASP B 104 
AA5 4  THR H 85  ? ASP H 94  ? THR B 85  ASP B 94  
AA5 5  THR H 66  ? LEU H 76  ? THR B 66  LEU B 76  
AA5 6  SER H 54  ? PRO H 61  ? SER B 54  PRO B 61  
AA5 7  GLU H 41  ? VAL H 43  ? GLU B 41  VAL B 43  
AA6 1  GLN F 49  ? LEU F 50  ? GLN D 49  LEU D 50  
AA6 2  ARG F 43  ? LYS F 46  ? ARG D 43  LYS D 46  
AA6 3  ALA F 73  ? ALA F 78  ? ALA D 73  ALA D 78  
AA6 4  ASP F 2   ? ARG F 9   ? ASP D 2   ARG D 9   
AA6 5  THR F 12  ? LYS F 19  ? THR D 12  LYS D 19  
AA6 6  GLU G 28  ? LYS G 32  ? GLU E 28  LYS E 32  
AA6 7  TYR G 18  ? ILE G 22  ? TYR E 18  ILE E 22  
AA6 8  GLU G 59  ? ASN G 61  ? GLU E 59  ASN E 61  
AA7 1  ARG F 80  ? ALA F 81  ? ARG D 80  ALA D 81  
AA7 2  THR F 84  ? PHE F 85  ? THR D 84  PHE D 85  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N ASP A 87  ? N ASP C 87  O TYR A 96  ? O TYR C 96  
AA1 2  3  N LEU A 97  ? N LEU C 97  O GLY A 112 ? O GLY C 112 
AA1 3  4  N ASP A 115 ? N ASP C 115 O ASP A 120 ? O ASP C 120 
AA1 4  5  O GLY A 123 ? O GLY C 123 N CYS A 25  ? N CYS C 25  
AA1 5  6  N LYS A 28  ? N LYS C 28  O VAL A 58  ? O VAL C 58  
AA1 6  7  N ILE A 55  ? N ILE C 55  O PHE A 68  ? O PHE C 68  
AA1 7  8  N SER A 65  ? N SER C 65  O VAL D 11  ? O VAL F 11  
AA1 8  9  N TRP D 12  ? N TRP F 12  O ALA D 88  ? O ALA F 88  
AA1 9  10 O GLY D 87  ? O GLY F 87  N TYR D 73  ? N TYR F 73  
AA1 10 11 O THR D 66  ? O THR F 66  N LEU D 62  ? N LEU F 62  
AA1 11 12 O GLU D 57  ? O GLU F 57  N VAL D 43  ? N VAL F 43  
AA2 1  2  N ASP A 87  ? N ASP C 87  O TYR A 96  ? O TYR C 96  
AA2 2  3  N ILE A 102 ? N ILE C 102 O ASP D 104 ? O ASP F 104 
AA2 3  4  O TYR D 101 ? O TYR F 101 N ASP D 94  ? N ASP F 94  
AA2 4  5  O GLY D 87  ? O GLY F 87  N TYR D 73  ? N TYR F 73  
AA2 5  6  O THR D 66  ? O THR F 66  N LEU D 62  ? N LEU F 62  
AA2 6  7  O GLU D 57  ? O GLU F 57  N VAL D 43  ? N VAL F 43  
AA3 1  2  O GLN B 49  ? O GLN W 49  N LYS B 46  ? N LYS W 46  
AA3 2  3  N TYR B 45  ? N TYR W 45  O GLY B 76  ? O GLY W 76  
AA3 3  4  O VAL B 75  ? O VAL W 75  N ARG B 8   ? N ARG W 8   
AA3 4  5  N ARG B 9   ? N ARG W 9   O THR B 12  ? O THR W 12  
AA3 5  6  N THR B 13  ? N THR W 13  O ILE C 30  ? O ILE Z 30  
AA3 6  7  O PHE C 29  ? O PHE Z 29  N LEU C 21  ? N LEU Z 21  
AA3 7  8  N ILE C 22  ? N ILE Z 22  O VAL C 60  ? O VAL Z 60  
AA4 1  2  N ASP E 87  ? N ASP A 87  O TYR E 96  ? O TYR A 96  
AA4 2  3  N LEU E 97  ? N LEU A 97  O GLY E 112 ? O GLY A 112 
AA4 3  4  N ILE E 109 ? N ILE A 109 O GLU E 126 ? O GLU A 126 
AA4 4  5  O GLY E 121 ? O GLY A 121 N ILE E 27  ? N ILE A 27  
AA4 5  6  N LYS E 28  ? N LYS A 28  O VAL E 58  ? O VAL A 58  
AA4 6  7  N PHE E 57  ? N PHE A 57  O LEU E 66  ? O LEU A 66  
AA4 7  8  N PHE E 69  ? N PHE A 69  O ILE H 7   ? O ILE B 7   
AA4 8  9  N TRP H 12  ? N TRP B 12  O ALA H 88  ? O ALA B 88  
AA4 9  10 O GLY H 87  ? O GLY B 87  N TYR H 73  ? N TYR B 73  
AA4 10 11 O ILE H 68  ? O ILE B 68  N ILE H 60  ? N ILE B 60  
AA4 11 12 O GLU H 57  ? O GLU B 57  N VAL H 43  ? N VAL B 43  
AA5 1  2  N ASP E 87  ? N ASP A 87  O TYR E 96  ? O TYR A 96  
AA5 2  3  N ILE E 102 ? N ILE A 102 O ASP H 104 ? O ASP B 104 
AA5 3  4  O TYR H 101 ? O TYR B 101 N ASP H 94  ? N ASP B 94  
AA5 4  5  O GLY H 87  ? O GLY B 87  N TYR H 73  ? N TYR B 73  
AA5 5  6  O ILE H 68  ? O ILE B 68  N ILE H 60  ? N ILE B 60  
AA5 6  7  O GLU H 57  ? O GLU B 57  N VAL H 43  ? N VAL B 43  
AA6 1  2  O GLN F 49  ? O GLN D 49  N LYS F 46  ? N LYS D 46  
AA6 2  3  N ARG F 43  ? N ARG D 43  O ALA F 78  ? O ALA D 78  
AA6 3  4  O VAL F 75  ? O VAL D 75  N MET F 6   ? N MET D 6   
AA6 4  5  N ARG F 9   ? N ARG D 9   O THR F 12  ? O THR D 12  
AA6 5  6  N THR F 13  ? N THR D 13  O ILE G 30  ? O ILE E 30  
AA6 6  7  O PHE G 29  ? O PHE E 29  N LEU G 21  ? N LEU E 21  
AA6 7  8  N ILE G 22  ? N ILE E 22  O VAL G 60  ? O VAL E 60  
AA7 1  2  N ALA F 81  ? N ALA D 81  O THR F 84  ? O THR D 84  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software F ZN  301 ? 4 'binding site for residue ZN F 301'  
AC2 Software F GOL 302 ? 4 'binding site for residue GOL F 302' 
AC3 Software A MES 201 ? 1 'binding site for residue MES A 201' 
AC4 Software B ZN  301 ? 4 'binding site for residue ZN B 301'  
AC5 Software B GOL 302 ? 5 'binding site for residue GOL B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS D 115 ? HIS F 115 . ? 1_555 ? 
2  AC1 4 CYS D 121 ? CYS F 121 . ? 1_555 ? 
3  AC1 4 CYS D 139 ? CYS F 139 . ? 1_555 ? 
4  AC1 4 HIS D 145 ? HIS F 145 . ? 1_555 ? 
5  AC2 4 ARG D 143 ? ARG F 143 . ? 1_555 ? 
6  AC2 4 HIS D 208 ? HIS F 208 . ? 1_555 ? 
7  AC2 4 PHE D 209 ? PHE F 209 . ? 1_555 ? 
8  AC2 4 SER D 211 ? SER F 211 . ? 1_555 ? 
9  AC3 1 ARG E 52  ? ARG A 52  . ? 1_555 ? 
10 AC4 4 HIS H 115 ? HIS B 115 . ? 1_555 ? 
11 AC4 4 CYS H 121 ? CYS B 121 . ? 1_555 ? 
12 AC4 4 CYS H 139 ? CYS B 139 . ? 1_555 ? 
13 AC4 4 HIS H 145 ? HIS B 145 . ? 1_555 ? 
14 AC5 5 ARG H 143 ? ARG B 143 . ? 1_555 ? 
15 AC5 5 HIS H 208 ? HIS B 208 . ? 1_555 ? 
16 AC5 5 PHE H 209 ? PHE B 209 . ? 1_555 ? 
17 AC5 5 SER H 211 ? SER B 211 . ? 1_555 ? 
18 AC5 5 TYR H 214 ? TYR B 214 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6P59 
_atom_sites.fract_transf_matrix[1][1]   0.009073 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008890 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007956 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 6.96715  ?       11.43723 ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527  ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
ZN ? ? 29.81721 ?       5.87945  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 6   ? 67.33015 26.05594  24.47547  1.000 151.54508 ? 6   PRO C N   1 
ATOM   2    C  CA  . PRO A 1 6   ? 66.68156 25.08909  23.58358  1.000 154.02993 ? 6   PRO C CA  1 
ATOM   3    C  C   . PRO A 1 6   ? 65.16293 25.26391  23.49135  1.000 159.54089 ? 6   PRO C C   1 
ATOM   4    O  O   . PRO A 1 6   ? 64.47605 25.36976  24.51076  1.000 164.40843 ? 6   PRO C O   1 
ATOM   5    C  CB  . PRO A 1 6   ? 67.03282 23.73760  24.21980  1.000 149.08439 ? 6   PRO C CB  1 
ATOM   6    C  CG  . PRO A 1 6   ? 68.28145 23.99687  24.99487  1.000 146.97564 ? 6   PRO C CG  1 
ATOM   7    C  CD  . PRO A 1 6   ? 68.12763 25.39254  25.52140  1.000 148.71903 ? 6   PRO C CD  1 
ATOM   8    N  N   . ASP A 1 7   ? 64.66467 25.32674  22.25644  1.000 160.21708 ? 7   ASP C N   1 
ATOM   9    C  CA  . ASP A 1 7   ? 63.23896 25.34002  21.94557  1.000 159.14375 ? 7   ASP C CA  1 
ATOM   10   C  C   . ASP A 1 7   ? 62.63515 23.94042  21.95046  1.000 153.60640 ? 7   ASP C C   1 
ATOM   11   O  O   . ASP A 1 7   ? 61.42003 23.80099  21.77013  1.000 152.82634 ? 7   ASP C O   1 
ATOM   12   C  CB  . ASP A 1 7   ? 63.00636 26.00890  20.59101  1.000 161.52801 ? 7   ASP C CB  1 
ATOM   13   C  CG  . ASP A 1 7   ? 63.52319 27.42850  20.55899  1.000 164.81969 ? 7   ASP C CG  1 
ATOM   14   O  OD1 . ASP A 1 7   ? 63.67259 28.02237  21.64728  1.000 166.86664 ? 7   ASP C OD1 1 
ATOM   15   O  OD2 . ASP A 1 7   ? 63.79213 27.94497  19.45525  1.000 165.53637 ? 7   ASP C OD2 1 
ATOM   16   N  N   . GLN A 1 8   ? 63.46523 22.91425  22.15948  1.000 152.15664 ? 8   GLN C N   1 
ATOM   17   C  CA  . GLN A 1 8   ? 63.00190 21.53367  22.20882  1.000 148.58182 ? 8   GLN C CA  1 
ATOM   18   C  C   . GLN A 1 8   ? 62.15355 21.26049  23.44196  1.000 147.89093 ? 8   GLN C C   1 
ATOM   19   O  O   . GLN A 1 8   ? 61.27998 20.38637  23.40531  1.000 147.81606 ? 8   GLN C O   1 
ATOM   20   C  CB  . GLN A 1 8   ? 64.20323 20.59395  22.20440  1.000 143.74858 ? 8   GLN C CB  1 
ATOM   21   C  CG  . GLN A 1 8   ? 65.25185 20.94410  21.17360  1.000 138.48584 ? 8   GLN C CG  1 
ATOM   22   C  CD  . GLN A 1 8   ? 66.47310 20.05310  21.26433  1.000 132.86908 ? 8   GLN C CD  1 
ATOM   23   O  OE1 . GLN A 1 8   ? 67.51285 20.34930  20.67608  1.000 131.24833 ? 8   GLN C OE1 1 
ATOM   24   N  NE2 . GLN A 1 8   ? 66.35730 18.95786  22.00983  1.000 130.33401 ? 8   GLN C NE2 1 
ATOM   25   N  N   . ARG A 1 9   ? 62.40761 21.97228  24.54386  1.000 148.68589 ? 9   ARG C N   1 
ATOM   26   C  CA  . ARG A 1 9   ? 61.63235 21.75750  25.76254  1.000 149.89175 ? 9   ARG C CA  1 
ATOM   27   C  C   . ARG A 1 9   ? 60.16277 22.09128  25.55405  1.000 155.70889 ? 9   ARG C C   1 
ATOM   28   O  O   . ARG A 1 9   ? 59.28910 21.45228  26.15275  1.000 157.02228 ? 9   ARG C O   1 
ATOM   29   C  CB  . ARG A 1 9   ? 62.21154 22.58946  26.90933  1.000 149.17578 ? 9   ARG C CB  1 
ATOM   30   C  CG  . ARG A 1 9   ? 62.34683 24.08412  26.61353  1.000 148.97419 ? 9   ARG C CG  1 
ATOM   31   C  CD  . ARG A 1 9   ? 63.19493 24.76380  27.67401  1.000 148.46150 ? 9   ARG C CD  1 
ATOM   32   N  NE  . ARG A 1 9   ? 64.40608 23.99274  27.93453  1.000 146.94819 ? 9   ARG C NE  1 
ATOM   33   C  CZ  . ARG A 1 9   ? 65.24880 24.23355  28.93169  1.000 146.80170 ? 9   ARG C CZ  1 
ATOM   34   N  NH1 . ARG A 1 9   ? 65.01957 25.23416  29.77412  1.000 147.44483 ? 9   ARG C NH1 1 
ATOM   35   N  NH2 . ARG A 1 9   ? 66.32272 23.46926  29.08809  1.000 145.74499 ? 9   ARG C NH2 1 
ATOM   36   N  N   . SER A 1 10  ? 59.87242 23.09352  24.72241  1.000 159.99993 ? 10  SER C N   1 
ATOM   37   C  CA  . SER A 1 10  ? 58.48528 23.41819  24.41121  1.000 163.32048 ? 10  SER C CA  1 
ATOM   38   C  C   . SER A 1 10  ? 57.82955 22.31609  23.58435  1.000 165.90406 ? 10  SER C C   1 
ATOM   39   O  O   . SER A 1 10  ? 56.66036 21.97852  23.80912  1.000 168.56053 ? 10  SER C O   1 
ATOM   40   C  CB  . SER A 1 10  ? 58.41488 24.76221  23.68622  1.000 162.90414 ? 10  SER C CB  1 
ATOM   41   O  OG  . SER A 1 10  ? 59.06934 25.77397  24.43532  1.000 163.06623 ? 10  SER C OG  1 
ATOM   42   N  N   . LYS A 1 11  ? 58.56673 21.73580  22.63059  1.000 155.24495 ? 11  LYS C N   1 
ATOM   43   C  CA  . LYS A 1 11  ? 58.03292 20.64297  21.82387  1.000 144.95995 ? 11  LYS C CA  1 
ATOM   44   C  C   . LYS A 1 11  ? 57.81459 19.36390  22.62295  1.000 142.59255 ? 11  LYS C C   1 
ATOM   45   O  O   . LYS A 1 11  ? 57.16683 18.44700  22.11478  1.000 137.31450 ? 11  LYS C O   1 
ATOM   46   C  CB  . LYS A 1 11  ? 58.96113 20.35068  20.64419  1.000 134.88671 ? 11  LYS C CB  1 
ATOM   47   C  CG  . LYS A 1 11  ? 58.23060 19.84350  19.41526  1.000 129.27529 ? 11  LYS C CG  1 
ATOM   48   C  CD  . LYS A 1 11  ? 59.19874 19.36275  18.35504  1.000 123.93422 ? 11  LYS C CD  1 
ATOM   49   C  CE  . LYS A 1 11  ? 60.26370 20.39118  18.04408  1.000 120.77546 ? 11  LYS C CE  1 
ATOM   50   N  NZ  . LYS A 1 11  ? 61.31387 19.77836  17.18610  1.000 118.93945 ? 11  LYS C NZ  1 
ATOM   51   N  N   . PHE A 1 12  ? 58.36686 19.26495  23.83463  1.000 146.97315 ? 12  PHE C N   1 
ATOM   52   C  CA  . PHE A 1 12  ? 58.09283 18.13584  24.72108  1.000 153.05392 ? 12  PHE C CA  1 
ATOM   53   C  C   . PHE A 1 12  ? 56.76904 18.29869  25.45565  1.000 165.03176 ? 12  PHE C C   1 
ATOM   54   O  O   . PHE A 1 12  ? 56.12143 17.30268  25.80157  1.000 173.84918 ? 12  PHE C O   1 
ATOM   55   C  CB  . PHE A 1 12  ? 59.22607 17.97750  25.73769  1.000 138.33399 ? 12  PHE C CB  1 
ATOM   56   C  CG  . PHE A 1 12  ? 59.05768 16.80381  26.66878  1.000 128.71195 ? 12  PHE C CG  1 
ATOM   57   C  CD1 . PHE A 1 12  ? 59.54724 15.55514  26.32978  1.000 122.49546 ? 12  PHE C CD1 1 
ATOM   58   C  CD2 . PHE A 1 12  ? 58.42293 16.95779  27.89341  1.000 124.61431 ? 12  PHE C CD2 1 
ATOM   59   C  CE1 . PHE A 1 12  ? 59.39760 14.47987  27.18765  1.000 120.18265 ? 12  PHE C CE1 1 
ATOM   60   C  CE2 . PHE A 1 12  ? 58.26904 15.88795  28.75239  1.000 122.64462 ? 12  PHE C CE2 1 
ATOM   61   C  CZ  . PHE A 1 12  ? 58.75871 14.64692  28.39968  1.000 120.19349 ? 12  PHE C CZ  1 
ATOM   62   N  N   . GLU A 1 13  ? 56.37323 19.54471  25.71545  1.000 168.03554 ? 13  GLU C N   1 
ATOM   63   C  CA  . GLU A 1 13  ? 55.18984 19.81393  26.52343  1.000 171.39830 ? 13  GLU C CA  1 
ATOM   64   C  C   . GLU A 1 13  ? 53.91852 19.28595  25.86655  1.000 169.53128 ? 13  GLU C C   1 
ATOM   65   O  O   . GLU A 1 13  ? 53.02240 18.78522  26.55640  1.000 171.43958 ? 13  GLU C O   1 
ATOM   66   C  CB  . GLU A 1 13  ? 55.09529 21.31871  26.76433  1.000 177.44314 ? 13  GLU C CB  1 
ATOM   67   C  CG  . GLU A 1 13  ? 56.21800 21.85204  27.64400  1.000 177.78019 ? 13  GLU C CG  1 
ATOM   68   C  CD  . GLU A 1 13  ? 56.10927 23.34033  27.90200  1.000 180.56008 ? 13  GLU C CD  1 
ATOM   69   O  OE1 . GLU A 1 13  ? 55.14186 23.96442  27.41803  1.000 182.66304 ? 13  GLU C OE1 1 
ATOM   70   O  OE2 . GLU A 1 13  ? 57.00753 23.89046  28.57194  1.000 181.06580 ? 13  GLU C OE2 1 
ATOM   71   N  N   . ASN A 1 14  ? 53.81233 19.39724  24.54224  1.000 169.38053 ? 14  ASN C N   1 
ATOM   72   C  CA  . ASN A 1 14  ? 52.63553 18.88328  23.85785  1.000 167.87136 ? 14  ASN C CA  1 
ATOM   73   C  C   . ASN A 1 14  ? 52.59329 17.35858  23.95390  1.000 164.47527 ? 14  ASN C C   1 
ATOM   74   O  O   . ASN A 1 14  ? 53.58641 16.69675  24.27411  1.000 167.06521 ? 14  ASN C O   1 
ATOM   75   C  CB  . ASN A 1 14  ? 52.59883 19.34660  22.39607  1.000 158.87738 ? 14  ASN C CB  1 
ATOM   76   C  CG  . ASN A 1 14  ? 53.69680 18.73351  21.55538  1.000 150.31172 ? 14  ASN C CG  1 
ATOM   77   O  OD1 . ASN A 1 14  ? 54.64435 18.16502  22.08362  1.000 145.01327 ? 14  ASN C OD1 1 
ATOM   78   N  ND2 . ASN A 1 14  ? 53.57606 18.85275  20.23610  1.000 147.13303 ? 14  ASN C ND2 1 
ATOM   79   N  N   . GLU A 1 15  ? 51.42035 16.80296  23.66831  1.000 159.93271 ? 15  GLU C N   1 
ATOM   80   C  CA  . GLU A 1 15  ? 51.18223 15.37707  23.83763  1.000 155.30522 ? 15  GLU C CA  1 
ATOM   81   C  C   . GLU A 1 15  ? 51.44046 14.63953  22.53066  1.000 146.20581 ? 15  GLU C C   1 
ATOM   82   O  O   . GLU A 1 15  ? 50.99081 15.07495  21.46435  1.000 145.44084 ? 15  GLU C O   1 
ATOM   83   C  CB  . GLU A 1 15  ? 49.75421 15.12887  24.32755  1.000 160.05662 ? 15  GLU C CB  1 
ATOM   84   C  CG  . GLU A 1 15  ? 49.45082 15.78347  25.67635  1.000 161.93678 ? 15  GLU C CG  1 
ATOM   85   C  CD  . GLU A 1 15  ? 50.51192 15.48801  26.73335  1.000 161.09680 ? 15  GLU C CD  1 
ATOM   86   O  OE1 . GLU A 1 15  ? 50.95041 14.32215  26.83959  1.000 159.22577 ? 15  GLU C OE1 1 
ATOM   87   O  OE2 . GLU A 1 15  ? 50.91074 16.42509  27.45894  1.000 161.09806 ? 15  GLU C OE2 1 
ATOM   88   N  N   . GLU A 1 16  ? 52.17356 13.52841  22.62522  1.000 137.80360 ? 16  GLU C N   1 
ATOM   89   C  CA  . GLU A 1 16  ? 52.51921 12.68758  21.48116  1.000 128.33766 ? 16  GLU C CA  1 
ATOM   90   C  C   . GLU A 1 16  ? 53.24772 13.50830  20.41135  1.000 122.63043 ? 16  GLU C C   1 
ATOM   91   O  O   . GLU A 1 16  ? 52.80049 13.63348  19.26890  1.000 125.03322 ? 16  GLU C O   1 
ATOM   92   C  CB  . GLU A 1 16  ? 51.24757 12.02505  20.92264  1.000 124.57259 ? 16  GLU C CB  1 
ATOM   93   C  CG  . GLU A 1 16  ? 51.40156 10.61778  20.33868  1.000 118.57813 ? 16  GLU C CG  1 
ATOM   94   C  CD  . GLU A 1 16  ? 50.08435 9.83224   20.32170  1.000 114.79144 ? 16  GLU C CD  1 
ATOM   95   O  OE1 . GLU A 1 16  ? 49.14884 10.20371  21.06364  1.000 115.19134 ? 16  GLU C OE1 1 
ATOM   96   O  OE2 . GLU A 1 16  ? 49.98369 8.84058   19.56773  1.000 111.92943 ? 16  GLU C OE2 1 
ATOM   97   N  N   . PHE A 1 17  ? 54.39886 14.06968  20.80789  1.000 114.31903 ? 17  PHE C N   1 
ATOM   98   C  CA  . PHE A 1 17  ? 55.24068 14.79138  19.85250  1.000 108.91829 ? 17  PHE C CA  1 
ATOM   99   C  C   . PHE A 1 17  ? 55.93457 13.84967  18.87610  1.000 105.50246 ? 17  PHE C C   1 
ATOM   100  O  O   . PHE A 1 17  ? 56.21404 14.23498  17.73470  1.000 107.68782 ? 17  PHE C O   1 
ATOM   101  C  CB  . PHE A 1 17  ? 56.28216 15.64911  20.57164  1.000 106.05806 ? 17  PHE C CB  1 
ATOM   102  C  CG  . PHE A 1 17  ? 57.27213 14.86484  21.38079  1.000 104.66834 ? 17  PHE C CG  1 
ATOM   103  C  CD1 . PHE A 1 17  ? 56.96694 14.43819  22.66280  1.000 104.28996 ? 17  PHE C CD1 1 
ATOM   104  C  CD2 . PHE A 1 17  ? 58.51932 14.56096  20.85488  1.000 104.21039 ? 17  PHE C CD2 1 
ATOM   105  C  CE1 . PHE A 1 17  ? 57.88631 13.72476  23.40306  1.000 103.36907 ? 17  PHE C CE1 1 
ATOM   106  C  CE2 . PHE A 1 17  ? 59.44185 13.84524  21.59027  1.000 103.11912 ? 17  PHE C CE2 1 
ATOM   107  C  CZ  . PHE A 1 17  ? 59.12535 13.42700  22.86489  1.000 102.86474 ? 17  PHE C CZ  1 
ATOM   108  N  N   . PHE A 1 18  ? 56.24320 12.63419  19.31719  1.000 99.68752  ? 18  PHE C N   1 
ATOM   109  C  CA  . PHE A 1 18  ? 56.74039 11.55945  18.46927  1.000 92.76563  ? 18  PHE C CA  1 
ATOM   110  C  C   . PHE A 1 18  ? 55.59245 10.57801  18.28999  1.000 91.90006  ? 18  PHE C C   1 
ATOM   111  O  O   . PHE A 1 18  ? 55.08691 10.03098  19.27578  1.000 92.98067  ? 18  PHE C O   1 
ATOM   112  C  CB  . PHE A 1 18  ? 57.95207 10.88348  19.11601  1.000 89.65096  ? 18  PHE C CB  1 
ATOM   113  C  CG  . PHE A 1 18  ? 58.59362 9.82217   18.26450  1.000 87.00662  ? 18  PHE C CG  1 
ATOM   114  C  CD1 . PHE A 1 18  ? 59.53833 10.15878  17.30854  1.000 85.03679  ? 18  PHE C CD1 1 
ATOM   115  C  CD2 . PHE A 1 18  ? 58.26227 8.48495   18.42718  1.000 86.22279  ? 18  PHE C CD2 1 
ATOM   116  C  CE1 . PHE A 1 18  ? 60.13058 9.18877   16.52159  1.000 82.85989  ? 18  PHE C CE1 1 
ATOM   117  C  CE2 . PHE A 1 18  ? 58.85028 7.50886   17.64359  1.000 84.03302  ? 18  PHE C CE2 1 
ATOM   118  C  CZ  . PHE A 1 18  ? 59.78496 7.86236   16.69048  1.000 83.31226  ? 18  PHE C CZ  1 
ATOM   119  N  N   . ARG A 1 19  ? 55.19605 10.34156  17.04069  1.000 89.98577  ? 19  ARG C N   1 
ATOM   120  C  CA  . ARG A 1 19  ? 53.93352 9.65458   16.78246  1.000 89.48146  ? 19  ARG C CA  1 
ATOM   121  C  C   . ARG A 1 19  ? 53.91941 8.23753   17.35051  1.000 90.03600  ? 19  ARG C C   1 
ATOM   122  O  O   . ARG A 1 19  ? 54.95665 7.58437   17.49217  1.000 89.04356  ? 19  ARG C O   1 
ATOM   123  C  CB  . ARG A 1 19  ? 53.63227 9.63020   15.28093  1.000 87.05480  ? 19  ARG C CB  1 
ATOM   124  C  CG  . ARG A 1 19  ? 53.19400 10.97319  14.73413  1.000 84.11703  ? 19  ARG C CG  1 
ATOM   125  C  CD  . ARG A 1 19  ? 53.19779 11.04398  13.21562  1.000 82.12161  ? 19  ARG C CD  1 
ATOM   126  N  NE  . ARG A 1 19  ? 52.87158 12.39203  12.75266  1.000 82.94364  ? 19  ARG C NE  1 
ATOM   127  C  CZ  . ARG A 1 19  ? 53.65952 13.45755  12.86489  1.000 82.36033  ? 19  ARG C CZ  1 
ATOM   128  N  NH1 . ARG A 1 19  ? 53.24405 14.63129  12.41551  1.000 82.80444  ? 19  ARG C NH1 1 
ATOM   129  N  NH2 . ARG A 1 19  ? 54.85472 13.35776  13.42481  1.000 82.05275  ? 19  ARG C NH2 1 
ATOM   130  N  N   . LYS A 1 20  ? 52.71485 7.78885   17.71244  1.000 89.70805  ? 20  LYS C N   1 
ATOM   131  C  CA  . LYS A 1 20  ? 52.39362 6.47069   18.24699  1.000 88.83103  ? 20  LYS C CA  1 
ATOM   132  C  C   . LYS A 1 20  ? 52.91793 6.27576   19.66423  1.000 90.43902  ? 20  LYS C C   1 
ATOM   133  O  O   . LYS A 1 20  ? 52.68292 5.21519   20.25181  1.000 91.62407  ? 20  LYS C O   1 
ATOM   134  C  CB  . LYS A 1 20  ? 52.90166 5.32375   17.35479  1.000 85.41468  ? 20  LYS C CB  1 
ATOM   135  C  CG  . LYS A 1 20  ? 52.27274 5.31679   15.96357  1.000 85.17284  ? 20  LYS C CG  1 
ATOM   136  C  CD  . LYS A 1 20  ? 50.75178 5.25815   16.05576  1.000 87.25886  ? 20  LYS C CD  1 
ATOM   137  C  CE  . LYS A 1 20  ? 50.08031 5.46568   14.69625  1.000 88.65771  ? 20  LYS C CE  1 
ATOM   138  N  NZ  . LYS A 1 20  ? 48.58112 5.44266   14.75657  1.000 90.86532  ? 20  LYS C NZ  1 
ATOM   139  N  N   . LEU A 1 21  ? 53.62044 7.25796   20.22758  1.000 92.91839  ? 21  LEU C N   1 
ATOM   140  C  CA  . LEU A 1 21  ? 54.21497 7.17577   21.55611  1.000 96.79384  ? 21  LEU C CA  1 
ATOM   141  C  C   . LEU A 1 21  ? 53.67511 8.28609   22.44350  1.000 102.53839 ? 21  LEU C C   1 
ATOM   142  O  O   . LEU A 1 21  ? 53.82903 9.47160   22.12744  1.000 101.67767 ? 21  LEU C O   1 
ATOM   143  C  CB  . LEU A 1 21  ? 55.74160 7.28356   21.49453  1.000 94.74719  ? 21  LEU C CB  1 
ATOM   144  C  CG  . LEU A 1 21  ? 56.44740 7.25110   22.85440  1.000 93.32556  ? 21  LEU C CG  1 
ATOM   145  C  CD1 . LEU A 1 21  ? 56.06008 5.99111   23.59757  1.000 93.59609  ? 21  LEU C CD1 1 
ATOM   146  C  CD2 . LEU A 1 21  ? 57.95469 7.32692   22.70085  1.000 91.05163  ? 21  LEU C CD2 1 
ATOM   147  N  N   . SER A 1 22  ? 53.10443 7.90547   23.57679  1.000 109.50280 ? 22  SER C N   1 
ATOM   148  C  CA  . SER A 1 22  ? 52.47419 8.85352   24.47783  1.000 115.29003 ? 22  SER C CA  1 
ATOM   149  C  C   . SER A 1 22  ? 53.40610 9.10708   25.65299  1.000 119.01256 ? 22  SER C C   1 
ATOM   150  O  O   . SER A 1 22  ? 54.31150 8.31717   25.93635  1.000 118.54730 ? 22  SER C O   1 
ATOM   151  C  CB  . SER A 1 22  ? 51.12864 8.32037   24.97510  1.000 118.39168 ? 22  SER C CB  1 
ATOM   152  O  OG  . SER A 1 22  ? 51.31020 7.16921   25.78198  1.000 119.46731 ? 22  SER C OG  1 
ATOM   153  N  N   . ARG A 1 23  ? 53.19446 10.24706  26.31583  1.000 121.22553 ? 23  ARG C N   1 
ATOM   154  C  CA  . ARG A 1 23  ? 54.11141 10.66595  27.37122  1.000 123.41104 ? 23  ARG C CA  1 
ATOM   155  C  C   . ARG A 1 23  ? 54.17758 9.63832   28.49359  1.000 120.06475 ? 23  ARG C C   1 
ATOM   156  O  O   . ARG A 1 23  ? 55.25807 9.37065   29.02485  1.000 116.69389 ? 23  ARG C O   1 
ATOM   157  C  CB  . ARG A 1 23  ? 53.71112 12.03684  27.90829  1.000 130.00450 ? 23  ARG C CB  1 
ATOM   158  C  CG  . ARG A 1 23  ? 54.25982 13.18125  27.07929  1.000 137.30115 ? 23  ARG C CG  1 
ATOM   159  C  CD  . ARG A 1 23  ? 54.00723 14.51635  27.75625  1.000 145.09572 ? 23  ARG C CD  1 
ATOM   160  N  NE  . ARG A 1 23  ? 54.69064 14.62423  29.04263  1.000 147.14948 ? 23  ARG C NE  1 
ATOM   161  C  CZ  . ARG A 1 23  ? 54.44281 15.57433  29.94218  1.000 150.86919 ? 23  ARG C CZ  1 
ATOM   162  N  NH1 . ARG A 1 23  ? 53.51933 16.50022  29.70368  1.000 153.80413 ? 23  ARG C NH1 1 
ATOM   163  N  NH2 . ARG A 1 23  ? 55.11388 15.59721  31.08627  1.000 150.88458 ? 23  ARG C NH2 1 
ATOM   164  N  N   . GLU A 1 24  ? 53.04068 9.05106   28.86542  1.000 122.34446 ? 24  GLU C N   1 
ATOM   165  C  CA  . GLU A 1 24  ? 53.01177 7.83936   29.67453  1.000 123.13645 ? 24  GLU C CA  1 
ATOM   166  C  C   . GLU A 1 24  ? 52.33831 6.73654   28.86181  1.000 121.33431 ? 24  GLU C C   1 
ATOM   167  O  O   . GLU A 1 24  ? 51.41615 7.00764   28.08609  1.000 122.80947 ? 24  GLU C O   1 
ATOM   168  C  CB  . GLU A 1 24  ? 52.27604 8.07621   31.00626  1.000 127.82231 ? 24  GLU C CB  1 
ATOM   169  C  CG  . GLU A 1 24  ? 52.73278 7.18050   32.15844  1.000 130.15365 ? 24  GLU C CG  1 
ATOM   170  C  CD  . GLU A 1 24  ? 51.98474 5.85519   32.22579  1.000 134.23610 ? 24  GLU C CD  1 
ATOM   171  O  OE1 . GLU A 1 24  ? 50.90216 5.73940   31.61300  1.000 135.45854 ? 24  GLU C OE1 1 
ATOM   172  O  OE2 . GLU A 1 24  ? 52.47910 4.92528   32.89890  1.000 134.15986 ? 24  GLU C OE2 1 
ATOM   173  N  N   . CYS A 1 25  ? 52.79686 5.49118   29.02255  1.000 116.78083 ? 25  CYS C N   1 
ATOM   174  C  CA  . CYS A 1 25  ? 52.22749 4.40009   28.23296  1.000 113.81609 ? 25  CYS C CA  1 
ATOM   175  C  C   . CYS A 1 25  ? 52.44467 3.04911   28.90689  1.000 108.83993 ? 25  CYS C C   1 
ATOM   176  O  O   . CYS A 1 25  ? 53.39542 2.86168   29.67004  1.000 107.77651 ? 25  CYS C O   1 
ATOM   177  C  CB  . CYS A 1 25  ? 52.82114 4.36227   26.82037  1.000 115.06540 ? 25  CYS C CB  1 
ATOM   178  S  SG  . CYS A 1 25  ? 54.62561 4.26044   26.75464  1.000 115.92425 ? 25  CYS C SG  1 
ATOM   179  N  N   . GLU A 1 26  ? 51.54660 2.11069   28.60136  1.000 105.80824 ? 26  GLU C N   1 
ATOM   180  C  CA  . GLU A 1 26  ? 51.61576 0.74083   29.10095  1.000 103.47709 ? 26  GLU C CA  1 
ATOM   181  C  C   . GLU A 1 26  ? 52.36390 -0.13680  28.10364  1.000 99.69164  ? 26  GLU C C   1 
ATOM   182  O  O   . GLU A 1 26  ? 52.11016 -0.06713  26.89704  1.000 101.29272 ? 26  GLU C O   1 
ATOM   183  C  CB  . GLU A 1 26  ? 50.21344 0.18084   29.34204  1.000 106.35882 ? 26  GLU C CB  1 
ATOM   184  C  CG  . GLU A 1 26  ? 50.17374 -1.31675  29.61354  1.000 107.97046 ? 26  GLU C CG  1 
ATOM   185  C  CD  . GLU A 1 26  ? 48.76022 -1.83486  29.80606  1.000 112.85909 ? 26  GLU C CD  1 
ATOM   186  O  OE1 . GLU A 1 26  ? 47.91261 -1.07509  30.32206  1.000 118.84233 ? 26  GLU C OE1 1 
ATOM   187  O  OE2 . GLU A 1 26  ? 48.49262 -2.99444  29.42249  1.000 111.64428 ? 26  GLU C OE2 1 
ATOM   188  N  N   . ILE A 1 27  ? 53.30489 -0.93904  28.60116  1.000 93.77881  ? 27  ILE C N   1 
ATOM   189  C  CA  . ILE A 1 27  ? 54.13024 -1.78106  27.74347  1.000 87.20155  ? 27  ILE C CA  1 
ATOM   190  C  C   . ILE A 1 27  ? 53.93807 -3.24466  28.10758  1.000 83.57324  ? 27  ILE C C   1 
ATOM   191  O  O   . ILE A 1 27  ? 53.65129 -3.59654  29.25699  1.000 84.29644  ? 27  ILE C O   1 
ATOM   192  C  CB  . ILE A 1 27  ? 55.62429 -1.41997  27.82760  1.000 85.33320  ? 27  ILE C CB  1 
ATOM   193  C  CG1 . ILE A 1 27  ? 56.11661 -1.59497  29.25953  1.000 83.80140  ? 27  ILE C CG1 1 
ATOM   194  C  CG2 . ILE A 1 27  ? 55.86310 -0.00220  27.32392  1.000 87.17584  ? 27  ILE C CG2 1 
ATOM   195  C  CD1 . ILE A 1 27  ? 57.55844 -1.24257  29.44291  1.000 83.29641  ? 27  ILE C CD1 1 
ATOM   196  N  N   . LYS A 1 28  ? 54.10766 -4.10313  27.10854  1.000 82.29977  ? 28  LYS C N   1 
ATOM   197  C  CA  . LYS A 1 28  ? 54.05326 -5.54208  27.29785  1.000 83.65960  ? 28  LYS C CA  1 
ATOM   198  C  C   . LYS A 1 28  ? 55.29758 -6.16311  26.68360  1.000 84.52187  ? 28  LYS C C   1 
ATOM   199  O  O   . LYS A 1 28  ? 56.01500 -5.53714  25.90290  1.000 82.38117  ? 28  LYS C O   1 
ATOM   200  C  CB  . LYS A 1 28  ? 52.78988 -6.17019  26.67934  1.000 85.21932  ? 28  LYS C CB  1 
ATOM   201  C  CG  . LYS A 1 28  ? 51.55071 -6.11958  27.57014  1.000 86.05766  ? 28  LYS C CG  1 
ATOM   202  C  CD  . LYS A 1 28  ? 50.40738 -6.96503  27.01134  1.000 87.76635  ? 28  LYS C CD  1 
ATOM   203  C  CE  . LYS A 1 28  ? 49.45484 -6.13521  26.17419  1.000 90.20496  ? 28  LYS C CE  1 
ATOM   204  N  NZ  . LYS A 1 28  ? 48.78232 -5.10769  27.01484  1.000 92.45398  ? 28  LYS C NZ  1 
ATOM   205  N  N   . TYR A 1 29  ? 55.54645 -7.41138  27.04512  1.000 88.08288  ? 29  TYR C N   1 
ATOM   206  C  CA  . TYR A 1 29  ? 56.58782 -8.21406  26.41939  1.000 90.09302  ? 29  TYR C CA  1 
ATOM   207  C  C   . TYR A 1 29  ? 55.87288 -9.09342  25.40681  1.000 96.31967  ? 29  TYR C C   1 
ATOM   208  O  O   . TYR A 1 29  ? 55.30199 -10.12721 25.75915  1.000 99.55737  ? 29  TYR C O   1 
ATOM   209  C  CB  . TYR A 1 29  ? 57.34787 -9.04525  27.44995  1.000 83.64881  ? 29  TYR C CB  1 
ATOM   210  C  CG  . TYR A 1 29  ? 58.26489 -10.11260 26.86754  1.000 77.33700  ? 29  TYR C CG  1 
ATOM   211  C  CD1 . TYR A 1 29  ? 59.51731 -9.78889  26.36026  1.000 71.05963  ? 29  TYR C CD1 1 
ATOM   212  C  CD2 . TYR A 1 29  ? 57.87803 -11.44573 26.83511  1.000 76.54547  ? 29  TYR C CD2 1 
ATOM   213  C  CE1 . TYR A 1 29  ? 60.35088 -10.75833 25.84000  1.000 69.10556  ? 29  TYR C CE1 1 
ATOM   214  C  CE2 . TYR A 1 29  ? 58.70385 -12.41854 26.30980  1.000 73.90219  ? 29  TYR C CE2 1 
ATOM   215  C  CZ  . TYR A 1 29  ? 59.93243 -12.07410 25.81656  1.000 71.58540  ? 29  TYR C CZ  1 
ATOM   216  O  OH  . TYR A 1 29  ? 60.73402 -13.06806 25.30461  1.000 74.18915  ? 29  TYR C OH  1 
ATOM   217  N  N   . THR A 1 30  ? 55.84390 -8.65463  24.15644  1.000 99.17985  ? 30  THR C N   1 
ATOM   218  C  CA  . THR A 1 30  ? 55.32177 -9.52894  23.12703  1.000 101.76609 ? 30  THR C CA  1 
ATOM   219  C  C   . THR A 1 30  ? 56.42292 -10.48946 22.74374  1.000 103.68796 ? 30  THR C C   1 
ATOM   220  O  O   . THR A 1 30  ? 57.60358 -10.13151 22.72123  1.000 104.52131 ? 30  THR C O   1 
ATOM   221  C  CB  . THR A 1 30  ? 54.89554 -8.76807  21.87831  1.000 102.81927 ? 30  THR C CB  1 
ATOM   222  O  OG1 . THR A 1 30  ? 56.03471 -8.07553  21.35053  1.000 101.76961 ? 30  THR C OG1 1 
ATOM   223  C  CG2 . THR A 1 30  ? 53.77183 -7.77890  22.18837  1.000 104.68085 ? 30  THR C CG2 1 
ATOM   224  N  N   . GLY A 1 31  ? 56.02688 -11.70025 22.40128  1.000 103.44475 ? 31  GLY C N   1 
ATOM   225  C  CA  . GLY A 1 31  ? 56.99666 -12.72678 22.11689  1.000 101.75633 ? 31  GLY C CA  1 
ATOM   226  C  C   . GLY A 1 31  ? 56.56886 -14.03613 22.72281  1.000 100.73906 ? 31  GLY C C   1 
ATOM   227  O  O   . GLY A 1 31  ? 56.27369 -14.10318 23.91964  1.000 100.42048 ? 31  GLY C O   1 
ATOM   228  N  N   . PHE A 1 32  ? 56.54954 -15.08078 21.89812  1.000 101.28653 ? 32  PHE C N   1 
ATOM   229  C  CA  . PHE A 1 32  ? 56.02469 -16.38318 22.28744  1.000 102.54905 ? 32  PHE C CA  1 
ATOM   230  C  C   . PHE A 1 32  ? 54.58166 -16.26201 22.77429  1.000 107.46958 ? 32  PHE C C   1 
ATOM   231  O  O   . PHE A 1 32  ? 54.19696 -16.82782 23.79766  1.000 108.74232 ? 32  PHE C O   1 
ATOM   232  C  CB  . PHE A 1 32  ? 56.92682 -17.05051 23.32447  1.000 101.36042 ? 32  PHE C CB  1 
ATOM   233  C  CG  . PHE A 1 32  ? 58.36979 -17.06029 22.92798  1.000 99.94258  ? 32  PHE C CG  1 
ATOM   234  C  CD1 . PHE A 1 32  ? 58.81630 -17.93860 21.95694  1.000 100.76823 ? 32  PHE C CD1 1 
ATOM   235  C  CD2 . PHE A 1 32  ? 59.26938 -16.17675 23.48968  1.000 99.16367  ? 32  PHE C CD2 1 
ATOM   236  C  CE1 . PHE A 1 32  ? 60.13522 -17.95439 21.56945  1.000 100.60880 ? 32  PHE C CE1 1 
ATOM   237  C  CE2 . PHE A 1 32  ? 60.59358 -16.18400 23.10616  1.000 99.80485  ? 32  PHE C CE2 1 
ATOM   238  C  CZ  . PHE A 1 32  ? 61.02814 -17.07336 22.14516  1.000 100.45342 ? 32  PHE C CZ  1 
ATOM   239  N  N   . ARG A 1 33  ? 53.77792 -15.50309 22.01692  1.000 111.04723 ? 33  ARG C N   1 
ATOM   240  C  CA  . ARG A 1 33  ? 52.38139 -15.26788 22.38362  1.000 117.12935 ? 33  ARG C CA  1 
ATOM   241  C  C   . ARG A 1 33  ? 51.56615 -16.55408 22.38159  1.000 124.18150 ? 33  ARG C C   1 
ATOM   242  O  O   . ARG A 1 33  ? 50.59200 -16.66767 23.13475  1.000 126.44658 ? 33  ARG C O   1 
ATOM   243  C  CB  . ARG A 1 33  ? 51.74930 -14.25189 21.42685  1.000 117.67579 ? 33  ARG C CB  1 
ATOM   244  C  CG  . ARG A 1 33  ? 52.20366 -12.81476 21.63997  1.000 117.32960 ? 33  ARG C CG  1 
ATOM   245  C  CD  . ARG A 1 33  ? 51.69123 -11.85489 20.55153  1.000 119.01515 ? 33  ARG C CD  1 
ATOM   246  N  NE  . ARG A 1 33  ? 50.27875 -11.49750 20.65253  1.000 121.53116 ? 33  ARG C NE  1 
ATOM   247  C  CZ  . ARG A 1 33  ? 49.37764 -11.70132 19.69102  1.000 123.24334 ? 33  ARG C CZ  1 
ATOM   248  N  NH1 . ARG A 1 33  ? 49.73001 -12.26335 18.53900  1.000 123.74107 ? 33  ARG C NH1 1 
ATOM   249  N  NH2 . ARG A 1 33  ? 48.11861 -11.32811 19.87664  1.000 122.87442 ? 33  ARG C NH2 1 
ATOM   250  N  N   . ASP A 1 34  ? 51.92493 -17.52010 21.53108  1.000 128.67770 ? 34  ASP C N   1 
ATOM   251  C  CA  . ASP A 1 34  ? 51.18460 -18.77445 21.47895  1.000 136.73404 ? 34  ASP C CA  1 
ATOM   252  C  C   . ASP A 1 34  ? 51.58996 -19.75688 22.57308  1.000 138.17937 ? 34  ASP C C   1 
ATOM   253  O  O   . ASP A 1 34  ? 50.79314 -20.63505 22.91524  1.000 142.23525 ? 34  ASP C O   1 
ATOM   254  C  CB  . ASP A 1 34  ? 51.34570 -19.44055 20.10630  1.000 140.09275 ? 34  ASP C CB  1 
ATOM   255  C  CG  . ASP A 1 34  ? 52.78646 -19.77801 19.78098  1.000 140.69898 ? 34  ASP C CG  1 
ATOM   256  O  OD1 . ASP A 1 34  ? 53.69558 -19.21099 20.42496  1.000 139.68095 ? 34  ASP C OD1 1 
ATOM   257  O  OD2 . ASP A 1 34  ? 53.00692 -20.61295 18.87428  1.000 142.02294 ? 34  ASP C OD2 1 
ATOM   258  N  N   . ARG A 1 35  ? 52.78531 -19.62457 23.14654  1.000 137.85673 ? 35  ARG C N   1 
ATOM   259  C  CA  . ARG A 1 35  ? 53.24525 -20.59925 24.12884  1.000 138.75509 ? 35  ARG C CA  1 
ATOM   260  C  C   . ARG A 1 35  ? 52.63614 -20.32924 25.50421  1.000 133.27441 ? 35  ARG C C   1 
ATOM   261  O  O   . ARG A 1 35  ? 52.10162 -19.24522 25.75349  1.000 132.47573 ? 35  ARG C O   1 
ATOM   262  C  CB  . ARG A 1 35  ? 54.76944 -20.58183 24.22160  1.000 146.84214 ? 35  ARG C CB  1 
ATOM   263  C  CG  . ARG A 1 35  ? 55.49939 -20.92192 22.93749  1.000 156.01951 ? 35  ARG C CG  1 
ATOM   264  C  CD  . ARG A 1 35  ? 56.99665 -20.83454 23.16296  1.000 163.82829 ? 35  ARG C CD  1 
ATOM   265  N  NE  . ARG A 1 35  ? 57.79138 -21.12341 21.97288  1.000 172.09149 ? 35  ARG C NE  1 
ATOM   266  C  CZ  . ARG A 1 35  ? 59.11811 -21.22729 21.98153  1.000 179.88409 ? 35  ARG C CZ  1 
ATOM   267  N  NH1 . ARG A 1 35  ? 59.77879 -21.48296 20.86017  1.000 181.42408 ? 35  ARG C NH1 1 
ATOM   268  N  NH2 . ARG A 1 35  ? 59.78717 -21.07130 23.11746  1.000 182.49122 ? 35  ARG C NH2 1 
ATOM   269  N  N   . PRO A 1 36  ? 52.66652 -21.31206 26.40831  1.000 128.98074 ? 36  PRO C N   1 
ATOM   270  C  CA  . PRO A 1 36  ? 52.08234 -21.09344 27.73427  1.000 126.51962 ? 36  PRO C CA  1 
ATOM   271  C  C   . PRO A 1 36  ? 52.83810 -20.02621 28.50996  1.000 123.31809 ? 36  PRO C C   1 
ATOM   272  O  O   . PRO A 1 36  ? 54.01401 -19.74610 28.26329  1.000 120.92255 ? 36  PRO C O   1 
ATOM   273  C  CB  . PRO A 1 36  ? 52.19956 -22.46664 28.41269  1.000 126.18758 ? 36  PRO C CB  1 
ATOM   274  C  CG  . PRO A 1 36  ? 53.26660 -23.17560 27.66833  1.000 126.89214 ? 36  PRO C CG  1 
ATOM   275  C  CD  . PRO A 1 36  ? 53.12498 -22.70286 26.24728  1.000 129.43246 ? 36  PRO C CD  1 
ATOM   276  N  N   . HIS A 1 37  ? 52.13337 -19.44636 29.48591  1.000 113.03893 ? 37  HIS C N   1 
ATOM   277  C  CA  . HIS A 1 37  ? 52.67228 -18.32348 30.25065  1.000 114.78064 ? 37  HIS C CA  1 
ATOM   278  C  C   . HIS A 1 37  ? 53.88391 -18.73452 31.08412  1.000 115.90967 ? 37  HIS C C   1 
ATOM   279  O  O   . HIS A 1 37  ? 54.84803 -17.96915 31.20111  1.000 115.85619 ? 37  HIS C O   1 
ATOM   280  C  CB  . HIS A 1 37  ? 51.57984 -17.73973 31.14374  1.000 116.22046 ? 37  HIS C CB  1 
ATOM   281  C  CG  . HIS A 1 37  ? 52.00125 -16.51593 31.89112  1.000 119.93253 ? 37  HIS C CG  1 
ATOM   282  N  ND1 . HIS A 1 37  ? 52.08832 -15.27462 31.29940  1.000 121.14204 ? 37  HIS C ND1 1 
ATOM   283  C  CD2 . HIS A 1 37  ? 52.36991 -16.34432 33.18262  1.000 123.25747 ? 37  HIS C CD2 1 
ATOM   284  C  CE1 . HIS A 1 37  ? 52.48611 -14.38891 32.19589  1.000 122.58295 ? 37  HIS C CE1 1 
ATOM   285  N  NE2 . HIS A 1 37  ? 52.66508 -15.01263 33.34644  1.000 124.17655 ? 37  HIS C NE2 1 
ATOM   286  N  N   . GLU A 1 38  ? 53.84774 -19.93104 31.68325  1.000 117.57690 ? 38  GLU C N   1 
ATOM   287  C  CA  . GLU A 1 38  ? 54.98454 -20.40385 32.47105  1.000 120.62327 ? 38  GLU C CA  1 
ATOM   288  C  C   . GLU A 1 38  ? 56.25168 -20.48621 31.62604  1.000 118.80808 ? 38  GLU C C   1 
ATOM   289  O  O   . GLU A 1 38  ? 57.35680 -20.24179 32.12750  1.000 118.96444 ? 38  GLU C O   1 
ATOM   290  C  CB  . GLU A 1 38  ? 54.67255 -21.76715 33.09717  1.000 125.32359 ? 38  GLU C CB  1 
ATOM   291  C  CG  . GLU A 1 38  ? 55.89983 -22.47919 33.68872  1.000 128.87147 ? 38  GLU C CG  1 
ATOM   292  C  CD  . GLU A 1 38  ? 55.55763 -23.76157 34.43813  1.000 130.89067 ? 38  GLU C CD  1 
ATOM   293  O  OE1 . GLU A 1 38  ? 56.34811 -24.16095 35.32123  1.000 131.85019 ? 38  GLU C OE1 1 
ATOM   294  O  OE2 . GLU A 1 38  ? 54.50505 -24.37170 34.14614  1.000 130.68925 ? 38  GLU C OE2 1 
ATOM   295  N  N   . GLU A 1 39  ? 56.11314 -20.83669 30.34175  1.000 118.64676 ? 39  GLU C N   1 
ATOM   296  C  CA  . GLU A 1 39  ? 57.27384 -20.87369 29.45361  1.000 116.57790 ? 39  GLU C CA  1 
ATOM   297  C  C   . GLU A 1 39  ? 57.73708 -19.46387 29.10226  1.000 111.56814 ? 39  GLU C C   1 
ATOM   298  O  O   . GLU A 1 39  ? 58.94180 -19.20672 28.98926  1.000 109.18691 ? 39  GLU C O   1 
ATOM   299  C  CB  . GLU A 1 39  ? 56.94418 -21.66411 28.18507  1.000 118.65664 ? 39  GLU C CB  1 
ATOM   300  C  CG  . GLU A 1 39  ? 58.12223 -21.84163 27.23941  1.000 121.40967 ? 39  GLU C CG  1 
ATOM   301  C  CD  . GLU A 1 39  ? 57.73998 -22.53637 25.94356  1.000 126.00685 ? 39  GLU C CD  1 
ATOM   302  O  OE1 . GLU A 1 39  ? 56.54365 -22.84365 25.76393  1.000 127.77897 ? 39  GLU C OE1 1 
ATOM   303  O  OE2 . GLU A 1 39  ? 58.63295 -22.76696 25.09798  1.000 128.19722 ? 39  GLU C OE2 1 
ATOM   304  N  N   . ARG A 1 40  ? 56.78763 -18.54030 28.92937  1.000 107.30356 ? 40  ARG C N   1 
ATOM   305  C  CA  . ARG A 1 40  ? 57.12443 -17.15767 28.61258  1.000 102.77527 ? 40  ARG C CA  1 
ATOM   306  C  C   . ARG A 1 40  ? 57.90605 -16.50686 29.74933  1.000 101.95555 ? 40  ARG C C   1 
ATOM   307  O  O   . ARG A 1 40  ? 58.88673 -15.79448 29.50377  1.000 100.50151 ? 40  ARG C O   1 
ATOM   308  C  CB  . ARG A 1 40  ? 55.85288 -16.36969 28.30756  1.000 99.28863  ? 40  ARG C CB  1 
ATOM   309  C  CG  . ARG A 1 40  ? 55.17879 -16.78177 27.01247  1.000 98.57454  ? 40  ARG C CG  1 
ATOM   310  C  CD  . ARG A 1 40  ? 53.83257 -16.09158 26.82865  1.000 98.09736  ? 40  ARG C CD  1 
ATOM   311  N  NE  . ARG A 1 40  ? 53.88995 -14.66158 27.12425  1.000 97.49756  ? 40  ARG C NE  1 
ATOM   312  C  CZ  . ARG A 1 40  ? 54.07043 -13.71254 26.21360  1.000 95.51896  ? 40  ARG C CZ  1 
ATOM   313  N  NH1 . ARG A 1 40  ? 54.21548 -14.03535 24.93953  1.000 96.31001  ? 40  ARG C NH1 1 
ATOM   314  N  NH2 . ARG A 1 40  ? 54.10363 -12.43805 26.57683  1.000 94.33181  ? 40  ARG C NH2 1 
ATOM   315  N  N   . GLN A 1 41  ? 57.48556 -16.73289 31.00325  1.000 103.67697 ? 41  GLN C N   1 
ATOM   316  C  CA  . GLN A 1 41  ? 58.18796 -16.13103 32.13772  1.000 104.54079 ? 41  GLN C CA  1 
ATOM   317  C  C   . GLN A 1 41  ? 59.63978 -16.57528 32.20074  1.000 105.54551 ? 41  GLN C C   1 
ATOM   318  O  O   . GLN A 1 41  ? 60.50230 -15.80853 32.64028  1.000 104.91926 ? 41  GLN C O   1 
ATOM   319  C  CB  . GLN A 1 41  ? 57.50929 -16.50123 33.45651  1.000 107.24617 ? 41  GLN C CB  1 
ATOM   320  C  CG  . GLN A 1 41  ? 56.03818 -16.16723 33.57603  1.000 108.20034 ? 41  GLN C CG  1 
ATOM   321  C  CD  . GLN A 1 41  ? 55.40189 -16.83724 34.78258  1.000 110.18769 ? 41  GLN C CD  1 
ATOM   322  O  OE1 . GLN A 1 41  ? 55.68431 -17.99897 35.08815  1.000 111.44026 ? 41  GLN C OE1 1 
ATOM   323  N  NE2 . GLN A 1 41  ? 54.54291 -16.10594 35.47738  1.000 111.26400 ? 41  GLN C NE2 1 
ATOM   324  N  N   . ALA A 1 42  ? 59.92213 -17.81435 31.79096  1.000 107.82148 ? 42  ALA C N   1 
ATOM   325  C  CA  . ALA A 1 42  ? 61.29506 -18.30086 31.72365  1.000 109.09438 ? 42  ALA C CA  1 
ATOM   326  C  C   . ALA A 1 42  ? 62.02166 -17.77156 30.49449  1.000 112.11098 ? 42  ALA C C   1 
ATOM   327  O  O   . ALA A 1 42  ? 63.22643 -17.50389 30.55974  1.000 113.03811 ? 42  ALA C O   1 
ATOM   328  C  CB  . ALA A 1 42  ? 61.31907 -19.83146 31.73212  1.000 107.30847 ? 42  ALA C CB  1 
ATOM   329  N  N   . ARG A 1 43  ? 61.31048 -17.60375 29.37565  1.000 113.99844 ? 43  ARG C N   1 
ATOM   330  C  CA  . ARG A 1 43  ? 61.95114 -17.08490 28.17266  1.000 116.77115 ? 43  ARG C CA  1 
ATOM   331  C  C   . ARG A 1 43  ? 62.37543 -15.63449 28.36525  1.000 114.51498 ? 43  ARG C C   1 
ATOM   332  O  O   . ARG A 1 43  ? 63.48124 -15.24728 27.96906  1.000 115.14439 ? 43  ARG C O   1 
ATOM   333  C  CB  . ARG A 1 43  ? 61.00750 -17.20259 26.97243  1.000 120.93194 ? 43  ARG C CB  1 
ATOM   334  C  CG  . ARG A 1 43  ? 60.74707 -18.63082 26.51948  1.000 126.36262 ? 43  ARG C CG  1 
ATOM   335  C  CD  . ARG A 1 43  ? 61.89301 -19.27885 25.77601  1.000 131.99153 ? 43  ARG C CD  1 
ATOM   336  N  NE  . ARG A 1 43  ? 61.53476 -20.65156 25.42973  1.000 137.37503 ? 43  ARG C NE  1 
ATOM   337  C  CZ  . ARG A 1 43  ? 62.37214 -21.54355 24.91238  1.000 143.17492 ? 43  ARG C CZ  1 
ATOM   338  N  NH1 . ARG A 1 43  ? 63.63489 -21.21487 24.67450  1.000 143.84216 ? 43  ARG C NH1 1 
ATOM   339  N  NH2 . ARG A 1 43  ? 61.94646 -22.77016 24.63896  1.000 148.95726 ? 43  ARG C NH2 1 
ATOM   340  N  N   . PHE A 1 44  ? 61.51054 -14.81566 28.96965  1.000 112.13430 ? 44  PHE C N   1 
ATOM   341  C  CA  . PHE A 1 44  ? 61.86334 -13.41679 29.19558  1.000 110.33416 ? 44  PHE C CA  1 
ATOM   342  C  C   . PHE A 1 44  ? 62.93793 -13.26941 30.26498  1.000 112.45475 ? 44  PHE C C   1 
ATOM   343  O  O   . PHE A 1 44  ? 63.80731 -12.39649 30.15990  1.000 113.16263 ? 44  PHE C O   1 
ATOM   344  C  CB  . PHE A 1 44  ? 60.61984 -12.61452 29.58382  1.000 106.23911 ? 44  PHE C CB  1 
ATOM   345  C  CG  . PHE A 1 44  ? 60.92354 -11.22796 30.08761  1.000 102.05567 ? 44  PHE C CG  1 
ATOM   346  C  CD1 . PHE A 1 44  ? 61.13590 -10.18536 29.20439  1.000 98.28257  ? 44  PHE C CD1 1 
ATOM   347  C  CD2 . PHE A 1 44  ? 60.98989 -10.96843 31.44929  1.000 102.58338 ? 44  PHE C CD2 1 
ATOM   348  C  CE1 . PHE A 1 44  ? 61.41034 -8.91186  29.66374  1.000 97.49372  ? 44  PHE C CE1 1 
ATOM   349  C  CE2 . PHE A 1 44  ? 61.26721 -9.69647  31.91703  1.000 101.31594 ? 44  PHE C CE2 1 
ATOM   350  C  CZ  . PHE A 1 44  ? 61.47659 -8.66547  31.01842  1.000 99.38857  ? 44  PHE C CZ  1 
ATOM   351  N  N   . GLN A 1 45  ? 62.88080 -14.09060 31.31554  1.000 114.28982 ? 45  GLN C N   1 
ATOM   352  C  CA  . GLN A 1 45  ? 63.88778 -13.99762 32.36796  1.000 117.48128 ? 45  GLN C CA  1 
ATOM   353  C  C   . GLN A 1 45  ? 65.26195 -14.42224 31.86212  1.000 116.63498 ? 45  GLN C C   1 
ATOM   354  O  O   . GLN A 1 45  ? 66.26745 -13.76495 32.15475  1.000 117.93013 ? 45  GLN C O   1 
ATOM   355  C  CB  . GLN A 1 45  ? 63.47315 -14.82476 33.58239  1.000 119.31448 ? 45  GLN C CB  1 
ATOM   356  C  CG  . GLN A 1 45  ? 64.35528 -14.58283 34.78947  1.000 120.95227 ? 45  GLN C CG  1 
ATOM   357  C  CD  . GLN A 1 45  ? 63.94778 -15.40843 35.98479  1.000 124.06584 ? 45  GLN C CD  1 
ATOM   358  O  OE1 . GLN A 1 45  ? 63.80875 -16.62985 35.89285  1.000 125.69147 ? 45  GLN C OE1 1 
ATOM   359  N  NE2 . GLN A 1 45  ? 63.75240 -14.74638 37.12099  1.000 124.65848 ? 45  GLN C NE2 1 
ATOM   360  N  N   . ASN A 1 46  ? 65.33201 -15.52287 31.11239  1.000 115.98607 ? 46  ASN C N   1 
ATOM   361  C  CA  . ASN A 1 46  ? 66.62060 -15.94826 30.58020  1.000 115.17924 ? 46  ASN C CA  1 
ATOM   362  C  C   . ASN A 1 46  ? 67.14865 -14.95901 29.54917  1.000 112.40177 ? 46  ASN C C   1 
ATOM   363  O  O   . ASN A 1 46  ? 68.36376 -14.74792 29.46166  1.000 111.61819 ? 46  ASN C O   1 
ATOM   364  C  CB  . ASN A 1 46  ? 66.50110 -17.34202 29.96442  1.000 118.34509 ? 46  ASN C CB  1 
ATOM   365  C  CG  . ASN A 1 46  ? 66.17090 -18.40696 30.99309  1.000 121.07066 ? 46  ASN C CG  1 
ATOM   366  O  OD1 . ASN A 1 46  ? 65.71159 -18.10247 32.09492  1.000 122.27878 ? 46  ASN C OD1 1 
ATOM   367  N  ND2 . ASN A 1 46  ? 66.39351 -19.66733 30.63307  1.000 121.54647 ? 46  ASN C ND2 1 
ATOM   368  N  N   . ALA A 1 47  ? 66.25297 -14.32795 28.78164  1.000 109.57148 ? 47  ALA C N   1 
ATOM   369  C  CA  . ALA A 1 47  ? 66.68004 -13.41887 27.72141  1.000 106.51566 ? 47  ALA C CA  1 
ATOM   370  C  C   . ALA A 1 47  ? 67.42298 -12.21209 28.28106  1.000 105.43026 ? 47  ALA C C   1 
ATOM   371  O  O   . ALA A 1 47  ? 68.41062 -11.75846 27.69358  1.000 104.35834 ? 47  ALA C O   1 
ATOM   372  C  CB  . ALA A 1 47  ? 65.47277 -12.97296 26.90045  1.000 105.29405 ? 47  ALA C CB  1 
ATOM   373  N  N   . CYS A 1 48  ? 66.96953 -11.68138 29.42103  1.000 107.49667 ? 48  CYS C N   1 
ATOM   374  C  CA  . CYS A 1 48  ? 67.66675 -10.55145 30.02994  1.000 109.86399 ? 48  CYS C CA  1 
ATOM   375  C  C   . CYS A 1 48  ? 69.03587 -10.95386 30.56170  1.000 117.93316 ? 48  CYS C C   1 
ATOM   376  O  O   . CYS A 1 48  ? 69.94981 -10.11986 30.61145  1.000 119.37057 ? 48  CYS C O   1 
ATOM   377  C  CB  . CYS A 1 48  ? 66.83227 -9.95132  31.16197  1.000 105.39077 ? 48  CYS C CB  1 
ATOM   378  S  SG  . CYS A 1 48  ? 65.12219 -9.52918  30.75595  1.000 102.38723 ? 48  CYS C SG  1 
ATOM   379  N  N   . ARG A 1 49  ? 69.19873 -12.22017 30.95329  1.000 123.54927 ? 49  ARG C N   1 
ATOM   380  C  CA  . ARG A 1 49  ? 70.45130 -12.70116 31.52406  1.000 127.97236 ? 49  ARG C CA  1 
ATOM   381  C  C   . ARG A 1 49  ? 71.39450 -13.24411 30.46092  1.000 122.50069 ? 49  ARG C C   1 
ATOM   382  O  O   . ARG A 1 49  ? 72.60986 -13.05052 30.56656  1.000 122.08744 ? 49  ARG C O   1 
ATOM   383  C  CB  . ARG A 1 49  ? 70.19786 -13.78367 32.58390  1.000 138.51675 ? 49  ARG C CB  1 
ATOM   384  C  CG  . ARG A 1 49  ? 69.48937 -13.31812 33.85169  1.000 145.28763 ? 49  ARG C CG  1 
ATOM   385  C  CD  . ARG A 1 49  ? 70.45486 -12.50837 34.71726  1.000 149.70229 ? 49  ARG C CD  1 
ATOM   386  N  NE  . ARG A 1 49  ? 70.02854 -12.39731 36.11066  1.000 151.46454 ? 49  ARG C NE  1 
ATOM   387  C  CZ  . ARG A 1 49  ? 70.69943 -11.72525 37.04325  1.000 151.05722 ? 49  ARG C CZ  1 
ATOM   388  N  NH1 . ARG A 1 49  ? 71.82663 -11.09746 36.73258  1.000 149.91011 ? 49  ARG C NH1 1 
ATOM   389  N  NH2 . ARG A 1 49  ? 70.23989 -11.67605 38.28655  1.000 151.81778 ? 49  ARG C NH2 1 
ATOM   390  N  N   . ASP A 1 50  ? 70.86662 -13.90258 29.43009  1.000 118.71674 ? 50  ASP C N   1 
ATOM   391  C  CA  . ASP A 1 50  ? 71.73334 -14.51863 28.43527  1.000 115.53827 ? 50  ASP C CA  1 
ATOM   392  C  C   . ASP A 1 50  ? 72.56960 -13.44243 27.74882  1.000 113.66961 ? 50  ASP C C   1 
ATOM   393  O  O   . ASP A 1 50  ? 72.14493 -12.29350 27.60055  1.000 112.28563 ? 50  ASP C O   1 
ATOM   394  C  CB  . ASP A 1 50  ? 70.89681 -15.30306 27.41977  1.000 114.09343 ? 50  ASP C CB  1 
ATOM   395  C  CG  . ASP A 1 50  ? 71.74366 -16.12934 26.45512  1.000 113.30766 ? 50  ASP C CG  1 
ATOM   396  O  OD1 . ASP A 1 50  ? 72.17646 -15.58235 25.41735  1.000 113.05770 ? 50  ASP C OD1 1 
ATOM   397  O  OD2 . ASP A 1 50  ? 71.95564 -17.33368 26.71995  1.000 113.52730 ? 50  ASP C OD2 1 
ATOM   398  N  N   . GLY A 1 51  ? 73.77992 -13.82503 27.33326  1.000 113.22593 ? 51  GLY C N   1 
ATOM   399  C  CA  . GLY A 1 51  ? 74.74020 -12.84188 26.85916  1.000 111.92690 ? 51  GLY C CA  1 
ATOM   400  C  C   . GLY A 1 51  ? 74.49031 -12.30150 25.46989  1.000 109.83006 ? 51  GLY C C   1 
ATOM   401  O  O   . GLY A 1 51  ? 74.90653 -11.18047 25.16424  1.000 109.42697 ? 51  GLY C O   1 
ATOM   402  N  N   . ARG A 1 52  ? 73.84794 -13.08173 24.60357  1.000 108.35444 ? 52  ARG C N   1 
ATOM   403  C  CA  . ARG A 1 52  ? 73.55323 -12.66021 23.23876  1.000 110.52804 ? 52  ARG C CA  1 
ATOM   404  C  C   . ARG A 1 52  ? 72.05718 -12.74217 22.93797  1.000 109.17548 ? 52  ARG C C   1 
ATOM   405  O  O   . ARG A 1 52  ? 71.64262 -13.13949 21.84370  1.000 109.81832 ? 52  ARG C O   1 
ATOM   406  C  CB  . ARG A 1 52  ? 74.37435 -13.45299 22.22421  1.000 115.31859 ? 52  ARG C CB  1 
ATOM   407  C  CG  . ARG A 1 52  ? 74.14436 -14.95353 22.17486  1.000 121.41199 ? 52  ARG C CG  1 
ATOM   408  C  CD  . ARG A 1 52  ? 74.94847 -15.53173 21.01329  1.000 127.89303 ? 52  ARG C CD  1 
ATOM   409  N  NE  . ARG A 1 52  ? 74.26653 -16.60875 20.29761  1.000 133.50080 ? 52  ARG C NE  1 
ATOM   410  C  CZ  . ARG A 1 52  ? 73.24987 -16.43027 19.45508  1.000 135.72441 ? 52  ARG C CZ  1 
ATOM   411  N  NH1 . ARG A 1 52  ? 72.76958 -15.21146 19.22466  1.000 135.00186 ? 52  ARG C NH1 1 
ATOM   412  N  NH2 . ARG A 1 52  ? 72.70573 -17.47373 18.84173  1.000 136.67791 ? 52  ARG C NH2 1 
ATOM   413  N  N   . SER A 1 53  ? 71.22572 -12.34695 23.90346  1.000 107.44154 ? 53  SER C N   1 
ATOM   414  C  CA  . SER A 1 53  ? 69.77754 -12.37596 23.75685  1.000 104.92299 ? 53  SER C CA  1 
ATOM   415  C  C   . SER A 1 53  ? 69.19065 -10.96951 23.67375  1.000 104.27127 ? 53  SER C C   1 
ATOM   416  O  O   . SER A 1 53  ? 69.69818 -10.01711 24.27622  1.000 103.89240 ? 53  SER C O   1 
ATOM   417  C  CB  . SER A 1 53  ? 69.11826 -13.14029 24.90839  1.000 104.15354 ? 53  SER C CB  1 
ATOM   418  O  OG  . SER A 1 53  ? 69.47031 -14.50876 24.87370  1.000 103.69290 ? 53  SER C OG  1 
ATOM   419  N  N   . GLU A 1 54  ? 68.10263 -10.86412 22.91553  1.000 102.06782 ? 54  GLU C N   1 
ATOM   420  C  CA  . GLU A 1 54  ? 67.40005 -9.61675  22.65727  1.000 101.50431 ? 54  GLU C CA  1 
ATOM   421  C  C   . GLU A 1 54  ? 66.07844 -9.60941  23.41669  1.000 97.61527  ? 54  GLU C C   1 
ATOM   422  O  O   . GLU A 1 54  ? 65.41325 -10.64320 23.54184  1.000 99.08044  ? 54  GLU C O   1 
ATOM   423  C  CB  . GLU A 1 54  ? 67.15960 -9.44669  21.14303  1.000 106.23871 ? 54  GLU C CB  1 
ATOM   424  C  CG  . GLU A 1 54  ? 66.12519 -10.41516 20.51493  1.000 112.41114 ? 54  GLU C CG  1 
ATOM   425  C  CD  . GLU A 1 54  ? 66.61682 -11.88070 20.41959  1.000 119.84165 ? 54  GLU C CD  1 
ATOM   426  O  OE1 . GLU A 1 54  ? 67.72474 -12.18816 20.91145  1.000 124.77285 ? 54  GLU C OE1 1 
ATOM   427  O  OE2 . GLU A 1 54  ? 65.88785 -12.73822 19.86791  1.000 120.76514 ? 54  GLU C OE2 1 
ATOM   428  N  N   . ILE A 1 55  ? 65.73552 -8.46129  23.98814  1.000 94.12411  ? 55  ILE C N   1 
ATOM   429  C  CA  . ILE A 1 55  ? 64.43499 -8.25188  24.61101  1.000 91.36333  ? 55  ILE C CA  1 
ATOM   430  C  C   . ILE A 1 55  ? 63.84032 -6.97787  24.03771  1.000 87.56451  ? 55  ILE C C   1 
ATOM   431  O  O   . ILE A 1 55  ? 64.53271 -5.96435  23.90662  1.000 87.88505  ? 55  ILE C O   1 
ATOM   432  C  CB  . ILE A 1 55  ? 64.52670 -8.17907  26.14935  1.000 91.56876  ? 55  ILE C CB  1 
ATOM   433  C  CG1 . ILE A 1 55  ? 65.36309 -6.97903  26.57456  1.000 92.13675  ? 55  ILE C CG1 1 
ATOM   434  C  CG2 . ILE A 1 55  ? 65.11631 -9.45564  26.71397  1.000 91.40172  ? 55  ILE C CG2 1 
ATOM   435  C  CD1 . ILE A 1 55  ? 65.33020 -6.73250  28.03436  1.000 93.14805  ? 55  ILE C CD1 1 
ATOM   436  N  N   . ALA A 1 56  ? 62.55877 -7.02224  23.70451  1.000 84.46085  ? 56  ALA C N   1 
ATOM   437  C  CA  . ALA A 1 56  ? 61.88017 -5.86868  23.13618  1.000 82.98722  ? 56  ALA C CA  1 
ATOM   438  C  C   . ALA A 1 56  ? 60.54436 -5.69780  23.83729  1.000 82.33224  ? 56  ALA C C   1 
ATOM   439  O  O   . ALA A 1 56  ? 59.95107 -6.66805  24.31232  1.000 89.90867  ? 56  ALA C O   1 
ATOM   440  C  CB  . ALA A 1 56  ? 61.67379 -6.01006  21.62221  1.000 82.08144  ? 56  ALA C CB  1 
ATOM   441  N  N   . PHE A 1 57  ? 60.09072 -4.45349  23.93744  1.000 77.27727  ? 57  PHE C N   1 
ATOM   442  C  CA  . PHE A 1 57  ? 58.82507 -4.16318  24.59492  1.000 74.68270  ? 57  PHE C CA  1 
ATOM   443  C  C   . PHE A 1 57  ? 57.95558 -3.33474  23.66360  1.000 74.09723  ? 57  PHE C C   1 
ATOM   444  O  O   . PHE A 1 57  ? 58.42618 -2.35550  23.08121  1.000 74.73624  ? 57  PHE C O   1 
ATOM   445  C  CB  . PHE A 1 57  ? 59.05698 -3.45119  25.92770  1.000 72.51943  ? 57  PHE C CB  1 
ATOM   446  C  CG  . PHE A 1 57  ? 60.01824 -4.17128  26.82576  1.000 69.61031  ? 57  PHE C CG  1 
ATOM   447  C  CD1 . PHE A 1 57  ? 59.58756 -5.21234  27.62800  1.000 70.10318  ? 57  PHE C CD1 1 
ATOM   448  C  CD2 . PHE A 1 57  ? 61.35967 -3.83303  26.83714  1.000 67.50592  ? 57  PHE C CD2 1 
ATOM   449  C  CE1 . PHE A 1 57  ? 60.47794 -5.89111  28.44383  1.000 71.45781  ? 57  PHE C CE1 1 
ATOM   450  C  CE2 . PHE A 1 57  ? 62.25418 -4.50507  27.64828  1.000 68.72171  ? 57  PHE C CE2 1 
ATOM   451  C  CZ  . PHE A 1 57  ? 61.81576 -5.53637  28.45235  1.000 70.30324  ? 57  PHE C CZ  1 
ATOM   452  N  N   . VAL A 1 58  ? 56.69320 -3.73091  23.51548  1.000 71.97284  ? 58  VAL C N   1 
ATOM   453  C  CA  . VAL A 1 58  ? 55.78120 -3.08827  22.57763  1.000 71.04761  ? 58  VAL C CA  1 
ATOM   454  C  C   . VAL A 1 58  ? 54.82664 -2.18286  23.34090  1.000 73.38927  ? 58  VAL C C   1 
ATOM   455  O  O   . VAL A 1 58  ? 54.13262 -2.63111  24.26272  1.000 75.77261  ? 58  VAL C O   1 
ATOM   456  C  CB  . VAL A 1 58  ? 55.00235 -4.13269  21.76249  1.000 67.09412  ? 58  VAL C CB  1 
ATOM   457  C  CG1 . VAL A 1 58  ? 53.93933 -3.44805  20.91300  1.000 65.19658  ? 58  VAL C CG1 1 
ATOM   458  C  CG2 . VAL A 1 58  ? 55.95043 -4.92362  20.89304  1.000 67.28140  ? 58  VAL C CG2 1 
ATOM   459  N  N   . ALA A 1 59  ? 54.75521 -0.92009  22.92476  1.000 72.18715  ? 59  ALA C N   1 
ATOM   460  C  CA  . ALA A 1 59  ? 53.74672 -0.00384  23.44215  1.000 70.88800  ? 59  ALA C CA  1 
ATOM   461  C  C   . ALA A 1 59  ? 52.36244 -0.47384  23.01145  1.000 71.28405  ? 59  ALA C C   1 
ATOM   462  O  O   . ALA A 1 59  ? 52.09553 -0.61833  21.81217  1.000 71.81250  ? 59  ALA C O   1 
ATOM   463  C  CB  . ALA A 1 59  ? 54.01416 1.41455   22.94210  1.000 69.21057  ? 59  ALA C CB  1 
ATOM   464  N  N   . THR A 1 60  ? 51.48491 -0.71391  23.98303  1.000 70.09769  ? 60  THR C N   1 
ATOM   465  C  CA  . THR A 1 60  ? 50.17564 -1.27331  23.67489  1.000 71.28542  ? 60  THR C CA  1 
ATOM   466  C  C   . THR A 1 60  ? 49.42163 -0.39624  22.67908  1.000 72.04149  ? 60  THR C C   1 
ATOM   467  O  O   . THR A 1 60  ? 49.49193 0.83482   22.72885  1.000 73.39698  ? 60  THR C O   1 
ATOM   468  C  CB  . THR A 1 60  ? 49.36739 -1.44587  24.96159  1.000 70.48578  ? 60  THR C CB  1 
ATOM   469  O  OG1 . THR A 1 60  ? 49.99259 -2.44997  25.76948  1.000 73.41281  ? 60  THR C OG1 1 
ATOM   470  C  CG2 . THR A 1 60  ? 47.93219 -1.86657  24.66258  1.000 68.04235  ? 60  THR C CG2 1 
ATOM   471  N  N   . GLY A 1 61  ? 48.71517 -1.04917  21.75108  1.000 70.87651  ? 61  GLY C N   1 
ATOM   472  C  CA  . GLY A 1 61  ? 47.94792 -0.38043  20.72259  1.000 67.15384  ? 61  GLY C CA  1 
ATOM   473  C  C   . GLY A 1 61  ? 48.72974 0.03073   19.50347  1.000 64.63372  ? 61  GLY C C   1 
ATOM   474  O  O   . GLY A 1 61  ? 48.12618 0.46370   18.51825  1.000 64.04655  ? 61  GLY C O   1 
ATOM   475  N  N   . THR A 1 62  ? 50.04526 -0.11407  19.51740  1.000 66.14567  ? 62  THR C N   1 
ATOM   476  C  CA  . THR A 1 62  ? 50.88751 0.26409   18.39741  1.000 69.04373  ? 62  THR C CA  1 
ATOM   477  C  C   . THR A 1 62  ? 51.78876 -0.89485  18.02048  1.000 71.30315  ? 62  THR C C   1 
ATOM   478  O  O   . THR A 1 62  ? 51.86181 -1.91529  18.70806  1.000 73.83889  ? 62  THR C O   1 
ATOM   479  C  CB  . THR A 1 62  ? 51.77380 1.46347   18.73144  1.000 71.28203  ? 62  THR C CB  1 
ATOM   480  O  OG1 . THR A 1 62  ? 52.89443 0.99891   19.50115  1.000 71.16197  ? 62  THR C OG1 1 
ATOM   481  C  CG2 . THR A 1 62  ? 50.99127 2.54401   19.50868  1.000 72.08375  ? 62  THR C CG2 1 
ATOM   482  N  N   . ASN A 1 63  ? 52.50224 -0.70836  16.91924  1.000 71.17228  ? 63  ASN C N   1 
ATOM   483  C  CA  . ASN A 1 63  ? 53.56380 -1.61863  16.52915  1.000 69.88483  ? 63  ASN C CA  1 
ATOM   484  C  C   . ASN A 1 63  ? 54.93759 -1.04750  16.84032  1.000 70.21741  ? 63  ASN C C   1 
ATOM   485  O  O   . ASN A 1 63  ? 55.94000 -1.56626  16.33595  1.000 69.16295  ? 63  ASN C O   1 
ATOM   486  C  CB  . ASN A 1 63  ? 53.45470 -1.97189  15.03956  1.000 68.57006  ? 63  ASN C CB  1 
ATOM   487  C  CG  . ASN A 1 63  ? 53.79223 -0.80444  14.11829  1.000 65.31029  ? 63  ASN C CG  1 
ATOM   488  O  OD1 . ASN A 1 63  ? 53.38176 0.34171   14.33493  1.000 65.44900  ? 63  ASN C OD1 1 
ATOM   489  N  ND2 . ASN A 1 63  ? 54.57450 -1.09365  13.09511  1.000 64.33769  ? 63  ASN C ND2 1 
ATOM   490  N  N   . LEU A 1 64  ? 54.99292 0.03619   17.62314  1.000 70.28677  ? 64  LEU C N   1 
ATOM   491  C  CA  . LEU A 1 64  ? 56.24593 0.67690   18.02171  1.000 69.90327  ? 64  LEU C CA  1 
ATOM   492  C  C   . LEU A 1 64  ? 56.87644 -0.02778  19.21512  1.000 68.99940  ? 64  LEU C C   1 
ATOM   493  O  O   . LEU A 1 64  ? 56.19269 -0.36641  20.18467  1.000 70.85168  ? 64  LEU C O   1 
ATOM   494  C  CB  . LEU A 1 64  ? 55.99397 2.14296   18.37559  1.000 68.47717  ? 64  LEU C CB  1 
ATOM   495  C  CG  . LEU A 1 64  ? 57.21316 2.96460   18.79854  1.000 69.08047  ? 64  LEU C CG  1 
ATOM   496  C  CD1 . LEU A 1 64  ? 58.07031 3.40145   17.60554  1.000 68.62518  ? 64  LEU C CD1 1 
ATOM   497  C  CD2 . LEU A 1 64  ? 56.77178 4.16304   19.61711  1.000 70.60496  ? 64  LEU C CD2 1 
ATOM   498  N  N   . SER A 1 65  ? 58.19095 -0.20773  19.17282  1.000 67.57287  ? 65  SER C N   1 
ATOM   499  C  CA  . SER A 1 65  ? 58.81802 -0.98150  20.22830  1.000 70.45796  ? 65  SER C CA  1 
ATOM   500  C  C   . SER A 1 65  ? 60.16437 -0.39728  20.60956  1.000 72.17493  ? 65  SER C C   1 
ATOM   501  O  O   . SER A 1 65  ? 60.89269 0.11479   19.75686  1.000 74.82903  ? 65  SER C O   1 
ATOM   502  C  CB  . SER A 1 65  ? 59.00636 -2.44014  19.80988  1.000 72.32605  ? 65  SER C CB  1 
ATOM   503  O  OG  . SER A 1 65  ? 60.16426 -2.57540  19.00731  1.000 72.27346  ? 65  SER C OG  1 
ATOM   504  N  N   . LEU A 1 66  ? 60.49351 -0.48226  21.89494  1.000 72.11860  ? 66  LEU C N   1 
ATOM   505  C  CA  . LEU A 1 66  ? 61.83745 -0.16307  22.36143  1.000 77.85284  ? 66  LEU C CA  1 
ATOM   506  C  C   . LEU A 1 66  ? 62.65165 -1.45422  22.37692  1.000 81.37053  ? 66  LEU C C   1 
ATOM   507  O  O   . LEU A 1 66  ? 62.43241 -2.33256  23.21917  1.000 84.91937  ? 66  LEU C O   1 
ATOM   508  C  CB  . LEU A 1 66  ? 61.79597 0.51139   23.73196  1.000 80.42392  ? 66  LEU C CB  1 
ATOM   509  C  CG  . LEU A 1 66  ? 61.33591 1.98246   23.68690  1.000 82.73534  ? 66  LEU C CG  1 
ATOM   510  C  CD1 . LEU A 1 66  ? 61.47485 2.70648   25.03825  1.000 82.72497  ? 66  LEU C CD1 1 
ATOM   511  C  CD2 . LEU A 1 66  ? 62.06666 2.75166   22.57615  1.000 83.31338  ? 66  LEU C CD2 1 
ATOM   512  N  N   . GLN A 1 67  ? 63.59665 -1.55999  21.44893  1.000 82.06749  ? 67  GLN C N   1 
ATOM   513  C  CA  . GLN A 1 67  ? 64.40104 -2.75814  21.26168  1.000 83.66817  ? 67  GLN C CA  1 
ATOM   514  C  C   . GLN A 1 67  ? 65.69475 -2.58767  22.04470  1.000 84.13091  ? 67  GLN C C   1 
ATOM   515  O  O   . GLN A 1 67  ? 66.37673 -1.56484  21.90384  1.000 84.04947  ? 67  GLN C O   1 
ATOM   516  C  CB  . GLN A 1 67  ? 64.69030 -2.99627  19.77959  1.000 86.64958  ? 67  GLN C CB  1 
ATOM   517  C  CG  . GLN A 1 67  ? 65.51654 -4.23299  19.47891  1.000 91.09796  ? 67  GLN C CG  1 
ATOM   518  C  CD  . GLN A 1 67  ? 64.75412 -5.51177  19.74177  1.000 95.92859  ? 67  GLN C CD  1 
ATOM   519  O  OE1 . GLN A 1 67  ? 63.83115 -5.85608  19.00086  1.000 97.23047  ? 67  GLN C OE1 1 
ATOM   520  N  NE2 . GLN A 1 67  ? 65.14502 -6.23721  20.78748  1.000 98.90030  ? 67  GLN C NE2 1 
ATOM   521  N  N   . PHE A 1 68  ? 65.97402 -3.53989  22.93237  1.000 83.71588  ? 68  PHE C N   1 
ATOM   522  C  CA  . PHE A 1 68  ? 67.21477 -3.58891  23.69271  1.000 84.24971  ? 68  PHE C CA  1 
ATOM   523  C  C   . PHE A 1 68  ? 68.10751 -4.68122  23.11207  1.000 87.45981  ? 68  PHE C C   1 
ATOM   524  O  O   . PHE A 1 68  ? 67.70284 -5.84564  23.03312  1.000 89.69414  ? 68  PHE C O   1 
ATOM   525  C  CB  . PHE A 1 68  ? 66.93114 -3.83855  25.17068  1.000 85.60160  ? 68  PHE C CB  1 
ATOM   526  C  CG  . PHE A 1 68  ? 66.27031 -2.68014  25.85359  1.000 87.57368  ? 68  PHE C CG  1 
ATOM   527  C  CD1 . PHE A 1 68  ? 64.90840 -2.44209  25.69944  1.000 86.72287  ? 68  PHE C CD1 1 
ATOM   528  C  CD2 . PHE A 1 68  ? 67.01254 -1.80562  26.63560  1.000 88.96176  ? 68  PHE C CD2 1 
ATOM   529  C  CE1 . PHE A 1 68  ? 64.29781 -1.35610  26.32309  1.000 84.20459  ? 68  PHE C CE1 1 
ATOM   530  C  CE2 . PHE A 1 68  ? 66.40838 -0.72344  27.25897  1.000 88.21143  ? 68  PHE C CE2 1 
ATOM   531  C  CZ  . PHE A 1 68  ? 65.04936 -0.50115  27.10145  1.000 85.79687  ? 68  PHE C CZ  1 
ATOM   532  N  N   . PHE A 1 69  ? 69.31150 -4.30506  22.70589  1.000 87.52194  ? 69  PHE C N   1 
ATOM   533  C  CA  . PHE A 1 69  ? 70.28796 -5.17826  22.07760  1.000 89.55247  ? 69  PHE C CA  1 
ATOM   534  C  C   . PHE A 1 69  ? 71.50144 -5.40586  22.98014  1.000 92.33675  ? 69  PHE C C   1 
ATOM   535  O  O   . PHE A 1 69  ? 71.90190 -4.50533  23.72342  1.000 92.01809  ? 69  PHE C O   1 
ATOM   536  C  CB  . PHE A 1 69  ? 70.76593 -4.56768  20.75634  1.000 88.56795  ? 69  PHE C CB  1 
ATOM   537  C  CG  . PHE A 1 69  ? 69.81865 -4.75206  19.60441  1.000 87.71795  ? 69  PHE C CG  1 
ATOM   538  C  CD1 . PHE A 1 69  ? 69.31666 -6.00263  19.29310  1.000 89.52060  ? 69  PHE C CD1 1 
ATOM   539  C  CD2 . PHE A 1 69  ? 69.45594 -3.67420  18.81294  1.000 85.37151  ? 69  PHE C CD2 1 
ATOM   540  C  CE1 . PHE A 1 69  ? 68.46602 -6.17620  18.21286  1.000 89.55162  ? 69  PHE C CE1 1 
ATOM   541  C  CE2 . PHE A 1 69  ? 68.61069 -3.83895  17.74035  1.000 86.13963  ? 69  PHE C CE2 1 
ATOM   542  C  CZ  . PHE A 1 69  ? 68.11476 -5.09425  17.43672  1.000 88.44837  ? 69  PHE C CZ  1 
ATOM   543  N  N   . PRO A 1 70  ? 72.11197 -6.59401  22.94391  1.000 95.90479  ? 70  PRO C N   1 
ATOM   544  C  CA  . PRO A 1 70  ? 73.43645 -6.75540  23.55824  1.000 98.61037  ? 70  PRO C CA  1 
ATOM   545  C  C   . PRO A 1 70  ? 74.47289 -5.98434  22.75784  1.000 104.37700 ? 70  PRO C C   1 
ATOM   546  O  O   . PRO A 1 70  ? 74.57562 -6.14781  21.53978  1.000 107.54782 ? 70  PRO C O   1 
ATOM   547  C  CB  . PRO A 1 70  ? 73.68928 -8.26763  23.49093  1.000 97.59778  ? 70  PRO C CB  1 
ATOM   548  C  CG  . PRO A 1 70  ? 72.38652 -8.88223  23.13312  1.000 96.83613  ? 70  PRO C CG  1 
ATOM   549  C  CD  . PRO A 1 70  ? 71.65738 -7.84996  22.33023  1.000 96.53291  ? 70  PRO C CD  1 
ATOM   550  N  N   . ALA A 1 71  ? 75.23535 -5.13022  23.44407  1.000 106.86131 ? 71  ALA C N   1 
ATOM   551  C  CA  . ALA A 1 71  ? 76.19083 -4.27952  22.73793  1.000 108.91082 ? 71  ALA C CA  1 
ATOM   552  C  C   . ALA A 1 71  ? 77.24720 -5.09589  21.99549  1.000 112.32236 ? 71  ALA C C   1 
ATOM   553  O  O   . ALA A 1 71  ? 77.72143 -4.67401  20.93421  1.000 113.17657 ? 71  ALA C O   1 
ATOM   554  C  CB  . ALA A 1 71  ? 76.85830 -3.31438  23.71359  1.000 108.90395 ? 71  ALA C CB  1 
ATOM   555  N  N   . SER A 1 72  ? 77.62716 -6.26009  22.52914  1.000 113.89062 ? 72  SER C N   1 
ATOM   556  C  CA  . SER A 1 72  ? 78.65192 -7.07911  21.89760  1.000 116.34326 ? 72  SER C CA  1 
ATOM   557  C  C   . SER A 1 72  ? 78.17361 -7.75599  20.61688  1.000 115.25415 ? 72  SER C C   1 
ATOM   558  O  O   . SER A 1 72  ? 79.00133 -8.32213  19.89326  1.000 117.95211 ? 72  SER C O   1 
ATOM   559  C  CB  . SER A 1 72  ? 79.16007 -8.12698  22.88986  1.000 120.64255 ? 72  SER C CB  1 
ATOM   560  O  OG  . SER A 1 72  ? 80.17800 -8.92802  22.31570  1.000 128.05099 ? 72  SER C OG  1 
ATOM   561  N  N   . TRP A 1 73  ? 76.87754 -7.70854  20.30747  1.000 112.06356 ? 73  TRP C N   1 
ATOM   562  C  CA  . TRP A 1 73  ? 76.36266 -8.33214  19.09582  1.000 110.48582 ? 73  TRP C CA  1 
ATOM   563  C  C   . TRP A 1 73  ? 75.67427 -7.35772  18.14386  1.000 103.26643 ? 73  TRP C C   1 
ATOM   564  O  O   . TRP A 1 73  ? 75.19291 -7.79273  17.08951  1.000 105.01485 ? 73  TRP C O   1 
ATOM   565  C  CB  . TRP A 1 73  ? 75.39819 -9.47938  19.45006  1.000 116.84374 ? 73  TRP C CB  1 
ATOM   566  C  CG  . TRP A 1 73  ? 76.07707 -10.84177 19.59765  1.000 125.51732 ? 73  TRP C CG  1 
ATOM   567  C  CD1 . TRP A 1 73  ? 76.09503 -11.85711 18.68065  1.000 126.06631 ? 73  TRP C CD1 1 
ATOM   568  C  CD2 . TRP A 1 73  ? 76.82738 -11.31507 20.72698  1.000 129.13708 ? 73  TRP C CD2 1 
ATOM   569  N  NE1 . TRP A 1 73  ? 76.80633 -12.92823 19.16867  1.000 127.78938 ? 73  TRP C NE1 1 
ATOM   570  C  CE2 . TRP A 1 73  ? 77.26781 -12.62068 20.42125  1.000 130.39349 ? 73  TRP C CE2 1 
ATOM   571  C  CE3 . TRP A 1 73  ? 77.16776 -10.76188 21.96580  1.000 131.88639 ? 73  TRP C CE3 1 
ATOM   572  C  CZ2 . TRP A 1 73  ? 78.03231 -13.37884 21.30983  1.000 134.87301 ? 73  TRP C CZ2 1 
ATOM   573  C  CZ3 . TRP A 1 73  ? 77.92740 -11.51506 22.84603  1.000 133.83312 ? 73  TRP C CZ3 1 
ATOM   574  C  CH2 . TRP A 1 73  ? 78.35105 -12.80946 22.51469  1.000 135.70578 ? 73  TRP C CH2 1 
ATOM   575  N  N   . GLN A 1 74  ? 75.62740 -6.06240  18.46325  1.000 111.95127 ? 74  GLN C N   1 
ATOM   576  C  CA  . GLN A 1 74  ? 74.93881 -5.10070  17.61130  1.000 107.44003 ? 74  GLN C CA  1 
ATOM   577  C  C   . GLN A 1 74  ? 75.40652 -3.69137  17.93981  1.000 111.97999 ? 74  GLN C C   1 
ATOM   578  O  O   . GLN A 1 74  ? 75.73919 -3.38551  19.08638  1.000 113.50489 ? 74  GLN C O   1 
ATOM   579  C  CB  . GLN A 1 74  ? 73.41926 -5.19542  17.76831  1.000 103.85708 ? 74  GLN C CB  1 
ATOM   580  C  CG  . GLN A 1 74  ? 72.63415 -4.38103  16.75473  1.000 102.32914 ? 74  GLN C CG  1 
ATOM   581  C  CD  . GLN A 1 74  ? 72.85400 -4.84422  15.31957  1.000 102.26846 ? 74  GLN C CD  1 
ATOM   582  O  OE1 . GLN A 1 74  ? 72.87857 -6.04171  15.03503  1.000 99.68400  ? 74  GLN C OE1 1 
ATOM   583  N  NE2 . GLN A 1 74  ? 72.98783 -3.88989  14.40313  1.000 105.01006 ? 74  GLN C NE2 1 
ATOM   584  N  N   . GLY A 1 75  ? 75.41483 -2.83310  16.91077  1.000 114.78009 ? 75  GLY C N   1 
ATOM   585  C  CA  . GLY A 1 75  ? 75.85280 -1.46175  17.06230  1.000 117.99475 ? 75  GLY C CA  1 
ATOM   586  C  C   . GLY A 1 75  ? 75.00355 -0.53013  16.22037  1.000 119.73006 ? 75  GLY C C   1 
ATOM   587  O  O   . GLY A 1 75  ? 74.16576 -0.96806  15.42738  1.000 117.90612 ? 75  GLY C O   1 
ATOM   588  N  N   . GLU A 1 76  ? 75.23015 0.76927   16.40689  1.000 124.38989 ? 76  GLU C N   1 
ATOM   589  C  CA  . GLU A 1 76  ? 74.51654 1.77258   15.62960  1.000 131.43685 ? 76  GLU C CA  1 
ATOM   590  C  C   . GLU A 1 76  ? 75.38089 3.02824   15.51836  1.000 137.19345 ? 76  GLU C C   1 
ATOM   591  O  O   . GLU A 1 76  ? 76.44168 3.13599   16.14125  1.000 141.24492 ? 76  GLU C O   1 
ATOM   592  C  CB  . GLU A 1 76  ? 73.13323 2.04314   16.23772  1.000 134.38492 ? 76  GLU C CB  1 
ATOM   593  C  CG  . GLU A 1 76  ? 72.17801 2.86088   15.37062  1.000 137.57577 ? 76  GLU C CG  1 
ATOM   594  C  CD  . GLU A 1 76  ? 71.94435 2.28263   13.97173  1.000 138.59758 ? 76  GLU C CD  1 
ATOM   595  O  OE1 . GLU A 1 76  ? 72.16035 1.07128   13.73935  1.000 138.05231 ? 76  GLU C OE1 1 
ATOM   596  O  OE2 . GLU A 1 76  ? 71.53987 3.06692   13.08650  1.000 139.81372 ? 76  GLU C OE2 1 
ATOM   597  N  N   . GLN A 1 77  ? 74.91114 3.97480   14.69616  1.000 134.66305 ? 77  GLN C N   1 
ATOM   598  C  CA  . GLN A 1 77  ? 75.70746 5.13556   14.29873  1.000 133.99193 ? 77  GLN C CA  1 
ATOM   599  C  C   . GLN A 1 77  ? 76.22255 5.91113   15.50938  1.000 134.57363 ? 77  GLN C C   1 
ATOM   600  O  O   . GLN A 1 77  ? 77.43198 6.11536   15.67028  1.000 131.51461 ? 77  GLN C O   1 
ATOM   601  C  CB  . GLN A 1 77  ? 74.85637 6.05771   13.41714  1.000 135.22776 ? 77  GLN C CB  1 
ATOM   602  C  CG  . GLN A 1 77  ? 74.66722 5.62621   11.96578  1.000 134.47393 ? 77  GLN C CG  1 
ATOM   603  C  CD  . GLN A 1 77  ? 75.86783 5.90395   11.08300  1.000 134.87533 ? 77  GLN C CD  1 
ATOM   604  O  OE1 . GLN A 1 77  ? 76.09935 7.03890   10.66106  1.000 136.91585 ? 77  GLN C OE1 1 
ATOM   605  N  NE2 . GLN A 1 77  ? 76.62278 4.85998   10.77522  1.000 132.44895 ? 77  GLN C NE2 1 
ATOM   606  N  N   . ARG A 1 78  ? 75.30979 6.35345   16.37416  1.000 135.97784 ? 78  ARG C N   1 
ATOM   607  C  CA  . ARG A 1 78  ? 75.63622 7.25419   17.47090  1.000 141.97108 ? 78  ARG C CA  1 
ATOM   608  C  C   . ARG A 1 78  ? 75.08227 6.77863   18.80936  1.000 147.18771 ? 78  ARG C C   1 
ATOM   609  O  O   . ARG A 1 78  ? 75.14951 7.51698   19.80076  1.000 156.14323 ? 78  ARG C O   1 
ATOM   610  C  CB  . ARG A 1 78  ? 75.10191 8.65021   17.12881  1.000 135.10855 ? 78  ARG C CB  1 
ATOM   611  C  CG  . ARG A 1 78  ? 75.45015 9.78886   18.06954  1.000 132.03489 ? 78  ARG C CG  1 
ATOM   612  C  CD  . ARG A 1 78  ? 76.85724 10.32028  17.94626  1.000 127.60070 ? 78  ARG C CD  1 
ATOM   613  N  NE  . ARG A 1 78  ? 77.08080 11.35491  18.95595  1.000 125.99890 ? 78  ARG C NE  1 
ATOM   614  C  CZ  . ARG A 1 78  ? 76.49563 12.55257  18.95210  1.000 124.85202 ? 78  ARG C CZ  1 
ATOM   615  N  NH1 . ARG A 1 78  ? 75.64256 12.88752  17.98990  1.000 123.24279 ? 78  ARG C NH1 1 
ATOM   616  N  NH2 . ARG A 1 78  ? 76.76151 13.42256  19.91813  1.000 126.04424 ? 78  ARG C NH2 1 
ATOM   617  N  N   . GLN A 1 79  ? 74.61551 5.54247   18.89614  1.000 144.21505 ? 79  GLN C N   1 
ATOM   618  C  CA  . GLN A 1 79  ? 74.08479 5.03672   20.15049  1.000 147.86194 ? 79  GLN C CA  1 
ATOM   619  C  C   . GLN A 1 79  ? 75.23075 4.45438   20.96894  1.000 147.22797 ? 79  GLN C C   1 
ATOM   620  O  O   . GLN A 1 79  ? 76.06932 3.71548   20.44091  1.000 146.66831 ? 79  GLN C O   1 
ATOM   621  C  CB  . GLN A 1 79  ? 72.98092 4.00940   19.88500  1.000 151.86233 ? 79  GLN C CB  1 
ATOM   622  C  CG  . GLN A 1 79  ? 71.72253 4.56510   19.17990  1.000 155.70161 ? 79  GLN C CG  1 
ATOM   623  C  CD  . GLN A 1 79  ? 71.01031 5.68427   19.95489  1.000 160.48404 ? 79  GLN C CD  1 
ATOM   624  O  OE1 . GLN A 1 79  ? 71.52589 6.79670   20.09217  1.000 162.42671 ? 79  GLN C OE1 1 
ATOM   625  N  NE2 . GLN A 1 79  ? 69.80661 5.38955   20.44483  1.000 159.67243 ? 79  GLN C NE2 1 
ATOM   626  N  N   . THR A 1 80  ? 75.26684 4.80427   22.25634  1.000 142.91980 ? 80  THR C N   1 
ATOM   627  C  CA  . THR A 1 80  ? 76.39723 4.49599   23.12536  1.000 136.50602 ? 80  THR C CA  1 
ATOM   628  C  C   . THR A 1 80  ? 76.01214 3.42089   24.13393  1.000 132.49686 ? 80  THR C C   1 
ATOM   629  O  O   . THR A 1 80  ? 75.04816 3.60657   24.89814  1.000 137.46719 ? 80  THR C O   1 
ATOM   630  C  CB  . THR A 1 80  ? 76.87487 5.75932   23.84778  1.000 139.31199 ? 80  THR C CB  1 
ATOM   631  O  OG1 . THR A 1 80  ? 75.88591 6.18880   24.79191  1.000 137.63600 ? 80  THR C OG1 1 
ATOM   632  C  CG2 . THR A 1 80  ? 77.10536 6.88769   22.84345  1.000 137.15647 ? 80  THR C CG2 1 
ATOM   633  N  N   . PRO A 1 81  ? 76.74355 2.30411   24.18426  1.000 124.70339 ? 81  PRO C N   1 
ATOM   634  C  CA  . PRO A 1 81  ? 76.37292 1.20927   25.09144  1.000 121.61351 ? 81  PRO C CA  1 
ATOM   635  C  C   . PRO A 1 81  ? 76.56995 1.56900   26.55715  1.000 121.48543 ? 81  PRO C C   1 
ATOM   636  O  O   . PRO A 1 81  ? 77.51796 2.26550   26.92207  1.000 122.73956 ? 81  PRO C O   1 
ATOM   637  C  CB  . PRO A 1 81  ? 77.31467 0.07536   24.67297  1.000 117.57966 ? 81  PRO C CB  1 
ATOM   638  C  CG  . PRO A 1 81  ? 77.71696 0.41386   23.26941  1.000 117.87631 ? 81  PRO C CG  1 
ATOM   639  C  CD  . PRO A 1 81  ? 77.80907 1.90739   23.25177  1.000 122.52023 ? 81  PRO C CD  1 
ATOM   640  N  N   . SER A 1 82  ? 75.66643 1.06277   27.39882  1.000 124.48441 ? 82  SER C N   1 
ATOM   641  C  CA  . SER A 1 82  ? 75.73273 1.22678   28.84523  1.000 133.14914 ? 82  SER C CA  1 
ATOM   642  C  C   . SER A 1 82  ? 75.25897 -0.05530  29.51300  1.000 142.37665 ? 82  SER C C   1 
ATOM   643  O  O   . SER A 1 82  ? 74.42373 -0.78221  28.97240  1.000 144.07915 ? 82  SER C O   1 
ATOM   644  C  CB  . SER A 1 82  ? 74.88324 2.40510   29.33807  1.000 128.28643 ? 82  SER C CB  1 
ATOM   645  O  OG  . SER A 1 82  ? 74.78296 2.40166   30.75464  1.000 127.46063 ? 82  SER C OG  1 
ATOM   646  N  N   . ARG A 1 83  ? 75.80192 -0.32482  30.69841  1.000 154.71283 ? 83  ARG C N   1 
ATOM   647  C  CA  . ARG A 1 83  ? 75.51105 -1.55263  31.43023  1.000 156.16508 ? 83  ARG C CA  1 
ATOM   648  C  C   . ARG A 1 83  ? 74.30260 -1.47077  32.35289  1.000 149.15346 ? 83  ARG C C   1 
ATOM   649  O  O   . ARG A 1 83  ? 73.90366 -2.49869  32.90870  1.000 147.31943 ? 83  ARG C O   1 
ATOM   650  C  CB  . ARG A 1 83  ? 76.74482 -1.94959  32.25476  1.000 164.11924 ? 83  ARG C CB  1 
ATOM   651  C  CG  . ARG A 1 83  ? 77.12464 -0.94151  33.33914  1.000 170.14918 ? 83  ARG C CG  1 
ATOM   652  C  CD  . ARG A 1 83  ? 78.43536 -1.31978  34.01981  1.000 174.97195 ? 83  ARG C CD  1 
ATOM   653  N  NE  . ARG A 1 83  ? 78.41671 -2.67873  34.55174  1.000 178.43581 ? 83  ARG C NE  1 
ATOM   654  C  CZ  . ARG A 1 83  ? 78.11537 -2.97799  35.81078  1.000 183.91378 ? 83  ARG C CZ  1 
ATOM   655  N  NH1 . ARG A 1 83  ? 77.81023 -2.01046  36.66587  1.000 188.27738 ? 83  ARG C NH1 1 
ATOM   656  N  NH2 . ARG A 1 83  ? 78.11996 -4.24032  36.21751  1.000 183.29794 ? 83  ARG C NH2 1 
ATOM   657  N  N   . GLU A 1 84  ? 73.69988 -0.30055  32.52991  1.000 145.59690 ? 84  GLU C N   1 
ATOM   658  C  CA  . GLU A 1 84  ? 72.66297 -0.14800  33.53969  1.000 140.39323 ? 84  GLU C CA  1 
ATOM   659  C  C   . GLU A 1 84  ? 71.28348 0.12517   32.94915  1.000 132.13936 ? 84  GLU C C   1 
ATOM   660  O  O   . GLU A 1 84  ? 70.35100 0.43083   33.69866  1.000 132.86047 ? 84  GLU C O   1 
ATOM   661  C  CB  . GLU A 1 84  ? 73.06789 0.93891   34.53509  1.000 139.80658 ? 84  GLU C CB  1 
ATOM   662  C  CG  . GLU A 1 84  ? 72.59313 0.66679   35.95368  1.000 137.55113 ? 84  GLU C CG  1 
ATOM   663  C  CD  . GLU A 1 84  ? 72.95378 1.78449   36.90776  1.000 135.50581 ? 84  GLU C CD  1 
ATOM   664  O  OE1 . GLU A 1 84  ? 72.56414 2.94109   36.64603  1.000 134.44951 ? 84  GLU C OE1 1 
ATOM   665  O  OE2 . GLU A 1 84  ? 73.65068 1.50928   37.90849  1.000 135.76599 ? 84  GLU C OE2 1 
ATOM   666  N  N   . TYR A 1 85  ? 71.13296 0.04713   31.62458  1.000 125.50470 ? 85  TYR C N   1 
ATOM   667  C  CA  . TYR A 1 85  ? 69.83447 0.30891   31.00314  1.000 119.07614 ? 85  TYR C CA  1 
ATOM   668  C  C   . TYR A 1 85  ? 68.78877 -0.74848  31.35472  1.000 116.39360 ? 85  TYR C C   1 
ATOM   669  O  O   . TYR A 1 85  ? 67.58843 -0.45498  31.32587  1.000 117.59632 ? 85  TYR C O   1 
ATOM   670  C  CB  . TYR A 1 85  ? 69.97645 0.40863   29.47999  1.000 116.83427 ? 85  TYR C CB  1 
ATOM   671  C  CG  . TYR A 1 85  ? 70.72836 1.62881   28.97774  1.000 118.21299 ? 85  TYR C CG  1 
ATOM   672  C  CD1 . TYR A 1 85  ? 70.77842 2.80047   29.72454  1.000 120.11739 ? 85  TYR C CD1 1 
ATOM   673  C  CD2 . TYR A 1 85  ? 71.36262 1.61570   27.73827  1.000 118.36349 ? 85  TYR C CD2 1 
ATOM   674  C  CE1 . TYR A 1 85  ? 71.45953 3.92012   29.26058  1.000 122.24521 ? 85  TYR C CE1 1 
ATOM   675  C  CE2 . TYR A 1 85  ? 72.04135 2.73157   27.26431  1.000 120.85124 ? 85  TYR C CE2 1 
ATOM   676  C  CZ  . TYR A 1 85  ? 72.08610 3.88035   28.02897  1.000 123.55084 ? 85  TYR C CZ  1 
ATOM   677  O  OH  . TYR A 1 85  ? 72.76408 4.98645   27.56310  1.000 125.97279 ? 85  TYR C OH  1 
ATOM   678  N  N   . VAL A 1 86  ? 69.20706 -1.97194  31.67567  1.000 116.79626 ? 86  VAL C N   1 
ATOM   679  C  CA  . VAL A 1 86  ? 68.29579 -3.03929  32.08447  1.000 114.42683 ? 86  VAL C CA  1 
ATOM   680  C  C   . VAL A 1 86  ? 68.78172 -3.56742  33.42724  1.000 116.68841 ? 86  VAL C C   1 
ATOM   681  O  O   . VAL A 1 86  ? 69.88936 -4.10990  33.52213  1.000 117.88243 ? 86  VAL C O   1 
ATOM   682  C  CB  . VAL A 1 86  ? 68.22424 -4.17224  31.04331  1.000 111.66020 ? 86  VAL C CB  1 
ATOM   683  C  CG1 . VAL A 1 86  ? 67.24541 -5.24340  31.48029  1.000 82.85187  ? 86  VAL C CG1 1 
ATOM   684  C  CG2 . VAL A 1 86  ? 67.83041 -3.62877  29.67821  1.000 108.89397 ? 86  VAL C CG2 1 
ATOM   685  N  N   . ASP A 1 87  ? 67.95848 -3.41233  34.46008  1.000 117.44872 ? 87  ASP C N   1 
ATOM   686  C  CA  . ASP A 1 87  ? 68.33344 -3.76621  35.82345  1.000 123.78874 ? 87  ASP C CA  1 
ATOM   687  C  C   . ASP A 1 87  ? 67.25572 -4.64685  36.43359  1.000 125.74922 ? 87  ASP C C   1 
ATOM   688  O  O   . ASP A 1 87  ? 66.11357 -4.20372  36.59589  1.000 125.99500 ? 87  ASP C O   1 
ATOM   689  C  CB  . ASP A 1 87  ? 68.53097 -2.50016  36.66626  1.000 131.78518 ? 87  ASP C CB  1 
ATOM   690  C  CG  . ASP A 1 87  ? 69.06737 -2.79458  38.05023  1.000 141.09560 ? 87  ASP C CG  1 
ATOM   691  O  OD1 . ASP A 1 87  ? 69.48856 -3.94230  38.30441  1.000 144.52393 ? 87  ASP C OD1 1 
ATOM   692  O  OD2 . ASP A 1 87  ? 69.05171 -1.87039  38.89185  1.000 146.28505 ? 87  ASP C OD2 1 
ATOM   693  N  N   . LEU A 1 88  ? 67.62701 -5.87681  36.79908  1.000 127.95180 ? 88  LEU C N   1 
ATOM   694  C  CA  . LEU A 1 88  ? 66.71809 -6.84589  37.40797  1.000 129.63347 ? 88  LEU C CA  1 
ATOM   695  C  C   . LEU A 1 88  ? 66.89211 -6.97532  38.91675  1.000 131.33065 ? 88  LEU C C   1 
ATOM   696  O  O   . LEU A 1 88  ? 65.93638 -6.75764  39.66814  1.000 131.65713 ? 88  LEU C O   1 
ATOM   697  C  CB  . LEU A 1 88  ? 66.89638 -8.22757  36.77184  1.000 128.60107 ? 88  LEU C CB  1 
ATOM   698  C  CG  . LEU A 1 88  ? 66.23542 -8.46719  35.42142  1.000 127.80952 ? 88  LEU C CG  1 
ATOM   699  C  CD1 . LEU A 1 88  ? 67.07653 -9.44283  34.64941  1.000 124.40290 ? 88  LEU C CD1 1 
ATOM   700  C  CD2 . LEU A 1 88  ? 64.81992 -9.01420  35.61205  1.000 130.18121 ? 88  LEU C CD2 1 
ATOM   701  N  N   . GLU A 1 89  ? 68.10315 -7.34096  39.37597  1.000 133.10576 ? 89  GLU C N   1 
ATOM   702  C  CA  . GLU A 1 89  ? 68.42235 -7.67615  40.77184  1.000 133.90513 ? 89  GLU C CA  1 
ATOM   703  C  C   . GLU A 1 89  ? 68.18755 -6.54168  41.74243  1.000 134.72628 ? 89  GLU C C   1 
ATOM   704  O  O   . GLU A 1 89  ? 68.49930 -6.75931  42.92192  1.000 135.99125 ? 89  GLU C O   1 
ATOM   705  C  CB  . GLU A 1 89  ? 69.86836 -8.15331  40.88966  1.000 135.82821 ? 89  GLU C CB  1 
ATOM   706  C  CG  . GLU A 1 89  ? 69.98679 -9.66000  40.86390  1.000 136.75919 ? 89  GLU C CG  1 
ATOM   707  C  CD  . GLU A 1 89  ? 71.40968 -10.14844 40.99354  1.000 141.05421 ? 89  GLU C CD  1 
ATOM   708  O  OE1 . GLU A 1 89  ? 72.33215 -9.30748  41.03770  1.000 143.89542 ? 89  GLU C OE1 1 
ATOM   709  O  OE2 . GLU A 1 89  ? 71.60380 -11.38032 41.05098  1.000 142.55030 ? 89  GLU C OE2 1 
ATOM   710  N  N   . ARG A 1 90  ? 67.68051 -5.38877  41.29816  1.000 132.87071 ? 90  ARG C N   1 
ATOM   711  C  CA  . ARG A 1 90  ? 67.31032 -4.31690  42.21746  1.000 133.18240 ? 90  ARG C CA  1 
ATOM   712  C  C   . ARG A 1 90  ? 66.11424 -4.70669  43.07841  1.000 133.15314 ? 90  ARG C C   1 
ATOM   713  O  O   . ARG A 1 90  ? 66.18764 -4.70394  44.31412  1.000 134.58870 ? 90  ARG C O   1 
ATOM   714  C  CB  . ARG A 1 90  ? 66.99768 -3.04458  41.42951  1.000 132.02180 ? 90  ARG C CB  1 
ATOM   715  C  CG  . ARG A 1 90  ? 66.55541 -1.88974  42.30262  1.000 132.43899 ? 90  ARG C CG  1 
ATOM   716  C  CD  . ARG A 1 90  ? 65.64097 -0.96260  41.54602  1.000 130.15312 ? 90  ARG C CD  1 
ATOM   717  N  NE  . ARG A 1 90  ? 66.36477 -0.30215  40.46731  1.000 128.41317 ? 90  ARG C NE  1 
ATOM   718  C  CZ  . ARG A 1 90  ? 65.92820 0.77717   39.82975  1.000 126.51354 ? 90  ARG C CZ  1 
ATOM   719  N  NH1 . ARG A 1 90  ? 66.65861 1.31643   38.86171  1.000 125.49778 ? 90  ARG C NH1 1 
ATOM   720  N  NH2 . ARG A 1 90  ? 64.76481 1.32101   40.16610  1.000 125.60203 ? 90  ARG C NH2 1 
ATOM   721  N  N   . GLU A 1 91  ? 65.00689 -5.06576  42.43709  1.000 130.21806 ? 91  GLU C N   1 
ATOM   722  C  CA  . GLU A 1 91  ? 63.75264 -5.34835  43.11928  1.000 130.21897 ? 91  GLU C CA  1 
ATOM   723  C  C   . GLU A 1 91  ? 63.27068 -6.72512  42.69617  1.000 127.73228 ? 91  GLU C C   1 
ATOM   724  O  O   . GLU A 1 91  ? 63.20714 -7.02152  41.49973  1.000 126.09148 ? 91  GLU C O   1 
ATOM   725  C  CB  . GLU A 1 91  ? 62.70925 -4.27429  42.77032  1.000 130.06370 ? 91  GLU C CB  1 
ATOM   726  C  CG  . GLU A 1 91  ? 61.39324 -4.32491  43.53857  1.000 131.34011 ? 91  GLU C CG  1 
ATOM   727  C  CD  . GLU A 1 91  ? 60.54128 -3.08204  43.29280  1.000 131.41102 ? 91  GLU C CD  1 
ATOM   728  O  OE1 . GLU A 1 91  ? 61.04711 -2.13523  42.65289  1.000 132.55959 ? 91  GLU C OE1 1 
ATOM   729  O  OE2 . GLU A 1 91  ? 59.36807 -3.05061  43.72501  1.000 129.84748 ? 91  GLU C OE2 1 
ATOM   730  N  N   . ALA A 1 92  ? 62.94082 -7.56448  43.67149  1.000 128.67592 ? 92  ALA C N   1 
ATOM   731  C  CA  . ALA A 1 92  ? 62.48321 -8.90981  43.35982  1.000 128.70363 ? 92  ALA C CA  1 
ATOM   732  C  C   . ALA A 1 92  ? 61.10637 -8.84827  42.70729  1.000 129.66641 ? 92  ALA C C   1 
ATOM   733  O  O   . ALA A 1 92  ? 60.19708 -8.18715  43.21626  1.000 129.70457 ? 92  ALA C O   1 
ATOM   734  C  CB  . ALA A 1 92  ? 62.44553 -9.75874  44.63030  1.000 128.81117 ? 92  ALA C CB  1 
ATOM   735  N  N   . GLY A 1 93  ? 60.95273 -9.52641  41.56860  1.000 130.91945 ? 93  GLY C N   1 
ATOM   736  C  CA  . GLY A 1 93  ? 59.68687 -9.55157  40.86943  1.000 133.35693 ? 93  GLY C CA  1 
ATOM   737  C  C   . GLY A 1 93  ? 59.48573 -8.48024  39.81467  1.000 137.65917 ? 93  GLY C C   1 
ATOM   738  O  O   . GLY A 1 93  ? 58.52401 -8.57864  39.04276  1.000 139.81023 ? 93  GLY C O   1 
ATOM   739  N  N   . LYS A 1 94  ? 60.33554 -7.45354  39.76211  1.000 130.74378 ? 94  LYS C N   1 
ATOM   740  C  CA  . LYS A 1 94  ? 60.23762 -6.38543  38.76997  1.000 129.95447 ? 94  LYS C CA  1 
ATOM   741  C  C   . LYS A 1 94  ? 61.54291 -6.26181  37.98244  1.000 120.95250 ? 94  LYS C C   1 
ATOM   742  O  O   . LYS A 1 94  ? 62.57226 -6.84571  38.33400  1.000 119.76216 ? 94  LYS C O   1 
ATOM   743  C  CB  . LYS A 1 94  ? 59.89773 -5.04982  39.44940  1.000 137.84728 ? 94  LYS C CB  1 
ATOM   744  C  CG  . LYS A 1 94  ? 58.54330 -5.03050  40.15418  1.000 143.94373 ? 94  LYS C CG  1 
ATOM   745  C  CD  . LYS A 1 94  ? 58.24146 -3.65623  40.74520  1.000 149.68753 ? 94  LYS C CD  1 
ATOM   746  C  CE  . LYS A 1 94  ? 56.90538 -3.63646  41.47728  1.000 155.36257 ? 94  LYS C CE  1 
ATOM   747  N  NZ  . LYS A 1 94  ? 56.63610 -2.30694  42.10010  1.000 159.86869 ? 94  LYS C NZ  1 
ATOM   748  N  N   . VAL A 1 95  ? 61.48576 -5.51033  36.88191  1.000 115.43395 ? 95  VAL C N   1 
ATOM   749  C  CA  . VAL A 1 95  ? 62.66753 -5.16463  36.09195  1.000 109.97790 ? 95  VAL C CA  1 
ATOM   750  C  C   . VAL A 1 95  ? 62.50872 -3.73679  35.58451  1.000 108.83719 ? 95  VAL C C   1 
ATOM   751  O  O   . VAL A 1 95  ? 61.51980 -3.42510  34.91609  1.000 109.92419 ? 95  VAL C O   1 
ATOM   752  C  CB  . VAL A 1 95  ? 62.89512 -6.13125  34.91260  1.000 101.85754 ? 95  VAL C CB  1 
ATOM   753  C  CG1 . VAL A 1 95  ? 61.58543 -6.48655  34.22180  1.000 99.25498  ? 95  VAL C CG1 1 
ATOM   754  C  CG2 . VAL A 1 95  ? 63.86427 -5.52797  33.91504  1.000 97.20101  ? 95  VAL C CG2 1 
ATOM   755  N  N   . TYR A 1 96  ? 63.46987 -2.87147  35.88911  1.000 108.36823 ? 96  TYR C N   1 
ATOM   756  C  CA  . TYR A 1 96  ? 63.42122 -1.48244  35.44833  1.000 109.61301 ? 96  TYR C CA  1 
ATOM   757  C  C   . TYR A 1 96  ? 64.22071 -1.28238  34.15970  1.000 107.30759 ? 96  TYR C C   1 
ATOM   758  O  O   . TYR A 1 96  ? 65.15049 -2.03713  33.86390  1.000 108.25906 ? 96  TYR C O   1 
ATOM   759  C  CB  . TYR A 1 96  ? 63.92518 -0.54437  36.54768  1.000 115.05154 ? 96  TYR C CB  1 
ATOM   760  C  CG  . TYR A 1 96  ? 62.88185 -0.20505  37.59883  1.000 123.71917 ? 96  TYR C CG  1 
ATOM   761  C  CD1 . TYR A 1 96  ? 62.50238 -1.12834  38.57044  1.000 127.87761 ? 96  TYR C CD1 1 
ATOM   762  C  CD2 . TYR A 1 96  ? 62.28852 1.05558   37.62897  1.000 128.69149 ? 96  TYR C CD2 1 
ATOM   763  C  CE1 . TYR A 1 96  ? 61.54476 -0.80670  39.53391  1.000 133.73794 ? 96  TYR C CE1 1 
ATOM   764  C  CE2 . TYR A 1 96  ? 61.33879 1.38598   38.58542  1.000 132.78934 ? 96  TYR C CE2 1 
ATOM   765  C  CZ  . TYR A 1 96  ? 60.97017 0.45640   39.53427  1.000 136.29274 ? 96  TYR C CZ  1 
ATOM   766  O  OH  . TYR A 1 96  ? 60.02557 0.80199   40.47843  1.000 141.75585 ? 96  TYR C OH  1 
ATOM   767  N  N   . LEU A 1 97  ? 63.81623 -0.27712  33.36997  1.000 104.88194 ? 97  LEU C N   1 
ATOM   768  C  CA  . LEU A 1 97  ? 64.38176 -0.01645  32.04939  1.000 100.68128 ? 97  LEU C CA  1 
ATOM   769  C  C   . LEU A 1 97  ? 64.72032 1.46467   31.88696  1.000 104.94614 ? 97  LEU C C   1 
ATOM   770  O  O   . LEU A 1 97  ? 64.01916 2.33355   32.41139  1.000 108.52258 ? 97  LEU C O   1 
ATOM   771  C  CB  . LEU A 1 97  ? 63.41537 -0.45873  30.93641  1.000 94.17790  ? 97  LEU C CB  1 
ATOM   772  C  CG  . LEU A 1 97  ? 62.90777 -1.90513  30.96333  1.000 88.66256  ? 97  LEU C CG  1 
ATOM   773  C  CD1 . LEU A 1 97  ? 61.64968 -2.01369  30.15618  1.000 85.70109  ? 97  LEU C CD1 1 
ATOM   774  C  CD2 . LEU A 1 97  ? 63.93297 -2.85570  30.38797  1.000 85.96277  ? 97  LEU C CD2 1 
ATOM   775  N  N   . LYS A 1 98  ? 65.80607 1.74529   31.15936  1.000 105.06206 ? 98  LYS C N   1 
ATOM   776  C  CA  . LYS A 1 98  ? 66.28903 3.10221   30.89308  1.000 107.58159 ? 98  LYS C CA  1 
ATOM   777  C  C   . LYS A 1 98  ? 66.72283 3.20595   29.43703  1.000 105.69588 ? 98  LYS C C   1 
ATOM   778  O  O   . LYS A 1 98  ? 67.45106 2.33935   28.94747  1.000 105.98363 ? 98  LYS C O   1 
ATOM   779  C  CB  . LYS A 1 98  ? 67.46681 3.46653   31.80215  1.000 112.97430 ? 98  LYS C CB  1 
ATOM   780  C  CG  . LYS A 1 98  ? 68.01958 4.87635   31.58795  1.000 118.50318 ? 98  LYS C CG  1 
ATOM   781  C  CD  . LYS A 1 98  ? 69.28464 5.11558   32.40886  1.000 123.58516 ? 98  LYS C CD  1 
ATOM   782  C  CE  . LYS A 1 98  ? 69.86836 6.49488   32.13696  1.000 130.19884 ? 98  LYS C CE  1 
ATOM   783  N  NZ  . LYS A 1 98  ? 71.16154 6.70532   32.84709  1.000 130.54129 ? 98  LYS C NZ  1 
ATOM   784  N  N   . ALA A 1 99  ? 66.30022 4.26344   28.74521  1.000 105.13337 ? 99  ALA C N   1 
ATOM   785  C  CA  . ALA A 1 99  ? 66.54074 4.37703   27.30630  1.000 103.62352 ? 99  ALA C CA  1 
ATOM   786  C  C   . ALA A 1 99  ? 66.76417 5.83084   26.90634  1.000 105.46714 ? 99  ALA C C   1 
ATOM   787  O  O   . ALA A 1 99  ? 65.80034 6.57845   26.68114  1.000 106.23013 ? 99  ALA C O   1 
ATOM   788  C  CB  . ALA A 1 99  ? 65.39008 3.77147   26.50795  1.000 101.28610 ? 99  ALA C CB  1 
ATOM   789  N  N   . PRO A 1 100 ? 68.01752 6.26383   26.77945  1.000 106.43390 ? 100 PRO C N   1 
ATOM   790  C  CA  . PRO A 1 100 ? 68.28221 7.58135   26.19265  1.000 108.29040 ? 100 PRO C CA  1 
ATOM   791  C  C   . PRO A 1 100 ? 68.29969 7.49802   24.67237  1.000 109.30971 ? 100 PRO C C   1 
ATOM   792  O  O   . PRO A 1 100 ? 68.87689 6.57641   24.08856  1.000 109.19016 ? 100 PRO C O   1 
ATOM   793  C  CB  . PRO A 1 100 ? 69.66555 7.93726   26.74788  1.000 108.67555 ? 100 PRO C CB  1 
ATOM   794  C  CG  . PRO A 1 100 ? 70.32374 6.63203   26.91900  1.000 106.25291 ? 100 PRO C CG  1 
ATOM   795  C  CD  . PRO A 1 100 ? 69.24429 5.65827   27.32365  1.000 106.07093 ? 100 PRO C CD  1 
ATOM   796  N  N   . MET A 1 101 ? 67.64364 8.46586   24.03148  1.000 110.82200 ? 101 MET C N   1 
ATOM   797  C  CA  . MET A 1 101 ? 67.53360 8.50571   22.57433  1.000 110.11238 ? 101 MET C CA  1 
ATOM   798  C  C   . MET A 1 101 ? 67.04228 9.88389   22.14789  1.000 109.16593 ? 101 MET C C   1 
ATOM   799  O  O   . MET A 1 101 ? 66.55141 10.66875  22.96315  1.000 110.89112 ? 101 MET C O   1 
ATOM   800  C  CB  . MET A 1 101 ? 66.59925 7.40669   22.05730  1.000 108.92597 ? 101 MET C CB  1 
ATOM   801  C  CG  . MET A 1 101 ? 65.35355 7.24451   22.90729  1.000 111.01979 ? 101 MET C CG  1 
ATOM   802  S  SD  . MET A 1 101 ? 64.43280 5.72077   22.61582  1.000 110.64019 ? 101 MET C SD  1 
ATOM   803  C  CE  . MET A 1 101 ? 62.99208 6.01140   23.63880  1.000 112.18633 ? 101 MET C CE  1 
ATOM   804  N  N   . ILE A 1 102 ? 67.18318 10.16440  20.85064  1.000 107.27835 ? 102 ILE C N   1 
ATOM   805  C  CA  . ILE A 1 102 ? 66.79777 11.44137  20.25019  1.000 107.41020 ? 102 ILE C CA  1 
ATOM   806  C  C   . ILE A 1 102 ? 65.62810 11.17443  19.30956  1.000 106.11838 ? 102 ILE C C   1 
ATOM   807  O  O   . ILE A 1 102 ? 65.78087 10.51766  18.27072  1.000 102.27105 ? 102 ILE C O   1 
ATOM   808  C  CB  . ILE A 1 102 ? 67.97271 12.10834  19.51717  1.000 104.96818 ? 102 ILE C CB  1 
ATOM   809  C  CG1 . ILE A 1 102 ? 69.18939 12.16665  20.43109  1.000 105.68899 ? 102 ILE C CG1 1 
ATOM   810  C  CG2 . ILE A 1 102 ? 67.61617 13.51036  19.06270  1.000 106.27462 ? 102 ILE C CG2 1 
ATOM   811  C  CD1 . ILE A 1 102 ? 70.40870 12.77540  19.78177  1.000 107.36099 ? 102 ILE C CD1 1 
ATOM   812  N  N   . LEU A 1 103 ? 64.46222 11.69502  19.67359  1.000 108.85830 ? 103 LEU C N   1 
ATOM   813  C  CA  . LEU A 1 103 ? 63.22077 11.47199  18.94806  1.000 101.80473 ? 103 LEU C CA  1 
ATOM   814  C  C   . LEU A 1 103 ? 62.76658 12.78200  18.31747  1.000 100.40949 ? 103 LEU C C   1 
ATOM   815  O  O   . LEU A 1 103 ? 62.39330 13.71777  19.03437  1.000 102.44462 ? 103 LEU C O   1 
ATOM   816  C  CB  . LEU A 1 103 ? 62.15342 10.94336  19.90207  1.000 101.07650 ? 103 LEU C CB  1 
ATOM   817  C  CG  . LEU A 1 103 ? 62.38261 9.55458   20.47846  1.000 99.20145  ? 103 LEU C CG  1 
ATOM   818  C  CD1 . LEU A 1 103 ? 61.25750 9.23407   21.45469  1.000 99.62038  ? 103 LEU C CD1 1 
ATOM   819  C  CD2 . LEU A 1 103 ? 62.45622 8.53421   19.34057  1.000 97.43608  ? 103 LEU C CD2 1 
ATOM   820  N  N   . ASN A 1 104 ? 62.75068 12.83343  16.98748  1.000 97.60158  ? 104 ASN C N   1 
ATOM   821  C  CA  . ASN A 1 104 ? 62.38360 14.04871  16.26371  1.000 99.43909  ? 104 ASN C CA  1 
ATOM   822  C  C   . ASN A 1 104 ? 63.20262 15.25248  16.73923  1.000 104.22788 ? 104 ASN C C   1 
ATOM   823  O  O   . ASN A 1 104 ? 62.67311 16.33395  17.00619  1.000 108.29675 ? 104 ASN C O   1 
ATOM   824  C  CB  . ASN A 1 104 ? 60.88541 14.32942  16.40477  1.000 97.90665  ? 104 ASN C CB  1 
ATOM   825  C  CG  . ASN A 1 104 ? 60.03466 13.37861  15.59490  1.000 95.23074  ? 104 ASN C CG  1 
ATOM   826  O  OD1 . ASN A 1 104 ? 60.53624 12.67508  14.71920  1.000 93.87794  ? 104 ASN C OD1 1 
ATOM   827  N  ND2 . ASN A 1 104 ? 58.73210 13.35903  15.87228  1.000 94.52266  ? 104 ASN C ND2 1 
ATOM   828  N  N   . GLY A 1 105 ? 64.51965 15.07026  16.82282  1.000 103.27876 ? 105 GLY C N   1 
ATOM   829  C  CA  . GLY A 1 105 ? 65.38557 16.12553  17.30571  1.000 107.90898 ? 105 GLY C CA  1 
ATOM   830  C  C   . GLY A 1 105 ? 65.25121 16.45147  18.77958  1.000 112.13026 ? 105 GLY C C   1 
ATOM   831  O  O   . GLY A 1 105 ? 65.99730 17.30678  19.27881  1.000 113.96437 ? 105 GLY C O   1 
ATOM   832  N  N   . VAL A 1 106 ? 64.34467 15.78613  19.49160  1.000 112.09179 ? 106 VAL C N   1 
ATOM   833  C  CA  . VAL A 1 106 ? 64.09746 16.00547  20.91306  1.000 114.34923 ? 106 VAL C CA  1 
ATOM   834  C  C   . VAL A 1 106 ? 64.85290 14.94232  21.69982  1.000 118.92571 ? 106 VAL C C   1 
ATOM   835  O  O   . VAL A 1 106 ? 64.54529 13.74994  21.60073  1.000 119.57263 ? 106 VAL C O   1 
ATOM   836  C  CB  . VAL A 1 106 ? 62.59806 15.95342  21.23333  1.000 110.43452 ? 106 VAL C CB  1 
ATOM   837  C  CG1 . VAL A 1 106 ? 62.34361 16.26248  22.70739  1.000 110.85383 ? 106 VAL C CG1 1 
ATOM   838  C  CG2 . VAL A 1 106 ? 61.83955 16.89658  20.32511  1.000 110.99047 ? 106 VAL C CG2 1 
ATOM   839  N  N   . CYS A 1 107 ? 65.83944 15.36133  22.48793  1.000 122.51736 ? 107 CYS C N   1 
ATOM   840  C  CA  . CYS A 1 107 ? 66.54638 14.42945  23.35913  1.000 124.27988 ? 107 CYS C CA  1 
ATOM   841  C  C   . CYS A 1 107 ? 65.64074 14.04814  24.52879  1.000 122.57453 ? 107 CYS C C   1 
ATOM   842  O  O   . CYS A 1 107 ? 65.17839 14.92581  25.26933  1.000 125.35206 ? 107 CYS C O   1 
ATOM   843  C  CB  . CYS A 1 107 ? 67.83972 15.06393  23.86754  1.000 128.68818 ? 107 CYS C CB  1 
ATOM   844  S  SG  . CYS A 1 107 ? 68.91521 15.77222  22.58936  1.000 132.72198 ? 107 CYS C SG  1 
ATOM   845  N  N   . VAL A 1 108 ? 65.40276 12.74150  24.70984  1.000 118.85385 ? 108 VAL C N   1 
ATOM   846  C  CA  . VAL A 1 108 ? 64.51575 12.23596  25.75277  1.000 117.42817 ? 108 VAL C CA  1 
ATOM   847  C  C   . VAL A 1 108 ? 65.19830 11.11116  26.52732  1.000 117.40980 ? 108 VAL C C   1 
ATOM   848  O  O   . VAL A 1 108 ? 66.18586 10.51896  26.08246  1.000 115.52669 ? 108 VAL C O   1 
ATOM   849  C  CB  . VAL A 1 108 ? 63.16061 11.74010  25.19246  1.000 114.28093 ? 108 VAL C CB  1 
ATOM   850  C  CG1 . VAL A 1 108 ? 62.37499 12.89224  24.60360  1.000 114.63896 ? 108 VAL C CG1 1 
ATOM   851  C  CG2 . VAL A 1 108 ? 63.37405 10.65094  24.14256  1.000 112.68186 ? 108 VAL C CG2 1 
ATOM   852  N  N   . ILE A 1 109 ? 64.65040 10.82772  27.71164  1.000 119.52111 ? 109 ILE C N   1 
ATOM   853  C  CA  . ILE A 1 109 ? 65.01902 9.67188   28.52300  1.000 120.06223 ? 109 ILE C CA  1 
ATOM   854  C  C   . ILE A 1 109 ? 63.74691 8.90557   28.86148  1.000 123.27650 ? 109 ILE C C   1 
ATOM   855  O  O   . ILE A 1 109 ? 62.78640 9.49083   29.37464  1.000 124.98402 ? 109 ILE C O   1 
ATOM   856  C  CB  . ILE A 1 109 ? 65.74422 10.08475  29.81851  1.000 122.87275 ? 109 ILE C CB  1 
ATOM   857  C  CG1 . ILE A 1 109 ? 66.98554 10.92442  29.51249  1.000 121.91345 ? 109 ILE C CG1 1 
ATOM   858  C  CG2 . ILE A 1 109 ? 66.11988 8.85893   30.63567  1.000 123.47159 ? 109 ILE C CG2 1 
ATOM   859  C  CD1 . ILE A 1 109 ? 68.11380 10.14000  28.92525  1.000 119.31244 ? 109 ILE C CD1 1 
ATOM   860  N  N   . TRP A 1 110 ? 63.73348 7.60594   28.57217  1.000 123.31038 ? 110 TRP C N   1 
ATOM   861  C  CA  . TRP A 1 110 ? 62.58249 6.74790   28.83447  1.000 120.52777 ? 110 TRP C CA  1 
ATOM   862  C  C   . TRP A 1 110 ? 62.88661 5.82124   30.00414  1.000 122.26355 ? 110 TRP C C   1 
ATOM   863  O  O   . TRP A 1 110 ? 63.94352 5.18254   30.03588  1.000 122.28310 ? 110 TRP C O   1 
ATOM   864  C  CB  . TRP A 1 110 ? 62.19431 5.93501   27.60095  1.000 115.65799 ? 110 TRP C CB  1 
ATOM   865  C  CG  . TRP A 1 110 ? 60.87993 5.24101   27.75428  1.000 112.90856 ? 110 TRP C CG  1 
ATOM   866  C  CD1 . TRP A 1 110 ? 59.66087 5.69998   27.35201  1.000 113.57441 ? 110 TRP C CD1 1 
ATOM   867  C  CD2 . TRP A 1 110 ? 60.64979 3.95819   28.34831  1.000 109.99769 ? 110 TRP C CD2 1 
ATOM   868  N  NE1 . TRP A 1 110 ? 58.68192 4.78331   27.66169  1.000 111.86929 ? 110 TRP C NE1 1 
ATOM   869  C  CE2 . TRP A 1 110 ? 59.26531 3.70500   28.27322  1.000 109.88399 ? 110 TRP C CE2 1 
ATOM   870  C  CE3 . TRP A 1 110 ? 61.47914 2.99834   28.93546  1.000 109.80488 ? 110 TRP C CE3 1 
ATOM   871  C  CZ2 . TRP A 1 110 ? 58.69252 2.53287   28.76279  1.000 108.73379 ? 110 TRP C CZ2 1 
ATOM   872  C  CZ3 . TRP A 1 110 ? 60.90693 1.83365   29.42191  1.000 109.25212 ? 110 TRP C CZ3 1 
ATOM   873  C  CH2 . TRP A 1 110 ? 59.52893 1.61295   29.33206  1.000 108.34078 ? 110 TRP C CH2 1 
ATOM   874  N  N   . LYS A 1 111 ? 61.97081 5.77778   30.97355  1.000 126.38497 ? 111 LYS C N   1 
ATOM   875  C  CA  . LYS A 1 111 ? 62.09700 4.96781   32.17758  1.000 125.60736 ? 111 LYS C CA  1 
ATOM   876  C  C   . LYS A 1 111 ? 60.84080 4.12211   32.35461  1.000 119.22804 ? 111 LYS C C   1 
ATOM   877  O  O   . LYS A 1 111 ? 59.72448 4.62733   32.20281  1.000 120.40759 ? 111 LYS C O   1 
ATOM   878  C  CB  . LYS A 1 111 ? 62.29698 5.87328   33.39327  1.000 131.38105 ? 111 LYS C CB  1 
ATOM   879  C  CG  . LYS A 1 111 ? 63.51039 6.78363   33.28780  1.000 137.31732 ? 111 LYS C CG  1 
ATOM   880  C  CD  . LYS A 1 111 ? 63.55791 7.73830   34.46726  1.000 145.88902 ? 111 LYS C CD  1 
ATOM   881  C  CE  . LYS A 1 111 ? 64.70078 8.73874   34.35531  1.000 147.05557 ? 111 LYS C CE  1 
ATOM   882  N  NZ  . LYS A 1 111 ? 64.63328 9.78508   35.41888  1.000 150.02336 ? 111 LYS C NZ  1 
ATOM   883  N  N   . GLY A 1 112 ? 61.01781 2.83714   32.66443  1.000 114.87588 ? 112 GLY C N   1 
ATOM   884  C  CA  . GLY A 1 112 ? 59.86866 1.96682   32.84252  1.000 110.90448 ? 112 GLY C CA  1 
ATOM   885  C  C   . GLY A 1 112 ? 60.21244 0.69429   33.58963  1.000 106.52846 ? 112 GLY C C   1 
ATOM   886  O  O   . GLY A 1 112 ? 61.35838 0.46738   33.98874  1.000 106.33211 ? 112 GLY C O   1 
ATOM   887  N  N   . TRP A 1 113 ? 59.20108 -0.16627  33.72869  1.000 102.21569 ? 113 TRP C N   1 
ATOM   888  C  CA  . TRP A 1 113 ? 59.35795 -1.41119  34.46585  1.000 99.56172  ? 113 TRP C CA  1 
ATOM   889  C  C   . TRP A 1 113 ? 58.40860 -2.46804  33.91621  1.000 95.68602  ? 113 TRP C C   1 
ATOM   890  O  O   . TRP A 1 113 ? 57.41469 -2.15579  33.25402  1.000 96.98367  ? 113 TRP C O   1 
ATOM   891  C  CB  . TRP A 1 113 ? 59.13235 -1.20443  35.97383  1.000 105.10994 ? 113 TRP C CB  1 
ATOM   892  C  CG  . TRP A 1 113 ? 57.83612 -0.54492  36.33987  1.000 107.54132 ? 113 TRP C CG  1 
ATOM   893  C  CD1 . TRP A 1 113 ? 57.63138 0.78290   36.57465  1.000 111.64597 ? 113 TRP C CD1 1 
ATOM   894  C  CD2 . TRP A 1 113 ? 56.56711 -1.18465  36.52464  1.000 108.68553 ? 113 TRP C CD2 1 
ATOM   895  N  NE1 . TRP A 1 113 ? 56.31382 1.00953   36.88963  1.000 115.77888 ? 113 TRP C NE1 1 
ATOM   896  C  CE2 . TRP A 1 113 ? 55.63884 -0.18162  36.86358  1.000 113.01703 ? 113 TRP C CE2 1 
ATOM   897  C  CE3 . TRP A 1 113 ? 56.12458 -2.50811  36.43143  1.000 108.57647 ? 113 TRP C CE3 1 
ATOM   898  C  CZ2 . TRP A 1 113 ? 54.29646 -0.45785  37.10981  1.000 114.22048 ? 113 TRP C CZ2 1 
ATOM   899  C  CZ3 . TRP A 1 113 ? 54.79001 -2.78043  36.67498  1.000 110.91970 ? 113 TRP C CZ3 1 
ATOM   900  C  CH2 . TRP A 1 113 ? 53.89255 -1.75938  37.01083  1.000 113.60272 ? 113 TRP C CH2 1 
ATOM   901  N  N   . ILE A 1 114 ? 58.74621 -3.73108  34.16521  1.000 91.08138  ? 114 ILE C N   1 
ATOM   902  C  CA  . ILE A 1 114 ? 57.90857 -4.86742  33.79598  1.000 87.31708  ? 114 ILE C CA  1 
ATOM   903  C  C   . ILE A 1 114 ? 57.72742 -5.79403  34.99386  1.000 89.47870  ? 114 ILE C C   1 
ATOM   904  O  O   . ILE A 1 114 ? 58.69515 -6.13332  35.68477  1.000 89.74510  ? 114 ILE C O   1 
ATOM   905  C  CB  . ILE A 1 114 ? 58.50954 -5.64448  32.61043  1.000 82.69666  ? 114 ILE C CB  1 
ATOM   906  C  CG1 . ILE A 1 114 ? 58.56484 -4.76092  31.35780  1.000 78.53825  ? 114 ILE C CG1 1 
ATOM   907  C  CG2 . ILE A 1 114 ? 57.69462 -6.89222  32.33094  1.000 82.33693  ? 114 ILE C CG2 1 
ATOM   908  C  CD1 . ILE A 1 114 ? 57.21794 -4.48168  30.78475  1.000 77.55473  ? 114 ILE C CD1 1 
ATOM   909  N  N   . ASP A 1 115 ? 56.49365 -6.23985  35.21808  1.000 92.52741  ? 115 ASP C N   1 
ATOM   910  C  CA  . ASP A 1 115 ? 56.23133 -7.22519  36.25659  1.000 97.96854  ? 115 ASP C CA  1 
ATOM   911  C  C   . ASP A 1 115 ? 56.65540 -8.59848  35.74882  1.000 101.45931 ? 115 ASP C C   1 
ATOM   912  O  O   . ASP A 1 115 ? 56.21833 -9.03075  34.67983  1.000 98.62148  ? 115 ASP C O   1 
ATOM   913  C  CB  . ASP A 1 115 ? 54.75202 -7.21278  36.62135  1.000 100.53162 ? 115 ASP C CB  1 
ATOM   914  C  CG  . ASP A 1 115 ? 54.44865 -8.03546  37.85056  1.000 106.40615 ? 115 ASP C CG  1 
ATOM   915  O  OD1 . ASP A 1 115 ? 55.39737 -8.52520  38.50270  1.000 110.14689 ? 115 ASP C OD1 1 
ATOM   916  O  OD2 . ASP A 1 115 ? 53.24942 -8.18446  38.16770  1.000 107.51549 ? 115 ASP C OD2 1 
ATOM   917  N  N   . LEU A 1 116 ? 57.51015 -9.28580  36.51474  1.000 107.48262 ? 116 LEU C N   1 
ATOM   918  C  CA  . LEU A 1 116 ? 58.04877 -10.56301 36.04673  1.000 109.50925 ? 116 LEU C CA  1 
ATOM   919  C  C   . LEU A 1 116 ? 56.97995 -11.64084 35.94108  1.000 112.91094 ? 116 LEU C C   1 
ATOM   920  O  O   . LEU A 1 116 ? 57.07451 -12.51230 35.07004  1.000 111.83235 ? 116 LEU C O   1 
ATOM   921  C  CB  . LEU A 1 116 ? 59.17186 -11.04392 36.96482  1.000 112.37486 ? 116 LEU C CB  1 
ATOM   922  C  CG  . LEU A 1 116 ? 60.60304 -10.63591 36.60810  1.000 112.44976 ? 116 LEU C CG  1 
ATOM   923  C  CD1 . LEU A 1 116 ? 60.71134 -9.13467  36.52801  1.000 114.33853 ? 116 LEU C CD1 1 
ATOM   924  C  CD2 . LEU A 1 116 ? 61.61471 -11.18917 37.60779  1.000 114.42192 ? 116 LEU C CD2 1 
ATOM   925  N  N   . GLN A 1 117 ? 55.95584 -11.60556 36.79555  1.000 117.58209 ? 117 GLN C N   1 
ATOM   926  C  CA  . GLN A 1 117 ? 54.93210 -12.63934 36.68979  1.000 119.73530 ? 117 GLN C CA  1 
ATOM   927  C  C   . GLN A 1 117 ? 53.92730 -12.32195 35.58875  1.000 112.76216 ? 117 GLN C C   1 
ATOM   928  O  O   . GLN A 1 117 ? 53.51576 -13.22529 34.85610  1.000 109.67990 ? 117 GLN C O   1 
ATOM   929  C  CB  . GLN A 1 117 ? 54.22276 -12.86043 38.02819  1.000 129.36440 ? 117 GLN C CB  1 
ATOM   930  C  CG  . GLN A 1 117 ? 53.54009 -14.23469 38.10664  1.000 136.58903 ? 117 GLN C CG  1 
ATOM   931  C  CD  . GLN A 1 117 ? 52.93460 -14.52889 39.46526  1.000 148.69982 ? 117 GLN C CD  1 
ATOM   932  O  OE1 . GLN A 1 117 ? 52.83016 -13.64347 40.31166  1.000 157.91217 ? 117 GLN C OE1 1 
ATOM   933  N  NE2 . GLN A 1 117 ? 52.54259 -15.78250 39.68531  1.000 150.17293 ? 117 GLN C NE2 1 
ATOM   934  N  N   . ARG A 1 118 ? 53.51791 -11.05811 35.43964  1.000 113.91616 ? 118 ARG C N   1 
ATOM   935  C  CA  . ARG A 1 118 ? 52.51018 -10.75692 34.42639  1.000 111.95114 ? 118 ARG C CA  1 
ATOM   936  C  C   . ARG A 1 118 ? 53.08778 -10.39624 33.06327  1.000 109.13771 ? 118 ARG C C   1 
ATOM   937  O  O   . ARG A 1 118 ? 52.37866 -10.53961 32.06200  1.000 104.75570 ? 118 ARG C O   1 
ATOM   938  C  CB  . ARG A 1 118 ? 51.58792 -9.60558  34.83416  1.000 114.93921 ? 118 ARG C CB  1 
ATOM   939  C  CG  . ARG A 1 118 ? 50.76365 -9.79646  36.07921  1.000 118.38023 ? 118 ARG C CG  1 
ATOM   940  C  CD  . ARG A 1 118 ? 49.87552 -8.58306  36.20566  1.000 120.18774 ? 118 ARG C CD  1 
ATOM   941  N  NE  . ARG A 1 118 ? 50.63467 -7.33875  36.13892  1.000 121.58789 ? 118 ARG C NE  1 
ATOM   942  C  CZ  . ARG A 1 118 ? 50.07930 -6.15328  35.90787  1.000 123.54928 ? 118 ARG C CZ  1 
ATOM   943  N  NH1 . ARG A 1 118 ? 48.76810 -6.06778  35.71674  1.000 123.96739 ? 118 ARG C NH1 1 
ATOM   944  N  NH2 . ARG A 1 118 ? 50.82784 -5.05795  35.85247  1.000 124.17039 ? 118 ARG C NH2 1 
ATOM   945  N  N   . LEU A 1 119 ? 54.33587 -9.92635  32.99481  1.000 109.92577 ? 119 LEU C N   1 
ATOM   946  C  CA  . LEU A 1 119 ? 54.96452 -9.45764  31.75913  1.000 107.97063 ? 119 LEU C CA  1 
ATOM   947  C  C   . LEU A 1 119 ? 54.33387 -8.16483  31.23541  1.000 113.77092 ? 119 LEU C C   1 
ATOM   948  O  O   . LEU A 1 119 ? 54.45992 -7.84379  30.04890  1.000 114.09337 ? 119 LEU C O   1 
ATOM   949  C  CB  . LEU A 1 119 ? 54.94512 -10.54804 30.68067  1.000 98.89903  ? 119 LEU C CB  1 
ATOM   950  C  CG  . LEU A 1 119 ? 55.74806 -11.79887 31.06118  1.000 96.44769  ? 119 LEU C CG  1 
ATOM   951  C  CD1 . LEU A 1 119 ? 55.84042 -12.78856 29.90670  1.000 91.54389  ? 119 LEU C CD1 1 
ATOM   952  C  CD2 . LEU A 1 119 ? 57.13840 -11.43397 31.57585  1.000 96.56354  ? 119 LEU C CD2 1 
ATOM   953  N  N   . ASP A 1 120 ? 53.68974 -7.39830  32.11420  1.000 119.27065 ? 120 ASP C N   1 
ATOM   954  C  CA  . ASP A 1 120 ? 53.09092 -6.10657  31.81309  1.000 116.54390 ? 120 ASP C CA  1 
ATOM   955  C  C   . ASP A 1 120 ? 53.89205 -5.00802  32.50540  1.000 112.88724 ? 120 ASP C C   1 
ATOM   956  O  O   . ASP A 1 120 ? 54.69063 -5.27296  33.40772  1.000 113.02568 ? 120 ASP C O   1 
ATOM   957  C  CB  . ASP A 1 120 ? 51.62604 -6.10929  32.28703  1.000 125.05192 ? 120 ASP C CB  1 
ATOM   958  C  CG  . ASP A 1 120 ? 50.99872 -4.72108  32.34909  1.000 134.21164 ? 120 ASP C CG  1 
ATOM   959  O  OD1 . ASP A 1 120 ? 51.19174 -4.00485  33.36224  1.000 137.12515 ? 120 ASP C OD1 1 
ATOM   960  O  OD2 . ASP A 1 120 ? 50.27625 -4.36109  31.39599  1.000 137.17473 ? 120 ASP C OD2 1 
ATOM   961  N  N   . GLY A 1 121 ? 53.68881 -3.76879  32.07394  1.000 112.19342 ? 121 GLY C N   1 
ATOM   962  C  CA  . GLY A 1 121 ? 54.42271 -2.67978  32.68452  1.000 112.46017 ? 121 GLY C CA  1 
ATOM   963  C  C   . GLY A 1 121 ? 53.90563 -1.32299  32.26249  1.000 110.06066 ? 121 GLY C C   1 
ATOM   964  O  O   . GLY A 1 121 ? 52.88416 -1.20510  31.58229  1.000 108.83523 ? 121 GLY C O   1 
ATOM   965  N  N   . MET A 1 122 ? 54.64088 -0.29428  32.68897  1.000 108.89955 ? 122 MET C N   1 
ATOM   966  C  CA  . MET A 1 122 ? 54.33565 1.10221   32.40309  1.000 108.72874 ? 122 MET C CA  1 
ATOM   967  C  C   . MET A 1 122 ? 55.63969 1.85653   32.17313  1.000 102.89219 ? 122 MET C C   1 
ATOM   968  O  O   . MET A 1 122 ? 56.73283 1.34426   32.43272  1.000 99.93872  ? 122 MET C O   1 
ATOM   969  C  CB  . MET A 1 122 ? 53.54904 1.76246   33.54904  1.000 118.88676 ? 122 MET C CB  1 
ATOM   970  C  CG  . MET A 1 122 ? 52.13744 1.23099   33.76852  1.000 128.29664 ? 122 MET C CG  1 
ATOM   971  S  SD  . MET A 1 122 ? 51.52656 1.56861   35.43842  1.000 143.63129 ? 122 MET C SD  1 
ATOM   972  C  CE  . MET A 1 122 ? 51.81330 3.32975   35.59201  1.000 147.97771 ? 122 MET C CE  1 
ATOM   973  N  N   . GLY A 1 123 ? 55.52450 3.06973   31.64652  1.000 101.72118 ? 123 GLY C N   1 
ATOM   974  C  CA  . GLY A 1 123 ? 56.69145 3.91551   31.47399  1.000 101.27195 ? 123 GLY C CA  1 
ATOM   975  C  C   . GLY A 1 123 ? 56.31947 5.28089   30.94284  1.000 101.28174 ? 123 GLY C C   1 
ATOM   976  O  O   . GLY A 1 123 ? 55.27017 5.46043   30.31382  1.000 97.95133  ? 123 GLY C O   1 
ATOM   977  N  N   . CYS A 1 124 ? 57.21190 6.24281   31.18294  1.000 105.81895 ? 124 CYS C N   1 
ATOM   978  C  CA  . CYS A 1 124 ? 56.99432 7.60510   30.72100  1.000 109.58798 ? 124 CYS C CA  1 
ATOM   979  C  C   . CYS A 1 124 ? 58.31799 8.22620   30.29037  1.000 112.86516 ? 124 CYS C C   1 
ATOM   980  O  O   . CYS A 1 124 ? 59.39814 7.77138   30.67604  1.000 111.66796 ? 124 CYS C O   1 
ATOM   981  C  CB  . CYS A 1 124 ? 56.30020 8.45955   31.79087  1.000 114.87226 ? 124 CYS C CB  1 
ATOM   982  S  SG  . CYS A 1 124 ? 57.15082 8.57911   33.36397  1.000 119.03235 ? 124 CYS C SG  1 
ATOM   983  N  N   . LEU A 1 125 ? 58.21660 9.27936   29.48102  1.000 114.56132 ? 125 LEU C N   1 
ATOM   984  C  CA  . LEU A 1 125 ? 59.37056 9.96521   28.91085  1.000 117.85995 ? 125 LEU C CA  1 
ATOM   985  C  C   . LEU A 1 125 ? 59.86383 11.09213  29.81374  1.000 127.35487 ? 125 LEU C C   1 
ATOM   986  O  O   . LEU A 1 125 ? 59.10643 11.66826  30.60107  1.000 128.20442 ? 125 LEU C O   1 
ATOM   987  C  CB  . LEU A 1 125 ? 59.03862 10.53542  27.53047  1.000 113.64508 ? 125 LEU C CB  1 
ATOM   988  C  CG  . LEU A 1 125 ? 59.06887 9.60079   26.32050  1.000 108.86879 ? 125 LEU C CG  1 
ATOM   989  C  CD1 . LEU A 1 125 ? 57.92944 8.60548   26.35102  1.000 107.98342 ? 125 LEU C CD1 1 
ATOM   990  C  CD2 . LEU A 1 125 ? 59.01790 10.41276  25.04539  1.000 107.36467 ? 125 LEU C CD2 1 
ATOM   991  N  N   . GLU A 1 126 ? 61.15279 11.41041  29.67830  1.000 135.24940 ? 126 GLU C N   1 
ATOM   992  C  CA  . GLU A 1 126 ? 61.78197 12.48999  30.42815  1.000 141.37009 ? 126 GLU C CA  1 
ATOM   993  C  C   . GLU A 1 126 ? 62.66659 13.31539  29.50058  1.000 142.41047 ? 126 GLU C C   1 
ATOM   994  O  O   . GLU A 1 126 ? 63.25466 12.78896  28.55338  1.000 140.78079 ? 126 GLU C O   1 
ATOM   995  C  CB  . GLU A 1 126 ? 62.62095 11.94580  31.59929  1.000 145.97407 ? 126 GLU C CB  1 
ATOM   996  C  CG  . GLU A 1 126 ? 61.87447 11.02320  32.57087  1.000 146.90192 ? 126 GLU C CG  1 
ATOM   997  C  CD  . GLU A 1 126 ? 60.82391 11.73093  33.41865  1.000 149.86733 ? 126 GLU C CD  1 
ATOM   998  O  OE1 . GLU A 1 126 ? 60.52909 12.91807  33.16617  1.000 152.23254 ? 126 GLU C OE1 1 
ATOM   999  O  OE2 . GLU A 1 126 ? 60.28971 11.08993  34.34979  1.000 150.24651 ? 126 GLU C OE2 1 
ATOM   1000 N  N   . PHE A 1 127 ? 62.72971 14.62256  29.76405  1.000 147.44543 ? 127 PHE C N   1 
ATOM   1001 C  CA  . PHE A 1 127 ? 63.56554 15.52899  28.98202  1.000 147.81167 ? 127 PHE C CA  1 
ATOM   1002 C  C   . PHE A 1 127 ? 65.02556 15.44480  29.42534  1.000 151.71451 ? 127 PHE C C   1 
ATOM   1003 O  O   . PHE A 1 127 ? 65.32498 15.35415  30.62051  1.000 155.59654 ? 127 PHE C O   1 
ATOM   1004 C  CB  . PHE A 1 127 ? 63.04885 16.96611  29.11404  1.000 141.41941 ? 127 PHE C CB  1 
ATOM   1005 C  CG  . PHE A 1 127 ? 63.66116 17.93247  28.13267  1.000 133.59889 ? 127 PHE C CG  1 
ATOM   1006 C  CD1 . PHE A 1 127 ? 63.16707 18.03198  26.84291  1.000 129.73003 ? 127 PHE C CD1 1 
ATOM   1007 C  CD2 . PHE A 1 127 ? 64.71268 18.75035  28.49843  1.000 129.59673 ? 127 PHE C CD2 1 
ATOM   1008 C  CE1 . PHE A 1 127 ? 63.72103 18.91689  25.93361  1.000 127.50871 ? 127 PHE C CE1 1 
ATOM   1009 C  CE2 . PHE A 1 127 ? 65.26288 19.63948  27.59113  1.000 127.87656 ? 127 PHE C CE2 1 
ATOM   1010 C  CZ  . PHE A 1 127 ? 64.77014 19.72021  26.31005  1.000 126.38963 ? 127 PHE C CZ  1 
ATOM   1011 N  N   . ASP A 1 128 ? 65.93462 15.47195  28.45088  1.000 183.25000 ? 128 ASP C N   1 
ATOM   1012 C  CA  . ASP A 1 128 ? 67.38056 15.39344  28.67650  1.000 185.34522 ? 128 ASP C CA  1 
ATOM   1013 C  C   . ASP A 1 128 ? 68.01734 16.70003  28.19934  1.000 187.86914 ? 128 ASP C C   1 
ATOM   1014 O  O   . ASP A 1 128 ? 68.62005 16.75547  27.12407  1.000 185.66046 ? 128 ASP C O   1 
ATOM   1015 C  CB  . ASP A 1 128 ? 67.97616 14.14213  27.94209  1.000 182.71189 ? 128 ASP C CB  1 
ATOM   1016 C  CG  . ASP A 1 128 ? 69.42111 13.85603  28.32857  1.000 183.20072 ? 128 ASP C CG  1 
ATOM   1017 O  OD1 . ASP A 1 128 ? 70.15302 14.80282  28.68328  1.000 185.19514 ? 128 ASP C OD1 1 
ATOM   1018 O  OD2 . ASP A 1 128 ? 69.82921 12.67655  28.27339  1.000 182.72214 ? 128 ASP C OD2 1 
ATOM   1019 N  N   . GLU A 1 129 ? 67.89606 17.75399  29.01416  1.000 192.32477 ? 129 GLU C N   1 
ATOM   1020 C  CA  . GLU A 1 129 ? 68.44117 19.04918  28.62038  1.000 191.63717 ? 129 GLU C CA  1 
ATOM   1021 C  C   . GLU A 1 129 ? 69.96030 19.04073  28.56724  1.000 195.37447 ? 129 GLU C C   1 
ATOM   1022 O  O   . GLU A 1 129 ? 70.55124 19.94367  27.96461  1.000 196.73549 ? 129 GLU C O   1 
ATOM   1023 C  CB  . GLU A 1 129 ? 67.97124 20.15636  29.56928  1.000 190.66606 ? 129 GLU C CB  1 
ATOM   1024 C  CG  . GLU A 1 129 ? 68.69434 20.20876  30.90309  1.000 188.71505 ? 129 GLU C CG  1 
ATOM   1025 C  CD  . GLU A 1 129 ? 68.36973 19.03867  31.80108  1.000 186.65138 ? 129 GLU C CD  1 
ATOM   1026 O  OE1 . GLU A 1 129 ? 67.36171 18.34754  31.54404  1.000 184.30236 ? 129 GLU C OE1 1 
ATOM   1027 O  OE2 . GLU A 1 129 ? 69.12719 18.81296  32.76706  1.000 187.38813 ? 129 GLU C OE2 1 
ATOM   1028 N  N   . GLU A 1 130 ? 70.60354 18.04493  29.17837  1.000 195.50380 ? 130 GLU C N   1 
ATOM   1029 C  CA  . GLU A 1 130 ? 72.05469 17.95877  29.09273  1.000 197.05808 ? 130 GLU C CA  1 
ATOM   1030 C  C   . GLU A 1 130 ? 72.48660 17.52142  27.70037  1.000 197.28406 ? 130 GLU C C   1 
ATOM   1031 O  O   . GLU A 1 130 ? 73.41394 18.10161  27.12302  1.000 199.23436 ? 130 GLU C O   1 
ATOM   1032 C  CB  . GLU A 1 130 ? 72.59527 17.00517  30.15817  1.000 199.56449 ? 130 GLU C CB  1 
ATOM   1033 C  CG  . GLU A 1 130 ? 74.11213 16.87270  30.14848  1.000 200.95176 ? 130 GLU C CG  1 
ATOM   1034 C  CD  . GLU A 1 130 ? 74.63844 16.09331  31.33778  1.000 204.02204 ? 130 GLU C CD  1 
ATOM   1035 O  OE1 . GLU A 1 130 ? 73.84098 15.36801  31.96839  1.000 205.60685 ? 130 GLU C OE1 1 
ATOM   1036 O  OE2 . GLU A 1 130 ? 75.84524 16.20852  31.64495  1.000 204.81311 ? 130 GLU C OE2 1 
ATOM   1037 N  N   . ARG A 1 131 ? 71.82185 16.50384  27.14270  1.000 195.88781 ? 131 ARG C N   1 
ATOM   1038 C  CA  . ARG A 1 131 ? 72.17233 16.03188  25.80657  1.000 189.66657 ? 131 ARG C CA  1 
ATOM   1039 C  C   . ARG A 1 131 ? 71.94099 17.11370  24.75655  1.000 190.21563 ? 131 ARG C C   1 
ATOM   1040 O  O   . ARG A 1 131 ? 72.68503 17.18853  23.77205  1.000 192.30983 ? 131 ARG C O   1 
ATOM   1041 C  CB  . ARG A 1 131 ? 71.39219 14.75715  25.47536  1.000 184.50564 ? 131 ARG C CB  1 
ATOM   1042 C  CG  . ARG A 1 131 ? 71.93183 13.99609  24.26650  1.000 179.02324 ? 131 ARG C CG  1 
ATOM   1043 C  CD  . ARG A 1 131 ? 71.20229 12.66794  24.05651  1.000 176.00621 ? 131 ARG C CD  1 
ATOM   1044 N  NE  . ARG A 1 131 ? 71.71145 11.92659  22.90182  1.000 170.49943 ? 131 ARG C NE  1 
ATOM   1045 C  CZ  . ARG A 1 131 ? 71.36848 10.67622  22.60011  1.000 166.74151 ? 131 ARG C CZ  1 
ATOM   1046 N  NH1 . ARG A 1 131 ? 71.87512 10.09008  21.52192  1.000 163.15656 ? 131 ARG C NH1 1 
ATOM   1047 N  NH2 . ARG A 1 131 ? 70.51877 10.01046  23.37178  1.000 166.92484 ? 131 ARG C NH2 1 
ATOM   1048 N  N   . ALA A 1 132 ? 70.91963 17.95675  24.94544  1.000 183.67463 ? 132 ALA C N   1 
ATOM   1049 C  CA  . ALA A 1 132 ? 70.70049 19.07564  24.03103  1.000 174.29522 ? 132 ALA C CA  1 
ATOM   1050 C  C   . ALA A 1 132 ? 71.89510 20.02082  24.03216  1.000 162.92421 ? 132 ALA C C   1 
ATOM   1051 O  O   . ALA A 1 132 ? 72.30339 20.52000  22.97726  1.000 158.83741 ? 132 ALA C O   1 
ATOM   1052 C  CB  . ALA A 1 132 ? 69.42240 19.82368  24.40637  1.000 174.82299 ? 132 ALA C CB  1 
ATOM   1053 N  N   . GLN A 1 133 ? 72.45930 20.29061  25.21265  1.000 160.18229 ? 133 GLN C N   1 
ATOM   1054 C  CA  . GLN A 1 133 ? 73.67149 21.09706  25.28560  1.000 155.24098 ? 133 GLN C CA  1 
ATOM   1055 C  C   . GLN A 1 133 ? 74.87778 20.33281  24.75346  1.000 151.41950 ? 133 GLN C C   1 
ATOM   1056 O  O   . GLN A 1 133 ? 75.77919 20.93555  24.16039  1.000 146.95423 ? 133 GLN C O   1 
ATOM   1057 C  CB  . GLN A 1 133 ? 73.92235 21.54212  26.72671  1.000 157.27858 ? 133 GLN C CB  1 
ATOM   1058 C  CG  . GLN A 1 133 ? 72.97594 22.62012  27.24179  1.000 158.87717 ? 133 GLN C CG  1 
ATOM   1059 C  CD  . GLN A 1 133 ? 73.40283 24.02665  26.85239  1.000 159.52117 ? 133 GLN C CD  1 
ATOM   1060 O  OE1 . GLN A 1 133 ? 73.74224 24.29218  25.69942  1.000 158.26110 ? 133 GLN C OE1 1 
ATOM   1061 N  NE2 . GLN A 1 133 ? 73.38646 24.93691  27.81979  1.000 160.60894 ? 133 GLN C NE2 1 
ATOM   1062 N  N   . GLN A 1 134 ? 74.90309 19.00986  24.93939  1.000 152.65861 ? 134 GLN C N   1 
ATOM   1063 C  CA  . GLN A 1 134 ? 76.03784 18.19867  24.51026  1.000 155.15673 ? 134 GLN C CA  1 
ATOM   1064 C  C   . GLN A 1 134 ? 76.11650 18.03091  22.99473  1.000 155.48853 ? 134 GLN C C   1 
ATOM   1065 O  O   . GLN A 1 134 ? 77.19615 17.71854  22.48134  1.000 157.87870 ? 134 GLN C O   1 
ATOM   1066 C  CB  . GLN A 1 134 ? 75.97923 16.81673  25.16852  1.000 151.59478 ? 134 GLN C CB  1 
ATOM   1067 C  CG  . GLN A 1 134 ? 76.27222 16.79226  26.66488  1.000 151.98616 ? 134 GLN C CG  1 
ATOM   1068 C  CD  . GLN A 1 134 ? 76.04812 15.41797  27.28574  1.000 149.89887 ? 134 GLN C CD  1 
ATOM   1069 O  OE1 . GLN A 1 134 ? 75.49538 14.51709  26.65143  1.000 147.96964 ? 134 GLN C OE1 1 
ATOM   1070 N  NE2 . GLN A 1 134 ? 76.47876 15.25410  28.53221  1.000 151.25835 ? 134 GLN C NE2 1 
ATOM   1071 N  N   . GLU A 1 135 ? 75.01032 18.21726  22.26999  1.000 154.18455 ? 135 GLU C N   1 
ATOM   1072 C  CA  . GLU A 1 135 ? 74.98205 17.95949  20.83097  1.000 160.49148 ? 135 GLU C CA  1 
ATOM   1073 C  C   . GLU A 1 135 ? 75.51603 19.16790  20.07141  1.000 175.14314 ? 135 GLU C C   1 
ATOM   1074 O  O   . GLU A 1 135 ? 74.94709 20.26273  20.15028  1.000 181.53504 ? 135 GLU C O   1 
ATOM   1075 C  CB  . GLU A 1 135 ? 73.56864 17.61322  20.37082  1.000 153.95689 ? 135 GLU C CB  1 
ATOM   1076 C  CG  . GLU A 1 135 ? 73.11673 16.21032  20.76187  1.000 149.68809 ? 135 GLU C CG  1 
ATOM   1077 C  CD  . GLU A 1 135 ? 73.98569 15.11873  20.15927  1.000 146.39839 ? 135 GLU C CD  1 
ATOM   1078 O  OE1 . GLU A 1 135 ? 74.04985 15.01753  18.91527  1.000 143.25388 ? 135 GLU C OE1 1 
ATOM   1079 O  OE2 . GLU A 1 135 ? 74.61073 14.36328  20.93276  1.000 146.87213 ? 135 GLU C OE2 1 
ATOM   1080 N  N   . ASP A 1 136 ? 76.58670 18.95486  19.31030  1.000 179.01467 ? 136 ASP C N   1 
ATOM   1081 C  CA  . ASP A 1 136 ? 77.40482 20.03946  18.79175  1.000 179.55257 ? 136 ASP C CA  1 
ATOM   1082 C  C   . ASP A 1 136 ? 76.86830 20.57206  17.46310  1.000 173.91613 ? 136 ASP C C   1 
ATOM   1083 O  O   . ASP A 1 136 ? 75.98622 19.98429  16.82807  1.000 169.05910 ? 136 ASP C O   1 
ATOM   1084 C  CB  . ASP A 1 136 ? 78.86905 19.59493  18.64404  1.000 183.53384 ? 136 ASP C CB  1 
ATOM   1085 C  CG  . ASP A 1 136 ? 79.05845 18.47734  17.62636  1.000 185.47794 ? 136 ASP C CG  1 
ATOM   1086 O  OD1 . ASP A 1 136 ? 78.20651 17.56425  17.55201  1.000 188.86566 ? 136 ASP C OD1 1 
ATOM   1087 O  OD2 . ASP A 1 136 ? 80.08055 18.51077  16.90752  1.000 183.76195 ? 136 ASP C OD2 1 
ATOM   1088 N  N   . ALA A 1 137 ? 77.41027 21.72731  17.07117  1.000 172.14661 ? 137 ALA C N   1 
ATOM   1089 C  CA  . ALA A 1 137 ? 77.08771 22.49894  15.87519  1.000 168.90271 ? 137 ALA C CA  1 
ATOM   1090 C  C   . ALA A 1 137 ? 75.67121 23.05584  15.88883  1.000 167.03317 ? 137 ALA C C   1 
ATOM   1091 O  O   . ALA A 1 137 ? 75.32615 23.83627  14.99124  1.000 165.77510 ? 137 ALA C O   1 
ATOM   1092 C  CB  . ALA A 1 137 ? 77.28688 21.69370  14.58171  1.000 165.72499 ? 137 ALA C CB  1 
ATOM   1093 N  N   . LEU A 1 138 ? 74.85251 22.71916  16.88694  1.000 164.94001 ? 138 LEU C N   1 
ATOM   1094 C  CA  . LEU A 1 138 ? 73.45693 23.15635  16.94727  1.000 156.94258 ? 138 LEU C CA  1 
ATOM   1095 C  C   . LEU A 1 138 ? 72.78120 22.95883  15.58773  1.000 148.82098 ? 138 LEU C C   1 
ATOM   1096 O  O   . LEU A 1 138 ? 72.07968 23.82865  15.06725  1.000 143.33103 ? 138 LEU C O   1 
ATOM   1097 C  CB  . LEU A 1 138 ? 73.35344 24.60604  17.42702  1.000 150.03825 ? 138 LEU C CB  1 
ATOM   1098 C  CG  . LEU A 1 138 ? 72.02516 25.05215  18.04831  1.000 144.57736 ? 138 LEU C CG  1 
ATOM   1099 C  CD1 . LEU A 1 138 ? 71.85150 24.45056  19.43069  1.000 142.75754 ? 138 LEU C CD1 1 
ATOM   1100 C  CD2 . LEU A 1 138 ? 71.91390 26.57560  18.10210  1.000 142.25344 ? 138 LEU C CD2 1 
ATOM   1101 N  N   . ALA A 1 139 ? 73.00634 21.76838  15.01803  1.000 148.83603 ? 139 ALA C N   1 
ATOM   1102 C  CA  . ALA A 1 139 ? 72.32166 21.28964  13.82628  1.000 153.45656 ? 139 ALA C CA  1 
ATOM   1103 C  C   . ALA A 1 139 ? 70.91009 20.80434  14.12861  1.000 160.38801 ? 139 ALA C C   1 
ATOM   1104 O  O   . ALA A 1 139 ? 70.14857 20.56617  13.18484  1.000 163.59798 ? 139 ALA C O   1 
ATOM   1105 C  CB  . ALA A 1 139 ? 73.11621 20.15903  13.16705  1.000 146.26558 ? 139 ALA C CB  1 
ATOM   1106 N  N   . GLN A 1 140 ? 70.53810 20.66166  15.40501  1.000 167.08264 ? 140 GLN C N   1 
ATOM   1107 C  CA  . GLN A 1 140 ? 69.14682 20.35113  15.72540  1.000 170.38142 ? 140 GLN C CA  1 
ATOM   1108 C  C   . GLN A 1 140 ? 68.22326 21.50778  15.37215  1.000 172.49602 ? 140 GLN C C   1 
ATOM   1109 O  O   . GLN A 1 140 ? 67.04688 21.28335  15.07362  1.000 176.93203 ? 140 GLN C O   1 
ATOM   1110 C  CB  . GLN A 1 140 ? 69.00090 19.97355  17.19743  1.000 174.45689 ? 140 GLN C CB  1 
ATOM   1111 C  CG  . GLN A 1 140 ? 69.49271 21.02784  18.18112  1.000 179.09992 ? 140 GLN C CG  1 
ATOM   1112 C  CD  . GLN A 1 140 ? 70.98046 20.91081  18.48330  1.000 182.94987 ? 140 GLN C CD  1 
ATOM   1113 O  OE1 . GLN A 1 140 ? 71.77783 20.53231  17.62302  1.000 181.62987 ? 140 GLN C OE1 1 
ATOM   1114 N  NE2 . GLN A 1 140 ? 71.35797 21.22844  19.71589  1.000 186.07992 ? 140 GLN C NE2 1 
ATOM   1115 N  N   . GLN A 1 141 ? 68.72541 22.74506  15.40610  1.000 167.55980 ? 141 GLN C N   1 
ATOM   1116 C  CA  . GLN A 1 141 ? 67.92651 23.86383  14.91877  1.000 161.03028 ? 141 GLN C CA  1 
ATOM   1117 C  C   . GLN A 1 141 ? 67.97654 23.97242  13.39827  1.000 151.47701 ? 141 GLN C C   1 
ATOM   1118 O  O   . GLN A 1 141 ? 67.05055 24.52270  12.79249  1.000 149.56350 ? 141 GLN C O   1 
ATOM   1119 C  CB  . GLN A 1 141 ? 68.38545 25.16623  15.57452  1.000 164.78127 ? 141 GLN C CB  1 
ATOM   1120 C  CG  . GLN A 1 141 ? 68.26067 25.15506  17.09080  1.000 168.33639 ? 141 GLN C CG  1 
ATOM   1121 C  CD  . GLN A 1 141 ? 68.09197 26.54043  17.67688  1.000 172.66317 ? 141 GLN C CD  1 
ATOM   1122 O  OE1 . GLN A 1 141 ? 67.97838 27.52366  16.94717  1.000 173.33746 ? 141 GLN C OE1 1 
ATOM   1123 N  NE2 . GLN A 1 141 ? 68.06927 26.62419  19.00401  1.000 174.16442 ? 141 GLN C NE2 1 
ATOM   1124 N  N   . ALA A 1 142 ? 69.04322 23.46140  12.77067  1.000 147.73498 ? 142 ALA C N   1 
ATOM   1125 C  CA  . ALA A 1 142 ? 69.05072 23.29897  11.31926  1.000 140.46476 ? 142 ALA C CA  1 
ATOM   1126 C  C   . ALA A 1 142 ? 68.15402 22.14350  10.89178  1.000 132.25111 ? 142 ALA C C   1 
ATOM   1127 O  O   . ALA A 1 142 ? 67.57106 22.18178  9.80137   1.000 132.02405 ? 142 ALA C O   1 
ATOM   1128 C  CB  . ALA A 1 142 ? 70.47820 23.08858  10.81540  1.000 138.44269 ? 142 ALA C CB  1 
ATOM   1129 N  N   . PHE A 1 143 ? 68.05127 21.10551  11.72910  1.000 125.38391 ? 143 PHE C N   1 
ATOM   1130 C  CA  . PHE A 1 143 ? 67.12926 20.00236  11.46650  1.000 123.09372 ? 143 PHE C CA  1 
ATOM   1131 C  C   . PHE A 1 143 ? 65.68502 20.48451  11.50241  1.000 128.02474 ? 143 PHE C C   1 
ATOM   1132 O  O   . PHE A 1 143 ? 64.89110 20.18173  10.60269  1.000 124.86864 ? 143 PHE C O   1 
ATOM   1133 C  CB  . PHE A 1 143 ? 67.35226 18.87435  12.48000  1.000 124.67260 ? 143 PHE C CB  1 
ATOM   1134 C  CG  . PHE A 1 143 ? 66.24735 17.84169  12.50603  1.000 122.62788 ? 143 PHE C CG  1 
ATOM   1135 C  CD1 . PHE A 1 143 ? 66.18868 16.84006  11.54699  1.000 118.75198 ? 143 PHE C CD1 1 
ATOM   1136 C  CD2 . PHE A 1 143 ? 65.28807 17.85250  13.51283  1.000 125.93157 ? 143 PHE C CD2 1 
ATOM   1137 C  CE1 . PHE A 1 143 ? 65.17916 15.89126  11.56868  1.000 117.24595 ? 143 PHE C CE1 1 
ATOM   1138 C  CE2 . PHE A 1 143 ? 64.27679 16.89769  13.54185  1.000 124.60425 ? 143 PHE C CE2 1 
ATOM   1139 C  CZ  . PHE A 1 143 ? 64.22582 15.91823  12.56693  1.000 120.47432 ? 143 PHE C CZ  1 
ATOM   1140 N  N   . GLU A 1 144 ? 65.32664 21.24562  12.53999  1.000 132.14777 ? 144 GLU C N   1 
ATOM   1141 C  CA  . GLU A 1 144 ? 63.96163 21.74869  12.64070  1.000 135.25398 ? 144 GLU C CA  1 
ATOM   1142 C  C   . GLU A 1 144 ? 63.62738 22.69490  11.49421  1.000 132.94168 ? 144 GLU C C   1 
ATOM   1143 O  O   . GLU A 1 144 ? 62.46377 22.78391  11.08858  1.000 133.16662 ? 144 GLU C O   1 
ATOM   1144 C  CB  . GLU A 1 144 ? 63.74606 22.43452  13.99120  1.000 138.81315 ? 144 GLU C CB  1 
ATOM   1145 C  CG  . GLU A 1 144 ? 62.30689 22.86242  14.23370  1.000 141.12861 ? 144 GLU C CG  1 
ATOM   1146 C  CD  . GLU A 1 144 ? 61.32885 21.70780  14.14061  1.000 142.42867 ? 144 GLU C CD  1 
ATOM   1147 O  OE1 . GLU A 1 144 ? 61.71353 20.57268  14.49145  1.000 145.36791 ? 144 GLU C OE1 1 
ATOM   1148 O  OE2 . GLU A 1 144 ? 60.17996 21.93052  13.69850  1.000 142.76943 ? 144 GLU C OE2 1 
ATOM   1149 N  N   . GLU A 1 145 ? 64.62830 23.38325  10.93898  1.000 132.24706 ? 145 GLU C N   1 
ATOM   1150 C  CA  . GLU A 1 145 ? 64.38263 24.21677  9.76576   1.000 130.95024 ? 145 GLU C CA  1 
ATOM   1151 C  C   . GLU A 1 145 ? 63.90574 23.37367  8.58623   1.000 126.30858 ? 145 GLU C C   1 
ATOM   1152 O  O   . GLU A 1 145 ? 62.89615 23.69678  7.94888   1.000 125.55278 ? 145 GLU C O   1 
ATOM   1153 C  CB  . GLU A 1 145 ? 65.64533 24.99013  9.38494   1.000 133.62611 ? 145 GLU C CB  1 
ATOM   1154 C  CG  . GLU A 1 145 ? 65.49956 25.79311  8.09447   1.000 134.84071 ? 145 GLU C CG  1 
ATOM   1155 C  CD  . GLU A 1 145 ? 66.75602 26.55339  7.72443   1.000 137.18618 ? 145 GLU C CD  1 
ATOM   1156 O  OE1 . GLU A 1 145 ? 66.71448 27.80192  7.69837   1.000 137.82034 ? 145 GLU C OE1 1 
ATOM   1157 O  OE2 . GLU A 1 145 ? 67.79219 25.89880  7.47931   1.000 137.68677 ? 145 GLU C OE2 1 
ATOM   1158 N  N   . ALA A 1 146 ? 64.61663 22.27911  8.28430   1.000 123.67161 ? 146 ALA C N   1 
ATOM   1159 C  CA  . ALA A 1 146 ? 64.23090 21.42933  7.15854   1.000 120.07344 ? 146 ALA C CA  1 
ATOM   1160 C  C   . ALA A 1 146 ? 62.87185 20.77478  7.36714   1.000 117.79324 ? 146 ALA C C   1 
ATOM   1161 O  O   . ALA A 1 146 ? 62.18921 20.45541  6.38662   1.000 115.77740 ? 146 ALA C O   1 
ATOM   1162 C  CB  . ALA A 1 146 ? 65.28856 20.34840  6.91229   1.000 117.88273 ? 146 ALA C CB  1 
ATOM   1163 N  N   . ARG A 1 147 ? 62.44814 20.59914  8.62306   1.000 118.20638 ? 147 ARG C N   1 
ATOM   1164 C  CA  . ARG A 1 147 ? 61.15480 19.99366  8.89944   1.000 117.30612 ? 147 ARG C CA  1 
ATOM   1165 C  C   . ARG A 1 147 ? 59.99412 20.95604  8.66343   1.000 120.29377 ? 147 ARG C C   1 
ATOM   1166 O  O   . ARG A 1 147 ? 58.88161 20.49717  8.38128   1.000 120.30559 ? 147 ARG C O   1 
ATOM   1167 C  CB  . ARG A 1 147 ? 61.14005 19.46645  10.34174  1.000 115.85001 ? 147 ARG C CB  1 
ATOM   1168 C  CG  . ARG A 1 147 ? 59.95328 18.57100  10.69115  1.000 113.92016 ? 147 ARG C CG  1 
ATOM   1169 C  CD  . ARG A 1 147 ? 59.98554 18.11883  12.15071  1.000 114.41895 ? 147 ARG C CD  1 
ATOM   1170 N  NE  . ARG A 1 147 ? 58.73592 17.46548  12.53728  1.000 112.46039 ? 147 ARG C NE  1 
ATOM   1171 C  CZ  . ARG A 1 147 ? 58.45235 17.05676  13.76916  1.000 112.33344 ? 147 ARG C CZ  1 
ATOM   1172 N  NH1 . ARG A 1 147 ? 59.33089 17.23522  14.74658  1.000 112.45921 ? 147 ARG C NH1 1 
ATOM   1173 N  NH2 . ARG A 1 147 ? 57.28807 16.47294  14.02708  1.000 113.19733 ? 147 ARG C NH2 1 
ATOM   1174 N  N   . ARG A 1 148 ? 60.23183 22.26999  8.73147   1.000 123.76119 ? 148 ARG C N   1 
ATOM   1175 C  CA  . ARG A 1 148 ? 59.20425 23.28303  8.50557   1.000 122.94553 ? 148 ARG C CA  1 
ATOM   1176 C  C   . ARG A 1 148 ? 59.27892 23.90755  7.11868   1.000 121.77968 ? 148 ARG C C   1 
ATOM   1177 O  O   . ARG A 1 148 ? 58.44890 24.75889  6.79093   1.000 122.06400 ? 148 ARG C O   1 
ATOM   1178 C  CB  . ARG A 1 148 ? 59.29763 24.38072  9.56961   1.000 126.46082 ? 148 ARG C CB  1 
ATOM   1179 C  CG  . ARG A 1 148 ? 59.24742 23.84262  10.98814  1.000 129.05080 ? 148 ARG C CG  1 
ATOM   1180 C  CD  . ARG A 1 148 ? 58.89937 24.90559  12.02076  1.000 132.73541 ? 148 ARG C CD  1 
ATOM   1181 N  NE  . ARG A 1 148 ? 57.49082 25.28293  11.94839  1.000 134.94706 ? 148 ARG C NE  1 
ATOM   1182 C  CZ  . ARG A 1 148 ? 57.05085 26.48810  11.59320  1.000 136.05784 ? 148 ARG C CZ  1 
ATOM   1183 N  NH1 . ARG A 1 148 ? 55.74739 26.72765  11.55216  1.000 137.34777 ? 148 ARG C NH1 1 
ATOM   1184 N  NH2 . ARG A 1 148 ? 57.90870 27.45677  11.29129  1.000 135.16148 ? 148 ARG C NH2 1 
ATOM   1185 N  N   . ARG A 1 149 ? 60.25902 23.52021  6.30984   1.000 115.14157 ? 149 ARG C N   1 
ATOM   1186 C  CA  . ARG A 1 149 ? 60.38139 24.03771  4.95623   1.000 115.79589 ? 149 ARG C CA  1 
ATOM   1187 C  C   . ARG A 1 149 ? 59.23447 23.51998  4.09377   1.000 115.10185 ? 149 ARG C C   1 
ATOM   1188 O  O   . ARG A 1 149 ? 58.64244 22.47456  4.37413   1.000 113.52293 ? 149 ARG C O   1 
ATOM   1189 C  CB  . ARG A 1 149 ? 61.73534 23.62633  4.36608   1.000 115.07698 ? 149 ARG C CB  1 
ATOM   1190 C  CG  . ARG A 1 149 ? 62.00032 24.08624  2.94044   1.000 114.06904 ? 149 ARG C CG  1 
ATOM   1191 C  CD  . ARG A 1 149 ? 63.14652 23.30847  2.30865   1.000 110.73049 ? 149 ARG C CD  1 
ATOM   1192 N  NE  . ARG A 1 149 ? 62.91049 23.06924  0.88737   1.000 107.76599 ? 149 ARG C NE  1 
ATOM   1193 C  CZ  . ARG A 1 149 ? 63.76691 22.44837  0.08229   1.000 105.39137 ? 149 ARG C CZ  1 
ATOM   1194 N  NH1 . ARG A 1 149 ? 64.92195 22.00987  0.56377   1.000 106.56980 ? 149 ARG C NH1 1 
ATOM   1195 N  NH2 . ARG A 1 149 ? 63.47200 22.26858  -1.20259  1.000 101.99219 ? 149 ARG C NH2 1 
ATOM   1196 N  N   . THR A 1 150 ? 58.89820 24.27695  3.05142   1.000 118.09461 ? 150 THR C N   1 
ATOM   1197 C  CA  . THR A 1 150 ? 57.89383 23.85860  2.08310   1.000 118.78059 ? 150 THR C CA  1 
ATOM   1198 C  C   . THR A 1 150 ? 58.54985 23.69019  0.71879   1.000 118.68013 ? 150 THR C C   1 
ATOM   1199 O  O   . THR A 1 150 ? 59.38240 24.50893  0.31527   1.000 122.50094 ? 150 THR C O   1 
ATOM   1200 C  CB  . THR A 1 150 ? 56.73897 24.87300  1.98080   1.000 119.79368 ? 150 THR C CB  1 
ATOM   1201 O  OG1 . THR A 1 150 ? 57.20860 26.06722  1.34501   1.000 123.04749 ? 150 THR C OG1 1 
ATOM   1202 C  CG2 . THR A 1 150 ? 56.18202 25.22193  3.36189   1.000 120.29835 ? 150 THR C CG2 1 
ATOM   1203 N  N   . ARG A 1 151 ? 58.17965 22.61794  0.01874   1.000 113.63621 ? 151 ARG C N   1 
ATOM   1204 C  CA  . ARG A 1 151 ? 58.65526 22.35016  -1.33083  1.000 111.39471 ? 151 ARG C CA  1 
ATOM   1205 C  C   . ARG A 1 151 ? 57.54048 22.47045  -2.36785  1.000 109.64584 ? 151 ARG C C   1 
ATOM   1206 O  O   . ARG A 1 151 ? 57.80060 22.35745  -3.57295  1.000 107.36987 ? 151 ARG C O   1 
ATOM   1207 C  CB  . ARG A 1 151 ? 59.30765 20.96302  -1.39223  1.000 110.60255 ? 151 ARG C CB  1 
ATOM   1208 C  CG  . ARG A 1 151 ? 60.00997 20.67029  -2.70619  1.000 107.88449 ? 151 ARG C CG  1 
ATOM   1209 C  CD  . ARG A 1 151 ? 59.51583 19.43668  -3.39250  1.000 102.86747 ? 151 ARG C CD  1 
ATOM   1210 N  NE  . ARG A 1 151 ? 60.33740 19.16785  -4.56483  1.000 99.66452  ? 151 ARG C NE  1 
ATOM   1211 C  CZ  . ARG A 1 151 ? 60.12957 18.15840  -5.39550  1.000 96.27266  ? 151 ARG C CZ  1 
ATOM   1212 N  NH1 . ARG A 1 151 ? 59.12307 17.33454  -5.17190  1.000 94.91394  ? 151 ARG C NH1 1 
ATOM   1213 N  NH2 . ARG A 1 151 ? 60.91721 17.97460  -6.44543  1.000 95.35867  ? 151 ARG C NH2 1 
ATOM   1214 N  N   . GLU A 1 152 ? 56.30554 22.71018  -1.92359  1.000 111.45081 ? 152 GLU C N   1 
ATOM   1215 C  CA  . GLU A 1 152 ? 55.12915 22.54598  -2.77371  1.000 111.25178 ? 152 GLU C CA  1 
ATOM   1216 C  C   . GLU A 1 152 ? 55.11846 23.46003  -3.99644  1.000 114.81637 ? 152 GLU C C   1 
ATOM   1217 O  O   . GLU A 1 152 ? 54.52240 23.10602  -5.01753  1.000 122.38751 ? 152 GLU C O   1 
ATOM   1218 C  CB  . GLU A 1 152 ? 53.88107 22.77821  -1.93208  1.000 109.85473 ? 152 GLU C CB  1 
ATOM   1219 C  CG  . GLU A 1 152 ? 54.00892 22.15418  -0.56558  1.000 110.28472 ? 152 GLU C CG  1 
ATOM   1220 C  CD  . GLU A 1 152 ? 53.13546 22.82497  0.45401   1.000 115.19508 ? 152 GLU C CD  1 
ATOM   1221 O  OE1 . GLU A 1 152 ? 52.87048 22.21120  1.50861   1.000 117.23325 ? 152 GLU C OE1 1 
ATOM   1222 O  OE2 . GLU A 1 152 ? 52.71179 23.96677  0.19638   1.000 117.23769 ? 152 GLU C OE2 1 
ATOM   1223 N  N   . PHE A 1 153 ? 55.75319 24.62278  -3.93911  1.000 110.13351 ? 153 PHE C N   1 
ATOM   1224 C  CA  . PHE A 1 153 ? 55.74691 25.49672  -5.10813  1.000 103.61058 ? 153 PHE C CA  1 
ATOM   1225 C  C   . PHE A 1 153 ? 57.12757 26.05510  -5.43155  1.000 106.83230 ? 153 PHE C C   1 
ATOM   1226 O  O   . PHE A 1 153 ? 57.23583 27.10554  -6.06879  1.000 108.20434 ? 153 PHE C O   1 
ATOM   1227 C  CB  . PHE A 1 153 ? 54.73692 26.62843  -4.94385  1.000 97.62460  ? 153 PHE C CB  1 
ATOM   1228 C  CG  . PHE A 1 153 ? 53.31668 26.17036  -4.75025  1.000 87.95436  ? 153 PHE C CG  1 
ATOM   1229 C  CD1 . PHE A 1 153 ? 52.64553 25.49375  -5.76134  1.000 79.92785  ? 153 PHE C CD1 1 
ATOM   1230 C  CD2 . PHE A 1 153 ? 52.65024 26.42153  -3.56690  1.000 87.62202  ? 153 PHE C CD2 1 
ATOM   1231 C  CE1 . PHE A 1 153 ? 51.33230 25.08977  -5.59282  1.000 74.81826  ? 153 PHE C CE1 1 
ATOM   1232 C  CE2 . PHE A 1 153 ? 51.34654 26.01575  -3.39139  1.000 72.23887  ? 153 PHE C CE2 1 
ATOM   1233 C  CZ  . PHE A 1 153 ? 50.68576 25.34892  -4.40325  1.000 70.41662  ? 153 PHE C CZ  1 
ATOM   1234 N  N   . GLU A 1 154 ? 58.18965 25.34905  -5.03731  1.000 108.06096 ? 154 GLU C N   1 
ATOM   1235 C  CA  . GLU A 1 154 ? 59.54778 25.85752  -5.18873  1.000 109.68427 ? 154 GLU C CA  1 
ATOM   1236 C  C   . GLU A 1 154 ? 60.23235 25.40626  -6.47564  1.000 108.68979 ? 154 GLU C C   1 
ATOM   1237 O  O   . GLU A 1 154 ? 61.04065 26.16390  -7.02415  1.000 111.74297 ? 154 GLU C O   1 
ATOM   1238 C  CB  . GLU A 1 154 ? 60.39996 25.45131  -3.98467  1.000 112.26712 ? 154 GLU C CB  1 
ATOM   1239 C  CG  . GLU A 1 154 ? 59.72633 25.70981  -2.65201  1.000 118.47865 ? 154 GLU C CG  1 
ATOM   1240 C  CD  . GLU A 1 154 ? 59.10563 27.09101  -2.56987  1.000 123.36886 ? 154 GLU C CD  1 
ATOM   1241 O  OE1 . GLU A 1 154 ? 59.77939 28.07182  -2.95281  1.000 128.03334 ? 154 GLU C OE1 1 
ATOM   1242 O  OE2 . GLU A 1 154 ? 57.93828 27.19337  -2.13242  1.000 122.97161 ? 154 GLU C OE2 1 
ATOM   1243 N  N   . ASP A 1 155 ? 59.95470 24.20620  -6.97971  1.000 106.87365 ? 155 ASP C N   1 
ATOM   1244 C  CA  . ASP A 1 155 ? 60.59706 23.78701  -8.21999  1.000 108.27290 ? 155 ASP C CA  1 
ATOM   1245 C  C   . ASP A 1 155 ? 60.15936 24.66695  -9.38646  1.000 110.32194 ? 155 ASP C C   1 
ATOM   1246 O  O   . ASP A 1 155 ? 58.98890 25.03344  -9.50901  1.000 109.25877 ? 155 ASP C O   1 
ATOM   1247 C  CB  . ASP A 1 155 ? 60.28813 22.32115  -8.52471  1.000 106.22876 ? 155 ASP C CB  1 
ATOM   1248 C  CG  . ASP A 1 155 ? 60.90967 21.37627  -7.52144  1.000 107.67071 ? 155 ASP C CG  1 
ATOM   1249 O  OD1 . ASP A 1 155 ? 61.74020 21.83853  -6.70962  1.000 110.81774 ? 155 ASP C OD1 1 
ATOM   1250 O  OD2 . ASP A 1 155 ? 60.57708 20.17422  -7.54917  1.000 105.63751 ? 155 ASP C OD2 1 
ATOM   1251 N  N   . ARG A 1 156 ? 61.12303 25.00470  -10.24277 1.000 113.73861 ? 156 ARG C N   1 
ATOM   1252 C  CA  . ARG A 1 156 ? 60.89047 25.83668  -11.41801 1.000 115.05241 ? 156 ARG C CA  1 
ATOM   1253 C  C   . ARG A 1 156 ? 60.32986 25.02218  -12.58015 1.000 117.33637 ? 156 ARG C C   1 
ATOM   1254 O  O   . ARG A 1 156 ? 60.92861 24.02268  -12.98711 1.000 117.39668 ? 156 ARG C O   1 
ATOM   1255 C  CB  . ARG A 1 156 ? 62.20892 26.48042  -11.82655 1.000 113.51833 ? 156 ARG C CB  1 
ATOM   1256 C  CG  . ARG A 1 156 ? 62.87111 27.22841  -10.69365 1.000 112.52436 ? 156 ARG C CG  1 
ATOM   1257 C  CD  . ARG A 1 156 ? 64.37395 27.32644  -10.89929 1.000 110.47975 ? 156 ARG C CD  1 
ATOM   1258 N  NE  . ARG A 1 156 ? 64.74298 28.19556  -12.01148 1.000 108.36730 ? 156 ARG C NE  1 
ATOM   1259 C  CZ  . ARG A 1 156 ? 65.16037 29.44832  -11.86690 1.000 109.44501 ? 156 ARG C CZ  1 
ATOM   1260 N  NH1 . ARG A 1 156 ? 65.47981 30.17323  -12.92993 1.000 108.74721 ? 156 ARG C NH1 1 
ATOM   1261 N  NH2 . ARG A 1 156 ? 65.25974 29.97383  -10.65506 1.000 112.18822 ? 156 ARG C NH2 1 
ATOM   1262 N  N   . ASP A 1 157 ? 59.20360 25.46963  -13.13638 1.000 118.98955 ? 157 ASP C N   1 
ATOM   1263 C  CA  . ASP A 1 157 ? 58.55377 24.75112  -14.22850 1.000 123.52542 ? 157 ASP C CA  1 
ATOM   1264 C  C   . ASP A 1 157 ? 59.42927 24.73225  -15.48215 1.000 133.09810 ? 157 ASP C C   1 
ATOM   1265 O  O   . ASP A 1 157 ? 60.24124 25.63240  -15.71426 1.000 134.88018 ? 157 ASP C O   1 
ATOM   1266 C  CB  . ASP A 1 157 ? 57.19768 25.37906  -14.55135 1.000 124.09383 ? 157 ASP C CB  1 
ATOM   1267 C  CG  . ASP A 1 157 ? 56.40966 24.57897  -15.58109 1.000 121.64680 ? 157 ASP C CG  1 
ATOM   1268 O  OD1 . ASP A 1 157 ? 56.66660 24.75173  -16.79304 1.000 120.77773 ? 157 ASP C OD1 1 
ATOM   1269 O  OD2 . ASP A 1 157 ? 55.53194 23.78179  -15.18230 1.000 121.31746 ? 157 ASP C OD2 1 
ATOM   1270 N  N   . ARG A 1 158 ? 59.23887 23.69730  -16.30639 1.000 139.58779 ? 158 ARG C N   1 
ATOM   1271 C  CA  . ARG A 1 158 ? 59.92018 23.55656  -17.59035 1.000 146.29877 ? 158 ARG C CA  1 
ATOM   1272 C  C   . ARG A 1 158 ? 58.90050 23.21557  -18.67168 1.000 150.54983 ? 158 ARG C C   1 
ATOM   1273 O  O   . ARG A 1 158 ? 58.11108 22.27812  -18.51134 1.000 151.52472 ? 158 ARG C O   1 
ATOM   1274 C  CB  . ARG A 1 158 ? 61.00639 22.47309  -17.52672 1.000 146.66432 ? 158 ARG C CB  1 
ATOM   1275 C  CG  . ARG A 1 158 ? 61.98752 22.62144  -16.35959 1.000 148.80482 ? 158 ARG C CG  1 
ATOM   1276 C  CD  . ARG A 1 158 ? 62.78748 23.92471  -16.43165 1.000 151.11474 ? 158 ARG C CD  1 
ATOM   1277 N  NE  . ARG A 1 158 ? 63.71005 24.07160  -15.30474 1.000 152.61078 ? 158 ARG C NE  1 
ATOM   1278 C  CZ  . ARG A 1 158 ? 64.39814 25.17990  -15.03500 1.000 155.25933 ? 158 ARG C CZ  1 
ATOM   1279 N  NH1 . ARG A 1 158 ? 65.21444 25.22017  -13.98908 1.000 157.04174 ? 158 ARG C NH1 1 
ATOM   1280 N  NH2 . ARG A 1 158 ? 64.26786 26.25197  -15.80688 1.000 156.23146 ? 158 ARG C NH2 1 
ATOM   1281 N  N   . SER A 1 159 ? 58.91836 23.97075  -19.77117 1.000 153.70030 ? 159 SER C N   1 
ATOM   1282 C  CA  . SER A 1 159 ? 57.99958 23.76139  -20.89252 1.000 156.98093 ? 159 SER C CA  1 
ATOM   1283 C  C   . SER A 1 159 ? 58.81106 23.50382  -22.16092 1.000 161.80993 ? 159 SER C C   1 
ATOM   1284 O  O   . SER A 1 159 ? 59.24196 24.44782  -22.83286 1.000 165.84977 ? 159 SER C O   1 
ATOM   1285 C  CB  . SER A 1 159 ? 57.06732 24.95729  -21.06946 1.000 157.49166 ? 159 SER C CB  1 
ATOM   1286 O  OG  . SER A 1 159 ? 56.12578 24.71074  -22.10037 1.000 156.57865 ? 159 SER C OG  1 
ATOM   1287 N  N   . HIS A 1 160 ? 59.00882 22.22749  -22.48839 1.000 158.30455 ? 160 HIS C N   1 
ATOM   1288 C  CA  . HIS A 1 160 ? 59.75296 21.83440  -23.68496 1.000 155.47352 ? 160 HIS C CA  1 
ATOM   1289 C  C   . HIS A 1 160 ? 59.05957 20.66946  -24.39415 1.000 152.92585 ? 160 HIS C C   1 
ATOM   1290 O  O   . HIS A 1 160 ? 58.93364 19.57265  -23.84379 1.000 150.54610 ? 160 HIS C O   1 
ATOM   1291 C  CB  . HIS A 1 160 ? 61.20111 21.45606  -23.33264 1.000 152.39633 ? 160 HIS C CB  1 
ATOM   1292 C  CG  . HIS A 1 160 ? 61.99868 22.58186  -22.74564 1.000 150.51355 ? 160 HIS C CG  1 
ATOM   1293 N  ND1 . HIS A 1 160 ? 61.94455 22.91624  -21.40928 1.000 149.57480 ? 160 HIS C ND1 1 
ATOM   1294 C  CD2 . HIS A 1 160 ? 62.86881 23.45023  -23.31408 1.000 150.21401 ? 160 HIS C CD2 1 
ATOM   1295 C  CE1 . HIS A 1 160 ? 62.74487 23.94199  -21.18003 1.000 150.20444 ? 160 HIS C CE1 1 
ATOM   1296 N  NE2 . HIS A 1 160 ? 63.31770 24.28523  -22.31941 1.000 150.30157 ? 160 HIS C NE2 1 
ATOM   1297 N  N   . MET B 2 1   ? 36.64980 20.28257  27.02611  1.000 143.07453 ? 1   MET W N   1 
ATOM   1298 C  CA  . MET B 2 1   ? 37.07609 20.20147  25.63539  1.000 142.09798 ? 1   MET W CA  1 
ATOM   1299 C  C   . MET B 2 1   ? 36.97881 21.57706  24.98021  1.000 136.25897 ? 1   MET W C   1 
ATOM   1300 O  O   . MET B 2 1   ? 36.75774 22.58271  25.65304  1.000 135.52525 ? 1   MET W O   1 
ATOM   1301 C  CB  . MET B 2 1   ? 36.22642 19.18482  24.86570  1.000 148.12324 ? 1   MET W CB  1 
ATOM   1302 C  CG  . MET B 2 1   ? 36.50529 17.73313  25.22195  1.000 155.27646 ? 1   MET W CG  1 
ATOM   1303 S  SD  . MET B 2 1   ? 36.10967 17.35392  26.94927  1.000 161.12448 ? 1   MET W SD  1 
ATOM   1304 C  CE  . MET B 2 1   ? 34.32426 17.51534  26.96247  1.000 164.06383 ? 1   MET W CE  1 
ATOM   1305 N  N   . ASP B 2 2   ? 37.13267 21.61173  23.66140  1.000 132.77284 ? 2   ASP W N   1 
ATOM   1306 C  CA  . ASP B 2 2   ? 37.03339 22.83764  22.88258  1.000 127.06394 ? 2   ASP W CA  1 
ATOM   1307 C  C   . ASP B 2 2   ? 35.95620 22.68402  21.82050  1.000 124.98561 ? 2   ASP W C   1 
ATOM   1308 O  O   . ASP B 2 2   ? 35.95620 21.70507  21.06471  1.000 128.08301 ? 2   ASP W O   1 
ATOM   1309 C  CB  . ASP B 2 2   ? 38.37211 23.18059  22.21977  1.000 122.21981 ? 2   ASP W CB  1 
ATOM   1310 C  CG  . ASP B 2 2   ? 39.29214 23.98676  23.12412  1.000 117.66995 ? 2   ASP W CG  1 
ATOM   1311 O  OD1 . ASP B 2 2   ? 38.80998 24.92158  23.80089  1.000 115.56909 ? 2   ASP W OD1 1 
ATOM   1312 O  OD2 . ASP B 2 2   ? 40.50491 23.68539  23.15391  1.000 115.99462 ? 2   ASP W OD2 1 
ATOM   1313 N  N   . VAL B 2 3   ? 35.05689 23.66030  21.75048  1.000 119.15498 ? 3   VAL W N   1 
ATOM   1314 C  CA  . VAL B 2 3   ? 34.06312 23.72998  20.68770  1.000 121.41560 ? 3   VAL W CA  1 
ATOM   1315 C  C   . VAL B 2 3   ? 34.35812 24.96589  19.84951  1.000 122.58057 ? 3   VAL W C   1 
ATOM   1316 O  O   . VAL B 2 3   ? 34.83265 25.99178  20.35223  1.000 125.41219 ? 3   VAL W O   1 
ATOM   1317 C  CB  . VAL B 2 3   ? 32.61631 23.76376  21.22479  1.000 123.82521 ? 3   VAL W CB  1 
ATOM   1318 C  CG1 . VAL B 2 3   ? 32.32438 22.50365  22.01224  1.000 125.53817 ? 3   VAL W CG1 1 
ATOM   1319 C  CG2 . VAL B 2 3   ? 32.37241 25.00433  22.06784  1.000 124.78014 ? 3   VAL W CG2 1 
ATOM   1320 N  N   . PHE B 2 4   ? 34.09752 24.85606  18.55205  1.000 116.10952 ? 4   PHE W N   1 
ATOM   1321 C  CA  . PHE B 2 4   ? 34.40518 25.91597  17.60431  1.000 108.08518 ? 4   PHE W CA  1 
ATOM   1322 C  C   . PHE B 2 4   ? 33.11831 26.35754  16.93039  1.000 100.88075 ? 4   PHE W C   1 
ATOM   1323 O  O   . PHE B 2 4   ? 32.47476 25.56970  16.22920  1.000 99.99108  ? 4   PHE W O   1 
ATOM   1324 C  CB  . PHE B 2 4   ? 35.42267 25.43210  16.57620  1.000 106.14575 ? 4   PHE W CB  1 
ATOM   1325 C  CG  . PHE B 2 4   ? 36.73845 25.03371  17.17320  1.000 104.55273 ? 4   PHE W CG  1 
ATOM   1326 C  CD1 . PHE B 2 4   ? 36.93676 23.75654  17.65789  1.000 104.19905 ? 4   PHE W CD1 1 
ATOM   1327 C  CD2 . PHE B 2 4   ? 37.77697 25.94444  17.25111  1.000 103.49078 ? 4   PHE W CD2 1 
ATOM   1328 C  CE1 . PHE B 2 4   ? 38.15346 23.39210  18.20343  1.000 104.23826 ? 4   PHE W CE1 1 
ATOM   1329 C  CE2 . PHE B 2 4   ? 38.99098 25.58763  17.79243  1.000 102.78495 ? 4   PHE W CE2 1 
ATOM   1330 C  CZ  . PHE B 2 4   ? 39.18089 24.30730  18.26984  1.000 102.78748 ? 4   PHE W CZ  1 
ATOM   1331 N  N   . LEU B 2 5   ? 32.77547 27.62397  17.09836  1.000 96.26025  ? 5   LEU W N   1 
ATOM   1332 C  CA  . LEU B 2 5   ? 31.44128 28.09565  16.78454  1.000 91.99288  ? 5   LEU W CA  1 
ATOM   1333 C  C   . LEU B 2 5   ? 31.50106 29.17457  15.71409  1.000 89.52614  ? 5   LEU W C   1 
ATOM   1334 O  O   . LEU B 2 5   ? 32.53041 29.82103  15.50599  1.000 86.85540  ? 5   LEU W O   1 
ATOM   1335 C  CB  . LEU B 2 5   ? 30.75812 28.65502  18.03107  1.000 89.03564  ? 5   LEU W CB  1 
ATOM   1336 C  CG  . LEU B 2 5   ? 30.77574 27.72603  19.22937  1.000 84.66402  ? 5   LEU W CG  1 
ATOM   1337 C  CD1 . LEU B 2 5   ? 30.24518 28.45798  20.44511  1.000 83.73944  ? 5   LEU W CD1 1 
ATOM   1338 C  CD2 . LEU B 2 5   ? 29.93074 26.53273  18.89641  1.000 84.88691  ? 5   LEU W CD2 1 
ATOM   1339 N  N   . MET B 2 6   ? 30.36108 29.36943  15.05848  1.000 87.99392  ? 6   MET W N   1 
ATOM   1340 C  CA  . MET B 2 6   ? 30.10081 30.49415  14.16578  1.000 86.98444  ? 6   MET W CA  1 
ATOM   1341 C  C   . MET B 2 6   ? 28.84673 31.17188  14.69342  1.000 86.04210  ? 6   MET W C   1 
ATOM   1342 O  O   . MET B 2 6   ? 27.73120 30.72375  14.41733  1.000 88.54142  ? 6   MET W O   1 
ATOM   1343 C  CB  . MET B 2 6   ? 29.90218 30.03135  12.72479  1.000 89.96213  ? 6   MET W CB  1 
ATOM   1344 C  CG  . MET B 2 6   ? 31.17128 29.66430  11.99280  1.000 93.04392  ? 6   MET W CG  1 
ATOM   1345 S  SD  . MET B 2 6   ? 30.85723 29.23614  10.26813  1.000 95.90128  ? 6   MET W SD  1 
ATOM   1346 C  CE  . MET B 2 6   ? 29.97471 30.66976  9.70708   1.000 96.51176  ? 6   MET W CE  1 
ATOM   1347 N  N   . ILE B 2 7   ? 29.01943 32.23337  15.47036  1.000 81.77840  ? 7   ILE W N   1 
ATOM   1348 C  CA  . ILE B 2 7   ? 27.87988 33.02851  15.91418  1.000 78.01556  ? 7   ILE W CA  1 
ATOM   1349 C  C   . ILE B 2 7   ? 27.45140 33.88741  14.72563  1.000 72.77169  ? 7   ILE W C   1 
ATOM   1350 O  O   . ILE B 2 7   ? 28.21683 34.72597  14.24544  1.000 69.86395  ? 7   ILE W O   1 
ATOM   1351 C  CB  . ILE B 2 7   ? 28.22496 33.88873  17.13675  1.000 75.74118  ? 7   ILE W CB  1 
ATOM   1352 C  CG1 . ILE B 2 7   ? 28.81461 33.02861  18.24778  1.000 76.16303  ? 7   ILE W CG1 1 
ATOM   1353 C  CG2 . ILE B 2 7   ? 26.98313 34.53605  17.68233  1.000 75.39097  ? 7   ILE W CG2 1 
ATOM   1354 C  CD1 . ILE B 2 7   ? 29.36877 33.83401  19.40462  1.000 75.63094  ? 7   ILE W CD1 1 
ATOM   1355 N  N   . ARG B 2 8   ? 26.26006 33.63640  14.20383  1.000 73.70925  ? 8   ARG W N   1 
ATOM   1356 C  CA  . ARG B 2 8   ? 25.81287 34.29655  12.99368  1.000 77.07201  ? 8   ARG W CA  1 
ATOM   1357 C  C   . ARG B 2 8   ? 24.54056 35.07892  13.26372  1.000 79.20776  ? 8   ARG W C   1 
ATOM   1358 O  O   . ARG B 2 8   ? 23.62194 34.58373  13.92395  1.000 79.54740  ? 8   ARG W O   1 
ATOM   1359 C  CB  . ARG B 2 8   ? 25.57846 33.30398  11.85142  1.000 80.56445  ? 8   ARG W CB  1 
ATOM   1360 C  CG  . ARG B 2 8   ? 26.82543 32.55879  11.42679  1.000 82.23301  ? 8   ARG W CG  1 
ATOM   1361 C  CD  . ARG B 2 8   ? 26.65787 32.04670  10.02616  1.000 83.85873  ? 8   ARG W CD  1 
ATOM   1362 N  NE  . ARG B 2 8   ? 26.39031 33.17031  9.14080   1.000 85.91705  ? 8   ARG W NE  1 
ATOM   1363 C  CZ  . ARG B 2 8   ? 25.93986 33.05254  7.90038   1.000 89.52703  ? 8   ARG W CZ  1 
ATOM   1364 N  NH1 . ARG B 2 8   ? 25.71085 31.85112  7.38715   1.000 90.24568  ? 8   ARG W NH1 1 
ATOM   1365 N  NH2 . ARG B 2 8   ? 25.72186 34.13983  7.17389   1.000 90.64275  ? 8   ARG W NH2 1 
ATOM   1366 N  N   . ARG B 2 9   ? 24.50413 36.30639  12.75212  1.000 80.67624  ? 9   ARG W N   1 
ATOM   1367 C  CA  . ARG B 2 9   ? 23.32969 37.16624  12.81507  1.000 83.57489  ? 9   ARG W CA  1 
ATOM   1368 C  C   . ARG B 2 9   ? 23.32536 38.06284  11.58448  1.000 83.00005  ? 9   ARG W C   1 
ATOM   1369 O  O   . ARG B 2 9   ? 24.32634 38.73929  11.33251  1.000 79.79881  ? 9   ARG W O   1 
ATOM   1370 C  CB  . ARG B 2 9   ? 23.33424 38.03432  14.06643  1.000 87.08643  ? 9   ARG W CB  1 
ATOM   1371 C  CG  . ARG B 2 9   ? 22.07699 38.84878  14.16276  1.000 90.97094  ? 9   ARG W CG  1 
ATOM   1372 C  CD  . ARG B 2 9   ? 22.38792 40.26686  14.51572  1.000 92.78844  ? 9   ARG W CD  1 
ATOM   1373 N  NE  . ARG B 2 9   ? 21.20759 41.11966  14.43366  1.000 95.79874  ? 9   ARG W NE  1 
ATOM   1374 C  CZ  . ARG B 2 9   ? 21.25515 42.44198  14.31679  1.000 95.71231  ? 9   ARG W CZ  1 
ATOM   1375 N  NH1 . ARG B 2 9   ? 22.42848 43.05716  14.27594  1.000 95.80663  ? 9   ARG W NH1 1 
ATOM   1376 N  NH2 . ARG B 2 9   ? 20.13460 43.14740  14.23881  1.000 94.45768  ? 9   ARG W NH2 1 
ATOM   1377 N  N   . HIS B 2 10  ? 22.21624 38.09082  10.84621  1.000 87.25773  ? 10  HIS W N   1 
ATOM   1378 C  CA  . HIS B 2 10  ? 22.10512 38.90488  9.63633   1.000 91.72118  ? 10  HIS W CA  1 
ATOM   1379 C  C   . HIS B 2 10  ? 23.24997 38.57295  8.72059   1.000 93.13906  ? 10  HIS W C   1 
ATOM   1380 O  O   . HIS B 2 10  ? 23.32532 37.44509  8.20739   1.000 96.55110  ? 10  HIS W O   1 
ATOM   1381 C  CB  . HIS B 2 10  ? 22.08776 40.39303  9.98253   1.000 95.37564  ? 10  HIS W CB  1 
ATOM   1382 C  CG  . HIS B 2 10  ? 20.80635 40.83986  10.60759  1.000 98.87438  ? 10  HIS W CG  1 
ATOM   1383 N  ND1 . HIS B 2 10  ? 20.39746 42.15529  10.62650  1.000 99.83854  ? 10  HIS W ND1 1 
ATOM   1384 C  CD2 . HIS B 2 10  ? 19.83186 40.13514  11.22722  1.000 100.39968 ? 10  HIS W CD2 1 
ATOM   1385 C  CE1 . HIS B 2 10  ? 19.23700 42.24485  11.25288  1.000 100.00672 ? 10  HIS W CE1 1 
ATOM   1386 N  NE2 . HIS B 2 10  ? 18.86856 41.03208  11.62223  1.000 99.57031  ? 10  HIS W NE2 1 
ATOM   1387 N  N   . LYS B 2 11  ? 24.13267 39.52906  8.46377   1.000 91.20129  ? 11  LYS W N   1 
ATOM   1388 C  CA  . LYS B 2 11  ? 25.32530 39.27552  7.67436   1.000 89.42588  ? 11  LYS W CA  1 
ATOM   1389 C  C   . LYS B 2 11  ? 26.59485 39.25867  8.51457   1.000 89.34613  ? 11  LYS W C   1 
ATOM   1390 O  O   . LYS B 2 11  ? 27.69364 39.26598  7.95141   1.000 89.86947  ? 11  LYS W O   1 
ATOM   1391 C  CB  . LYS B 2 11  ? 25.45408 40.28367  6.54095   1.000 88.87667  ? 11  LYS W CB  1 
ATOM   1392 C  CG  . LYS B 2 11  ? 24.56251 40.01452  5.35728   1.000 86.25362  ? 11  LYS W CG  1 
ATOM   1393 C  CD  . LYS B 2 11  ? 24.78431 41.06769  4.28726   1.000 82.85046  ? 11  LYS W CD  1 
ATOM   1394 C  CE  . LYS B 2 11  ? 24.26115 40.60322  2.93466   1.000 83.35196  ? 11  LYS W CE  1 
ATOM   1395 N  NZ  . LYS B 2 11  ? 24.58485 41.55005  1.82730   1.000 84.36121  ? 11  LYS W NZ  1 
ATOM   1396 N  N   . THR B 2 12  ? 26.48009 39.21939  9.83427   1.000 88.73314  ? 12  THR W N   1 
ATOM   1397 C  CA  . THR B 2 12  ? 27.63574 39.21808  10.72044  1.000 87.18931  ? 12  THR W CA  1 
ATOM   1398 C  C   . THR B 2 12  ? 27.95174 37.79173  11.15560  1.000 83.69358  ? 12  THR W C   1 
ATOM   1399 O  O   . THR B 2 12  ? 27.04519 37.00819  11.44827  1.000 84.34039  ? 12  THR W O   1 
ATOM   1400 C  CB  . THR B 2 12  ? 27.36822 40.11353  11.93387  1.000 88.06338  ? 12  THR W CB  1 
ATOM   1401 O  OG1 . THR B 2 12  ? 27.23698 41.47256  11.49031  1.000 87.32048  ? 12  THR W OG1 1 
ATOM   1402 C  CG2 . THR B 2 12  ? 28.49489 40.00783  12.96560  1.000 86.13652  ? 12  THR W CG2 1 
ATOM   1403 N  N   . THR B 2 13  ? 29.24207 37.45559  11.17386  1.000 79.33423  ? 13  THR W N   1 
ATOM   1404 C  CA  . THR B 2 13  ? 29.70474 36.11883  11.51467  1.000 79.62576  ? 13  THR W CA  1 
ATOM   1405 C  C   . THR B 2 13  ? 30.92843 36.24288  12.40856  1.000 78.62340  ? 13  THR W C   1 
ATOM   1406 O  O   . THR B 2 13  ? 31.87454 36.95139  12.05461  1.000 79.56702  ? 13  THR W O   1 
ATOM   1407 C  CB  . THR B 2 13  ? 30.05826 35.31814  10.25424  1.000 81.45563  ? 13  THR W CB  1 
ATOM   1408 O  OG1 . THR B 2 13  ? 28.90130 35.18100  9.41853   1.000 83.57652  ? 13  THR W OG1 1 
ATOM   1409 C  CG2 . THR B 2 13  ? 30.55102 33.94528  10.63568  1.000 83.13539  ? 13  THR W CG2 1 
ATOM   1410 N  N   . ILE B 2 14  ? 30.89394 35.58845  13.57117  1.000 77.11091  ? 14  ILE W N   1 
ATOM   1411 C  CA  . ILE B 2 14  ? 31.95880 35.64837  14.57078  1.000 74.46571  ? 14  ILE W CA  1 
ATOM   1412 C  C   . ILE B 2 14  ? 32.55197 34.25493  14.70798  1.000 72.20325  ? 14  ILE W C   1 
ATOM   1413 O  O   . ILE B 2 14  ? 31.87446 33.33684  15.18336  1.000 71.24002  ? 14  ILE W O   1 
ATOM   1414 C  CB  . ILE B 2 14  ? 31.44654 36.13920  15.93169  1.000 77.48989  ? 14  ILE W CB  1 
ATOM   1415 C  CG1 . ILE B 2 14  ? 30.89007 37.55981  15.84026  1.000 76.53227  ? 14  ILE W CG1 1 
ATOM   1416 C  CG2 . ILE B 2 14  ? 32.55054 36.04587  16.98216  1.000 77.15947  ? 14  ILE W CG2 1 
ATOM   1417 C  CD1 . ILE B 2 14  ? 30.30030 38.04477  17.14690  1.000 75.94677  ? 14  ILE W CD1 1 
ATOM   1418 N  N   . PHE B 2 15  ? 33.81770 34.09480  14.32435  1.000 73.06213  ? 15  PHE W N   1 
ATOM   1419 C  CA  . PHE B 2 15  ? 34.54454 32.84789  14.54510  1.000 72.68771  ? 15  PHE W CA  1 
ATOM   1420 C  C   . PHE B 2 15  ? 35.21561 32.92066  15.90745  1.000 79.87668  ? 15  PHE W C   1 
ATOM   1421 O  O   . PHE B 2 15  ? 36.19704 33.64761  16.07927  1.000 83.19501  ? 15  PHE W O   1 
ATOM   1422 C  CB  . PHE B 2 15  ? 35.58936 32.62177  13.45789  1.000 67.15316  ? 15  PHE W CB  1 
ATOM   1423 C  CG  . PHE B 2 15  ? 35.02448 32.15897  12.15956  1.000 67.09375  ? 15  PHE W CG  1 
ATOM   1424 C  CD1 . PHE B 2 15  ? 34.56436 33.06359  11.22474  1.000 68.12382  ? 15  PHE W CD1 1 
ATOM   1425 C  CD2 . PHE B 2 15  ? 34.97529 30.81806  11.86162  1.000 70.00574  ? 15  PHE W CD2 1 
ATOM   1426 C  CE1 . PHE B 2 15  ? 34.05841 32.63732  10.02713  1.000 69.06800  ? 15  PHE W CE1 1 
ATOM   1427 C  CE2 . PHE B 2 15  ? 34.47297 30.38102  10.66255  1.000 70.61767  ? 15  PHE W CE2 1 
ATOM   1428 C  CZ  . PHE B 2 15  ? 34.01369 31.29154  9.74272   1.000 70.58103  ? 15  PHE W CZ  1 
ATOM   1429 N  N   . THR B 2 16  ? 34.73237 32.12396  16.85541  1.000 85.57165  ? 16  THR W N   1 
ATOM   1430 C  CA  . THR B 2 16  ? 35.28331 32.11770  18.20226  1.000 90.47280  ? 16  THR W CA  1 
ATOM   1431 C  C   . THR B 2 16  ? 35.21367 30.69827  18.74705  1.000 96.17628  ? 16  THR W C   1 
ATOM   1432 O  O   . THR B 2 16  ? 34.64274 29.80180  18.11921  1.000 94.05055  ? 16  THR W O   1 
ATOM   1433 C  CB  . THR B 2 16  ? 34.52550 33.08277  19.11189  1.000 92.06996  ? 16  THR W CB  1 
ATOM   1434 O  OG1 . THR B 2 16  ? 35.25073 33.24823  20.33567  1.000 92.43031  ? 16  THR W OG1 1 
ATOM   1435 C  CG2 . THR B 2 16  ? 33.14047 32.51765  19.42167  1.000 94.63209  ? 16  THR W CG2 1 
ATOM   1436 N  N   . ASP B 2 17  ? 35.76792 30.50594  19.94526  1.000 103.90885 ? 17  ASP W N   1 
ATOM   1437 C  CA  . ASP B 2 17  ? 35.79035 29.19690  20.58402  1.000 111.71258 ? 17  ASP W CA  1 
ATOM   1438 C  C   . ASP B 2 17  ? 35.49311 29.31862  22.07561  1.000 114.21050 ? 17  ASP W C   1 
ATOM   1439 O  O   . ASP B 2 17  ? 35.60747 30.39204  22.67239  1.000 115.29891 ? 17  ASP W O   1 
ATOM   1440 C  CB  . ASP B 2 17  ? 37.13959 28.49635  20.36154  1.000 113.41777 ? 17  ASP W CB  1 
ATOM   1441 C  CG  . ASP B 2 17  ? 38.31331 29.28302  20.92778  1.000 113.99256 ? 17  ASP W CG  1 
ATOM   1442 O  OD1 . ASP B 2 17  ? 38.21222 30.52390  21.04547  1.000 114.31266 ? 17  ASP W OD1 1 
ATOM   1443 O  OD2 . ASP B 2 17  ? 39.34161 28.65383  21.25956  1.000 114.53392 ? 17  ASP W OD2 1 
ATOM   1444 N  N   . ALA B 2 18  ? 35.10191 28.19314  22.67179  1.000 115.53132 ? 18  ALA W N   1 
ATOM   1445 C  CA  . ALA B 2 18  ? 34.78527 28.13454  24.09350  1.000 116.40422 ? 18  ALA W CA  1 
ATOM   1446 C  C   . ALA B 2 18  ? 34.87957 26.68220  24.55733  1.000 117.61023 ? 18  ALA W C   1 
ATOM   1447 O  O   . ALA B 2 18  ? 34.94140 25.75476  23.74674  1.000 124.46779 ? 18  ALA W O   1 
ATOM   1448 C  CB  . ALA B 2 18  ? 33.40066 28.73292  24.37001  1.000 115.30404 ? 18  ALA W CB  1 
ATOM   1449 N  N   . LYS B 2 19  ? 34.90143 26.49429  25.87757  1.000 115.64041 ? 19  LYS W N   1 
ATOM   1450 C  CA  . LYS B 2 19  ? 34.93940 25.14797  26.44200  1.000 112.02170 ? 19  LYS W CA  1 
ATOM   1451 C  C   . LYS B 2 19  ? 33.59946 24.44914  26.24499  1.000 113.47729 ? 19  LYS W C   1 
ATOM   1452 O  O   . LYS B 2 19  ? 32.54208 25.08240  26.27689  1.000 114.13093 ? 19  LYS W O   1 
ATOM   1453 C  CB  . LYS B 2 19  ? 35.30967 25.19372  27.92627  1.000 106.93713 ? 19  LYS W CB  1 
ATOM   1454 C  CG  . LYS B 2 19  ? 36.69592 25.78399  28.18932  1.000 100.83031 ? 19  LYS W CG  1 
ATOM   1455 C  CD  . LYS B 2 19  ? 37.75963 24.95807  27.45606  1.000 96.77363  ? 19  LYS W CD  1 
ATOM   1456 C  CE  . LYS B 2 19  ? 39.17265 25.50974  27.59976  1.000 92.83753  ? 19  LYS W CE  1 
ATOM   1457 N  NZ  . LYS B 2 19  ? 39.33582 26.79801  26.87937  1.000 92.46538  ? 19  LYS W NZ  1 
ATOM   1458 N  N   . GLU B 2 20  ? 33.65099 23.13373  26.01795  1.000 114.23169 ? 20  GLU W N   1 
ATOM   1459 C  CA  . GLU B 2 20  ? 32.43153 22.38127  25.73246  1.000 115.97129 ? 20  GLU W CA  1 
ATOM   1460 C  C   . GLU B 2 20  ? 31.43130 22.45579  26.88091  1.000 118.39262 ? 20  GLU W C   1 
ATOM   1461 O  O   . GLU B 2 20  ? 30.22046 22.57222  26.65252  1.000 118.64666 ? 20  GLU W O   1 
ATOM   1462 C  CB  . GLU B 2 20  ? 32.78165 20.92777  25.42034  1.000 117.21007 ? 20  GLU W CB  1 
ATOM   1463 C  CG  . GLU B 2 20  ? 31.59276 20.09077  25.00198  1.000 119.23514 ? 20  GLU W CG  1 
ATOM   1464 C  CD  . GLU B 2 20  ? 32.00308 18.72961  24.49712  1.000 121.58187 ? 20  GLU W CD  1 
ATOM   1465 O  OE1 . GLU B 2 20  ? 31.16222 17.80865  24.52658  1.000 123.86528 ? 20  GLU W OE1 1 
ATOM   1466 O  OE2 . GLU B 2 20  ? 33.17271 18.57893  24.08381  1.000 122.01924 ? 20  GLU W OE2 1 
ATOM   1467 N  N   . SER B 2 21  ? 31.91366 22.38135  28.11823  1.000 120.03862 ? 21  SER W N   1 
ATOM   1468 C  CA  . SER B 2 21  ? 31.06206 22.52582  29.29752  1.000 121.34504 ? 21  SER W CA  1 
ATOM   1469 C  C   . SER B 2 21  ? 31.18192 23.95285  29.83365  1.000 119.29627 ? 21  SER W C   1 
ATOM   1470 O  O   . SER B 2 21  ? 31.75478 24.22330  30.88677  1.000 120.75494 ? 21  SER W O   1 
ATOM   1471 C  CB  . SER B 2 21  ? 31.42150 21.47291  30.34756  1.000 125.07748 ? 21  SER W CB  1 
ATOM   1472 O  OG  . SER B 2 21  ? 31.10701 20.15995  29.90149  1.000 126.29083 ? 21  SER W OG  1 
ATOM   1473 N  N   . SER B 2 22  ? 30.65286 24.87877  29.04485  1.000 117.45350 ? 22  SER W N   1 
ATOM   1474 C  CA  . SER B 2 22  ? 30.59117 26.28916  29.39612  1.000 117.94872 ? 22  SER W CA  1 
ATOM   1475 C  C   . SER B 2 22  ? 29.16363 26.79273  29.22233  1.000 120.94234 ? 22  SER W C   1 
ATOM   1476 O  O   . SER B 2 22  ? 28.40931 26.29567  28.38121  1.000 120.49494 ? 22  SER W O   1 
ATOM   1477 C  CB  . SER B 2 22  ? 31.55693 27.11862  28.53873  1.000 115.18760 ? 22  SER W CB  1 
ATOM   1478 O  OG  . SER B 2 22  ? 31.41132 28.49794  28.80469  1.000 115.05286 ? 22  SER W OG  1 
ATOM   1479 N  N   . THR B 2 23  ? 28.79190 27.77506  30.03626  1.000 118.47794 ? 23  THR W N   1 
ATOM   1480 C  CA  . THR B 2 23  ? 27.41251 28.22680  30.04967  1.000 115.11447 ? 23  THR W CA  1 
ATOM   1481 C  C   . THR B 2 23  ? 27.10111 29.06533  28.80974  1.000 112.71063 ? 23  THR W C   1 
ATOM   1482 O  O   . THR B 2 23  ? 27.99029 29.62415  28.16199  1.000 115.59453 ? 23  THR W O   1 
ATOM   1483 C  CB  . THR B 2 23  ? 27.13947 29.01963  31.33033  1.000 108.31422 ? 23  THR W CB  1 
ATOM   1484 O  OG1 . THR B 2 23  ? 25.87203 29.68008  31.24227  1.000 108.41976 ? 23  THR W OG1 1 
ATOM   1485 C  CG2 . THR B 2 23  ? 28.23394 30.04222  31.56849  1.000 104.87030 ? 23  THR W CG2 1 
ATOM   1486 N  N   . VAL B 2 24  ? 25.80757 29.13567  28.47764  1.000 119.55489 ? 24  VAL W N   1 
ATOM   1487 C  CA  . VAL B 2 24  ? 25.35259 29.96354  27.36070  1.000 115.84401 ? 24  VAL W CA  1 
ATOM   1488 C  C   . VAL B 2 24  ? 25.45661 31.44434  27.70219  1.000 115.42332 ? 24  VAL W C   1 
ATOM   1489 O  O   . VAL B 2 24  ? 25.76877 32.27482  26.83936  1.000 111.97076 ? 24  VAL W O   1 
ATOM   1490 C  CB  . VAL B 2 24  ? 23.91501 29.57886  26.96317  1.000 116.85772 ? 24  VAL W CB  1 
ATOM   1491 C  CG1 . VAL B 2 24  ? 23.23679 30.72180  26.21151  1.000 115.26945 ? 24  VAL W CG1 1 
ATOM   1492 C  CG2 . VAL B 2 24  ? 23.91860 28.30895  26.12253  1.000 115.38692 ? 24  VAL W CG2 1 
ATOM   1493 N  N   . PHE B 2 25  ? 25.16813 31.80343  28.95465  1.000 118.67699 ? 25  PHE W N   1 
ATOM   1494 C  CA  . PHE B 2 25  ? 25.22847 33.20660  29.34827  1.000 120.29490 ? 25  PHE W CA  1 
ATOM   1495 C  C   . PHE B 2 25  ? 26.62946 33.77810  29.16442  1.000 121.91663 ? 25  PHE W C   1 
ATOM   1496 O  O   . PHE B 2 25  ? 26.78334 34.92427  28.72916  1.000 123.05522 ? 25  PHE W O   1 
ATOM   1497 C  CB  . PHE B 2 25  ? 24.76134 33.37498  30.79307  1.000 120.13208 ? 25  PHE W CB  1 
ATOM   1498 C  CG  . PHE B 2 25  ? 24.77828 34.79544  31.26342  1.000 117.47722 ? 25  PHE W CG  1 
ATOM   1499 C  CD1 . PHE B 2 25  ? 23.72619 35.64508  30.96698  1.000 117.48528 ? 25  PHE W CD1 1 
ATOM   1500 C  CD2 . PHE B 2 25  ? 25.84761 35.28577  31.99244  1.000 115.97070 ? 25  PHE W CD2 1 
ATOM   1501 C  CE1 . PHE B 2 25  ? 23.73969 36.96049  31.39214  1.000 117.90237 ? 25  PHE W CE1 1 
ATOM   1502 C  CE2 . PHE B 2 25  ? 25.86734 36.59776  32.42212  1.000 116.64569 ? 25  PHE W CE2 1 
ATOM   1503 C  CZ  . PHE B 2 25  ? 24.81349 37.43649  32.12201  1.000 117.25777 ? 25  PHE W CZ  1 
ATOM   1504 N  N   . GLU B 2 26  ? 27.66492 33.00111  29.49442  1.000 121.51224 ? 26  GLU W N   1 
ATOM   1505 C  CA  . GLU B 2 26  ? 29.02669 33.48320  29.28545  1.000 121.40204 ? 26  GLU W CA  1 
ATOM   1506 C  C   . GLU B 2 26  ? 29.31858 33.69444  27.80807  1.000 113.20665 ? 26  GLU W C   1 
ATOM   1507 O  O   . GLU B 2 26  ? 30.13311 34.55341  27.45161  1.000 113.77409 ? 26  GLU W O   1 
ATOM   1508 C  CB  . GLU B 2 26  ? 30.03958 32.51027  29.89268  1.000 128.23285 ? 26  GLU W CB  1 
ATOM   1509 C  CG  . GLU B 2 26  ? 31.51082 32.83478  29.59838  1.000 135.31884 ? 26  GLU W CG  1 
ATOM   1510 C  CD  . GLU B 2 26  ? 32.04123 32.18228  28.31815  1.000 140.70116 ? 26  GLU W CD  1 
ATOM   1511 O  OE1 . GLU B 2 26  ? 31.30054 31.40234  27.67465  1.000 145.07687 ? 26  GLU W OE1 1 
ATOM   1512 O  OE2 . GLU B 2 26  ? 33.20899 32.45207  27.95880  1.000 140.67085 ? 26  GLU W OE2 1 
ATOM   1513 N  N   . LEU B 2 27  ? 28.67651 32.92263  26.93281  1.000 107.42108 ? 27  LEU W N   1 
ATOM   1514 C  CA  . LEU B 2 27  ? 28.86426 33.15529  25.50706  1.000 98.98113  ? 27  LEU W CA  1 
ATOM   1515 C  C   . LEU B 2 27  ? 28.30458 34.51694  25.09764  1.000 96.81455  ? 27  LEU W C   1 
ATOM   1516 O  O   . LEU B 2 27  ? 28.91380 35.22385  24.28518  1.000 93.88183  ? 27  LEU W O   1 
ATOM   1517 C  CB  . LEU B 2 27  ? 28.22021 32.02508  24.70201  1.000 93.98619  ? 27  LEU W CB  1 
ATOM   1518 C  CG  . LEU B 2 27  ? 28.57319 32.02679  23.21452  1.000 88.13870  ? 27  LEU W CG  1 
ATOM   1519 C  CD1 . LEU B 2 27  ? 30.04795 31.72672  23.03897  1.000 85.29184  ? 27  LEU W CD1 1 
ATOM   1520 C  CD2 . LEU B 2 27  ? 27.71877 31.04475  22.42627  1.000 86.96943  ? 27  LEU W CD2 1 
ATOM   1521 N  N   . LYS B 2 28  ? 27.16941 34.92123  25.68332  1.000 96.80707  ? 28  LYS W N   1 
ATOM   1522 C  CA  . LYS B 2 28  ? 26.64151 36.25831  25.42819  1.000 95.60935  ? 28  LYS W CA  1 
ATOM   1523 C  C   . LYS B 2 28  ? 27.62365 37.33042  25.87228  1.000 97.45947  ? 28  LYS W C   1 
ATOM   1524 O  O   . LYS B 2 28  ? 27.63187 38.43233  25.31382  1.000 98.06281  ? 28  LYS W O   1 
ATOM   1525 C  CB  . LYS B 2 28  ? 25.30360 36.45720  26.14775  1.000 95.19070  ? 28  LYS W CB  1 
ATOM   1526 C  CG  . LYS B 2 28  ? 24.18292 35.54008  25.69074  1.000 94.41663  ? 28  LYS W CG  1 
ATOM   1527 C  CD  . LYS B 2 28  ? 22.89334 35.81073  26.44524  1.000 93.10988  ? 28  LYS W CD  1 
ATOM   1528 C  CE  . LYS B 2 28  ? 21.74834 34.98351  25.89138  1.000 91.59619  ? 28  LYS W CE  1 
ATOM   1529 N  NZ  . LYS B 2 28  ? 20.45799 35.33448  26.54756  1.000 93.00850  ? 28  LYS W NZ  1 
ATOM   1530 N  N   . ARG B 2 29  ? 28.46026 37.02179  26.86687  1.000 100.01534 ? 29  ARG W N   1 
ATOM   1531 C  CA  . ARG B 2 29  ? 29.49128 37.95439  27.30870  1.000 100.32630 ? 29  ARG W CA  1 
ATOM   1532 C  C   . ARG B 2 29  ? 30.55044 38.16412  26.23295  1.000 99.31553  ? 29  ARG W C   1 
ATOM   1533 O  O   . ARG B 2 29  ? 31.05055 39.28229  26.06138  1.000 100.33692 ? 29  ARG W O   1 
ATOM   1534 C  CB  . ARG B 2 29  ? 30.12138 37.45686  28.60575  1.000 103.54540 ? 29  ARG W CB  1 
ATOM   1535 C  CG  . ARG B 2 29  ? 29.19297 37.55535  29.80334  1.000 108.35316 ? 29  ARG W CG  1 
ATOM   1536 C  CD  . ARG B 2 29  ? 28.79331 39.00717  30.05645  1.000 112.20090 ? 29  ARG W CD  1 
ATOM   1537 N  NE  . ARG B 2 29  ? 28.05850 39.19436  31.30778  1.000 117.34830 ? 29  ARG W NE  1 
ATOM   1538 C  CZ  . ARG B 2 29  ? 27.63619 40.37505  31.75460  1.000 122.02779 ? 29  ARG W CZ  1 
ATOM   1539 N  NH1 . ARG B 2 29  ? 27.87813 41.47776  31.05446  1.000 122.75971 ? 29  ARG W NH1 1 
ATOM   1540 N  NH2 . ARG B 2 29  ? 26.97693 40.46007  32.90366  1.000 124.60643 ? 29  ARG W NH2 1 
ATOM   1541 N  N   . ILE B 2 30  ? 30.94163 37.09240  25.53314  1.000 96.23747  ? 30  ILE W N   1 
ATOM   1542 C  CA  . ILE B 2 30  ? 31.86841 37.23037  24.40965  1.000 91.52310  ? 30  ILE W CA  1 
ATOM   1543 C  C   . ILE B 2 30  ? 31.25166 38.10044  23.32668  1.000 90.49001  ? 30  ILE W C   1 
ATOM   1544 O  O   . ILE B 2 30  ? 31.93651 38.90956  22.68730  1.000 88.87238  ? 30  ILE W O   1 
ATOM   1545 C  CB  . ILE B 2 30  ? 32.26149 35.84508  23.85936  1.000 91.10456  ? 30  ILE W CB  1 
ATOM   1546 C  CG1 . ILE B 2 30  ? 33.18727 35.11522  24.83084  1.000 91.29835  ? 30  ILE W CG1 1 
ATOM   1547 C  CG2 . ILE B 2 30  ? 32.91159 35.96811  22.48384  1.000 89.47195  ? 30  ILE W CG2 1 
ATOM   1548 C  CD1 . ILE B 2 30  ? 34.57580 35.73173  24.93777  1.000 91.56707  ? 30  ILE W CD1 1 
ATOM   1549 N  N   . VAL B 2 31  ? 29.94631 37.93992  23.10236  1.000 89.52285  ? 31  VAL W N   1 
ATOM   1550 C  CA  . VAL B 2 31  ? 29.23629 38.77542  22.14116  1.000 86.85327  ? 31  VAL W CA  1 
ATOM   1551 C  C   . VAL B 2 31  ? 29.21817 40.22678  22.60492  1.000 86.59006  ? 31  VAL W C   1 
ATOM   1552 O  O   . VAL B 2 31  ? 29.36350 41.14972  21.79560  1.000 85.52326  ? 31  VAL W O   1 
ATOM   1553 C  CB  . VAL B 2 31  ? 27.81920 38.21823  21.90013  1.000 85.72411  ? 31  VAL W CB  1 
ATOM   1554 C  CG1 . VAL B 2 31  ? 27.03742 39.10649  20.96299  1.000 85.03050  ? 31  VAL W CG1 1 
ATOM   1555 C  CG2 . VAL B 2 31  ? 27.91124 36.82484  21.29990  1.000 83.78633  ? 31  VAL W CG2 1 
ATOM   1556 N  N   . GLU B 2 32  ? 29.06024 40.45703  23.91048  1.000 89.51938  ? 32  GLU W N   1 
ATOM   1557 C  CA  . GLU B 2 32  ? 29.00735 41.83147  24.40079  1.000 92.88678  ? 32  GLU W CA  1 
ATOM   1558 C  C   . GLU B 2 32  ? 30.32751 42.55786  24.15730  1.000 94.25405  ? 32  GLU W C   1 
ATOM   1559 O  O   . GLU B 2 32  ? 30.33686 43.75768  23.85198  1.000 96.08052  ? 32  GLU W O   1 
ATOM   1560 C  CB  . GLU B 2 32  ? 28.64330 41.86136  25.88461  1.000 95.89191  ? 32  GLU W CB  1 
ATOM   1561 C  CG  . GLU B 2 32  ? 28.46033 43.27460  26.40995  1.000 100.91748 ? 32  GLU W CG  1 
ATOM   1562 C  CD  . GLU B 2 32  ? 28.27083 43.33806  27.90910  1.000 108.36070 ? 32  GLU W CD  1 
ATOM   1563 O  OE1 . GLU B 2 32  ? 28.36321 42.28210  28.56859  1.000 110.52065 ? 32  GLU W OE1 1 
ATOM   1564 O  OE2 . GLU B 2 32  ? 28.04302 44.45307  28.42844  1.000 111.61072 ? 32  GLU W OE2 1 
ATOM   1565 N  N   . GLY B 2 33  ? 31.45175 41.84558  24.27928  1.000 92.98087  ? 33  GLY W N   1 
ATOM   1566 C  CA  . GLY B 2 33  ? 32.75903 42.44679  24.07590  1.000 93.41232  ? 33  GLY W CA  1 
ATOM   1567 C  C   . GLY B 2 33  ? 33.07972 42.77317  22.63197  1.000 93.52970  ? 33  GLY W C   1 
ATOM   1568 O  O   . GLY B 2 33  ? 33.98747 43.57236  22.37550  1.000 96.54418  ? 33  GLY W O   1 
ATOM   1569 N  N   . ILE B 2 34  ? 32.35261 42.18628  21.68804  1.000 90.78263  ? 34  ILE W N   1 
ATOM   1570 C  CA  . ILE B 2 34  ? 32.60760 42.37113  20.26489  1.000 86.66767  ? 34  ILE W CA  1 
ATOM   1571 C  C   . ILE B 2 34  ? 31.59061 43.31329  19.62858  1.000 88.05144  ? 34  ILE W C   1 
ATOM   1572 O  O   . ILE B 2 34  ? 31.96073 44.27945  18.96077  1.000 87.72893  ? 34  ILE W O   1 
ATOM   1573 C  CB  . ILE B 2 34  ? 32.62036 40.99840  19.55292  1.000 84.16634  ? 34  ILE W CB  1 
ATOM   1574 C  CG1 . ILE B 2 34  ? 33.74871 40.11585  20.10155  1.000 89.13620  ? 34  ILE W CG1 1 
ATOM   1575 C  CG2 . ILE B 2 34  ? 32.72655 41.15897  18.04563  1.000 78.02459  ? 34  ILE W CG2 1 
ATOM   1576 C  CD1 . ILE B 2 34  ? 33.80244 38.70833  19.50516  1.000 89.97779  ? 34  ILE W CD1 1 
ATOM   1577 N  N   . LEU B 2 35  ? 30.29840 43.06174  19.85518  1.000 88.46151  ? 35  LEU W N   1 
ATOM   1578 C  CA  . LEU B 2 35  ? 29.20879 43.79042  19.21426  1.000 84.51129  ? 35  LEU W CA  1 
ATOM   1579 C  C   . LEU B 2 35  ? 28.53034 44.79942  20.14662  1.000 87.71450  ? 35  LEU W C   1 
ATOM   1580 O  O   . LEU B 2 35  ? 27.51298 45.38955  19.76486  1.000 86.23754  ? 35  LEU W O   1 
ATOM   1581 C  CB  . LEU B 2 35  ? 28.18715 42.79635  18.63791  1.000 80.57438  ? 35  LEU W CB  1 
ATOM   1582 C  CG  . LEU B 2 35  ? 28.75832 41.74058  17.66199  1.000 75.10971  ? 35  LEU W CG  1 
ATOM   1583 C  CD1 . LEU B 2 35  ? 27.71943 40.80881  16.99484  1.000 71.50738  ? 35  LEU W CD1 1 
ATOM   1584 C  CD2 . LEU B 2 35  ? 29.60287 42.42443  16.60534  1.000 72.32760  ? 35  LEU W CD2 1 
ATOM   1585 N  N   . LYS B 2 36  ? 29.05699 44.98427  21.36538  1.000 89.68804  ? 36  LYS W N   1 
ATOM   1586 C  CA  . LYS B 2 36  ? 28.71653 46.11577  22.23744  1.000 92.19990  ? 36  LYS W CA  1 
ATOM   1587 C  C   . LYS B 2 36  ? 27.21640 46.19811  22.53711  1.000 96.67651  ? 36  LYS W C   1 
ATOM   1588 O  O   . LYS B 2 36  ? 26.59286 47.25586  22.42009  1.000 98.33714  ? 36  LYS W O   1 
ATOM   1589 C  CB  . LYS B 2 36  ? 29.21314 47.42834  21.62511  1.000 89.77805  ? 36  LYS W CB  1 
ATOM   1590 C  CG  . LYS B 2 36  ? 30.69307 47.45628  21.29953  1.000 87.35798  ? 36  LYS W CG  1 
ATOM   1591 C  CD  . LYS B 2 36  ? 31.52119 47.14736  22.51508  1.000 91.95616  ? 36  LYS W CD  1 
ATOM   1592 C  CE  . LYS B 2 36  ? 32.98834 47.31524  22.21494  1.000 94.80202  ? 36  LYS W CE  1 
ATOM   1593 N  NZ  . LYS B 2 36  ? 33.43086 46.34876  21.17634  1.000 95.07842  ? 36  LYS W NZ  1 
ATOM   1594 N  N   . ARG B 2 37  ? 26.63098 45.06323  22.92643  1.000 97.55560  ? 37  ARG W N   1 
ATOM   1595 C  CA  . ARG B 2 37  ? 25.24160 45.01006  23.38300  1.000 97.40126  ? 37  ARG W CA  1 
ATOM   1596 C  C   . ARG B 2 37  ? 25.14758 44.13655  24.62855  1.000 95.34905  ? 37  ARG W C   1 
ATOM   1597 O  O   . ARG B 2 37  ? 25.69786 43.02065  24.64016  1.000 93.13281  ? 37  ARG W O   1 
ATOM   1598 C  CB  . ARG B 2 37  ? 24.32306 44.48090  22.28439  1.000 97.72466  ? 37  ARG W CB  1 
ATOM   1599 C  CG  . ARG B 2 37  ? 24.22416 45.39081  21.06449  1.000 100.39958 ? 37  ARG W CG  1 
ATOM   1600 C  CD  . ARG B 2 37  ? 23.36126 46.61500  21.30215  1.000 106.03731 ? 37  ARG W CD  1 
ATOM   1601 N  NE  . ARG B 2 37  ? 21.94098 46.26342  21.28343  1.000 109.08249 ? 37  ARG W NE  1 
ATOM   1602 C  CZ  . ARG B 2 37  ? 21.20835 46.17425  20.17331  1.000 109.20508 ? 37  ARG W CZ  1 
ATOM   1603 N  NH1 . ARG B 2 37  ? 21.76518 46.39264  18.98692  1.000 106.78496 ? 37  ARG W NH1 1 
ATOM   1604 N  NH2 . ARG B 2 37  ? 19.92322 45.84857  20.24412  1.000 110.83383 ? 37  ARG W NH2 1 
ATOM   1605 N  N   . PRO B 2 38  ? 24.46214 44.59644  25.67345  1.000 98.08931  ? 38  PRO W N   1 
ATOM   1606 C  CA  . PRO B 2 38  ? 24.38144 43.80553  26.89977  1.000 100.17364 ? 38  PRO W CA  1 
ATOM   1607 C  C   . PRO B 2 38  ? 23.65589 42.49438  26.65427  1.000 101.55379 ? 38  PRO W C   1 
ATOM   1608 O  O   . PRO B 2 38  ? 22.78153 42.40578  25.77415  1.000 101.71573 ? 38  PRO W O   1 
ATOM   1609 C  CB  . PRO B 2 38  ? 23.59394 44.71267  27.85430  1.000 102.95311 ? 38  PRO W CB  1 
ATOM   1610 C  CG  . PRO B 2 38  ? 23.79163 46.09855  27.30977  1.000 102.32840 ? 38  PRO W CG  1 
ATOM   1611 C  CD  . PRO B 2 38  ? 23.86538 45.93346  25.82703  1.000 99.58732  ? 38  PRO W CD  1 
ATOM   1612 N  N   . PRO B 2 39  ? 23.99795 41.44627  27.40905  1.000 103.75532 ? 39  PRO W N   1 
ATOM   1613 C  CA  . PRO B 2 39  ? 23.35174 40.13576  27.19643  1.000 106.91575 ? 39  PRO W CA  1 
ATOM   1614 C  C   . PRO B 2 39  ? 21.84465 40.12991  27.41613  1.000 114.05818 ? 39  PRO W C   1 
ATOM   1615 O  O   . PRO B 2 39  ? 21.17425 39.21511  26.92125  1.000 114.20828 ? 39  PRO W O   1 
ATOM   1616 C  CB  . PRO B 2 39  ? 24.07225 39.22257  28.19674  1.000 105.88146 ? 39  PRO W CB  1 
ATOM   1617 C  CG  . PRO B 2 39  ? 25.39711 39.86358  28.38721  1.000 103.60525 ? 39  PRO W CG  1 
ATOM   1618 C  CD  . PRO B 2 39  ? 25.14712 41.34716  28.32123  1.000 103.38698 ? 39  PRO W CD  1 
ATOM   1619 N  N   . ASP B 2 40  ? 21.29079 41.10043  28.15052  1.000 119.49153 ? 40  ASP W N   1 
ATOM   1620 C  CA  . ASP B 2 40  ? 19.84740 41.15282  28.35513  1.000 124.89649 ? 40  ASP W CA  1 
ATOM   1621 C  C   . ASP B 2 40  ? 19.08897 41.43020  27.06687  1.000 124.45858 ? 40  ASP W C   1 
ATOM   1622 O  O   . ASP B 2 40  ? 17.87812 41.18067  27.00902  1.000 126.08192 ? 40  ASP W O   1 
ATOM   1623 C  CB  . ASP B 2 40  ? 19.50345 42.23355  29.37791  1.000 130.92028 ? 40  ASP W CB  1 
ATOM   1624 C  CG  . ASP B 2 40  ? 20.29378 42.09011  30.65188  1.000 138.49716 ? 40  ASP W CG  1 
ATOM   1625 O  OD1 . ASP B 2 40  ? 20.89362 41.01350  30.83650  1.000 141.23748 ? 40  ASP W OD1 1 
ATOM   1626 O  OD2 . ASP B 2 40  ? 20.31467 43.04115  31.46342  1.000 141.58100 ? 40  ASP W OD2 1 
ATOM   1627 N  N   . GLU B 2 41  ? 19.77672 41.94843  26.04804  1.000 122.90366 ? 41  GLU W N   1 
ATOM   1628 C  CA  . GLU B 2 41  ? 19.19597 42.35213  24.77472  1.000 120.48945 ? 41  GLU W CA  1 
ATOM   1629 C  C   . GLU B 2 41  ? 19.43284 41.35099  23.64889  1.000 118.93135 ? 41  GLU W C   1 
ATOM   1630 O  O   . GLU B 2 41  ? 19.17093 41.67735  22.48919  1.000 125.06416 ? 41  GLU W O   1 
ATOM   1631 C  CB  . GLU B 2 41  ? 19.74508 43.72381  24.37291  1.000 121.41378 ? 41  GLU W CB  1 
ATOM   1632 C  CG  . GLU B 2 41  ? 19.30410 44.83619  25.30975  1.000 123.33518 ? 41  GLU W CG  1 
ATOM   1633 C  CD  . GLU B 2 41  ? 19.80001 46.20931  24.89884  1.000 123.20711 ? 41  GLU W CD  1 
ATOM   1634 O  OE1 . GLU B 2 41  ? 20.01761 46.44648  23.68974  1.000 121.69935 ? 41  GLU W OE1 1 
ATOM   1635 O  OE2 . GLU B 2 41  ? 19.97345 47.05431  25.80280  1.000 124.25507 ? 41  GLU W OE2 1 
ATOM   1636 N  N   . GLN B 2 42  ? 19.96960 40.17084  23.93864  1.000 111.75912 ? 42  GLN W N   1 
ATOM   1637 C  CA  . GLN B 2 42  ? 20.28850 39.21725  22.88537  1.000 107.01488 ? 42  GLN W CA  1 
ATOM   1638 C  C   . GLN B 2 42  ? 19.85671 37.80377  23.25149  1.000 110.26160 ? 42  GLN W C   1 
ATOM   1639 O  O   . GLN B 2 42  ? 20.09773 37.33742  24.36885  1.000 113.41556 ? 42  GLN W O   1 
ATOM   1640 C  CB  . GLN B 2 42  ? 21.78638 39.24049  22.55981  1.000 99.21243  ? 42  GLN W CB  1 
ATOM   1641 C  CG  . GLN B 2 42  ? 22.69228 39.43499  23.75538  1.000 96.32982  ? 42  GLN W CG  1 
ATOM   1642 C  CD  . GLN B 2 42  ? 24.15304 39.27133  23.39544  1.000 92.05467  ? 42  GLN W CD  1 
ATOM   1643 O  OE1 . GLN B 2 42  ? 24.54414 38.26920  22.80371  1.000 89.75955  ? 42  GLN W OE1 1 
ATOM   1644 N  NE2 . GLN B 2 42  ? 24.96483 40.26603  23.72996  1.000 92.11625  ? 42  GLN W NE2 1 
ATOM   1645 N  N   . ARG B 2 43  ? 19.24012 37.12392  22.28696  1.000 111.60299 ? 43  ARG W N   1 
ATOM   1646 C  CA  . ARG B 2 43  ? 18.93233 35.70222  22.36012  1.000 111.77857 ? 43  ARG W CA  1 
ATOM   1647 C  C   . ARG B 2 43  ? 19.94582 34.92007  21.53653  1.000 103.48065 ? 43  ARG W C   1 
ATOM   1648 O  O   . ARG B 2 43  ? 20.25260 35.29332  20.39914  1.000 99.53179  ? 43  ARG W O   1 
ATOM   1649 C  CB  . ARG B 2 43  ? 17.54056 35.40509  21.80499  1.000 119.41837 ? 43  ARG W CB  1 
ATOM   1650 C  CG  . ARG B 2 43  ? 16.34941 35.59711  22.71129  1.000 129.70441 ? 43  ARG W CG  1 
ATOM   1651 C  CD  . ARG B 2 43  ? 15.09692 35.44623  21.85392  1.000 138.10000 ? 43  ARG W CD  1 
ATOM   1652 N  NE  . ARG B 2 43  ? 13.88552 35.10336  22.59527  1.000 150.09950 ? 43  ARG W NE  1 
ATOM   1653 C  CZ  . ARG B 2 43  ? 12.66812 35.07459  22.05712  1.000 151.92660 ? 43  ARG W CZ  1 
ATOM   1654 N  NH1 . ARG B 2 43  ? 11.61771 34.74341  22.79839  1.000 152.79473 ? 43  ARG W NH1 1 
ATOM   1655 N  NH2 . ARG B 2 43  ? 12.49868 35.39177  20.77856  1.000 151.44820 ? 43  ARG W NH2 1 
ATOM   1656 N  N   . LEU B 2 44  ? 20.44305 33.81933  22.09949  1.000 99.28605  ? 44  LEU W N   1 
ATOM   1657 C  CA  . LEU B 2 44  ? 21.32353 32.90267  21.38304  1.000 94.06144  ? 44  LEU W CA  1 
ATOM   1658 C  C   . LEU B 2 44  ? 20.55212 31.64029  21.01683  1.000 99.25829  ? 44  LEU W C   1 
ATOM   1659 O  O   . LEU B 2 44  ? 19.79824 31.10561  21.83518  1.000 100.09630 ? 44  LEU W O   1 
ATOM   1660 C  CB  . LEU B 2 44  ? 22.55320 32.54123  22.21892  1.000 87.33272  ? 44  LEU W CB  1 
ATOM   1661 C  CG  . LEU B 2 44  ? 23.55062 33.67175  22.46089  1.000 83.77463  ? 44  LEU W CG  1 
ATOM   1662 C  CD1 . LEU B 2 44  ? 24.78885 33.18212  23.18396  1.000 82.99319  ? 44  LEU W CD1 1 
ATOM   1663 C  CD2 . LEU B 2 44  ? 23.94494 34.29587  21.14212  1.000 82.19047  ? 44  LEU W CD2 1 
ATOM   1664 N  N   . TYR B 2 45  ? 20.73870 31.16472  19.78683  1.000 104.19744 ? 45  TYR W N   1 
ATOM   1665 C  CA  . TYR B 2 45  ? 19.99538 30.01947  19.27914  1.000 111.76510 ? 45  TYR W CA  1 
ATOM   1666 C  C   . TYR B 2 45  ? 20.92792 28.93969  18.75008  1.000 116.75483 ? 45  TYR W C   1 
ATOM   1667 O  O   . TYR B 2 45  ? 21.94866 29.23579  18.12341  1.000 118.58048 ? 45  TYR W O   1 
ATOM   1668 C  CB  . TYR B 2 45  ? 19.02658 30.43056  18.16282  1.000 110.59268 ? 45  TYR W CB  1 
ATOM   1669 C  CG  . TYR B 2 45  ? 17.81768 31.18600  18.63746  1.000 112.10740 ? 45  TYR W CG  1 
ATOM   1670 C  CD1 . TYR B 2 45  ? 17.82449 32.56951  18.75495  1.000 112.30803 ? 45  TYR W CD1 1 
ATOM   1671 C  CD2 . TYR B 2 45  ? 16.65770 30.50181  18.97442  1.000 116.03977 ? 45  TYR W CD2 1 
ATOM   1672 C  CE1 . TYR B 2 45  ? 16.70053 33.25267  19.19971  1.000 116.71262 ? 45  TYR W CE1 1 
ATOM   1673 C  CE2 . TYR B 2 45  ? 15.53547 31.16838  19.41897  1.000 120.32057 ? 45  TYR W CE2 1 
ATOM   1674 C  CZ  . TYR B 2 45  ? 15.56011 32.54269  19.53061  1.000 123.12423 ? 45  TYR W CZ  1 
ATOM   1675 O  OH  . TYR B 2 45  ? 14.43762 33.20080  19.97122  1.000 131.66022 ? 45  TYR W OH  1 
ATOM   1676 N  N   . LYS B 2 46  ? 20.56370 27.68589  19.01400  1.000 119.41802 ? 46  LYS W N   1 
ATOM   1677 C  CA  . LYS B 2 46  ? 21.18241 26.51795  18.40698  1.000 123.66520 ? 46  LYS W CA  1 
ATOM   1678 C  C   . LYS B 2 46  ? 20.13178 25.78440  17.59480  1.000 132.38646 ? 46  LYS W C   1 
ATOM   1679 O  O   . LYS B 2 46  ? 19.07550 25.42109  18.12780  1.000 139.05184 ? 46  LYS W O   1 
ATOM   1680 C  CB  . LYS B 2 46  ? 21.77882 25.56668  19.43995  1.000 125.26279 ? 46  LYS W CB  1 
ATOM   1681 C  CG  . LYS B 2 46  ? 22.16385 24.23123  18.80473  1.000 125.48547 ? 46  LYS W CG  1 
ATOM   1682 C  CD  . LYS B 2 46  ? 22.70929 23.22385  19.79430  1.000 128.20014 ? 46  LYS W CD  1 
ATOM   1683 C  CE  . LYS B 2 46  ? 22.89803 21.86154  19.12012  1.000 128.32293 ? 46  LYS W CE  1 
ATOM   1684 N  NZ  . LYS B 2 46  ? 23.68170 21.96186  17.85145  1.000 125.74208 ? 46  LYS W NZ  1 
ATOM   1685 N  N   . ASP B 2 47  ? 20.41487 25.59198  16.30498  1.000 161.01756 ? 47  ASP W N   1 
ATOM   1686 C  CA  . ASP B 2 47  ? 19.48331 24.98151  15.35674  1.000 171.71883 ? 47  ASP W CA  1 
ATOM   1687 C  C   . ASP B 2 47  ? 18.18718 25.78680  15.39930  1.000 184.93915 ? 47  ASP W C   1 
ATOM   1688 O  O   . ASP B 2 47  ? 18.21767 26.98713  15.07826  1.000 196.98884 ? 47  ASP W O   1 
ATOM   1689 C  CB  . ASP B 2 47  ? 19.35736 23.48453  15.68978  1.000 162.04748 ? 47  ASP W CB  1 
ATOM   1690 C  CG  . ASP B 2 47  ? 20.65095 22.69401  15.43495  1.000 153.47268 ? 47  ASP W CG  1 
ATOM   1691 O  OD1 . ASP B 2 47  ? 21.69559 23.30388  15.11109  1.000 148.34663 ? 47  ASP W OD1 1 
ATOM   1692 O  OD2 . ASP B 2 47  ? 20.63370 21.46260  15.59514  1.000 150.60651 ? 47  ASP W OD2 1 
ATOM   1693 N  N   . ASP B 2 48  ? 17.05228 25.18430  15.75096  1.000 184.70818 ? 48  ASP W N   1 
ATOM   1694 C  CA  . ASP B 2 48  ? 15.75711 25.83520  15.88978  1.000 193.13970 ? 48  ASP W CA  1 
ATOM   1695 C  C   . ASP B 2 48  ? 15.27299 25.72123  17.33589  1.000 196.08999 ? 48  ASP W C   1 
ATOM   1696 O  O   . ASP B 2 48  ? 14.25306 25.07360  17.60329  1.000 203.39533 ? 48  ASP W O   1 
ATOM   1697 C  CB  . ASP B 2 48  ? 14.76146 25.20846  14.90149  1.000 200.97851 ? 48  ASP W CB  1 
ATOM   1698 C  CG  . ASP B 2 48  ? 13.42702 25.91592  14.89327  1.000 205.90973 ? 48  ASP W CG  1 
ATOM   1699 O  OD1 . ASP B 2 48  ? 13.33214 27.00991  15.49363  1.000 207.10268 ? 48  ASP W OD1 1 
ATOM   1700 O  OD2 . ASP B 2 48  ? 12.47423 25.37388  14.27590  1.000 208.49952 ? 48  ASP W OD2 1 
ATOM   1701 N  N   . GLN B 2 49  ? 16.04725 26.23356  18.29262  1.000 186.85026 ? 49  GLN W N   1 
ATOM   1702 C  CA  . GLN B 2 49  ? 15.64275 26.14049  19.69322  1.000 174.48734 ? 49  GLN W CA  1 
ATOM   1703 C  C   . GLN B 2 49  ? 16.25668 27.28795  20.47740  1.000 158.62391 ? 49  GLN W C   1 
ATOM   1704 O  O   . GLN B 2 49  ? 17.46118 27.52761  20.37038  1.000 157.47849 ? 49  GLN W O   1 
ATOM   1705 C  CB  . GLN B 2 49  ? 16.07272 24.79943  20.30217  1.000 169.40040 ? 49  GLN W CB  1 
ATOM   1706 C  CG  . GLN B 2 49  ? 15.89535 24.71292  21.80747  1.000 164.98565 ? 49  GLN W CG  1 
ATOM   1707 C  CD  . GLN B 2 49  ? 16.36016 23.38781  22.37168  1.000 160.64864 ? 49  GLN W CD  1 
ATOM   1708 O  OE1 . GLN B 2 49  ? 16.95701 22.57625  21.66556  1.000 159.34328 ? 49  GLN W OE1 1 
ATOM   1709 N  NE2 . GLN B 2 49  ? 16.09103 23.16134  23.65307  1.000 158.80221 ? 49  GLN W NE2 1 
ATOM   1710 N  N   . LEU B 2 50  ? 15.44432 27.97764  21.27202  1.000 146.89798 ? 50  LEU W N   1 
ATOM   1711 C  CA  . LEU B 2 50  ? 15.97971 29.00068  22.15807  1.000 134.47920 ? 50  LEU W CA  1 
ATOM   1712 C  C   . LEU B 2 50  ? 16.83825 28.35154  23.23896  1.000 129.31671 ? 50  LEU W C   1 
ATOM   1713 O  O   . LEU B 2 50  ? 16.55301 27.24626  23.70712  1.000 130.24123 ? 50  LEU W O   1 
ATOM   1714 C  CB  . LEU B 2 50  ? 14.84274 29.80171  22.79303  1.000 131.42679 ? 50  LEU W CB  1 
ATOM   1715 C  CG  . LEU B 2 50  ? 15.19979 30.85171  23.85318  1.000 128.33261 ? 50  LEU W CG  1 
ATOM   1716 C  CD1 . LEU B 2 50  ? 16.20734 31.86050  23.32674  1.000 122.75519 ? 50  LEU W CD1 1 
ATOM   1717 C  CD2 . LEU B 2 50  ? 13.95127 31.54622  24.41167  1.000 130.42862 ? 50  LEU W CD2 1 
ATOM   1718 N  N   . LEU B 2 51  ? 17.89718 29.04844  23.64001  1.000 125.58838 ? 51  LEU W N   1 
ATOM   1719 C  CA  . LEU B 2 51  ? 18.85249 28.52932  24.60837  1.000 125.12371 ? 51  LEU W CA  1 
ATOM   1720 C  C   . LEU B 2 51  ? 18.66498 29.19470  25.96572  1.000 129.95277 ? 51  LEU W C   1 
ATOM   1721 O  O   . LEU B 2 51  ? 18.41037 30.40005  26.04926  1.000 131.65535 ? 51  LEU W O   1 
ATOM   1722 C  CB  . LEU B 2 51  ? 20.28777 28.73995  24.12993  1.000 119.94707 ? 51  LEU W CB  1 
ATOM   1723 C  CG  . LEU B 2 51  ? 20.62467 28.04215  22.81684  1.000 117.02086 ? 51  LEU W CG  1 
ATOM   1724 C  CD1 . LEU B 2 51  ? 22.10591 28.17151  22.51693  1.000 113.84339 ? 51  LEU W CD1 1 
ATOM   1725 C  CD2 . LEU B 2 51  ? 20.20967 26.57702  22.88578  1.000 118.08019 ? 51  LEU W CD2 1 
ATOM   1726 N  N   . ASP B 2 52  ? 18.78416 28.39656  27.02491  1.000 132.29553 ? 52  ASP W N   1 
ATOM   1727 C  CA  . ASP B 2 52  ? 18.70010 28.89673  28.39071  1.000 133.70114 ? 52  ASP W CA  1 
ATOM   1728 C  C   . ASP B 2 52  ? 20.06239 29.43166  28.81628  1.000 130.41480 ? 52  ASP W C   1 
ATOM   1729 O  O   . ASP B 2 52  ? 21.10156 28.86251  28.46881  1.000 129.64860 ? 52  ASP W O   1 
ATOM   1730 C  CB  . ASP B 2 52  ? 18.23835 27.77423  29.33428  1.000 139.43354 ? 52  ASP W CB  1 
ATOM   1731 C  CG  . ASP B 2 52  ? 17.91285 28.26300  30.75265  1.000 142.94991 ? 52  ASP W CG  1 
ATOM   1732 O  OD1 . ASP B 2 52  ? 17.48070 29.42301  30.92658  1.000 145.31187 ? 52  ASP W OD1 1 
ATOM   1733 O  OD2 . ASP B 2 52  ? 18.07501 27.46118  31.70124  1.000 143.15312 ? 52  ASP W OD2 1 
ATOM   1734 N  N   . ASP B 2 53  ? 20.05771 30.55952  29.53235  1.000 128.46420 ? 53  ASP W N   1 
ATOM   1735 C  CA  . ASP B 2 53  ? 21.32163 31.16917  29.93393  1.000 129.16079 ? 53  ASP W CA  1 
ATOM   1736 C  C   . ASP B 2 53  ? 22.15537 30.21797  30.78700  1.000 130.47363 ? 53  ASP W C   1 
ATOM   1737 O  O   . ASP B 2 53  ? 23.38813 30.23480  30.70916  1.000 129.48593 ? 53  ASP W O   1 
ATOM   1738 C  CB  . ASP B 2 53  ? 21.07041 32.47747  30.69395  1.000 131.27529 ? 53  ASP W CB  1 
ATOM   1739 C  CG  . ASP B 2 53  ? 20.40923 33.55156  29.83281  1.000 133.03877 ? 53  ASP W CG  1 
ATOM   1740 O  OD1 . ASP B 2 53  ? 20.41048 33.42316  28.58984  1.000 134.56080 ? 53  ASP W OD1 1 
ATOM   1741 O  OD2 . ASP B 2 53  ? 19.89477 34.53614  30.40621  1.000 132.81509 ? 53  ASP W OD2 1 
ATOM   1742 N  N   . GLY B 2 54  ? 21.50530 29.37722  31.59746  1.000 133.19051 ? 54  GLY W N   1 
ATOM   1743 C  CA  . GLY B 2 54  ? 22.22370 28.49251  32.50022  1.000 135.11179 ? 54  GLY W CA  1 
ATOM   1744 C  C   . GLY B 2 54  ? 22.76654 27.21730  31.88165  1.000 139.33453 ? 54  GLY W C   1 
ATOM   1745 O  O   . GLY B 2 54  ? 23.72586 26.65193  32.41553  1.000 140.10819 ? 54  GLY W O   1 
ATOM   1746 N  N   . LYS B 2 55  ? 22.18863 26.75149  30.77426  1.000 142.04658 ? 55  LYS W N   1 
ATOM   1747 C  CA  . LYS B 2 55  ? 22.58268 25.46280  30.21375  1.000 145.74034 ? 55  LYS W CA  1 
ATOM   1748 C  C   . LYS B 2 55  ? 23.98973 25.52198  29.63008  1.000 144.37664 ? 55  LYS W C   1 
ATOM   1749 O  O   . LYS B 2 55  ? 24.39300 26.52560  29.03773  1.000 147.68020 ? 55  LYS W O   1 
ATOM   1750 C  CB  . LYS B 2 55  ? 21.59189 25.01202  29.13956  1.000 141.99426 ? 55  LYS W CB  1 
ATOM   1751 C  CG  . LYS B 2 55  ? 20.24741 24.54864  29.68166  1.000 141.18263 ? 55  LYS W CG  1 
ATOM   1752 C  CD  . LYS B 2 55  ? 19.36418 23.96311  28.58643  1.000 139.04080 ? 55  LYS W CD  1 
ATOM   1753 C  CE  . LYS B 2 55  ? 18.04576 23.46051  29.15927  1.000 138.93802 ? 55  LYS W CE  1 
ATOM   1754 N  NZ  . LYS B 2 55  ? 17.26796 24.55885  29.80279  1.000 137.57740 ? 55  LYS W NZ  1 
ATOM   1755 N  N   . THR B 2 56  ? 24.74648 24.44128  29.83058  1.000 141.34152 ? 56  THR W N   1 
ATOM   1756 C  CA  . THR B 2 56  ? 26.09146 24.32348  29.28048  1.000 138.12227 ? 56  THR W CA  1 
ATOM   1757 C  C   . THR B 2 56  ? 26.05349 24.13816  27.76504  1.000 136.35499 ? 56  THR W C   1 
ATOM   1758 O  O   . THR B 2 56  ? 25.06359 23.67491  27.19081  1.000 140.06194 ? 56  THR W O   1 
ATOM   1759 C  CB  . THR B 2 56  ? 26.83211 23.14180  29.90643  1.000 138.61881 ? 56  THR W CB  1 
ATOM   1760 O  OG1 . THR B 2 56  ? 26.18388 21.91740  29.53131  1.000 140.83510 ? 56  THR W OG1 1 
ATOM   1761 C  CG2 . THR B 2 56  ? 26.84901 23.25982  31.42488  1.000 137.98182 ? 56  THR W CG2 1 
ATOM   1762 N  N   . LEU B 2 57  ? 27.16776 24.49184  27.11677  1.000 131.07879 ? 57  LEU W N   1 
ATOM   1763 C  CA  . LEU B 2 57  ? 27.27131 24.29941  25.67293  1.000 124.32516 ? 57  LEU W CA  1 
ATOM   1764 C  C   . LEU B 2 57  ? 27.17989 22.82191  25.31455  1.000 121.92808 ? 57  LEU W C   1 
ATOM   1765 O  O   . LEU B 2 57  ? 26.54273 22.45273  24.32024  1.000 124.11846 ? 57  LEU W O   1 
ATOM   1766 C  CB  . LEU B 2 57  ? 28.57329 24.91558  25.14444  1.000 115.08325 ? 57  LEU W CB  1 
ATOM   1767 C  CG  . LEU B 2 57  ? 28.79244 26.43129  25.33192  1.000 107.00742 ? 57  LEU W CG  1 
ATOM   1768 C  CD1 . LEU B 2 57  ? 30.09381 26.90562  24.69814  1.000 85.62182  ? 57  LEU W CD1 1 
ATOM   1769 C  CD2 . LEU B 2 57  ? 27.62218 27.26619  24.81549  1.000 102.67414 ? 57  LEU W CD2 1 
ATOM   1770 N  N   . GLY B 2 58  ? 27.79754 21.95936  26.12630  1.000 121.62874 ? 58  GLY W N   1 
ATOM   1771 C  CA  . GLY B 2 58  ? 27.71083 20.52925  25.87556  1.000 120.65252 ? 58  GLY W CA  1 
ATOM   1772 C  C   . GLY B 2 58  ? 26.29616 19.98975  25.97734  1.000 125.54811 ? 58  GLY W C   1 
ATOM   1773 O  O   . GLY B 2 58  ? 25.88705 19.14787  25.17412  1.000 129.30079 ? 58  GLY W O   1 
ATOM   1774 N  N   . GLU B 2 59  ? 25.53212 20.45413  26.97393  1.000 129.65253 ? 59  GLU W N   1 
ATOM   1775 C  CA  . GLU B 2 59  ? 24.15559 19.98319  27.11547  1.000 133.45318 ? 59  GLU W CA  1 
ATOM   1776 C  C   . GLU B 2 59  ? 23.28069 20.41788  25.94553  1.000 134.51977 ? 59  GLU W C   1 
ATOM   1777 O  O   . GLU B 2 59  ? 22.37487 19.67706  25.54261  1.000 135.67140 ? 59  GLU W O   1 
ATOM   1778 C  CB  . GLU B 2 59  ? 23.54713 20.44790  28.44287  1.000 137.13800 ? 59  GLU W CB  1 
ATOM   1779 C  CG  . GLU B 2 59  ? 22.06486 20.07139  28.57315  1.000 142.73574 ? 59  GLU W CG  1 
ATOM   1780 C  CD  . GLU B 2 59  ? 21.67989 19.53530  29.94518  1.000 147.70509 ? 59  GLU W CD  1 
ATOM   1781 O  OE1 . GLU B 2 59  ? 22.45741 19.71133  30.90703  1.000 148.65211 ? 59  GLU W OE1 1 
ATOM   1782 O  OE2 . GLU B 2 59  ? 20.59751 18.91791  30.05385  1.000 149.28558 ? 59  GLU W OE2 1 
ATOM   1783 N  N   . CYS B 2 60  ? 23.55183 21.59202  25.36467  1.000 133.90779 ? 60  CYS W N   1 
ATOM   1784 C  CA  . CYS B 2 60  ? 22.71788 22.07753  24.27077  1.000 134.90907 ? 60  CYS W CA  1 
ATOM   1785 C  C   . CYS B 2 60  ? 22.96469 21.30275  22.97935  1.000 135.16297 ? 60  CYS W C   1 
ATOM   1786 O  O   . CYS B 2 60  ? 22.09508 21.29891  22.10147  1.000 135.86863 ? 60  CYS W O   1 
ATOM   1787 C  CB  . CYS B 2 60  ? 22.96912 23.57437  24.02822  1.000 134.74725 ? 60  CYS W CB  1 
ATOM   1788 S  SG  . CYS B 2 60  ? 22.75094 24.70410  25.44563  1.000 134.64968 ? 60  CYS W SG  1 
ATOM   1789 N  N   . GLY B 2 61  ? 24.07705 20.57661  22.88087  1.000 117.57497 ? 61  GLY W N   1 
ATOM   1790 C  CA  . GLY B 2 61  ? 24.38081 19.80781  21.68836  1.000 117.43414 ? 61  GLY W CA  1 
ATOM   1791 C  C   . GLY B 2 61  ? 25.68203 20.14932  20.98918  1.000 115.97220 ? 61  GLY W C   1 
ATOM   1792 O  O   . GLY B 2 61  ? 25.94318 19.65657  19.88498  1.000 114.15664 ? 61  GLY W O   1 
ATOM   1793 N  N   . PHE B 2 62  ? 26.52679 20.95727  21.62908  1.000 118.40621 ? 62  PHE W N   1 
ATOM   1794 C  CA  . PHE B 2 62  ? 27.82489 21.33608  21.06708  1.000 123.33121 ? 62  PHE W CA  1 
ATOM   1795 C  C   . PHE B 2 62  ? 28.87819 20.41858  21.68043  1.000 129.04594 ? 62  PHE W C   1 
ATOM   1796 O  O   . PHE B 2 62  ? 29.49556 20.74662  22.69356  1.000 132.68465 ? 62  PHE W O   1 
ATOM   1797 C  CB  . PHE B 2 62  ? 28.14948 22.80319  21.34968  1.000 111.62082 ? 62  PHE W CB  1 
ATOM   1798 C  CG  . PHE B 2 62  ? 27.18847 23.78425  20.72516  1.000 103.98993 ? 62  PHE W CG  1 
ATOM   1799 C  CD1 . PHE B 2 62  ? 27.26849 24.08846  19.37955  1.000 99.83712  ? 62  PHE W CD1 1 
ATOM   1800 C  CD2 . PHE B 2 62  ? 26.22989 24.42533  21.49574  1.000 97.11185  ? 62  PHE W CD2 1 
ATOM   1801 C  CE1 . PHE B 2 62  ? 26.39275 24.99260  18.80423  1.000 97.61054  ? 62  PHE W CE1 1 
ATOM   1802 C  CE2 . PHE B 2 62  ? 25.35692 25.32721  20.92841  1.000 94.80438  ? 62  PHE W CE2 1 
ATOM   1803 C  CZ  . PHE B 2 62  ? 25.43838 25.61176  19.57960  1.000 94.74317  ? 62  PHE W CZ  1 
ATOM   1804 N  N   . THR B 2 63  ? 29.09415 19.26471  21.05121  1.000 134.06181 ? 63  THR W N   1 
ATOM   1805 C  CA  . THR B 2 63  ? 30.17871 18.37402  21.44200  1.000 137.91860 ? 63  THR W CA  1 
ATOM   1806 C  C   . THR B 2 63  ? 31.43809 18.70699  20.64679  1.000 137.40190 ? 63  THR W C   1 
ATOM   1807 O  O   . THR B 2 63  ? 31.38719 19.33396  19.58523  1.000 138.49920 ? 63  THR W O   1 
ATOM   1808 C  CB  . THR B 2 63  ? 29.79653 16.90136  21.23482  1.000 145.04112 ? 63  THR W CB  1 
ATOM   1809 O  OG1 . THR B 2 63  ? 30.77522 16.05130  21.84915  1.000 147.32257 ? 63  THR W OG1 1 
ATOM   1810 C  CG2 . THR B 2 63  ? 29.71354 16.55817  19.75401  1.000 147.23318 ? 63  THR W CG2 1 
ATOM   1811 N  N   . SER B 2 64  ? 32.58213 18.28525  21.18487  1.000 134.18256 ? 64  SER W N   1 
ATOM   1812 C  CA  . SER B 2 64  ? 33.85054 18.53058  20.51254  1.000 130.64715 ? 64  SER W CA  1 
ATOM   1813 C  C   . SER B 2 64  ? 33.90749 17.90080  19.12535  1.000 129.72003 ? 64  SER W C   1 
ATOM   1814 O  O   . SER B 2 64  ? 34.70897 18.33599  18.29005  1.000 130.17533 ? 64  SER W O   1 
ATOM   1815 C  CB  . SER B 2 64  ? 35.00073 18.01210  21.37713  1.000 129.65777 ? 64  SER W CB  1 
ATOM   1816 O  OG  . SER B 2 64  ? 36.25533 18.41255  20.85829  1.000 129.19025 ? 64  SER W OG  1 
ATOM   1817 N  N   . GLN B 2 65  ? 33.06489 16.90248  18.85381  1.000 128.88501 ? 65  GLN W N   1 
ATOM   1818 C  CA  . GLN B 2 65  ? 33.07439 16.24620  17.55172  1.000 131.15365 ? 65  GLN W CA  1 
ATOM   1819 C  C   . GLN B 2 65  ? 32.23601 16.98390  16.51073  1.000 129.11206 ? 65  GLN W C   1 
ATOM   1820 O  O   . GLN B 2 65  ? 32.56388 16.93922  15.31962  1.000 130.48963 ? 65  GLN W O   1 
ATOM   1821 C  CB  . GLN B 2 65  ? 32.56460 14.80608  17.69089  1.000 137.43975 ? 65  GLN W CB  1 
ATOM   1822 C  CG  . GLN B 2 65  ? 33.48317 13.84146  18.46024  1.000 139.73356 ? 65  GLN W CG  1 
ATOM   1823 C  CD  . GLN B 2 65  ? 33.44415 14.05869  19.96709  1.000 140.25249 ? 65  GLN W CD  1 
ATOM   1824 O  OE1 . GLN B 2 65  ? 33.87236 15.10050  20.46363  1.000 139.48010 ? 65  GLN W OE1 1 
ATOM   1825 N  NE2 . GLN B 2 65  ? 32.92686 13.07488  20.69908  1.000 141.77212 ? 65  GLN W NE2 1 
ATOM   1826 N  N   . THR B 2 66  ? 31.15208 17.64811  16.92583  1.000 126.58073 ? 66  THR W N   1 
ATOM   1827 C  CA  . THR B 2 66  ? 30.31095 18.37356  15.97490  1.000 126.48814 ? 66  THR W CA  1 
ATOM   1828 C  C   . THR B 2 66  ? 30.90326 19.73666  15.62721  1.000 120.67120 ? 66  THR W C   1 
ATOM   1829 O  O   . THR B 2 66  ? 31.02795 20.08940  14.44764  1.000 119.74606 ? 66  THR W O   1 
ATOM   1830 C  CB  . THR B 2 66  ? 28.88990 18.52224  16.52929  1.000 129.70630 ? 66  THR W CB  1 
ATOM   1831 O  OG1 . THR B 2 66  ? 28.94068 18.98346  17.88511  1.000 130.56172 ? 66  THR W OG1 1 
ATOM   1832 C  CG2 . THR B 2 66  ? 28.15661 17.18865  16.47839  1.000 131.87561 ? 66  THR W CG2 1 
ATOM   1833 N  N   . ALA B 2 67  ? 31.31111 20.49757  16.63688  1.000 117.99890 ? 67  ALA W N   1 
ATOM   1834 C  CA  . ALA B 2 67  ? 31.90452 21.81203  16.42602  1.000 113.40831 ? 67  ALA W CA  1 
ATOM   1835 C  C   . ALA B 2 67  ? 33.41953 21.65732  16.34612  1.000 111.42428 ? 67  ALA W C   1 
ATOM   1836 O  O   . ALA B 2 67  ? 34.08133 21.45812  17.36908  1.000 111.41408 ? 67  ALA W O   1 
ATOM   1837 C  CB  . ALA B 2 67  ? 31.50838 22.75335  17.56004  1.000 112.27201 ? 67  ALA W CB  1 
ATOM   1838 N  N   . ARG B 2 68  ? 33.96704 21.75582  15.14106  1.000 108.54582 ? 68  ARG W N   1 
ATOM   1839 C  CA  . ARG B 2 68  ? 35.38564 21.57708  14.87457  1.000 106.27905 ? 68  ARG W CA  1 
ATOM   1840 C  C   . ARG B 2 68  ? 35.91113 22.74908  14.05288  1.000 105.04967 ? 68  ARG W C   1 
ATOM   1841 O  O   . ARG B 2 68  ? 35.13561 23.45026  13.38778  1.000 106.11042 ? 68  ARG W O   1 
ATOM   1842 C  CB  . ARG B 2 68  ? 35.64263 20.25465  14.13389  1.000 109.59419 ? 68  ARG W CB  1 
ATOM   1843 C  CG  . ARG B 2 68  ? 35.40300 19.00255  14.97737  1.000 111.82499 ? 68  ARG W CG  1 
ATOM   1844 C  CD  . ARG B 2 68  ? 35.60987 17.73519  14.15686  1.000 115.39615 ? 68  ARG W CD  1 
ATOM   1845 N  NE  . ARG B 2 68  ? 34.66273 17.64342  13.04764  1.000 118.47409 ? 68  ARG W NE  1 
ATOM   1846 C  CZ  . ARG B 2 68  ? 34.77173 16.77967  12.04580  1.000 121.35200 ? 68  ARG W CZ  1 
ATOM   1847 N  NH1 . ARG B 2 68  ? 35.78915 15.93144  12.01491  1.000 122.57417 ? 68  ARG W NH1 1 
ATOM   1848 N  NH2 . ARG B 2 68  ? 33.87072 16.76846  11.07315  1.000 123.08816 ? 68  ARG W NH2 1 
ATOM   1849 N  N   . PRO B 2 69  ? 37.23236 23.00264  14.08621  1.000 99.97988  ? 69  PRO W N   1 
ATOM   1850 C  CA  . PRO B 2 69  ? 37.77405 24.13848  13.30754  1.000 95.24402  ? 69  PRO W CA  1 
ATOM   1851 C  C   . PRO B 2 69  ? 37.51023 24.05160  11.81117  1.000 96.61710  ? 69  PRO W C   1 
ATOM   1852 O  O   . PRO B 2 69  ? 37.28745 25.08762  11.17450  1.000 98.55884  ? 69  PRO W O   1 
ATOM   1853 C  CB  . PRO B 2 69  ? 39.27612 24.09647  13.61849  1.000 91.80985  ? 69  PRO W CB  1 
ATOM   1854 C  CG  . PRO B 2 69  ? 39.38313 23.35362  14.89505  1.000 91.66312  ? 69  PRO W CG  1 
ATOM   1855 C  CD  . PRO B 2 69  ? 38.27618 22.34589  14.89140  1.000 95.21918  ? 69  PRO W CD  1 
ATOM   1856 N  N   . GLN B 2 70  ? 37.53651 22.85444  11.22330  1.000 95.58181  ? 70  GLN W N   1 
ATOM   1857 C  CA  . GLN B 2 70  ? 37.26251 22.71705  9.79754   1.000 97.35729  ? 70  GLN W CA  1 
ATOM   1858 C  C   . GLN B 2 70  ? 35.77811 22.80119  9.46419   1.000 96.61322  ? 70  GLN W C   1 
ATOM   1859 O  O   . GLN B 2 70  ? 35.43563 23.10631  8.31461   1.000 97.95771  ? 70  GLN W O   1 
ATOM   1860 C  CB  . GLN B 2 70  ? 37.82625 21.39298  9.26304   1.000 101.69861 ? 70  GLN W CB  1 
ATOM   1861 C  CG  . GLN B 2 70  ? 37.33450 20.11239  9.96266   1.000 104.39175 ? 70  GLN W CG  1 
ATOM   1862 C  CD  . GLN B 2 70  ? 38.19882 19.72842  11.15429  1.000 105.83239 ? 70  GLN W CD  1 
ATOM   1863 O  OE1 . GLN B 2 70  ? 38.92651 20.55918  11.69908  1.000 101.75526 ? 70  GLN W OE1 1 
ATOM   1864 N  NE2 . GLN B 2 70  ? 38.12405 18.46356  11.56368  1.000 111.36271 ? 70  GLN W NE2 1 
ATOM   1865 N  N   . ALA B 2 71  ? 34.89595 22.53353  10.42703  1.000 96.00494  ? 71  ALA W N   1 
ATOM   1866 C  CA  . ALA B 2 71  ? 33.44995 22.61044  10.20879  1.000 97.07356  ? 71  ALA W CA  1 
ATOM   1867 C  C   . ALA B 2 71  ? 32.78097 23.04594  11.50232  1.000 97.77135  ? 71  ALA W C   1 
ATOM   1868 O  O   . ALA B 2 71  ? 32.24555 22.22530  12.25803  1.000 101.05494 ? 71  ALA W O   1 
ATOM   1869 C  CB  . ALA B 2 71  ? 32.88899 21.27323  9.72608   1.000 99.75125  ? 71  ALA W CB  1 
ATOM   1870 N  N   . PRO B 2 72  ? 32.79888 24.34292  11.79612  1.000 94.46138  ? 72  PRO W N   1 
ATOM   1871 C  CA  . PRO B 2 72  ? 32.22362 24.83199  13.05544  1.000 92.40578  ? 72  PRO W CA  1 
ATOM   1872 C  C   . PRO B 2 72  ? 30.70927 24.68287  13.08926  1.000 92.48611  ? 72  PRO W C   1 
ATOM   1873 O  O   . PRO B 2 72  ? 30.04684 24.52502  12.06207  1.000 95.90750  ? 72  PRO W O   1 
ATOM   1874 C  CB  . PRO B 2 72  ? 32.62851 26.31194  13.08334  1.000 91.37327  ? 72  PRO W CB  1 
ATOM   1875 C  CG  . PRO B 2 72  ? 33.73130 26.44174  12.07046  1.000 92.73867  ? 72  PRO W CG  1 
ATOM   1876 C  CD  . PRO B 2 72  ? 33.43010 25.42289  11.02025  1.000 94.12706  ? 72  PRO W CD  1 
ATOM   1877 N  N   . ALA B 2 73  ? 30.16398 24.73885  14.30390  1.000 91.57575  ? 73  ALA W N   1 
ATOM   1878 C  CA  . ALA B 2 73  ? 28.72194 24.71191  14.51188  1.000 94.67741  ? 73  ALA W CA  1 
ATOM   1879 C  C   . ALA B 2 73  ? 28.15745 26.12825  14.49925  1.000 95.74676  ? 73  ALA W C   1 
ATOM   1880 O  O   . ALA B 2 73  ? 28.78995 27.06458  14.99416  1.000 94.75884  ? 73  ALA W O   1 
ATOM   1881 C  CB  . ALA B 2 73  ? 28.38245 24.02667  15.83518  1.000 94.67623  ? 73  ALA W CB  1 
ATOM   1882 N  N   . THR B 2 74  ? 26.95496 26.27745  13.94511  1.000 97.08451  ? 74  THR W N   1 
ATOM   1883 C  CA  . THR B 2 74  ? 26.34127 27.58915  13.76219  1.000 95.74509  ? 74  THR W CA  1 
ATOM   1884 C  C   . THR B 2 74  ? 25.47170 27.93875  14.96910  1.000 96.75257  ? 74  THR W C   1 
ATOM   1885 O  O   . THR B 2 74  ? 24.66682 27.11676  15.42368  1.000 101.80016 ? 74  THR W O   1 
ATOM   1886 C  CB  . THR B 2 74  ? 25.52050 27.61168  12.46877  1.000 97.33199  ? 74  THR W CB  1 
ATOM   1887 O  OG1 . THR B 2 74  ? 26.33358 27.14906  11.38047  1.000 98.93172  ? 74  THR W OG1 1 
ATOM   1888 C  CG2 . THR B 2 74  ? 25.01641 29.00908  12.16092  1.000 95.09351  ? 74  THR W CG2 1 
ATOM   1889 N  N   . VAL B 2 75  ? 25.65499 29.14800  15.50168  1.000 90.45662  ? 75  VAL W N   1 
ATOM   1890 C  CA  . VAL B 2 75  ? 24.88365 29.64455  16.64153  1.000 87.27027  ? 75  VAL W CA  1 
ATOM   1891 C  C   . VAL B 2 75  ? 24.12688 30.89067  16.20455  1.000 86.60720  ? 75  VAL W C   1 
ATOM   1892 O  O   . VAL B 2 75  ? 24.73444 31.84820  15.71463  1.000 87.53003  ? 75  VAL W O   1 
ATOM   1893 C  CB  . VAL B 2 75  ? 25.77179 29.95598  17.85812  1.000 82.80711  ? 75  VAL W CB  1 
ATOM   1894 C  CG1 . VAL B 2 75  ? 24.92277 30.45428  19.01734  1.000 80.19722  ? 75  VAL W CG1 1 
ATOM   1895 C  CG2 . VAL B 2 75  ? 26.55713 28.72493  18.27340  1.000 83.91799  ? 75  VAL W CG2 1 
ATOM   1896 N  N   . GLY B 2 76  ? 22.80657 30.87760  16.37474  1.000 87.30779  ? 76  GLY W N   1 
ATOM   1897 C  CA  . GLY B 2 76  ? 22.00403 32.03467  16.03014  1.000 86.62601  ? 76  GLY W CA  1 
ATOM   1898 C  C   . GLY B 2 76  ? 22.06957 33.11935  17.09073  1.000 85.36056  ? 76  GLY W C   1 
ATOM   1899 O  O   . GLY B 2 76  ? 22.32261 32.85810  18.26738  1.000 84.83381  ? 76  GLY W O   1 
ATOM   1900 N  N   . LEU B 2 77  ? 21.85281 34.36112  16.64413  1.000 85.45087  ? 77  LEU W N   1 
ATOM   1901 C  CA  . LEU B 2 77  ? 21.87872 35.55493  17.48273  1.000 86.99288  ? 77  LEU W CA  1 
ATOM   1902 C  C   . LEU B 2 77  ? 20.74813 36.47450  17.04057  1.000 93.26561  ? 77  LEU W C   1 
ATOM   1903 O  O   . LEU B 2 77  ? 20.48288 36.59067  15.84237  1.000 94.97734  ? 77  LEU W O   1 
ATOM   1904 C  CB  . LEU B 2 77  ? 23.23444 36.26898  17.40251  1.000 85.64807  ? 77  LEU W CB  1 
ATOM   1905 C  CG  . LEU B 2 77  ? 23.40360 37.57726  18.17862  1.000 84.36618  ? 77  LEU W CG  1 
ATOM   1906 C  CD1 . LEU B 2 77  ? 22.94355 37.42446  19.62068  1.000 84.80377  ? 77  LEU W CD1 1 
ATOM   1907 C  CD2 . LEU B 2 77  ? 24.85802 38.01389  18.12042  1.000 81.66080  ? 77  LEU W CD2 1 
ATOM   1908 N  N   . ALA B 2 78  ? 20.09494 37.15104  17.98800  1.000 98.46902  ? 78  ALA W N   1 
ATOM   1909 C  CA  . ALA B 2 78  ? 18.89428 37.90403  17.64264  1.000 105.95619 ? 78  ALA W CA  1 
ATOM   1910 C  C   . ALA B 2 78  ? 18.96570 39.41051  17.87603  1.000 113.13331 ? 78  ALA W C   1 
ATOM   1911 O  O   . ALA B 2 78  ? 18.30544 40.13729  17.13712  1.000 117.16641 ? 78  ALA W O   1 
ATOM   1912 C  CB  . ALA B 2 78  ? 17.69071 37.36663  18.42769  1.000 106.09372 ? 78  ALA W CB  1 
ATOM   1913 N  N   . PHE B 2 79  ? 19.73030 39.89349  18.85736  1.000 117.49623 ? 79  PHE W N   1 
ATOM   1914 C  CA  . PHE B 2 79  ? 19.84716 41.32417  19.13548  1.000 121.48263 ? 79  PHE W CA  1 
ATOM   1915 C  C   . PHE B 2 79  ? 18.48136 42.00276  19.23546  1.000 133.04054 ? 79  PHE W C   1 
ATOM   1916 O  O   . PHE B 2 79  ? 18.04919 42.66742  18.29672  1.000 132.96552 ? 79  PHE W O   1 
ATOM   1917 C  CB  . PHE B 2 79  ? 20.66071 42.04647  18.05552  1.000 119.18019 ? 79  PHE W CB  1 
ATOM   1918 C  CG  . PHE B 2 79  ? 22.13260 42.00044  18.28305  1.000 115.23141 ? 79  PHE W CG  1 
ATOM   1919 C  CD1 . PHE B 2 79  ? 22.68222 42.53804  19.41607  1.000 114.14684 ? 79  PHE W CD1 1 
ATOM   1920 C  CD2 . PHE B 2 79  ? 22.96468 41.43851  17.34813  1.000 112.57456 ? 79  PHE W CD2 1 
ATOM   1921 C  CE1 . PHE B 2 79  ? 24.02598 42.48718  19.61761  1.000 112.34765 ? 79  PHE W CE1 1 
ATOM   1922 C  CE2 . PHE B 2 79  ? 24.31180 41.39233  17.53854  1.000 110.88535 ? 79  PHE W CE2 1 
ATOM   1923 C  CZ  . PHE B 2 79  ? 24.84752 41.92149  18.68066  1.000 110.91791 ? 79  PHE W CZ  1 
ATOM   1924 N  N   . ARG B 2 80  ? 17.81100 41.84101  20.37767  1.000 142.19927 ? 80  ARG W N   1 
ATOM   1925 C  CA  . ARG B 2 80  ? 16.48902 42.43283  20.55843  1.000 156.88660 ? 80  ARG W CA  1 
ATOM   1926 C  C   . ARG B 2 80  ? 16.49758 43.93381  20.28243  1.000 169.98612 ? 80  ARG W C   1 
ATOM   1927 O  O   . ARG B 2 80  ? 17.27741 44.68359  20.87950  1.000 177.30945 ? 80  ARG W O   1 
ATOM   1928 C  CB  . ARG B 2 80  ? 15.99848 42.18575  21.98985  1.000 150.87043 ? 80  ARG W CB  1 
ATOM   1929 C  CG  . ARG B 2 80  ? 16.13234 40.75719  22.47149  1.000 146.18958 ? 80  ARG W CG  1 
ATOM   1930 C  CD  . ARG B 2 80  ? 15.29196 39.81384  21.63827  1.000 141.54307 ? 80  ARG W CD  1 
ATOM   1931 N  NE  . ARG B 2 80  ? 14.91006 38.63505  22.40430  1.000 138.15059 ? 80  ARG W NE  1 
ATOM   1932 C  CZ  . ARG B 2 80  ? 13.96694 38.63323  23.33791  1.000 137.22863 ? 80  ARG W CZ  1 
ATOM   1933 N  NH1 . ARG B 2 80  ? 13.31520 39.75231  23.62315  1.000 138.65921 ? 80  ARG W NH1 1 
ATOM   1934 N  NH2 . ARG B 2 80  ? 13.67947 37.51827  23.99491  1.000 135.69927 ? 80  ARG W NH2 1 
ATOM   1935 N  N   . ALA B 2 81  ? 15.62131 44.36648  19.37643  1.000 178.10486 ? 81  ALA W N   1 
ATOM   1936 C  CA  . ALA B 2 81  ? 15.36289 45.79293  19.21284  1.000 188.39998 ? 81  ALA W CA  1 
ATOM   1937 C  C   . ALA B 2 81  ? 14.87016 46.37530  20.53179  1.000 197.18954 ? 81  ALA W C   1 
ATOM   1938 O  O   . ALA B 2 81  ? 14.32575 45.66977  21.38431  1.000 201.04141 ? 81  ALA W O   1 
ATOM   1939 C  CB  . ALA B 2 81  ? 14.33507 46.04879  18.10976  1.000 188.37457 ? 81  ALA W CB  1 
ATOM   1940 N  N   . ASP B 2 82  ? 15.07980 47.67355  20.71782  1.000 192.09900 ? 82  ASP W N   1 
ATOM   1941 C  CA  . ASP B 2 82  ? 14.75354 48.24147  22.01784  1.000 181.98275 ? 82  ASP W CA  1 
ATOM   1942 C  C   . ASP B 2 82  ? 13.24793 48.27690  22.21522  1.000 174.05009 ? 82  ASP W C   1 
ATOM   1943 O  O   . ASP B 2 82  ? 12.50453 48.78451  21.36818  1.000 176.13266 ? 82  ASP W O   1 
ATOM   1944 C  CB  . ASP B 2 82  ? 15.37130 49.62648  22.19553  1.000 176.28230 ? 82  ASP W CB  1 
ATOM   1945 C  CG  . ASP B 2 82  ? 16.54745 49.59936  23.16001  1.000 169.34413 ? 82  ASP W CG  1 
ATOM   1946 O  OD1 . ASP B 2 82  ? 16.65482 48.61403  23.92154  1.000 164.53986 ? 82  ASP W OD1 1 
ATOM   1947 O  OD2 . ASP B 2 82  ? 17.36132 50.54969  23.15837  1.000 167.88504 ? 82  ASP W OD2 1 
ATOM   1948 N  N   . ASP B 2 83  ? 12.81379 47.69096  23.33114  1.000 165.88587 ? 83  ASP W N   1 
ATOM   1949 C  CA  . ASP B 2 83  ? 11.43809 47.53660  23.78716  1.000 163.29381 ? 83  ASP W CA  1 
ATOM   1950 C  C   . ASP B 2 83  ? 10.73187 46.35809  23.12188  1.000 157.34913 ? 83  ASP W C   1 
ATOM   1951 O  O   . ASP B 2 83  ? 9.55864  46.11400  23.43635  1.000 154.31732 ? 83  ASP W O   1 
ATOM   1952 C  CB  . ASP B 2 83  ? 10.59471 48.80794  23.59035  1.000 166.95178 ? 83  ASP W CB  1 
ATOM   1953 C  CG  . ASP B 2 83  ? 11.22963 50.06103  24.20976  1.000 172.08286 ? 83  ASP W CG  1 
ATOM   1954 O  OD1 . ASP B 2 83  ? 12.03845 49.94868  25.16096  1.000 173.56892 ? 83  ASP W OD1 1 
ATOM   1955 O  OD2 . ASP B 2 83  ? 10.90667 51.17356  23.74161  1.000 173.89188 ? 83  ASP W OD2 1 
ATOM   1956 N  N   . THR B 2 84  ? 11.38661 45.61440  22.22817  1.000 157.20508 ? 84  THR W N   1 
ATOM   1957 C  CA  . THR B 2 84  ? 10.72934 44.50848  21.53797  1.000 156.37422 ? 84  THR W CA  1 
ATOM   1958 C  C   . THR B 2 84  ? 11.74617 43.62960  20.82094  1.000 158.60021 ? 84  THR W C   1 
ATOM   1959 O  O   . THR B 2 84  ? 12.66190 44.13647  20.17443  1.000 164.22227 ? 84  THR W O   1 
ATOM   1960 C  CB  . THR B 2 84  ? 9.69693  45.01356  20.51718  1.000 146.49703 ? 84  THR W CB  1 
ATOM   1961 O  OG1 . THR B 2 84  ? 8.69212  45.79118  21.17762  1.000 145.43424 ? 84  THR W OG1 1 
ATOM   1962 C  CG2 . THR B 2 84  ? 9.04588  43.84392  19.79931  1.000 142.36747 ? 84  THR W CG2 1 
ATOM   1963 N  N   . PHE B 2 85  ? 11.53417 42.31220  20.89781  1.000 155.42265 ? 85  PHE W N   1 
ATOM   1964 C  CA  . PHE B 2 85  ? 12.36941 41.33220  20.21396  1.000 155.79716 ? 85  PHE W CA  1 
ATOM   1965 C  C   . PHE B 2 85  ? 12.23283 41.42938  18.69639  1.000 152.35016 ? 85  PHE W C   1 
ATOM   1966 O  O   . PHE B 2 85  ? 11.31767 42.06344  18.16412  1.000 157.03838 ? 85  PHE W O   1 
ATOM   1967 C  CB  . PHE B 2 85  ? 11.98911 39.90714  20.64690  1.000 161.38051 ? 85  PHE W CB  1 
ATOM   1968 C  CG  . PHE B 2 85  ? 10.53939 39.55148  20.40423  1.000 168.71852 ? 85  PHE W CG  1 
ATOM   1969 C  CD1 . PHE B 2 85  ? 10.13532 38.94840  19.21798  1.000 169.82139 ? 85  PHE W CD1 1 
ATOM   1970 C  CD2 . PHE B 2 85  ? 9.58201  39.79769  21.37701  1.000 171.76438 ? 85  PHE W CD2 1 
ATOM   1971 C  CE1 . PHE B 2 85  ? 8.79937  38.61300  19.00488  1.000 169.87310 ? 85  PHE W CE1 1 
ATOM   1972 C  CE2 . PHE B 2 85  ? 8.24940  39.46490  21.17066  1.000 172.04252 ? 85  PHE W CE2 1 
ATOM   1973 C  CZ  . PHE B 2 85  ? 7.85773  38.87226  19.98449  1.000 170.57044 ? 85  PHE W CZ  1 
ATOM   1974 N  N   . GLU B 2 86  ? 13.15203 40.75732  17.99576  1.000 146.77259 ? 86  GLU W N   1 
ATOM   1975 C  CA  . GLU B 2 86  ? 13.07209 40.61446  16.54849  1.000 140.44059 ? 86  GLU W CA  1 
ATOM   1976 C  C   . GLU B 2 86  ? 13.29430 39.15600  16.16457  1.000 132.76175 ? 86  GLU W C   1 
ATOM   1977 O  O   . GLU B 2 86  ? 13.97413 38.40696  16.87148  1.000 130.97791 ? 86  GLU W O   1 
ATOM   1978 C  CB  . GLU B 2 86  ? 14.09325 41.50538  15.81511  1.000 140.24865 ? 86  GLU W CB  1 
ATOM   1979 C  CG  . GLU B 2 86  ? 15.51512 40.97322  15.80057  1.000 136.46949 ? 86  GLU W CG  1 
ATOM   1980 C  CD  . GLU B 2 86  ? 16.52580 42.01316  15.34780  1.000 134.74862 ? 86  GLU W CD  1 
ATOM   1981 O  OE1 . GLU B 2 86  ? 16.19638 43.21891  15.37792  1.000 135.63895 ? 86  GLU W OE1 1 
ATOM   1982 O  OE2 . GLU B 2 86  ? 17.64335 41.62551  14.94276  1.000 132.19844 ? 86  GLU W OE2 1 
ATOM   1983 N  N   . ALA B 2 87  ? 12.71244 38.76294  15.03318  1.000 127.05288 ? 87  ALA W N   1 
ATOM   1984 C  CA  . ALA B 2 87  ? 12.84918 37.40012  14.53807  1.000 120.50903 ? 87  ALA W CA  1 
ATOM   1985 C  C   . ALA B 2 87  ? 14.29856 37.08705  14.18730  1.000 117.91813 ? 87  ALA W C   1 
ATOM   1986 O  O   . ALA B 2 87  ? 15.07631 37.96929  13.81188  1.000 118.59934 ? 87  ALA W O   1 
ATOM   1987 C  CB  . ALA B 2 87  ? 11.96136 37.19121  13.30723  1.000 119.35613 ? 87  ALA W CB  1 
ATOM   1988 N  N   . LEU B 2 88  ? 14.66998 35.81919  14.36097  1.000 113.64763 ? 88  LEU W N   1 
ATOM   1989 C  CA  . LEU B 2 88  ? 16.00179 35.36357  13.97978  1.000 110.83833 ? 88  LEU W CA  1 
ATOM   1990 C  C   . LEU B 2 88  ? 16.12543 35.36340  12.45821  1.000 108.15883 ? 88  LEU W C   1 
ATOM   1991 O  O   . LEU B 2 88  ? 15.21276 34.91936  11.75105  1.000 106.61016 ? 88  LEU W O   1 
ATOM   1992 C  CB  . LEU B 2 88  ? 16.27666 33.96982  14.55422  1.000 107.10304 ? 88  LEU W CB  1 
ATOM   1993 C  CG  . LEU B 2 88  ? 17.61324 33.29505  14.22270  1.000 105.32957 ? 88  LEU W CG  1 
ATOM   1994 C  CD1 . LEU B 2 88  ? 18.75925 34.17465  14.65805  1.000 107.25756 ? 88  LEU W CD1 1 
ATOM   1995 C  CD2 . LEU B 2 88  ? 17.73289 31.92754  14.88874  1.000 102.28153 ? 88  LEU W CD2 1 
ATOM   1996 N  N   . CYS B 2 89  ? 17.24892 35.87898  11.95734  1.000 108.83066 ? 89  CYS W N   1 
ATOM   1997 C  CA  . CYS B 2 89  ? 17.47946 36.01072  10.52049  1.000 108.70190 ? 89  CYS W CA  1 
ATOM   1998 C  C   . CYS B 2 89  ? 18.97347 35.86747  10.26512  1.000 108.42582 ? 89  CYS W C   1 
ATOM   1999 O  O   . CYS B 2 89  ? 19.77742 36.58887  10.86828  1.000 109.28940 ? 89  CYS W O   1 
ATOM   2000 C  CB  . CYS B 2 89  ? 16.95016 37.35977  10.00922  1.000 110.32257 ? 89  CYS W CB  1 
ATOM   2001 S  SG  . CYS B 2 89  ? 17.33006 37.82500  8.29430   1.000 112.04698 ? 89  CYS W SG  1 
ATOM   2002 N  N   . ILE B 2 90  ? 19.34201 34.91206  9.40799   1.000 105.84452 ? 90  ILE W N   1 
ATOM   2003 C  CA  . ILE B 2 90  ? 20.73433 34.64565  9.03905   1.000 101.85641 ? 90  ILE W CA  1 
ATOM   2004 C  C   . ILE B 2 90  ? 20.80117 34.61466  7.51668   1.000 106.01661 ? 90  ILE W C   1 
ATOM   2005 O  O   . ILE B 2 90  ? 20.39257 33.62853  6.89324   1.000 105.18782 ? 90  ILE W O   1 
ATOM   2006 C  CB  . ILE B 2 90  ? 21.25195 33.33235  9.63603   1.000 94.07283  ? 90  ILE W CB  1 
ATOM   2007 C  CG1 . ILE B 2 90  ? 21.26725 33.40906  11.15735  1.000 87.59949  ? 90  ILE W CG1 1 
ATOM   2008 C  CG2 . ILE B 2 90  ? 22.63329 32.97813  9.08645   1.000 92.74520  ? 90  ILE W CG2 1 
ATOM   2009 C  CD1 . ILE B 2 90  ? 21.96691 32.24814  11.78096  1.000 84.74270  ? 90  ILE W CD1 1 
ATOM   2010 N  N   . GLU B 2 91  ? 21.32496 35.67879  6.91454   1.000 110.76906 ? 91  GLU W N   1 
ATOM   2011 C  CA  . GLU B 2 91  ? 21.38959 35.74212  5.46129   1.000 116.00958 ? 91  GLU W CA  1 
ATOM   2012 C  C   . GLU B 2 91  ? 22.43559 34.75588  4.94105   1.000 109.10318 ? 91  GLU W C   1 
ATOM   2013 O  O   . GLU B 2 91  ? 23.53580 34.66995  5.49134   1.000 108.39623 ? 91  GLU W O   1 
ATOM   2014 C  CB  . GLU B 2 91  ? 21.70442 37.16630  4.99329   1.000 129.14035 ? 91  GLU W CB  1 
ATOM   2015 C  CG  . GLU B 2 91  ? 20.75801 38.23488  5.56679   1.000 139.56579 ? 91  GLU W CG  1 
ATOM   2016 C  CD  . GLU B 2 91  ? 20.69296 39.50278  4.71928   1.000 144.93560 ? 91  GLU W CD  1 
ATOM   2017 O  OE1 . GLU B 2 91  ? 20.08264 39.45877  3.62930   1.000 146.67133 ? 91  GLU W OE1 1 
ATOM   2018 O  OE2 . GLU B 2 91  ? 21.24785 40.54254  5.14138   1.000 148.35505 ? 91  GLU W OE2 1 
ATOM   2019 N  N   . PRO B 2 92  ? 22.12628 34.00618  3.88639   1.000 104.63204 ? 92  PRO W N   1 
ATOM   2020 C  CA  . PRO B 2 92  ? 23.02782 32.93642  3.43743   1.000 101.69899 ? 92  PRO W CA  1 
ATOM   2021 C  C   . PRO B 2 92  ? 24.28003 33.48312  2.76365   1.000 100.04787 ? 92  PRO W C   1 
ATOM   2022 O  O   . PRO B 2 92  ? 24.43480 34.68555  2.53323   1.000 101.47319 ? 92  PRO W O   1 
ATOM   2023 C  CB  . PRO B 2 92  ? 22.16155 32.14753  2.45316   1.000 102.52642 ? 92  PRO W CB  1 
ATOM   2024 C  CG  . PRO B 2 92  ? 21.21908 33.16775  1.89882   1.000 103.29739 ? 92  PRO W CG  1 
ATOM   2025 C  CD  . PRO B 2 92  ? 20.91867 34.10357  3.04725   1.000 103.63636 ? 92  PRO W CD  1 
ATOM   2026 N  N   . PHE B 2 93  ? 25.21607 32.57033  2.49901   1.000 86.15237  ? 93  PHE W N   1 
ATOM   2027 C  CA  . PHE B 2 93  ? 26.41856 32.91480  1.75792   1.000 86.98019  ? 93  PHE W CA  1 
ATOM   2028 C  C   . PHE B 2 93  ? 26.10197 32.93613  0.26045   1.000 89.24018  ? 93  PHE W C   1 
ATOM   2029 O  O   . PHE B 2 93  ? 24.97319 32.67464  -0.17159  1.000 90.20127  ? 93  PHE W O   1 
ATOM   2030 C  CB  . PHE B 2 93  ? 27.55318 31.93696  2.07335   1.000 86.41248  ? 93  PHE W CB  1 
ATOM   2031 C  CG  . PHE B 2 93  ? 28.05916 32.00991  3.50261   1.000 87.35412  ? 93  PHE W CG  1 
ATOM   2032 C  CD1 . PHE B 2 93  ? 27.97440 33.18556  4.23565   1.000 88.47603  ? 93  PHE W CD1 1 
ATOM   2033 C  CD2 . PHE B 2 93  ? 28.60580 30.88626  4.11821   1.000 85.90365  ? 93  PHE W CD2 1 
ATOM   2034 C  CE1 . PHE B 2 93  ? 28.43404 33.24129  5.55731   1.000 87.63409  ? 93  PHE W CE1 1 
ATOM   2035 C  CE2 . PHE B 2 93  ? 29.06154 30.93888  5.43304   1.000 85.05763  ? 93  PHE W CE2 1 
ATOM   2036 C  CZ  . PHE B 2 93  ? 28.97479 32.11561  6.15052   1.000 86.17645  ? 93  PHE W CZ  1 
ATOM   2037 N  N   . SER B 2 94  ? 27.10827 33.28476  -0.54012  1.000 91.09227  ? 94  SER W N   1 
ATOM   2038 C  CA  . SER B 2 94  ? 26.97525 33.30096  -1.99020  1.000 88.90536  ? 94  SER W CA  1 
ATOM   2039 C  C   . SER B 2 94  ? 27.11511 31.89063  -2.54803  1.000 95.34131  ? 94  SER W C   1 
ATOM   2040 O  O   . SER B 2 94  ? 27.85387 31.06476  -2.00761  1.000 93.46184  ? 94  SER W O   1 
ATOM   2041 C  CB  . SER B 2 94  ? 28.02315 34.23028  -2.60945  1.000 84.72881  ? 94  SER W CB  1 
ATOM   2042 O  OG  . SER B 2 94  ? 29.34568 33.83241  -2.27811  1.000 79.78762  ? 94  SER W OG  1 
ATOM   2043 N  N   . SER B 2 95  ? 26.36829 31.60446  -3.59405  1.000 102.42641 ? 95  SER W N   1 
ATOM   2044 C  CA  . SER B 2 95  ? 26.54605 30.24701  -4.09797  1.000 112.25485 ? 95  SER W CA  1 
ATOM   2045 C  C   . SER B 2 95  ? 27.56164 30.22301  -5.23875  1.000 124.54790 ? 95  SER W C   1 
ATOM   2046 O  O   . SER B 2 95  ? 27.58007 31.13491  -6.07318  1.000 129.47159 ? 95  SER W O   1 
ATOM   2047 C  CB  . SER B 2 95  ? 25.21917 29.67387  -4.58409  1.000 108.12120 ? 95  SER W CB  1 
ATOM   2048 O  OG  . SER B 2 95  ? 24.26102 29.66581  -3.54081  1.000 106.25273 ? 95  SER W OG  1 
ATOM   2049 N  N   . PRO B 2 96  ? 28.42126 29.20882  -5.30066  1.000 132.24109 ? 96  PRO W N   1 
ATOM   2050 C  CA  . PRO B 2 96  ? 29.36780 29.11258  -6.41653  1.000 141.18675 ? 96  PRO W CA  1 
ATOM   2051 C  C   . PRO B 2 96  ? 28.77697 28.32638  -7.57333  1.000 151.82002 ? 96  PRO W C   1 
ATOM   2052 O  O   . PRO B 2 96  ? 28.40741 27.15237  -7.41333  1.000 152.48742 ? 96  PRO W O   1 
ATOM   2053 C  CB  . PRO B 2 96  ? 30.56242 28.37384  -5.79400  1.000 137.86325 ? 96  PRO W CB  1 
ATOM   2054 C  CG  . PRO B 2 96  ? 29.93989 27.50214  -4.73640  1.000 133.37918 ? 96  PRO W CG  1 
ATOM   2055 C  CD  . PRO B 2 96  ? 28.70998 28.22768  -4.23452  1.000 131.83570 ? 96  PRO W CD  1 
ATOM   2056 N  N   . PRO B 2 97  ? 28.68679 28.92736  -8.76867  1.000 154.64925 ? 97  PRO W N   1 
ATOM   2057 C  CA  . PRO B 2 97  ? 28.15756 28.18227  -9.91996  1.000 156.56544 ? 97  PRO W CA  1 
ATOM   2058 C  C   . PRO B 2 97  ? 29.14510 27.14263  -10.42926 1.000 155.93668 ? 97  PRO W C   1 
ATOM   2059 O  O   . PRO B 2 97  ? 30.11477 27.49381  -11.10929 1.000 156.86085 ? 97  PRO W O   1 
ATOM   2060 C  CB  . PRO B 2 97  ? 27.89968 29.27714  -10.96600 1.000 155.95923 ? 97  PRO W CB  1 
ATOM   2061 C  CG  . PRO B 2 97  ? 27.81989 30.55063  -10.18367 1.000 156.63292 ? 97  PRO W CG  1 
ATOM   2062 C  CD  . PRO B 2 97  ? 28.79181 30.36809  -9.05297  1.000 157.20592 ? 97  PRO W CD  1 
ATOM   2063 N  N   . GLU B 2 98  ? 28.91885 25.87055  -10.10447 1.000 157.16229 ? 98  GLU W N   1 
ATOM   2064 C  CA  . GLU B 2 98  ? 29.75537 24.78520  -10.61990 1.000 157.08395 ? 98  GLU W CA  1 
ATOM   2065 C  C   . GLU B 2 98  ? 29.11778 23.42080  -10.36059 1.000 155.64577 ? 98  GLU W C   1 
ATOM   2066 O  O   . GLU B 2 98  ? 28.58395 22.78810  -11.27343 1.000 155.59106 ? 98  GLU W O   1 
ATOM   2067 C  CB  . GLU B 2 98  ? 31.15901 24.83921  -10.00038 1.000 157.99362 ? 98  GLU W CB  1 
ATOM   2068 C  CG  . GLU B 2 98  ? 32.18696 23.93504  -10.68272 1.000 160.59754 ? 98  GLU W CG  1 
ATOM   2069 C  CD  . GLU B 2 98  ? 33.62110 24.28668  -10.31117 1.000 163.46626 ? 98  GLU W CD  1 
ATOM   2070 O  OE1 . GLU B 2 98  ? 33.82703 25.33549  -9.66701  1.000 163.96552 ? 98  GLU W OE1 1 
ATOM   2071 O  OE2 . GLU B 2 98  ? 34.54303 23.51875  -10.66483 1.000 164.94355 ? 98  GLU W OE2 1 
ATOM   2072 N  N   . MET C 3 17  ? 41.93196 40.70825  20.91586  1.000 103.84848 ? 17  MET Z N   1 
ATOM   2073 C  CA  . MET C 3 17  ? 41.44836 41.66704  19.92735  1.000 101.45257 ? 17  MET Z CA  1 
ATOM   2074 C  C   . MET C 3 17  ? 40.91539 40.89788  18.71063  1.000 94.59128  ? 17  MET Z C   1 
ATOM   2075 O  O   . MET C 3 17  ? 41.44958 39.84297  18.35896  1.000 93.24258  ? 17  MET Z O   1 
ATOM   2076 C  CB  . MET C 3 17  ? 42.56287 42.65403  19.52890  1.000 104.29575 ? 17  MET Z CB  1 
ATOM   2077 C  CG  . MET C 3 17  ? 42.05426 43.88308  18.76407  1.000 110.26226 ? 17  MET Z CG  1 
ATOM   2078 S  SD  . MET C 3 17  ? 43.26332 45.21091  18.45499  1.000 115.93708 ? 17  MET Z SD  1 
ATOM   2079 C  CE  . MET C 3 17  ? 42.32272 46.37244  17.45614  1.000 115.93602 ? 17  MET Z CE  1 
ATOM   2080 N  N   . TYR C 3 18  ? 39.85081 41.41863  18.09205  1.000 88.80993  ? 18  TYR Z N   1 
ATOM   2081 C  CA  . TYR C 3 18  ? 39.21830 40.83274  16.91389  1.000 81.42573  ? 18  TYR Z CA  1 
ATOM   2082 C  C   . TYR C 3 18  ? 39.28489 41.82090  15.75168  1.000 79.10388  ? 18  TYR Z C   1 
ATOM   2083 O  O   . TYR C 3 18  ? 39.19121 43.03275  15.96199  1.000 79.74660  ? 18  TYR Z O   1 
ATOM   2084 C  CB  . TYR C 3 18  ? 37.75778 40.47009  17.20788  1.000 78.21446  ? 18  TYR Z CB  1 
ATOM   2085 C  CG  . TYR C 3 18  ? 37.58976 39.29992  18.14937  1.000 75.97925  ? 18  TYR Z CG  1 
ATOM   2086 C  CD1 . TYR C 3 18  ? 37.61178 39.48312  19.52880  1.000 75.37910  ? 18  TYR Z CD1 1 
ATOM   2087 C  CD2 . TYR C 3 18  ? 37.41227 38.00715  17.66675  1.000 72.73840  ? 18  TYR Z CD2 1 
ATOM   2088 C  CE1 . TYR C 3 18  ? 37.46578 38.40845  20.40070  1.000 72.63987  ? 18  TYR Z CE1 1 
ATOM   2089 C  CE2 . TYR C 3 18  ? 37.26655 36.93805  18.52517  1.000 70.26271  ? 18  TYR Z CE2 1 
ATOM   2090 C  CZ  . TYR C 3 18  ? 37.29410 37.13906  19.88909  1.000 69.94368  ? 18  TYR Z CZ  1 
ATOM   2091 O  OH  . TYR C 3 18  ? 37.14805 36.05752  20.73317  1.000 68.55793  ? 18  TYR Z OH  1 
ATOM   2092 N  N   . VAL C 3 19  ? 39.49271 41.31613  14.53321  1.000 76.50037  ? 19  VAL Z N   1 
ATOM   2093 C  CA  . VAL C 3 19  ? 39.46783 42.14398  13.32690  1.000 75.71694  ? 19  VAL Z CA  1 
ATOM   2094 C  C   . VAL C 3 19  ? 38.25759 41.75463  12.48642  1.000 74.06928  ? 19  VAL Z C   1 
ATOM   2095 O  O   . VAL C 3 19  ? 37.66673 40.68740  12.66343  1.000 75.39617  ? 19  VAL Z O   1 
ATOM   2096 C  CB  . VAL C 3 19  ? 40.76102 42.02407  12.49112  1.000 77.27838  ? 19  VAL Z CB  1 
ATOM   2097 C  CG1 . VAL C 3 19  ? 41.96082 42.41484  13.32027  1.000 79.18896  ? 19  VAL Z CG1 1 
ATOM   2098 C  CG2 . VAL C 3 19  ? 40.92300 40.61759  11.93156  1.000 77.05128  ? 19  VAL Z CG2 1 
ATOM   2099 N  N   . LYS C 3 20  ? 37.90814 42.61753  11.53156  1.000 72.49096  ? 20  LYS Z N   1 
ATOM   2100 C  CA  . LYS C 3 20  ? 36.69391 42.45127  10.73758  1.000 75.76686  ? 20  LYS Z CA  1 
ATOM   2101 C  C   . LYS C 3 20  ? 37.05079 42.30595  9.26470   1.000 74.72388  ? 20  LYS Z C   1 
ATOM   2102 O  O   . LYS C 3 20  ? 37.80580 43.11858  8.72687   1.000 76.46764  ? 20  LYS Z O   1 
ATOM   2103 C  CB  . LYS C 3 20  ? 35.73433 43.62924  10.94745  1.000 78.98749  ? 20  LYS Z CB  1 
ATOM   2104 C  CG  . LYS C 3 20  ? 34.29598 43.34286  10.56076  1.000 82.88766  ? 20  LYS Z CG  1 
ATOM   2105 C  CD  . LYS C 3 20  ? 33.37392 44.45356  11.04181  1.000 87.92462  ? 20  LYS Z CD  1 
ATOM   2106 C  CE  . LYS C 3 20  ? 33.83706 45.81563  10.55703  1.000 93.05614  ? 20  LYS Z CE  1 
ATOM   2107 N  NZ  . LYS C 3 20  ? 32.92647 46.90375  11.01445  1.000 100.49393 ? 20  LYS Z NZ  1 
ATOM   2108 N  N   . LEU C 3 21  ? 36.51616 41.27257  8.61181   1.000 72.06276  ? 21  LEU Z N   1 
ATOM   2109 C  CA  . LEU C 3 21  ? 36.80948 40.99945  7.20414   1.000 69.32897  ? 21  LEU Z CA  1 
ATOM   2110 C  C   . LEU C 3 21  ? 35.53318 41.06433  6.37294   1.000 72.04625  ? 21  LEU Z C   1 
ATOM   2111 O  O   . LEU C 3 21  ? 34.66292 40.19859  6.49857   1.000 75.90357  ? 21  LEU Z O   1 
ATOM   2112 C  CB  . LEU C 3 21  ? 37.48702 39.63731  7.04908   1.000 64.08022  ? 21  LEU Z CB  1 
ATOM   2113 C  CG  . LEU C 3 21  ? 38.76671 39.48025  7.86784   1.000 60.32892  ? 21  LEU Z CG  1 
ATOM   2114 C  CD1 . LEU C 3 21  ? 39.40554 38.12239  7.62776   1.000 58.03416  ? 21  LEU Z CD1 1 
ATOM   2115 C  CD2 . LEU C 3 21  ? 39.74408 40.60935  7.52989   1.000 59.95073  ? 21  LEU Z CD2 1 
ATOM   2116 N  N   . ILE C 3 22  ? 35.42549 42.06571  5.50448   1.000 70.47625  ? 22  ILE Z N   1 
ATOM   2117 C  CA  . ILE C 3 22  ? 34.24582 42.20659  4.65568   1.000 72.03435  ? 22  ILE Z CA  1 
ATOM   2118 C  C   . ILE C 3 22  ? 34.49447 41.52568  3.31443   1.000 70.82412  ? 22  ILE Z C   1 
ATOM   2119 O  O   . ILE C 3 22  ? 35.50093 41.78609  2.64794   1.000 67.29310  ? 22  ILE Z O   1 
ATOM   2120 C  CB  . ILE C 3 22  ? 33.84933 43.68241  4.46696   1.000 73.92834  ? 22  ILE Z CB  1 
ATOM   2121 C  CG1 . ILE C 3 22  ? 33.61716 44.38203  5.81256   1.000 72.58125  ? 22  ILE Z CG1 1 
ATOM   2122 C  CG2 . ILE C 3 22  ? 32.57939 43.76251  3.65046   1.000 76.16724  ? 22  ILE Z CG2 1 
ATOM   2123 C  CD1 . ILE C 3 22  ? 34.76926 45.20674  6.29424   1.000 71.30297  ? 22  ILE Z CD1 1 
ATOM   2124 N  N   . SER C 3 23  ? 33.56432 40.65886  2.91765   1.000 73.81999  ? 23  SER Z N   1 
ATOM   2125 C  CA  . SER C 3 23  ? 33.64666 39.91770  1.66555   1.000 76.63553  ? 23  SER Z CA  1 
ATOM   2126 C  C   . SER C 3 23  ? 33.25154 40.81877  0.49906   1.000 81.26780  ? 23  SER Z C   1 
ATOM   2127 O  O   . SER C 3 23  ? 32.97504 42.01015  0.66474   1.000 83.90633  ? 23  SER Z O   1 
ATOM   2128 C  CB  . SER C 3 23  ? 32.75234 38.68642  1.72630   1.000 76.37162  ? 23  SER Z CB  1 
ATOM   2129 O  OG  . SER C 3 23  ? 31.39576 39.08734  1.86356   1.000 76.92626  ? 23  SER Z OG  1 
ATOM   2130 N  N   . SER C 3 24  ? 33.18385 40.24204  -0.70448  1.000 83.31791  ? 24  SER Z N   1 
ATOM   2131 C  CA  . SER C 3 24  ? 32.83564 41.03990  -1.87449  1.000 83.44463  ? 24  SER Z CA  1 
ATOM   2132 C  C   . SER C 3 24  ? 31.36467 41.41828  -1.87977  1.000 82.52279  ? 24  SER Z C   1 
ATOM   2133 O  O   . SER C 3 24  ? 31.01345 42.51153  -2.32892  1.000 83.93210  ? 24  SER Z O   1 
ATOM   2134 C  CB  . SER C 3 24  ? 33.17800 40.27890  -3.15129  1.000 86.21192  ? 24  SER Z CB  1 
ATOM   2135 O  OG  . SER C 3 24  ? 32.32379 39.16146  -3.30111  1.000 89.62647  ? 24  SER Z OG  1 
ATOM   2136 N  N   . ASP C 3 25  ? 30.49861 40.55273  -1.36342  1.000 84.20058  ? 25  ASP Z N   1 
ATOM   2137 C  CA  . ASP C 3 25  ? 29.06468 40.80549  -1.35098  1.000 86.24970  ? 25  ASP Z CA  1 
ATOM   2138 C  C   . ASP C 3 25  ? 28.57545 41.44602  -0.05529  1.000 86.49768  ? 25  ASP Z C   1 
ATOM   2139 O  O   . ASP C 3 25  ? 27.36396 41.52300  0.16145   1.000 87.73126  ? 25  ASP Z O   1 
ATOM   2140 C  CB  . ASP C 3 25  ? 28.29331 39.50649  -1.62732  1.000 88.28919  ? 25  ASP Z CB  1 
ATOM   2141 C  CG  . ASP C 3 25  ? 28.80610 38.32138  -0.81531  1.000 86.99198  ? 25  ASP Z CG  1 
ATOM   2142 O  OD1 . ASP C 3 25  ? 29.95513 38.37519  -0.34188  1.000 86.65856  ? 25  ASP Z OD1 1 
ATOM   2143 O  OD2 . ASP C 3 25  ? 28.06252 37.32784  -0.66412  1.000 87.19419  ? 25  ASP Z OD2 1 
ATOM   2144 N  N   . GLY C 3 26  ? 29.47786 41.93361  0.79467   1.000 85.03428  ? 26  GLY Z N   1 
ATOM   2145 C  CA  . GLY C 3 26  ? 29.09767 42.68427  1.97368   1.000 85.47039  ? 26  GLY Z CA  1 
ATOM   2146 C  C   . GLY C 3 26  ? 29.05466 41.89692  3.27010   1.000 86.85583  ? 26  GLY Z C   1 
ATOM   2147 O  O   . GLY C 3 26  ? 28.84462 42.50329  4.32870   1.000 89.05284  ? 26  GLY Z O   1 
ATOM   2148 N  N   . HIS C 3 27  ? 29.24660 40.57793  3.22736   1.000 86.18454  ? 27  HIS Z N   1 
ATOM   2149 C  CA  . HIS C 3 27  ? 29.25090 39.78761  4.45340   1.000 82.01905  ? 27  HIS Z CA  1 
ATOM   2150 C  C   . HIS C 3 27  ? 30.41931 40.18420  5.35033   1.000 81.05467  ? 27  HIS Z C   1 
ATOM   2151 O  O   . HIS C 3 27  ? 31.53432 40.42005  4.87890   1.000 80.42079  ? 27  HIS Z O   1 
ATOM   2152 C  CB  . HIS C 3 27  ? 29.31894 38.29377  4.12482   1.000 79.24768  ? 27  HIS Z CB  1 
ATOM   2153 C  CG  . HIS C 3 27  ? 27.98526 37.61677  4.09415   1.000 76.20582  ? 27  HIS Z CG  1 
ATOM   2154 N  ND1 . HIS C 3 27  ? 27.37622 37.12648  5.22863   1.000 74.95169  ? 27  HIS Z ND1 1 
ATOM   2155 C  CD2 . HIS C 3 27  ? 27.14083 37.35265  3.07038   1.000 76.63926  ? 27  HIS Z CD2 1 
ATOM   2156 C  CE1 . HIS C 3 27  ? 26.21420 36.58913  4.90476   1.000 76.23943  ? 27  HIS Z CE1 1 
ATOM   2157 N  NE2 . HIS C 3 27  ? 26.04694 36.71223  3.60080   1.000 76.25240  ? 27  HIS Z NE2 1 
ATOM   2158 N  N   . GLU C 3 28  ? 30.15414 40.27831  6.65230   1.000 79.50864  ? 28  GLU Z N   1 
ATOM   2159 C  CA  . GLU C 3 28  ? 31.15921 40.67840  7.62965   1.000 79.97188  ? 28  GLU Z CA  1 
ATOM   2160 C  C   . GLU C 3 28  ? 31.58604 39.46368  8.44190   1.000 75.97293  ? 28  GLU Z C   1 
ATOM   2161 O  O   . GLU C 3 28  ? 30.75732 38.83855  9.11241   1.000 79.33563  ? 28  GLU Z O   1 
ATOM   2162 C  CB  . GLU C 3 28  ? 30.62958 41.76863  8.55366   1.000 84.88826  ? 28  GLU Z CB  1 
ATOM   2163 C  CG  . GLU C 3 28  ? 30.10472 42.97907  7.83919   1.000 90.54873  ? 28  GLU Z CG  1 
ATOM   2164 C  CD  . GLU C 3 28  ? 29.69140 44.04715  8.81209   1.000 97.26157  ? 28  GLU Z CD  1 
ATOM   2165 O  OE1 . GLU C 3 28  ? 29.66466 43.74689  10.02564  1.000 96.78820  ? 28  GLU Z OE1 1 
ATOM   2166 O  OE2 . GLU C 3 28  ? 29.38049 45.17346  8.36829   1.000 103.34321 ? 28  GLU Z OE2 1 
ATOM   2167 N  N   . PHE C 3 29  ? 32.87775 39.14769  8.39599   1.000 71.10391  ? 29  PHE Z N   1 
ATOM   2168 C  CA  . PHE C 3 29  ? 33.46405 38.02652  9.11874   1.000 65.68964  ? 29  PHE Z CA  1 
ATOM   2169 C  C   . PHE C 3 29  ? 34.44090 38.56307  10.15025  1.000 65.90014  ? 29  PHE Z C   1 
ATOM   2170 O  O   . PHE C 3 29  ? 35.44814 39.17939  9.78562   1.000 69.44649  ? 29  PHE Z O   1 
ATOM   2171 C  CB  . PHE C 3 29  ? 34.19015 37.08902  8.16101   1.000 64.02845  ? 29  PHE Z CB  1 
ATOM   2172 C  CG  . PHE C 3 29  ? 33.28600 36.36492  7.22203   1.000 61.91281  ? 29  PHE Z CG  1 
ATOM   2173 C  CD1 . PHE C 3 29  ? 32.68090 35.18009  7.60118   1.000 61.01348  ? 29  PHE Z CD1 1 
ATOM   2174 C  CD2 . PHE C 3 29  ? 33.03413 36.87263  5.96239   1.000 60.36746  ? 29  PHE Z CD2 1 
ATOM   2175 C  CE1 . PHE C 3 29  ? 31.85528 34.50775  6.74182   1.000 62.59556  ? 29  PHE Z CE1 1 
ATOM   2176 C  CE2 . PHE C 3 29  ? 32.20681 36.20796  5.09710   1.000 62.80094  ? 29  PHE Z CE2 1 
ATOM   2177 C  CZ  . PHE C 3 29  ? 31.61308 35.01878  5.48767   1.000 65.57231  ? 29  PHE Z CZ  1 
ATOM   2178 N  N   . ILE C 3 30  ? 34.15950 38.31479  11.42456  1.000 63.10171  ? 30  ILE Z N   1 
ATOM   2179 C  CA  . ILE C 3 30  ? 34.99769 38.77009  12.52819  1.000 62.12416  ? 30  ILE Z CA  1 
ATOM   2180 C  C   . ILE C 3 30  ? 35.79664 37.58467  13.07136  1.000 66.83534  ? 30  ILE Z C   1 
ATOM   2181 O  O   . ILE C 3 30  ? 35.22222 36.62880  13.60656  1.000 67.71888  ? 30  ILE Z O   1 
ATOM   2182 C  CB  . ILE C 3 30  ? 34.14645 39.41839  13.63209  1.000 63.29066  ? 30  ILE Z CB  1 
ATOM   2183 C  CG1 . ILE C 3 30  ? 33.37133 40.62792  13.09603  1.000 63.87423  ? 30  ILE Z CG1 1 
ATOM   2184 C  CG2 . ILE C 3 30  ? 35.00713 39.83446  14.79523  1.000 63.48929  ? 30  ILE Z CG2 1 
ATOM   2185 C  CD1 . ILE C 3 30  ? 32.39499 41.24006  14.10818  1.000 64.51934  ? 30  ILE Z CD1 1 
ATOM   2186 N  N   . VAL C 3 31  ? 37.12580 37.64813  12.96690  1.000 68.97722  ? 31  VAL Z N   1 
ATOM   2187 C  CA  . VAL C 3 31  ? 37.99587 36.57938  13.44058  1.000 70.54710  ? 31  VAL Z CA  1 
ATOM   2188 C  C   . VAL C 3 31  ? 39.02315 37.19367  14.38275  1.000 76.00517  ? 31  VAL Z C   1 
ATOM   2189 O  O   . VAL C 3 31  ? 39.21143 38.41172  14.42532  1.000 75.77482  ? 31  VAL Z O   1 
ATOM   2190 C  CB  . VAL C 3 31  ? 38.69851 35.83729  12.28314  1.000 66.01133  ? 31  VAL Z CB  1 
ATOM   2191 C  CG1 . VAL C 3 31  ? 37.72004 35.61416  11.15321  1.000 66.19205  ? 31  VAL Z CG1 1 
ATOM   2192 C  CG2 . VAL C 3 31  ? 39.93989 36.58735  11.81809  1.000 63.81561  ? 31  VAL Z CG2 1 
ATOM   2193 N  N   . LYS C 3 32  ? 39.66939 36.33824  15.16931  1.000 82.42779  ? 32  LYS Z N   1 
ATOM   2194 C  CA  . LYS C 3 32  ? 40.70140 36.82641  16.07269  1.000 88.07180  ? 32  LYS Z CA  1 
ATOM   2195 C  C   . LYS C 3 32  ? 41.84592 37.42510  15.26955  1.000 88.63738  ? 32  LYS Z C   1 
ATOM   2196 O  O   . LYS C 3 32  ? 42.24613 36.87866  14.23831  1.000 92.96202  ? 32  LYS Z O   1 
ATOM   2197 C  CB  . LYS C 3 32  ? 41.21096 35.69138  16.96056  1.000 93.73513  ? 32  LYS Z CB  1 
ATOM   2198 C  CG  . LYS C 3 32  ? 40.11662 35.04941  17.80256  1.000 100.87350 ? 32  LYS Z CG  1 
ATOM   2199 C  CD  . LYS C 3 32  ? 40.69263 34.14119  18.88019  1.000 107.26369 ? 32  LYS Z CD  1 
ATOM   2200 C  CE  . LYS C 3 32  ? 39.59006 33.49352  19.71515  1.000 112.92835 ? 32  LYS Z CE  1 
ATOM   2201 N  NZ  . LYS C 3 32  ? 40.15458 32.64650  20.80903  1.000 119.49741 ? 32  LYS Z NZ  1 
ATOM   2202 N  N   . ARG C 3 33  ? 42.34405 38.58096  15.72122  1.000 87.52297  ? 33  ARG Z N   1 
ATOM   2203 C  CA  . ARG C 3 33  ? 43.42607 39.24621  14.99807  1.000 87.36154  ? 33  ARG Z CA  1 
ATOM   2204 C  C   . ARG C 3 33  ? 44.63670 38.32711  14.83658  1.000 87.72845  ? 33  ARG Z C   1 
ATOM   2205 O  O   . ARG C 3 33  ? 45.25354 38.28323  13.76341  1.000 86.81276  ? 33  ARG Z O   1 
ATOM   2206 C  CB  . ARG C 3 33  ? 43.83544 40.53430  15.72093  1.000 86.30104  ? 33  ARG Z CB  1 
ATOM   2207 C  CG  . ARG C 3 33  ? 44.91487 41.34719  15.00879  1.000 83.66213  ? 33  ARG Z CG  1 
ATOM   2208 C  CD  . ARG C 3 33  ? 45.47861 42.44636  15.90051  1.000 84.01807  ? 33  ARG Z CD  1 
ATOM   2209 N  NE  . ARG C 3 33  ? 46.12152 43.49212  15.11380  1.000 84.86364  ? 33  ARG Z NE  1 
ATOM   2210 C  CZ  . ARG C 3 33  ? 45.55122 44.65432  14.79281  1.000 85.53193  ? 33  ARG Z CZ  1 
ATOM   2211 N  NH1 . ARG C 3 33  ? 44.32119 44.94201  15.20814  1.000 87.17436  ? 33  ARG Z NH1 1 
ATOM   2212 N  NH2 . ARG C 3 33  ? 46.21291 45.53115  14.05487  1.000 83.28706  ? 33  ARG Z NH2 1 
ATOM   2213 N  N   . GLU C 3 34  ? 44.99523 37.58671  15.89375  1.000 86.61042  ? 34  GLU Z N   1 
ATOM   2214 C  CA  . GLU C 3 34  ? 46.12652 36.66657  15.79859  1.000 87.02895  ? 34  GLU Z CA  1 
ATOM   2215 C  C   . GLU C 3 34  ? 45.90156 35.60078  14.72894  1.000 82.76957  ? 34  GLU Z C   1 
ATOM   2216 O  O   . GLU C 3 34  ? 46.85946 35.14701  14.09573  1.000 81.44437  ? 34  GLU Z O   1 
ATOM   2217 C  CB  . GLU C 3 34  ? 46.40885 36.01951  17.15919  1.000 93.76390  ? 34  GLU Z CB  1 
ATOM   2218 C  CG  . GLU C 3 34  ? 47.72547 35.24078  17.21806  1.000 102.39752 ? 34  GLU Z CG  1 
ATOM   2219 C  CD  . GLU C 3 34  ? 48.93015 36.13210  17.49397  1.000 110.97531 ? 34  GLU Z CD  1 
ATOM   2220 O  OE1 . GLU C 3 34  ? 49.62383 35.88587  18.50557  1.000 113.25225 ? 34  GLU Z OE1 1 
ATOM   2221 O  OE2 . GLU C 3 34  ? 49.17944 37.08141  16.71537  1.000 114.48045 ? 34  GLU Z OE2 1 
ATOM   2222 N  N   . HIS C 3 35  ? 44.65315 35.18497  14.51383  1.000 81.32085  ? 35  HIS Z N   1 
ATOM   2223 C  CA  . HIS C 3 35  ? 44.37608 34.17136  13.50112  1.000 80.76299  ? 35  HIS Z CA  1 
ATOM   2224 C  C   . HIS C 3 35  ? 44.43919 34.75068  12.09487  1.000 80.36089  ? 35  HIS Z C   1 
ATOM   2225 O  O   . HIS C 3 35  ? 44.93817 34.09168  11.17441  1.000 79.54494  ? 35  HIS Z O   1 
ATOM   2226 C  CB  . HIS C 3 35  ? 43.00760 33.53817  13.73491  1.000 82.41739  ? 35  HIS Z CB  1 
ATOM   2227 C  CG  . HIS C 3 35  ? 42.90877 32.76516  15.01155  1.000 84.05086  ? 35  HIS Z CG  1 
ATOM   2228 N  ND1 . HIS C 3 35  ? 41.84067 31.94001  15.29664  1.000 84.20870  ? 35  HIS Z ND1 1 
ATOM   2229 C  CD2 . HIS C 3 35  ? 43.74633 32.68078  16.07361  1.000 85.17529  ? 35  HIS Z CD2 1 
ATOM   2230 C  CE1 . HIS C 3 35  ? 42.01963 31.38744  16.48301  1.000 84.24756  ? 35  HIS Z CE1 1 
ATOM   2231 N  NE2 . HIS C 3 35  ? 43.16813 31.81975  16.97534  1.000 84.69615  ? 35  HIS Z NE2 1 
ATOM   2232 N  N   . ALA C 3 36  ? 43.91935 35.97006  11.90610  1.000 78.61587  ? 36  ALA Z N   1 
ATOM   2233 C  CA  . ALA C 3 36  ? 43.93970 36.59935  10.58995  1.000 74.75123  ? 36  ALA Z CA  1 
ATOM   2234 C  C   . ALA C 3 36  ? 45.35800 36.86607  10.10025  1.000 73.93148  ? 36  ALA Z C   1 
ATOM   2235 O  O   . ALA C 3 36  ? 45.57445 36.95493  8.88661   1.000 74.07267  ? 36  ALA Z O   1 
ATOM   2236 C  CB  . ALA C 3 36  ? 43.13493 37.89352  10.61194  1.000 73.11895  ? 36  ALA Z CB  1 
ATOM   2237 N  N   . LEU C 3 37  ? 46.32984 36.97786  11.01197  1.000 74.92271  ? 37  LEU Z N   1 
ATOM   2238 C  CA  . LEU C 3 37  ? 47.72550 37.16373  10.62656  1.000 76.80750  ? 37  LEU Z CA  1 
ATOM   2239 C  C   . LEU C 3 37  ? 48.28645 35.97299  9.85962   1.000 81.23192  ? 37  LEU Z C   1 
ATOM   2240 O  O   . LEU C 3 37  ? 49.42341 36.04906  9.37723   1.000 82.46523  ? 37  LEU Z O   1 
ATOM   2241 C  CB  . LEU C 3 37  ? 48.58886 37.41877  11.86037  1.000 75.33114  ? 37  LEU Z CB  1 
ATOM   2242 C  CG  . LEU C 3 37  ? 48.32807 38.74037  12.57907  1.000 76.00264  ? 37  LEU Z CG  1 
ATOM   2243 C  CD1 . LEU C 3 37  ? 49.30484 38.92715  13.72083  1.000 75.97487  ? 37  LEU Z CD1 1 
ATOM   2244 C  CD2 . LEU C 3 37  ? 48.40186 39.90300  11.61097  1.000 76.69826  ? 37  LEU Z CD2 1 
ATOM   2245 N  N   . THR C 3 38  ? 47.54696 34.86353  9.78245   1.000 84.68229  ? 38  THR Z N   1 
ATOM   2246 C  CA  . THR C 3 38  ? 47.97319 33.73821  8.95490   1.000 88.37256  ? 38  THR Z CA  1 
ATOM   2247 C  C   . THR C 3 38  ? 48.20030 34.16550  7.50963   1.000 90.80481  ? 38  THR Z C   1 
ATOM   2248 O  O   . THR C 3 38  ? 49.24418 33.86885  6.91800   1.000 96.85187  ? 38  THR Z O   1 
ATOM   2249 C  CB  . THR C 3 38  ? 46.93791 32.61502  9.03061   1.000 89.26527  ? 38  THR Z CB  1 
ATOM   2250 O  OG1 . THR C 3 38  ? 46.95157 32.04533  10.34605  1.000 90.50833  ? 38  THR Z OG1 1 
ATOM   2251 C  CG2 . THR C 3 38  ? 47.23451 31.53441  7.99288   1.000 90.86128  ? 38  THR Z CG2 1 
ATOM   2252 N  N   . SER C 3 39  ? 47.24721 34.88955  6.93636   1.000 91.63775  ? 39  SER Z N   1 
ATOM   2253 C  CA  . SER C 3 39  ? 47.38915 35.36839  5.57084   1.000 85.95104  ? 39  SER Z CA  1 
ATOM   2254 C  C   . SER C 3 39  ? 48.54948 36.35331  5.48786   1.000 83.73864  ? 39  SER Z C   1 
ATOM   2255 O  O   . SER C 3 39  ? 48.67384 37.25022  6.32671   1.000 84.52710  ? 39  SER Z O   1 
ATOM   2256 C  CB  . SER C 3 39  ? 46.08145 36.01042  5.11180   1.000 83.95632  ? 39  SER Z CB  1 
ATOM   2257 O  OG  . SER C 3 39  ? 46.22208 36.64698  3.85934   1.000 83.73344  ? 39  SER Z OG  1 
ATOM   2258 N  N   . GLY C 3 40  ? 49.43955 36.14610  4.51386   1.000 81.89857  ? 40  GLY Z N   1 
ATOM   2259 C  CA  . GLY C 3 40  ? 50.52399 37.09687  4.31071   1.000 81.18182  ? 40  GLY Z CA  1 
ATOM   2260 C  C   . GLY C 3 40  ? 50.02392 38.46903  3.90385   1.000 79.41478  ? 40  GLY Z C   1 
ATOM   2261 O  O   . GLY C 3 40  ? 50.55247 39.49308  4.34562   1.000 78.25673  ? 40  GLY Z O   1 
ATOM   2262 N  N   . THR C 3 41  ? 48.98772 38.50773  3.06592   1.000 77.75277  ? 41  THR Z N   1 
ATOM   2263 C  CA  . THR C 3 41  ? 48.41518 39.78309  2.65674   1.000 78.28118  ? 41  THR Z CA  1 
ATOM   2264 C  C   . THR C 3 41  ? 47.79673 40.50285  3.84348   1.000 78.92188  ? 41  THR Z C   1 
ATOM   2265 O  O   . THR C 3 41  ? 48.00170 41.70821  4.03316   1.000 81.68684  ? 41  THR Z O   1 
ATOM   2266 C  CB  . THR C 3 41  ? 47.38059 39.56685  1.55876   1.000 79.51967  ? 41  THR Z CB  1 
ATOM   2267 O  OG1 . THR C 3 41  ? 48.04944 39.13664  0.37228   1.000 84.05683  ? 41  THR Z OG1 1 
ATOM   2268 C  CG2 . THR C 3 41  ? 46.64767 40.86309  1.25835   1.000 79.60410  ? 41  THR Z CG2 1 
ATOM   2269 N  N   . ILE C 3 42  ? 47.03051 39.78158  4.65625   1.000 76.53402  ? 42  ILE Z N   1 
ATOM   2270 C  CA  . ILE C 3 42  ? 46.42233 40.43572  5.80558   1.000 73.72235  ? 42  ILE Z CA  1 
ATOM   2271 C  C   . ILE C 3 42  ? 47.49628 40.88651  6.79411   1.000 75.97650  ? 42  ILE Z C   1 
ATOM   2272 O  O   . ILE C 3 42  ? 47.35132 41.92875  7.44477   1.000 76.68018  ? 42  ILE Z O   1 
ATOM   2273 C  CB  . ILE C 3 42  ? 45.38703 39.49283  6.44137   1.000 67.04102  ? 42  ILE Z CB  1 
ATOM   2274 C  CG1 . ILE C 3 42  ? 44.33457 39.12410  5.39808   1.000 64.06042  ? 42  ILE Z CG1 1 
ATOM   2275 C  CG2 . ILE C 3 42  ? 44.73060 40.14855  7.64877   1.000 63.03898  ? 42  ILE Z CG2 1 
ATOM   2276 C  CD1 . ILE C 3 42  ? 43.12288 38.46297  5.98618   1.000 65.59793  ? 42  ILE Z CD1 1 
ATOM   2277 N  N   . LYS C 3 43  ? 48.59893 40.13693  6.90324   1.000 77.08735  ? 43  LYS Z N   1 
ATOM   2278 C  CA  . LYS C 3 43  ? 49.64103 40.49852  7.86099   1.000 79.43800  ? 43  LYS Z CA  1 
ATOM   2279 C  C   . LYS C 3 43  ? 50.26016 41.84942  7.52015   1.000 78.36163  ? 43  LYS Z C   1 
ATOM   2280 O  O   . LYS C 3 43  ? 50.47894 42.68212  8.40828   1.000 80.93799  ? 43  LYS Z O   1 
ATOM   2281 C  CB  . LYS C 3 43  ? 50.72490 39.41922  7.89737   1.000 81.77541  ? 43  LYS Z CB  1 
ATOM   2282 C  CG  . LYS C 3 43  ? 51.85636 39.71508  8.86211   1.000 83.93991  ? 43  LYS Z CG  1 
ATOM   2283 C  CD  . LYS C 3 43  ? 52.96974 38.67948  8.75913   1.000 88.08936  ? 43  LYS Z CD  1 
ATOM   2284 C  CE  . LYS C 3 43  ? 52.50712 37.29485  9.17027   1.000 93.45593  ? 43  LYS Z CE  1 
ATOM   2285 N  NZ  . LYS C 3 43  ? 53.64382 36.34887  9.40129   1.000 94.10973  ? 43  LYS Z NZ  1 
ATOM   2286 N  N   . ALA C 3 44  ? 50.54445 42.08911  6.23712   1.000 74.42614  ? 44  ALA Z N   1 
ATOM   2287 C  CA  . ALA C 3 44  ? 51.11311 43.36964  5.83109   1.000 73.04687  ? 44  ALA Z CA  1 
ATOM   2288 C  C   . ALA C 3 44  ? 50.13899 44.52869  6.03694   1.000 72.01210  ? 44  ALA Z C   1 
ATOM   2289 O  O   . ALA C 3 44  ? 50.57152 45.68153  6.11730   1.000 73.97731  ? 44  ALA Z O   1 
ATOM   2290 C  CB  . ALA C 3 44  ? 51.56487 43.30949  4.36993   1.000 71.48200  ? 44  ALA Z CB  1 
ATOM   2291 N  N   . MET C 3 45  ? 48.83892 44.25735  6.10602   1.000 69.01867  ? 45  MET Z N   1 
ATOM   2292 C  CA  . MET C 3 45  ? 47.86784 45.29870  6.38917   1.000 67.88904  ? 45  MET Z CA  1 
ATOM   2293 C  C   . MET C 3 45  ? 47.67997 45.55240  7.87474   1.000 71.05544  ? 45  MET Z C   1 
ATOM   2294 O  O   . MET C 3 45  ? 47.21121 46.64210  8.24714   1.000 73.03948  ? 45  MET Z O   1 
ATOM   2295 C  CB  . MET C 3 45  ? 46.52221 44.95200  5.76568   1.000 65.43324  ? 45  MET Z CB  1 
ATOM   2296 C  CG  . MET C 3 45  ? 46.59383 44.82319  4.26951   1.000 66.90647  ? 45  MET Z CG  1 
ATOM   2297 S  SD  . MET C 3 45  ? 44.96180 44.63341  3.54946   1.000 69.86034  ? 45  MET Z SD  1 
ATOM   2298 C  CE  . MET C 3 45  ? 44.10481 46.05004  4.21629   1.000 72.51490  ? 45  MET Z CE  1 
ATOM   2299 N  N   . LEU C 3 46  ? 48.03479 44.58534  8.72710   1.000 69.45666  ? 46  LEU Z N   1 
ATOM   2300 C  CA  . LEU C 3 46  ? 47.74732 44.68872  10.14692  1.000 67.94235  ? 46  LEU Z CA  1 
ATOM   2301 C  C   . LEU C 3 46  ? 48.98285 44.80398  11.02307  1.000 70.97799  ? 46  LEU Z C   1 
ATOM   2302 O  O   . LEU C 3 46  ? 48.84476 45.14438  12.20155  1.000 71.78270  ? 46  LEU Z O   1 
ATOM   2303 C  CB  . LEU C 3 46  ? 46.92386 43.48786  10.61935  1.000 64.92002  ? 46  LEU Z CB  1 
ATOM   2304 C  CG  . LEU C 3 46  ? 45.59447 43.27212  9.90945   1.000 60.84988  ? 46  LEU Z CG  1 
ATOM   2305 C  CD1 . LEU C 3 46  ? 44.86853 42.12029  10.55143  1.000 60.75307  ? 46  LEU Z CD1 1 
ATOM   2306 C  CD2 . LEU C 3 46  ? 44.75755 44.52907  9.97902   1.000 59.33343  ? 46  LEU Z CD2 1 
ATOM   2307 N  N   . SER C 3 47  ? 50.17765 44.56782  10.48835  1.000 73.70602  ? 47  SER Z N   1 
ATOM   2308 C  CA  . SER C 3 47  ? 51.38255 44.62988  11.29898  1.000 80.49235  ? 47  SER Z CA  1 
ATOM   2309 C  C   . SER C 3 47  ? 52.49700 45.28960  10.50869  1.000 83.48441  ? 47  SER Z C   1 
ATOM   2310 O  O   . SER C 3 47  ? 52.59555 45.11873  9.29066   1.000 81.67843  ? 47  SER Z O   1 
ATOM   2311 C  CB  . SER C 3 47  ? 51.83500 43.23306  11.78433  1.000 84.68996  ? 47  SER Z CB  1 
ATOM   2312 O  OG  . SER C 3 47  ? 51.92646 42.29180  10.72422  1.000 85.88668  ? 47  SER Z OG  1 
ATOM   2313 N  N   . GLY C 3 48  ? 53.33868 46.03879  11.21303  1.000 89.40778  ? 48  GLY Z N   1 
ATOM   2314 C  CA  . GLY C 3 48  ? 54.45167 46.71771  10.58996  1.000 94.59930  ? 48  GLY Z CA  1 
ATOM   2315 C  C   . GLY C 3 48  ? 54.98965 47.84365  11.44395  1.000 100.70401 ? 48  GLY Z C   1 
ATOM   2316 O  O   . GLY C 3 48  ? 54.60709 48.00732  12.60655  1.000 101.56590 ? 48  GLY Z O   1 
ATOM   2317 N  N   . PRO C 3 49  ? 55.90514 48.63811  10.88243  1.000 105.54354 ? 49  PRO Z N   1 
ATOM   2318 C  CA  . PRO C 3 49  ? 56.46067 49.77278  11.64074  1.000 110.21594 ? 49  PRO Z CA  1 
ATOM   2319 C  C   . PRO C 3 49  ? 55.41474 50.74194  12.15708  1.000 115.49802 ? 49  PRO Z C   1 
ATOM   2320 O  O   . PRO C 3 49  ? 55.69753 51.48040  13.10833  1.000 117.05995 ? 49  PRO Z O   1 
ATOM   2321 C  CB  . PRO C 3 49  ? 57.39581 50.45136  10.62823  1.000 108.61489 ? 49  PRO Z CB  1 
ATOM   2322 C  CG  . PRO C 3 49  ? 56.95802 49.95462  9.28733   1.000 106.15369 ? 49  PRO Z CG  1 
ATOM   2323 C  CD  . PRO C 3 49  ? 56.46771 48.55726  9.52448   1.000 105.92675 ? 49  PRO Z CD  1 
ATOM   2324 N  N   . GLY C 3 50  ? 54.22340 50.77021  11.56370  1.000 118.93653 ? 50  GLY Z N   1 
ATOM   2325 C  CA  . GLY C 3 50  ? 53.17315 51.66747  11.98987  1.000 115.58497 ? 50  GLY Z CA  1 
ATOM   2326 C  C   . GLY C 3 50  ? 53.11383 52.97736  11.23836  1.000 111.69213 ? 50  GLY Z C   1 
ATOM   2327 O  O   . GLY C 3 50  ? 52.29055 53.83426  11.58510  1.000 110.92246 ? 50  GLY Z O   1 
ATOM   2328 N  N   . GLN C 3 51  ? 53.95701 53.15617  10.21865  1.000 108.02843 ? 51  GLN Z N   1 
ATOM   2329 C  CA  . GLN C 3 51  ? 53.93590 54.38236  9.42871   1.000 105.00100 ? 51  GLN Z CA  1 
ATOM   2330 C  C   . GLN C 3 51  ? 52.57454 54.59296  8.77816   1.000 95.80332  ? 51  GLN Z C   1 
ATOM   2331 O  O   . GLN C 3 51  ? 52.11617 55.73259  8.62660   1.000 93.34268  ? 51  GLN Z O   1 
ATOM   2332 C  CB  . GLN C 3 51  ? 55.02578 54.32413  8.36137   1.000 109.65149 ? 51  GLN Z CB  1 
ATOM   2333 C  CG  . GLN C 3 51  ? 56.41964 54.12483  8.91047   1.000 116.49059 ? 51  GLN Z CG  1 
ATOM   2334 C  CD  . GLN C 3 51  ? 56.93355 55.35521  9.61589   1.000 121.98733 ? 51  GLN Z CD  1 
ATOM   2335 O  OE1 . GLN C 3 51  ? 56.33569 56.42967  9.52321   1.000 122.54582 ? 51  GLN Z OE1 1 
ATOM   2336 N  NE2 . GLN C 3 51  ? 58.04959 55.21187  10.32328  1.000 124.50874 ? 51  GLN Z NE2 1 
ATOM   2337 N  N   . PHE C 3 52  ? 51.92840 53.50395  8.35678   1.000 89.55099  ? 52  PHE Z N   1 
ATOM   2338 C  CA  . PHE C 3 52  ? 50.64694 53.56299  7.66960   1.000 81.17559  ? 52  PHE Z CA  1 
ATOM   2339 C  C   . PHE C 3 52  ? 49.50569 53.07665  8.55005   1.000 77.01412  ? 52  PHE Z C   1 
ATOM   2340 O  O   . PHE C 3 52  ? 48.50680 52.55577  8.04539   1.000 75.05095  ? 52  PHE Z O   1 
ATOM   2341 C  CB  . PHE C 3 52  ? 50.69246 52.77592  6.36384   1.000 76.15038  ? 52  PHE Z CB  1 
ATOM   2342 C  CG  . PHE C 3 52  ? 51.68996 53.30994  5.38365   1.000 73.98065  ? 52  PHE Z CG  1 
ATOM   2343 C  CD1 . PHE C 3 52  ? 53.02381 52.95412  5.47822   1.000 73.08854  ? 52  PHE Z CD1 1 
ATOM   2344 C  CD2 . PHE C 3 52  ? 51.29917 54.17265  4.36946   1.000 73.08692  ? 52  PHE Z CD2 1 
ATOM   2345 C  CE1 . PHE C 3 52  ? 53.94570 53.43573  4.58530   1.000 73.01144  ? 52  PHE Z CE1 1 
ATOM   2346 C  CE2 . PHE C 3 52  ? 52.22424 54.66290  3.46194   1.000 71.46471  ? 52  PHE Z CE2 1 
ATOM   2347 C  CZ  . PHE C 3 52  ? 53.54952 54.28963  3.57491   1.000 72.91579  ? 52  PHE Z CZ  1 
ATOM   2348 N  N   . ALA C 3 53  ? 49.65475 53.22462  9.86611   1.000 75.64029  ? 53  ALA Z N   1 
ATOM   2349 C  CA  . ALA C 3 53  ? 48.58778 52.90936  10.80920  1.000 74.49635  ? 53  ALA Z CA  1 
ATOM   2350 C  C   . ALA C 3 53  ? 48.12273 51.46366  10.66943  1.000 76.43969  ? 53  ALA Z C   1 
ATOM   2351 O  O   . ALA C 3 53  ? 46.92594 51.18171  10.67448  1.000 76.36734  ? 53  ALA Z O   1 
ATOM   2352 C  CB  . ALA C 3 53  ? 47.41253 53.87460  10.64102  1.000 72.59387  ? 53  ALA Z CB  1 
ATOM   2353 N  N   . GLU C 3 54  ? 49.07134 50.53813  10.49835  1.000 78.14411  ? 54  GLU Z N   1 
ATOM   2354 C  CA  . GLU C 3 54  ? 48.69789 49.12774  10.44558  1.000 79.05467  ? 54  GLU Z CA  1 
ATOM   2355 C  C   . GLU C 3 54  ? 48.26840 48.61200  11.81394  1.000 82.40283  ? 54  GLU Z C   1 
ATOM   2356 O  O   . GLU C 3 54  ? 47.25777 47.91133  11.92086  1.000 82.80991  ? 54  GLU Z O   1 
ATOM   2357 C  CB  . GLU C 3 54  ? 49.83553 48.28006  9.88433   1.000 80.02692  ? 54  GLU Z CB  1 
ATOM   2358 C  CG  . GLU C 3 54  ? 50.34758 48.71580  8.52897   1.000 81.64351  ? 54  GLU Z CG  1 
ATOM   2359 C  CD  . GLU C 3 54  ? 51.46901 49.72207  8.64059   1.000 87.03377  ? 54  GLU Z CD  1 
ATOM   2360 O  OE1 . GLU C 3 54  ? 51.37754 50.62028  9.50394   1.000 90.78989  ? 54  GLU Z OE1 1 
ATOM   2361 O  OE2 . GLU C 3 54  ? 52.44908 49.60797  7.87142   1.000 88.12896  ? 54  GLU Z OE2 1 
ATOM   2362 N  N   . ASN C 3 55  ? 49.01674 48.94996  12.87318  1.000 87.54212  ? 55  ASN Z N   1 
ATOM   2363 C  CA  . ASN C 3 55  ? 48.71004 48.49512  14.22845  1.000 91.35587  ? 55  ASN Z CA  1 
ATOM   2364 C  C   . ASN C 3 55  ? 47.46935 49.14394  14.80588  1.000 91.32554  ? 55  ASN Z C   1 
ATOM   2365 O  O   . ASN C 3 55  ? 47.11839 48.86461  15.95648  1.000 91.54676  ? 55  ASN Z O   1 
ATOM   2366 C  CB  . ASN C 3 55  ? 49.89046 48.75047  15.16230  1.000 98.22263  ? 55  ASN Z CB  1 
ATOM   2367 C  CG  . ASN C 3 55  ? 51.05896 47.84579  14.86976  1.000 104.69516 ? 55  ASN Z CG  1 
ATOM   2368 O  OD1 . ASN C 3 55  ? 50.89734 46.63546  14.69453  1.000 103.41815 ? 55  ASN Z OD1 1 
ATOM   2369 N  ND2 . ASN C 3 55  ? 52.24865 48.42728  14.80518  1.000 107.42582 ? 55  ASN Z ND2 1 
ATOM   2370 N  N   . GLU C 3 56  ? 46.83219 50.03799  14.06153  1.000 90.90480  ? 56  GLU Z N   1 
ATOM   2371 C  CA  . GLU C 3 56  ? 45.57256 50.63766  14.46766  1.000 92.50747  ? 56  GLU Z CA  1 
ATOM   2372 C  C   . GLU C 3 56  ? 44.45968 50.33290  13.47379  1.000 83.19159  ? 56  GLU Z C   1 
ATOM   2373 O  O   . GLU C 3 56  ? 43.38836 50.94527  13.55800  1.000 83.04215  ? 56  GLU Z O   1 
ATOM   2374 C  CB  . GLU C 3 56  ? 45.73648 52.14294  14.66610  1.000 103.05298 ? 56  GLU Z CB  1 
ATOM   2375 C  CG  . GLU C 3 56  ? 46.65606 52.46582  15.82591  1.000 118.66462 ? 56  GLU Z CG  1 
ATOM   2376 C  CD  . GLU C 3 56  ? 47.10098 53.90818  15.85046  1.000 132.34719 ? 56  GLU Z CD  1 
ATOM   2377 O  OE1 . GLU C 3 56  ? 47.46181 54.43804  14.77844  1.000 137.97013 ? 56  GLU Z OE1 1 
ATOM   2378 O  OE2 . GLU C 3 56  ? 47.09357 54.50931  16.94596  1.000 136.83355 ? 56  GLU Z OE2 1 
ATOM   2379 N  N   . THR C 3 57  ? 44.68634 49.40642  12.53600  1.000 77.53965  ? 57  THR Z N   1 
ATOM   2380 C  CA  . THR C 3 57  ? 43.67909 48.98065  11.57126  1.000 73.13971  ? 57  THR Z CA  1 
ATOM   2381 C  C   . THR C 3 57  ? 43.08106 47.66727  12.05097  1.000 77.84536  ? 57  THR Z C   1 
ATOM   2382 O  O   . THR C 3 57  ? 43.81492 46.73166  12.38066  1.000 81.12518  ? 57  THR Z O   1 
ATOM   2383 C  CB  . THR C 3 57  ? 44.28835 48.79868  10.16741  1.000 70.77049  ? 57  THR Z CB  1 
ATOM   2384 O  OG1 . THR C 3 57  ? 44.73707 50.05628  9.65527   1.000 69.86018  ? 57  THR Z OG1 1 
ATOM   2385 C  CG2 . THR C 3 57  ? 43.27459 48.21027  9.17213   1.000 66.12714  ? 57  THR Z CG2 1 
ATOM   2386 N  N   . ASN C 3 58  ? 41.75071 47.59777  12.08547  1.000 78.10117  ? 58  ASN Z N   1 
ATOM   2387 C  CA  . ASN C 3 58  ? 41.06727 46.38922  12.52801  1.000 84.00597  ? 58  ASN Z CA  1 
ATOM   2388 C  C   . ASN C 3 58  ? 39.87506 46.06389  11.63318  1.000 82.92256  ? 58  ASN Z C   1 
ATOM   2389 O  O   . ASN C 3 58  ? 38.85731 45.55289  12.11222  1.000 83.79137  ? 58  ASN Z O   1 
ATOM   2390 C  CB  . ASN C 3 58  ? 40.65620 46.50000  13.99856  1.000 91.48667  ? 58  ASN Z CB  1 
ATOM   2391 C  CG  . ASN C 3 58  ? 39.92784 47.78162  14.30148  1.000 99.97837  ? 58  ASN Z CG  1 
ATOM   2392 O  OD1 . ASN C 3 58  ? 39.00532 48.17639  13.58638  1.000 104.21671 ? 58  ASN Z OD1 1 
ATOM   2393 N  ND2 . ASN C 3 58  ? 40.35920 48.46218  15.35915  1.000 102.41080 ? 58  ASN Z ND2 1 
ATOM   2394 N  N   . GLU C 3 59  ? 39.98700 46.35817  10.33656  1.000 92.94831  ? 59  GLU Z N   1 
ATOM   2395 C  CA  . GLU C 3 59  ? 38.91934 46.11387  9.37260   1.000 95.09686  ? 59  GLU Z CA  1 
ATOM   2396 C  C   . GLU C 3 59  ? 39.52669 46.07651  7.97631   1.000 96.68386  ? 59  GLU Z C   1 
ATOM   2397 O  O   . GLU C 3 59  ? 40.33647 46.94409  7.63057   1.000 101.13293 ? 59  GLU Z O   1 
ATOM   2398 C  CB  . GLU C 3 59  ? 37.84154 47.19578  9.46858   1.000 100.12897 ? 59  GLU Z CB  1 
ATOM   2399 C  CG  . GLU C 3 59  ? 36.75886 47.11166  8.40987   1.000 108.36167 ? 59  GLU Z CG  1 
ATOM   2400 C  CD  . GLU C 3 59  ? 35.71875 48.21368  8.55169   1.000 119.13819 ? 59  GLU Z CD  1 
ATOM   2401 O  OE1 . GLU C 3 59  ? 35.40724 48.59309  9.70141   1.000 124.58406 ? 59  GLU Z OE1 1 
ATOM   2402 O  OE2 . GLU C 3 59  ? 35.23702 48.72471  7.51447   1.000 122.83079 ? 59  GLU Z OE2 1 
ATOM   2403 N  N   . VAL C 3 60  ? 39.13523 45.07858  7.17858   1.000 91.95027  ? 60  VAL Z N   1 
ATOM   2404 C  CA  . VAL C 3 60  ? 39.68595 44.86843  5.84125   1.000 87.51144  ? 60  VAL Z CA  1 
ATOM   2405 C  C   . VAL C 3 60  ? 38.55525 44.48535  4.89157   1.000 85.03728  ? 60  VAL Z C   1 
ATOM   2406 O  O   . VAL C 3 60  ? 37.83029 43.51611  5.14390   1.000 82.91661  ? 60  VAL Z O   1 
ATOM   2407 C  CB  . VAL C 3 60  ? 40.76269 43.76713  5.82833   1.000 84.11027  ? 60  VAL Z CB  1 
ATOM   2408 C  CG1 . VAL C 3 60  ? 41.30757 43.58718  4.42156   1.000 84.47289  ? 60  VAL Z CG1 1 
ATOM   2409 C  CG2 . VAL C 3 60  ? 41.88078 44.06539  6.81737   1.000 83.77100  ? 60  VAL Z CG2 1 
ATOM   2410 N  N   . ASN C 3 61  ? 38.42568 45.22410  3.78439   1.000 85.31759  ? 61  ASN Z N   1 
ATOM   2411 C  CA  . ASN C 3 61  ? 37.42296 44.96084  2.75289   1.000 83.93568  ? 61  ASN Z CA  1 
ATOM   2412 C  C   . ASN C 3 61  ? 38.05309 44.22108  1.58152   1.000 80.41396  ? 61  ASN Z C   1 
ATOM   2413 O  O   . ASN C 3 61  ? 38.95830 44.74604  0.92763   1.000 80.16292  ? 61  ASN Z O   1 
ATOM   2414 C  CB  . ASN C 3 61  ? 36.79054 46.25305  2.24088   1.000 86.85511  ? 61  ASN Z CB  1 
ATOM   2415 C  CG  . ASN C 3 61  ? 36.16669 47.06912  3.33155   1.000 90.68987  ? 61  ASN Z CG  1 
ATOM   2416 O  OD1 . ASN C 3 61  ? 34.95012 47.04442  3.51017   1.000 92.00268  ? 61  ASN Z OD1 1 
ATOM   2417 N  ND2 . ASN C 3 61  ? 36.98841 47.81355  4.06567   1.000 93.72211  ? 61  ASN Z ND2 1 
ATOM   2418 N  N   . PHE C 3 62  ? 37.55175 43.03187  1.29224   1.000 77.89403  ? 62  PHE Z N   1 
ATOM   2419 C  CA  . PHE C 3 62  ? 38.00802 42.25555  0.14653   1.000 74.13760  ? 62  PHE Z CA  1 
ATOM   2420 C  C   . PHE C 3 62  ? 36.94613 42.31406  -0.94607  1.000 74.10309  ? 62  PHE Z C   1 
ATOM   2421 O  O   . PHE C 3 62  ? 35.93681 41.61044  -0.87871  1.000 71.65748  ? 62  PHE Z O   1 
ATOM   2422 C  CB  . PHE C 3 62  ? 38.31008 40.82082  0.54712   1.000 69.09343  ? 62  PHE Z CB  1 
ATOM   2423 C  CG  . PHE C 3 62  ? 39.49410 40.69003  1.44646   1.000 68.15501  ? 62  PHE Z CG  1 
ATOM   2424 C  CD1 . PHE C 3 62  ? 40.76774 40.92214  0.96691   1.000 70.60888  ? 62  PHE Z CD1 1 
ATOM   2425 C  CD2 . PHE C 3 62  ? 39.33911 40.31760  2.76822   1.000 67.49855  ? 62  PHE Z CD2 1 
ATOM   2426 C  CE1 . PHE C 3 62  ? 41.86655 40.80138  1.79483   1.000 71.17855  ? 62  PHE Z CE1 1 
ATOM   2427 C  CE2 . PHE C 3 62  ? 40.43151 40.18874  3.59687   1.000 68.98771  ? 62  PHE Z CE2 1 
ATOM   2428 C  CZ  . PHE C 3 62  ? 41.69678 40.42994  3.11037   1.000 70.18060  ? 62  PHE Z CZ  1 
ATOM   2429 N  N   . ARG C 3 63  ? 37.16563 43.16469  -1.94818  1.000 76.30304  ? 63  ARG Z N   1 
ATOM   2430 C  CA  . ARG C 3 63  ? 36.32247 43.10539  -3.13284  1.000 80.07110  ? 63  ARG Z CA  1 
ATOM   2431 C  C   . ARG C 3 63  ? 36.55243 41.81473  -3.92096  1.000 79.95913  ? 63  ARG Z C   1 
ATOM   2432 O  O   . ARG C 3 63  ? 35.68154 41.40377  -4.69848  1.000 79.52137  ? 63  ARG Z O   1 
ATOM   2433 C  CB  . ARG C 3 63  ? 36.58141 44.34403  -4.00399  1.000 85.48302  ? 63  ARG Z CB  1 
ATOM   2434 C  CG  . ARG C 3 63  ? 36.02381 44.30124  -5.41743  1.000 87.96069  ? 63  ARG Z CG  1 
ATOM   2435 C  CD  . ARG C 3 63  ? 34.50707 44.36297  -5.43191  1.000 91.48778  ? 63  ARG Z CD  1 
ATOM   2436 N  NE  . ARG C 3 63  ? 33.99814 43.96263  -6.73801  1.000 96.86974  ? 63  ARG Z NE  1 
ATOM   2437 C  CZ  . ARG C 3 63  ? 32.73152 44.07674  -7.12370  1.000 100.44928 ? 63  ARG Z CZ  1 
ATOM   2438 N  NH1 . ARG C 3 63  ? 31.82242 44.59598  -6.30326  1.000 102.61706 ? 63  ARG Z NH1 1 
ATOM   2439 N  NH2 . ARG C 3 63  ? 32.37516 43.67682  -8.33774  1.000 100.66674 ? 63  ARG Z NH2 1 
ATOM   2440 N  N   . GLU C 3 64  ? 37.67261 41.13397  -3.68639  1.000 80.89057  ? 64  GLU Z N   1 
ATOM   2441 C  CA  . GLU C 3 64  ? 38.09669 40.02503  -4.52497  1.000 79.07013  ? 64  GLU Z CA  1 
ATOM   2442 C  C   . GLU C 3 64  ? 37.56787 38.66711  -4.07538  1.000 76.61852  ? 64  GLU Z C   1 
ATOM   2443 O  O   . GLU C 3 64  ? 37.63675 37.70629  -4.85288  1.000 77.55742  ? 64  GLU Z O   1 
ATOM   2444 C  CB  . GLU C 3 64  ? 39.62720 39.97899  -4.58701  1.000 81.20605  ? 64  GLU Z CB  1 
ATOM   2445 C  CG  . GLU C 3 64  ? 40.29059 41.25652  -5.10856  1.000 87.38648  ? 64  GLU Z CG  1 
ATOM   2446 C  CD  . GLU C 3 64  ? 40.43824 42.35451  -4.05712  1.000 91.97358  ? 64  GLU Z CD  1 
ATOM   2447 O  OE1 . GLU C 3 64  ? 39.78118 42.27226  -2.99692  1.000 93.78928  ? 64  GLU Z OE1 1 
ATOM   2448 O  OE2 . GLU C 3 64  ? 41.22577 43.30079  -4.29006  1.000 93.24721  ? 64  GLU Z OE2 1 
ATOM   2449 N  N   . ILE C 3 65  ? 37.05774 38.54684  -2.85592  1.000 75.53240  ? 65  ILE Z N   1 
ATOM   2450 C  CA  . ILE C 3 65  ? 36.75430 37.24741  -2.27219  1.000 72.96916  ? 65  ILE Z CA  1 
ATOM   2451 C  C   . ILE C 3 65  ? 35.26512 37.17479  -1.94944  1.000 72.96329  ? 65  ILE Z C   1 
ATOM   2452 O  O   . ILE C 3 65  ? 34.78489 37.91593  -1.08255  1.000 70.28740  ? 65  ILE Z O   1 
ATOM   2453 C  CB  . ILE C 3 65  ? 37.58885 36.98009  -1.00821  1.000 70.44508  ? 65  ILE Z CB  1 
ATOM   2454 C  CG1 . ILE C 3 65  ? 39.07491 37.25323  -1.25673  1.000 68.75770  ? 65  ILE Z CG1 1 
ATOM   2455 C  CG2 . ILE C 3 65  ? 37.39437 35.55722  -0.56558  1.000 70.19630  ? 65  ILE Z CG2 1 
ATOM   2456 C  CD1 . ILE C 3 65  ? 39.64231 36.52563  -2.45144  1.000 68.46202  ? 65  ILE Z CD1 1 
ATOM   2457 N  N   . PRO C 3 66  ? 34.50546 36.27696  -2.57894  1.000 75.28285  ? 66  PRO Z N   1 
ATOM   2458 C  CA  . PRO C 3 66  ? 33.09262 36.12854  -2.22600  1.000 75.84690  ? 66  PRO Z CA  1 
ATOM   2459 C  C   . PRO C 3 66  ? 32.93465 35.53918  -0.83507  1.000 76.95219  ? 66  PRO Z C   1 
ATOM   2460 O  O   . PRO C 3 66  ? 33.90501 35.13649  -0.18334  1.000 78.13601  ? 66  PRO Z O   1 
ATOM   2461 C  CB  . PRO C 3 66  ? 32.53626 35.17601  -3.29907  1.000 75.18642  ? 66  PRO Z CB  1 
ATOM   2462 C  CG  . PRO C 3 66  ? 33.57594 35.14139  -4.37186  1.000 76.60081  ? 66  PRO Z CG  1 
ATOM   2463 C  CD  . PRO C 3 66  ? 34.88688 35.40163  -3.69705  1.000 76.83005  ? 66  PRO Z CD  1 
ATOM   2464 N  N   . SER C 3 67  ? 31.69236 35.48196  -0.37787  1.000 76.36333  ? 67  SER Z N   1 
ATOM   2465 C  CA  . SER C 3 67  ? 31.46024 35.12333  1.01588   1.000 76.41578  ? 67  SER Z CA  1 
ATOM   2466 C  C   . SER C 3 67  ? 31.62698 33.62678  1.23952   1.000 79.78732  ? 67  SER Z C   1 
ATOM   2467 O  O   . SER C 3 67  ? 32.14372 33.20717  2.28422   1.000 81.08909  ? 67  SER Z O   1 
ATOM   2468 C  CB  . SER C 3 67  ? 30.08761 35.58868  1.46421   1.000 77.11805  ? 67  SER Z CB  1 
ATOM   2469 O  OG  . SER C 3 67  ? 29.09488 35.10286  0.58865   1.000 79.27473  ? 67  SER Z OG  1 
ATOM   2470 N  N   . HIS C 3 68  ? 31.17132 32.79851  0.29677   1.000 79.35228  ? 68  HIS Z N   1 
ATOM   2471 C  CA  . HIS C 3 68  ? 31.31367 31.36429  0.51233   1.000 76.85836  ? 68  HIS Z CA  1 
ATOM   2472 C  C   . HIS C 3 68  ? 32.77539 30.95574  0.48873   1.000 77.05149  ? 68  HIS Z C   1 
ATOM   2473 O  O   . HIS C 3 68  ? 33.16651 30.02447  1.19960   1.000 80.01780  ? 68  HIS Z O   1 
ATOM   2474 C  CB  . HIS C 3 68  ? 30.52151 30.57122  -0.52922  1.000 75.81761  ? 68  HIS Z CB  1 
ATOM   2475 C  CG  . HIS C 3 68  ? 31.11590 30.59630  -1.90436  1.000 77.24407  ? 68  HIS Z CG  1 
ATOM   2476 N  ND1 . HIS C 3 68  ? 30.74184 31.51672  -2.86280  1.000 78.35632  ? 68  HIS Z ND1 1 
ATOM   2477 C  CD2 . HIS C 3 68  ? 32.04957 29.80632  -2.48605  1.000 78.85674  ? 68  HIS Z CD2 1 
ATOM   2478 C  CE1 . HIS C 3 68  ? 31.42417 31.29720  -3.97241  1.000 78.94643  ? 68  HIS Z CE1 1 
ATOM   2479 N  NE2 . HIS C 3 68  ? 32.22561 30.26604  -3.76962  1.000 81.21426  ? 68  HIS Z NE2 1 
ATOM   2480 N  N   . VAL C 3 69  ? 33.60979 31.69153  -0.24309  1.000 75.74450  ? 69  VAL Z N   1 
ATOM   2481 C  CA  . VAL C 3 69  ? 35.04166 31.42756  -0.20298  1.000 75.32496  ? 69  VAL Z CA  1 
ATOM   2482 C  C   . VAL C 3 69  ? 35.65754 32.00262  1.06387   1.000 81.45157  ? 69  VAL Z C   1 
ATOM   2483 O  O   . VAL C 3 69  ? 36.44667 31.33879  1.74341   1.000 84.63374  ? 69  VAL Z O   1 
ATOM   2484 C  CB  . VAL C 3 69  ? 35.73021 31.98598  -1.45690  1.000 71.81769  ? 69  VAL Z CB  1 
ATOM   2485 C  CG1 . VAL C 3 69  ? 37.21976 31.80468  -1.32143  1.000 70.40010  ? 69  VAL Z CG1 1 
ATOM   2486 C  CG2 . VAL C 3 69  ? 35.22424 31.27904  -2.69270  1.000 70.58006  ? 69  VAL Z CG2 1 
ATOM   2487 N  N   . LEU C 3 70  ? 35.31093 33.24778  1.39960   1.000 82.45976  ? 70  LEU Z N   1 
ATOM   2488 C  CA  . LEU C 3 70  ? 35.87913 33.87251  2.58711   1.000 83.59605  ? 70  LEU Z CA  1 
ATOM   2489 C  C   . LEU C 3 70  ? 35.49378 33.12409  3.85489   1.000 86.03616  ? 70  LEU Z C   1 
ATOM   2490 O  O   . LEU C 3 70  ? 36.25707 33.12153  4.82700   1.000 87.82062  ? 70  LEU Z O   1 
ATOM   2491 C  CB  . LEU C 3 70  ? 35.43663 35.32985  2.67868   1.000 81.59179  ? 70  LEU Z CB  1 
ATOM   2492 C  CG  . LEU C 3 70  ? 36.20257 36.16679  3.70120   1.000 82.84260  ? 70  LEU Z CG  1 
ATOM   2493 C  CD1 . LEU C 3 70  ? 37.68625 36.02056  3.44354   1.000 84.67059  ? 70  LEU Z CD1 1 
ATOM   2494 C  CD2 . LEU C 3 70  ? 35.79439 37.62908  3.62841   1.000 83.06199  ? 70  LEU Z CD2 1 
ATOM   2495 N  N   . SER C 3 71  ? 34.32214 32.48552  3.87028   1.000 87.15584  ? 71  SER Z N   1 
ATOM   2496 C  CA  . SER C 3 71  ? 33.93571 31.69074  5.03138   1.000 88.40263  ? 71  SER Z CA  1 
ATOM   2497 C  C   . SER C 3 71  ? 34.82506 30.46397  5.17769   1.000 87.57627  ? 71  SER Z C   1 
ATOM   2498 O  O   . SER C 3 71  ? 35.17605 30.07801  6.29799   1.000 87.12287  ? 71  SER Z O   1 
ATOM   2499 C  CB  . SER C 3 71  ? 32.46957 31.29384  4.92009   1.000 89.45771  ? 71  SER Z CB  1 
ATOM   2500 O  OG  . SER C 3 71  ? 32.26839 30.52639  3.74861   1.000 91.99410  ? 71  SER Z OG  1 
ATOM   2501 N  N   . LYS C 3 72  ? 35.15518 29.80681  4.05910   1.000 87.61046  ? 72  LYS Z N   1 
ATOM   2502 C  CA  . LYS C 3 72  ? 36.11207 28.70387  4.10742   1.000 87.73275  ? 72  LYS Z CA  1 
ATOM   2503 C  C   . LYS C 3 72  ? 37.47468 29.18753  4.57645   1.000 85.85878  ? 72  LYS Z C   1 
ATOM   2504 O  O   . LYS C 3 72  ? 38.12855 28.52816  5.39195   1.000 91.22335  ? 72  LYS Z O   1 
ATOM   2505 C  CB  . LYS C 3 72  ? 36.24466 28.04120  2.73433   1.000 92.00184  ? 72  LYS Z CB  1 
ATOM   2506 C  CG  . LYS C 3 72  ? 35.23865 26.93940  2.43689   1.000 93.52090  ? 72  LYS Z CG  1 
ATOM   2507 C  CD  . LYS C 3 72  ? 35.52812 25.65937  3.20974   1.000 92.16559  ? 72  LYS Z CD  1 
ATOM   2508 C  CE  . LYS C 3 72  ? 34.52631 24.58356  2.82641   1.000 90.47166  ? 72  LYS Z CE  1 
ATOM   2509 N  NZ  . LYS C 3 72  ? 34.73573 23.34650  3.61071   1.000 91.34847  ? 72  LYS Z NZ  1 
ATOM   2510 N  N   . VAL C 3 73  ? 37.92408 30.33257  4.06094   1.000 81.68650  ? 73  VAL Z N   1 
ATOM   2511 C  CA  . VAL C 3 73  ? 39.22917 30.86061  4.44496   1.000 78.25661  ? 73  VAL Z CA  1 
ATOM   2512 C  C   . VAL C 3 73  ? 39.29431 31.09845  5.95173   1.000 75.36168  ? 73  VAL Z C   1 
ATOM   2513 O  O   . VAL C 3 73  ? 40.28458 30.75034  6.60004   1.000 72.70894  ? 73  VAL Z O   1 
ATOM   2514 C  CB  . VAL C 3 73  ? 39.54882 32.13310  3.63609   1.000 77.84134  ? 73  VAL Z CB  1 
ATOM   2515 C  CG1 . VAL C 3 73  ? 40.84450 32.76351  4.10720   1.000 76.23019  ? 73  VAL Z CG1 1 
ATOM   2516 C  CG2 . VAL C 3 73  ? 39.64609 31.80008  2.14861   1.000 78.19096  ? 73  VAL Z CG2 1 
ATOM   2517 N  N   . CYS C 3 74  ? 38.24271 31.68165  6.53753   1.000 77.86856  ? 74  CYS Z N   1 
ATOM   2518 C  CA  . CYS C 3 74  ? 38.28037 31.98104  7.96861   1.000 83.22460  ? 74  CYS Z CA  1 
ATOM   2519 C  C   . CYS C 3 74  ? 38.32647 30.71987  8.81397   1.000 84.16175  ? 74  CYS Z C   1 
ATOM   2520 O  O   . CYS C 3 74  ? 38.93182 30.71993  9.89486   1.000 85.05038  ? 74  CYS Z O   1 
ATOM   2521 C  CB  . CYS C 3 74  ? 37.08981 32.83783  8.37569   1.000 89.83240  ? 74  CYS Z CB  1 
ATOM   2522 S  SG  . CYS C 3 74  ? 37.19959 34.52158  7.76280   1.000 102.57229 ? 74  CYS Z SG  1 
ATOM   2523 N  N   . MET C 3 75  ? 37.67106 29.65075  8.36514   1.000 82.20403  ? 75  MET Z N   1 
ATOM   2524 C  CA  . MET C 3 75  ? 37.83019 28.38010  9.05323   1.000 78.95714  ? 75  MET Z CA  1 
ATOM   2525 C  C   . MET C 3 75  ? 39.28010 27.92994  8.98586   1.000 75.02048  ? 75  MET Z C   1 
ATOM   2526 O  O   . MET C 3 75  ? 39.87181 27.55701  10.00560  1.000 75.19868  ? 75  MET Z O   1 
ATOM   2527 C  CB  . MET C 3 75  ? 36.90537 27.33464  8.44142   1.000 80.48413  ? 75  MET Z CB  1 
ATOM   2528 C  CG  . MET C 3 75  ? 35.44782 27.71564  8.50914   1.000 81.38122  ? 75  MET Z CG  1 
ATOM   2529 S  SD  . MET C 3 75  ? 34.49177 26.53768  7.55984   1.000 80.95511  ? 75  MET Z SD  1 
ATOM   2530 C  CE  . MET C 3 75  ? 32.84463 27.21822  7.72752   1.000 79.32757  ? 75  MET Z CE  1 
ATOM   2531 N  N   . TYR C 3 76  ? 39.89531 28.04785  7.80721   1.000 72.53237  ? 76  TYR Z N   1 
ATOM   2532 C  CA  . TYR C 3 76  ? 41.29670 27.68167  7.67568   1.000 74.63837  ? 76  TYR Z CA  1 
ATOM   2533 C  C   . TYR C 3 76  ? 42.17354 28.39114  8.70717   1.000 78.09843  ? 76  TYR Z C   1 
ATOM   2534 O  O   . TYR C 3 76  ? 43.13923 27.80193  9.19990   1.000 81.84869  ? 76  TYR Z O   1 
ATOM   2535 C  CB  . TYR C 3 76  ? 41.79731 27.99322  6.26401   1.000 75.88756  ? 76  TYR Z CB  1 
ATOM   2536 C  CG  . TYR C 3 76  ? 43.25050 27.64250  6.08223   1.000 78.04476  ? 76  TYR Z CG  1 
ATOM   2537 C  CD1 . TYR C 3 76  ? 43.62919 26.34661  5.76083   1.000 77.68876  ? 76  TYR Z CD1 1 
ATOM   2538 C  CD2 . TYR C 3 76  ? 44.24295 28.58632  6.28836   1.000 78.38994  ? 76  TYR Z CD2 1 
ATOM   2539 C  CE1 . TYR C 3 76  ? 44.95020 26.01419  5.61537   1.000 78.86743  ? 76  TYR Z CE1 1 
ATOM   2540 C  CE2 . TYR C 3 76  ? 45.57058 28.25673  6.14980   1.000 80.35203  ? 76  TYR Z CE2 1 
ATOM   2541 C  CZ  . TYR C 3 76  ? 45.91853 26.97050  5.81299   1.000 81.28062  ? 76  TYR Z CZ  1 
ATOM   2542 O  OH  . TYR C 3 76  ? 47.24758 26.64811  5.67317   1.000 85.16515  ? 76  TYR Z OH  1 
ATOM   2543 N  N   . PHE C 3 77  ? 41.85760 29.63723  9.06561   1.000 79.57921  ? 77  PHE Z N   1 
ATOM   2544 C  CA  . PHE C 3 77  ? 42.64623 30.32088  10.09116  1.000 82.66948  ? 77  PHE Z CA  1 
ATOM   2545 C  C   . PHE C 3 77  ? 42.56712 29.57050  11.41505  1.000 91.11034  ? 77  PHE Z C   1 
ATOM   2546 O  O   . PHE C 3 77  ? 43.59071 29.17581  11.98339  1.000 95.28246  ? 77  PHE Z O   1 
ATOM   2547 C  CB  . PHE C 3 77  ? 42.17869 31.77060  10.26217  1.000 73.58879  ? 77  PHE Z CB  1 
ATOM   2548 C  CG  . PHE C 3 77  ? 42.44710 32.64150  9.06174   1.000 67.02657  ? 77  PHE Z CG  1 
ATOM   2549 C  CD1 . PHE C 3 77  ? 43.31193 32.22840  8.06273   1.000 63.90765  ? 77  PHE Z CD1 1 
ATOM   2550 C  CD2 . PHE C 3 77  ? 41.76311 33.83623  8.88930   1.000 63.18547  ? 77  PHE Z CD2 1 
ATOM   2551 C  CE1 . PHE C 3 77  ? 43.52947 33.00280  6.94628   1.000 58.86494  ? 77  PHE Z CE1 1 
ATOM   2552 C  CE2 . PHE C 3 77  ? 41.97254 34.62106  7.76486   1.000 60.59931  ? 77  PHE Z CE2 1 
ATOM   2553 C  CZ  . PHE C 3 77  ? 42.85481 34.20480  6.79352   1.000 60.30039  ? 77  PHE Z CZ  1 
ATOM   2554 N  N   . THR C 3 78  ? 41.34638 29.37045  11.92591  1.000 96.71589  ? 78  THR Z N   1 
ATOM   2555 C  CA  . THR C 3 78  ? 41.16936 28.68447  13.20492  1.000 103.08379 ? 78  THR Z CA  1 
ATOM   2556 C  C   . THR C 3 78  ? 41.65229 27.23770  13.13295  1.000 104.43850 ? 78  THR Z C   1 
ATOM   2557 O  O   . THR C 3 78  ? 42.04015 26.65417  14.15410  1.000 105.19319 ? 78  THR Z O   1 
ATOM   2558 C  CB  . THR C 3 78  ? 39.69949 28.77226  13.64012  1.000 107.63039 ? 78  THR Z CB  1 
ATOM   2559 O  OG1 . THR C 3 78  ? 38.86535 28.08028  12.70461  1.000 109.53423 ? 78  THR Z OG1 1 
ATOM   2560 C  CG2 . THR C 3 78  ? 39.24422 30.24810  13.69757  1.000 108.06915 ? 78  THR Z CG2 1 
ATOM   2561 N  N   . TYR C 3 79  ? 41.66358 26.65638  11.93121  1.000 101.47201 ? 79  TYR Z N   1 
ATOM   2562 C  CA  . TYR C 3 79  ? 42.16790 25.29786  11.75258  1.000 95.16367  ? 79  TYR Z CA  1 
ATOM   2563 C  C   . TYR C 3 79  ? 43.68884 25.25634  11.84064  1.000 92.66523  ? 79  TYR Z C   1 
ATOM   2564 O  O   . TYR C 3 79  ? 44.25530 24.34823  12.45294  1.000 93.42858  ? 79  TYR Z O   1 
ATOM   2565 C  CB  . TYR C 3 79  ? 41.67183 24.77123  10.40513  1.000 91.91793  ? 79  TYR Z CB  1 
ATOM   2566 C  CG  . TYR C 3 79  ? 42.28609 23.49480  9.88496   1.000 90.70973  ? 79  TYR Z CG  1 
ATOM   2567 C  CD1 . TYR C 3 79  ? 41.75684 22.25828  10.22593  1.000 91.40033  ? 79  TYR Z CD1 1 
ATOM   2568 C  CD2 . TYR C 3 79  ? 43.35593 23.52596  8.99923   1.000 89.60051  ? 79  TYR Z CD2 1 
ATOM   2569 C  CE1 . TYR C 3 79  ? 42.29542 21.08453  9.72707   1.000 91.66315  ? 79  TYR Z CE1 1 
ATOM   2570 C  CE2 . TYR C 3 79  ? 43.90450 22.36017  8.49271   1.000 89.86610  ? 79  TYR Z CE2 1 
ATOM   2571 C  CZ  . TYR C 3 79  ? 43.36809 21.14136  8.86113   1.000 91.25377  ? 79  TYR Z CZ  1 
ATOM   2572 O  OH  . TYR C 3 79  ? 43.89848 19.97233  8.36787   1.000 91.86860  ? 79  TYR Z OH  1 
ATOM   2573 N  N   . LYS C 3 80  ? 44.36799 26.25002  11.26848  1.000 91.97270  ? 80  LYS Z N   1 
ATOM   2574 C  CA  . LYS C 3 80  ? 45.82545 26.25642  11.31523  1.000 92.62648  ? 80  LYS Z CA  1 
ATOM   2575 C  C   . LYS C 3 80  ? 46.35058 26.63260  12.69965  1.000 96.63985  ? 80  LYS Z C   1 
ATOM   2576 O  O   . LYS C 3 80  ? 47.46249 26.23494  13.06581  1.000 98.66086  ? 80  LYS Z O   1 
ATOM   2577 C  CB  . LYS C 3 80  ? 46.38844 27.18213  10.24428  1.000 90.55554  ? 80  LYS Z CB  1 
ATOM   2578 C  CG  . LYS C 3 80  ? 47.88475 27.38442  10.33914  1.000 90.89250  ? 80  LYS Z CG  1 
ATOM   2579 C  CD  . LYS C 3 80  ? 48.43584 27.94895  9.05766   1.000 91.27796  ? 80  LYS Z CD  1 
ATOM   2580 C  CE  . LYS C 3 80  ? 49.93379 28.15477  9.15223   1.000 93.65726  ? 80  LYS Z CE  1 
ATOM   2581 N  NZ  . LYS C 3 80  ? 50.63175 26.87725  9.43647   1.000 95.43239  ? 80  LYS Z NZ  1 
ATOM   2582 N  N   . VAL C 3 81  ? 45.57965 27.37971  13.48992  1.000 97.28139  ? 81  VAL Z N   1 
ATOM   2583 C  CA  . VAL C 3 81  ? 46.08993 27.80217  14.79162  1.000 99.00639  ? 81  VAL Z CA  1 
ATOM   2584 C  C   . VAL C 3 81  ? 46.07232 26.65047  15.79832  1.000 101.21093 ? 81  VAL Z C   1 
ATOM   2585 O  O   . VAL C 3 81  ? 46.95814 26.55999  16.65855  1.000 100.86730 ? 81  VAL Z O   1 
ATOM   2586 C  CB  . VAL C 3 81  ? 45.29968 29.02244  15.30349  1.000 95.45158  ? 81  VAL Z CB  1 
ATOM   2587 C  CG1 . VAL C 3 81  ? 45.83231 29.48496  16.65494  1.000 98.35154  ? 81  VAL Z CG1 1 
ATOM   2588 C  CG2 . VAL C 3 81  ? 45.38227 30.15067  14.31038  1.000 92.74609  ? 81  VAL Z CG2 1 
ATOM   2589 N  N   . ARG C 3 82  ? 45.07329 25.75626  15.72812  1.000 103.87868 ? 82  ARG Z N   1 
ATOM   2590 C  CA  . ARG C 3 82  ? 45.02487 24.66885  16.70531  1.000 107.08169 ? 82  ARG Z CA  1 
ATOM   2591 C  C   . ARG C 3 82  ? 46.03264 23.57403  16.37536  1.000 105.48694 ? 82  ARG Z C   1 
ATOM   2592 O  O   . ARG C 3 82  ? 46.89002 23.23939  17.19996  1.000 103.78531 ? 82  ARG Z O   1 
ATOM   2593 C  CB  . ARG C 3 82  ? 43.61930 24.06111  16.80963  1.000 110.33782 ? 82  ARG Z CB  1 
ATOM   2594 C  CG  . ARG C 3 82  ? 43.59589 22.84003  17.76021  1.000 114.96239 ? 82  ARG Z CG  1 
ATOM   2595 C  CD  . ARG C 3 82  ? 42.20281 22.25341  18.04992  1.000 117.92262 ? 82  ARG Z CD  1 
ATOM   2596 N  NE  . ARG C 3 82  ? 42.28564 21.11579  18.97588  1.000 121.13976 ? 82  ARG Z NE  1 
ATOM   2597 C  CZ  . ARG C 3 82  ? 41.26002 20.34211  19.33691  1.000 121.49191 ? 82  ARG Z CZ  1 
ATOM   2598 N  NH1 . ARG C 3 82  ? 40.04039 20.56173  18.85928  1.000 119.63081 ? 82  ARG Z NH1 1 
ATOM   2599 N  NH2 . ARG C 3 82  ? 41.45708 19.33706  20.18271  1.000 122.21818 ? 82  ARG Z NH2 1 
ATOM   2600 N  N   . TYR C 3 83  ? 45.98032 23.04391  15.16064  1.000 100.56622 ? 83  TYR Z N   1 
ATOM   2601 C  CA  . TYR C 3 83  ? 46.76693 21.86573  14.79623  1.000 101.50469 ? 83  TYR Z CA  1 
ATOM   2602 C  C   . TYR C 3 83  ? 48.09261 22.25718  14.15861  1.000 107.46953 ? 83  TYR Z C   1 
ATOM   2603 O  O   . TYR C 3 83  ? 48.43099 21.78692  13.07519  1.000 107.74775 ? 83  TYR Z O   1 
ATOM   2604 C  CB  . TYR C 3 83  ? 45.96397 20.97489  13.85347  1.000 101.05275 ? 83  TYR Z CB  1 
ATOM   2605 C  CG  . TYR C 3 83  ? 44.60500 20.54864  14.36844  1.000 103.45807 ? 83  TYR Z CG  1 
ATOM   2606 C  CD1 . TYR C 3 83  ? 44.48518 19.69920  15.46362  1.000 105.58960 ? 83  TYR Z CD1 1 
ATOM   2607 C  CD2 . TYR C 3 83  ? 43.43764 20.98893  13.75600  1.000 104.26703 ? 83  TYR Z CD2 1 
ATOM   2608 C  CE1 . TYR C 3 83  ? 43.23314 19.30035  15.93801  1.000 106.61602 ? 83  TYR Z CE1 1 
ATOM   2609 C  CE2 . TYR C 3 83  ? 42.18360 20.59975  14.22212  1.000 105.89386 ? 83  TYR Z CE2 1 
ATOM   2610 C  CZ  . TYR C 3 83  ? 42.08502 19.75531  15.31347  1.000 106.61805 ? 83  TYR Z CZ  1 
ATOM   2611 O  OH  . TYR C 3 83  ? 40.83984 19.36771  15.77412  1.000 105.96121 ? 83  TYR Z OH  1 
ATOM   2612 N  N   . THR C 3 84  ? 48.85274 23.14095  14.80252  1.000 110.25710 ? 84  THR Z N   1 
ATOM   2613 C  CA  . THR C 3 84  ? 50.13097 23.59201  14.25942  1.000 118.50906 ? 84  THR Z CA  1 
ATOM   2614 C  C   . THR C 3 84  ? 51.33656 23.05646  15.02899  1.000 128.13642 ? 84  THR Z C   1 
ATOM   2615 O  O   . THR C 3 84  ? 52.36015 22.74007  14.41501  1.000 132.95645 ? 84  THR Z O   1 
ATOM   2616 C  CB  . THR C 3 84  ? 50.16242 25.13147  14.18695  1.000 108.59640 ? 84  THR Z CB  1 
ATOM   2617 O  OG1 . THR C 3 84  ? 51.30592 25.56854  13.44039  1.000 106.53605 ? 84  THR Z OG1 1 
ATOM   2618 C  CG2 . THR C 3 84  ? 50.17160 25.76524  15.57823  1.000 107.43325 ? 84  THR Z CG2 1 
ATOM   2619 N  N   . ASN C 3 85  ? 51.23667 22.92284  16.36118  1.000 134.83121 ? 85  ASN Z N   1 
ATOM   2620 C  CA  . ASN C 3 85  ? 52.28591 22.33215  17.18647  1.000 137.04585 ? 85  ASN Z CA  1 
ATOM   2621 C  C   . ASN C 3 85  ? 51.91552 20.95726  17.72351  1.000 141.80548 ? 85  ASN Z C   1 
ATOM   2622 O  O   . ASN C 3 85  ? 52.76947 20.29241  18.32440  1.000 146.46043 ? 85  ASN Z O   1 
ATOM   2623 C  CB  . ASN C 3 85  ? 52.61749 23.24588  18.37884  1.000 136.47708 ? 85  ASN Z CB  1 
ATOM   2624 C  CG  . ASN C 3 85  ? 52.76319 24.70144  17.98036  1.000 134.61236 ? 85  ASN Z CG  1 
ATOM   2625 O  OD1 . ASN C 3 85  ? 53.43186 25.02146  17.00054  1.000 136.15661 ? 85  ASN Z OD1 1 
ATOM   2626 N  ND2 . ASN C 3 85  ? 52.13185 25.59181  18.73913  1.000 135.67000 ? 85  ASN Z ND2 1 
ATOM   2627 N  N   . SER C 3 86  ? 50.67225 20.52100  17.53436  1.000 139.46314 ? 86  SER Z N   1 
ATOM   2628 C  CA  . SER C 3 86  ? 50.21950 19.21823  18.00179  1.000 139.79952 ? 86  SER Z CA  1 
ATOM   2629 C  C   . SER C 3 86  ? 50.56029 18.16083  16.96041  1.000 139.28660 ? 86  SER Z C   1 
ATOM   2630 O  O   . SER C 3 86  ? 50.05062 18.20733  15.83462  1.000 138.96579 ? 86  SER Z O   1 
ATOM   2631 C  CB  . SER C 3 86  ? 48.71597 19.23150  18.27212  1.000 139.93749 ? 86  SER Z CB  1 
ATOM   2632 O  OG  . SER C 3 86  ? 48.26728 17.94440  18.65735  1.000 140.96139 ? 86  SER Z OG  1 
ATOM   2633 N  N   . SER C 3 87  ? 51.41262 17.20559  17.33816  1.000 142.96275 ? 87  SER Z N   1 
ATOM   2634 C  CA  . SER C 3 87  ? 51.76320 16.09282  16.46220  1.000 146.74271 ? 87  SER Z CA  1 
ATOM   2635 C  C   . SER C 3 87  ? 50.74833 14.96735  16.53986  1.000 146.91689 ? 87  SER Z C   1 
ATOM   2636 O  O   . SER C 3 87  ? 51.03009 13.85439  16.07540  1.000 153.36375 ? 87  SER Z O   1 
ATOM   2637 C  CB  . SER C 3 87  ? 53.16050 15.56801  16.80420  1.000 141.04523 ? 87  SER Z CB  1 
ATOM   2638 O  OG  . SER C 3 87  ? 54.14361 16.58612  16.68461  1.000 139.15706 ? 87  SER Z OG  1 
ATOM   2639 N  N   . THR C 3 88  ? 49.59464 15.24674  17.14928  1.000 142.15694 ? 88  THR Z N   1 
ATOM   2640 C  CA  . THR C 3 88  ? 48.43243 14.37075  17.13304  1.000 139.05995 ? 88  THR Z CA  1 
ATOM   2641 C  C   . THR C 3 88  ? 47.86797 14.29285  15.71509  1.000 137.18364 ? 88  THR Z C   1 
ATOM   2642 O  O   . THR C 3 88  ? 48.38137 14.90624  14.77228  1.000 135.94559 ? 88  THR Z O   1 
ATOM   2643 C  CB  . THR C 3 88  ? 47.37368 14.86609  18.12215  1.000 137.58345 ? 88  THR Z CB  1 
ATOM   2644 O  OG1 . THR C 3 88  ? 46.87990 16.14873  17.71218  1.000 136.81410 ? 88  THR Z OG1 1 
ATOM   2645 C  CG2 . THR C 3 88  ? 47.95445 14.97803  19.53158  1.000 136.41608 ? 88  THR Z CG2 1 
ATOM   2646 N  N   . GLU C 3 89  ? 46.78661 13.53879  15.56322  1.000 130.41467 ? 89  GLU Z N   1 
ATOM   2647 C  CA  . GLU C 3 89  ? 46.18813 13.37772  14.24827  1.000 125.23264 ? 89  GLU Z CA  1 
ATOM   2648 C  C   . GLU C 3 89  ? 45.67876 14.71676  13.73565  1.000 118.96546 ? 89  GLU Z C   1 
ATOM   2649 O  O   . GLU C 3 89  ? 44.83797 15.35734  14.37639  1.000 118.86147 ? 89  GLU Z O   1 
ATOM   2650 C  CB  . GLU C 3 89  ? 45.04675 12.36655  14.31066  1.000 124.54808 ? 89  GLU Z CB  1 
ATOM   2651 C  CG  . GLU C 3 89  ? 44.43123 12.07997  12.96424  1.000 125.30250 ? 89  GLU Z CG  1 
ATOM   2652 C  CD  . GLU C 3 89  ? 43.89673 10.67102  12.86101  1.000 127.31098 ? 89  GLU Z CD  1 
ATOM   2653 O  OE1 . GLU C 3 89  ? 43.13044 10.40444  11.91231  1.000 129.69975 ? 89  GLU Z OE1 1 
ATOM   2654 O  OE2 . GLU C 3 89  ? 44.24987 9.82938   13.71764  1.000 128.13265 ? 89  GLU Z OE2 1 
ATOM   2655 N  N   . ILE C 3 90  ? 46.21996 15.15480  12.59997  1.000 112.93841 ? 90  ILE Z N   1 
ATOM   2656 C  CA  . ILE C 3 90  ? 45.81499 16.41809  11.98561  1.000 104.69014 ? 90  ILE Z CA  1 
ATOM   2657 C  C   . ILE C 3 90  ? 44.58236 16.14158  11.13375  1.000 101.19091 ? 90  ILE Z C   1 
ATOM   2658 O  O   . ILE C 3 90  ? 44.66628 15.39876  10.14320  1.000 101.12226 ? 90  ILE Z O   1 
ATOM   2659 C  CB  . ILE C 3 90  ? 46.95034 17.03256  11.15275  1.000 101.37536 ? 90  ILE Z CB  1 
ATOM   2660 C  CG1 . ILE C 3 90  ? 48.19260 17.24601  12.01454  1.000 99.07200  ? 90  ILE Z CG1 1 
ATOM   2661 C  CG2 . ILE C 3 90  ? 46.52015 18.34252  10.54372  1.000 100.05471 ? 90  ILE Z CG2 1 
ATOM   2662 C  CD1 . ILE C 3 90  ? 49.36493 17.82009  11.24995  1.000 97.61325  ? 90  ILE Z CD1 1 
ATOM   2663 N  N   . PRO C 3 91  ? 43.43634 16.73388  11.45295  1.000 96.77122  ? 91  PRO Z N   1 
ATOM   2664 C  CA  . PRO C 3 91  ? 42.20258 16.36355  10.75108  1.000 97.29909  ? 91  PRO Z CA  1 
ATOM   2665 C  C   . PRO C 3 91  ? 42.16102 16.90347  9.32646   1.000 101.11767 ? 91  PRO Z C   1 
ATOM   2666 O  O   . PRO C 3 91  ? 42.70187 17.96841  9.01718   1.000 103.21761 ? 91  PRO Z O   1 
ATOM   2667 C  CB  . PRO C 3 91  ? 41.09782 16.97744  11.62344  1.000 94.20794  ? 91  PRO Z CB  1 
ATOM   2668 C  CG  . PRO C 3 91  ? 41.76937 17.28614  12.95517  1.000 92.08945  ? 91  PRO Z CG  1 
ATOM   2669 C  CD  . PRO C 3 91  ? 43.18168 17.61079  12.60780  1.000 93.09423  ? 91  PRO Z CD  1 
ATOM   2670 N  N   . GLU C 3 92  ? 41.51521 16.13563  8.45104   1.000 102.89350 ? 92  GLU Z N   1 
ATOM   2671 C  CA  . GLU C 3 92  ? 41.35641 16.54005  7.06102   1.000 106.80609 ? 92  GLU Z CA  1 
ATOM   2672 C  C   . GLU C 3 92  ? 40.54384 17.82940  6.96900   1.000 109.37475 ? 92  GLU Z C   1 
ATOM   2673 O  O   . GLU C 3 92  ? 39.60807 18.05055  7.74437   1.000 110.55689 ? 92  GLU Z O   1 
ATOM   2674 C  CB  . GLU C 3 92  ? 40.66974 15.41995  6.27090   1.000 110.13614 ? 92  GLU Z CB  1 
ATOM   2675 C  CG  . GLU C 3 92  ? 40.22643 15.80661  4.86322   1.000 113.17425 ? 92  GLU Z CG  1 
ATOM   2676 C  CD  . GLU C 3 92  ? 39.27532 14.79421  4.24184   1.000 115.60598 ? 92  GLU Z CD  1 
ATOM   2677 O  OE1 . GLU C 3 92  ? 39.74784 13.89182  3.51692   1.000 118.05896 ? 92  GLU Z OE1 1 
ATOM   2678 O  OE2 . GLU C 3 92  ? 38.05239 14.89947  4.48265   1.000 115.83870 ? 92  GLU Z OE2 1 
ATOM   2679 N  N   . PHE C 3 93  ? 40.92162 18.69588  6.02207   1.000 110.50943 ? 93  PHE Z N   1 
ATOM   2680 C  CA  . PHE C 3 93  ? 40.22928 19.95741  5.79360   1.000 108.73753 ? 93  PHE Z CA  1 
ATOM   2681 C  C   . PHE C 3 93  ? 39.28122 19.80769  4.61109   1.000 109.49140 ? 93  PHE Z C   1 
ATOM   2682 O  O   . PHE C 3 93  ? 39.74881 19.69828  3.46772   1.000 111.99723 ? 93  PHE Z O   1 
ATOM   2683 C  CB  . PHE C 3 93  ? 41.24203 21.06690  5.52824   1.000 104.90505 ? 93  PHE Z CB  1 
ATOM   2684 C  CG  . PHE C 3 93  ? 40.65646 22.44743  5.49159   1.000 98.97222  ? 93  PHE Z CG  1 
ATOM   2685 C  CD1 . PHE C 3 93  ? 40.35793 23.12175  6.66336   1.000 95.93892  ? 93  PHE Z CD1 1 
ATOM   2686 C  CD2 . PHE C 3 93  ? 40.43342 23.08506  4.28137   1.000 94.63190  ? 93  PHE Z CD2 1 
ATOM   2687 C  CE1 . PHE C 3 93  ? 39.83890 24.40430  6.62708   1.000 93.06740  ? 93  PHE Z CE1 1 
ATOM   2688 C  CE2 . PHE C 3 93  ? 39.91199 24.35968  4.24010   1.000 91.98407  ? 93  PHE Z CE2 1 
ATOM   2689 C  CZ  . PHE C 3 93  ? 39.61459 25.02161  5.41615   1.000 91.04732  ? 93  PHE Z CZ  1 
ATOM   2690 N  N   . PRO C 3 94  ? 37.96486 19.78382  4.82280   1.000 108.15712 ? 94  PRO Z N   1 
ATOM   2691 C  CA  . PRO C 3 94  ? 37.03133 19.54281  3.70901   1.000 109.82402 ? 94  PRO Z CA  1 
ATOM   2692 C  C   . PRO C 3 94  ? 37.05272 20.67759  2.69261   1.000 103.95407 ? 94  PRO Z C   1 
ATOM   2693 O  O   . PRO C 3 94  ? 36.85469 21.84589  3.03549   1.000 104.01836 ? 94  PRO Z O   1 
ATOM   2694 C  CB  . PRO C 3 94  ? 35.66702 19.43628  4.40348   1.000 113.41136 ? 94  PRO Z CB  1 
ATOM   2695 C  CG  . PRO C 3 94  ? 35.83783 20.18963  5.68705   1.000 113.24344 ? 94  PRO Z CG  1 
ATOM   2696 C  CD  . PRO C 3 94  ? 37.26314 19.94922  6.10648   1.000 111.27245 ? 94  PRO Z CD  1 
ATOM   2697 N  N   . ILE C 3 95  ? 37.28893 20.32206  1.43402   1.000 97.29761  ? 95  ILE Z N   1 
ATOM   2698 C  CA  . ILE C 3 95  ? 37.30257 21.26804  0.32551   1.000 89.43775  ? 95  ILE Z CA  1 
ATOM   2699 C  C   . ILE C 3 95  ? 36.47575 20.65835  -0.79897  1.000 85.87268  ? 95  ILE Z C   1 
ATOM   2700 O  O   . ILE C 3 95  ? 36.97335 19.82619  -1.56658  1.000 87.42485  ? 95  ILE Z O   1 
ATOM   2701 C  CB  . ILE C 3 95  ? 38.72683 21.59687  -0.14069  1.000 84.99308  ? 95  ILE Z CB  1 
ATOM   2702 C  CG1 . ILE C 3 95  ? 39.48878 22.34985  0.94630   1.000 81.46934  ? 95  ILE Z CG1 1 
ATOM   2703 C  CG2 . ILE C 3 95  ? 38.72196 22.40562  -1.41063  1.000 86.14070  ? 95  ILE Z CG2 1 
ATOM   2704 C  CD1 . ILE C 3 95  ? 40.90119 22.67432  0.55446   1.000 78.29651  ? 95  ILE Z CD1 1 
ATOM   2705 N  N   . ALA C 3 96  ? 35.22674 21.09717  -0.92675  1.000 85.84313  ? 96  ALA Z N   1 
ATOM   2706 C  CA  . ALA C 3 96  ? 34.34947 20.54330  -1.94408  1.000 89.28758  ? 96  ALA Z CA  1 
ATOM   2707 C  C   . ALA C 3 96  ? 34.85910 20.90486  -3.33981  1.000 99.41888  ? 96  ALA Z C   1 
ATOM   2708 O  O   . ALA C 3 96  ? 35.40679 21.99047  -3.54615  1.000 101.85381 ? 96  ALA Z O   1 
ATOM   2709 C  CB  . ALA C 3 96  ? 32.92264 21.05506  -1.75966  1.000 88.19109  ? 96  ALA Z CB  1 
ATOM   2710 N  N   . PRO C 3 97  ? 34.69525 20.00421  -4.31660  1.000 101.81208 ? 97  PRO Z N   1 
ATOM   2711 C  CA  . PRO C 3 97  ? 35.23762 20.27951  -5.66041  1.000 108.07890 ? 97  PRO Z CA  1 
ATOM   2712 C  C   . PRO C 3 97  ? 34.72227 21.55893  -6.29884  1.000 113.12522 ? 97  PRO Z C   1 
ATOM   2713 O  O   . PRO C 3 97  ? 35.47485 22.21837  -7.02370  1.000 115.52847 ? 97  PRO Z O   1 
ATOM   2714 C  CB  . PRO C 3 97  ? 34.79971 19.04729  -6.46473  1.000 104.58644 ? 97  PRO Z CB  1 
ATOM   2715 C  CG  . PRO C 3 97  ? 34.65994 17.97276  -5.46114  1.000 103.31910 ? 97  PRO Z CG  1 
ATOM   2716 C  CD  . PRO C 3 97  ? 34.14331 18.64104  -4.21639  1.000 103.13787 ? 97  PRO Z CD  1 
ATOM   2717 N  N   . GLU C 3 98  ? 33.45762 21.92540  -6.07018  1.000 119.08961 ? 98  GLU Z N   1 
ATOM   2718 C  CA  . GLU C 3 98  ? 32.92591 23.14657  -6.67126  1.000 119.08620 ? 98  GLU Z CA  1 
ATOM   2719 C  C   . GLU C 3 98  ? 33.65669 24.37629  -6.14698  1.000 114.17424 ? 98  GLU Z C   1 
ATOM   2720 O  O   . GLU C 3 98  ? 33.93415 25.31482  -6.90304  1.000 115.12407 ? 98  GLU Z O   1 
ATOM   2721 C  CB  . GLU C 3 98  ? 31.42310 23.25545  -6.41003  1.000 125.52353 ? 98  GLU Z CB  1 
ATOM   2722 C  CG  . GLU C 3 98  ? 30.61911 22.00279  -6.76506  1.000 132.59008 ? 98  GLU Z CG  1 
ATOM   2723 C  CD  . GLU C 3 98  ? 30.55661 20.97754  -5.63531  1.000 140.03420 ? 98  GLU Z CD  1 
ATOM   2724 O  OE1 . GLU C 3 98  ? 31.60101 20.70988  -5.00257  1.000 145.99575 ? 98  GLU Z OE1 1 
ATOM   2725 O  OE2 . GLU C 3 98  ? 29.46099 20.42520  -5.39097  1.000 139.57318 ? 98  GLU Z OE2 1 
ATOM   2726 N  N   . ILE C 3 99  ? 33.97174 24.38986  -4.84703  1.000 108.73455 ? 99  ILE Z N   1 
ATOM   2727 C  CA  . ILE C 3 99  ? 34.71794 25.49057  -4.24201  1.000 100.69666 ? 99  ILE Z CA  1 
ATOM   2728 C  C   . ILE C 3 99  ? 36.21171 25.35918  -4.49635  1.000 94.67034  ? 99  ILE Z C   1 
ATOM   2729 O  O   . ILE C 3 99  ? 36.93766 26.34695  -4.35356  1.000 94.55802  ? 99  ILE Z O   1 
ATOM   2730 C  CB  . ILE C 3 99  ? 34.42151 25.53167  -2.72666  1.000 100.96755 ? 99  ILE Z CB  1 
ATOM   2731 C  CG1 . ILE C 3 99  ? 32.91779 25.68147  -2.45630  1.000 99.52128  ? 99  ILE Z CG1 1 
ATOM   2732 C  CG2 . ILE C 3 99  ? 35.12608 26.69901  -2.04923  1.000 100.64155 ? 99  ILE Z CG2 1 
ATOM   2733 C  CD1 . ILE C 3 99  ? 32.54827 25.69283  -0.96551  1.000 97.53096  ? 99  ILE Z CD1 1 
ATOM   2734 N  N   . ALA C 3 100 ? 36.67118 24.18202  -4.94732  1.000 91.25990  ? 100 ALA Z N   1 
ATOM   2735 C  CA  . ALA C 3 100 ? 38.09536 23.83468  -4.94310  1.000 87.28788  ? 100 ALA Z CA  1 
ATOM   2736 C  C   . ALA C 3 100 ? 38.94229 24.85587  -5.69522  1.000 84.83890  ? 100 ALA Z C   1 
ATOM   2737 O  O   . ALA C 3 100 ? 39.90311 25.40602  -5.14362  1.000 83.39015  ? 100 ALA Z O   1 
ATOM   2738 C  CB  . ALA C 3 100 ? 38.29925 22.43843  -5.53299  1.000 88.04145  ? 100 ALA Z CB  1 
ATOM   2739 N  N   . LEU C 3 101 ? 38.61864 25.10804  -6.96845  1.000 85.04027  ? 101 LEU Z N   1 
ATOM   2740 C  CA  . LEU C 3 101 ? 39.40386 26.06859  -7.73737  1.000 86.16800  ? 101 LEU Z CA  1 
ATOM   2741 C  C   . LEU C 3 101 ? 39.25418 27.47132  -7.17003  1.000 92.72182  ? 101 LEU Z C   1 
ATOM   2742 O  O   . LEU C 3 101 ? 40.24900 28.17524  -6.96675  1.000 95.80055  ? 101 LEU Z O   1 
ATOM   2743 C  CB  . LEU C 3 101 ? 38.99301 26.05608  -9.20896  1.000 83.12293  ? 101 LEU Z CB  1 
ATOM   2744 C  CG  . LEU C 3 101 ? 39.83965 26.97090  -10.10974 1.000 79.89947  ? 101 LEU Z CG  1 
ATOM   2745 C  CD1 . LEU C 3 101 ? 41.30597 26.58620  -10.05547 1.000 80.90615  ? 101 LEU Z CD1 1 
ATOM   2746 C  CD2 . LEU C 3 101 ? 39.34438 27.00205  -11.55720 1.000 76.56568  ? 101 LEU Z CD2 1 
ATOM   2747 N  N   . GLU C 3 102 ? 38.01509 27.88386  -6.88447  1.000 93.07636  ? 102 GLU Z N   1 
ATOM   2748 C  CA  . GLU C 3 102 ? 37.77091 29.24317  -6.41174  1.000 91.43454  ? 102 GLU Z CA  1 
ATOM   2749 C  C   . GLU C 3 102 ? 38.54024 29.53567  -5.12695  1.000 86.74849  ? 102 GLU Z C   1 
ATOM   2750 O  O   . GLU C 3 102 ? 39.01025 30.66152  -4.92294  1.000 88.18019  ? 102 GLU Z O   1 
ATOM   2751 C  CB  . GLU C 3 102 ? 36.27049 29.44941  -6.21282  1.000 95.31326  ? 102 GLU Z CB  1 
ATOM   2752 C  CG  . GLU C 3 102 ? 35.83157 30.89281  -6.20124  1.000 102.34864 ? 102 GLU Z CG  1 
ATOM   2753 C  CD  . GLU C 3 102 ? 34.36004 31.04855  -6.53037  1.000 109.31887 ? 102 GLU Z CD  1 
ATOM   2754 O  OE1 . GLU C 3 102 ? 33.68809 30.01940  -6.78370  1.000 108.07023 ? 102 GLU Z OE1 1 
ATOM   2755 O  OE2 . GLU C 3 102 ? 33.88097 32.20491  -6.54054  1.000 115.11655 ? 102 GLU Z OE2 1 
ATOM   2756 N  N   . LEU C 3 103 ? 38.68557 28.53042  -4.25126  1.000 81.52278  ? 103 LEU Z N   1 
ATOM   2757 C  CA  . LEU C 3 103 ? 39.38941 28.72138  -2.98516  1.000 74.35378  ? 103 LEU Z CA  1 
ATOM   2758 C  C   . LEU C 3 103 ? 40.88340 28.89149  -3.18510  1.000 73.42501  ? 103 LEU Z C   1 
ATOM   2759 O  O   . LEU C 3 103 ? 41.53794 29.58165  -2.39632  1.000 74.53319  ? 103 LEU Z O   1 
ATOM   2760 C  CB  . LEU C 3 103 ? 39.12582 27.55382  -2.05338  1.000 71.33770  ? 103 LEU Z CB  1 
ATOM   2761 C  CG  . LEU C 3 103 ? 39.82986 27.65866  -0.71012  1.000 68.60847  ? 103 LEU Z CG  1 
ATOM   2762 C  CD1 . LEU C 3 103 ? 39.37510 28.90593  0.03322   1.000 67.57673  ? 103 LEU Z CD1 1 
ATOM   2763 C  CD2 . LEU C 3 103 ? 39.57101 26.39849  0.09190   1.000 67.53252  ? 103 LEU Z CD2 1 
ATOM   2764 N  N   . LEU C 3 104 ? 41.44400 28.25978  -4.21449  1.000 72.21301  ? 104 LEU Z N   1 
ATOM   2765 C  CA  . LEU C 3 104 ? 42.85649 28.46547  -4.50845  1.000 70.56681  ? 104 LEU Z CA  1 
ATOM   2766 C  C   . LEU C 3 104 ? 43.13325 29.89762  -4.94203  1.000 72.08741  ? 104 LEU Z C   1 
ATOM   2767 O  O   . LEU C 3 104 ? 44.20275 30.43840  -4.64303  1.000 74.12806  ? 104 LEU Z O   1 
ATOM   2768 C  CB  . LEU C 3 104 ? 43.30934 27.49841  -5.59661  1.000 68.69797  ? 104 LEU Z CB  1 
ATOM   2769 C  CG  . LEU C 3 104 ? 44.77381 27.60123  -6.00422  1.000 66.15377  ? 104 LEU Z CG  1 
ATOM   2770 C  CD1 . LEU C 3 104 ? 45.65522 27.39525  -4.78839  1.000 66.05325  ? 104 LEU Z CD1 1 
ATOM   2771 C  CD2 . LEU C 3 104 ? 45.07833 26.60056  -7.09678  1.000 64.47222  ? 104 LEU Z CD2 1 
ATOM   2772 N  N   . MET C 3 105 ? 42.19211 30.53179  -5.64170  1.000 72.96937  ? 105 MET Z N   1 
ATOM   2773 C  CA  . MET C 3 105 ? 42.39789 31.92553  -6.01858  1.000 74.74359  ? 105 MET Z CA  1 
ATOM   2774 C  C   . MET C 3 105 ? 42.49781 32.80983  -4.77811  1.000 72.83766  ? 105 MET Z C   1 
ATOM   2775 O  O   . MET C 3 105 ? 43.40130 33.64743  -4.67211  1.000 73.23459  ? 105 MET Z O   1 
ATOM   2776 C  CB  . MET C 3 105 ? 41.29152 32.39776  -6.96867  1.000 75.79710  ? 105 MET Z CB  1 
ATOM   2777 C  CG  . MET C 3 105 ? 41.41924 31.85851  -8.40477  1.000 76.37232  ? 105 MET Z CG  1 
ATOM   2778 S  SD  . MET C 3 105 ? 39.94092 32.03788  -9.43235  1.000 77.00538  ? 105 MET Z SD  1 
ATOM   2779 C  CE  . MET C 3 105 ? 39.15221 33.43996  -8.64368  1.000 82.55139  ? 105 MET Z CE  1 
ATOM   2780 N  N   . ALA C 3 106 ? 41.58763 32.62257  -3.81630  1.000 69.72766  ? 106 ALA Z N   1 
ATOM   2781 C  CA  . ALA C 3 106 ? 41.65757 33.39760  -2.58141  1.000 68.25113  ? 106 ALA Z CA  1 
ATOM   2782 C  C   . ALA C 3 106 ? 42.94201 33.09894  -1.81603  1.000 72.29523  ? 106 ALA Z C   1 
ATOM   2783 O  O   . ALA C 3 106 ? 43.59576 34.01402  -1.29819  1.000 72.56211  ? 106 ALA Z O   1 
ATOM   2784 C  CB  . ALA C 3 106 ? 40.43013 33.11613  -1.71702  1.000 63.66186  ? 106 ALA Z CB  1 
ATOM   2785 N  N   . ALA C 3 107 ? 43.33532 31.82543  -1.76148  1.000 73.20691  ? 107 ALA Z N   1 
ATOM   2786 C  CA  . ALA C 3 107 ? 44.51255 31.43810  -0.99221  1.000 74.66472  ? 107 ALA Z CA  1 
ATOM   2787 C  C   . ALA C 3 107 ? 45.78845 32.02236  -1.58950  1.000 73.53195  ? 107 ALA Z C   1 
ATOM   2788 O  O   . ALA C 3 107 ? 46.67866 32.46217  -0.85208  1.000 72.68862  ? 107 ALA Z O   1 
ATOM   2789 C  CB  . ALA C 3 107 ? 44.59773 29.91202  -0.91673  1.000 77.52662  ? 107 ALA Z CB  1 
ATOM   2790 N  N   . ASN C 3 108 ? 45.90367 32.01763  -2.92285  1.000 73.63373  ? 108 ASN Z N   1 
ATOM   2791 C  CA  . ASN C 3 108 ? 47.05686 32.63549  -3.57554  1.000 75.51312  ? 108 ASN Z CA  1 
ATOM   2792 C  C   . ASN C 3 108 ? 47.05080 34.15208  -3.38944  1.000 78.90917  ? 108 ASN Z C   1 
ATOM   2793 O  O   . ASN C 3 108 ? 48.10043 34.76377  -3.14840  1.000 78.52351  ? 108 ASN Z O   1 
ATOM   2794 C  CB  . ASN C 3 108 ? 47.06898 32.28795  -5.06419  1.000 76.22833  ? 108 ASN Z CB  1 
ATOM   2795 C  CG  . ASN C 3 108 ? 48.34529 32.73879  -5.75445  1.000 81.49546  ? 108 ASN Z CG  1 
ATOM   2796 O  OD1 . ASN C 3 108 ? 49.42632 32.67730  -5.17207  1.000 83.11144  ? 108 ASN Z OD1 1 
ATOM   2797 N  ND2 . ASN C 3 108 ? 48.22616 33.21247  -6.99011  1.000 84.21094  ? 108 ASN Z ND2 1 
ATOM   2798 N  N   . PHE C 3 109 ? 45.87005 34.77071  -3.48128  1.000 79.01964  ? 109 PHE Z N   1 
ATOM   2799 C  CA  . PHE C 3 109 ? 45.73479 36.21200  -3.30520  1.000 76.34609  ? 109 PHE Z CA  1 
ATOM   2800 C  C   . PHE C 3 109 ? 46.05335 36.66172  -1.88794  1.000 78.42904  ? 109 PHE Z C   1 
ATOM   2801 O  O   . PHE C 3 109 ? 46.37296 37.83918  -1.68926  1.000 78.01337  ? 109 PHE Z O   1 
ATOM   2802 C  CB  . PHE C 3 109 ? 44.31216 36.63539  -3.67658  1.000 72.45713  ? 109 PHE Z CB  1 
ATOM   2803 C  CG  . PHE C 3 109 ? 43.97786 38.05270  -3.32010  1.000 69.70802  ? 109 PHE Z CG  1 
ATOM   2804 C  CD1 . PHE C 3 109 ? 44.37257 39.09557  -4.13950  1.000 69.21995  ? 109 PHE Z CD1 1 
ATOM   2805 C  CD2 . PHE C 3 109 ? 43.25808 38.34458  -2.16901  1.000 66.45815  ? 109 PHE Z CD2 1 
ATOM   2806 C  CE1 . PHE C 3 109 ? 44.05845 40.39730  -3.82306  1.000 65.22935  ? 109 PHE Z CE1 1 
ATOM   2807 C  CE2 . PHE C 3 109 ? 42.94504 39.64594  -1.84828  1.000 64.37986  ? 109 PHE Z CE2 1 
ATOM   2808 C  CZ  . PHE C 3 109 ? 43.34613 40.67208  -2.68016  1.000 63.66743  ? 109 PHE Z CZ  1 
ATOM   2809 N  N   . LEU C 3 110 ? 45.97245 35.75348  -0.90986  1.000 80.81183  ? 110 LEU Z N   1 
ATOM   2810 C  CA  . LEU C 3 110 ? 46.13524 36.07000  0.50623   1.000 82.63658  ? 110 LEU Z CA  1 
ATOM   2811 C  C   . LEU C 3 110 ? 47.45550 35.58127  1.08865   1.000 88.26253  ? 110 LEU Z C   1 
ATOM   2812 O  O   . LEU C 3 110 ? 48.21864 36.38343  1.62668   1.000 89.34504  ? 110 LEU Z O   1 
ATOM   2813 C  CB  . LEU C 3 110 ? 44.96221 35.48527  1.31117   1.000 77.94865  ? 110 LEU Z CB  1 
ATOM   2814 C  CG  . LEU C 3 110 ? 43.58160 36.10719  1.08012   1.000 73.29454  ? 110 LEU Z CG  1 
ATOM   2815 C  CD1 . LEU C 3 110 ? 42.47182 35.35323  1.82026   1.000 66.43580  ? 110 LEU Z CD1 1 
ATOM   2816 C  CD2 . LEU C 3 110 ? 43.57414 37.60550  1.43064   1.000 74.59525  ? 110 LEU Z CD2 1 
ATOM   2817 N  N   . ASP C 3 111 ? 47.73440 34.28002  1.03112   1.000 94.15755  ? 111 ASP Z N   1 
ATOM   2818 C  CA  . ASP C 3 111 ? 48.90448 33.72960  1.70514   1.000 101.42350 ? 111 ASP Z CA  1 
ATOM   2819 C  C   . ASP C 3 111 ? 50.19274 34.33097  1.13106   1.000 109.27670 ? 111 ASP Z C   1 
ATOM   2820 O  O   . ASP C 3 111 ? 50.19102 35.02089  0.10538   1.000 109.95097 ? 111 ASP Z O   1 
ATOM   2821 C  CB  . ASP C 3 111 ? 48.92630 32.20970  1.57928   1.000 101.20040 ? 111 ASP Z CB  1 
ATOM   2822 C  CG  . ASP C 3 111 ? 47.94526 31.51089  2.52551   1.000 101.90698 ? 111 ASP Z CG  1 
ATOM   2823 O  OD1 . ASP C 3 111 ? 46.99651 32.15222  3.03648   1.000 99.87803  ? 111 ASP Z OD1 1 
ATOM   2824 O  OD2 . ASP C 3 111 ? 48.13104 30.28977  2.74547   1.000 103.48170 ? 111 ASP Z OD2 1 
ATOM   2825 N  N   . CYS C 3 112 ? 51.29985 34.07655  1.82563   1.000 112.05916 ? 112 CYS Z N   1 
ATOM   2826 C  CA  . CYS C 3 112 ? 52.62079 34.55092  1.40729   1.000 118.04435 ? 112 CYS Z CA  1 
ATOM   2827 C  C   . CYS C 3 112 ? 52.63110 36.06727  1.18814   1.000 121.45179 ? 112 CYS Z C   1 
ATOM   2828 O  O   . CYS C 3 112 ? 53.63616 36.74449  1.42755   1.000 124.48891 ? 112 CYS Z O   1 
ATOM   2829 C  CB  . CYS C 3 112 ? 53.07671 33.83044  0.12785   1.000 122.09851 ? 112 CYS Z CB  1 
ATOM   2830 S  SG  . CYS C 3 112 ? 53.41254 32.04234  0.29566   1.000 123.43317 ? 112 CYS Z SG  1 
ATOM   2831 N  N   . GLU D 4 3   ? 77.64738 -6.40520  34.24735  1.000 172.57093 ? 3   GLU F N   1 
ATOM   2832 C  CA  . GLU D 4 3   ? 78.72717 -6.68610  33.30668  1.000 173.15647 ? 3   GLU F CA  1 
ATOM   2833 C  C   . GLU D 4 3   ? 78.20003 -6.90842  31.89351  1.000 167.38516 ? 3   GLU F C   1 
ATOM   2834 O  O   . GLU D 4 3   ? 78.98135 -7.06905  30.95717  1.000 169.24935 ? 3   GLU F O   1 
ATOM   2835 C  CB  . GLU D 4 3   ? 79.54118 -7.90793  33.75435  1.000 177.15996 ? 3   GLU F CB  1 
ATOM   2836 C  CG  . GLU D 4 3   ? 80.17000 -7.79949  35.14316  1.000 179.30532 ? 3   GLU F CG  1 
ATOM   2837 C  CD  . GLU D 4 3   ? 79.21507 -8.13970  36.27288  1.000 179.41804 ? 3   GLU F CD  1 
ATOM   2838 O  OE1 . GLU D 4 3   ? 78.00507 -8.31025  36.01447  1.000 178.11782 ? 3   GLU F OE1 1 
ATOM   2839 O  OE2 . GLU D 4 3   ? 79.68421 -8.24146  37.42506  1.000 178.32040 ? 3   GLU F OE2 1 
ATOM   2840 N  N   . LYS D 4 4   ? 76.87676 -6.91801  31.74081  1.000 154.17476 ? 4   LYS F N   1 
ATOM   2841 C  CA  . LYS D 4 4   ? 76.24783 -6.96201  30.42732  1.000 140.83532 ? 4   LYS F CA  1 
ATOM   2842 C  C   . LYS D 4 4   ? 75.75389 -5.56594  30.07595  1.000 133.40813 ? 4   LYS F C   1 
ATOM   2843 O  O   . LYS D 4 4   ? 74.96122 -4.97408  30.81944  1.000 132.62432 ? 4   LYS F O   1 
ATOM   2844 C  CB  . LYS D 4 4   ? 75.09119 -7.95638  30.38048  1.000 129.52051 ? 4   LYS F CB  1 
ATOM   2845 C  CG  . LYS D 4 4   ? 74.44509 -8.02869  29.00511  1.000 122.52361 ? 4   LYS F CG  1 
ATOM   2846 C  CD  . LYS D 4 4   ? 73.18853 -8.87281  29.00166  1.000 116.69018 ? 4   LYS F CD  1 
ATOM   2847 C  CE  . LYS D 4 4   ? 72.59482 -8.96671  27.60442  1.000 114.29522 ? 4   LYS F CE  1 
ATOM   2848 N  NZ  . LYS D 4 4   ? 71.23141 -9.56989  27.61002  1.000 112.74602 ? 4   LYS F NZ  1 
ATOM   2849 N  N   . MET D 4 5   ? 76.21529 -5.05047  28.94221  1.000 129.49554 ? 5   MET F N   1 
ATOM   2850 C  CA  . MET D 4 5   ? 75.86018 -3.71860  28.48618  1.000 123.12451 ? 5   MET F CA  1 
ATOM   2851 C  C   . MET D 4 5   ? 74.87414 -3.81968  27.33002  1.000 114.63283 ? 5   MET F C   1 
ATOM   2852 O  O   . MET D 4 5   ? 74.97780 -4.71787  26.48614  1.000 112.42023 ? 5   MET F O   1 
ATOM   2853 C  CB  . MET D 4 5   ? 77.11073 -2.93360  28.07136  1.000 128.61701 ? 5   MET F CB  1 
ATOM   2854 C  CG  . MET D 4 5   ? 78.12048 -2.77653  29.20704  1.000 132.10757 ? 5   MET F CG  1 
ATOM   2855 S  SD  . MET D 4 5   ? 79.24968 -1.37852  29.06943  1.000 136.99735 ? 5   MET F SD  1 
ATOM   2856 C  CE  . MET D 4 5   ? 80.24848 -1.61661  30.53674  1.000 142.65776 ? 5   MET F CE  1 
ATOM   2857 N  N   . TRP D 4 6   ? 73.91551 -2.89322  27.31025  1.000 109.18289 ? 6   TRP F N   1 
ATOM   2858 C  CA  . TRP D 4 6   ? 72.82706 -2.85436  26.34341  1.000 105.04094 ? 6   TRP F CA  1 
ATOM   2859 C  C   . TRP D 4 6   ? 72.88673 -1.56829  25.53124  1.000 103.46548 ? 6   TRP F C   1 
ATOM   2860 O  O   . TRP D 4 6   ? 73.33566 -0.52957  26.02105  1.000 102.70490 ? 6   TRP F O   1 
ATOM   2861 C  CB  . TRP D 4 6   ? 71.45547 -2.91396  27.03543  1.000 102.79726 ? 6   TRP F CB  1 
ATOM   2862 C  CG  . TRP D 4 6   ? 70.93065 -4.27948  27.34669  1.000 101.53504 ? 6   TRP F CG  1 
ATOM   2863 C  CD1 . TRP D 4 6   ? 70.23808 -5.10331  26.50660  1.000 101.06203 ? 6   TRP F CD1 1 
ATOM   2864 C  CD2 . TRP D 4 6   ? 71.01392 -4.96102  28.59876  1.000 102.70246 ? 6   TRP F CD2 1 
ATOM   2865 N  NE1 . TRP D 4 6   ? 69.90100 -6.26447  27.15285  1.000 101.52906 ? 6   TRP F NE1 1 
ATOM   2866 C  CE2 . TRP D 4 6   ? 70.36657 -6.20311  28.44028  1.000 103.32478 ? 6   TRP F CE2 1 
ATOM   2867 C  CE3 . TRP D 4 6   ? 71.58351 -4.64752  29.83822  1.000 103.79616 ? 6   TRP F CE3 1 
ATOM   2868 C  CZ2 . TRP D 4 6   ? 70.26941 -7.13281  29.47777  1.000 105.10312 ? 6   TRP F CZ2 1 
ATOM   2869 C  CZ3 . TRP D 4 6   ? 71.49114 -5.57299  30.86831  1.000 104.90877 ? 6   TRP F CZ3 1 
ATOM   2870 C  CH2 . TRP D 4 6   ? 70.83949 -6.80086  30.68095  1.000 105.32363 ? 6   TRP F CH2 1 
ATOM   2871 N  N   . ILE D 4 7   ? 72.39342 -1.63209  24.29815  1.000 105.65030 ? 7   ILE F N   1 
ATOM   2872 C  CA  . ILE D 4 7   ? 72.10954 -0.44219  23.50493  1.000 108.35692 ? 7   ILE F CA  1 
ATOM   2873 C  C   . ILE D 4 7   ? 70.62648 -0.45653  23.14940  1.000 111.10006 ? 7   ILE F C   1 
ATOM   2874 O  O   . ILE D 4 7   ? 70.05005 -1.52486  22.91710  1.000 112.70289 ? 7   ILE F O   1 
ATOM   2875 C  CB  . ILE D 4 7   ? 72.99882 -0.35416  22.24433  1.000 107.46935 ? 7   ILE F CB  1 
ATOM   2876 C  CG1 . ILE D 4 7   ? 72.94655 1.05705   21.67200  1.000 105.24187 ? 7   ILE F CG1 1 
ATOM   2877 C  CG2 . ILE D 4 7   ? 72.55244 -1.33268  21.18140  1.000 106.82876 ? 7   ILE F CG2 1 
ATOM   2878 C  CD1 . ILE D 4 7   ? 73.05127 2.13459   22.72564  1.000 104.29909 ? 7   ILE F CD1 1 
ATOM   2879 N  N   . VAL D 4 8   ? 70.00235 0.72470   23.12461  1.000 112.40496 ? 8   VAL F N   1 
ATOM   2880 C  CA  . VAL D 4 8   ? 68.56487 0.84451   22.89540  1.000 108.51333 ? 8   VAL F CA  1 
ATOM   2881 C  C   . VAL D 4 8   ? 68.29436 1.77826   21.72149  1.000 106.52472 ? 8   VAL F C   1 
ATOM   2882 O  O   . VAL D 4 8   ? 68.89651 2.85468   21.61320  1.000 110.20067 ? 8   VAL F O   1 
ATOM   2883 C  CB  . VAL D 4 8   ? 67.83302 1.34433   24.15953  1.000 107.92660 ? 8   VAL F CB  1 
ATOM   2884 C  CG1 . VAL D 4 8   ? 68.42636 2.67044   24.63747  1.000 110.23115 ? 8   VAL F CG1 1 
ATOM   2885 C  CG2 . VAL D 4 8   ? 66.34400 1.48661   23.88686  1.000 107.66002 ? 8   VAL F CG2 1 
ATOM   2886 N  N   . ARG D 4 9   ? 67.36986 1.36943   20.84401  1.000 102.43025 ? 9   ARG F N   1 
ATOM   2887 C  CA  . ARG D 4 9   ? 66.98730 2.18688   19.69582  1.000 100.80306 ? 9   ARG F CA  1 
ATOM   2888 C  C   . ARG D 4 9   ? 65.50009 1.95039   19.44779  1.000 93.97150  ? 9   ARG F C   1 
ATOM   2889 O  O   . ARG D 4 9   ? 65.02426 0.82756   19.67113  1.000 93.47281  ? 9   ARG F O   1 
ATOM   2890 C  CB  . ARG D 4 9   ? 67.80954 1.85296   18.43772  1.000 104.47045 ? 9   ARG F CB  1 
ATOM   2891 C  CG  . ARG D 4 9   ? 67.68243 2.89969   17.32815  1.000 107.95399 ? 9   ARG F CG  1 
ATOM   2892 C  CD  . ARG D 4 9   ? 68.37503 2.51976   16.02038  1.000 109.51883 ? 9   ARG F CD  1 
ATOM   2893 N  NE  . ARG D 4 9   ? 68.11571 3.51292   14.97300  1.000 109.71192 ? 9   ARG F NE  1 
ATOM   2894 C  CZ  . ARG D 4 9   ? 68.47793 3.36883   13.70020  1.000 111.02426 ? 9   ARG F CZ  1 
ATOM   2895 N  NH1 . ARG D 4 9   ? 68.19924 4.30955   12.80569  1.000 110.24612 ? 9   ARG F NH1 1 
ATOM   2896 N  NH2 . ARG D 4 9   ? 69.09709 2.26434   13.31166  1.000 110.99583 ? 9   ARG F NH2 1 
ATOM   2897 N  N   . PRO D 4 10  ? 64.73178 2.98161   19.06740  1.000 88.25221  ? 10  PRO F N   1 
ATOM   2898 C  CA  . PRO D 4 10  ? 63.30663 2.77321   18.74873  1.000 82.41180  ? 10  PRO F CA  1 
ATOM   2899 C  C   . PRO D 4 10  ? 63.13248 2.01239   17.44511  1.000 80.40653  ? 10  PRO F C   1 
ATOM   2900 O  O   . PRO D 4 10  ? 63.68598 2.39062   16.41084  1.000 84.66741  ? 10  PRO F O   1 
ATOM   2901 C  CB  . PRO D 4 10  ? 62.74794 4.19616   18.63025  1.000 82.21064  ? 10  PRO F CB  1 
ATOM   2902 C  CG  . PRO D 4 10  ? 63.73986 5.06313   19.26978  1.000 84.26837  ? 10  PRO F CG  1 
ATOM   2903 C  CD  . PRO D 4 10  ? 65.07340 4.41061   19.08323  1.000 86.39430  ? 10  PRO F CD  1 
ATOM   2904 N  N   . VAL D 4 11  ? 62.32525 0.95843   17.48718  1.000 73.33369  ? 11  VAL F N   1 
ATOM   2905 C  CA  . VAL D 4 11  ? 62.18387 0.05305   16.35607  1.000 69.42105  ? 11  VAL F CA  1 
ATOM   2906 C  C   . VAL D 4 11  ? 60.71058 -0.22657  16.10844  1.000 68.60621  ? 11  VAL F C   1 
ATOM   2907 O  O   . VAL D 4 11  ? 59.98743 -0.63986  17.02031  1.000 70.04532  ? 11  VAL F O   1 
ATOM   2908 C  CB  . VAL D 4 11  ? 62.94262 -1.26490  16.59482  1.000 66.57203  ? 11  VAL F CB  1 
ATOM   2909 C  CG1 . VAL D 4 11  ? 62.50889 -2.29428  15.58103  1.000 66.91702  ? 11  VAL F CG1 1 
ATOM   2910 C  CG2 . VAL D 4 11  ? 64.44708 -1.03827  16.51358  1.000 65.44285  ? 11  VAL F CG2 1 
ATOM   2911 N  N   . TRP D 4 12  ? 60.27775 -0.03994  14.87171  1.000 67.43761  ? 12  TRP F N   1 
ATOM   2912 C  CA  . TRP D 4 12  ? 58.94286 -0.44579  14.48153  1.000 65.59192  ? 12  TRP F CA  1 
ATOM   2913 C  C   . TRP D 4 12  ? 58.94424 -1.92083  14.11275  1.000 66.97250  ? 12  TRP F C   1 
ATOM   2914 O  O   . TRP D 4 12  ? 59.83850 -2.39594  13.41413  1.000 68.99359  ? 12  TRP F O   1 
ATOM   2915 C  CB  . TRP D 4 12  ? 58.46740 0.37238   13.28825  1.000 67.10627  ? 12  TRP F CB  1 
ATOM   2916 C  CG  . TRP D 4 12  ? 58.58312 1.83434   13.47159  1.000 66.96621  ? 12  TRP F CG  1 
ATOM   2917 C  CD1 . TRP D 4 12  ? 59.65139 2.62099   13.15623  1.000 66.89194  ? 12  TRP F CD1 1 
ATOM   2918 C  CD2 . TRP D 4 12  ? 57.59083 2.70109   14.02779  1.000 68.99925  ? 12  TRP F CD2 1 
ATOM   2919 N  NE1 . TRP D 4 12  ? 59.38084 3.93452   13.47377  1.000 69.13260  ? 12  TRP F NE1 1 
ATOM   2920 C  CE2 . TRP D 4 12  ? 58.12196 4.00844   14.01243  1.000 70.16828  ? 12  TRP F CE2 1 
ATOM   2921 C  CE3 . TRP D 4 12  ? 56.30157 2.49951   14.53648  1.000 68.94775  ? 12  TRP F CE3 1 
ATOM   2922 C  CZ2 . TRP D 4 12  ? 57.40855 5.10704   14.48657  1.000 70.45842  ? 12  TRP F CZ2 1 
ATOM   2923 C  CZ3 . TRP D 4 12  ? 55.59738 3.59049   15.00230  1.000 70.03747  ? 12  TRP F CZ3 1 
ATOM   2924 C  CH2 . TRP D 4 12  ? 56.14828 4.87899   14.97359  1.000 70.68330  ? 12  TRP F CH2 1 
ATOM   2925 N  N   . ARG D 4 13  ? 57.93280 -2.64662  14.57722  1.000 67.16535  ? 13  ARG F N   1 
ATOM   2926 C  CA  . ARG D 4 13  ? 57.78511 -4.06190  14.26831  1.000 68.67798  ? 13  ARG F CA  1 
ATOM   2927 C  C   . ARG D 4 13  ? 56.83816 -4.19710  13.07698  1.000 71.28107  ? 13  ARG F C   1 
ATOM   2928 O  O   . ARG D 4 13  ? 55.66340 -3.82708  13.16399  1.000 69.45149  ? 13  ARG F O   1 
ATOM   2929 C  CB  . ARG D 4 13  ? 57.28834 -4.83375  15.48833  1.000 66.24163  ? 13  ARG F CB  1 
ATOM   2930 C  CG  . ARG D 4 13  ? 58.29392 -4.88589  16.64534  1.000 65.02789  ? 13  ARG F CG  1 
ATOM   2931 C  CD  . ARG D 4 13  ? 57.79630 -5.74293  17.81170  1.000 65.38120  ? 13  ARG F CD  1 
ATOM   2932 N  NE  . ARG D 4 13  ? 58.82599 -6.67016  18.27762  1.000 71.03825  ? 13  ARG F NE  1 
ATOM   2933 C  CZ  . ARG D 4 13  ? 58.78314 -7.99402  18.10381  1.000 76.34458  ? 13  ARG F CZ  1 
ATOM   2934 N  NH1 . ARG D 4 13  ? 57.74992 -8.56448  17.48538  1.000 75.65246  ? 13  ARG F NH1 1 
ATOM   2935 N  NH2 . ARG D 4 13  ? 59.77706 -8.75278  18.56193  1.000 77.44372  ? 13  ARG F NH2 1 
ATOM   2936 N  N   . VAL D 4 14  ? 57.36122 -4.70203  11.95491  1.000 76.90028  ? 14  VAL F N   1 
ATOM   2937 C  CA  . VAL D 4 14  ? 56.65258 -4.73186  10.67949  1.000 79.75702  ? 14  VAL F CA  1 
ATOM   2938 C  C   . VAL D 4 14  ? 56.68026 -6.14634  10.11007  1.000 88.33582  ? 14  VAL F C   1 
ATOM   2939 O  O   . VAL D 4 14  ? 57.63090 -6.90596  10.32580  1.000 88.37134  ? 14  VAL F O   1 
ATOM   2940 C  CB  . VAL D 4 14  ? 57.26495 -3.73226  9.68039   1.000 79.73033  ? 14  VAL F CB  1 
ATOM   2941 C  CG1 . VAL D 4 14  ? 57.41199 -2.34856  10.32785  1.000 80.43918  ? 14  VAL F CG1 1 
ATOM   2942 C  CG2 . VAL D 4 14  ? 58.60289 -4.22211  9.18848   1.000 77.96784  ? 14  VAL F CG2 1 
ATOM   2943 N  N   . ASP D 4 15  ? 55.62018 -6.50249  9.38312   1.000 96.70395  ? 15  ASP F N   1 
ATOM   2944 C  CA  . ASP D 4 15  ? 55.57339 -7.79108  8.70071   1.000 100.31230 ? 15  ASP F CA  1 
ATOM   2945 C  C   . ASP D 4 15  ? 56.66345 -7.86560  7.63851   1.000 97.37970  ? 15  ASP F C   1 
ATOM   2946 O  O   . ASP D 4 15  ? 56.98911 -6.87094  6.98511   1.000 97.44282  ? 15  ASP F O   1 
ATOM   2947 C  CB  . ASP D 4 15  ? 54.19237 -8.00786  8.06147   1.000 107.44348 ? 15  ASP F CB  1 
ATOM   2948 C  CG  . ASP D 4 15  ? 53.93261 -9.47111  7.65552   1.000 113.40044 ? 15  ASP F CG  1 
ATOM   2949 O  OD1 . ASP D 4 15  ? 54.90030 -10.23715 7.45571   1.000 115.97325 ? 15  ASP F OD1 1 
ATOM   2950 O  OD2 . ASP D 4 15  ? 52.74813 -9.85076  7.50145   1.000 114.63525 ? 15  ASP F OD2 1 
ATOM   2951 N  N   . ARG D 4 16  ? 57.24261 -9.05783  7.48514   1.000 94.89573  ? 16  ARG F N   1 
ATOM   2952 C  CA  . ARG D 4 16  ? 58.24611 -9.26979  6.44845   1.000 90.82956  ? 16  ARG F CA  1 
ATOM   2953 C  C   . ARG D 4 16  ? 57.71114 -8.88568  5.07554   1.000 89.74501  ? 16  ARG F C   1 
ATOM   2954 O  O   . ARG D 4 16  ? 58.45683 -8.37356  4.23373   1.000 89.57385  ? 16  ARG F O   1 
ATOM   2955 C  CB  . ARG D 4 16  ? 58.71026 -10.72141 6.46321   1.000 88.38924  ? 16  ARG F CB  1 
ATOM   2956 C  CG  . ARG D 4 16  ? 59.72672 -11.04850 5.39716   1.000 87.53468  ? 16  ARG F CG  1 
ATOM   2957 C  CD  . ARG D 4 16  ? 59.88995 -12.53522 5.30934   1.000 88.88352  ? 16  ARG F CD  1 
ATOM   2958 N  NE  . ARG D 4 16  ? 58.63292 -13.19641 4.97893   1.000 90.14225  ? 16  ARG F NE  1 
ATOM   2959 C  CZ  . ARG D 4 16  ? 58.30284 -13.59571 3.76114   1.000 91.64310  ? 16  ARG F CZ  1 
ATOM   2960 N  NH1 . ARG D 4 16  ? 57.13705 -14.18857 3.54249   1.000 90.86646  ? 16  ARG F NH1 1 
ATOM   2961 N  NH2 . ARG D 4 16  ? 59.14976 -13.40659 2.76596   1.000 94.22198  ? 16  ARG F NH2 1 
ATOM   2962 N  N   . ARG D 4 17  ? 56.42258 -9.13879  4.82772   1.000 87.93007  ? 17  ARG F N   1 
ATOM   2963 C  CA  . ARG D 4 17  ? 55.83129 -8.79683  3.54004   1.000 88.13880  ? 17  ARG F CA  1 
ATOM   2964 C  C   . ARG D 4 17  ? 55.95200 -7.30861  3.24823   1.000 85.43087  ? 17  ARG F C   1 
ATOM   2965 O  O   . ARG D 4 17  ? 56.02421 -6.90699  2.08147   1.000 85.94215  ? 17  ARG F O   1 
ATOM   2966 C  CB  . ARG D 4 17  ? 54.36567 -9.22912  3.50777   1.000 92.66880  ? 17  ARG F CB  1 
ATOM   2967 C  CG  . ARG D 4 17  ? 54.15222 -10.66989 3.05668   1.000 95.04200  ? 17  ARG F CG  1 
ATOM   2968 C  CD  . ARG D 4 17  ? 54.56797 -10.84140 1.60204   1.000 96.67555  ? 17  ARG F CD  1 
ATOM   2969 N  NE  . ARG D 4 17  ? 53.75567 -10.02240 0.70595   1.000 94.75354  ? 17  ARG F NE  1 
ATOM   2970 C  CZ  . ARG D 4 17  ? 54.19208 -9.51452  -0.44016  1.000 95.30602  ? 17  ARG F CZ  1 
ATOM   2971 N  NH1 . ARG D 4 17  ? 53.38403 -8.78340  -1.19438  1.000 95.13885  ? 17  ARG F NH1 1 
ATOM   2972 N  NH2 . ARG D 4 17  ? 55.44230 -9.72698  -0.82693  1.000 96.76394  ? 17  ARG F NH2 1 
ATOM   2973 N  N   . LYS D 4 18  ? 55.99390 -6.47795  4.28886   1.000 82.82415  ? 18  LYS F N   1 
ATOM   2974 C  CA  . LYS D 4 18  ? 56.11054 -5.04235  4.07222   1.000 81.30199  ? 18  LYS F CA  1 
ATOM   2975 C  C   . LYS D 4 18  ? 57.52049 -4.65559  3.62798   1.000 82.72073  ? 18  LYS F C   1 
ATOM   2976 O  O   . LYS D 4 18  ? 57.68804 -3.78987  2.76047   1.000 84.28142  ? 18  LYS F O   1 
ATOM   2977 C  CB  . LYS D 4 18  ? 55.71217 -4.30178  5.34588   1.000 80.31425  ? 18  LYS F CB  1 
ATOM   2978 C  CG  . LYS D 4 18  ? 54.68707 -3.20806  5.12350   1.000 82.07686  ? 18  LYS F CG  1 
ATOM   2979 C  CD  . LYS D 4 18  ? 53.26962 -3.73991  5.14033   1.000 82.16515  ? 18  LYS F CD  1 
ATOM   2980 C  CE  . LYS D 4 18  ? 52.28697 -2.59373  5.27353   1.000 82.10466  ? 18  LYS F CE  1 
ATOM   2981 N  NZ  . LYS D 4 18  ? 50.88706 -3.07928  5.39027   1.000 82.00104  ? 18  LYS F NZ  1 
ATOM   2982 N  N   . ILE D 4 19  ? 58.54529 -5.30551  4.18584   1.000 82.07005  ? 19  ILE F N   1 
ATOM   2983 C  CA  . ILE D 4 19  ? 59.92369 -4.98911  3.81729   1.000 81.28080  ? 19  ILE F CA  1 
ATOM   2984 C  C   . ILE D 4 19  ? 60.20395 -5.37034  2.36472   1.000 85.04687  ? 19  ILE F C   1 
ATOM   2985 O  O   . ILE D 4 19  ? 60.87006 -4.62950  1.63074   1.000 86.49121  ? 19  ILE F O   1 
ATOM   2986 C  CB  . ILE D 4 19  ? 60.88849 -5.67830  4.79564   1.000 79.02300  ? 19  ILE F CB  1 
ATOM   2987 C  CG1 . ILE D 4 19  ? 60.67773 -5.11697  6.19561   1.000 78.61509  ? 19  ILE F CG1 1 
ATOM   2988 C  CG2 . ILE D 4 19  ? 62.34000 -5.51038  4.36446   1.000 77.31057  ? 19  ILE F CG2 1 
ATOM   2989 C  CD1 . ILE D 4 19  ? 61.67302 -5.62842  7.18937   1.000 81.34876  ? 19  ILE F CD1 1 
ATOM   2990 N  N   . GLU D 4 20  ? 59.70230 -6.52674  1.92627   1.000 87.66320  ? 20  GLU F N   1 
ATOM   2991 C  CA  . GLU D 4 20  ? 59.83760 -6.91776  0.52473   1.000 93.03827  ? 20  GLU F CA  1 
ATOM   2992 C  C   . GLU D 4 20  ? 59.20592 -5.88025  -0.39560  1.000 93.69054  ? 20  GLU F C   1 
ATOM   2993 O  O   . GLU D 4 20  ? 59.75551 -5.55327  -1.45659  1.000 91.29537  ? 20  GLU F O   1 
ATOM   2994 C  CB  . GLU D 4 20  ? 59.18387 -8.28045  0.30535   1.000 96.77305  ? 20  GLU F CB  1 
ATOM   2995 C  CG  . GLU D 4 20  ? 59.67830 -9.34684  1.25306   1.000 101.72587 ? 20  GLU F CG  1 
ATOM   2996 C  CD  . GLU D 4 20  ? 58.95837 -10.66706 1.08215   1.000 105.78767 ? 20  GLU F CD  1 
ATOM   2997 O  OE1 . GLU D 4 20  ? 57.92293 -10.70499 0.38442   1.000 107.90615 ? 20  GLU F OE1 1 
ATOM   2998 O  OE2 . GLU D 4 20  ? 59.43195 -11.66926 1.65154   1.000 107.48725 ? 20  GLU F OE2 1 
ATOM   2999 N  N   . GLN D 4 21  ? 58.03054 -5.37251  -0.01008  1.000 91.69748  ? 21  GLN F N   1 
ATOM   3000 C  CA  . GLN D 4 21  ? 57.34262 -4.36507  -0.80789  1.000 88.59599  ? 21  GLN F CA  1 
ATOM   3001 C  C   . GLN D 4 21  ? 58.13246 -3.06713  -0.85140  1.000 86.91087  ? 21  GLN F C   1 
ATOM   3002 O  O   . GLN D 4 21  ? 58.16733 -2.38857  -1.88354  1.000 88.02858  ? 21  GLN F O   1 
ATOM   3003 C  CB  . GLN D 4 21  ? 55.94682 -4.12111  -0.23886  1.000 87.27475  ? 21  GLN F CB  1 
ATOM   3004 C  CG  . GLN D 4 21  ? 54.96254 -5.23762  -0.51316  1.000 88.61080  ? 21  GLN F CG  1 
ATOM   3005 C  CD  . GLN D 4 21  ? 53.61620 -4.99733  0.13694   1.000 88.18772  ? 21  GLN F CD  1 
ATOM   3006 O  OE1 . GLN D 4 21  ? 53.49813 -4.19679  1.06573   1.000 87.75205  ? 21  GLN F OE1 1 
ATOM   3007 N  NE2 . GLN D 4 21  ? 52.59464 -5.70634  -0.33347  1.000 88.17827  ? 21  GLN F NE2 1 
ATOM   3008 N  N   . TRP D 4 22  ? 58.78167 -2.70352  0.25424   1.000 84.83903  ? 22  TRP F N   1 
ATOM   3009 C  CA  . TRP D 4 22  ? 59.52355 -1.45016  0.26155   1.000 83.95103  ? 22  TRP F CA  1 
ATOM   3010 C  C   . TRP D 4 22  ? 60.79788 -1.56649  -0.56504  1.000 85.84364  ? 22  TRP F C   1 
ATOM   3011 O  O   . TRP D 4 22  ? 61.09730 -0.68845  -1.38137  1.000 85.64888  ? 22  TRP F O   1 
ATOM   3012 C  CB  . TRP D 4 22  ? 59.84491 -1.03223  1.69173   1.000 82.90667  ? 22  TRP F CB  1 
ATOM   3013 C  CG  . TRP D 4 22  ? 60.44077 0.33347   1.78904   1.000 84.73606  ? 22  TRP F CG  1 
ATOM   3014 C  CD1 . TRP D 4 22  ? 59.80975 1.52083   1.55008   1.000 85.63843  ? 22  TRP F CD1 1 
ATOM   3015 C  CD2 . TRP D 4 22  ? 61.77647 0.66231   2.18544   1.000 87.08223  ? 22  TRP F CD2 1 
ATOM   3016 N  NE1 . TRP D 4 22  ? 60.67821 2.57382   1.76014   1.000 86.54690  ? 22  TRP F NE1 1 
ATOM   3017 C  CE2 . TRP D 4 22  ? 61.88992 2.07148   2.15302   1.000 86.55449  ? 22  TRP F CE2 1 
ATOM   3018 C  CE3 . TRP D 4 22  ? 62.88788 -0.09582  2.56129   1.000 90.73474  ? 22  TRP F CE3 1 
ATOM   3019 C  CZ2 . TRP D 4 22  ? 63.06417 2.73080   2.48056   1.000 87.95664  ? 22  TRP F CZ2 1 
ATOM   3020 C  CZ3 . TRP D 4 22  ? 64.05158 0.56228   2.88722   1.000 93.41978  ? 22  TRP F CZ3 1 
ATOM   3021 C  CH2 . TRP D 4 22  ? 64.13163 1.96282   2.84311   1.000 92.06021  ? 22  TRP F CH2 1 
ATOM   3022 N  N   . HIS D 4 23  ? 61.55434 -2.65687  -0.37759  1.000 88.02809  ? 23  HIS F N   1 
ATOM   3023 C  CA  . HIS D 4 23  ? 62.80460 -2.83393  -1.11328  1.000 87.90450  ? 23  HIS F CA  1 
ATOM   3024 C  C   . HIS D 4 23  ? 62.57018 -2.90040  -2.61361  1.000 86.65856  ? 23  HIS F C   1 
ATOM   3025 O  O   . HIS D 4 23  ? 63.33361 -2.31724  -3.39015  1.000 84.26202  ? 23  HIS F O   1 
ATOM   3026 C  CB  . HIS D 4 23  ? 63.52918 -4.08649  -0.62995  1.000 92.32336  ? 23  HIS F CB  1 
ATOM   3027 C  CG  . HIS D 4 23  ? 64.39298 -3.85605  0.57094   1.000 96.54204  ? 23  HIS F CG  1 
ATOM   3028 N  ND1 . HIS D 4 23  ? 63.93148 -4.00084  1.86208   1.000 97.83959  ? 23  HIS F ND1 1 
ATOM   3029 C  CD2 . HIS D 4 23  ? 65.69223 -3.48905  0.67619   1.000 99.13868  ? 23  HIS F CD2 1 
ATOM   3030 C  CE1 . HIS D 4 23  ? 64.90765 -3.72875  2.71086   1.000 98.85102  ? 23  HIS F CE1 1 
ATOM   3031 N  NE2 . HIS D 4 23  ? 65.98745 -3.41647  2.01689   1.000 99.86145  ? 23  HIS F NE2 1 
ATOM   3032 N  N   . SER D 4 24  ? 61.51190 -3.59403  -3.04031  1.000 90.11926  ? 24  SER F N   1 
ATOM   3033 C  CA  . SER D 4 24  ? 61.19726 -3.65477  -4.46396  1.000 95.91896  ? 24  SER F CA  1 
ATOM   3034 C  C   . SER D 4 24  ? 60.92049 -2.26549  -5.03537  1.000 100.26085 ? 24  SER F C   1 
ATOM   3035 O  O   . SER D 4 24  ? 61.24636 -1.99875  -6.19859  1.000 106.47813 ? 24  SER F O   1 
ATOM   3036 C  CB  . SER D 4 24  ? 60.00821 -4.58729  -4.70453  1.000 94.23432  ? 24  SER F CB  1 
ATOM   3037 O  OG  . SER D 4 24  ? 58.78405 -3.92974  -4.44345  1.000 93.46056  ? 24  SER F OG  1 
ATOM   3038 N  N   . LEU D 4 25  ? 60.33169 -1.36791  -4.23532  1.000 91.39354  ? 25  LEU F N   1 
ATOM   3039 C  CA  . LEU D 4 25  ? 60.04021 -0.01609  -4.70476  1.000 84.22236  ? 25  LEU F CA  1 
ATOM   3040 C  C   . LEU D 4 25  ? 61.29041 0.84880   -4.76029  1.000 83.46769  ? 25  LEU F C   1 
ATOM   3041 O  O   . LEU D 4 25  ? 61.43693 1.66972   -5.67294  1.000 84.10722  ? 25  LEU F O   1 
ATOM   3042 C  CB  . LEU D 4 25  ? 58.98382 0.63930   -3.81970  1.000 80.33481  ? 25  LEU F CB  1 
ATOM   3043 C  CG  . LEU D 4 25  ? 57.55711 0.14605   -4.02852  1.000 79.19692  ? 25  LEU F CG  1 
ATOM   3044 C  CD1 . LEU D 4 25  ? 56.61392 0.93811   -3.15147  1.000 77.73015  ? 25  LEU F CD1 1 
ATOM   3045 C  CD2 . LEU D 4 25  ? 57.18014 0.29602   -5.49504  1.000 79.58302  ? 25  LEU F CD2 1 
ATOM   3046 N  N   . VAL D 4 26  ? 62.19373 0.68146   -3.79601  1.000 84.06790  ? 26  VAL F N   1 
ATOM   3047 C  CA  . VAL D 4 26  ? 63.44410 1.43536   -3.79370  1.000 88.21069  ? 26  VAL F CA  1 
ATOM   3048 C  C   . VAL D 4 26  ? 64.32795 1.02527   -4.97117  1.000 97.88169  ? 26  VAL F C   1 
ATOM   3049 O  O   . VAL D 4 26  ? 64.85339 1.87847   -5.69683  1.000 101.47820 ? 26  VAL F O   1 
ATOM   3050 C  CB  . VAL D 4 26  ? 64.15367 1.25141   -2.44191  1.000 84.78777  ? 26  VAL F CB  1 
ATOM   3051 C  CG1 . VAL D 4 26  ? 65.57060 1.77408   -2.48191  1.000 61.23704  ? 26  VAL F CG1 1 
ATOM   3052 C  CG2 . VAL D 4 26  ? 63.37693 1.98085   -1.38905  1.000 58.70059  ? 26  VAL F CG2 1 
ATOM   3053 N  N   . LYS D 4 27  ? 64.50509 -0.28576  -5.18133  1.000 102.37247 ? 27  LYS F N   1 
ATOM   3054 C  CA  . LYS D 4 27  ? 65.33656 -0.74951  -6.29142  1.000 109.08306 ? 27  LYS F CA  1 
ATOM   3055 C  C   . LYS D 4 27  ? 64.75967 -0.34891  -7.64238  1.000 109.01954 ? 27  LYS F C   1 
ATOM   3056 O  O   . LYS D 4 27  ? 65.51641 -0.10974  -8.58935  1.000 111.90948 ? 27  LYS F O   1 
ATOM   3057 C  CB  . LYS D 4 27  ? 65.54040 -2.26610  -6.23678  1.000 114.46355 ? 27  LYS F CB  1 
ATOM   3058 C  CG  . LYS D 4 27  ? 66.39655 -2.74058  -5.06874  1.000 118.56421 ? 27  LYS F CG  1 
ATOM   3059 C  CD  . LYS D 4 27  ? 67.88297 -2.66834  -5.39181  1.000 125.19523 ? 27  LYS F CD  1 
ATOM   3060 C  CE  . LYS D 4 27  ? 68.30284 -3.76536  -6.35680  1.000 134.69078 ? 27  LYS F CE  1 
ATOM   3061 N  NZ  . LYS D 4 27  ? 69.77454 -3.79325  -6.60444  1.000 138.83115 ? 27  LYS F NZ  1 
ATOM   3062 N  N   . TYR D 4 28  ? 63.43365 -0.29073  -7.76634  1.000 103.25078 ? 28  TYR F N   1 
ATOM   3063 C  CA  . TYR D 4 28  ? 62.85541 0.09623   -9.04695  1.000 100.58153 ? 28  TYR F CA  1 
ATOM   3064 C  C   . TYR D 4 28  ? 63.14810 1.54814   -9.37479  1.000 99.07345  ? 28  TYR F C   1 
ATOM   3065 O  O   . TYR D 4 28  ? 63.48975 1.86812   -10.51782 1.000 101.81668 ? 28  TYR F O   1 
ATOM   3066 C  CB  . TYR D 4 28  ? 61.35023 -0.13167  -9.05599  1.000 98.99430  ? 28  TYR F CB  1 
ATOM   3067 C  CG  . TYR D 4 28  ? 60.66909 0.48300   -10.26109 1.000 98.61290  ? 28  TYR F CG  1 
ATOM   3068 C  CD1 . TYR D 4 28  ? 60.65332 -0.17418  -11.48535 1.000 99.17856  ? 28  TYR F CD1 1 
ATOM   3069 C  CD2 . TYR D 4 28  ? 60.03399 1.71839   -10.17329 1.000 97.51992  ? 28  TYR F CD2 1 
ATOM   3070 C  CE1 . TYR D 4 28  ? 60.03052 0.38113   -12.58898 1.000 98.38910  ? 28  TYR F CE1 1 
ATOM   3071 C  CE2 . TYR D 4 28  ? 59.40884 2.28295   -11.27346 1.000 95.97361  ? 28  TYR F CE2 1 
ATOM   3072 C  CZ  . TYR D 4 28  ? 59.40941 1.60906   -12.47552 1.000 96.32293  ? 28  TYR F CZ  1 
ATOM   3073 O  OH  . TYR D 4 28  ? 58.78739 2.16275   -13.56808 1.000 95.52834  ? 28  TYR F OH  1 
ATOM   3074 N  N   . HIS D 4 29  ? 63.00967 2.44460   -8.39698  1.000 95.15304  ? 29  HIS F N   1 
ATOM   3075 C  CA  . HIS D 4 29  ? 63.15007 3.86153   -8.69903  1.000 93.26231  ? 29  HIS F CA  1 
ATOM   3076 C  C   . HIS D 4 29  ? 64.59618 4.33186   -8.78797  1.000 96.86786  ? 29  HIS F C   1 
ATOM   3077 O  O   . HIS D 4 29  ? 64.82314 5.46822   -9.21310  1.000 98.58788  ? 29  HIS F O   1 
ATOM   3078 C  CB  . HIS D 4 29  ? 62.39856 4.69918   -7.65773  1.000 89.59039  ? 29  HIS F CB  1 
ATOM   3079 C  CG  . HIS D 4 29  ? 60.91295 4.67666   -7.83369  1.000 87.77296  ? 29  HIS F CG  1 
ATOM   3080 N  ND1 . HIS D 4 29  ? 60.29180 5.16055   -8.96478  1.000 87.04187  ? 29  HIS F ND1 1 
ATOM   3081 C  CD2 . HIS D 4 29  ? 59.92488 4.21505   -7.03126  1.000 87.52836  ? 29  HIS F CD2 1 
ATOM   3082 C  CE1 . HIS D 4 29  ? 58.98474 5.00040   -8.84995  1.000 86.24651  ? 29  HIS F CE1 1 
ATOM   3083 N  NE2 . HIS D 4 29  ? 58.73508 4.42922   -7.68568  1.000 86.18213  ? 29  HIS F NE2 1 
ATOM   3084 N  N   . MET D 4 30  ? 65.58055 3.49835   -8.44573  1.000 99.64474  ? 30  MET F N   1 
ATOM   3085 C  CA  . MET D 4 30  ? 66.96832 3.87977   -8.68844  1.000 102.85566 ? 30  MET F CA  1 
ATOM   3086 C  C   . MET D 4 30  ? 67.51321 3.37601   -10.01987 1.000 104.61368 ? 30  MET F C   1 
ATOM   3087 O  O   . MET D 4 30  ? 68.45092 3.97852   -10.55688 1.000 104.61391 ? 30  MET F O   1 
ATOM   3088 C  CB  . MET D 4 30  ? 67.87571 3.41073   -7.53855  1.000 103.13302 ? 30  MET F CB  1 
ATOM   3089 C  CG  . MET D 4 30  ? 67.64399 1.99402   -7.03307  1.000 102.58821 ? 30  MET F CG  1 
ATOM   3090 S  SD  . MET D 4 30  ? 68.20046 1.75351   -5.31912  1.000 101.20917 ? 30  MET F SD  1 
ATOM   3091 C  CE  . MET D 4 30  ? 69.93117 2.17184   -5.46164  1.000 102.02281 ? 30  MET F CE  1 
ATOM   3092 N  N   . TYR D 4 31  ? 66.94694 2.31043   -10.58044 1.000 107.28352 ? 31  TYR F N   1 
ATOM   3093 C  CA  . TYR D 4 31  ? 67.58471 1.63959   -11.70671 1.000 119.28448 ? 31  TYR F CA  1 
ATOM   3094 C  C   . TYR D 4 31  ? 66.71088 1.54310   -12.94847 1.000 131.09072 ? 31  TYR F C   1 
ATOM   3095 O  O   . TYR D 4 31  ? 67.14062 1.96657   -14.03010 1.000 141.98250 ? 31  TYR F O   1 
ATOM   3096 C  CB  . TYR D 4 31  ? 68.04090 0.22773   -11.27329 1.000 118.18888 ? 31  TYR F CB  1 
ATOM   3097 C  CG  . TYR D 4 31  ? 69.18126 0.20879   -10.27015 1.000 115.57452 ? 31  TYR F CG  1 
ATOM   3098 C  CD1 . TYR D 4 31  ? 70.05802 1.27944   -10.16941 1.000 115.60891 ? 31  TYR F CD1 1 
ATOM   3099 C  CD2 . TYR D 4 31  ? 69.39550 -0.88863  -9.44054  1.000 116.60552 ? 31  TYR F CD2 1 
ATOM   3100 C  CE1 . TYR D 4 31  ? 71.10795 1.27315   -9.26611  1.000 114.77452 ? 31  TYR F CE1 1 
ATOM   3101 C  CE2 . TYR D 4 31  ? 70.45315 -0.90954  -8.52862  1.000 115.68085 ? 31  TYR F CE2 1 
ATOM   3102 C  CZ  . TYR D 4 31  ? 71.30574 0.17994   -8.44843  1.000 114.98898 ? 31  TYR F CZ  1 
ATOM   3103 O  OH  . TYR D 4 31  ? 72.36060 0.19449   -7.55889  1.000 114.11042 ? 31  TYR F OH  1 
ATOM   3104 N  N   . LYS D 4 32  ? 65.48682 1.02659   -12.83634 1.000 132.75975 ? 32  LYS F N   1 
ATOM   3105 C  CA  . LYS D 4 32  ? 64.69528 0.74894   -14.03114 1.000 135.78852 ? 32  LYS F CA  1 
ATOM   3106 C  C   . LYS D 4 32  ? 63.63303 1.79110   -14.34146 1.000 139.82203 ? 32  LYS F C   1 
ATOM   3107 O  O   . LYS D 4 32  ? 63.24421 1.91277   -15.50973 1.000 143.44497 ? 32  LYS F O   1 
ATOM   3108 C  CB  . LYS D 4 32  ? 64.03149 -0.63539  -13.93087 1.000 125.99669 ? 32  LYS F CB  1 
ATOM   3109 C  CG  . LYS D 4 32  ? 65.00650 -1.79587  -14.10435 1.000 120.80388 ? 32  LYS F CG  1 
ATOM   3110 C  CD  . LYS D 4 32  ? 65.63639 -1.73198  -15.49860 1.000 116.29301 ? 32  LYS F CD  1 
ATOM   3111 C  CE  . LYS D 4 32  ? 66.85434 -2.63455  -15.66281 1.000 113.38619 ? 32  LYS F CE  1 
ATOM   3112 N  NZ  . LYS D 4 32  ? 67.47703 -2.45525  -17.01048 1.000 112.04432 ? 32  LYS F NZ  1 
ATOM   3113 N  N   . GLY D 4 33  ? 63.15559 2.54285   -13.35332 1.000 142.98287 ? 33  GLY F N   1 
ATOM   3114 C  CA  . GLY D 4 33  ? 62.09935 3.50818   -13.59431 1.000 136.75360 ? 33  GLY F CA  1 
ATOM   3115 C  C   . GLY D 4 33  ? 62.57763 4.73349   -14.34359 1.000 131.81742 ? 33  GLY F C   1 
ATOM   3116 O  O   . GLY D 4 33  ? 63.44456 4.64483   -15.22180 1.000 133.34621 ? 33  GLY F O   1 
ATOM   3117 N  N   . LYS D 4 34  ? 61.99903 5.88390   -14.01863 1.000 125.94151 ? 34  LYS F N   1 
ATOM   3118 C  CA  . LYS D 4 34  ? 62.52059 7.15469   -14.49506 1.000 119.87863 ? 34  LYS F CA  1 
ATOM   3119 C  C   . LYS D 4 34  ? 63.68785 7.63544   -13.63785 1.000 116.98432 ? 34  LYS F C   1 
ATOM   3120 O  O   . LYS D 4 34  ? 64.06326 8.81168   -13.71536 1.000 112.56447 ? 34  LYS F O   1 
ATOM   3121 C  CB  . LYS D 4 34  ? 61.40726 8.20710   -14.52533 1.000 120.79376 ? 34  LYS F CB  1 
ATOM   3122 C  CG  . LYS D 4 34  ? 60.37314 7.98476   -15.62153 1.000 121.24212 ? 34  LYS F CG  1 
ATOM   3123 C  CD  . LYS D 4 34  ? 59.43265 9.17026   -15.76583 1.000 120.46888 ? 34  LYS F CD  1 
ATOM   3124 C  CE  . LYS D 4 34  ? 60.17541 10.39303  -16.28088 1.000 121.74197 ? 34  LYS F CE  1 
ATOM   3125 N  NZ  . LYS D 4 34  ? 60.84568 10.14407  -17.59053 1.000 123.40821 ? 34  LYS F NZ  1 
ATOM   3126 N  N   . LYS D 4 35  ? 64.24003 6.73141   -12.82087 1.000 114.85121 ? 35  LYS F N   1 
ATOM   3127 C  CA  . LYS D 4 35  ? 65.40936 6.97846   -11.98087 1.000 113.48099 ? 35  LYS F CA  1 
ATOM   3128 C  C   . LYS D 4 35  ? 65.16762 8.13449   -11.01380 1.000 105.99372 ? 35  LYS F C   1 
ATOM   3129 O  O   . LYS D 4 35  ? 66.00986 9.01312   -10.83836 1.000 105.43015 ? 35  LYS F O   1 
ATOM   3130 C  CB  . LYS D 4 35  ? 66.64845 7.22196   -12.84338 1.000 118.17143 ? 35  LYS F CB  1 
ATOM   3131 C  CG  . LYS D 4 35  ? 66.93622 6.07422   -13.80852 1.000 120.57531 ? 35  LYS F CG  1 
ATOM   3132 C  CD  . LYS D 4 35  ? 67.96470 6.45389   -14.86860 1.000 123.04011 ? 35  LYS F CD  1 
ATOM   3133 C  CE  . LYS D 4 35  ? 68.20400 5.29882   -15.83658 1.000 124.40500 ? 35  LYS F CE  1 
ATOM   3134 N  NZ  . LYS D 4 35  ? 69.10607 5.69581   -16.95266 1.000 125.43373 ? 35  LYS F NZ  1 
ATOM   3135 N  N   . GLU D 4 36  ? 63.98946 8.12041   -10.38067 1.000 102.82319 ? 36  GLU F N   1 
ATOM   3136 C  CA  . GLU D 4 36  ? 63.62933 9.15808   -9.41676  1.000 101.91158 ? 36  GLU F CA  1 
ATOM   3137 C  C   . GLU D 4 36  ? 64.46897 9.05183   -8.15283  1.000 98.62877  ? 36  GLU F C   1 
ATOM   3138 O  O   . GLU D 4 36  ? 64.78835 10.06639  -7.52500  1.000 98.09811  ? 36  GLU F O   1 
ATOM   3139 C  CB  . GLU D 4 36  ? 62.14224 9.06551   -9.06523  1.000 104.53081 ? 36  GLU F CB  1 
ATOM   3140 C  CG  . GLU D 4 36  ? 61.18394 9.03819   -10.26230 1.000 110.96820 ? 36  GLU F CG  1 
ATOM   3141 C  CD  . GLU D 4 36  ? 60.76192 10.42702  -10.72925 1.000 116.10729 ? 36  GLU F CD  1 
ATOM   3142 O  OE1 . GLU D 4 36  ? 61.26397 11.42739  -10.16972 1.000 116.93295 ? 36  GLU F OE1 1 
ATOM   3143 O  OE2 . GLU D 4 36  ? 59.91937 10.51531  -11.65209 1.000 117.05993 ? 36  GLU F OE2 1 
ATOM   3144 N  N   . ALA D 4 37  ? 64.81457 7.83343   -7.75948  1.000 97.66658  ? 37  ALA F N   1 
ATOM   3145 C  CA  . ALA D 4 37  ? 65.64403 7.57589   -6.59581  1.000 95.96212  ? 37  ALA F CA  1 
ATOM   3146 C  C   . ALA D 4 37  ? 67.04642 7.16199   -7.02152  1.000 98.36471  ? 37  ALA F C   1 
ATOM   3147 O  O   . ALA D 4 37  ? 67.70753 6.37528   -6.34058  1.000 99.57320  ? 37  ALA F O   1 
ATOM   3148 C  CB  . ALA D 4 37  ? 64.99927 6.51051   -5.71153  1.000 92.55450  ? 37  ALA F CB  1 
ATOM   3149 N  N   . ARG D 4 38  ? 67.50286 7.69626   -8.15739  1.000 98.91355  ? 38  ARG F N   1 
ATOM   3150 C  CA  . ARG D 4 38  ? 68.78646 7.29476   -8.71759  1.000 102.22740 ? 38  ARG F CA  1 
ATOM   3151 C  C   . ARG D 4 38  ? 69.93355 7.57479   -7.75989  1.000 102.49872 ? 38  ARG F C   1 
ATOM   3152 O  O   . ARG D 4 38  ? 70.91302 6.82157   -7.73315  1.000 105.40657 ? 38  ARG F O   1 
ATOM   3153 C  CB  . ARG D 4 38  ? 69.01305 8.01839   -10.04328 1.000 107.02466 ? 38  ARG F CB  1 
ATOM   3154 C  CG  . ARG D 4 38  ? 70.19393 7.52274   -10.84348 1.000 114.94418 ? 38  ARG F CG  1 
ATOM   3155 C  CD  . ARG D 4 38  ? 70.29700 8.29089   -12.14547 1.000 120.89925 ? 38  ARG F CD  1 
ATOM   3156 N  NE  . ARG D 4 38  ? 70.34244 9.72959   -11.90428 1.000 124.52690 ? 38  ARG F NE  1 
ATOM   3157 C  CZ  . ARG D 4 38  ? 70.47488 10.64413  -12.85797 1.000 128.21655 ? 38  ARG F CZ  1 
ATOM   3158 N  NH1 . ARG D 4 38  ? 70.57193 10.27040  -14.12751 1.000 128.49863 ? 38  ARG F NH1 1 
ATOM   3159 N  NH2 . ARG D 4 38  ? 70.50983 11.93296  -12.54089 1.000 130.03796 ? 38  ARG F NH2 1 
ATOM   3160 N  N   . GLU D 4 39  ? 69.82146 8.62391   -6.94933  1.000 100.15742 ? 39  GLU F N   1 
ATOM   3161 C  CA  . GLU D 4 39  ? 70.86312 8.97868   -5.99714  1.000 99.27647  ? 39  GLU F CA  1 
ATOM   3162 C  C   . GLU D 4 39  ? 70.74736 8.23121   -4.67349  1.000 98.81672  ? 39  GLU F C   1 
ATOM   3163 O  O   . GLU D 4 39  ? 71.53132 8.50340   -3.75773  1.000 98.99696  ? 39  GLU F O   1 
ATOM   3164 C  CB  . GLU D 4 39  ? 70.85962 10.49329  -5.75888  1.000 98.54008  ? 39  GLU F CB  1 
ATOM   3165 C  CG  . GLU D 4 39  ? 70.92056 11.34300  -7.04420  1.000 100.93422 ? 39  GLU F CG  1 
ATOM   3166 C  CD  . GLU D 4 39  ? 72.18212 11.12551  -7.90077  1.000 105.59359 ? 39  GLU F CD  1 
ATOM   3167 O  OE1 . GLU D 4 39  ? 73.18387 10.54673  -7.41722  1.000 107.99875 ? 39  GLU F OE1 1 
ATOM   3168 O  OE2 . GLU D 4 39  ? 72.16995 11.55353  -9.07708  1.000 105.80262 ? 39  GLU F OE2 1 
ATOM   3169 N  N   . TRP D 4 40  ? 69.79395 7.30967   -4.54537  1.000 98.74736  ? 40  TRP F N   1 
ATOM   3170 C  CA  . TRP D 4 40  ? 69.70337 6.46840   -3.36088  1.000 100.33340 ? 40  TRP F CA  1 
ATOM   3171 C  C   . TRP D 4 40  ? 70.76305 5.36701   -3.40720  1.000 104.33579 ? 40  TRP F C   1 
ATOM   3172 O  O   . TRP D 4 40  ? 71.34518 5.06496   -4.45218  1.000 104.62746 ? 40  TRP F O   1 
ATOM   3173 C  CB  . TRP D 4 40  ? 68.30885 5.85108   -3.23234  1.000 98.23232  ? 40  TRP F CB  1 
ATOM   3174 C  CG  . TRP D 4 40  ? 67.20569 6.85483   -3.01358  1.000 95.70540  ? 40  TRP F CG  1 
ATOM   3175 C  CD1 . TRP D 4 40  ? 67.21925 8.17268   -3.35497  1.000 93.40068  ? 40  TRP F CD1 1 
ATOM   3176 C  CD2 . TRP D 4 40  ? 65.93974 6.61827   -2.38215  1.000 96.38759  ? 40  TRP F CD2 1 
ATOM   3177 N  NE1 . TRP D 4 40  ? 66.04037 8.76844   -2.99525  1.000 92.98641  ? 40  TRP F NE1 1 
ATOM   3178 C  CE2 . TRP D 4 40  ? 65.23605 7.83770   -2.39460  1.000 95.77366  ? 40  TRP F CE2 1 
ATOM   3179 C  CE3 . TRP D 4 40  ? 65.32923 5.49179   -1.81561  1.000 96.10061  ? 40  TRP F CE3 1 
ATOM   3180 C  CZ2 . TRP D 4 40  ? 63.95103 7.96906   -1.85758  1.000 96.58644  ? 40  TRP F CZ2 1 
ATOM   3181 C  CZ3 . TRP D 4 40  ? 64.05026 5.62187   -1.28578  1.000 95.64083  ? 40  TRP F CZ3 1 
ATOM   3182 C  CH2 . TRP D 4 40  ? 63.37711 6.85195   -1.30908  1.000 95.88242  ? 40  TRP F CH2 1 
ATOM   3183 N  N   . GLU D 4 41  ? 70.98624 4.74210   -2.25442  1.000 108.23731 ? 41  GLU F N   1 
ATOM   3184 C  CA  . GLU D 4 41  ? 72.03079 3.74299   -2.08838  1.000 111.84838 ? 41  GLU F CA  1 
ATOM   3185 C  C   . GLU D 4 41  ? 71.47544 2.55994   -1.31034  1.000 109.62148 ? 41  GLU F C   1 
ATOM   3186 O  O   . GLU D 4 41  ? 70.89357 2.74413   -0.23876  1.000 108.41100 ? 41  GLU F O   1 
ATOM   3187 C  CB  . GLU D 4 41  ? 73.22782 4.36921   -1.36303  1.000 118.69223 ? 41  GLU F CB  1 
ATOM   3188 C  CG  . GLU D 4 41  ? 74.44588 3.49091   -1.19894  1.000 126.30788 ? 41  GLU F CG  1 
ATOM   3189 C  CD  . GLU D 4 41  ? 75.52528 4.17062   -0.37459  1.000 133.33541 ? 41  GLU F CD  1 
ATOM   3190 O  OE1 . GLU D 4 41  ? 75.20092 5.14965   0.33371   1.000 132.51073 ? 41  GLU F OE1 1 
ATOM   3191 O  OE2 . GLU D 4 41  ? 76.69371 3.73061   -0.43486  1.000 138.51210 ? 41  GLU F OE2 1 
ATOM   3192 N  N   . TYR D 4 42  ? 71.66697 1.34842   -1.83374  1.000 109.29819 ? 42  TYR F N   1 
ATOM   3193 C  CA  . TYR D 4 42  ? 71.15726 0.12891   -1.21000  1.000 109.22587 ? 42  TYR F CA  1 
ATOM   3194 C  C   . TYR D 4 42  ? 72.32180 -0.74194  -0.76712  1.000 108.64145 ? 42  TYR F C   1 
ATOM   3195 O  O   . TYR D 4 42  ? 73.25181 -0.98515  -1.54328  1.000 109.82217 ? 42  TYR F O   1 
ATOM   3196 C  CB  . TYR D 4 42  ? 70.23439 -0.65024  -2.16359  1.000 112.54302 ? 42  TYR F CB  1 
ATOM   3197 C  CG  . TYR D 4 42  ? 69.91282 -2.06173  -1.70125  1.000 115.09195 ? 42  TYR F CG  1 
ATOM   3198 C  CD1 . TYR D 4 42  ? 69.03722 -2.28192  -0.64878  1.000 114.24531 ? 42  TYR F CD1 1 
ATOM   3199 C  CD2 . TYR D 4 42  ? 70.47099 -3.17461  -2.32913  1.000 118.23791 ? 42  TYR F CD2 1 
ATOM   3200 C  CE1 . TYR D 4 42  ? 68.73655 -3.56562  -0.21242  1.000 114.91167 ? 42  TYR F CE1 1 
ATOM   3201 C  CE2 . TYR D 4 42  ? 70.17066 -4.47157  -1.90039  1.000 118.59699 ? 42  TYR F CE2 1 
ATOM   3202 C  CZ  . TYR D 4 42  ? 69.29829 -4.65592  -0.83827  1.000 117.58033 ? 42  TYR F CZ  1 
ATOM   3203 O  OH  . TYR D 4 42  ? 68.97676 -5.91790  -0.38120  1.000 117.31078 ? 42  TYR F OH  1 
ATOM   3204 N  N   . VAL D 4 43  ? 72.27561 -1.19595  0.48111   1.000 107.16177 ? 43  VAL F N   1 
ATOM   3205 C  CA  . VAL D 4 43  ? 73.33723 -1.98902  1.08884   1.000 107.87455 ? 43  VAL F CA  1 
ATOM   3206 C  C   . VAL D 4 43  ? 72.77566 -3.37710  1.38377   1.000 112.24020 ? 43  VAL F C   1 
ATOM   3207 O  O   . VAL D 4 43  ? 71.79728 -3.49683  2.12846   1.000 111.32764 ? 43  VAL F O   1 
ATOM   3208 C  CB  . VAL D 4 43  ? 73.88637 -1.33468  2.37004   1.000 99.42730  ? 43  VAL F CB  1 
ATOM   3209 C  CG1 . VAL D 4 43  ? 75.18960 -1.98285  2.77486   1.000 99.18335  ? 43  VAL F CG1 1 
ATOM   3210 C  CG2 . VAL D 4 43  ? 74.08442 0.16237   2.16740   1.000 96.13992  ? 43  VAL F CG2 1 
ATOM   3211 N  N   . PRO D 4 44  ? 73.34252 -4.44748  0.82101   1.000 118.09975 ? 44  PRO F N   1 
ATOM   3212 C  CA  . PRO D 4 44  ? 72.83655 -5.80315  1.10132   1.000 119.94091 ? 44  PRO F CA  1 
ATOM   3213 C  C   . PRO D 4 44  ? 73.19414 -6.25049  2.51362   1.000 121.42018 ? 44  PRO F C   1 
ATOM   3214 O  O   . PRO D 4 44  ? 73.88666 -5.55168  3.24752   1.000 120.44522 ? 44  PRO F O   1 
ATOM   3215 C  CB  . PRO D 4 44  ? 73.54225 -6.67120  0.04708   1.000 122.70413 ? 44  PRO F CB  1 
ATOM   3216 C  CG  . PRO D 4 44  ? 74.10455 -5.68888  -0.97365  1.000 122.20652 ? 44  PRO F CG  1 
ATOM   3217 C  CD  . PRO D 4 44  ? 74.41828 -4.46205  -0.18330  1.000 120.87750 ? 44  PRO F CD  1 
ATOM   3218 N  N   . HIS D 4 45  ? 72.69356 -7.42646  2.90655   1.000 123.63126 ? 45  HIS F N   1 
ATOM   3219 C  CA  . HIS D 4 45  ? 72.92907 -7.88519  4.27567   1.000 127.05491 ? 45  HIS F CA  1 
ATOM   3220 C  C   . HIS D 4 45  ? 74.42253 -8.05612  4.55507   1.000 133.30035 ? 45  HIS F C   1 
ATOM   3221 O  O   . HIS D 4 45  ? 74.87760 -7.81779  5.67843   1.000 133.70317 ? 45  HIS F O   1 
ATOM   3222 C  CB  . HIS D 4 45  ? 72.18409 -9.19081  4.55505   1.000 125.73522 ? 45  HIS F CB  1 
ATOM   3223 C  CG  . HIS D 4 45  ? 72.20427 -10.15393 3.41457   1.000 126.40012 ? 45  HIS F CG  1 
ATOM   3224 N  ND1 . HIS D 4 45  ? 71.28791 -10.11202 2.38705   1.000 125.88070 ? 45  HIS F ND1 1 
ATOM   3225 C  CD2 . HIS D 4 45  ? 73.03790 -11.18421 3.13520   1.000 127.22526 ? 45  HIS F CD2 1 
ATOM   3226 C  CE1 . HIS D 4 45  ? 71.55516 -11.07625 1.52352   1.000 126.22327 ? 45  HIS F CE1 1 
ATOM   3227 N  NE2 . HIS D 4 45  ? 72.61233 -11.74108 1.95386   1.000 127.16625 ? 45  HIS F NE2 1 
ATOM   3228 N  N   . PHE D 4 46  ? 75.19443 -8.51434  3.56770   1.000 138.83871 ? 46  PHE F N   1 
ATOM   3229 C  CA  . PHE D 4 46  ? 76.64564 -8.50457  3.69896   1.000 144.89359 ? 46  PHE F CA  1 
ATOM   3230 C  C   . PHE D 4 46  ? 77.16458 -7.08400  3.46132   1.000 151.67008 ? 46  PHE F C   1 
ATOM   3231 O  O   . PHE D 4 46  ? 76.43620 -6.19992  3.00205   1.000 153.68899 ? 46  PHE F O   1 
ATOM   3232 C  CB  . PHE D 4 46  ? 77.30159 -9.47407  2.71640   1.000 143.97792 ? 46  PHE F CB  1 
ATOM   3233 C  CG  . PHE D 4 46  ? 76.71780 -9.43234  1.33323   1.000 143.06342 ? 46  PHE F CG  1 
ATOM   3234 C  CD1 . PHE D 4 46  ? 75.61649 -10.20248 0.99934   1.000 142.74571 ? 46  PHE F CD1 1 
ATOM   3235 C  CD2 . PHE D 4 46  ? 77.28100 -8.61714  0.36061   1.000 142.64470 ? 46  PHE F CD2 1 
ATOM   3236 C  CE1 . PHE D 4 46  ? 75.08121 -10.15526 -0.27521  1.000 142.72655 ? 46  PHE F CE1 1 
ATOM   3237 C  CE2 . PHE D 4 46  ? 76.75289 -8.56861  -0.91441  1.000 142.56081 ? 46  PHE F CE2 1 
ATOM   3238 C  CZ  . PHE D 4 46  ? 75.65043 -9.33931  -1.23235  1.000 142.69638 ? 46  PHE F CZ  1 
ATOM   3239 N  N   . LYS D 4 47  ? 78.43903 -6.85838  3.76671   1.000 153.02566 ? 47  LYS F N   1 
ATOM   3240 C  CA  . LYS D 4 47  ? 79.07780 -5.55534  3.58427   1.000 155.63765 ? 47  LYS F CA  1 
ATOM   3241 C  C   . LYS D 4 47  ? 78.43266 -4.43608  4.41093   1.000 148.51473 ? 47  LYS F C   1 
ATOM   3242 O  O   . LYS D 4 47  ? 78.75949 -3.25781  4.20719   1.000 146.45190 ? 47  LYS F O   1 
ATOM   3243 C  CB  . LYS D 4 47  ? 79.13932 -5.15039  2.09963   1.000 161.08046 ? 47  LYS F CB  1 
ATOM   3244 C  CG  . LYS D 4 47  ? 80.15413 -5.94465  1.26948   1.000 161.92648 ? 47  LYS F CG  1 
ATOM   3245 C  CD  . LYS D 4 47  ? 80.34446 -5.34246  -0.12377  1.000 161.56976 ? 47  LYS F CD  1 
ATOM   3246 C  CE  . LYS D 4 47  ? 80.61527 -3.83862  -0.07161  1.000 159.51105 ? 47  LYS F CE  1 
ATOM   3247 N  NZ  . LYS D 4 47  ? 81.89800 -3.49599  0.60322   1.000 159.73134 ? 47  LYS F NZ  1 
ATOM   3248 N  N   . VAL D 4 48  ? 77.49381 -4.75614  5.30077   1.000 148.29954 ? 48  VAL F N   1 
ATOM   3249 C  CA  . VAL D 4 48  ? 76.99324 -3.77634  6.26413   1.000 145.19856 ? 48  VAL F CA  1 
ATOM   3250 C  C   . VAL D 4 48  ? 77.93207 -3.88611  7.45697   1.000 151.77142 ? 48  VAL F C   1 
ATOM   3251 O  O   . VAL D 4 48  ? 78.46902 -4.97668  7.70750   1.000 153.16823 ? 48  VAL F O   1 
ATOM   3252 C  CB  . VAL D 4 48  ? 75.53758 -4.02355  6.70401   1.000 138.02129 ? 48  VAL F CB  1 
ATOM   3253 C  CG1 . VAL D 4 48  ? 74.59989 -3.95346  5.55738   1.000 135.91274 ? 48  VAL F CG1 1 
ATOM   3254 C  CG2 . VAL D 4 48  ? 75.39902 -5.34512  7.42686   1.000 135.15941 ? 48  VAL F CG2 1 
ATOM   3255 N  N   . PRO D 4 49  ? 78.20944 -2.79934  8.17605   1.000 157.11030 ? 49  PRO F N   1 
ATOM   3256 C  CA  . PRO D 4 49  ? 78.92970 -2.93007  9.44825   1.000 162.61645 ? 49  PRO F CA  1 
ATOM   3257 C  C   . PRO D 4 49  ? 78.27202 -4.00394  10.29957  1.000 173.34380 ? 49  PRO F C   1 
ATOM   3258 O  O   . PRO D 4 49  ? 77.04739 -4.03772  10.44358  1.000 173.41887 ? 49  PRO F O   1 
ATOM   3259 C  CB  . PRO D 4 49  ? 78.80450 -1.53698  10.07661  1.000 159.55502 ? 49  PRO F CB  1 
ATOM   3260 C  CG  . PRO D 4 49  ? 77.68938 -0.86371  9.32202   1.000 155.69963 ? 49  PRO F CG  1 
ATOM   3261 C  CD  . PRO D 4 49  ? 77.77129 -1.41733  7.93656   1.000 155.23839 ? 49  PRO F CD  1 
ATOM   3262 N  N   . TRP D 4 50  ? 79.09615 -4.89987  10.84429  1.000 183.07036 ? 50  TRP F N   1 
ATOM   3263 C  CA  . TRP D 4 50  ? 78.59887 -6.18133  11.33328  1.000 188.17560 ? 50  TRP F CA  1 
ATOM   3264 C  C   . TRP D 4 50  ? 77.47394 -6.01250  12.34925  1.000 184.46898 ? 50  TRP F C   1 
ATOM   3265 O  O   . TRP D 4 50  ? 77.57319 -5.22197  13.29282  1.000 185.02330 ? 50  TRP F O   1 
ATOM   3266 C  CB  . TRP D 4 50  ? 79.73422 -6.99737  11.94689  1.000 196.31764 ? 50  TRP F CB  1 
ATOM   3267 C  CG  . TRP D 4 50  ? 79.24408 -8.29434  12.50593  1.000 199.60796 ? 50  TRP F CG  1 
ATOM   3268 C  CD1 . TRP D 4 50  ? 78.82043 -9.38308  11.79868  1.000 203.68699 ? 50  TRP F CD1 1 
ATOM   3269 C  CD2 . TRP D 4 50  ? 79.10644 -8.63651  13.89135  1.000 201.21439 ? 50  TRP F CD2 1 
ATOM   3270 N  NE1 . TRP D 4 50  ? 78.43309 -10.38350 12.65776  1.000 203.03417 ? 50  TRP F NE1 1 
ATOM   3271 C  CE2 . TRP D 4 50  ? 78.59963 -9.95105  13.94777  1.000 200.89362 ? 50  TRP F CE2 1 
ATOM   3272 C  CE3 . TRP D 4 50  ? 79.36754 -7.96127  15.08866  1.000 199.14716 ? 50  TRP F CE3 1 
ATOM   3273 C  CZ2 . TRP D 4 50  ? 78.34967 -10.60298 15.15325  1.000 200.93876 ? 50  TRP F CZ2 1 
ATOM   3274 C  CZ3 . TRP D 4 50  ? 79.11867 -8.60970  16.28322  1.000 199.63351 ? 50  TRP F CZ3 1 
ATOM   3275 C  CH2 . TRP D 4 50  ? 78.61485 -9.91737  16.30666  1.000 200.25390 ? 50  TRP F CH2 1 
ATOM   3276 N  N   . GLY D 4 51  ? 76.39872 -6.76527  12.14104  1.000 176.09213 ? 51  GLY F N   1 
ATOM   3277 C  CA  . GLY D 4 51  ? 75.27458 -6.80218  13.05280  1.000 165.37005 ? 51  GLY F CA  1 
ATOM   3278 C  C   . GLY D 4 51  ? 74.49602 -8.08807  12.87178  1.000 155.09493 ? 51  GLY F C   1 
ATOM   3279 O  O   . GLY D 4 51  ? 74.09466 -8.40835  11.74772  1.000 153.49208 ? 51  GLY F O   1 
ATOM   3280 N  N   . TRP D 4 52  ? 74.29751 -8.84427  13.95693  1.000 146.18775 ? 52  TRP F N   1 
ATOM   3281 C  CA  . TRP D 4 52  ? 73.54086 -10.09082 13.86945  1.000 138.80302 ? 52  TRP F CA  1 
ATOM   3282 C  C   . TRP D 4 52  ? 72.17502 -9.86188  13.23573  1.000 127.59759 ? 52  TRP F C   1 
ATOM   3283 O  O   . TRP D 4 52  ? 71.79768 -10.54945 12.28066  1.000 129.45300 ? 52  TRP F O   1 
ATOM   3284 C  CB  . TRP D 4 52  ? 73.38040 -10.71461 15.25928  1.000 140.49901 ? 52  TRP F CB  1 
ATOM   3285 C  CG  . TRP D 4 52  ? 72.85587 -12.13277 15.22565  1.000 143.01240 ? 52  TRP F CG  1 
ATOM   3286 C  CD1 . TRP D 4 52  ? 71.63988 -12.55308 14.75910  1.000 143.04946 ? 52  TRP F CD1 1 
ATOM   3287 C  CD2 . TRP D 4 52  ? 73.53558 -13.31001 15.68215  1.000 144.26775 ? 52  TRP F CD2 1 
ATOM   3288 N  NE1 . TRP D 4 52  ? 71.52775 -13.91638 14.88918  1.000 143.74307 ? 52  TRP F NE1 1 
ATOM   3289 C  CE2 . TRP D 4 52  ? 72.67590 -14.40436 15.45569  1.000 145.03552 ? 52  TRP F CE2 1 
ATOM   3290 C  CE3 . TRP D 4 52  ? 74.78813 -13.54443 16.25645  1.000 144.07835 ? 52  TRP F CE3 1 
ATOM   3291 C  CZ2 . TRP D 4 52  ? 73.02925 -15.71114 15.78589  1.000 147.45866 ? 52  TRP F CZ2 1 
ATOM   3292 C  CZ3 . TRP D 4 52  ? 75.13577 -14.84009 16.58400  1.000 145.50128 ? 52  TRP F CZ3 1 
ATOM   3293 C  CH2 . TRP D 4 52  ? 74.26142 -15.90855 16.34613  1.000 146.95446 ? 52  TRP F CH2 1 
ATOM   3294 N  N   . TRP D 4 53  ? 71.42537 -8.88671  13.75079  1.000 115.93290 ? 53  TRP F N   1 
ATOM   3295 C  CA  . TRP D 4 53  ? 70.04583 -8.64212  13.34823  1.000 103.68034 ? 53  TRP F CA  1 
ATOM   3296 C  C   . TRP D 4 53  ? 69.91812 -7.66394  12.17647  1.000 99.22694  ? 53  TRP F C   1 
ATOM   3297 O  O   . TRP D 4 53  ? 68.79490 -7.29211  11.83326  1.000 97.75623  ? 53  TRP F O   1 
ATOM   3298 C  CB  . TRP D 4 53  ? 69.23004 -8.12128  14.54068  1.000 97.49273  ? 53  TRP F CB  1 
ATOM   3299 C  CG  . TRP D 4 53  ? 69.12783 -9.09331  15.69927  1.000 94.49339  ? 53  TRP F CG  1 
ATOM   3300 C  CD1 . TRP D 4 53  ? 68.24213 -10.12591 15.82987  1.000 90.78486  ? 53  TRP F CD1 1 
ATOM   3301 C  CD2 . TRP D 4 53  ? 69.91056 -9.08703  16.90615  1.000 93.01321  ? 53  TRP F CD2 1 
ATOM   3302 N  NE1 . TRP D 4 53  ? 68.44715 -10.78233 17.01806  1.000 87.99883  ? 53  TRP F NE1 1 
ATOM   3303 C  CE2 . TRP D 4 53  ? 69.46165 -10.16421 17.70029  1.000 89.86230  ? 53  TRP F CE2 1 
ATOM   3304 C  CE3 . TRP D 4 53  ? 70.95579 -8.28715  17.38356  1.000 92.60707  ? 53  TRP F CE3 1 
ATOM   3305 C  CZ2 . TRP D 4 53  ? 70.01951 -10.45914 18.94460  1.000 89.31070  ? 53  TRP F CZ2 1 
ATOM   3306 C  CZ3 . TRP D 4 53  ? 71.50810 -8.58424  18.62370  1.000 91.50892  ? 53  TRP F CZ3 1 
ATOM   3307 C  CH2 . TRP D 4 53  ? 71.03959 -9.66162  19.38684  1.000 89.79800  ? 53  TRP F CH2 1 
ATOM   3308 N  N   . SER D 4 54  ? 71.02857 -7.23848  11.56119  1.000 96.61858  ? 54  SER F N   1 
ATOM   3309 C  CA  . SER D 4 54  ? 71.00502 -6.19945  10.52737  1.000 91.30604  ? 54  SER F CA  1 
ATOM   3310 C  C   . SER D 4 54  ? 70.66181 -6.81285  9.17407   1.000 88.76917  ? 54  SER F C   1 
ATOM   3311 O  O   . SER D 4 54  ? 71.43098 -7.60421  8.62410   1.000 90.11588  ? 54  SER F O   1 
ATOM   3312 C  CB  . SER D 4 54  ? 72.34277 -5.46701  10.47615  1.000 91.74313  ? 54  SER F CB  1 
ATOM   3313 O  OG  . SER D 4 54  ? 72.51388 -4.63261  11.61526  1.000 90.16982  ? 54  SER F OG  1 
ATOM   3314 N  N   . HIS D 4 55  ? 69.49697 -6.44863  8.64029   1.000 86.85651  ? 55  HIS F N   1 
ATOM   3315 C  CA  . HIS D 4 55  ? 69.03783 -6.98489  7.36396   1.000 88.98710  ? 55  HIS F CA  1 
ATOM   3316 C  C   . HIS D 4 55  ? 69.59199 -6.18633  6.18862   1.000 92.29781  ? 55  HIS F C   1 
ATOM   3317 O  O   . HIS D 4 55  ? 70.11922 -6.76340  5.23278   1.000 96.58358  ? 55  HIS F O   1 
ATOM   3318 C  CB  . HIS D 4 55  ? 67.50797 -7.01431  7.35386   1.000 89.03293  ? 55  HIS F CB  1 
ATOM   3319 C  CG  . HIS D 4 55  ? 66.91143 -7.81115  6.23630   1.000 91.36367  ? 55  HIS F CG  1 
ATOM   3320 N  ND1 . HIS D 4 55  ? 66.94748 -7.39609  4.92099   1.000 94.20244  ? 55  HIS F ND1 1 
ATOM   3321 C  CD2 . HIS D 4 55  ? 66.23553 -8.98512  6.24262   1.000 92.33238  ? 55  HIS F CD2 1 
ATOM   3322 C  CE1 . HIS D 4 55  ? 66.33048 -8.28567  4.16361   1.000 95.91920  ? 55  HIS F CE1 1 
ATOM   3323 N  NE2 . HIS D 4 55  ? 65.88969 -9.26009  4.94124   1.000 95.31921  ? 55  HIS F NE2 1 
ATOM   3324 N  N   . SER D 4 56  ? 69.48484 -4.86220  6.24125   1.000 92.16424  ? 56  SER F N   1 
ATOM   3325 C  CA  . SER D 4 56  ? 69.95117 -4.01112  5.15142   1.000 93.58433  ? 56  SER F CA  1 
ATOM   3326 C  C   . SER D 4 56  ? 69.88919 -2.55684  5.60098   1.000 90.64501  ? 56  SER F C   1 
ATOM   3327 O  O   . SER D 4 56  ? 69.29789 -2.22667  6.63023   1.000 90.35962  ? 56  SER F O   1 
ATOM   3328 C  CB  . SER D 4 56  ? 69.12162 -4.22119  3.87885   1.000 96.79070  ? 56  SER F CB  1 
ATOM   3329 O  OG  . SER D 4 56  ? 67.78562 -3.76549  4.05350   1.000 96.07965  ? 56  SER F OG  1 
ATOM   3330 N  N   . GLU D 4 57  ? 70.52385 -1.69375  4.81919   1.000 90.38615  ? 57  GLU F N   1 
ATOM   3331 C  CA  . GLU D 4 57  ? 70.47078 -0.25636  5.03012   1.000 91.14905  ? 57  GLU F CA  1 
ATOM   3332 C  C   . GLU D 4 57  ? 70.11129 0.42547   3.71849   1.000 89.36000  ? 57  GLU F C   1 
ATOM   3333 O  O   . GLU D 4 57  ? 70.51144 -0.02775  2.64253   1.000 89.95430  ? 57  GLU F O   1 
ATOM   3334 C  CB  . GLU D 4 57  ? 71.80152 0.29493   5.55974   1.000 95.52763  ? 57  GLU F CB  1 
ATOM   3335 C  CG  . GLU D 4 57  ? 72.01048 0.14109   7.05843   1.000 98.71483  ? 57  GLU F CG  1 
ATOM   3336 C  CD  . GLU D 4 57  ? 73.27858 0.83184   7.53392   1.000 103.39912 ? 57  GLU F CD  1 
ATOM   3337 O  OE1 . GLU D 4 57  ? 74.16973 1.07674   6.69098   1.000 107.58758 ? 57  GLU F OE1 1 
ATOM   3338 O  OE2 . GLU D 4 57  ? 73.38746 1.12987   8.74435   1.000 102.29603 ? 57  GLU F OE2 1 
ATOM   3339 N  N   . VAL D 4 58  ? 69.34076 1.50422   3.80847   1.000 88.21167  ? 58  VAL F N   1 
ATOM   3340 C  CA  . VAL D 4 58  ? 69.07092 2.36786   2.66724   1.000 89.41065  ? 58  VAL F CA  1 
ATOM   3341 C  C   . VAL D 4 58  ? 69.48298 3.77849   3.05642   1.000 90.19555  ? 58  VAL F C   1 
ATOM   3342 O  O   . VAL D 4 58  ? 69.02663 4.30923   4.07643   1.000 88.32561  ? 58  VAL F O   1 
ATOM   3343 C  CB  . VAL D 4 58  ? 67.60060 2.30889   2.22820   1.000 87.41266  ? 58  VAL F CB  1 
ATOM   3344 C  CG1 . VAL D 4 58  ? 67.31070 3.37100   1.17618   1.000 86.00435  ? 58  VAL F CG1 1 
ATOM   3345 C  CG2 . VAL D 4 58  ? 67.29233 0.93955   1.67025   1.000 87.46139  ? 58  VAL F CG2 1 
ATOM   3346 N  N   . HIS D 4 59  ? 70.35895 4.37249   2.25461   1.000 94.57316  ? 59  HIS F N   1 
ATOM   3347 C  CA  . HIS D 4 59  ? 70.89181 5.70593   2.49822   1.000 96.20103  ? 59  HIS F CA  1 
ATOM   3348 C  C   . HIS D 4 59  ? 70.27236 6.65818   1.48475   1.000 100.69253 ? 59  HIS F C   1 
ATOM   3349 O  O   . HIS D 4 59  ? 70.51063 6.53833   0.27707   1.000 100.55392 ? 59  HIS F O   1 
ATOM   3350 C  CB  . HIS D 4 59  ? 72.41693 5.69231   2.41330   1.000 98.58967  ? 59  HIS F CB  1 
ATOM   3351 C  CG  . HIS D 4 59  ? 73.06137 4.92744   3.52269   1.000 100.02018 ? 59  HIS F CG  1 
ATOM   3352 N  ND1 . HIS D 4 59  ? 73.46180 5.52298   4.69946   1.000 100.62198 ? 59  HIS F ND1 1 
ATOM   3353 C  CD2 . HIS D 4 59  ? 73.33318 3.60784   3.65552   1.000 101.95779 ? 59  HIS F CD2 1 
ATOM   3354 C  CE1 . HIS D 4 59  ? 73.97290 4.60587   5.50101   1.000 102.08396 ? 59  HIS F CE1 1 
ATOM   3355 N  NE2 . HIS D 4 59  ? 73.90380 3.43454   4.89318   1.000 102.61770 ? 59  HIS F NE2 1 
ATOM   3356 N  N   . ILE D 4 60  ? 69.46913 7.59295   1.97749   1.000 105.59288 ? 60  ILE F N   1 
ATOM   3357 C  CA  . ILE D 4 60  ? 68.82699 8.57834   1.11442   1.000 102.50559 ? 60  ILE F CA  1 
ATOM   3358 C  C   . ILE D 4 60  ? 69.46432 9.93088   1.41016   1.000 106.79635 ? 60  ILE F C   1 
ATOM   3359 O  O   . ILE D 4 60  ? 69.09680 10.58664  2.39828   1.000 111.25938 ? 60  ILE F O   1 
ATOM   3360 C  CB  . ILE D 4 60  ? 67.30680 8.60876   1.33151   1.000 95.92881  ? 60  ILE F CB  1 
ATOM   3361 C  CG1 . ILE D 4 60  ? 66.74134 7.19630   1.30256   1.000 91.35836  ? 60  ILE F CG1 1 
ATOM   3362 C  CG2 . ILE D 4 60  ? 66.64536 9.42715   0.26011   1.000 94.69815  ? 60  ILE F CG2 1 
ATOM   3363 C  CD1 . ILE D 4 60  ? 65.28048 7.15061   1.59282   1.000 87.78202  ? 60  ILE F CD1 1 
ATOM   3364 N  N   . PRO D 4 61  ? 70.41618 10.38147  0.59693   1.000 105.83483 ? 61  PRO F N   1 
ATOM   3365 C  CA  . PRO D 4 61  ? 71.07159 11.66614  0.86934   1.000 106.59297 ? 61  PRO F CA  1 
ATOM   3366 C  C   . PRO D 4 61  ? 70.11665 12.84852  0.74558   1.000 108.84929 ? 61  PRO F C   1 
ATOM   3367 O  O   . PRO D 4 61  ? 69.16494 12.83651  -0.03713  1.000 106.49454 ? 61  PRO F O   1 
ATOM   3368 C  CB  . PRO D 4 61  ? 72.17890 11.72845  -0.18977  1.000 107.92873 ? 61  PRO F CB  1 
ATOM   3369 C  CG  . PRO D 4 61  ? 71.72532 10.80041  -1.28277  1.000 106.07810 ? 61  PRO F CG  1 
ATOM   3370 C  CD  . PRO D 4 61  ? 70.95569 9.71287   -0.60108  1.000 104.50872 ? 61  PRO F CD  1 
ATOM   3371 N  N   . LEU D 4 62  ? 70.37758 13.88058  1.54086   1.000 111.32475 ? 62  LEU F N   1 
ATOM   3372 C  CA  . LEU D 4 62  ? 69.58484 15.10336  1.52145   1.000 114.16884 ? 62  LEU F CA  1 
ATOM   3373 C  C   . LEU D 4 62  ? 70.51139 16.28678  1.22921   1.000 124.98692 ? 62  LEU F C   1 
ATOM   3374 O  O   . LEU D 4 62  ? 71.66007 16.12374  0.80327   1.000 127.58337 ? 62  LEU F O   1 
ATOM   3375 C  CB  . LEU D 4 62  ? 68.83238 15.27654  2.84048   1.000 106.76997 ? 62  LEU F CB  1 
ATOM   3376 C  CG  . LEU D 4 62  ? 67.79575 14.19061  3.16226   1.000 99.51103  ? 62  LEU F CG  1 
ATOM   3377 C  CD1 . LEU D 4 62  ? 66.97064 14.51977  4.40757   1.000 95.38645  ? 62  LEU F CD1 1 
ATOM   3378 C  CD2 . LEU D 4 62  ? 66.89320 13.93248  1.96720   1.000 97.53746  ? 62  LEU F CD2 1 
ATOM   3379 N  N   . GLY D 4 63  ? 70.01065 17.48988  1.47636   1.000 134.63954 ? 63  GLY F N   1 
ATOM   3380 C  CA  . GLY D 4 63  ? 70.80584 18.68336  1.24083   1.000 140.72738 ? 63  GLY F CA  1 
ATOM   3381 C  C   . GLY D 4 63  ? 71.83467 18.93554  2.32993   1.000 146.58087 ? 63  GLY F C   1 
ATOM   3382 O  O   . GLY D 4 63  ? 71.66340 18.55354  3.48567   1.000 150.33730 ? 63  GLY F O   1 
ATOM   3383 N  N   . ASN D 4 64  ? 72.94131 19.57610  1.91925   1.000 145.43720 ? 64  ASN F N   1 
ATOM   3384 C  CA  . ASN D 4 64  ? 74.01221 20.03081  2.82043   1.000 144.40634 ? 64  ASN F CA  1 
ATOM   3385 C  C   . ASN D 4 64  ? 74.66678 18.86679  3.56341   1.000 138.43118 ? 64  ASN F C   1 
ATOM   3386 O  O   . ASN D 4 64  ? 74.80184 18.88395  4.78954   1.000 138.22722 ? 64  ASN F O   1 
ATOM   3387 C  CB  . ASN D 4 64  ? 73.49473 21.08086  3.80980   1.000 146.47503 ? 64  ASN F CB  1 
ATOM   3388 C  CG  . ASN D 4 64  ? 72.92502 22.31237  3.12745   1.000 148.82117 ? 64  ASN F CG  1 
ATOM   3389 O  OD1 . ASN D 4 64  ? 73.37003 22.71335  2.04828   1.000 150.81300 ? 64  ASN F OD1 1 
ATOM   3390 N  ND2 . ASN D 4 64  ? 71.93391 22.92333  3.76179   1.000 148.59927 ? 64  ASN F ND2 1 
ATOM   3391 N  N   . ASN D 4 65  ? 75.07291 17.84605  2.80589   1.000 134.02706 ? 65  ASN F N   1 
ATOM   3392 C  CA  . ASN D 4 65  ? 75.84035 16.72277  3.35036   1.000 130.02716 ? 65  ASN F CA  1 
ATOM   3393 C  C   . ASN D 4 65  ? 75.07078 16.04471  4.48700   1.000 125.96555 ? 65  ASN F C   1 
ATOM   3394 O  O   . ASN D 4 65  ? 75.61524 15.74733  5.55411   1.000 128.66660 ? 65  ASN F O   1 
ATOM   3395 C  CB  . ASN D 4 65  ? 77.23197 17.17695  3.80670   1.000 129.64286 ? 65  ASN F CB  1 
ATOM   3396 C  CG  . ASN D 4 65  ? 78.21331 16.02680  3.94930   1.000 130.20150 ? 65  ASN F CG  1 
ATOM   3397 O  OD1 . ASN D 4 65  ? 77.90007 14.88529  3.60560   1.000 130.32333 ? 65  ASN F OD1 1 
ATOM   3398 N  ND2 . ASN D 4 65  ? 79.40874 16.31947  4.45653   1.000 130.38368 ? 65  ASN F ND2 1 
ATOM   3399 N  N   . THR D 4 66  ? 73.78137 15.80009  4.24190   1.000 120.98646 ? 66  THR F N   1 
ATOM   3400 C  CA  . THR D 4 66  ? 72.88464 15.15318  5.19123   1.000 115.82898 ? 66  THR F CA  1 
ATOM   3401 C  C   . THR D 4 66  ? 72.14554 14.00953  4.50153   1.000 111.52589 ? 66  THR F C   1 
ATOM   3402 O  O   . THR D 4 66  ? 71.90602 14.04757  3.29265   1.000 110.22399 ? 66  THR F O   1 
ATOM   3403 C  CB  . THR D 4 66  ? 71.88189 16.18486  5.77530   1.000 115.43744 ? 66  THR F CB  1 
ATOM   3404 O  OG1 . THR D 4 66  ? 72.57304 17.12494  6.60642   1.000 115.87082 ? 66  THR F OG1 1 
ATOM   3405 C  CG2 . THR D 4 66  ? 70.83830 15.51946  6.59867   1.000 114.72835 ? 66  THR F CG2 1 
ATOM   3406 N  N   . LYS D 4 67  ? 71.79872 12.97731  5.27400   1.000 108.24073 ? 67  LYS F N   1 
ATOM   3407 C  CA  . LYS D 4 67  ? 71.12552 11.80909  4.72296   1.000 106.72343 ? 67  LYS F CA  1 
ATOM   3408 C  C   . LYS D 4 67  ? 70.12671 11.25486  5.72846   1.000 103.96053 ? 67  LYS F C   1 
ATOM   3409 O  O   . LYS D 4 67  ? 70.14581 11.59361  6.91424   1.000 105.29824 ? 67  LYS F O   1 
ATOM   3410 C  CB  . LYS D 4 67  ? 72.11700 10.69571  4.33963   1.000 108.54271 ? 67  LYS F CB  1 
ATOM   3411 C  CG  . LYS D 4 67  ? 72.82500 10.06307  5.53437   1.000 109.88208 ? 67  LYS F CG  1 
ATOM   3412 C  CD  . LYS D 4 67  ? 73.76571 8.93388   5.13342   1.000 110.60169 ? 67  LYS F CD  1 
ATOM   3413 C  CE  . LYS D 4 67  ? 74.41021 8.32736   6.36759   1.000 110.40660 ? 67  LYS F CE  1 
ATOM   3414 N  NZ  . LYS D 4 67  ? 75.52332 7.40321   6.04325   1.000 111.93721 ? 67  LYS F NZ  1 
ATOM   3415 N  N   . ILE D 4 68  ? 69.22746 10.41721  5.21922   1.000 98.88184  ? 68  ILE F N   1 
ATOM   3416 C  CA  . ILE D 4 68  ? 68.33677 9.59306   6.02746   1.000 94.81232  ? 68  ILE F CA  1 
ATOM   3417 C  C   . ILE D 4 68  ? 68.77655 8.14268   5.86463   1.000 95.38452  ? 68  ILE F C   1 
ATOM   3418 O  O   . ILE D 4 68  ? 69.01787 7.68177   4.73967   1.000 94.97708  ? 68  ILE F O   1 
ATOM   3419 C  CB  . ILE D 4 68  ? 66.86705 9.78510   5.61554   1.000 88.98067  ? 68  ILE F CB  1 
ATOM   3420 C  CG1 . ILE D 4 68  ? 66.28930 11.04644  6.25242   1.000 86.37149  ? 68  ILE F CG1 1 
ATOM   3421 C  CG2 . ILE D 4 68  ? 66.03706 8.58316   5.99926   1.000 87.55733  ? 68  ILE F CG2 1 
ATOM   3422 C  CD1 . ILE D 4 68  ? 64.82141 11.26148  5.93653   1.000 83.95711  ? 68  ILE F CD1 1 
ATOM   3423 N  N   . LYS D 4 69  ? 68.94085 7.44419   6.98503   1.000 96.62246  ? 69  LYS F N   1 
ATOM   3424 C  CA  . LYS D 4 69  ? 69.32525 6.03963   6.98426   1.000 96.40430  ? 69  LYS F CA  1 
ATOM   3425 C  C   . LYS D 4 69  ? 68.15964 5.19207   7.47688   1.000 94.39669  ? 69  LYS F C   1 
ATOM   3426 O  O   . LYS D 4 69  ? 67.63323 5.42331   8.57095   1.000 94.44259  ? 69  LYS F O   1 
ATOM   3427 C  CB  . LYS D 4 69  ? 70.54901 5.79492   7.86310   1.000 99.15960  ? 69  LYS F CB  1 
ATOM   3428 C  CG  . LYS D 4 69  ? 71.16857 4.44552   7.60369   1.000 103.11019 ? 69  LYS F CG  1 
ATOM   3429 C  CD  . LYS D 4 69  ? 72.43729 4.21540   8.39613   1.000 107.51354 ? 69  LYS F CD  1 
ATOM   3430 C  CE  . LYS D 4 69  ? 72.11502 3.92119   9.84860   1.000 109.59804 ? 69  LYS F CE  1 
ATOM   3431 N  NZ  . LYS D 4 69  ? 73.23827 3.19841   10.50752  1.000 114.16176 ? 69  LYS F NZ  1 
ATOM   3432 N  N   . VAL D 4 70  ? 67.76959 4.20929   6.67692   1.000 92.64642  ? 70  VAL F N   1 
ATOM   3433 C  CA  . VAL D 4 70  ? 66.68426 3.29465   7.00578   1.000 87.69221  ? 70  VAL F CA  1 
ATOM   3434 C  C   . VAL D 4 70  ? 67.30062 1.93180   7.26662   1.000 87.48183  ? 70  VAL F C   1 
ATOM   3435 O  O   . VAL D 4 70  ? 67.76693 1.26464   6.33589   1.000 87.57671  ? 70  VAL F O   1 
ATOM   3436 C  CB  . VAL D 4 70  ? 65.63492 3.23106   5.88968   1.000 86.23297  ? 70  VAL F CB  1 
ATOM   3437 C  CG1 . VAL D 4 70  ? 64.49648 2.29637   6.28104   1.000 82.96718  ? 70  VAL F CG1 1 
ATOM   3438 C  CG2 . VAL D 4 70  ? 65.11645 4.64384   5.56897   1.000 86.15619  ? 70  VAL F CG2 1 
ATOM   3439 N  N   . THR D 4 71  ? 67.30846 1.52559   8.53338   1.000 86.75671  ? 71  THR F N   1 
ATOM   3440 C  CA  . THR D 4 71  ? 67.85647 0.24343   8.95717   1.000 87.48405  ? 71  THR F CA  1 
ATOM   3441 C  C   . THR D 4 71  ? 66.74204 -0.78039  9.11367   1.000 84.09517  ? 71  THR F C   1 
ATOM   3442 O  O   . THR D 4 71  ? 65.78650 -0.55712  9.85957   1.000 82.37856  ? 71  THR F O   1 
ATOM   3443 C  CB  . THR D 4 71  ? 68.61006 0.38023   10.28121  1.000 90.45474  ? 71  THR F CB  1 
ATOM   3444 O  OG1 . THR D 4 71  ? 69.81208 1.12737   10.08347  1.000 98.33643  ? 71  THR F OG1 1 
ATOM   3445 C  CG2 . THR D 4 71  ? 68.95755 -0.97195  10.82621  1.000 91.34678  ? 71  THR F CG2 1 
ATOM   3446 N  N   . THR D 4 72  ? 66.88356 -1.91238  8.44220   1.000 84.35451  ? 72  THR F N   1 
ATOM   3447 C  CA  . THR D 4 72  ? 65.96036 -3.01999  8.61271   1.000 82.61842  ? 72  THR F CA  1 
ATOM   3448 C  C   . THR D 4 72  ? 66.61304 -4.08706  9.47068   1.000 81.00210  ? 72  THR F C   1 
ATOM   3449 O  O   . THR D 4 72  ? 67.80166 -4.38066  9.32346   1.000 81.49156  ? 72  THR F O   1 
ATOM   3450 C  CB  . THR D 4 72  ? 65.54554 -3.62188  7.27468   1.000 86.00656  ? 72  THR F CB  1 
ATOM   3451 O  OG1 . THR D 4 72  ? 66.71616 -4.05921  6.57495   1.000 90.40982  ? 72  THR F OG1 1 
ATOM   3452 C  CG2 . THR D 4 72  ? 64.82517 -2.58122  6.43459   1.000 86.83565  ? 72  THR F CG2 1 
ATOM   3453 N  N   . TYR D 4 73  ? 65.82805 -4.64961  10.37399  1.000 80.13948  ? 73  TYR F N   1 
ATOM   3454 C  CA  . TYR D 4 73  ? 66.27426 -5.68158  11.28710  1.000 80.00084  ? 73  TYR F CA  1 
ATOM   3455 C  C   . TYR D 4 73  ? 65.52545 -6.97705  10.99865  1.000 80.51477  ? 73  TYR F C   1 
ATOM   3456 O  O   . TYR D 4 73  ? 64.36279 -6.95625  10.58415  1.000 80.12568  ? 73  TYR F O   1 
ATOM   3457 C  CB  . TYR D 4 73  ? 66.03760 -5.25004  12.72786  1.000 79.87878  ? 73  TYR F CB  1 
ATOM   3458 C  CG  . TYR D 4 73  ? 66.92009 -4.12346  13.19860  1.000 81.74939  ? 73  TYR F CG  1 
ATOM   3459 C  CD1 . TYR D 4 73  ? 68.27362 -4.32901  13.41164  1.000 84.65454  ? 73  TYR F CD1 1 
ATOM   3460 C  CD2 . TYR D 4 73  ? 66.39870 -2.86291  13.45917  1.000 79.72270  ? 73  TYR F CD2 1 
ATOM   3461 C  CE1 . TYR D 4 73  ? 69.08370 -3.31228  13.85857  1.000 85.24444  ? 73  TYR F CE1 1 
ATOM   3462 C  CE2 . TYR D 4 73  ? 67.20434 -1.84076  13.90749  1.000 80.97199  ? 73  TYR F CE2 1 
ATOM   3463 C  CZ  . TYR D 4 73  ? 68.54405 -2.07140  14.10420  1.000 82.85896  ? 73  TYR F CZ  1 
ATOM   3464 O  OH  . TYR D 4 73  ? 69.35488 -1.05624  14.54858  1.000 83.01119  ? 73  TYR F OH  1 
ATOM   3465 N  N   . TRP D 4 74  ? 66.19408 -8.10777  11.23096  1.000 82.08017  ? 74  TRP F N   1 
ATOM   3466 C  CA  . TRP D 4 74  ? 65.59107 -9.42199  11.04907  1.000 81.74262  ? 74  TRP F CA  1 
ATOM   3467 C  C   . TRP D 4 74  ? 65.94052 -10.29663 12.24281  1.000 91.36065  ? 74  TRP F C   1 
ATOM   3468 O  O   . TRP D 4 74  ? 66.74328 -9.91837  13.09946  1.000 93.65602  ? 74  TRP F O   1 
ATOM   3469 C  CB  . TRP D 4 74  ? 66.05417 -10.09158 9.74606   1.000 78.79959  ? 74  TRP F CB  1 
ATOM   3470 C  CG  . TRP D 4 74  ? 67.39629 -10.79287 9.84768   1.000 76.87948  ? 74  TRP F CG  1 
ATOM   3471 C  CD1 . TRP D 4 74  ? 68.62589 -10.20042 9.94758   1.000 75.23259  ? 74  TRP F CD1 1 
ATOM   3472 C  CD2 . TRP D 4 74  ? 67.63824 -12.20921 9.82852   1.000 73.33272  ? 74  TRP F CD2 1 
ATOM   3473 N  NE1 . TRP D 4 74  ? 69.60782 -11.15461 10.01037  1.000 75.16685  ? 74  TRP F NE1 1 
ATOM   3474 C  CE2 . TRP D 4 74  ? 69.03053 -12.39547 9.93847   1.000 74.04723  ? 74  TRP F CE2 1 
ATOM   3475 C  CE3 . TRP D 4 74  ? 66.81335 -13.33478 9.73439   1.000 70.24456  ? 74  TRP F CE3 1 
ATOM   3476 C  CZ2 . TRP D 4 74  ? 69.61507 -13.66108 9.95937   1.000 73.25014  ? 74  TRP F CZ2 1 
ATOM   3477 C  CZ3 . TRP D 4 74  ? 67.39434 -14.58685 9.75628   1.000 70.20859  ? 74  TRP F CZ3 1 
ATOM   3478 C  CH2 . TRP D 4 74  ? 68.78119 -14.73968 9.86701   1.000 71.85633  ? 74  TRP F CH2 1 
ATOM   3479 N  N   . ASN D 4 75  ? 65.30120 -11.47015 12.30140  1.000 95.38265  ? 75  ASN F N   1 
ATOM   3480 C  CA  . ASN D 4 75  ? 65.57152 -12.48421 13.32836  1.000 95.60984  ? 75  ASN F CA  1 
ATOM   3481 C  C   . ASN D 4 75  ? 65.34906 -11.93571 14.74000  1.000 92.74526  ? 75  ASN F C   1 
ATOM   3482 O  O   . ASN D 4 75  ? 66.08972 -12.25427 15.67206  1.000 92.51667  ? 75  ASN F O   1 
ATOM   3483 C  CB  . ASN D 4 75  ? 66.98804 -13.04684 13.17983  1.000 100.05677 ? 75  ASN F CB  1 
ATOM   3484 C  CG  . ASN D 4 75  ? 67.13447 -14.42147 13.80333  1.000 106.51840 ? 75  ASN F CG  1 
ATOM   3485 O  OD1 . ASN D 4 75  ? 66.16777 -15.17982 13.88509  1.000 109.56615 ? 75  ASN F OD1 1 
ATOM   3486 N  ND2 . ASN D 4 75  ? 68.34823 -14.75621 14.23293  1.000 109.61244 ? 75  ASN F ND2 1 
ATOM   3487 N  N   . LEU D 4 76  ? 64.30809 -11.11900 14.90201  1.000 89.57141  ? 76  LEU F N   1 
ATOM   3488 C  CA  . LEU D 4 76  ? 63.96283 -10.53729 16.19017  1.000 87.49236  ? 76  LEU F CA  1 
ATOM   3489 C  C   . LEU D 4 76  ? 63.22021 -11.56112 17.04757  1.000 92.92027  ? 76  LEU F C   1 
ATOM   3490 O  O   . LEU D 4 76  ? 62.96820 -12.69425 16.63446  1.000 97.44896  ? 76  LEU F O   1 
ATOM   3491 C  CB  . LEU D 4 76  ? 63.12543 -9.27576  15.99025  1.000 83.01474  ? 76  LEU F CB  1 
ATOM   3492 C  CG  . LEU D 4 76  ? 63.82915 -8.05917  15.38522  1.000 77.92265  ? 76  LEU F CG  1 
ATOM   3493 C  CD1 . LEU D 4 76  ? 62.85202 -6.94775  15.04785  1.000 73.67031  ? 76  LEU F CD1 1 
ATOM   3494 C  CD2 . LEU D 4 76  ? 64.85679 -7.54647  16.35653  1.000 77.30310  ? 76  LEU F CD2 1 
ATOM   3495 N  N   . THR D 4 77  ? 62.86636 -11.16012 18.26547  1.000 92.33057  ? 77  THR F N   1 
ATOM   3496 C  CA  . THR D 4 77  ? 62.19830 -12.07019 19.19018  1.000 93.57247  ? 77  THR F CA  1 
ATOM   3497 C  C   . THR D 4 77  ? 60.89997 -12.60140 18.58512  1.000 87.07076  ? 77  THR F C   1 
ATOM   3498 O  O   . THR D 4 77  ? 60.03931 -11.83197 18.15208  1.000 85.05343  ? 77  THR F O   1 
ATOM   3499 C  CB  . THR D 4 77  ? 61.93197 -11.35248 20.50889  1.000 100.16431 ? 77  THR F CB  1 
ATOM   3500 O  OG1 . THR D 4 77  ? 63.09955 -10.60347 20.87428  1.000 106.13823 ? 77  THR F OG1 1 
ATOM   3501 C  CG2 . THR D 4 77  ? 61.62881 -12.35951 21.61262  1.000 100.22698 ? 77  THR F CG2 1 
ATOM   3502 N  N   . THR D 4 78  ? 60.74823 -13.92225 18.60501  1.000 86.22521  ? 78  THR F N   1 
ATOM   3503 C  CA  . THR D 4 78  ? 59.64162 -14.60419 17.94185  1.000 85.39001  ? 78  THR F CA  1 
ATOM   3504 C  C   . THR D 4 78  ? 58.30420 -14.22039 18.57008  1.000 85.06945  ? 78  THR F C   1 
ATOM   3505 O  O   . THR D 4 78  ? 58.21076 -13.99943 19.77195  1.000 86.26782  ? 78  THR F O   1 
ATOM   3506 C  CB  . THR D 4 78  ? 59.84541 -16.11893 18.05802  1.000 84.76156  ? 78  THR F CB  1 
ATOM   3507 O  OG1 . THR D 4 78  ? 61.13917 -16.47158 17.55210  1.000 86.10956  ? 78  THR F OG1 1 
ATOM   3508 C  CG2 . THR D 4 78  ? 58.76848 -16.89153 17.30176  1.000 83.55246  ? 78  THR F CG2 1 
ATOM   3509 N  N   . GLU D 4 79  ? 57.25117 -14.16672 17.75438  1.000 85.41467  ? 79  GLU F N   1 
ATOM   3510 C  CA  . GLU D 4 79  ? 55.92408 -13.83518 18.26216  1.000 87.21908  ? 79  GLU F CA  1 
ATOM   3511 C  C   . GLU D 4 79  ? 55.07325 -15.09174 18.41673  1.000 88.29008  ? 79  GLU F C   1 
ATOM   3512 O  O   . GLU D 4 79  ? 54.64592 -15.42874 19.52596  1.000 88.88742  ? 79  GLU F O   1 
ATOM   3513 C  CB  . GLU D 4 79  ? 55.23217 -12.83663 17.33225  1.000 91.23250  ? 79  GLU F CB  1 
ATOM   3514 C  CG  . GLU D 4 79  ? 55.69477 -11.38787 17.47998  1.000 95.40360  ? 79  GLU F CG  1 
ATOM   3515 C  CD  . GLU D 4 79  ? 54.94373 -10.61043 18.52948  1.000 97.68716  ? 79  GLU F CD  1 
ATOM   3516 O  OE1 . GLU D 4 79  ? 54.47192 -11.23748 19.49720  1.000 101.12881 ? 79  GLU F OE1 1 
ATOM   3517 O  OE2 . GLU D 4 79  ? 54.83063 -9.37078  18.38196  1.000 96.44728  ? 79  GLU F OE2 1 
ATOM   3518 N  N   . LYS D 4 80  ? 54.82109 -15.80037 17.32351  1.000 89.17860  ? 80  LYS F N   1 
ATOM   3519 C  CA  . LYS D 4 80  ? 54.20742 -17.11886 17.37868  1.000 88.07701  ? 80  LYS F CA  1 
ATOM   3520 C  C   . LYS D 4 80  ? 54.99745 -18.06707 16.48208  1.000 90.45921  ? 80  LYS F C   1 
ATOM   3521 O  O   . LYS D 4 80  ? 55.82208 -17.64498 15.67084  1.000 91.44777  ? 80  LYS F O   1 
ATOM   3522 C  CB  . LYS D 4 80  ? 52.72876 -17.08658 16.96635  1.000 87.93055  ? 80  LYS F CB  1 
ATOM   3523 C  CG  . LYS D 4 80  ? 52.45585 -16.44884 15.61400  1.000 89.63332  ? 80  LYS F CG  1 
ATOM   3524 C  CD  . LYS D 4 80  ? 51.05160 -16.78569 15.12534  1.000 91.55484  ? 80  LYS F CD  1 
ATOM   3525 C  CE  . LYS D 4 80  ? 50.57913 -15.83094 14.03042  1.000 92.67243  ? 80  LYS F CE  1 
ATOM   3526 N  NZ  . LYS D 4 80  ? 49.95189 -14.58519 14.56694  1.000 92.28993  ? 80  LYS F NZ  1 
ATOM   3527 N  N   . GLY D 4 81  ? 54.74289 -19.35563 16.63862  1.000 92.29680  ? 81  GLY F N   1 
ATOM   3528 C  CA  . GLY D 4 81  ? 55.42649 -20.35911 15.84449  1.000 93.44621  ? 81  GLY F CA  1 
ATOM   3529 C  C   . GLY D 4 81  ? 56.91063 -20.48329 16.13944  1.000 90.56416  ? 81  GLY F C   1 
ATOM   3530 O  O   . GLY D 4 81  ? 57.27948 -20.74863 17.28913  1.000 92.17551  ? 81  GLY F O   1 
ATOM   3531 N  N   . TRP D 4 82  ? 57.77381 -20.30345 15.13219  1.000 86.73818  ? 82  TRP F N   1 
ATOM   3532 C  CA  . TRP D 4 82  ? 59.20251 -20.38955 15.39148  1.000 85.55041  ? 82  TRP F CA  1 
ATOM   3533 C  C   . TRP D 4 82  ? 60.04449 -19.35873 14.64986  1.000 84.63200  ? 82  TRP F C   1 
ATOM   3534 O  O   . TRP D 4 82  ? 61.26210 -19.31643 14.87378  1.000 85.11285  ? 82  TRP F O   1 
ATOM   3535 C  CB  . TRP D 4 82  ? 59.71805 -21.79862 15.05454  1.000 89.26662  ? 82  TRP F CB  1 
ATOM   3536 C  CG  . TRP D 4 82  ? 59.54372 -22.14186 13.60889  1.000 90.92538  ? 82  TRP F CG  1 
ATOM   3537 C  CD1 . TRP D 4 82  ? 58.42206 -22.62987 13.00790  1.000 90.41832  ? 82  TRP F CD1 1 
ATOM   3538 C  CD2 . TRP D 4 82  ? 60.52521 -22.00346 12.57937  1.000 92.32598  ? 82  TRP F CD2 1 
ATOM   3539 N  NE1 . TRP D 4 82  ? 58.64329 -22.79773 11.66270  1.000 91.47987  ? 82  TRP F NE1 1 
ATOM   3540 C  CE2 . TRP D 4 82  ? 59.92922 -22.42171 11.37576  1.000 92.68215  ? 82  TRP F CE2 1 
ATOM   3541 C  CE3 . TRP D 4 82  ? 61.85161 -21.56340 12.55949  1.000 94.37023  ? 82  TRP F CE3 1 
ATOM   3542 C  CZ2 . TRP D 4 82  ? 60.61474 -22.41426 10.16272  1.000 95.53748  ? 82  TRP F CZ2 1 
ATOM   3543 C  CZ3 . TRP D 4 82  ? 62.53067 -21.55710 11.35683  1.000 96.50276  ? 82  TRP F CZ3 1 
ATOM   3544 C  CH2 . TRP D 4 82  ? 61.91297 -21.98031 10.17505  1.000 97.16455  ? 82  TRP F CH2 1 
ATOM   3545 N  N   . LEU D 4 83  ? 59.46095 -18.53441 13.79142  1.000 84.00589  ? 83  LEU F N   1 
ATOM   3546 C  CA  . LEU D 4 83  ? 60.24589 -17.65068 12.93965  1.000 82.83766  ? 83  LEU F CA  1 
ATOM   3547 C  C   . LEU D 4 83  ? 60.57580 -16.34270 13.64159  1.000 79.23888  ? 83  LEU F C   1 
ATOM   3548 O  O   . LEU D 4 83  ? 59.88574 -15.90094 14.56257  1.000 76.20334  ? 83  LEU F O   1 
ATOM   3549 C  CB  . LEU D 4 83  ? 59.53205 -17.36585 11.61298  1.000 82.54169  ? 83  LEU F CB  1 
ATOM   3550 C  CG  . LEU D 4 83  ? 59.75468 -18.42797 10.52607  1.000 83.41208  ? 83  LEU F CG  1 
ATOM   3551 C  CD1 . LEU D 4 83  ? 58.63507 -18.41497 9.51232   1.000 82.06960  ? 83  LEU F CD1 1 
ATOM   3552 C  CD2 . LEU D 4 83  ? 61.10579 -18.22575 9.82511   1.000 84.19713  ? 83  LEU F CD2 1 
ATOM   3553 N  N   . GLY D 4 84  ? 61.65690 -15.72201 13.18363  1.000 80.15426  ? 84  GLY F N   1 
ATOM   3554 C  CA  . GLY D 4 84  ? 62.06800 -14.45824 13.74689  1.000 81.09256  ? 84  GLY F CA  1 
ATOM   3555 C  C   . GLY D 4 84  ? 61.31342 -13.29350 13.13183  1.000 80.89098  ? 84  GLY F C   1 
ATOM   3556 O  O   . GLY D 4 84  ? 60.89469 -13.32740 11.97575  1.000 82.04380  ? 84  GLY F O   1 
ATOM   3557 N  N   . THR D 4 85  ? 61.13870 -12.24835 13.93122  1.000 79.75013  ? 85  THR F N   1 
ATOM   3558 C  CA  . THR D 4 85  ? 60.37632 -11.07477 13.53971  1.000 80.27926  ? 85  THR F CA  1 
ATOM   3559 C  C   . THR D 4 85  ? 61.29066 -10.07762 12.83573  1.000 80.20117  ? 85  THR F C   1 
ATOM   3560 O  O   . THR D 4 85  ? 62.50573 -10.06765 13.03845  1.000 84.04728  ? 85  THR F O   1 
ATOM   3561 C  CB  . THR D 4 85  ? 59.72362 -10.43701 14.76792  1.000 84.54643  ? 85  THR F CB  1 
ATOM   3562 O  OG1 . THR D 4 85  ? 58.99673 -11.43722 15.49055  1.000 86.51957  ? 85  THR F OG1 1 
ATOM   3563 C  CG2 . THR D 4 85  ? 58.77934 -9.29566  14.37868  1.000 85.17323  ? 85  THR F CG2 1 
ATOM   3564 N  N   . TYR D 4 86  ? 60.69622 -9.23222  11.99496  1.000 78.10171  ? 86  TYR F N   1 
ATOM   3565 C  CA  . TYR D 4 86  ? 61.44053 -8.18661  11.30523  1.000 80.58549  ? 86  TYR F CA  1 
ATOM   3566 C  C   . TYR D 4 86  ? 61.09853 -6.80667  11.87728  1.000 79.76415  ? 86  TYR F C   1 
ATOM   3567 O  O   . TYR D 4 86  ? 60.08426 -6.62359  12.55851  1.000 80.26841  ? 86  TYR F O   1 
ATOM   3568 C  CB  . TYR D 4 86  ? 61.15634 -8.25228  9.79422   1.000 80.22817  ? 86  TYR F CB  1 
ATOM   3569 C  CG  . TYR D 4 86  ? 61.60188 -9.55265  9.12650   1.000 80.20580  ? 86  TYR F CG  1 
ATOM   3570 C  CD1 . TYR D 4 86  ? 60.92513 -10.75366 9.35011   1.000 79.49138  ? 86  TYR F CD1 1 
ATOM   3571 C  CD2 . TYR D 4 86  ? 62.69920 -9.58143  8.27534   1.000 81.47580  ? 86  TYR F CD2 1 
ATOM   3572 C  CE1 . TYR D 4 86  ? 61.32983 -11.93957 8.73994   1.000 79.45542  ? 86  TYR F CE1 1 
ATOM   3573 C  CE2 . TYR D 4 86  ? 63.11156 -10.76127 7.66047   1.000 82.73090  ? 86  TYR F CE2 1 
ATOM   3574 C  CZ  . TYR D 4 86  ? 62.42262 -11.93409 7.89680   1.000 82.43513  ? 86  TYR F CZ  1 
ATOM   3575 O  OH  . TYR D 4 86  ? 62.82924 -13.10097 7.29017   1.000 86.20949  ? 86  TYR F OH  1 
ATOM   3576 N  N   . GLY D 4 87  ? 61.95478 -5.82494  11.60028  1.000 76.96846  ? 87  GLY F N   1 
ATOM   3577 C  CA  . GLY D 4 87  ? 61.73534 -4.49136  12.13032  1.000 75.89481  ? 87  GLY F CA  1 
ATOM   3578 C  C   . GLY D 4 87  ? 62.46506 -3.44017  11.32864  1.000 77.81243  ? 87  GLY F C   1 
ATOM   3579 O  O   . GLY D 4 87  ? 63.38832 -3.74587  10.56915  1.000 81.89707  ? 87  GLY F O   1 
ATOM   3580 N  N   . ALA D 4 88  ? 62.04976 -2.18278  11.51582  1.000 73.86275  ? 88  ALA F N   1 
ATOM   3581 C  CA  . ALA D 4 88  ? 62.64727 -1.04912  10.81401  1.000 70.35972  ? 88  ALA F CA  1 
ATOM   3582 C  C   . ALA D 4 88  ? 62.91784 0.07768   11.79983  1.000 69.92619  ? 88  ALA F C   1 
ATOM   3583 O  O   . ALA D 4 88  ? 62.20982 0.24015   12.79813  1.000 69.39472  ? 88  ALA F O   1 
ATOM   3584 C  CB  . ALA D 4 88  ? 61.75875 -0.53037  9.67022   1.000 66.01025  ? 88  ALA F CB  1 
ATOM   3585 N  N   . ALA D 4 89  ? 63.96024 0.84519   11.51326  1.000 71.86226  ? 89  ALA F N   1 
ATOM   3586 C  CA  . ALA D 4 89  ? 64.36313 1.95647   12.35505  1.000 72.47683  ? 89  ALA F CA  1 
ATOM   3587 C  C   . ALA D 4 89  ? 64.74621 3.12877   11.46679  1.000 77.77198  ? 89  ALA F C   1 
ATOM   3588 O  O   . ALA D 4 89  ? 65.42103 2.94161   10.45300  1.000 78.75508  ? 89  ALA F O   1 
ATOM   3589 C  CB  . ALA D 4 89  ? 65.52346 1.55316   13.27854  1.000 70.63219  ? 89  ALA F CB  1 
ATOM   3590 N  N   . LEU D 4 90  ? 64.29626 4.32905   11.83156  1.000 81.68685  ? 90  LEU F N   1 
ATOM   3591 C  CA  . LEU D 4 90  ? 64.44710 5.51486   10.99206  1.000 87.96642  ? 90  LEU F CA  1 
ATOM   3592 C  C   . LEU D 4 90  ? 65.38881 6.51811   11.63900  1.000 93.72861  ? 90  LEU F C   1 
ATOM   3593 O  O   . LEU D 4 90  ? 65.26087 6.81119   12.83257  1.000 97.72007  ? 90  LEU F O   1 
ATOM   3594 C  CB  . LEU D 4 90  ? 63.10777 6.19582   10.72308  1.000 88.01029  ? 90  LEU F CB  1 
ATOM   3595 C  CG  . LEU D 4 90  ? 62.14795 5.53971   9.73954   1.000 90.05855  ? 90  LEU F CG  1 
ATOM   3596 C  CD1 . LEU D 4 90  ? 61.85274 4.11215   10.11980  1.000 93.21434  ? 90  LEU F CD1 1 
ATOM   3597 C  CD2 . LEU D 4 90  ? 60.88471 6.32931   9.71082   1.000 89.71856  ? 90  LEU F CD2 1 
ATOM   3598 N  N   . ALA D 4 91  ? 66.31218 7.05867   10.84118  1.000 95.66701  ? 91  ALA F N   1 
ATOM   3599 C  CA  . ALA D 4 91  ? 67.32547 7.98330   11.32663  1.000 95.11785  ? 91  ALA F CA  1 
ATOM   3600 C  C   . ALA D 4 91  ? 67.49405 9.16148   10.38089  1.000 96.50213  ? 91  ALA F C   1 
ATOM   3601 O  O   . ALA D 4 91  ? 67.27930 9.05123   9.16921   1.000 94.64936  ? 91  ALA F O   1 
ATOM   3602 C  CB  . ALA D 4 91  ? 68.68744 7.32293   11.49072  1.000 96.23231  ? 91  ALA F CB  1 
ATOM   3603 N  N   . TYR D 4 92  ? 67.88380 10.29514  10.96591  1.000 97.35543  ? 92  TYR F N   1 
ATOM   3604 C  CA  . TYR D 4 92  ? 68.33116 11.47710  10.23794  1.000 97.54905  ? 92  TYR F CA  1 
ATOM   3605 C  C   . TYR D 4 92  ? 69.78218 11.75418  10.62037  1.000 92.39533  ? 92  TYR F C   1 
ATOM   3606 O  O   . TYR D 4 92  ? 70.09162 11.93940  11.80293  1.000 88.15586  ? 92  TYR F O   1 
ATOM   3607 C  CB  . TYR D 4 92  ? 67.43051 12.67625  10.55055  1.000 101.51442 ? 92  TYR F CB  1 
ATOM   3608 C  CG  . TYR D 4 92  ? 67.92897 13.99573  10.00776  1.000 108.61900 ? 92  TYR F CG  1 
ATOM   3609 C  CD1 . TYR D 4 92  ? 68.79558 14.79792  10.74521  1.000 110.93528 ? 92  TYR F CD1 1 
ATOM   3610 C  CD2 . TYR D 4 92  ? 67.53479 14.43864  8.75410   1.000 111.40334 ? 92  TYR F CD2 1 
ATOM   3611 C  CE1 . TYR D 4 92  ? 69.24998 16.00288  10.24837  1.000 112.77144 ? 92  TYR F CE1 1 
ATOM   3612 C  CE2 . TYR D 4 92  ? 67.97938 15.64598  8.25104   1.000 113.21827 ? 92  TYR F CE2 1 
ATOM   3613 C  CZ  . TYR D 4 92  ? 68.83779 16.42527  9.00100   1.000 114.58026 ? 92  TYR F CZ  1 
ATOM   3614 O  OH  . TYR D 4 92  ? 69.28820 17.62429  8.48906   1.000 117.11218 ? 92  TYR F OH  1 
ATOM   3615 N  N   . ILE D 4 93  ? 70.66584 11.79755  9.62625   1.000 95.18115  ? 93  ILE F N   1 
ATOM   3616 C  CA  . ILE D 4 93  ? 72.10418 11.86357  9.86266   1.000 98.41244  ? 93  ILE F CA  1 
ATOM   3617 C  C   . ILE D 4 93  ? 72.65873 13.14886  9.26104   1.000 103.18511 ? 93  ILE F C   1 
ATOM   3618 O  O   . ILE D 4 93  ? 72.60899 13.34586  8.03973   1.000 103.04287 ? 93  ILE F O   1 
ATOM   3619 C  CB  . ILE D 4 93  ? 72.81753 10.62592  9.29378   1.000 95.77620  ? 93  ILE F CB  1 
ATOM   3620 C  CG1 . ILE D 4 93  ? 72.35622 9.37936   10.04239  1.000 92.58012  ? 93  ILE F CG1 1 
ATOM   3621 C  CG2 . ILE D 4 93  ? 74.32145 10.75859  9.39828   1.000 97.21579  ? 93  ILE F CG2 1 
ATOM   3622 C  CD1 . ILE D 4 93  ? 73.18860 8.16530   9.76111   1.000 92.80020  ? 93  ILE F CD1 1 
ATOM   3623 N  N   . ASP D 4 94  ? 73.19889 14.01201  10.12257  1.000 106.63673 ? 94  ASP F N   1 
ATOM   3624 C  CA  . ASP D 4 94  ? 73.92915 15.21002  9.72400   1.000 112.77061 ? 94  ASP F CA  1 
ATOM   3625 C  C   . ASP D 4 94  ? 75.40491 14.97225  10.02458  1.000 117.97812 ? 94  ASP F C   1 
ATOM   3626 O  O   . ASP D 4 94  ? 75.77972 14.79452  11.19068  1.000 119.43337 ? 94  ASP F O   1 
ATOM   3627 C  CB  . ASP D 4 94  ? 73.42188 16.44966  10.46444  1.000 112.02142 ? 94  ASP F CB  1 
ATOM   3628 C  CG  . ASP D 4 94  ? 73.89119 17.74021  9.81968   1.000 113.10536 ? 94  ASP F CG  1 
ATOM   3629 O  OD1 . ASP D 4 94  ? 74.98652 17.74191  9.22120   1.000 113.03472 ? 94  ASP F OD1 1 
ATOM   3630 O  OD2 . ASP D 4 94  ? 73.17555 18.75829  9.92714   1.000 114.12674 ? 94  ASP F OD2 1 
ATOM   3631 N  N   . GLN D 4 95  ? 76.23170 14.96316  8.97706   1.000 125.00931 ? 95  GLN F N   1 
ATOM   3632 C  CA  . GLN D 4 95  ? 77.64942 14.63111  9.07212   1.000 128.06575 ? 95  GLN F CA  1 
ATOM   3633 C  C   . GLN D 4 95  ? 78.57366 15.83772  9.08551   1.000 133.78870 ? 95  GLN F C   1 
ATOM   3634 O  O   . GLN D 4 95  ? 79.79479 15.65835  9.04594   1.000 138.94827 ? 95  GLN F O   1 
ATOM   3635 C  CB  . GLN D 4 95  ? 78.04808 13.69171  7.92277   1.000 127.30200 ? 95  GLN F CB  1 
ATOM   3636 C  CG  . GLN D 4 95  ? 77.52985 12.26622  8.11579   1.000 126.39905 ? 95  GLN F CG  1 
ATOM   3637 C  CD  . GLN D 4 95  ? 77.75244 11.35163  6.90935   1.000 127.01243 ? 95  GLN F CD  1 
ATOM   3638 O  OE1 . GLN D 4 95  ? 78.83112 10.76589  6.72540   1.000 128.65302 ? 95  GLN F OE1 1 
ATOM   3639 N  NE2 . GLN D 4 95  ? 76.69844 11.17534  6.11721   1.000 125.46205 ? 95  GLN F NE2 1 
ATOM   3640 N  N   . LYS D 4 96  ? 78.03664 17.05650  9.11446   1.000 129.78532 ? 96  LYS F N   1 
ATOM   3641 C  CA  . LYS D 4 96  ? 78.89650 18.23554  9.11960   1.000 128.82356 ? 96  LYS F CA  1 
ATOM   3642 C  C   . LYS D 4 96  ? 79.55811 18.46841  10.47414  1.000 133.67865 ? 96  LYS F C   1 
ATOM   3643 O  O   . LYS D 4 96  ? 80.66535 19.01290  10.52915  1.000 131.01105 ? 96  LYS F O   1 
ATOM   3644 C  CB  . LYS D 4 96  ? 78.10705 19.46696  8.67990   1.000 124.12662 ? 96  LYS F CB  1 
ATOM   3645 C  CG  . LYS D 4 96  ? 77.71581 19.43972  7.20974   1.000 119.59307 ? 96  LYS F CG  1 
ATOM   3646 C  CD  . LYS D 4 96  ? 76.75811 20.56697  6.86436   1.000 116.26261 ? 96  LYS F CD  1 
ATOM   3647 C  CE  . LYS D 4 96  ? 75.44901 20.44303  7.62511   1.000 112.39409 ? 96  LYS F CE  1 
ATOM   3648 N  NZ  . LYS D 4 96  ? 74.43556 21.45030  7.20241   1.000 110.92058 ? 96  LYS F NZ  1 
ATOM   3649 N  N   . CYS D 4 97  ? 78.89904 18.09384  11.56928  1.000 139.06200 ? 97  CYS F N   1 
ATOM   3650 C  CA  . CYS D 4 97  ? 79.44091 18.33629  12.89811  1.000 148.99480 ? 97  CYS F CA  1 
ATOM   3651 C  C   . CYS D 4 97  ? 80.43556 17.24737  13.32105  1.000 157.46140 ? 97  CYS F C   1 
ATOM   3652 O  O   . CYS D 4 97  ? 80.54181 16.18618  12.69864  1.000 158.90727 ? 97  CYS F O   1 
ATOM   3653 C  CB  . CYS D 4 97  ? 78.30842 18.45827  13.90994  1.000 142.61970 ? 97  CYS F CB  1 
ATOM   3654 S  SG  . CYS D 4 97  ? 76.92807 17.35490  13.59375  1.000 137.82137 ? 97  CYS F SG  1 
ATOM   3655 N  N   . ASP D 4 98  ? 81.16328 17.53330  14.41733  1.000 167.05915 ? 98  ASP F N   1 
ATOM   3656 C  CA  . ASP D 4 98  ? 82.30957 16.70823  14.80338  1.000 166.44334 ? 98  ASP F CA  1 
ATOM   3657 C  C   . ASP D 4 98  ? 81.90705 15.26191  15.09089  1.000 159.99398 ? 98  ASP F C   1 
ATOM   3658 O  O   . ASP D 4 98  ? 82.37422 14.36272  14.37217  1.000 164.56330 ? 98  ASP F O   1 
ATOM   3659 C  CB  . ASP D 4 98  ? 83.06791 17.36859  15.96736  1.000 169.61531 ? 98  ASP F CB  1 
ATOM   3660 C  CG  . ASP D 4 98  ? 83.77523 18.66309  15.57732  1.000 172.84285 ? 98  ASP F CG  1 
ATOM   3661 O  OD1 . ASP D 4 98  ? 83.91266 18.94756  14.36973  1.000 175.25429 ? 98  ASP F OD1 1 
ATOM   3662 O  OD2 . ASP D 4 98  ? 84.21509 19.39261  16.49447  1.000 173.73195 ? 98  ASP F OD2 1 
ATOM   3663 N  N   . PRO D 4 99  ? 81.07109 14.95445  16.09045  1.000 151.41379 ? 99  PRO F N   1 
ATOM   3664 C  CA  . PRO D 4 99  ? 80.35924 13.66579  16.06912  1.000 143.25973 ? 99  PRO F CA  1 
ATOM   3665 C  C   . PRO D 4 99  ? 79.06857 13.79294  15.28199  1.000 130.61798 ? 99  PRO F C   1 
ATOM   3666 O  O   . PRO D 4 99  ? 78.31148 14.75518  15.47952  1.000 128.41697 ? 99  PRO F O   1 
ATOM   3667 C  CB  . PRO D 4 99  ? 80.09356 13.37347  17.55105  1.000 144.66803 ? 99  PRO F CB  1 
ATOM   3668 C  CG  . PRO D 4 99  ? 79.93577 14.69053  18.13961  1.000 148.11723 ? 99  PRO F CG  1 
ATOM   3669 C  CD  . PRO D 4 99  ? 80.90265 15.59280  17.41823  1.000 151.47758 ? 99  PRO F CD  1 
ATOM   3670 N  N   . PRO D 4 100 ? 78.81844 12.89165  14.32748  1.000 124.76065 ? 100 PRO F N   1 
ATOM   3671 C  CA  . PRO D 4 100 ? 77.66778 13.07161  13.42802  1.000 116.25208 ? 100 PRO F CA  1 
ATOM   3672 C  C   . PRO D 4 100 ? 76.38587 13.26563  14.22558  1.000 112.14562 ? 100 PRO F C   1 
ATOM   3673 O  O   . PRO D 4 100 ? 76.18240 12.65684  15.28273  1.000 112.11465 ? 100 PRO F O   1 
ATOM   3674 C  CB  . PRO D 4 100 ? 77.62681 11.76016  12.63145  1.000 117.12900 ? 100 PRO F CB  1 
ATOM   3675 C  CG  . PRO D 4 100 ? 78.98629 11.20070  12.75294  1.000 120.36426 ? 100 PRO F CG  1 
ATOM   3676 C  CD  . PRO D 4 100 ? 79.45633 11.57793  14.13193  1.000 123.02699 ? 100 PRO F CD  1 
ATOM   3677 N  N   . TYR D 4 101 ? 75.53368 14.15763  13.74364  1.000 107.26329 ? 101 TYR F N   1 
ATOM   3678 C  CA  . TYR D 4 101 ? 74.27201 14.37557  14.42879  1.000 102.97086 ? 101 TYR F CA  1 
ATOM   3679 C  C   . TYR D 4 101 ? 73.31066 13.26508  14.03452  1.000 100.71084 ? 101 TYR F C   1 
ATOM   3680 O  O   . TYR D 4 101 ? 73.05447 13.04403  12.84642  1.000 100.86659 ? 101 TYR F O   1 
ATOM   3681 C  CB  . TYR D 4 101 ? 73.69115 15.75078  14.11262  1.000 100.71170 ? 101 TYR F CB  1 
ATOM   3682 C  CG  . TYR D 4 101 ? 72.40899 15.97918  14.86614  1.000 97.34643  ? 101 TYR F CG  1 
ATOM   3683 C  CD1 . TYR D 4 101 ? 72.40870 16.04606  16.25274  1.000 96.06201  ? 101 TYR F CD1 1 
ATOM   3684 C  CD2 . TYR D 4 101 ? 71.19569 16.09398  14.20344  1.000 96.61511  ? 101 TYR F CD2 1 
ATOM   3685 C  CE1 . TYR D 4 101 ? 71.23619 16.23384  16.96220  1.000 95.65919  ? 101 TYR F CE1 1 
ATOM   3686 C  CE2 . TYR D 4 101 ? 70.01244 16.28537  14.90379  1.000 96.06403  ? 101 TYR F CE2 1 
ATOM   3687 C  CZ  . TYR D 4 101 ? 70.04133 16.35533  16.28606  1.000 96.82410  ? 101 TYR F CZ  1 
ATOM   3688 O  OH  . TYR D 4 101 ? 68.88157 16.54814  17.00437  1.000 97.93563  ? 101 TYR F OH  1 
ATOM   3689 N  N   . PHE D 4 102 ? 72.77974 12.56523  15.03252  1.000 99.53889  ? 102 PHE F N   1 
ATOM   3690 C  CA  . PHE D 4 102 ? 71.91973 11.41493  14.80183  1.000 99.87539  ? 102 PHE F CA  1 
ATOM   3691 C  C   . PHE D 4 102 ? 70.62668 11.59489  15.57873  1.000 99.93796  ? 102 PHE F C   1 
ATOM   3692 O  O   . PHE D 4 102 ? 70.65565 11.90873  16.77206  1.000 100.77714 ? 102 PHE F O   1 
ATOM   3693 C  CB  . PHE D 4 102 ? 72.62432 10.13553  15.23199  1.000 102.10951 ? 102 PHE F CB  1 
ATOM   3694 C  CG  . PHE D 4 102 ? 71.85886 8.88595   14.93241  1.000 103.92730 ? 102 PHE F CG  1 
ATOM   3695 C  CD1 . PHE D 4 102 ? 70.86220 8.44103   15.78783  1.000 103.77740 ? 102 PHE F CD1 1 
ATOM   3696 C  CD2 . PHE D 4 102 ? 72.15439 8.14068   13.80538  1.000 105.89375 ? 102 PHE F CD2 1 
ATOM   3697 C  CE1 . PHE D 4 102 ? 70.16578 7.28949   15.51441  1.000 104.23806 ? 102 PHE F CE1 1 
ATOM   3698 C  CE2 . PHE D 4 102 ? 71.46573 6.98518   13.52957  1.000 106.47827 ? 102 PHE F CE2 1 
ATOM   3699 C  CZ  . PHE D 4 102 ? 70.46865 6.55827   14.38389  1.000 106.62517 ? 102 PHE F CZ  1 
ATOM   3700 N  N   . THR D 4 103 ? 69.49722 11.38068  14.91138  1.000 99.46146  ? 103 THR F N   1 
ATOM   3701 C  CA  . THR D 4 103 ? 68.20985 11.53604  15.56803  1.000 99.23003  ? 103 THR F CA  1 
ATOM   3702 C  C   . THR D 4 103 ? 67.21498 10.56583  14.95398  1.000 100.67741 ? 103 THR F C   1 
ATOM   3703 O  O   . THR D 4 103 ? 67.16436 10.39951  13.73079  1.000 102.71385 ? 103 THR F O   1 
ATOM   3704 C  CB  . THR D 4 103 ? 67.68704 12.97194  15.47258  1.000 99.41200  ? 103 THR F CB  1 
ATOM   3705 O  OG1 . THR D 4 103 ? 66.40238 13.05319  16.10385  1.000 99.15312  ? 103 THR F OG1 1 
ATOM   3706 C  CG2 . THR D 4 103 ? 67.57065 13.42132  14.02070  1.000 98.07838  ? 103 THR F CG2 1 
ATOM   3707 N  N   . ASP D 4 104 ? 66.44235 9.91183   15.81275  1.000 99.08555  ? 104 ASP F N   1 
ATOM   3708 C  CA  . ASP D 4 104 ? 65.40044 9.01078   15.34930  1.000 101.25956 ? 104 ASP F CA  1 
ATOM   3709 C  C   . ASP D 4 104 ? 64.13073 9.78920   15.03894  1.000 95.09506  ? 104 ASP F C   1 
ATOM   3710 O  O   . ASP D 4 104 ? 63.74177 10.69243  15.78462  1.000 97.72635  ? 104 ASP F O   1 
ATOM   3711 C  CB  . ASP D 4 104 ? 65.13787 7.93339   16.39945  1.000 108.26273 ? 104 ASP F CB  1 
ATOM   3712 C  CG  . ASP D 4 104 ? 66.39125 7.14384   16.73726  1.000 115.36399 ? 104 ASP F CG  1 
ATOM   3713 O  OD1 . ASP D 4 104 ? 67.12628 7.55732   17.66528  1.000 116.34476 ? 104 ASP F OD1 1 
ATOM   3714 O  OD2 . ASP D 4 104 ? 66.65197 6.11777   16.06896  1.000 117.02988 ? 104 ASP F OD2 1 
ATOM   3715 N  N   . ILE D 4 105 ? 63.49723 9.44635   13.92304  1.000 89.54995  ? 105 ILE F N   1 
ATOM   3716 C  CA  . ILE D 4 105 ? 62.35135 10.18679  13.41161  1.000 87.63904  ? 105 ILE F CA  1 
ATOM   3717 C  C   . ILE D 4 105 ? 61.20766 9.22239   13.13473  1.000 82.92442  ? 105 ILE F C   1 
ATOM   3718 O  O   . ILE D 4 105 ? 61.43613 8.08565   12.70814  1.000 83.56155  ? 105 ILE F O   1 
ATOM   3719 C  CB  . ILE D 4 105 ? 62.71666 10.97459  12.13519  1.000 87.81358  ? 105 ILE F CB  1 
ATOM   3720 C  CG1 . ILE D 4 105 ? 63.34096 10.02518  11.10686  1.000 88.05212  ? 105 ILE F CG1 1 
ATOM   3721 C  CG2 . ILE D 4 105 ? 63.64069 12.14390  12.47355  1.000 88.86126  ? 105 ILE F CG2 1 
ATOM   3722 C  CD1 . ILE D 4 105 ? 63.78115 10.68582  9.82287   1.000 89.29559  ? 105 ILE F CD1 1 
ATOM   3723 N  N   . ASP D 4 106 ? 59.97540 9.67091   13.39106  1.000 78.11010  ? 106 ASP F N   1 
ATOM   3724 C  CA  . ASP D 4 106 ? 58.81244 8.87720   13.03542  1.000 73.92230  ? 106 ASP F CA  1 
ATOM   3725 C  C   . ASP D 4 106 ? 58.63751 8.91087   11.51438  1.000 72.05659  ? 106 ASP F C   1 
ATOM   3726 O  O   . ASP D 4 106 ? 59.20712 9.77013   10.83845  1.000 74.99167  ? 106 ASP F O   1 
ATOM   3727 C  CB  . ASP D 4 106 ? 57.55523 9.37991   13.76006  1.000 74.55215  ? 106 ASP F CB  1 
ATOM   3728 C  CG  . ASP D 4 106 ? 57.07920 10.75200  13.28669  1.000 75.74893  ? 106 ASP F CG  1 
ATOM   3729 O  OD1 . ASP D 4 106 ? 56.59124 10.86747  12.13970  1.000 76.48424  ? 106 ASP F OD1 1 
ATOM   3730 O  OD2 . ASP D 4 106 ? 57.12653 11.70513  14.09217  1.000 75.92541  ? 106 ASP F OD2 1 
ATOM   3731 N  N   . PRO D 4 107 ? 57.89996 7.95520   10.93851  1.000 75.53448  ? 107 PRO F N   1 
ATOM   3732 C  CA  . PRO D 4 107 ? 57.91759 7.83895   9.47014   1.000 74.61502  ? 107 PRO F CA  1 
ATOM   3733 C  C   . PRO D 4 107 ? 57.31223 9.02102   8.74176   1.000 76.14260  ? 107 PRO F C   1 
ATOM   3734 O  O   . PRO D 4 107 ? 57.80708 9.38605   7.66688   1.000 79.13330  ? 107 PRO F O   1 
ATOM   3735 C  CB  . PRO D 4 107 ? 57.14094 6.54050   9.21387   1.000 71.91094  ? 107 PRO F CB  1 
ATOM   3736 C  CG  . PRO D 4 107 ? 57.22201 5.79398   10.47673  1.000 71.39339  ? 107 PRO F CG  1 
ATOM   3737 C  CD  . PRO D 4 107 ? 57.17638 6.83220   11.55123  1.000 72.93701  ? 107 PRO F CD  1 
ATOM   3738 N  N   . ILE D 4 108 ? 56.25516 9.62881   9.28909   1.000 74.69480  ? 108 ILE F N   1 
ATOM   3739 C  CA  . ILE D 4 108 ? 55.60448 10.74114  8.60103   1.000 72.68164  ? 108 ILE F CA  1 
ATOM   3740 C  C   . ILE D 4 108 ? 56.54660 11.93647  8.50417   1.000 73.78002  ? 108 ILE F C   1 
ATOM   3741 O  O   . ILE D 4 108 ? 56.49240 12.70771  7.53708   1.000 76.46584  ? 108 ILE F O   1 
ATOM   3742 C  CB  . ILE D 4 108 ? 54.27170 11.07435  9.30525   1.000 72.42165  ? 108 ILE F CB  1 
ATOM   3743 C  CG1 . ILE D 4 108 ? 53.28420 9.91542   9.14227   1.000 74.59260  ? 108 ILE F CG1 1 
ATOM   3744 C  CG2 . ILE D 4 108 ? 53.62983 12.29400  8.71913   1.000 71.53322  ? 108 ILE F CG2 1 
ATOM   3745 C  CD1 . ILE D 4 108 ? 53.33570 8.83625   10.20318  1.000 75.51646  ? 108 ILE F CD1 1 
ATOM   3746 N  N   . VAL D 4 109 ? 57.46677 12.07482  9.45632   1.000 74.11264  ? 109 VAL F N   1 
ATOM   3747 C  CA  . VAL D 4 109 ? 58.50300 13.09493  9.33685   1.000 77.34170  ? 109 VAL F CA  1 
ATOM   3748 C  C   . VAL D 4 109 ? 59.46881 12.73636  8.20759   1.000 81.20954  ? 109 VAL F C   1 
ATOM   3749 O  O   . VAL D 4 109 ? 59.75190 13.55472  7.32292   1.000 80.85513  ? 109 VAL F O   1 
ATOM   3750 C  CB  . VAL D 4 109 ? 59.22369 13.26583  10.68716  1.000 77.72554  ? 109 VAL F CB  1 
ATOM   3751 C  CG1 . VAL D 4 109 ? 60.51304 14.02963  10.51629  1.000 81.58095  ? 109 VAL F CG1 1 
ATOM   3752 C  CG2 . VAL D 4 109 ? 58.31965 13.98225  11.66608  1.000 76.59622  ? 109 VAL F CG2 1 
ATOM   3753 N  N   . ALA D 4 110 ? 59.92653 11.47997  8.18005   1.000 82.86485  ? 110 ALA F N   1 
ATOM   3754 C  CA  . ALA D 4 110 ? 60.90910 11.05922  7.18711   1.000 84.08175  ? 110 ALA F CA  1 
ATOM   3755 C  C   . ALA D 4 110 ? 60.37284 11.22543  5.76925   1.000 87.32734  ? 110 ALA F C   1 
ATOM   3756 O  O   . ALA D 4 110 ? 61.07673 11.73401  4.88916   1.000 91.06073  ? 110 ALA F O   1 
ATOM   3757 C  CB  . ALA D 4 110 ? 61.31390 9.61482   7.45292   1.000 82.17832  ? 110 ALA F CB  1 
ATOM   3758 N  N   . ASP D 4 111 ? 59.12062 10.82292  5.53382   1.000 86.18715  ? 111 ASP F N   1 
ATOM   3759 C  CA  . ASP D 4 111 ? 58.49339 11.06084  4.23650   1.000 87.97795  ? 111 ASP F CA  1 
ATOM   3760 C  C   . ASP D 4 111 ? 58.46676 12.54179  3.89510   1.000 88.80519  ? 111 ASP F C   1 
ATOM   3761 O  O   . ASP D 4 111 ? 58.70890 12.92423  2.74445   1.000 90.51147  ? 111 ASP F O   1 
ATOM   3762 C  CB  . ASP D 4 111 ? 57.07688 10.50250  4.22279   1.000 90.46711  ? 111 ASP F CB  1 
ATOM   3763 C  CG  . ASP D 4 111 ? 57.05248 9.02773   3.98641   1.000 96.85853  ? 111 ASP F CG  1 
ATOM   3764 O  OD1 . ASP D 4 111 ? 58.03178 8.52091   3.39935   1.000 99.76958  ? 111 ASP F OD1 1 
ATOM   3765 O  OD2 . ASP D 4 111 ? 56.06030 8.38097   4.38206   1.000 99.99866  ? 111 ASP F OD2 1 
ATOM   3766 N  N   . SER D 4 112 ? 58.14872 13.39097  4.87549   1.000 87.05388  ? 112 SER F N   1 
ATOM   3767 C  CA  . SER D 4 112 ? 58.10278 14.82325  4.61251   1.000 85.32483  ? 112 SER F CA  1 
ATOM   3768 C  C   . SER D 4 112 ? 59.48209 15.36684  4.26285   1.000 86.90168  ? 112 SER F C   1 
ATOM   3769 O  O   . SER D 4 112 ? 59.60468 16.22789  3.38522   1.000 86.43087  ? 112 SER F O   1 
ATOM   3770 C  CB  . SER D 4 112 ? 57.51853 15.55629  5.81715   1.000 84.47213  ? 112 SER F CB  1 
ATOM   3771 O  OG  . SER D 4 112 ? 57.61376 16.95981  5.64966   1.000 85.61597  ? 112 SER F OG  1 
ATOM   3772 N  N   . LEU D 4 113 ? 60.53338 14.86722  4.92686   1.000 86.56414  ? 113 LEU F N   1 
ATOM   3773 C  CA  . LEU D 4 113 ? 61.89316 15.30904  4.61768   1.000 87.53179  ? 113 LEU F CA  1 
ATOM   3774 C  C   . LEU D 4 113 ? 62.35084 14.80856  3.25144   1.000 85.77458  ? 113 LEU F C   1 
ATOM   3775 O  O   . LEU D 4 113 ? 63.04773 15.52358  2.52444   1.000 86.19426  ? 113 LEU F O   1 
ATOM   3776 C  CB  . LEU D 4 113 ? 62.85975 14.85357  5.71483   1.000 88.32854  ? 113 LEU F CB  1 
ATOM   3777 C  CG  . LEU D 4 113 ? 62.83061 15.67955  7.00553   1.000 88.60445  ? 113 LEU F CG  1 
ATOM   3778 C  CD1 . LEU D 4 113 ? 63.86038 15.20233  8.03150   1.000 88.48716  ? 113 LEU F CD1 1 
ATOM   3779 C  CD2 . LEU D 4 113 ? 63.03036 17.15362  6.68371   1.000 89.22863  ? 113 LEU F CD2 1 
ATOM   3780 N  N   . ILE D 4 114 ? 61.98824 13.57754  2.89298   1.000 84.49555  ? 114 ILE F N   1 
ATOM   3781 C  CA  . ILE D 4 114 ? 62.40247 13.02969  1.60595   1.000 83.70249  ? 114 ILE F CA  1 
ATOM   3782 C  C   . ILE D 4 114 ? 61.74367 13.78999  0.45688   1.000 81.82097  ? 114 ILE F C   1 
ATOM   3783 O  O   . ILE D 4 114 ? 62.39115 14.10419  -0.55303  1.000 79.34339  ? 114 ILE F O   1 
ATOM   3784 C  CB  . ILE D 4 114 ? 62.09631 11.52090  1.56754   1.000 83.87075  ? 114 ILE F CB  1 
ATOM   3785 C  CG1 . ILE D 4 114 ? 62.98058 10.79819  2.58683   1.000 82.15344  ? 114 ILE F CG1 1 
ATOM   3786 C  CG2 . ILE D 4 114 ? 62.29390 10.94619  0.16661   1.000 86.45731  ? 114 ILE F CG2 1 
ATOM   3787 C  CD1 . ILE D 4 114 ? 62.73338 9.32250   2.68059   1.000 80.30440  ? 114 ILE F CD1 1 
ATOM   3788 N  N   . HIS D 4 115 ? 60.46158 14.13203  0.60427   1.000 81.50247  ? 115 HIS F N   1 
ATOM   3789 C  CA  . HIS D 4 115 ? 59.75408 14.82900  -0.46188  1.000 82.86002  ? 115 HIS F CA  1 
ATOM   3790 C  C   . HIS D 4 115 ? 60.24797 16.25346  -0.68461  1.000 87.06617  ? 115 HIS F C   1 
ATOM   3791 O  O   . HIS D 4 115 ? 59.93122 16.84743  -1.72255  1.000 88.41169  ? 115 HIS F O   1 
ATOM   3792 C  CB  . HIS D 4 115 ? 58.25538 14.86623  -0.18295  1.000 79.83049  ? 115 HIS F CB  1 
ATOM   3793 C  CG  . HIS D 4 115 ? 57.45481 15.30704  -1.36308  1.000 79.54920  ? 115 HIS F CG  1 
ATOM   3794 N  ND1 . HIS D 4 115 ? 57.73026 14.86685  -2.63959  1.000 81.88979  ? 115 HIS F ND1 1 
ATOM   3795 C  CD2 . HIS D 4 115 ? 56.39274 16.13758  -1.47030  1.000 78.21899  ? 115 HIS F CD2 1 
ATOM   3796 C  CE1 . HIS D 4 115 ? 56.87382 15.41091  -3.48426  1.000 82.28124  ? 115 HIS F CE1 1 
ATOM   3797 N  NE2 . HIS D 4 115 ? 56.05049 16.18502  -2.80034  1.000 81.05863  ? 115 HIS F NE2 1 
ATOM   3798 N  N   . LYS D 4 116 ? 61.00764 16.81555  0.25443   1.000 87.97029  ? 116 LYS F N   1 
ATOM   3799 C  CA  . LYS D 4 116 ? 61.58905 18.13022  0.02783   1.000 91.49449  ? 116 LYS F CA  1 
ATOM   3800 C  C   . LYS D 4 116 ? 62.50974 18.12344  -1.17930  1.000 98.51353  ? 116 LYS F C   1 
ATOM   3801 O  O   . LYS D 4 116 ? 62.65105 19.14378  -1.85770  1.000 101.98301 ? 116 LYS F O   1 
ATOM   3802 C  CB  . LYS D 4 116 ? 62.38272 18.57582  1.25575   1.000 92.33096  ? 116 LYS F CB  1 
ATOM   3803 C  CG  . LYS D 4 116 ? 61.61414 18.65839  2.55907   1.000 90.91848  ? 116 LYS F CG  1 
ATOM   3804 C  CD  . LYS D 4 116 ? 60.60794 19.78778  2.54838   1.000 90.62066  ? 116 LYS F CD  1 
ATOM   3805 C  CE  . LYS D 4 116 ? 59.53886 19.60073  3.61871   1.000 88.87030  ? 116 LYS F CE  1 
ATOM   3806 N  NZ  . LYS D 4 116 ? 58.44226 18.67090  3.23093   1.000 86.08366  ? 116 LYS F NZ  1 
ATOM   3807 N  N   . ILE D 4 117 ? 63.14539 16.98918  -1.46009  1.000 102.85711 ? 117 ILE F N   1 
ATOM   3808 C  CA  . ILE D 4 117 ? 64.22285 16.95737  -2.43667  1.000 109.41763 ? 117 ILE F CA  1 
ATOM   3809 C  C   . ILE D 4 117 ? 63.96185 16.01314  -3.60990  1.000 111.89041 ? 117 ILE F C   1 
ATOM   3810 O  O   . ILE D 4 117 ? 64.39677 16.28637  -4.73500  1.000 114.56676 ? 117 ILE F O   1 
ATOM   3811 C  CB  . ILE D 4 117 ? 65.52968 16.59709  -1.70441  1.000 111.56802 ? 117 ILE F CB  1 
ATOM   3812 C  CG1 . ILE D 4 117 ? 65.76495 17.59765  -0.56692  1.000 111.59408 ? 117 ILE F CG1 1 
ATOM   3813 C  CG2 . ILE D 4 117 ? 66.71842 16.54276  -2.66027  1.000 114.99939 ? 117 ILE F CG2 1 
ATOM   3814 C  CD1 . ILE D 4 117 ? 66.99726 17.32262  0.25046   1.000 113.84602 ? 117 ILE F CD1 1 
ATOM   3815 N  N   . TYR D 4 118 ? 63.22477 14.91678  -3.38422  1.000 113.78170 ? 118 TYR F N   1 
ATOM   3816 C  CA  . TYR D 4 118 ? 63.26982 13.81610  -4.35073  1.000 115.33578 ? 118 TYR F CA  1 
ATOM   3817 C  C   . TYR D 4 118 ? 62.08584 13.70321  -5.30265  1.000 119.21522 ? 118 TYR F C   1 
ATOM   3818 O  O   . TYR D 4 118 ? 62.24167 13.90836  -6.51092  1.000 123.56535 ? 118 TYR F O   1 
ATOM   3819 C  CB  . TYR D 4 118 ? 63.43620 12.47463  -3.63401  1.000 108.39865 ? 118 TYR F CB  1 
ATOM   3820 C  CG  . TYR D 4 118 ? 64.84866 12.25725  -3.19768  1.000 103.85522 ? 118 TYR F CG  1 
ATOM   3821 C  CD1 . TYR D 4 118 ? 65.82352 11.87602  -4.10803  1.000 103.53170 ? 118 TYR F CD1 1 
ATOM   3822 C  CD2 . TYR D 4 118 ? 65.22110 12.47246  -1.88147  1.000 104.03912 ? 118 TYR F CD2 1 
ATOM   3823 C  CE1 . TYR D 4 118 ? 67.13329 11.69916  -3.71731  1.000 104.10065 ? 118 TYR F CE1 1 
ATOM   3824 C  CE2 . TYR D 4 118 ? 66.52568 12.30089  -1.47953  1.000 104.89730 ? 118 TYR F CE2 1 
ATOM   3825 C  CZ  . TYR D 4 118 ? 67.47658 11.90945  -2.40010  1.000 105.27726 ? 118 TYR F CZ  1 
ATOM   3826 O  OH  . TYR D 4 118 ? 68.77878 11.73260  -2.00637  1.000 106.53382 ? 118 TYR F OH  1 
ATOM   3827 N  N   . PHE D 4 119 ? 60.91579 13.36147  -4.80607  1.000 110.42570 ? 119 PHE F N   1 
ATOM   3828 C  CA  . PHE D 4 119 ? 59.88089 12.98749  -5.75237  1.000 105.31682 ? 119 PHE F CA  1 
ATOM   3829 C  C   . PHE D 4 119 ? 59.21389 14.23762  -6.31501  1.000 105.10433 ? 119 PHE F C   1 
ATOM   3830 O  O   . PHE D 4 119 ? 59.33186 15.31243  -5.73290  1.000 108.58468 ? 119 PHE F O   1 
ATOM   3831 C  CB  . PHE D 4 119 ? 58.88379 12.06541  -5.06649  1.000 100.63722 ? 119 PHE F CB  1 
ATOM   3832 C  CG  . PHE D 4 119 ? 59.51636 10.82124  -4.50291  1.000 93.78067  ? 119 PHE F CG  1 
ATOM   3833 C  CD1 . PHE D 4 119 ? 60.38508 10.06666  -5.26361  1.000 90.19074  ? 119 PHE F CD1 1 
ATOM   3834 C  CD2 . PHE D 4 119 ? 59.26169 10.43288  -3.20306  1.000 90.53465  ? 119 PHE F CD2 1 
ATOM   3835 C  CE1 . PHE D 4 119 ? 60.96252 8.93540   -4.74634  1.000 89.93333  ? 119 PHE F CE1 1 
ATOM   3836 C  CE2 . PHE D 4 119 ? 59.83695 9.31303   -2.67964  1.000 89.30892  ? 119 PHE F CE2 1 
ATOM   3837 C  CZ  . PHE D 4 119 ? 60.69318 8.55688   -3.45414  1.000 89.93504  ? 119 PHE F CZ  1 
ATOM   3838 N  N   . PRO D 4 120 ? 58.51562 14.13748  -7.45255  1.000 103.14521 ? 120 PRO F N   1 
ATOM   3839 C  CA  . PRO D 4 120 ? 58.03117 15.35692  -8.11704  1.000 103.32350 ? 120 PRO F CA  1 
ATOM   3840 C  C   . PRO D 4 120 ? 56.86249 16.00123  -7.39068  1.000 103.79193 ? 120 PRO F C   1 
ATOM   3841 O  O   . PRO D 4 120 ? 55.99499 15.31645  -6.84293  1.000 101.86130 ? 120 PRO F O   1 
ATOM   3842 C  CB  . PRO D 4 120 ? 57.60170 14.85925  -9.50134  1.000 102.78579 ? 120 PRO F CB  1 
ATOM   3843 C  CG  . PRO D 4 120 ? 57.19929 13.46196  -9.27244  1.000 101.93133 ? 120 PRO F CG  1 
ATOM   3844 C  CD  . PRO D 4 120 ? 58.13894 12.93148  -8.21120  1.000 101.91240 ? 120 PRO F CD  1 
ATOM   3845 N  N   . CYS D 4 121 ? 56.86300 17.33722  -7.38966  1.000 106.46797 ? 121 CYS F N   1 
ATOM   3846 C  CA  . CYS D 4 121 ? 55.81794 18.14655  -6.76488  1.000 108.21844 ? 121 CYS F CA  1 
ATOM   3847 C  C   . CYS D 4 121 ? 55.19436 19.16594  -7.72284  1.000 108.69622 ? 121 CYS F C   1 
ATOM   3848 O  O   . CYS D 4 121 ? 55.47970 19.16252  -8.92118  1.000 114.06976 ? 121 CYS F O   1 
ATOM   3849 C  CB  . CYS D 4 121 ? 56.38633 18.88659  -5.55321  1.000 110.56552 ? 121 CYS F CB  1 
ATOM   3850 S  SG  . CYS D 4 121 ? 55.09943 19.39090  -4.44199  1.000 109.75378 ? 121 CYS F SG  1 
ATOM   3851 N  N   . PHE D 4 122 ? 54.31559 20.02830  -7.19020  1.000 100.38475 ? 122 PHE F N   1 
ATOM   3852 C  CA  . PHE D 4 122 ? 53.77586 21.13780  -7.97018  1.000 93.35025  ? 122 PHE F CA  1 
ATOM   3853 C  C   . PHE D 4 122 ? 54.87168 22.14452  -8.30762  1.000 97.35039  ? 122 PHE F C   1 
ATOM   3854 O  O   . PHE D 4 122 ? 55.72901 22.45803  -7.47558  1.000 97.38981  ? 122 PHE F O   1 
ATOM   3855 C  CB  . PHE D 4 122 ? 52.65718 21.83676  -7.20092  1.000 84.65641  ? 122 PHE F CB  1 
ATOM   3856 C  CG  . PHE D 4 122 ? 51.44667 20.98962  -6.99005  1.000 76.87313  ? 122 PHE F CG  1 
ATOM   3857 C  CD1 . PHE D 4 122 ? 50.57916 20.71586  -8.03412  1.000 73.30174  ? 122 PHE F CD1 1 
ATOM   3858 C  CD2 . PHE D 4 122 ? 51.16954 20.46482  -5.74235  1.000 74.25578  ? 122 PHE F CD2 1 
ATOM   3859 C  CE1 . PHE D 4 122 ? 49.46531 19.92884  -7.83507  1.000 70.37187  ? 122 PHE F CE1 1 
ATOM   3860 C  CE2 . PHE D 4 122 ? 50.05954 19.67881  -5.53781  1.000 70.50899  ? 122 PHE F CE2 1 
ATOM   3861 C  CZ  . PHE D 4 122 ? 49.20707 19.40985  -6.58265  1.000 69.04645  ? 122 PHE F CZ  1 
ATOM   3862 N  N   . THR D 4 123 ? 54.83056 22.67568  -9.52721  1.000 100.21168 ? 123 THR F N   1 
ATOM   3863 C  CA  . THR D 4 123 ? 55.92612 23.50574  -10.00700 1.000 105.25485 ? 123 THR F CA  1 
ATOM   3864 C  C   . THR D 4 123 ? 55.75482 24.96532  -9.57872  1.000 110.24254 ? 123 THR F C   1 
ATOM   3865 O  O   . THR D 4 123 ? 54.84021 25.32893  -8.83490  1.000 108.76031 ? 123 THR F O   1 
ATOM   3866 C  CB  . THR D 4 123 ? 56.05787 23.40164  -11.52773 1.000 105.94432 ? 123 THR F CB  1 
ATOM   3867 O  OG1 . THR D 4 123 ? 54.76914 23.54648  -12.13717 1.000 105.72807 ? 123 THR F OG1 1 
ATOM   3868 C  CG2 . THR D 4 123 ? 56.65974 22.05630  -11.92340 1.000 104.97252 ? 123 THR F CG2 1 
ATOM   3869 N  N   . ASP D 4 124 ? 56.69082 25.80491  -10.02929 1.000 117.12276 ? 124 ASP F N   1 
ATOM   3870 C  CA  . ASP D 4 124 ? 56.60529 27.24263  -9.79011  1.000 124.58783 ? 124 ASP F CA  1 
ATOM   3871 C  C   . ASP D 4 124 ? 55.30929 27.80896  -10.35147 1.000 117.27055 ? 124 ASP F C   1 
ATOM   3872 O  O   . ASP D 4 124 ? 54.58611 28.54176  -9.66853  1.000 115.28478 ? 124 ASP F O   1 
ATOM   3873 C  CB  . ASP D 4 124 ? 57.81601 27.93617  -10.41595 1.000 139.31512 ? 124 ASP F CB  1 
ATOM   3874 C  CG  . ASP D 4 124 ? 58.01341 29.34842  -9.90720  1.000 154.89424 ? 124 ASP F CG  1 
ATOM   3875 O  OD1 . ASP D 4 124 ? 57.03295 29.97299  -9.44965  1.000 159.07841 ? 124 ASP F OD1 1 
ATOM   3876 O  OD2 . ASP D 4 124 ? 59.16261 29.83491  -9.96629  1.000 166.90975 ? 124 ASP F OD2 1 
ATOM   3877 N  N   . LYS D 4 125 ? 54.99959 27.47154  -11.59921 1.000 114.93168 ? 125 LYS F N   1 
ATOM   3878 C  CA  . LYS D 4 125 ? 53.82480 27.97121  -12.29328 1.000 109.16585 ? 125 LYS F CA  1 
ATOM   3879 C  C   . LYS D 4 125 ? 52.59168 27.10422  -12.05449 1.000 106.19502 ? 125 LYS F C   1 
ATOM   3880 O  O   . LYS D 4 125 ? 51.63695 27.17740  -12.83546 1.000 106.02199 ? 125 LYS F O   1 
ATOM   3881 C  CB  . LYS D 4 125 ? 54.11442 28.08017  -13.79186 1.000 107.89404 ? 125 LYS F CB  1 
ATOM   3882 C  CG  . LYS D 4 125 ? 55.43120 28.77421  -14.12201 1.000 106.54060 ? 125 LYS F CG  1 
ATOM   3883 C  CD  . LYS D 4 125 ? 55.61993 28.92005  -15.62437 1.000 106.05443 ? 125 LYS F CD  1 
ATOM   3884 C  CE  . LYS D 4 125 ? 56.99844 29.46714  -15.95542 1.000 108.93092 ? 125 LYS F CE  1 
ATOM   3885 N  NZ  . LYS D 4 125 ? 57.24801 30.77695  -15.29051 1.000 110.63295 ? 125 LYS F NZ  1 
ATOM   3886 N  N   . ALA D 4 126 ? 52.60104 26.27446  -11.00548 1.000 102.24591 ? 126 ALA F N   1 
ATOM   3887 C  CA  . ALA D 4 126 ? 51.52436 25.30564  -10.79950 1.000 99.99680  ? 126 ALA F CA  1 
ATOM   3888 C  C   . ALA D 4 126 ? 50.17353 25.98849  -10.62142 1.000 96.92337  ? 126 ALA F C   1 
ATOM   3889 O  O   . ALA D 4 126 ? 49.16583 25.55285  -11.19047 1.000 96.23464  ? 126 ALA F O   1 
ATOM   3890 C  CB  . ALA D 4 126 ? 51.83666 24.42421  -9.59159  1.000 100.20538 ? 126 ALA F CB  1 
ATOM   3891 N  N   . ILE D 4 127 ? 50.12816 27.04754  -9.80910  1.000 95.02346  ? 127 ILE F N   1 
ATOM   3892 C  CA  . ILE D 4 127 ? 48.86350 27.72733  -9.54489  1.000 91.74500  ? 127 ILE F CA  1 
ATOM   3893 C  C   . ILE D 4 127 ? 48.39109 28.49180  -10.77612 1.000 93.64283  ? 127 ILE F C   1 
ATOM   3894 O  O   . ILE D 4 127 ? 47.20066 28.47720  -11.11151 1.000 92.36882  ? 127 ILE F O   1 
ATOM   3895 C  CB  . ILE D 4 127 ? 48.99458 28.65103  -8.32335  1.000 88.90456  ? 127 ILE F CB  1 
ATOM   3896 C  CG1 . ILE D 4 127 ? 49.47029 27.87893  -7.10679  1.000 86.14481  ? 127 ILE F CG1 1 
ATOM   3897 C  CG2 . ILE D 4 127 ? 47.67149 29.28612  -7.97889  1.000 88.70059  ? 127 ILE F CG2 1 
ATOM   3898 C  CD1 . ILE D 4 127 ? 49.51521 28.74650  -5.89163  1.000 84.91820  ? 127 ILE F CD1 1 
ATOM   3899 N  N   . ARG D 4 128 ? 49.30379 29.18330  -11.46098 1.000 97.19628  ? 128 ARG F N   1 
ATOM   3900 C  CA  . ARG D 4 128 ? 48.90689 29.95580  -12.63451 1.000 99.42658  ? 128 ARG F CA  1 
ATOM   3901 C  C   . ARG D 4 128 ? 48.34428 29.05155  -13.72626 1.000 98.19516  ? 128 ARG F C   1 
ATOM   3902 O  O   . ARG D 4 128 ? 47.29676 29.34853  -14.31340 1.000 95.01146  ? 128 ARG F O   1 
ATOM   3903 C  CB  . ARG D 4 128 ? 50.09713 30.75789  -13.16022 1.000 104.67471 ? 128 ARG F CB  1 
ATOM   3904 C  CG  . ARG D 4 128 ? 49.81094 31.48921  -14.45791 1.000 109.86240 ? 128 ARG F CG  1 
ATOM   3905 C  CD  . ARG D 4 128 ? 50.87841 32.52396  -14.74449 1.000 117.43010 ? 128 ARG F CD  1 
ATOM   3906 N  NE  . ARG D 4 128 ? 52.11953 31.94402  -15.24919 1.000 124.51705 ? 128 ARG F NE  1 
ATOM   3907 C  CZ  . ARG D 4 128 ? 52.46917 31.95130  -16.53134 1.000 126.47818 ? 128 ARG F CZ  1 
ATOM   3908 N  NH1 . ARG D 4 128 ? 53.61724 31.40974  -16.91657 1.000 128.24770 ? 128 ARG F NH1 1 
ATOM   3909 N  NH2 . ARG D 4 128 ? 51.66612 32.50702  -17.42851 1.000 126.66395 ? 128 ARG F NH2 1 
ATOM   3910 N  N   . GLN D 4 129 ? 49.03074 27.93357  -14.00493 1.000 98.87949  ? 129 GLN F N   1 
ATOM   3911 C  CA  . GLN D 4 129 ? 48.59902 27.02255  -15.06420 1.000 97.01212  ? 129 GLN F CA  1 
ATOM   3912 C  C   . GLN D 4 129 ? 47.25299 26.39180  -14.73853 1.000 91.58189  ? 129 GLN F C   1 
ATOM   3913 O  O   . GLN D 4 129 ? 46.42507 26.17304  -15.63315 1.000 88.80083  ? 129 GLN F O   1 
ATOM   3914 C  CB  . GLN D 4 129 ? 49.65325 25.93592  -15.29890 1.000 101.36547 ? 129 GLN F CB  1 
ATOM   3915 C  CG  . GLN D 4 129 ? 50.99820 26.43788  -15.80709 1.000 106.75325 ? 129 GLN F CG  1 
ATOM   3916 C  CD  . GLN D 4 129 ? 52.14945 25.49882  -15.47318 1.000 110.39564 ? 129 GLN F CD  1 
ATOM   3917 O  OE1 . GLN D 4 129 ? 52.03096 24.63631  -14.60174 1.000 111.96453 ? 129 GLN F OE1 1 
ATOM   3918 N  NE2 . GLN D 4 129 ? 53.27077 25.66609  -16.16741 1.000 110.83627 ? 129 GLN F NE2 1 
ATOM   3919 N  N   . ALA D 4 130 ? 47.02925 26.07060  -13.46397 1.000 89.15254  ? 130 ALA F N   1 
ATOM   3920 C  CA  . ALA D 4 130 ? 45.77849 25.44120  -13.06406 1.000 88.61958  ? 130 ALA F CA  1 
ATOM   3921 C  C   . ALA D 4 130 ? 44.60409 26.39113  -13.25504 1.000 92.49813  ? 130 ALA F C   1 
ATOM   3922 O  O   . ALA D 4 130 ? 43.51278 25.96781  -13.65672 1.000 94.45147  ? 130 ALA F O   1 
ATOM   3923 C  CB  . ALA D 4 130 ? 45.86925 24.98204  -11.61027 1.000 87.53509  ? 130 ALA F CB  1 
ATOM   3924 N  N   . ILE D 4 131 ? 44.81508 27.68496  -13.00135 1.000 93.24525  ? 131 ILE F N   1 
ATOM   3925 C  CA  . ILE D 4 131 ? 43.70976 28.63652  -13.06762 1.000 92.91229  ? 131 ILE F CA  1 
ATOM   3926 C  C   . ILE D 4 131 ? 43.29595 28.87386  -14.51540 1.000 100.53985 ? 131 ILE F C   1 
ATOM   3927 O  O   . ILE D 4 131 ? 42.10200 28.96043  -14.82683 1.000 101.63030 ? 131 ILE F O   1 
ATOM   3928 C  CB  . ILE D 4 131 ? 44.09037 29.95214  -12.35768 1.000 87.39406  ? 131 ILE F CB  1 
ATOM   3929 C  CG1 . ILE D 4 131 ? 44.24176 29.72341  -10.84716 1.000 82.46998  ? 131 ILE F CG1 1 
ATOM   3930 C  CG2 . ILE D 4 131 ? 43.06671 31.04256  -12.65534 1.000 83.30750  ? 131 ILE F CG2 1 
ATOM   3931 C  CD1 . ILE D 4 131 ? 44.50251 30.98449  -10.03706 1.000 79.98315  ? 131 ILE F CD1 1 
ATOM   3932 N  N   . LEU D 4 132 ? 44.26728 28.96128  -15.42478 1.000 105.64132 ? 132 LEU F N   1 
ATOM   3933 C  CA  . LEU D 4 132 ? 43.98191 29.30118  -16.81168 1.000 109.31916 ? 132 LEU F CA  1 
ATOM   3934 C  C   . LEU D 4 132 ? 43.61583 28.09719  -17.67016 1.000 116.70374 ? 132 LEU F C   1 
ATOM   3935 O  O   . LEU D 4 132 ? 43.07194 28.27972  -18.76696 1.000 119.00885 ? 132 LEU F O   1 
ATOM   3936 C  CB  . LEU D 4 132 ? 45.19357 29.98922  -17.43072 1.000 108.72849 ? 132 LEU F CB  1 
ATOM   3937 C  CG  . LEU D 4 132 ? 45.62813 31.22806  -16.66476 1.000 107.78209 ? 132 LEU F CG  1 
ATOM   3938 C  CD1 . LEU D 4 132 ? 46.85006 31.81907  -17.32953 1.000 110.62259 ? 132 LEU F CD1 1 
ATOM   3939 C  CD2 . LEU D 4 132 ? 44.49529 32.23208  -16.58759 1.000 105.84228 ? 132 LEU F CD2 1 
ATOM   3940 N  N   . GLY D 4 133 ? 43.88810 26.87980  -17.20804 1.000 120.22519 ? 133 GLY F N   1 
ATOM   3941 C  CA  . GLY D 4 133 ? 43.59453 25.69781  -17.98519 1.000 125.45676 ? 133 GLY F CA  1 
ATOM   3942 C  C   . GLY D 4 133 ? 44.78723 24.98102  -18.58319 1.000 132.76595 ? 133 GLY F C   1 
ATOM   3943 O  O   . GLY D 4 133 ? 44.59180 24.10586  -19.43570 1.000 138.24043 ? 133 GLY F O   1 
ATOM   3944 N  N   . GLU D 4 134 ? 46.00603 25.32219  -18.17918 1.000 132.86895 ? 134 GLU F N   1 
ATOM   3945 C  CA  . GLU D 4 134 ? 47.21422 24.68957  -18.68761 1.000 134.89409 ? 134 GLU F CA  1 
ATOM   3946 C  C   . GLU D 4 134 ? 47.54614 23.41690  -17.89280 1.000 132.39199 ? 134 GLU F C   1 
ATOM   3947 O  O   . GLU D 4 134 ? 46.96470 23.14149  -16.84226 1.000 134.28420 ? 134 GLU F O   1 
ATOM   3948 C  CB  . GLU D 4 134 ? 48.35584 25.70465  -18.64483 1.000 137.75748 ? 134 GLU F CB  1 
ATOM   3949 C  CG  . GLU D 4 134 ? 48.05564 26.94389  -19.49556 1.000 140.65188 ? 134 GLU F CG  1 
ATOM   3950 C  CD  . GLU D 4 134 ? 49.11326 28.03196  -19.39114 1.000 143.84703 ? 134 GLU F CD  1 
ATOM   3951 O  OE1 . GLU D 4 134 ? 49.41719 28.46981  -18.26066 1.000 143.99078 ? 134 GLU F OE1 1 
ATOM   3952 O  OE2 . GLU D 4 134 ? 49.64192 28.45059  -20.44264 1.000 146.32880 ? 134 GLU F OE2 1 
ATOM   3953 N  N   . LYS D 4 135 ? 48.48992 22.62763  -18.41217 1.000 128.92717 ? 135 LYS F N   1 
ATOM   3954 C  CA  . LYS D 4 135 ? 48.88271 21.37366  -17.77580 1.000 122.75782 ? 135 LYS F CA  1 
ATOM   3955 C  C   . LYS D 4 135 ? 49.83492 21.62810  -16.60956 1.000 117.56510 ? 135 LYS F C   1 
ATOM   3956 O  O   . LYS D 4 135 ? 50.44016 22.69592  -16.49383 1.000 118.56433 ? 135 LYS F O   1 
ATOM   3957 C  CB  . LYS D 4 135 ? 49.54860 20.44166  -18.78447 1.000 124.54796 ? 135 LYS F CB  1 
ATOM   3958 C  CG  . LYS D 4 135 ? 48.63581 19.98003  -19.89626 1.000 125.77245 ? 135 LYS F CG  1 
ATOM   3959 C  CD  . LYS D 4 135 ? 49.39865 19.18589  -20.94431 1.000 128.92397 ? 135 LYS F CD  1 
ATOM   3960 C  CE  . LYS D 4 135 ? 50.39492 20.05940  -21.70693 1.000 131.42879 ? 135 LYS F CE  1 
ATOM   3961 N  NZ  . LYS D 4 135 ? 49.76248 21.21215  -22.41550 1.000 131.72774 ? 135 LYS F NZ  1 
ATOM   3962 N  N   . VAL D 4 136 ? 49.98312 20.61742  -15.74784 1.000 111.88436 ? 136 VAL F N   1 
ATOM   3963 C  CA  . VAL D 4 136 ? 50.77471 20.77469  -14.52775 1.000 106.66768 ? 136 VAL F CA  1 
ATOM   3964 C  C   . VAL D 4 136 ? 51.09824 19.42514  -13.88734 1.000 103.45132 ? 136 VAL F C   1 
ATOM   3965 O  O   . VAL D 4 136 ? 50.24802 18.52952  -13.84551 1.000 101.38951 ? 136 VAL F O   1 
ATOM   3966 C  CB  . VAL D 4 136 ? 50.04968 21.71252  -13.53673 1.000 103.35187 ? 136 VAL F CB  1 
ATOM   3967 C  CG1 . VAL D 4 136 ? 48.61588 21.25668  -13.28430 1.000 98.16800  ? 136 VAL F CG1 1 
ATOM   3968 C  CG2 . VAL D 4 136 ? 50.82917 21.82928  -12.23275 1.000 103.35856 ? 136 VAL F CG2 1 
ATOM   3969 N  N   . LEU D 4 137 ? 52.33179 19.26793  -13.39778 1.000 101.77988 ? 137 LEU F N   1 
ATOM   3970 C  CA  . LEU D 4 137 ? 52.68796 18.07863  -12.63287 1.000 101.46556 ? 137 LEU F CA  1 
ATOM   3971 C  C   . LEU D 4 137 ? 51.86623 18.02641  -11.35005 1.000 102.91887 ? 137 LEU F C   1 
ATOM   3972 O  O   . LEU D 4 137 ? 51.50777 19.05688  -10.77716 1.000 104.45844 ? 137 LEU F O   1 
ATOM   3973 C  CB  . LEU D 4 137 ? 54.18284 18.07116  -12.30293 1.000 100.12010 ? 137 LEU F CB  1 
ATOM   3974 C  CG  . LEU D 4 137 ? 55.15196 18.06161  -13.48554 1.000 99.83462  ? 137 LEU F CG  1 
ATOM   3975 C  CD1 . LEU D 4 137 ? 56.57885 17.78850  -13.01854 1.000 99.83749  ? 137 LEU F CD1 1 
ATOM   3976 C  CD2 . LEU D 4 137 ? 54.71277 17.04224  -14.52392 1.000 99.41818  ? 137 LEU F CD2 1 
ATOM   3977 N  N   . LEU D 4 138 ? 51.55287 16.80981  -10.90446 1.000 102.87589 ? 138 LEU F N   1 
ATOM   3978 C  CA  . LEU D 4 138 ? 50.55149 16.61093  -9.86566  1.000 103.14525 ? 138 LEU F CA  1 
ATOM   3979 C  C   . LEU D 4 138 ? 51.11165 16.19026  -8.51376  1.000 102.75779 ? 138 LEU F C   1 
ATOM   3980 O  O   . LEU D 4 138 ? 50.32143 15.85544  -7.62382  1.000 103.08041 ? 138 LEU F O   1 
ATOM   3981 C  CB  . LEU D 4 138 ? 49.53455 15.56753  -10.32712 1.000 104.58570 ? 138 LEU F CB  1 
ATOM   3982 C  CG  . LEU D 4 138 ? 48.57472 15.98272  -11.43433 1.000 105.42842 ? 138 LEU F CG  1 
ATOM   3983 C  CD1 . LEU D 4 138 ? 47.69822 14.82389  -11.83456 1.000 106.39955 ? 138 LEU F CD1 1 
ATOM   3984 C  CD2 . LEU D 4 138 ? 47.72519 17.10642  -10.92739 1.000 103.74458 ? 138 LEU F CD2 1 
ATOM   3985 N  N   . CYS D 4 139 ? 52.43144 16.21337  -8.31994  1.000 103.92043 ? 139 CYS F N   1 
ATOM   3986 C  CA  . CYS D 4 139 ? 52.99075 15.73508  -7.05986  1.000 102.43005 ? 139 CYS F CA  1 
ATOM   3987 C  C   . CYS D 4 139 ? 52.50172 14.32058  -6.77976  1.000 104.88758 ? 139 CYS F C   1 
ATOM   3988 O  O   . CYS D 4 139 ? 51.51697 14.12705  -6.06033  1.000 105.05771 ? 139 CYS F O   1 
ATOM   3989 C  CB  . CYS D 4 139 ? 52.62144 16.68269  -5.90831  1.000 98.73770  ? 139 CYS F CB  1 
ATOM   3990 S  SG  . CYS D 4 139 ? 52.95639 16.04578  -4.26187  1.000 92.13192  ? 139 CYS F SG  1 
ATOM   3991 N  N   . GLY D 4 140 ? 53.17774 13.32898  -7.35677  1.000 106.25145 ? 140 GLY F N   1 
ATOM   3992 C  CA  . GLY D 4 140 ? 52.82696 11.92521  -7.18055  1.000 106.59447 ? 140 GLY F CA  1 
ATOM   3993 C  C   . GLY D 4 140 ? 53.03320 11.38243  -5.78120  1.000 101.33536 ? 140 GLY F C   1 
ATOM   3994 O  O   . GLY D 4 140 ? 52.64788 10.23540  -5.52101  1.000 99.11002  ? 140 GLY F O   1 
ATOM   3995 N  N   . PHE D 4 141 ? 53.63267 12.16361  -4.88688  1.000 96.72012  ? 141 PHE F N   1 
ATOM   3996 C  CA  . PHE D 4 141 ? 53.99878 11.70122  -3.55421  1.000 92.28776  ? 141 PHE F CA  1 
ATOM   3997 C  C   . PHE D 4 141 ? 53.21131 12.48875  -2.50527  1.000 91.38718  ? 141 PHE F C   1 
ATOM   3998 O  O   . PHE D 4 141 ? 53.76579 13.31930  -1.77724  1.000 91.94212  ? 141 PHE F O   1 
ATOM   3999 C  CB  . PHE D 4 141 ? 55.52657 11.83083  -3.34696  1.000 88.60698  ? 141 PHE F CB  1 
ATOM   4000 C  CG  . PHE D 4 141 ? 56.02800 11.15465  -2.10456  1.000 85.30787  ? 141 PHE F CG  1 
ATOM   4001 C  CD1 . PHE D 4 141 ? 56.00762 9.77105   -2.00408  1.000 84.57286  ? 141 PHE F CD1 1 
ATOM   4002 C  CD2 . PHE D 4 141 ? 56.53307 11.88979  -1.04424  1.000 84.00163  ? 141 PHE F CD2 1 
ATOM   4003 C  CE1 . PHE D 4 141 ? 56.46462 9.13010   -0.86468  1.000 83.84723  ? 141 PHE F CE1 1 
ATOM   4004 C  CE2 . PHE D 4 141 ? 56.99793 11.25211  0.10004   1.000 84.92056  ? 141 PHE F CE2 1 
ATOM   4005 C  CZ  . PHE D 4 141 ? 56.96038 9.86550   0.18538   1.000 84.32913  ? 141 PHE F CZ  1 
ATOM   4006 N  N   . GLN D 4 142 ? 51.90865 12.19717  -2.41549  1.000 88.14732  ? 142 GLN F N   1 
ATOM   4007 C  CA  . GLN D 4 142 ? 51.06324 12.84106  -1.42206  1.000 85.08011  ? 142 GLN F CA  1 
ATOM   4008 C  C   . GLN D 4 142 ? 51.42678 12.41896  -0.00420  1.000 83.63910  ? 142 GLN F C   1 
ATOM   4009 O  O   . GLN D 4 142 ? 51.08374 13.12397  0.94797   1.000 81.01021  ? 142 GLN F O   1 
ATOM   4010 C  CB  . GLN D 4 142 ? 49.59230 12.52137  -1.70956  1.000 86.89163  ? 142 GLN F CB  1 
ATOM   4011 C  CG  . GLN D 4 142 ? 48.59046 13.45935  -1.06159  1.000 89.95138  ? 142 GLN F CG  1 
ATOM   4012 C  CD  . GLN D 4 142 ? 48.20069 13.01396  0.33213   1.000 91.90252  ? 142 GLN F CD  1 
ATOM   4013 O  OE1 . GLN D 4 142 ? 48.44415 11.86926  0.71919   1.000 93.82680  ? 142 GLN F OE1 1 
ATOM   4014 N  NE2 . GLN D 4 142 ? 47.59633 13.91789  1.09716   1.000 90.14277  ? 142 GLN F NE2 1 
ATOM   4015 N  N   . ARG D 4 143 ? 52.13492 11.30015  0.15454   1.000 88.83959  ? 143 ARG F N   1 
ATOM   4016 C  CA  . ARG D 4 143 ? 52.59163 10.87704  1.47526   1.000 90.19127  ? 143 ARG F CA  1 
ATOM   4017 C  C   . ARG D 4 143 ? 53.54467 11.88935  2.09393   1.000 90.65010  ? 143 ARG F C   1 
ATOM   4018 O  O   . ARG D 4 143 ? 53.70982 11.91001  3.31685   1.000 90.94677  ? 143 ARG F O   1 
ATOM   4019 C  CB  . ARG D 4 143 ? 53.27602 9.50516   1.39008   1.000 90.73040  ? 143 ARG F CB  1 
ATOM   4020 C  CG  . ARG D 4 143 ? 52.36067 8.31070   1.06231   1.000 90.17294  ? 143 ARG F CG  1 
ATOM   4021 C  CD  . ARG D 4 143 ? 52.00565 7.51708   2.31599   1.000 89.72885  ? 143 ARG F CD  1 
ATOM   4022 N  NE  . ARG D 4 143 ? 51.36612 6.23782   2.01581   1.000 89.17164  ? 143 ARG F NE  1 
ATOM   4023 C  CZ  . ARG D 4 143 ? 50.89444 5.40986   2.94618   1.000 89.34497  ? 143 ARG F CZ  1 
ATOM   4024 N  NH1 . ARG D 4 143 ? 50.99993 5.72773   4.23337   1.000 90.30089  ? 143 ARG F NH1 1 
ATOM   4025 N  NH2 . ARG D 4 143 ? 50.31975 4.26417   2.59757   1.000 88.22280  ? 143 ARG F NH2 1 
ATOM   4026 N  N   . GLY D 4 144 ? 54.19887 12.71130  1.27182   1.000 91.23491  ? 144 GLY F N   1 
ATOM   4027 C  CA  . GLY D 4 144 ? 55.16933 13.65430  1.79715   1.000 94.79577  ? 144 GLY F CA  1 
ATOM   4028 C  C   . GLY D 4 144 ? 54.56611 14.84208  2.52047   1.000 95.28638  ? 144 GLY F C   1 
ATOM   4029 O  O   . GLY D 4 144 ? 55.15935 15.35709  3.47011   1.000 100.04102 ? 144 GLY F O   1 
ATOM   4030 N  N   . HIS D 4 145 ? 53.39364 15.29857  2.09532   1.000 95.33787  ? 145 HIS F N   1 
ATOM   4031 C  CA  . HIS D 4 145 ? 52.80149 16.50423  2.67599   1.000 96.96506  ? 145 HIS F CA  1 
ATOM   4032 C  C   . HIS D 4 145 ? 51.90905 16.15732  3.86945   1.000 91.58340  ? 145 HIS F C   1 
ATOM   4033 O  O   . HIS D 4 145 ? 50.73511 16.52937  3.92589   1.000 90.10613  ? 145 HIS F O   1 
ATOM   4034 C  CB  . HIS D 4 145 ? 52.00143 17.25425  1.62109   1.000 105.97115 ? 145 HIS F CB  1 
ATOM   4035 C  CG  . HIS D 4 145 ? 52.71546 17.41195  0.32233   1.000 114.53326 ? 145 HIS F CG  1 
ATOM   4036 N  ND1 . HIS D 4 145 ? 53.62716 18.41633  0.08175   1.000 118.90679 ? 145 HIS F ND1 1 
ATOM   4037 C  CD2 . HIS D 4 145 ? 52.62533 16.69865  -0.82048  1.000 121.04224 ? 145 HIS F CD2 1 
ATOM   4038 C  CE1 . HIS D 4 145 ? 54.08153 18.30067  -1.15108  1.000 124.64694 ? 145 HIS F CE1 1 
ATOM   4039 N  NE2 . HIS D 4 145 ? 53.48473 17.26854  -1.71720  1.000 129.05548 ? 145 HIS F NE2 1 
ATOM   4040 N  N   . ARG D 4 146 ? 52.48149 15.46109  4.85221   1.000 89.17752  ? 146 ARG F N   1 
ATOM   4041 C  CA  . ARG D 4 146 ? 51.67437 14.90483  5.93422   1.000 85.91751  ? 146 ARG F CA  1 
ATOM   4042 C  C   . ARG D 4 146 ? 52.22045 15.10996  7.34192   1.000 83.69892  ? 146 ARG F C   1 
ATOM   4043 O  O   . ARG D 4 146 ? 51.51673 14.77779  8.30248   1.000 78.22082  ? 146 ARG F O   1 
ATOM   4044 C  CB  . ARG D 4 146 ? 51.46257 13.39882  5.70804   1.000 84.43443  ? 146 ARG F CB  1 
ATOM   4045 C  CG  . ARG D 4 146 ? 50.09761 12.89018  6.15546   1.000 83.96059  ? 146 ARG F CG  1 
ATOM   4046 C  CD  . ARG D 4 146 ? 49.79964 11.47495  5.63606   1.000 83.79976  ? 146 ARG F CD  1 
ATOM   4047 N  NE  . ARG D 4 146 ? 49.29333 11.44521  4.26056   1.000 84.02394  ? 146 ARG F NE  1 
ATOM   4048 C  CZ  . ARG D 4 146 ? 48.99348 10.32513  3.60192   1.000 83.42130  ? 146 ARG F CZ  1 
ATOM   4049 N  NH1 . ARG D 4 146 ? 49.16320 9.14072   4.18379   1.000 83.32361  ? 146 ARG F NH1 1 
ATOM   4050 N  NH2 . ARG D 4 146 ? 48.53682 10.37907  2.35732   1.000 82.24661  ? 146 ARG F NH2 1 
ATOM   4051 N  N   . ASP D 4 147 ? 53.43291 15.62883  7.50828   1.000 90.44791  ? 147 ASP F N   1 
ATOM   4052 C  CA  . ASP D 4 147 ? 53.89999 15.90785  8.86121   1.000 98.32559  ? 147 ASP F CA  1 
ATOM   4053 C  C   . ASP D 4 147 ? 53.35299 17.24050  9.35896   1.000 101.05662 ? 147 ASP F C   1 
ATOM   4054 O  O   . ASP D 4 147 ? 52.72837 17.30855  10.42380  1.000 101.81532 ? 147 ASP F O   1 
ATOM   4055 C  CB  . ASP D 4 147 ? 55.42603 15.89510  8.90670   1.000 105.06653 ? 147 ASP F CB  1 
ATOM   4056 C  CG  . ASP D 4 147 ? 55.96752 16.34287  10.24184  1.000 108.27744 ? 147 ASP F CG  1 
ATOM   4057 O  OD1 . ASP D 4 147 ? 55.31816 16.06171  11.27113  1.000 109.84765 ? 147 ASP F OD1 1 
ATOM   4058 O  OD2 . ASP D 4 147 ? 57.03986 16.97918  10.25896  1.000 108.93631 ? 147 ASP F OD2 1 
ATOM   4059 N  N   . GLN D 4 148 ? 53.58437 18.30593  8.60191   1.000 102.43696 ? 148 GLN F N   1 
ATOM   4060 C  CA  . GLN D 4 148 ? 53.10763 19.63567  8.93757   1.000 101.04723 ? 148 GLN F CA  1 
ATOM   4061 C  C   . GLN D 4 148 ? 51.80779 19.92226  8.20014   1.000 96.97526  ? 148 GLN F C   1 
ATOM   4062 O  O   . GLN D 4 148 ? 51.58728 19.44610  7.08345   1.000 95.01853  ? 148 GLN F O   1 
ATOM   4063 C  CB  . GLN D 4 148 ? 54.14833 20.69376  8.57948   1.000 106.20653 ? 148 GLN F CB  1 
ATOM   4064 C  CG  . GLN D 4 148 ? 55.44279 20.53050  9.32872   1.000 110.44220 ? 148 GLN F CG  1 
ATOM   4065 C  CD  . GLN D 4 148 ? 55.37479 21.13129  10.70909  1.000 114.67919 ? 148 GLN F CD  1 
ATOM   4066 O  OE1 . GLN D 4 148 ? 54.94362 22.27236  10.88023  1.000 115.46942 ? 148 GLN F OE1 1 
ATOM   4067 N  NE2 . GLN D 4 148 ? 55.78801 20.36147  11.70997  1.000 113.98026 ? 148 GLN F NE2 1 
ATOM   4068 N  N   . VAL D 4 149 ? 50.93994 20.69669  8.84629   1.000 95.25916  ? 149 VAL F N   1 
ATOM   4069 C  CA  . VAL D 4 149 ? 49.70096 21.13723  8.21638   1.000 91.46358  ? 149 VAL F CA  1 
ATOM   4070 C  C   . VAL D 4 149 ? 50.03539 22.09970  7.08079   1.000 90.82795  ? 149 VAL F C   1 
ATOM   4071 O  O   . VAL D 4 149 ? 50.73210 23.10330  7.27795   1.000 89.33393  ? 149 VAL F O   1 
ATOM   4072 C  CB  . VAL D 4 149 ? 48.76011 21.76571  9.25103   1.000 90.71703  ? 149 VAL F CB  1 
ATOM   4073 C  CG1 . VAL D 4 149 ? 49.52631 22.71692  10.14503  1.000 91.54611  ? 149 VAL F CG1 1 
ATOM   4074 C  CG2 . VAL D 4 149 ? 47.61254 22.48612  8.55297   1.000 91.50288  ? 149 VAL F CG2 1 
ATOM   4075 N  N   . GLY D 4 150 ? 49.57509 21.76708  5.87001   1.000 90.51306  ? 150 GLY F N   1 
ATOM   4076 C  CA  . GLY D 4 150 ? 49.99976 22.48916  4.69436   1.000 92.12407  ? 150 GLY F CA  1 
ATOM   4077 C  C   . GLY D 4 150 ? 49.27470 23.80719  4.49638   1.000 91.40231  ? 150 GLY F C   1 
ATOM   4078 O  O   . GLY D 4 150 ? 48.17316 24.03684  5.00046   1.000 89.12707  ? 150 GLY F O   1 
ATOM   4079 N  N   . THR D 4 151 ? 49.91038 24.67255  3.70959   1.000 92.16326  ? 151 THR F N   1 
ATOM   4080 C  CA  . THR D 4 151 ? 49.31351 25.94565  3.34411   1.000 90.14299  ? 151 THR F CA  1 
ATOM   4081 C  C   . THR D 4 151 ? 48.01621 25.72807  2.57225   1.000 86.82390  ? 151 THR F C   1 
ATOM   4082 O  O   . THR D 4 151 ? 47.82829 24.70834  1.90001   1.000 86.40579  ? 151 THR F O   1 
ATOM   4083 C  CB  . THR D 4 151 ? 50.29550 26.76998  2.51970   1.000 94.14536  ? 151 THR F CB  1 
ATOM   4084 O  OG1 . THR D 4 151 ? 49.69149 28.02865  2.17622   1.000 102.39730 ? 151 THR F OG1 1 
ATOM   4085 C  CG2 . THR D 4 151 ? 50.69487 26.02586  1.26591   1.000 90.68385  ? 151 THR F CG2 1 
ATOM   4086 N  N   . LEU D 4 152 ? 47.09000 26.68533  2.71313   1.000 83.91544  ? 152 LEU F N   1 
ATOM   4087 C  CA  . LEU D 4 152 ? 45.80378 26.57451  2.03002   1.000 79.38897  ? 152 LEU F CA  1 
ATOM   4088 C  C   . LEU D 4 152 ? 45.96272 26.54721  0.51422   1.000 81.98598  ? 152 LEU F C   1 
ATOM   4089 O  O   . LEU D 4 152 ? 45.10315 25.98931  -0.17370  1.000 81.01820  ? 152 LEU F O   1 
ATOM   4090 C  CB  . LEU D 4 152 ? 44.87638 27.71411  2.45427   1.000 73.42808  ? 152 LEU F CB  1 
ATOM   4091 C  CG  . LEU D 4 152 ? 43.47715 27.73839  1.82896   1.000 67.48627  ? 152 LEU F CG  1 
ATOM   4092 C  CD1 . LEU D 4 152 ? 42.72096 26.49051  2.17361   1.000 65.14170  ? 152 LEU F CD1 1 
ATOM   4093 C  CD2 . LEU D 4 152 ? 42.69196 28.93404  2.28906   1.000 65.01426  ? 152 LEU F CD2 1 
ATOM   4094 N  N   . GLN D 4 153 ? 47.05002 27.11562  -0.01840  1.000 86.63434  ? 153 GLN F N   1 
ATOM   4095 C  CA  . GLN D 4 153 ? 47.31711 27.00203  -1.44820  1.000 87.92665  ? 153 GLN F CA  1 
ATOM   4096 C  C   . GLN D 4 153 ? 47.57582 25.55263  -1.84245  1.000 89.38472  ? 153 GLN F C   1 
ATOM   4097 O  O   . GLN D 4 153 ? 47.18881 25.12485  -2.93502  1.000 93.63625  ? 153 GLN F O   1 
ATOM   4098 C  CB  . GLN D 4 153 ? 48.50696 27.87535  -1.84563  1.000 92.16571  ? 153 GLN F CB  1 
ATOM   4099 C  CG  . GLN D 4 153 ? 48.43182 29.31272  -1.36566  1.000 95.37172  ? 153 GLN F CG  1 
ATOM   4100 C  CD  . GLN D 4 153 ? 49.67978 30.11899  -1.70526  1.000 100.50522 ? 153 GLN F CD  1 
ATOM   4101 O  OE1 . GLN D 4 153 ? 50.28590 30.74676  -0.83531  1.000 102.93788 ? 153 GLN F OE1 1 
ATOM   4102 N  NE2 . GLN D 4 153 ? 50.06104 30.11300  -2.97508  1.000 102.64084 ? 153 GLN F NE2 1 
ATOM   4103 N  N   . TYR D 4 154 ? 48.26000 24.78335  -0.98789  1.000 87.61209  ? 154 TYR F N   1 
ATOM   4104 C  CA  . TYR D 4 154 ? 48.46848 23.37466  -1.31437  1.000 86.56924  ? 154 TYR F CA  1 
ATOM   4105 C  C   . TYR D 4 154 ? 47.17378 22.58489  -1.19138  1.000 83.14283  ? 154 TYR F C   1 
ATOM   4106 O  O   . TYR D 4 154 ? 46.79312 21.85511  -2.11421  1.000 83.67252  ? 154 TYR F O   1 
ATOM   4107 C  CB  . TYR D 4 154 ? 49.54202 22.74251  -0.42807  1.000 87.18759  ? 154 TYR F CB  1 
ATOM   4108 C  CG  . TYR D 4 154 ? 49.54350 21.22191  -0.54371  1.000 89.06947  ? 154 TYR F CG  1 
ATOM   4109 C  CD1 . TYR D 4 154 ? 50.06163 20.59018  -1.67239  1.000 90.54392  ? 154 TYR F CD1 1 
ATOM   4110 C  CD2 . TYR D 4 154 ? 49.01519 20.41885  0.46738   1.000 89.85833  ? 154 TYR F CD2 1 
ATOM   4111 C  CE1 . TYR D 4 154 ? 50.05666 19.21039  -1.79200  1.000 90.93005  ? 154 TYR F CE1 1 
ATOM   4112 C  CE2 . TYR D 4 154 ? 49.00805 19.03282  0.35244   1.000 90.52033  ? 154 TYR F CE2 1 
ATOM   4113 C  CZ  . TYR D 4 154 ? 49.53144 18.43608  -0.77948  1.000 91.30416  ? 154 TYR F CZ  1 
ATOM   4114 O  OH  . TYR D 4 154 ? 49.53340 17.06224  -0.90869  1.000 91.51830  ? 154 TYR F OH  1 
ATOM   4115 N  N   . LEU D 4 155 ? 46.47042 22.73423  -0.06269  1.000 80.15873  ? 155 LEU F N   1 
ATOM   4116 C  CA  . LEU D 4 155 ? 45.24515 21.96865  0.14279   1.000 75.13160  ? 155 LEU F CA  1 
ATOM   4117 C  C   . LEU D 4 155 ? 44.23741 22.23611  -0.96643  1.000 75.94100  ? 155 LEU F C   1 
ATOM   4118 O  O   . LEU D 4 155 ? 43.57848 21.30950  -1.44748  1.000 77.42037  ? 155 LEU F O   1 
ATOM   4119 C  CB  . LEU D 4 155 ? 44.64208 22.28709  1.51227   1.000 71.13409  ? 155 LEU F CB  1 
ATOM   4120 C  CG  . LEU D 4 155 ? 45.48795 21.91697  2.73854   1.000 71.73858  ? 155 LEU F CG  1 
ATOM   4121 C  CD1 . LEU D 4 155 ? 44.77521 22.22280  4.06691   1.000 69.34054  ? 155 LEU F CD1 1 
ATOM   4122 C  CD2 . LEU D 4 155 ? 45.93846 20.45404  2.68847   1.000 71.81334  ? 155 LEU F CD2 1 
ATOM   4123 N  N   . ALA D 4 156 ? 44.13944 23.48296  -1.42553  1.000 77.73109  ? 156 ALA F N   1 
ATOM   4124 C  CA  . ALA D 4 156 ? 43.17381 23.78694  -2.47204  1.000 79.45408  ? 156 ALA F CA  1 
ATOM   4125 C  C   . ALA D 4 156 ? 43.56458 23.12587  -3.78105  1.000 86.70888  ? 156 ALA F C   1 
ATOM   4126 O  O   . ALA D 4 156 ? 42.70412 22.59067  -4.48790  1.000 89.76176  ? 156 ALA F O   1 
ATOM   4127 C  CB  . ALA D 4 156 ? 43.03316 25.29355  -2.64966  1.000 79.18165  ? 156 ALA F CB  1 
ATOM   4128 N  N   . ILE D 4 157 ? 44.85052 23.18165  -4.13963  1.000 91.42937  ? 157 ILE F N   1 
ATOM   4129 C  CA  . ILE D 4 157 ? 45.27089 22.62427  -5.42154  1.000 91.92214  ? 157 ILE F CA  1 
ATOM   4130 C  C   . ILE D 4 157 ? 45.30640 21.09999  -5.36221  1.000 92.56148  ? 157 ILE F C   1 
ATOM   4131 O  O   . ILE D 4 157 ? 45.04011 20.43265  -6.36699  1.000 95.34837  ? 157 ILE F O   1 
ATOM   4132 C  CB  . ILE D 4 157 ? 46.62220 23.22709  -5.86599  1.000 91.81822  ? 157 ILE F CB  1 
ATOM   4133 C  CG1 . ILE D 4 157 ? 46.89288 22.88330  -7.33199  1.000 90.27117  ? 157 ILE F CG1 1 
ATOM   4134 C  CG2 . ILE D 4 157 ? 47.77792 22.74041  -4.98852  1.000 91.49495  ? 157 ILE F CG2 1 
ATOM   4135 C  CD1 . ILE D 4 157 ? 48.13476 23.52493  -7.89749  1.000 91.18916  ? 157 ILE F CD1 1 
ATOM   4136 N  N   . GLN D 4 158 ? 45.60573 20.51973  -4.19437  1.000 90.92654  ? 158 GLN F N   1 
ATOM   4137 C  CA  . GLN D 4 158 ? 45.58329 19.06338  -4.08361  1.000 91.02164  ? 158 GLN F CA  1 
ATOM   4138 C  C   . GLN D 4 158 ? 44.15418 18.52787  -4.13034  1.000 92.31400  ? 158 GLN F C   1 
ATOM   4139 O  O   . GLN D 4 158 ? 43.88333 17.54512  -4.83014  1.000 96.67281  ? 158 GLN F O   1 
ATOM   4140 C  CB  . GLN D 4 158 ? 46.30488 18.61730  -2.80776  1.000 91.52419  ? 158 GLN F CB  1 
ATOM   4141 C  CG  . GLN D 4 158 ? 46.18745 17.12961  -2.47291  1.000 92.18870  ? 158 GLN F CG  1 
ATOM   4142 C  CD  . GLN D 4 158 ? 46.59188 16.22148  -3.62152  1.000 95.98185  ? 158 GLN F CD  1 
ATOM   4143 O  OE1 . GLN D 4 158 ? 47.50572 16.53190  -4.38687  1.000 98.64423  ? 158 GLN F OE1 1 
ATOM   4144 N  NE2 . GLN D 4 158 ? 45.90231 15.09149  -3.75208  1.000 96.71436  ? 158 GLN F NE2 1 
ATOM   4145 N  N   . ALA D 4 159 ? 43.21917 19.17274  -3.42039  1.000 88.39082  ? 159 ALA F N   1 
ATOM   4146 C  CA  . ALA D 4 159 ? 41.80971 18.81189  -3.56244  1.000 87.39891  ? 159 ALA F CA  1 
ATOM   4147 C  C   . ALA D 4 159 ? 41.33251 18.99387  -4.99309  1.000 86.02218  ? 159 ALA F C   1 
ATOM   4148 O  O   . ALA D 4 159 ? 40.43030 18.28279  -5.44880  1.000 85.63149  ? 159 ALA F O   1 
ATOM   4149 C  CB  . ALA D 4 159 ? 40.93994 19.64995  -2.62975  1.000 88.20238  ? 159 ALA F CB  1 
ATOM   4150 N  N   . TRP D 4 160 ? 41.92851 19.93888  -5.71237  1.000 85.98891  ? 160 TRP F N   1 
ATOM   4151 C  CA  . TRP D 4 160 ? 41.59418 20.13566  -7.11198  1.000 85.08092  ? 160 TRP F CA  1 
ATOM   4152 C  C   . TRP D 4 160 ? 42.13741 19.01343  -7.98128  1.000 89.44895  ? 160 TRP F C   1 
ATOM   4153 O  O   . TRP D 4 160 ? 41.51775 18.65635  -8.98974  1.000 89.09738  ? 160 TRP F O   1 
ATOM   4154 C  CB  . TRP D 4 160 ? 42.13818 21.48610  -7.57175  1.000 83.75023  ? 160 TRP F CB  1 
ATOM   4155 C  CG  . TRP D 4 160 ? 42.07733 21.71168  -9.04295  1.000 84.10169  ? 160 TRP F CG  1 
ATOM   4156 C  CD1 . TRP D 4 160 ? 40.99187 22.09571  -9.77431  1.000 85.16576  ? 160 TRP F CD1 1 
ATOM   4157 C  CD2 . TRP D 4 160 ? 43.16156 21.58046  -9.96995  1.000 82.27286  ? 160 TRP F CD2 1 
ATOM   4158 N  NE1 . TRP D 4 160 ? 41.33325 22.20655  -11.10168 1.000 84.21234  ? 160 TRP F NE1 1 
ATOM   4159 C  CE2 . TRP D 4 160 ? 42.66006 21.89522  -11.24697 1.000 83.07610  ? 160 TRP F CE2 1 
ATOM   4160 C  CE3 . TRP D 4 160 ? 44.50775 21.22613  -9.84204  1.000 79.94848  ? 160 TRP F CE3 1 
ATOM   4161 C  CZ2 . TRP D 4 160 ? 43.45519 21.86657  -12.38598 1.000 81.35738  ? 160 TRP F CZ2 1 
ATOM   4162 C  CZ3 . TRP D 4 160 ? 45.29403 21.19934  -10.97165 1.000 79.99079  ? 160 TRP F CZ3 1 
ATOM   4163 C  CH2 . TRP D 4 160 ? 44.76609 21.51653  -12.22815 1.000 81.36370  ? 160 TRP F CH2 1 
ATOM   4164 N  N   . ALA D 4 161 ? 43.29257 18.45543  -7.62330  1.000 93.61455  ? 161 ALA F N   1 
ATOM   4165 C  CA  . ALA D 4 161 ? 43.84150 17.36373  -8.41581  1.000 95.65125  ? 161 ALA F CA  1 
ATOM   4166 C  C   . ALA D 4 161 ? 42.97456 16.10988  -8.30856  1.000 97.57254  ? 161 ALA F C   1 
ATOM   4167 O  O   . ALA D 4 161 ? 42.72678 15.44395  -9.31901  1.000 97.65870  ? 161 ALA F O   1 
ATOM   4168 C  CB  . ALA D 4 161 ? 45.28592 17.09449  -8.00048  1.000 96.35809  ? 161 ALA F CB  1 
ATOM   4169 N  N   . ARG D 4 162 ? 42.46260 15.80122  -7.10590  1.000 99.61670  ? 162 ARG F N   1 
ATOM   4170 C  CA  . ARG D 4 162 ? 41.61520 14.62085  -6.92759  1.000 107.36316 ? 162 ARG F CA  1 
ATOM   4171 C  C   . ARG D 4 162 ? 40.42765 14.60510  -7.88590  1.000 112.36868 ? 162 ARG F C   1 
ATOM   4172 O  O   . ARG D 4 162 ? 39.89522 13.53167  -8.18842  1.000 113.37052 ? 162 ARG F O   1 
ATOM   4173 C  CB  . ARG D 4 162 ? 41.10839 14.51823  -5.48497  1.000 112.19812 ? 162 ARG F CB  1 
ATOM   4174 C  CG  . ARG D 4 162 ? 42.15623 14.14046  -4.43908  1.000 117.21515 ? 162 ARG F CG  1 
ATOM   4175 C  CD  . ARG D 4 162 ? 41.49332 13.68655  -3.12766  1.000 120.92424 ? 162 ARG F CD  1 
ATOM   4176 N  NE  . ARG D 4 162 ? 40.61903 14.70836  -2.54650  1.000 123.57595 ? 162 ARG F NE  1 
ATOM   4177 C  CZ  . ARG D 4 162 ? 40.99838 15.60164  -1.63359  1.000 126.43309 ? 162 ARG F CZ  1 
ATOM   4178 N  NH1 . ARG D 4 162 ? 42.24561 15.60642  -1.18062  1.000 128.04460 ? 162 ARG F NH1 1 
ATOM   4179 N  NH2 . ARG D 4 162 ? 40.12620 16.49038  -1.16863  1.000 125.90498 ? 162 ARG F NH2 1 
ATOM   4180 N  N   . GLU D 4 163 ? 39.98573 15.77058  -8.36551  1.000 114.30253 ? 163 GLU F N   1 
ATOM   4181 C  CA  . GLU D 4 163 ? 38.88552 15.77999  -9.32117  1.000 116.88091 ? 163 GLU F CA  1 
ATOM   4182 C  C   . GLU D 4 163 ? 39.38114 15.55959  -10.73942 1.000 120.26690 ? 163 GLU F C   1 
ATOM   4183 O  O   . GLU D 4 163 ? 38.67145 14.95881  -11.55375 1.000 123.04418 ? 163 GLU F O   1 
ATOM   4184 C  CB  . GLU D 4 163 ? 38.10188 17.08644  -9.22708  1.000 116.84299 ? 163 GLU F CB  1 
ATOM   4185 C  CG  . GLU D 4 163 ? 37.36675 17.21798  -7.91961  1.000 119.62565 ? 163 GLU F CG  1 
ATOM   4186 C  CD  . GLU D 4 163 ? 36.51364 15.99425  -7.60454  1.000 122.97270 ? 163 GLU F CD  1 
ATOM   4187 O  OE1 . GLU D 4 163 ? 35.77887 15.52566  -8.50363  1.000 125.21281 ? 163 GLU F OE1 1 
ATOM   4188 O  OE2 . GLU D 4 163 ? 36.58020 15.49547  -6.45776  1.000 122.15696 ? 163 GLU F OE2 1 
ATOM   4189 N  N   . GLN D 4 164 ? 40.58592 16.02835  -11.05748 1.000 122.10119 ? 164 GLN F N   1 
ATOM   4190 C  CA  . GLN D 4 164 ? 41.09304 15.78951  -12.39747 1.000 124.71857 ? 164 GLN F CA  1 
ATOM   4191 C  C   . GLN D 4 164 ? 41.51677 14.33583  -12.56869 1.000 125.27464 ? 164 GLN F C   1 
ATOM   4192 O  O   . GLN D 4 164 ? 41.49802 13.81786  -13.68880 1.000 127.36081 ? 164 GLN F O   1 
ATOM   4193 C  CB  . GLN D 4 164 ? 42.24904 16.74255  -12.69619 1.000 128.26001 ? 164 GLN F CB  1 
ATOM   4194 C  CG  . GLN D 4 164 ? 41.84863 18.22464  -12.67719 1.000 127.89579 ? 164 GLN F CG  1 
ATOM   4195 C  CD  . GLN D 4 164 ? 40.95521 18.61861  -13.84338 1.000 127.46062 ? 164 GLN F CD  1 
ATOM   4196 O  OE1 . GLN D 4 164 ? 40.93922 17.95656  -14.88387 1.000 129.39078 ? 164 GLN F OE1 1 
ATOM   4197 N  NE2 . GLN D 4 164 ? 40.19821 19.69742  -13.66897 1.000 124.50198 ? 164 GLN F NE2 1 
ATOM   4198 N  N   . VAL D 4 165 ? 41.89616 13.65927  -11.48113 1.000 122.27461 ? 165 VAL F N   1 
ATOM   4199 C  CA  . VAL D 4 165 ? 42.17204 12.22501  -11.57943 1.000 120.47995 ? 165 VAL F CA  1 
ATOM   4200 C  C   . VAL D 4 165 ? 40.88501 11.40066  -11.50181 1.000 119.95140 ? 165 VAL F C   1 
ATOM   4201 O  O   . VAL D 4 165 ? 40.80075 10.32959  -12.10972 1.000 120.08628 ? 165 VAL F O   1 
ATOM   4202 C  CB  . VAL D 4 165 ? 43.19533 11.77199  -10.52318 1.000 118.05733 ? 165 VAL F CB  1 
ATOM   4203 C  CG1 . VAL D 4 165 ? 44.46852 12.59535  -10.64255 1.000 119.05546 ? 165 VAL F CG1 1 
ATOM   4204 C  CG2 . VAL D 4 165 ? 42.61614 11.84051  -9.11498  1.000 116.01051 ? 165 VAL F CG2 1 
ATOM   4205 N  N   . LYS D 4 166 ? 39.87276 11.88419  -10.77099 1.000 121.02214 ? 166 LYS F N   1 
ATOM   4206 C  CA  . LYS D 4 166 ? 38.60362 11.16629  -10.67986 1.000 121.08237 ? 166 LYS F CA  1 
ATOM   4207 C  C   . LYS D 4 166 ? 37.79871 11.22375  -11.96188 1.000 130.62000 ? 166 LYS F C   1 
ATOM   4208 O  O   . LYS D 4 166 ? 36.90302 10.39249  -12.15059 1.000 128.08875 ? 166 LYS F O   1 
ATOM   4209 C  CB  . LYS D 4 166 ? 37.71617 11.70950  -9.55630  1.000 116.36262 ? 166 LYS F CB  1 
ATOM   4210 C  CG  . LYS D 4 166 ? 37.90611 11.08486  -8.17677  1.000 112.29824 ? 166 LYS F CG  1 
ATOM   4211 C  CD  . LYS D 4 166 ? 36.81610 11.57784  -7.21899  1.000 108.99176 ? 166 LYS F CD  1 
ATOM   4212 C  CE  . LYS D 4 166 ? 36.80112 10.80366  -5.90217  1.000 105.31551 ? 166 LYS F CE  1 
ATOM   4213 N  NZ  . LYS D 4 166 ? 35.56794 11.09836  -5.10737  1.000 101.67404 ? 166 LYS F NZ  1 
ATOM   4214 N  N   . LYS D 4 167 ? 38.06304 12.18748  -12.83519 1.000 140.09958 ? 167 LYS F N   1 
ATOM   4215 C  CA  . LYS D 4 167 ? 37.18816 12.39588  -13.97810 1.000 155.77323 ? 167 LYS F CA  1 
ATOM   4216 C  C   . LYS D 4 167 ? 37.94829 12.31914  -15.29470 1.000 174.43774 ? 167 LYS F C   1 
ATOM   4217 O  O   . LYS D 4 167 ? 38.86445 13.10417  -15.55157 1.000 183.31872 ? 167 LYS F O   1 
ATOM   4218 C  CB  . LYS D 4 167 ? 36.41382 13.70867  -13.86294 1.000 143.08950 ? 167 LYS F CB  1 
ATOM   4219 C  CG  . LYS D 4 167 ? 35.28641 13.65780  -12.82036 1.000 135.46052 ? 167 LYS F CG  1 
ATOM   4220 C  CD  . LYS D 4 167 ? 34.49693 12.33164  -12.82883 1.000 130.69824 ? 167 LYS F CD  1 
ATOM   4221 C  CE  . LYS D 4 167 ? 33.57767 12.18577  -14.04004 1.000 128.51130 ? 167 LYS F CE  1 
ATOM   4222 N  NZ  . LYS D 4 167 ? 32.81895 10.90094  -14.01598 1.000 126.79589 ? 167 LYS F NZ  1 
ATOM   4223 N  N   . HIS D 4 168 ? 37.56109 11.34461  -16.10456 1.000 186.76162 ? 168 HIS F N   1 
ATOM   4224 C  CA  . HIS D 4 168 ? 37.82196 11.32045  -17.52768 1.000 190.72412 ? 168 HIS F CA  1 
ATOM   4225 C  C   . HIS D 4 168 ? 36.87657 12.29061  -18.23127 1.000 193.45830 ? 168 HIS F C   1 
ATOM   4226 O  O   . HIS D 4 168 ? 35.73112 12.47853  -17.79853 1.000 196.62381 ? 168 HIS F O   1 
ATOM   4227 C  CB  . HIS D 4 168 ? 37.56605 9.90208   -18.03087 1.000 191.60470 ? 168 HIS F CB  1 
ATOM   4228 C  CG  . HIS D 4 168 ? 36.21148 9.39087   -17.64148 1.000 191.17831 ? 168 HIS F CG  1 
ATOM   4229 N  ND1 . HIS D 4 168 ? 35.81120 9.27618   -16.32613 1.000 192.20410 ? 168 HIS F ND1 1 
ATOM   4230 C  CD2 . HIS D 4 168 ? 35.14723 9.02190   -18.38968 1.000 193.82418 ? 168 HIS F CD2 1 
ATOM   4231 C  CE1 . HIS D 4 168 ? 34.56775 8.83901   -16.28082 1.000 191.92175 ? 168 HIS F CE1 1 
ATOM   4232 N  NE2 . HIS D 4 168 ? 34.14287 8.67347   -17.51985 1.000 192.83715 ? 168 HIS F NE2 1 
ATOM   4233 N  N   . GLY D 4 169 ? 37.34822 12.89903  -19.31465 1.000 190.72238 ? 169 GLY F N   1 
ATOM   4234 C  CA  . GLY D 4 169 ? 36.50276 13.78149  -20.10105 1.000 185.98326 ? 169 GLY F CA  1 
ATOM   4235 C  C   . GLY D 4 169 ? 35.17941 13.15415  -20.50101 1.000 179.28938 ? 169 GLY F C   1 
ATOM   4236 O  O   . GLY D 4 169 ? 35.14350 12.01471  -20.98193 1.000 177.75912 ? 169 GLY F O   1 
ATOM   4237 N  N   . ARG D 4 170 ? 34.08478 13.88324  -20.28613 1.000 174.07631 ? 170 ARG F N   1 
ATOM   4238 C  CA  . ARG D 4 170 ? 32.74644 13.38582  -20.59836 1.000 170.03148 ? 170 ARG F CA  1 
ATOM   4239 C  C   . ARG D 4 170 ? 32.05068 14.23934  -21.65735 1.000 169.48535 ? 170 ARG F C   1 
ATOM   4240 O  O   . ARG D 4 170 ? 30.83583 14.44006  -21.60868 1.000 168.14781 ? 170 ARG F O   1 
ATOM   4241 C  CB  . ARG D 4 170 ? 31.88474 13.33104  -19.33520 1.000 166.36496 ? 170 ARG F CB  1 
ATOM   4242 C  CG  . ARG D 4 170 ? 32.26482 12.23791  -18.34173 1.000 164.48294 ? 170 ARG F CG  1 
ATOM   4243 C  CD  . ARG D 4 170 ? 31.09292 11.86961  -17.43089 1.000 163.43061 ? 170 ARG F CD  1 
ATOM   4244 N  NE  . ARG D 4 170 ? 30.13646 12.96582  -17.27165 1.000 163.95691 ? 170 ARG F NE  1 
ATOM   4245 C  CZ  . ARG D 4 170 ? 28.96497 13.03490  -17.90249 1.000 165.06104 ? 170 ARG F CZ  1 
ATOM   4246 N  NH1 . ARG D 4 170 ? 28.60756 12.06497  -18.73835 1.000 167.36584 ? 170 ARG F NH1 1 
ATOM   4247 N  NH2 . ARG D 4 170 ? 28.15548 14.07072  -17.70360 1.000 163.08798 ? 170 ARG F NH2 1 
ATOM   4248 N  N   . GLY D 4 198 ? 37.50779 16.70019  -21.49469 1.000 173.56761 ? 198 GLY F N   1 
ATOM   4249 C  CA  . GLY D 4 198 ? 38.32933 17.73415  -20.89528 1.000 173.04061 ? 198 GLY F CA  1 
ATOM   4250 C  C   . GLY D 4 198 ? 39.74571 17.25623  -20.64286 1.000 171.42118 ? 198 GLY F C   1 
ATOM   4251 O  O   . GLY D 4 198 ? 40.64349 17.51775  -21.44471 1.000 170.39164 ? 198 GLY F O   1 
ATOM   4252 N  N   . SER D 4 199 ? 39.93468 16.55715  -19.52220 1.000 171.64063 ? 199 SER F N   1 
ATOM   4253 C  CA  . SER D 4 199 ? 41.21673 15.95517  -19.15882 1.000 170.50069 ? 199 SER F CA  1 
ATOM   4254 C  C   . SER D 4 199 ? 42.37893 16.94828  -19.28766 1.000 169.38084 ? 199 SER F C   1 
ATOM   4255 O  O   . SER D 4 199 ? 43.15540 16.87290  -20.23421 1.000 171.18443 ? 199 SER F O   1 
ATOM   4256 C  CB  . SER D 4 199 ? 41.48933 14.72054  -20.03017 1.000 171.14715 ? 199 SER F CB  1 
ATOM   4257 O  OG  . SER D 4 199 ? 42.59676 13.97631  -19.54381 1.000 171.81316 ? 199 SER F OG  1 
ATOM   4258 N  N   . GLN D 4 200 ? 42.50157 17.86704  -18.31783 1.000 160.69988 ? 200 GLN F N   1 
ATOM   4259 C  CA  . GLN D 4 200 ? 43.52007 18.91459  -18.39805 1.000 152.58049 ? 200 GLN F CA  1 
ATOM   4260 C  C   . GLN D 4 200 ? 44.91817 18.43418  -18.02084 1.000 149.44128 ? 200 GLN F C   1 
ATOM   4261 O  O   . GLN D 4 200 ? 45.90122 18.82964  -18.65544 1.000 150.40132 ? 200 GLN F O   1 
ATOM   4262 C  CB  . GLN D 4 200 ? 43.12601 20.07066  -17.47087 1.000 144.46552 ? 200 GLN F CB  1 
ATOM   4263 C  CG  . GLN D 4 200 ? 44.23671 21.09558  -17.24225 1.000 139.64650 ? 200 GLN F CG  1 
ATOM   4264 C  CD  . GLN D 4 200 ? 43.76070 22.36886  -16.56114 1.000 133.62695 ? 200 GLN F CD  1 
ATOM   4265 O  OE1 . GLN D 4 200 ? 42.57626 22.54111  -16.27988 1.000 130.07892 ? 200 GLN F OE1 1 
ATOM   4266 N  NE2 . GLN D 4 200 ? 44.70329 23.23859  -16.23109 1.000 132.89275 ? 200 GLN F NE2 1 
ATOM   4267 N  N   . VAL D 4 201 ? 45.03062 17.57123  -17.01601 1.000 146.31785 ? 201 VAL F N   1 
ATOM   4268 C  CA  . VAL D 4 201 ? 46.33165 17.15325  -16.51012 1.000 142.78518 ? 201 VAL F CA  1 
ATOM   4269 C  C   . VAL D 4 201 ? 46.48560 15.64591  -16.66448 1.000 144.53431 ? 201 VAL F C   1 
ATOM   4270 O  O   . VAL D 4 201 ? 45.50375 14.89383  -16.66981 1.000 143.50423 ? 201 VAL F O   1 
ATOM   4271 C  CB  . VAL D 4 201 ? 46.51686 17.59715  -15.04398 1.000 137.79763 ? 201 VAL F CB  1 
ATOM   4272 C  CG1 . VAL D 4 201 ? 46.26244 19.09903  -14.93540 1.000 135.17411 ? 201 VAL F CG1 1 
ATOM   4273 C  CG2 . VAL D 4 201 ? 45.59738 16.81511  -14.12585 1.000 133.25640 ? 201 VAL F CG2 1 
ATOM   4274 N  N   . THR D 4 202 ? 47.73732 15.20980  -16.79775 1.000 147.01140 ? 202 THR F N   1 
ATOM   4275 C  CA  . THR D 4 202 ? 48.05993 13.80650  -17.01210 1.000 149.69894 ? 202 THR F CA  1 
ATOM   4276 C  C   . THR D 4 202 ? 48.15843 13.03813  -15.69633 1.000 153.46387 ? 202 THR F C   1 
ATOM   4277 O  O   . THR D 4 202 ? 48.59093 13.56145  -14.66470 1.000 153.41805 ? 202 THR F O   1 
ATOM   4278 C  CB  . THR D 4 202 ? 49.34541 13.66111  -17.83922 1.000 151.71471 ? 202 THR F CB  1 
ATOM   4279 O  OG1 . THR D 4 202 ? 50.43975 14.31627  -17.18568 1.000 153.64176 ? 202 THR F OG1 1 
ATOM   4280 C  CG2 . THR D 4 202 ? 49.15001 14.24409  -19.24306 1.000 152.07330 ? 202 THR F CG2 1 
ATOM   4281 N  N   . LEU D 4 203 ? 47.75705 11.76766  -15.76908 1.000 157.17241 ? 203 LEU F N   1 
ATOM   4282 C  CA  . LEU D 4 203 ? 47.52917 10.88850  -14.62750 1.000 159.66122 ? 203 LEU F CA  1 
ATOM   4283 C  C   . LEU D 4 203 ? 48.81870 10.44440  -13.93177 1.000 165.20751 ? 203 LEU F C   1 
ATOM   4284 O  O   . LEU D 4 203 ? 49.91772 10.56985  -14.48401 1.000 166.12190 ? 203 LEU F O   1 
ATOM   4285 C  CB  . LEU D 4 203 ? 46.76516 9.65061   -15.10427 1.000 157.82882 ? 203 LEU F CB  1 
ATOM   4286 C  CG  . LEU D 4 203 ? 45.25812 9.83098   -15.29945 1.000 155.62979 ? 203 LEU F CG  1 
ATOM   4287 C  CD1 . LEU D 4 203 ? 44.59425 8.53211   -15.76143 1.000 154.18502 ? 203 LEU F CD1 1 
ATOM   4288 C  CD2 . LEU D 4 203 ? 44.59155 10.38924  -14.04043 1.000 154.47072 ? 203 LEU F CD2 1 
ATOM   4289 N  N   . PRO D 4 204 ? 48.70289 9.93328   -12.70374 1.000 169.91285 ? 204 PRO F N   1 
ATOM   4290 C  CA  . PRO D 4 204 ? 49.87243 9.41949   -11.98290 1.000 166.53096 ? 204 PRO F CA  1 
ATOM   4291 C  C   . PRO D 4 204 ? 50.26086 8.03073   -12.47209 1.000 158.28942 ? 204 PRO F C   1 
ATOM   4292 O  O   . PRO D 4 204 ? 49.52036 7.35963   -13.19122 1.000 156.19371 ? 204 PRO F O   1 
ATOM   4293 C  CB  . PRO D 4 204 ? 49.40294 9.36720   -10.52402 1.000 169.83791 ? 204 PRO F CB  1 
ATOM   4294 C  CG  . PRO D 4 204 ? 47.93483 9.19892   -10.60665 1.000 170.82169 ? 204 PRO F CG  1 
ATOM   4295 C  CD  . PRO D 4 204 ? 47.47745 9.84921   -11.88580 1.000 170.93058 ? 204 PRO F CD  1 
ATOM   4296 N  N   . SER D 4 205 ? 51.45841 7.61600   -12.07003 1.000 153.06178 ? 205 SER F N   1 
ATOM   4297 C  CA  . SER D 4 205 ? 51.97262 6.30667   -12.44108 1.000 147.51635 ? 205 SER F CA  1 
ATOM   4298 C  C   . SER D 4 205 ? 51.43557 5.21858   -11.51534 1.000 139.73423 ? 205 SER F C   1 
ATOM   4299 O  O   . SER D 4 205 ? 51.17954 5.44647   -10.32786 1.000 138.09187 ? 205 SER F O   1 
ATOM   4300 C  CB  . SER D 4 205 ? 53.49950 6.30031   -12.39151 1.000 147.72998 ? 205 SER F CB  1 
ATOM   4301 O  OG  . SER D 4 205 ? 53.95754 6.62732   -11.09139 1.000 146.93333 ? 205 SER F OG  1 
ATOM   4302 N  N   . ARG D 4 206 ? 51.27564 4.01898   -12.07957 1.000 133.23257 ? 206 ARG F N   1 
ATOM   4303 C  CA  . ARG D 4 206 ? 50.74697 2.87352   -11.35154 1.000 127.01673 ? 206 ARG F CA  1 
ATOM   4304 C  C   . ARG D 4 206 ? 51.76226 2.23534   -10.41485 1.000 120.33170 ? 206 ARG F C   1 
ATOM   4305 O  O   . ARG D 4 206 ? 51.38413 1.34525   -9.64579  1.000 120.11237 ? 206 ARG F O   1 
ATOM   4306 C  CB  . ARG D 4 206 ? 50.24143 1.80950   -12.32969 1.000 128.66701 ? 206 ARG F CB  1 
ATOM   4307 C  CG  . ARG D 4 206 ? 48.75217 1.86190   -12.62832 1.000 131.11437 ? 206 ARG F CG  1 
ATOM   4308 C  CD  . ARG D 4 206 ? 48.49865 1.87579   -14.13091 1.000 134.02376 ? 206 ARG F CD  1 
ATOM   4309 N  NE  . ARG D 4 206 ? 48.97232 3.11254   -14.75120 1.000 136.82504 ? 206 ARG F NE  1 
ATOM   4310 C  CZ  . ARG D 4 206 ? 48.78505 3.43363   -16.02811 1.000 139.01730 ? 206 ARG F CZ  1 
ATOM   4311 N  NH1 . ARG D 4 206 ? 48.12986 2.60999   -16.83480 1.000 139.92645 ? 206 ARG F NH1 1 
ATOM   4312 N  NH2 . ARG D 4 206 ? 49.25219 4.58282   -16.49961 1.000 141.25875 ? 206 ARG F NH2 1 
ATOM   4313 N  N   . VAL D 4 207 ? 53.02833 2.64288   -10.47076 1.000 114.65845 ? 207 VAL F N   1 
ATOM   4314 C  CA  . VAL D 4 207 ? 54.06764 2.12966   -9.58208  1.000 107.10862 ? 207 VAL F CA  1 
ATOM   4315 C  C   . VAL D 4 207 ? 54.26669 3.14606   -8.46422  1.000 104.11363 ? 207 VAL F C   1 
ATOM   4316 O  O   . VAL D 4 207 ? 54.72636 4.26800   -8.70970  1.000 104.58248 ? 207 VAL F O   1 
ATOM   4317 C  CB  . VAL D 4 207 ? 55.38153 1.85813   -10.33005 1.000 105.64634 ? 207 VAL F CB  1 
ATOM   4318 C  CG1 . VAL D 4 207 ? 56.47303 1.41510   -9.35953  1.000 102.59210 ? 207 VAL F CG1 1 
ATOM   4319 C  CG2 . VAL D 4 207 ? 55.17491 0.80089   -11.41054 1.000 105.40284 ? 207 VAL F CG2 1 
ATOM   4320 N  N   . HIS D 4 208 ? 53.89672 2.75890   -7.24091  1.000 99.94136  ? 208 HIS F N   1 
ATOM   4321 C  CA  . HIS D 4 208 ? 53.99377 3.63340   -6.08014  1.000 97.17981  ? 208 HIS F CA  1 
ATOM   4322 C  C   . HIS D 4 208 ? 55.44198 4.06785   -5.83926  1.000 94.75195  ? 208 HIS F C   1 
ATOM   4323 O  O   . HIS D 4 208 ? 56.39759 3.51124   -6.38473  1.000 93.24850  ? 208 HIS F O   1 
ATOM   4324 C  CB  . HIS D 4 208 ? 53.46396 2.93305   -4.83059  1.000 98.37293  ? 208 HIS F CB  1 
ATOM   4325 C  CG  . HIS D 4 208 ? 51.98882 2.71212   -4.84201  1.000 100.67006 ? 208 HIS F CG  1 
ATOM   4326 N  ND1 . HIS D 4 208 ? 51.40631 1.56013   -4.35684  1.000 102.07347 ? 208 HIS F ND1 1 
ATOM   4327 C  CD2 . HIS D 4 208 ? 50.97380 3.49707   -5.27274  1.000 103.38604 ? 208 HIS F CD2 1 
ATOM   4328 C  CE1 . HIS D 4 208 ? 50.09470 1.64205   -4.49393  1.000 103.26730 ? 208 HIS F CE1 1 
ATOM   4329 N  NE2 . HIS D 4 208 ? 49.80613 2.80804   -5.04639  1.000 104.85559 ? 208 HIS F NE2 1 
ATOM   4330 N  N   . PHE D 4 209 ? 55.59098 5.04078   -5.00597  1.000 93.05891  ? 209 PHE F N   1 
ATOM   4331 C  CA  . PHE D 4 209 ? 56.89940 5.46066   -4.54304  1.000 92.55506  ? 209 PHE F CA  1 
ATOM   4332 C  C   . PHE D 4 209 ? 57.17883 4.87406   -3.15893  1.000 86.10193  ? 209 PHE F C   1 
ATOM   4333 O  O   . PHE D 4 209 ? 56.25118 4.55297   -2.41458  1.000 86.09628  ? 209 PHE F O   1 
ATOM   4334 C  CB  . PHE D 4 209 ? 56.96900 6.98992   -4.49287  1.000 97.20345  ? 209 PHE F CB  1 
ATOM   4335 C  CG  . PHE D 4 209 ? 56.90509 7.66589   -5.85530  1.000 103.52464 ? 209 PHE F CG  1 
ATOM   4336 C  CD1 . PHE D 4 209 ? 55.69198 7.82296   -6.52134  1.000 106.96488 ? 209 PHE F CD1 1 
ATOM   4337 C  CD2 . PHE D 4 209 ? 58.04744 8.18257   -6.45048  1.000 105.02885 ? 209 PHE F CD2 1 
ATOM   4338 C  CE1 . PHE D 4 209 ? 55.63341 8.46110   -7.76349  1.000 106.65193 ? 209 PHE F CE1 1 
ATOM   4339 C  CE2 . PHE D 4 209 ? 57.99017 8.82118   -7.68771  1.000 105.46899 ? 209 PHE F CE2 1 
ATOM   4340 C  CZ  . PHE D 4 209 ? 56.78496 8.95672   -8.34054  1.000 105.39503 ? 209 PHE F CZ  1 
ATOM   4341 N  N   . PRO D 4 210 ? 58.44374 4.70608   -2.77567  1.000 82.63234  ? 210 PRO F N   1 
ATOM   4342 C  CA  . PRO D 4 210 ? 58.76628 4.15055   -1.44625  1.000 79.41227  ? 210 PRO F CA  1 
ATOM   4343 C  C   . PRO D 4 210 ? 58.31030 5.06970   -0.32052  1.000 77.79447  ? 210 PRO F C   1 
ATOM   4344 O  O   . PRO D 4 210 ? 58.74854 6.21730   -0.23297  1.000 78.55360  ? 210 PRO F O   1 
ATOM   4345 C  CB  . PRO D 4 210 ? 60.29425 4.02937   -1.48141  1.000 80.71749  ? 210 PRO F CB  1 
ATOM   4346 C  CG  . PRO D 4 210 ? 60.73206 5.04304   -2.50480  1.000 82.52011  ? 210 PRO F CG  1 
ATOM   4347 C  CD  . PRO D 4 210 ? 59.65556 5.03630   -3.54750  1.000 83.41699  ? 210 PRO F CD  1 
ATOM   4348 N  N   . SER D 4 211 ? 57.45181 4.55501   0.56163   1.000 76.90815  ? 211 SER F N   1 
ATOM   4349 C  CA  . SER D 4 211 ? 56.94414 5.32022   1.69984   1.000 77.87460  ? 211 SER F CA  1 
ATOM   4350 C  C   . SER D 4 211 ? 57.33327 4.64157   3.00887   1.000 77.18637  ? 211 SER F C   1 
ATOM   4351 O  O   . SER D 4 211 ? 57.02650 3.46201   3.21895   1.000 75.56065  ? 211 SER F O   1 
ATOM   4352 C  CB  . SER D 4 211 ? 55.42278 5.48951   1.62269   1.000 76.91270  ? 211 SER F CB  1 
ATOM   4353 O  OG  . SER D 4 211 ? 54.91513 6.16685   2.76637   1.000 75.15099  ? 211 SER F OG  1 
ATOM   4354 N  N   . LEU D 4 212 ? 57.99748 5.39381   3.89311   1.000 78.06537  ? 212 LEU F N   1 
ATOM   4355 C  CA  . LEU D 4 212 ? 58.31722 4.86032   5.21381   1.000 77.45800  ? 212 LEU F CA  1 
ATOM   4356 C  C   . LEU D 4 212 ? 57.08116 4.76385   6.10412   1.000 78.13862  ? 212 LEU F C   1 
ATOM   4357 O  O   . LEU D 4 212 ? 56.96875 3.82235   6.89833   1.000 78.68957  ? 212 LEU F O   1 
ATOM   4358 C  CB  . LEU D 4 212 ? 59.40294 5.71068   5.87366   1.000 76.93786  ? 212 LEU F CB  1 
ATOM   4359 C  CG  . LEU D 4 212 ? 60.73256 5.67486   5.12385   1.000 76.89933  ? 212 LEU F CG  1 
ATOM   4360 C  CD1 . LEU D 4 212 ? 61.68480 6.68211   5.70603   1.000 77.55129  ? 212 LEU F CD1 1 
ATOM   4361 C  CD2 . LEU D 4 212 ? 61.33503 4.27495   5.19026   1.000 76.31961  ? 212 LEU F CD2 1 
ATOM   4362 N  N   . ALA D 4 213 ? 56.12229 5.68331   5.95556   1.000 77.72901  ? 213 ALA F N   1 
ATOM   4363 C  CA  . ALA D 4 213 ? 54.85513 5.54000   6.67140   1.000 80.13096  ? 213 ALA F CA  1 
ATOM   4364 C  C   . ALA D 4 213 ? 54.15315 4.23575   6.30152   1.000 83.00561  ? 213 ALA F C   1 
ATOM   4365 O  O   . ALA D 4 213 ? 53.48265 3.62342   7.14154   1.000 84.41752  ? 213 ALA F O   1 
ATOM   4366 C  CB  . ALA D 4 213 ? 53.93919 6.73060   6.38976   1.000 83.21470  ? 213 ALA F CB  1 
ATOM   4367 N  N   . TYR D 4 214 ? 54.25074 3.82035   5.03416   1.000 83.39765  ? 214 TYR F N   1 
ATOM   4368 C  CA  . TYR D 4 214 ? 53.70592 2.52476   4.64048   1.000 79.96243  ? 214 TYR F CA  1 
ATOM   4369 C  C   . TYR D 4 214 ? 54.52284 1.37888   5.22277   1.000 80.55868  ? 214 TYR F C   1 
ATOM   4370 O  O   . TYR D 4 214 ? 53.96133 0.35681   5.63742   1.000 81.19470  ? 214 TYR F O   1 
ATOM   4371 C  CB  . TYR D 4 214 ? 53.65066 2.41567   3.12104   1.000 79.10084  ? 214 TYR F CB  1 
ATOM   4372 C  CG  . TYR D 4 214 ? 53.13731 1.08048   2.62747   1.000 76.96951  ? 214 TYR F CG  1 
ATOM   4373 C  CD1 . TYR D 4 214 ? 51.77184 0.82807   2.55135   1.000 75.53640  ? 214 TYR F CD1 1 
ATOM   4374 C  CD2 . TYR D 4 214 ? 54.01329 0.07391   2.24195   1.000 75.64506  ? 214 TYR F CD2 1 
ATOM   4375 C  CE1 . TYR D 4 214 ? 51.29954 -0.38127  2.10055   1.000 75.26597  ? 214 TYR F CE1 1 
ATOM   4376 C  CE2 . TYR D 4 214 ? 53.54477 -1.14207  1.79336   1.000 73.98409  ? 214 TYR F CE2 1 
ATOM   4377 C  CZ  . TYR D 4 214 ? 52.19068 -1.36412  1.72387   1.000 74.35208  ? 214 TYR F CZ  1 
ATOM   4378 O  OH  . TYR D 4 214 ? 51.72880 -2.57957  1.27500   1.000 75.47978  ? 214 TYR F OH  1 
ATOM   4379 N  N   . LEU D 4 215 ? 55.85058 1.52892   5.24582   1.000 80.73067  ? 215 LEU F N   1 
ATOM   4380 C  CA  . LEU D 4 215 ? 56.73423 0.45738   5.70039   1.000 80.15224  ? 215 LEU F CA  1 
ATOM   4381 C  C   . LEU D 4 215 ? 56.57231 0.18156   7.18616   1.000 81.16917  ? 215 LEU F C   1 
ATOM   4382 O  O   . LEU D 4 215 ? 56.67760 -0.97179  7.61994   1.000 77.67995  ? 215 LEU F O   1 
ATOM   4383 C  CB  . LEU D 4 215 ? 58.18656 0.82184   5.40024   1.000 78.50433  ? 215 LEU F CB  1 
ATOM   4384 C  CG  . LEU D 4 215 ? 59.23708 -0.04228  6.08295   1.000 77.97097  ? 215 LEU F CG  1 
ATOM   4385 C  CD1 . LEU D 4 215 ? 59.05445 -1.46112  5.61453   1.000 80.04715  ? 215 LEU F CD1 1 
ATOM   4386 C  CD2 . LEU D 4 215 ? 60.62853 0.43633   5.74187   1.000 77.78091  ? 215 LEU F CD2 1 
ATOM   4387 N  N   . CYS D 4 216 ? 56.35713 1.23099   7.98410   1.000 86.25341  ? 216 CYS F N   1 
ATOM   4388 C  CA  . CYS D 4 216 ? 56.28354 1.11569   9.43511   1.000 89.60965  ? 216 CYS F CA  1 
ATOM   4389 C  C   . CYS D 4 216 ? 54.86766 1.15271   9.96604   1.000 97.97072  ? 216 CYS F C   1 
ATOM   4390 O  O   . CYS D 4 216 ? 54.68072 1.08822   11.18488  1.000 102.32003 ? 216 CYS F O   1 
ATOM   4391 C  CB  . CYS D 4 216 ? 57.06751 2.24401   10.11223  1.000 84.35404  ? 216 CYS F CB  1 
ATOM   4392 S  SG  . CYS D 4 216 ? 58.76544 2.49167   9.59142   1.000 81.45965  ? 216 CYS F SG  1 
ATOM   4393 N  N   . GLY D 4 217 ? 53.86851 1.24317   9.09346   1.000 103.06787 ? 217 GLY F N   1 
ATOM   4394 C  CA  . GLY D 4 217 ? 52.50078 1.43157   9.51075   1.000 112.82163 ? 217 GLY F CA  1 
ATOM   4395 C  C   . GLY D 4 217 ? 51.68005 0.16461   9.40568   1.000 122.24480 ? 217 GLY F C   1 
ATOM   4396 O  O   . GLY D 4 217 ? 51.55772 -0.41421  8.32660   1.000 123.98832 ? 217 GLY F O   1 
ATOM   4397 N  N   . THR D 4 218 ? 51.12561 -0.27375  10.53778  1.000 129.86963 ? 218 THR F N   1 
ATOM   4398 C  CA  . THR D 4 218 ? 50.07700 -1.29349  10.50554  1.000 139.60350 ? 218 THR F CA  1 
ATOM   4399 C  C   . THR D 4 218 ? 48.76936 -0.63238  10.06872  1.000 149.22007 ? 218 THR F C   1 
ATOM   4400 O  O   . THR D 4 218 ? 47.76628 -0.63383  10.78074  1.000 156.19192 ? 218 THR F O   1 
ATOM   4401 C  CB  . THR D 4 218 ? 49.91078 -1.98839  11.85390  1.000 130.97608 ? 218 THR F CB  1 
ATOM   4402 O  OG1 . THR D 4 218 ? 49.66919 -1.01165  12.87928  1.000 130.28545 ? 218 THR F OG1 1 
ATOM   4403 C  CG2 . THR D 4 218 ? 51.13997 -2.84380  12.20310  1.000 128.41933 ? 218 THR F CG2 1 
ATOM   4404 N  N   . LEU D 4 219 ? 48.81822 -0.03619  8.87361   1.000 153.40293 ? 219 LEU F N   1 
ATOM   4405 C  CA  . LEU D 4 219 ? 47.69197 0.73151   8.35464   1.000 159.74889 ? 219 LEU F CA  1 
ATOM   4406 C  C   . LEU D 4 219 ? 46.41851 -0.10849  8.35954   1.000 160.56586 ? 219 LEU F C   1 
ATOM   4407 O  O   . LEU D 4 219 ? 45.40973 0.26507   8.97000   1.000 161.63876 ? 219 LEU F O   1 
ATOM   4408 C  CB  . LEU D 4 219 ? 48.01966 1.24234   6.94464   1.000 159.94932 ? 219 LEU F CB  1 
ATOM   4409 C  CG  . LEU D 4 219 ? 49.30819 2.06551   6.77388   1.000 160.74957 ? 219 LEU F CG  1 
ATOM   4410 C  CD1 . LEU D 4 219 ? 49.60247 2.34207   5.29877   1.000 160.61618 ? 219 LEU F CD1 1 
ATOM   4411 C  CD2 . LEU D 4 219 ? 49.25829 3.37485   7.56886   1.000 163.06207 ? 219 LEU F CD2 1 
ATOM   4412 N  N   . ALA D 4 220 ? 46.46769 -1.26737  7.70760   1.000 158.45663 ? 220 ALA F N   1 
ATOM   4413 C  CA  . ALA D 4 220 ? 45.38917 -2.25122  7.74651   1.000 154.35186 ? 220 ALA F CA  1 
ATOM   4414 C  C   . ALA D 4 220 ? 45.86473 -3.55669  7.11290   1.000 150.70625 ? 220 ALA F C   1 
ATOM   4415 O  O   . ALA D 4 220 ? 46.96794 -3.62404  6.56198   1.000 148.60521 ? 220 ALA F O   1 
ATOM   4416 C  CB  . ALA D 4 220 ? 44.14354 -1.72955  7.03352   1.000 153.58927 ? 220 ALA F CB  1 
ATOM   4417 N  N   . VAL E 1 5   ? 71.84722 25.05681  -42.30347 1.000 150.69658 ? 5   VAL A N   1 
ATOM   4418 C  CA  . VAL E 1 5   ? 71.65214 24.11885  -41.19787 1.000 156.32273 ? 5   VAL A CA  1 
ATOM   4419 C  C   . VAL E 1 5   ? 70.33715 24.35980  -40.42714 1.000 168.41218 ? 5   VAL A C   1 
ATOM   4420 O  O   . VAL E 1 5   ? 69.60502 23.40122  -40.17559 1.000 174.35810 ? 5   VAL A O   1 
ATOM   4421 C  CB  . VAL E 1 5   ? 72.86818 24.13342  -40.22863 1.000 143.27472 ? 5   VAL A CB  1 
ATOM   4422 C  CG1 . VAL E 1 5   ? 72.64762 23.16830  -39.06281 1.000 140.10587 ? 5   VAL A CG1 1 
ATOM   4423 C  CG2 . VAL E 1 5   ? 74.15678 23.81212  -40.97716 1.000 140.13295 ? 5   VAL A CG2 1 
ATOM   4424 N  N   . PRO E 1 6   ? 70.02464 25.60762  -40.04241 1.000 178.02763 ? 6   PRO A N   1 
ATOM   4425 C  CA  . PRO E 1 6   ? 68.72461 25.85520  -39.39153 1.000 178.01425 ? 6   PRO A CA  1 
ATOM   4426 C  C   . PRO E 1 6   ? 67.52493 25.58133  -40.28755 1.000 171.28081 ? 6   PRO A C   1 
ATOM   4427 O  O   . PRO E 1 6   ? 66.40067 25.52026  -39.77260 1.000 173.09868 ? 6   PRO A O   1 
ATOM   4428 C  CB  . PRO E 1 6   ? 68.79198 27.34143  -39.00538 1.000 180.64091 ? 6   PRO A CB  1 
ATOM   4429 C  CG  . PRO E 1 6   ? 70.23154 27.65228  -38.92323 1.000 182.52494 ? 6   PRO A CG  1 
ATOM   4430 C  CD  . PRO E 1 6   ? 70.86876 26.82037  -40.00163 1.000 183.55983 ? 6   PRO A CD  1 
ATOM   4431 N  N   . ASP E 1 7   ? 67.71604 25.42566  -41.60188 1.000 158.34956 ? 7   ASP A N   1 
ATOM   4432 C  CA  . ASP E 1 7   ? 66.60095 25.06262  -42.46615 1.000 142.22670 ? 7   ASP A CA  1 
ATOM   4433 C  C   . ASP E 1 7   ? 66.29437 23.57196  -42.44253 1.000 126.47992 ? 7   ASP A C   1 
ATOM   4434 O  O   . ASP E 1 7   ? 65.25117 23.16891  -42.96754 1.000 124.22072 ? 7   ASP A O   1 
ATOM   4435 C  CB  . ASP E 1 7   ? 66.87929 25.49758  -43.90739 1.000 133.44865 ? 7   ASP A CB  1 
ATOM   4436 C  CG  . ASP E 1 7   ? 67.08406 26.99312  -44.03675 1.000 128.17047 ? 7   ASP A CG  1 
ATOM   4437 O  OD1 . ASP E 1 7   ? 68.21737 27.45772  -43.78678 1.000 125.80694 ? 7   ASP A OD1 1 
ATOM   4438 O  OD2 . ASP E 1 7   ? 66.11664 27.70110  -44.39344 1.000 124.85511 ? 7   ASP A OD2 1 
ATOM   4439 N  N   . GLN E 1 8   ? 67.17053 22.74377  -41.86453 1.000 117.66739 ? 8   GLN A N   1 
ATOM   4440 C  CA  . GLN E 1 8   ? 66.82278 21.33972  -41.68553 1.000 107.30587 ? 8   GLN A CA  1 
ATOM   4441 C  C   . GLN E 1 8   ? 65.89116 21.13930  -40.49886 1.000 106.75240 ? 8   GLN A C   1 
ATOM   4442 O  O   . GLN E 1 8   ? 65.03340 20.24860  -40.53119 1.000 105.34030 ? 8   GLN A O   1 
ATOM   4443 C  CB  . GLN E 1 8   ? 68.07500 20.47745  -41.51462 1.000 102.09686 ? 8   GLN A CB  1 
ATOM   4444 C  CG  . GLN E 1 8   ? 69.15785 20.73865  -42.54047 1.000 98.91499  ? 8   GLN A CG  1 
ATOM   4445 C  CD  . GLN E 1 8   ? 70.38763 19.87228  -42.33530 1.000 97.34801  ? 8   GLN A CD  1 
ATOM   4446 O  OE1 . GLN E 1 8   ? 70.28643 18.71136  -41.93276 1.000 95.15718  ? 8   GLN A OE1 1 
ATOM   4447 N  NE2 . GLN E 1 8   ? 71.55676 20.42608  -42.63595 1.000 98.33870  ? 8   GLN A NE2 1 
ATOM   4448 N  N   . ARG E 1 9   ? 66.05516 21.94349  -39.44453 1.000 108.25639 ? 9   ARG A N   1 
ATOM   4449 C  CA  . ARG E 1 9   ? 65.19822 21.80985  -38.27133 1.000 111.59137 ? 9   ARG A CA  1 
ATOM   4450 C  C   . ARG E 1 9   ? 63.75960 22.19549  -38.58752 1.000 113.45227 ? 9   ARG A C   1 
ATOM   4451 O  O   . ARG E 1 9   ? 62.81840 21.57948  -38.07410 1.000 114.93754 ? 9   ARG A O   1 
ATOM   4452 C  CB  . ARG E 1 9   ? 65.73884 22.65893  -37.11743 1.000 115.94015 ? 9   ARG A CB  1 
ATOM   4453 C  CG  . ARG E 1 9   ? 64.97362 22.47865  -35.80460 1.000 119.25416 ? 9   ARG A CG  1 
ATOM   4454 C  CD  . ARG E 1 9   ? 65.60835 23.24987  -34.65250 1.000 122.95142 ? 9   ARG A CD  1 
ATOM   4455 N  NE  . ARG E 1 9   ? 66.96977 22.79949  -34.37480 1.000 123.90222 ? 9   ARG A NE  1 
ATOM   4456 C  CZ  . ARG E 1 9   ? 68.06421 23.50838  -34.64291 1.000 125.18770 ? 9   ARG A CZ  1 
ATOM   4457 N  NH1 . ARG E 1 9   ? 69.26216 23.01067  -34.35930 1.000 124.36888 ? 9   ARG A NH1 1 
ATOM   4458 N  NH2 . ARG E 1 9   ? 67.96408 24.71869  -35.18614 1.000 126.46603 ? 9   ARG A NH2 1 
ATOM   4459 N  N   . SER E 1 10  ? 63.56553 23.21242  -39.42778 1.000 113.79185 ? 10  SER A N   1 
ATOM   4460 C  CA  . SER E 1 10  ? 62.20843 23.59027  -39.80172 1.000 118.19840 ? 10  SER A CA  1 
ATOM   4461 C  C   . SER E 1 10  ? 61.56459 22.51197  -40.65970 1.000 115.76495 ? 10  SER A C   1 
ATOM   4462 O  O   . SER E 1 10  ? 60.38244 22.18882  -40.48313 1.000 118.38993 ? 10  SER A O   1 
ATOM   4463 C  CB  . SER E 1 10  ? 62.22193 24.93310  -40.53137 1.000 122.34120 ? 10  SER A CB  1 
ATOM   4464 O  OG  . SER E 1 10  ? 62.88280 25.92401  -39.75887 1.000 128.38895 ? 10  SER A OG  1 
ATOM   4465 N  N   . LYS E 1 11  ? 62.33734 21.93777  -41.58466 1.000 112.39544 ? 11  LYS A N   1 
ATOM   4466 C  CA  . LYS E 1 11  ? 61.89386 20.84459  -42.44042 1.000 107.09863 ? 11  LYS A CA  1 
ATOM   4467 C  C   . LYS E 1 11  ? 61.69064 19.55122  -41.66786 1.000 107.00660 ? 11  LYS A C   1 
ATOM   4468 O  O   . LYS E 1 11  ? 61.03975 18.63613  -42.18051 1.000 105.89663 ? 11  LYS A O   1 
ATOM   4469 C  CB  . LYS E 1 11  ? 62.92824 20.64507  -43.55087 1.000 102.29590 ? 11  LYS A CB  1 
ATOM   4470 C  CG  . LYS E 1 11  ? 62.38576 20.15458  -44.86258 1.000 97.61468  ? 11  LYS A CG  1 
ATOM   4471 C  CD  . LYS E 1 11  ? 63.53486 19.85584  -45.79728 1.000 93.22251  ? 11  LYS A CD  1 
ATOM   4472 C  CE  . LYS E 1 11  ? 63.06626 19.02124  -46.97091 1.000 91.67816  ? 11  LYS A CE  1 
ATOM   4473 N  NZ  . LYS E 1 11  ? 64.19878 18.38826  -47.69884 1.000 89.75438  ? 11  LYS A NZ  1 
ATOM   4474 N  N   . PHE E 1 12  ? 62.19668 19.48066  -40.43415 1.000 109.82684 ? 12  PHE A N   1 
ATOM   4475 C  CA  . PHE E 1 12  ? 62.00509 18.31352  -39.58495 1.000 111.01699 ? 12  PHE A CA  1 
ATOM   4476 C  C   . PHE E 1 12  ? 60.61181 18.30042  -38.96589 1.000 119.17263 ? 12  PHE A C   1 
ATOM   4477 O  O   . PHE E 1 12  ? 60.04205 17.22252  -38.76732 1.000 120.82613 ? 12  PHE A O   1 
ATOM   4478 C  CB  . PHE E 1 12  ? 63.09098 18.30148  -38.50354 1.000 107.21189 ? 12  PHE A CB  1 
ATOM   4479 C  CG  . PHE E 1 12  ? 63.10135 17.06825  -37.63783 1.000 104.70070 ? 12  PHE A CG  1 
ATOM   4480 C  CD1 . PHE E 1 12  ? 62.18032 16.89748  -36.61422 1.000 104.54803 ? 12  PHE A CD1 1 
ATOM   4481 C  CD2 . PHE E 1 12  ? 64.06717 16.09387  -37.82746 1.000 103.49785 ? 12  PHE A CD2 1 
ATOM   4482 C  CE1 . PHE E 1 12  ? 62.20238 15.77004  -35.82306 1.000 104.77801 ? 12  PHE A CE1 1 
ATOM   4483 C  CE2 . PHE E 1 12  ? 64.09905 14.96475  -37.03474 1.000 103.18208 ? 12  PHE A CE2 1 
ATOM   4484 C  CZ  . PHE E 1 12  ? 63.16683 14.80152  -36.03247 1.000 104.28526 ? 12  PHE A CZ  1 
ATOM   4485 N  N   . GLU E 1 13  ? 60.04309 19.47368  -38.66518 1.000 126.24849 ? 13  GLU A N   1 
ATOM   4486 C  CA  . GLU E 1 13  ? 58.70476 19.51117  -38.08228 1.000 133.32214 ? 13  GLU A CA  1 
ATOM   4487 C  C   . GLU E 1 13  ? 57.66228 18.95659  -39.04105 1.000 137.14213 ? 13  GLU A C   1 
ATOM   4488 O  O   . GLU E 1 13  ? 56.66243 18.37833  -38.59955 1.000 137.90580 ? 13  GLU A O   1 
ATOM   4489 C  CB  . GLU E 1 13  ? 58.31426 20.92938  -37.66470 1.000 140.27205 ? 13  GLU A CB  1 
ATOM   4490 C  CG  . GLU E 1 13  ? 59.04935 21.47318  -36.44927 1.000 146.14034 ? 13  GLU A CG  1 
ATOM   4491 C  CD  . GLU E 1 13  ? 58.52808 22.83721  -36.02013 1.000 152.86796 ? 13  GLU A CD  1 
ATOM   4492 O  OE1 . GLU E 1 13  ? 57.59198 23.35437  -36.66918 1.000 156.56254 ? 13  GLU A OE1 1 
ATOM   4493 O  OE2 . GLU E 1 13  ? 59.03253 23.37622  -35.01269 1.000 156.03209 ? 13  GLU A OE2 1 
ATOM   4494 N  N   . ASN E 1 14  ? 57.85957 19.14796  -40.34565 1.000 139.20052 ? 14  ASN A N   1 
ATOM   4495 C  CA  . ASN E 1 14  ? 56.89898 18.66134  -41.32737 1.000 143.20272 ? 14  ASN A CA  1 
ATOM   4496 C  C   . ASN E 1 14  ? 56.79853 17.14035  -41.27388 1.000 148.98221 ? 14  ASN A C   1 
ATOM   4497 O  O   . ASN E 1 14  ? 57.75858 16.44193  -40.93808 1.000 150.92067 ? 14  ASN A O   1 
ATOM   4498 C  CB  . ASN E 1 14  ? 57.28690 19.12381  -42.73575 1.000 137.36328 ? 14  ASN A CB  1 
ATOM   4499 C  CG  . ASN E 1 14  ? 56.70500 20.49023  -43.08482 1.000 135.26642 ? 14  ASN A CG  1 
ATOM   4500 O  OD1 . ASN E 1 14  ? 56.29049 21.24688  -42.20144 1.000 135.72600 ? 14  ASN A OD1 1 
ATOM   4501 N  ND2 . ASN E 1 14  ? 56.67202 20.80981  -44.37625 1.000 131.79808 ? 14  ASN A ND2 1 
ATOM   4502 N  N   . GLU E 1 15  ? 55.60717 16.63850  -41.61824 1.000 154.28507 ? 15  GLU A N   1 
ATOM   4503 C  CA  . GLU E 1 15  ? 55.24462 15.25360  -41.32515 1.000 157.35993 ? 15  GLU A CA  1 
ATOM   4504 C  C   . GLU E 1 15  ? 56.24457 14.26710  -41.90732 1.000 149.66914 ? 15  GLU A C   1 
ATOM   4505 O  O   . GLU E 1 15  ? 56.65041 13.31033  -41.23347 1.000 150.77145 ? 15  GLU A O   1 
ATOM   4506 C  CB  . GLU E 1 15  ? 53.84351 14.95234  -41.86333 1.000 164.65725 ? 15  GLU A CB  1 
ATOM   4507 C  CG  . GLU E 1 15  ? 52.69717 15.30871  -40.92136 1.000 171.53607 ? 15  GLU A CG  1 
ATOM   4508 C  CD  . GLU E 1 15  ? 51.34636 14.83561  -41.44007 1.000 173.90607 ? 15  GLU A CD  1 
ATOM   4509 O  OE1 . GLU E 1 15  ? 51.07859 14.99446  -42.65182 1.000 174.76084 ? 15  GLU A OE1 1 
ATOM   4510 O  OE2 . GLU E 1 15  ? 50.55589 14.29647  -40.63621 1.000 174.52675 ? 15  GLU A OE2 1 
ATOM   4511 N  N   . GLU E 1 16  ? 56.65868 14.48135  -43.15534 1.000 137.60583 ? 16  GLU A N   1 
ATOM   4512 C  CA  . GLU E 1 16  ? 57.37267 13.43812  -43.87459 1.000 127.12383 ? 16  GLU A CA  1 
ATOM   4513 C  C   . GLU E 1 16  ? 58.36576 14.07601  -44.84026 1.000 116.15942 ? 16  GLU A C   1 
ATOM   4514 O  O   . GLU E 1 16  ? 58.18470 14.03939  -46.05203 1.000 115.78350 ? 16  GLU A O   1 
ATOM   4515 C  CB  . GLU E 1 16  ? 56.42015 12.50203  -44.61915 1.000 125.52759 ? 16  GLU A CB  1 
ATOM   4516 C  CG  . GLU E 1 16  ? 55.93564 11.35648  -43.77577 1.000 126.65456 ? 16  GLU A CG  1 
ATOM   4517 C  CD  . GLU E 1 16  ? 55.01919 10.42808  -44.53302 1.000 127.76556 ? 16  GLU A CD  1 
ATOM   4518 O  OE1 . GLU E 1 16  ? 54.31802 9.64072   -43.86553 1.000 130.79589 ? 16  GLU A OE1 1 
ATOM   4519 O  OE2 . GLU E 1 16  ? 54.99988 10.48031  -45.78510 1.000 125.61345 ? 16  GLU A OE2 1 
ATOM   4520 N  N   . PHE E 1 17  ? 59.42600 14.65661  -44.27835 1.000 107.79225 ? 17  PHE A N   1 
ATOM   4521 C  CA  . PHE E 1 17  ? 60.50275 15.18476  -45.10662 1.000 94.54532  ? 17  PHE A CA  1 
ATOM   4522 C  C   . PHE E 1 17  ? 61.13571 14.08154  -45.94717 1.000 89.40119  ? 17  PHE A C   1 
ATOM   4523 O  O   . PHE E 1 17  ? 61.66307 14.35198  -47.03118 1.000 87.52497  ? 17  PHE A O   1 
ATOM   4524 C  CB  . PHE E 1 17  ? 61.54081 15.86617  -44.21354 1.000 88.78318  ? 17  PHE A CB  1 
ATOM   4525 C  CG  . PHE E 1 17  ? 62.14380 14.95105  -43.17666 1.000 81.19475  ? 17  PHE A CG  1 
ATOM   4526 C  CD1 . PHE E 1 17  ? 61.47873 14.70009  -41.98503 1.000 79.61591  ? 17  PHE A CD1 1 
ATOM   4527 C  CD2 . PHE E 1 17  ? 63.36789 14.34532  -43.39130 1.000 76.67917  ? 17  PHE A CD2 1 
ATOM   4528 C  CE1 . PHE E 1 17  ? 62.02372 13.86807  -41.03475 1.000 77.78932  ? 17  PHE A CE1 1 
ATOM   4529 C  CE2 . PHE E 1 17  ? 63.92149 13.50820  -42.44167 1.000 73.61774  ? 17  PHE A CE2 1 
ATOM   4530 C  CZ  . PHE E 1 17  ? 63.24967 13.27086  -41.26251 1.000 75.16597  ? 17  PHE A CZ  1 
ATOM   4531 N  N   . PHE E 1 18  ? 61.12257 12.84833  -45.44708 1.000 82.04027  ? 18  PHE A N   1 
ATOM   4532 C  CA  . PHE E 1 18  ? 61.44999 11.64644  -46.20683 1.000 71.55772  ? 18  PHE A CA  1 
ATOM   4533 C  C   . PHE E 1 18  ? 60.17353 10.83021  -46.37678 1.000 70.82788  ? 18  PHE A C   1 
ATOM   4534 O  O   . PHE E 1 18  ? 59.52695 10.48141  -45.38489 1.000 69.13873  ? 18  PHE A O   1 
ATOM   4535 C  CB  . PHE E 1 18  ? 62.52205 10.82907  -45.49322 1.000 66.53110  ? 18  PHE A CB  1 
ATOM   4536 C  CG  . PHE E 1 18  ? 62.98814 9.62213   -46.25459 1.000 61.95347  ? 18  PHE A CG  1 
ATOM   4537 C  CD1 . PHE E 1 18  ? 62.33935 8.40473   -46.12388 1.000 59.25930  ? 18  PHE A CD1 1 
ATOM   4538 C  CD2 . PHE E 1 18  ? 64.10056 9.69706   -47.08142 1.000 61.08945  ? 18  PHE A CD2 1 
ATOM   4539 C  CE1 . PHE E 1 18  ? 62.78227 7.29078   -46.81686 1.000 58.41593  ? 18  PHE A CE1 1 
ATOM   4540 C  CE2 . PHE E 1 18  ? 64.54614 8.58677   -47.77455 1.000 59.03174  ? 18  PHE A CE2 1 
ATOM   4541 C  CZ  . PHE E 1 18  ? 63.88407 7.38401   -47.63931 1.000 58.56052  ? 18  PHE A CZ  1 
ATOM   4542 N  N   . ARG E 1 19  ? 59.80750 10.52678  -47.62184 1.000 70.62718  ? 19  ARG A N   1 
ATOM   4543 C  CA  . ARG E 1 19  ? 58.49100 9.95100   -47.87639 1.000 70.24962  ? 19  ARG A CA  1 
ATOM   4544 C  C   . ARG E 1 19  ? 58.35858 8.57615   -47.23756 1.000 75.18156  ? 19  ARG A C   1 
ATOM   4545 O  O   . ARG E 1 19  ? 59.32886 7.82703   -47.11190 1.000 76.80349  ? 19  ARG A O   1 
ATOM   4546 C  CB  . ARG E 1 19  ? 58.21840 9.85078   -49.36563 1.000 64.36789  ? 19  ARG A CB  1 
ATOM   4547 C  CG  . ARG E 1 19  ? 58.12865 11.21103  -49.97143 1.000 65.81932  ? 19  ARG A CG  1 
ATOM   4548 C  CD  . ARG E 1 19  ? 58.13670 11.20223  -51.47520 1.000 67.97998  ? 19  ARG A CD  1 
ATOM   4549 N  NE  . ARG E 1 19  ? 58.36838 12.56021  -51.96355 1.000 70.06780  ? 19  ARG A NE  1 
ATOM   4550 C  CZ  . ARG E 1 19  ? 57.42609 13.48241  -52.08497 1.000 69.80505  ? 19  ARG A CZ  1 
ATOM   4551 N  NH1 . ARG E 1 19  ? 56.17137 13.18692  -51.76054 1.000 72.65209  ? 19  ARG A NH1 1 
ATOM   4552 N  NH2 . ARG E 1 19  ? 57.72931 14.69609  -52.53304 1.000 65.45507  ? 19  ARG A NH2 1 
ATOM   4553 N  N   . LYS E 1 20  ? 57.12920 8.26072   -46.82696 1.000 79.44077  ? 20  LYS A N   1 
ATOM   4554 C  CA  . LYS E 1 20  ? 56.76729 6.96960   -46.25082 1.000 79.58101  ? 20  LYS A CA  1 
ATOM   4555 C  C   . LYS E 1 20  ? 57.34198 6.71671   -44.86194 1.000 83.57005  ? 20  LYS A C   1 
ATOM   4556 O  O   . LYS E 1 20  ? 57.03506 5.67615   -44.27863 1.000 85.65197  ? 20  LYS A O   1 
ATOM   4557 C  CB  . LYS E 1 20  ? 57.18156 5.82347   -47.17730 1.000 75.25999  ? 20  LYS A CB  1 
ATOM   4558 C  CG  . LYS E 1 20  ? 56.44820 5.78643   -48.50968 1.000 71.57653  ? 20  LYS A CG  1 
ATOM   4559 C  CD  . LYS E 1 20  ? 54.95260 5.63821   -48.30637 1.000 70.36720  ? 20  LYS A CD  1 
ATOM   4560 C  CE  . LYS E 1 20  ? 54.19694 5.73789   -49.62165 1.000 70.32069  ? 20  LYS A CE  1 
ATOM   4561 N  NZ  . LYS E 1 20  ? 52.72942 5.53862   -49.42218 1.000 72.54355  ? 20  LYS A NZ  1 
ATOM   4562 N  N   . LEU E 1 21  ? 58.18067 7.60842   -44.32460 1.000 86.40880  ? 21  LEU A N   1 
ATOM   4563 C  CA  . LEU E 1 21  ? 58.70959 7.44285   -42.97160 1.000 89.38485  ? 21  LEU A CA  1 
ATOM   4564 C  C   . LEU E 1 21  ? 58.33885 8.66053   -42.15219 1.000 96.36234  ? 21  LEU A C   1 
ATOM   4565 O  O   . LEU E 1 21  ? 58.83872 9.75457   -42.41813 1.000 97.85421  ? 21  LEU A O   1 
ATOM   4566 C  CB  . LEU E 1 21  ? 60.22480 7.29663   -42.95195 1.000 85.90260  ? 21  LEU A CB  1 
ATOM   4567 C  CG  . LEU E 1 21  ? 60.80258 7.14018   -41.54772 1.000 84.17963  ? 21  LEU A CG  1 
ATOM   4568 C  CD1 . LEU E 1 21  ? 60.12326 5.95622   -40.88611 1.000 84.75798  ? 21  LEU A CD1 1 
ATOM   4569 C  CD2 . LEU E 1 21  ? 62.28707 6.90282   -41.61894 1.000 81.40855  ? 21  LEU A CD2 1 
ATOM   4570 N  N   . SER E 1 22  ? 57.49971 8.47236   -41.14388 1.000 103.58768 ? 22  SER A N   1 
ATOM   4571 C  CA  . SER E 1 22  ? 57.01414 9.58524   -40.34488 1.000 112.78823 ? 22  SER A CA  1 
ATOM   4572 C  C   . SER E 1 22  ? 57.26202 9.35360   -38.86566 1.000 116.20197 ? 22  SER A C   1 
ATOM   4573 O  O   . SER E 1 22  ? 56.75537 8.37645   -38.31051 1.000 122.98994 ? 22  SER A O   1 
ATOM   4574 C  CB  . SER E 1 22  ? 55.51789 9.82040   -40.61552 1.000 118.53163 ? 22  SER A CB  1 
ATOM   4575 O  OG  . SER E 1 22  ? 54.74406 8.70403   -40.21529 1.000 116.64392 ? 22  SER A OG  1 
ATOM   4576 N  N   . ARG E 1 23  ? 58.01325 10.26156  -38.22760 1.000 114.17509 ? 23  ARG A N   1 
ATOM   4577 C  CA  . ARG E 1 23  ? 57.95666 10.45261  -36.75437 1.000 113.79119 ? 23  ARG A CA  1 
ATOM   4578 C  C   . ARG E 1 23  ? 58.09970 9.09349   -36.06118 1.000 110.01343 ? 23  ARG A C   1 
ATOM   4579 O  O   . ARG E 1 23  ? 58.96864 8.29552   -36.45037 1.000 110.63554 ? 23  ARG A O   1 
ATOM   4580 C  CB  . ARG E 1 23  ? 56.66798 11.19272  -36.42598 1.000 116.79187 ? 23  ARG A CB  1 
ATOM   4581 C  CG  . ARG E 1 23  ? 56.61776 12.69692  -36.57567 1.000 118.74776 ? 23  ARG A CG  1 
ATOM   4582 C  CD  . ARG E 1 23  ? 55.17096 13.18415  -36.39046 1.000 120.47237 ? 23  ARG A CD  1 
ATOM   4583 N  NE  . ARG E 1 23  ? 54.59467 12.73833  -35.11855 1.000 123.05090 ? 23  ARG A NE  1 
ATOM   4584 C  CZ  . ARG E 1 23  ? 53.45204 13.20624  -34.62541 1.000 127.13381 ? 23  ARG A CZ  1 
ATOM   4585 N  NH1 . ARG E 1 23  ? 52.79006 14.12079  -35.30940 1.000 129.00299 ? 23  ARG A NH1 1 
ATOM   4586 N  NH2 . ARG E 1 23  ? 52.96954 12.78478  -33.45934 1.000 129.92511 ? 23  ARG A NH2 1 
ATOM   4587 N  N   . GLU E 1 24  ? 57.24437 8.77589   -35.08135 1.000 107.24221 ? 24  GLU A N   1 
ATOM   4588 C  CA  . GLU E 1 24  ? 57.06130 7.40597   -34.61552 1.000 103.23543 ? 24  GLU A CA  1 
ATOM   4589 C  C   . GLU E 1 24  ? 56.49129 6.52457   -35.71807 1.000 98.17877  ? 24  GLU A C   1 
ATOM   4590 O  O   . GLU E 1 24  ? 55.67770 6.95785   -36.52940 1.000 97.78983  ? 24  GLU A O   1 
ATOM   4591 C  CB  . GLU E 1 24  ? 56.08865 7.32192   -33.44358 1.000 106.91583 ? 24  GLU A CB  1 
ATOM   4592 C  CG  . GLU E 1 24  ? 56.33602 8.22460   -32.27026 1.000 108.35657 ? 24  GLU A CG  1 
ATOM   4593 C  CD  . GLU E 1 24  ? 55.25290 8.11193   -31.22545 1.000 112.69249 ? 24  GLU A CD  1 
ATOM   4594 O  OE1 . GLU E 1 24  ? 54.15178 7.65359   -31.58289 1.000 115.86953 ? 24  GLU A OE1 1 
ATOM   4595 O  OE2 . GLU E 1 24  ? 55.51114 8.46615   -30.05328 1.000 115.46364 ? 24  GLU A OE2 1 
ATOM   4596 N  N   . CYS E 1 25  ? 56.86777 5.25241   -35.70353 1.000 93.58339  ? 25  CYS A N   1 
ATOM   4597 C  CA  . CYS E 1 25  ? 56.33142 4.31660   -36.67970 1.000 91.03740  ? 25  CYS A CA  1 
ATOM   4598 C  C   . CYS E 1 25  ? 56.43121 2.96456   -36.01916 1.000 85.91347  ? 25  CYS A C   1 
ATOM   4599 O  O   . CYS E 1 25  ? 57.31781 2.74748   -35.19776 1.000 85.19210  ? 25  CYS A O   1 
ATOM   4600 C  CB  . CYS E 1 25  ? 57.11390 4.35328   -37.98585 1.000 92.33622  ? 25  CYS A CB  1 
ATOM   4601 S  SG  . CYS E 1 25  ? 58.86361 4.08430   -37.70349 1.000 94.44436  ? 25  CYS A SG  1 
ATOM   4602 N  N   . GLU E 1 26  ? 55.52991 2.06267   -36.36476 1.000 85.56004  ? 26  GLU A N   1 
ATOM   4603 C  CA  . GLU E 1 26  ? 55.55839 0.72955   -35.78284 1.000 84.92095  ? 26  GLU A CA  1 
ATOM   4604 C  C   . GLU E 1 26  ? 56.38856 -0.15759  -36.69064 1.000 81.37868  ? 26  GLU A C   1 
ATOM   4605 O  O   . GLU E 1 26  ? 56.18614 -0.16086  -37.90731 1.000 81.46103  ? 26  GLU A O   1 
ATOM   4606 C  CB  . GLU E 1 26  ? 54.14189 0.16944   -35.61705 1.000 89.75007  ? 26  GLU A CB  1 
ATOM   4607 C  CG  . GLU E 1 26  ? 54.08791 -1.30997  -35.26577 1.000 95.26277  ? 26  GLU A CG  1 
ATOM   4608 C  CD  . GLU E 1 26  ? 52.67005 -1.83616  -35.13050 1.000 100.92702 ? 26  GLU A CD  1 
ATOM   4609 O  OE1 . GLU E 1 26  ? 52.44525 -3.01965  -35.46804 1.000 102.38699 ? 26  GLU A OE1 1 
ATOM   4610 O  OE2 . GLU E 1 26  ? 51.78235 -1.06450  -34.70298 1.000 105.10840 ? 26  GLU A OE2 1 
ATOM   4611 N  N   . ILE E 1 27  ? 57.33618 -0.88045  -36.10995 1.000 76.35156  ? 27  ILE A N   1 
ATOM   4612 C  CA  . ILE E 1 27  ? 58.23891 -1.70487  -36.89508 1.000 73.32935  ? 27  ILE A CA  1 
ATOM   4613 C  C   . ILE E 1 27  ? 58.05464 -3.16522  -36.50426 1.000 74.22777  ? 27  ILE A C   1 
ATOM   4614 O  O   . ILE E 1 27  ? 57.72338 -3.49469  -35.36093 1.000 75.92448  ? 27  ILE A O   1 
ATOM   4615 C  CB  . ILE E 1 27  ? 59.70240 -1.24278  -36.72946 1.000 70.66850  ? 27  ILE A CB  1 
ATOM   4616 C  CG1 . ILE E 1 27  ? 60.11118 -1.28184  -35.25902 1.000 71.82635  ? 27  ILE A CG1 1 
ATOM   4617 C  CG2 . ILE E 1 27  ? 59.88395 0.14328   -37.30735 1.000 67.57789  ? 27  ILE A CG2 1 
ATOM   4618 C  CD1 . ILE E 1 27  ? 61.52293 -0.80821  -34.99656 1.000 70.80132  ? 27  ILE A CD1 1 
ATOM   4619 N  N   . LYS E 1 28  ? 58.27079 -4.04242  -37.48135 1.000 74.59417  ? 28  LYS A N   1 
ATOM   4620 C  CA  . LYS E 1 28  ? 58.15674 -5.48206  -37.31769 1.000 76.12150  ? 28  LYS A CA  1 
ATOM   4621 C  C   . LYS E 1 28  ? 59.42234 -6.13803  -37.83468 1.000 79.81010  ? 28  LYS A C   1 
ATOM   4622 O  O   . LYS E 1 28  ? 60.20762 -5.53283  -38.56097 1.000 78.46193  ? 28  LYS A O   1 
ATOM   4623 C  CB  . LYS E 1 28  ? 56.97074 -6.04846  -38.10695 1.000 77.63148  ? 28  LYS A CB  1 
ATOM   4624 C  CG  . LYS E 1 28  ? 55.59838 -5.95264  -37.45442 1.000 81.95108  ? 28  LYS A CG  1 
ATOM   4625 C  CD  . LYS E 1 28  ? 54.59923 -6.73072  -38.30643 1.000 85.26571  ? 28  LYS A CD  1 
ATOM   4626 C  CE  . LYS E 1 28  ? 53.20101 -6.75205  -37.71919 1.000 89.79075  ? 28  LYS A CE  1 
ATOM   4627 N  NZ  . LYS E 1 28  ? 52.33082 -7.67060  -38.51940 1.000 92.46556  ? 28  LYS A NZ  1 
ATOM   4628 N  N   . TYR E 1 29  ? 59.61236 -7.38918  -37.46016 1.000 88.10431  ? 29  TYR A N   1 
ATOM   4629 C  CA  . TYR E 1 29  ? 60.64302 -8.22430  -38.06110 1.000 98.28076  ? 29  TYR A CA  1 
ATOM   4630 C  C   . TYR E 1 29  ? 59.93207 -9.14774  -39.04171 1.000 108.90785 ? 29  TYR A C   1 
ATOM   4631 O  O   . TYR E 1 29  ? 59.39573 -10.18735 -38.65603 1.000 116.59034 ? 29  TYR A O   1 
ATOM   4632 C  CB  . TYR E 1 29  ? 61.42094 -8.99873  -37.00630 1.000 93.01655  ? 29  TYR A CB  1 
ATOM   4633 C  CG  . TYR E 1 29  ? 62.29324 -10.08509 -37.59706 1.000 90.09238  ? 29  TYR A CG  1 
ATOM   4634 C  CD1 . TYR E 1 29  ? 63.51126 -9.78228  -38.19281 1.000 85.82403  ? 29  TYR A CD1 1 
ATOM   4635 C  CD2 . TYR E 1 29  ? 61.90081 -11.41748 -37.54970 1.000 87.93889  ? 29  TYR A CD2 1 
ATOM   4636 C  CE1 . TYR E 1 29  ? 64.30091 -10.77727 -38.73342 1.000 85.32275  ? 29  TYR A CE1 1 
ATOM   4637 C  CE2 . TYR E 1 29  ? 62.67845 -12.40672 -38.08567 1.000 85.61896  ? 29  TYR A CE2 1 
ATOM   4638 C  CZ  . TYR E 1 29  ? 63.87154 -12.09128 -38.67163 1.000 84.59560  ? 29  TYR A CZ  1 
ATOM   4639 O  OH  . TYR E 1 29  ? 64.62489 -13.11459 -39.19242 1.000 85.39827  ? 29  TYR A OH  1 
ATOM   4640 N  N   . THR E 1 30  ? 59.88977 -8.75191  -40.30751 1.000 114.77135 ? 30  THR A N   1 
ATOM   4641 C  CA  . THR E 1 30  ? 59.34050 -9.63559  -41.32290 1.000 116.07543 ? 30  THR A CA  1 
ATOM   4642 C  C   . THR E 1 30  ? 60.39742 -10.63811 -41.73253 1.000 120.01334 ? 30  THR A C   1 
ATOM   4643 O  O   . THR E 1 30  ? 61.59745 -10.35088 -41.72225 1.000 129.38460 ? 30  THR A O   1 
ATOM   4644 C  CB  . THR E 1 30  ? 58.85755 -8.86065  -42.55113 1.000 115.43354 ? 30  THR A CB  1 
ATOM   4645 O  OG1 . THR E 1 30  ? 59.93244 -8.07474  -43.09156 1.000 110.90740 ? 30  THR A OG1 1 
ATOM   4646 C  CG2 . THR E 1 30  ? 57.67878 -7.97721  -42.19807 1.000 113.44972 ? 30  THR A CG2 1 
ATOM   4647 N  N   . GLY E 1 31  ? 59.94481 -11.82480 -42.08137 1.000 115.13535 ? 31  GLY A N   1 
ATOM   4648 C  CA  . GLY E 1 31  ? 60.88937 -12.86851 -42.38211 1.000 110.19574 ? 31  GLY A CA  1 
ATOM   4649 C  C   . GLY E 1 31  ? 60.43929 -14.14241 -41.72129 1.000 104.58081 ? 31  GLY A C   1 
ATOM   4650 O  O   . GLY E 1 31  ? 60.14497 -14.15331 -40.51837 1.000 105.08756 ? 31  GLY A O   1 
ATOM   4651 N  N   . PHE E 1 32  ? 60.38435 -15.21383 -42.49820 1.000 99.85157  ? 32  PHE A N   1 
ATOM   4652 C  CA  . PHE E 1 32  ? 59.83235 -16.46793 -42.02529 1.000 96.79980  ? 32  PHE A CA  1 
ATOM   4653 C  C   . PHE E 1 32  ? 58.40000 -16.25917 -41.53735 1.000 102.42813 ? 32  PHE A C   1 
ATOM   4654 O  O   . PHE E 1 32  ? 58.00356 -16.77310 -40.49106 1.000 106.39101 ? 32  PHE A O   1 
ATOM   4655 C  CB  . PHE E 1 32  ? 60.69347 -17.05734 -40.90639 1.000 92.02284  ? 32  PHE A CB  1 
ATOM   4656 C  CG  . PHE E 1 32  ? 62.17454 -17.01320 -41.17685 1.000 85.38242  ? 32  PHE A CG  1 
ATOM   4657 C  CD1 . PHE E 1 32  ? 62.76567 -17.89170 -42.07366 1.000 83.94981  ? 32  PHE A CD1 1 
ATOM   4658 C  CD2 . PHE E 1 32  ? 62.98298 -16.10566 -40.50294 1.000 80.83758  ? 32  PHE A CD2 1 
ATOM   4659 C  CE1 . PHE E 1 32  ? 64.13163 -17.85403 -42.30466 1.000 81.51785  ? 32  PHE A CE1 1 
ATOM   4660 C  CE2 . PHE E 1 32  ? 64.34675 -16.06404 -40.72707 1.000 78.59985  ? 32  PHE A CE2 1 
ATOM   4661 C  CZ  . PHE E 1 32  ? 64.92351 -16.93956 -41.62826 1.000 79.19263  ? 32  PHE A CZ  1 
ATOM   4662 N  N   . ARG E 1 33  ? 57.61615 -15.47351 -42.28011 1.000 102.82277 ? 33  ARG A N   1 
ATOM   4663 C  CA  . ARG E 1 33  ? 56.25455 -15.20519 -41.82909 1.000 107.43643 ? 33  ARG A CA  1 
ATOM   4664 C  C   . ARG E 1 33  ? 55.39074 -16.45980 -41.84049 1.000 113.36159 ? 33  ARG A C   1 
ATOM   4665 O  O   . ARG E 1 33  ? 54.46230 -16.57343 -41.03211 1.000 115.40815 ? 33  ARG A O   1 
ATOM   4666 C  CB  . ARG E 1 33  ? 55.60866 -14.09839 -42.66069 1.000 107.34831 ? 33  ARG A CB  1 
ATOM   4667 C  CG  . ARG E 1 33  ? 56.16432 -12.72270 -42.33447 1.000 107.19430 ? 33  ARG A CG  1 
ATOM   4668 C  CD  . ARG E 1 33  ? 55.55766 -11.60918 -43.18321 1.000 109.00650 ? 33  ARG A CD  1 
ATOM   4669 N  NE  . ARG E 1 33  ? 55.71965 -11.78782 -44.62448 1.000 111.15248 ? 33  ARG A NE  1 
ATOM   4670 C  CZ  . ARG E 1 33  ? 54.77678 -12.27726 -45.42343 1.000 114.41006 ? 33  ARG A CZ  1 
ATOM   4671 N  NH1 . ARG E 1 33  ? 53.60454 -12.64554 -44.92151 1.000 117.05002 ? 33  ARG A NH1 1 
ATOM   4672 N  NH2 . ARG E 1 33  ? 55.00214 -12.39439 -46.72527 1.000 114.55226 ? 33  ARG A NH2 1 
ATOM   4673 N  N   . ASP E 1 34  ? 55.67541 -17.40802 -42.73371 1.000 117.61535 ? 34  ASP A N   1 
ATOM   4674 C  CA  . ASP E 1 34  ? 54.87537 -18.62400 -42.81111 1.000 124.59176 ? 34  ASP A CA  1 
ATOM   4675 C  C   . ASP E 1 34  ? 55.22614 -19.64215 -41.72883 1.000 128.32803 ? 34  ASP A C   1 
ATOM   4676 O  O   . ASP E 1 34  ? 54.41839 -20.54112 -41.45883 1.000 131.49391 ? 34  ASP A O   1 
ATOM   4677 C  CB  . ASP E 1 34  ? 55.02172 -19.26590 -44.19469 1.000 127.37784 ? 34  ASP A CB  1 
ATOM   4678 C  CG  . ASP E 1 34  ? 56.45208 -19.62759 -44.51771 1.000 129.47087 ? 34  ASP A CG  1 
ATOM   4679 O  OD1 . ASP E 1 34  ? 57.36323 -19.06611 -43.87521 1.000 130.82154 ? 34  ASP A OD1 1 
ATOM   4680 O  OD2 . ASP E 1 34  ? 56.66503 -20.49196 -45.39697 1.000 130.88406 ? 34  ASP A OD2 1 
ATOM   4681 N  N   . ARG E 1 35  ? 56.41460 -19.53682 -41.12803 1.000 129.51087 ? 35  ARG A N   1 
ATOM   4682 C  CA  . ARG E 1 35  ? 56.89701 -20.49078 -40.13929 1.000 134.17727 ? 35  ARG A CA  1 
ATOM   4683 C  C   . ARG E 1 35  ? 56.37655 -20.16315 -38.73963 1.000 134.05149 ? 35  ARG A C   1 
ATOM   4684 O  O   . ARG E 1 35  ? 56.00259 -19.02165 -38.45596 1.000 133.16928 ? 35  ARG A O   1 
ATOM   4685 C  CB  . ARG E 1 35  ? 58.42008 -20.50798 -40.17668 1.000 136.38999 ? 35  ARG A CB  1 
ATOM   4686 C  CG  . ARG E 1 35  ? 58.88423 -20.86350 -41.57395 1.000 138.72378 ? 35  ARG A CG  1 
ATOM   4687 C  CD  . ARG E 1 35  ? 60.37426 -20.84441 -41.78537 1.000 138.69569 ? 35  ARG A CD  1 
ATOM   4688 N  NE  . ARG E 1 35  ? 60.66050 -21.13251 -43.18946 1.000 139.25200 ? 35  ARG A NE  1 
ATOM   4689 C  CZ  . ARG E 1 35  ? 61.87597 -21.30523 -43.69832 1.000 138.50133 ? 35  ARG A CZ  1 
ATOM   4690 N  NH1 . ARG E 1 35  ? 62.94742 -21.22639 -42.91967 1.000 139.72489 ? 35  ARG A NH1 1 
ATOM   4691 N  NH2 . ARG E 1 35  ? 62.01727 -21.55174 -44.99358 1.000 136.84371 ? 35  ARG A NH2 1 
ATOM   4692 N  N   . PRO E 1 36  ? 56.36947 -21.14615 -37.83635 1.000 135.08450 ? 36  PRO A N   1 
ATOM   4693 C  CA  . PRO E 1 36  ? 55.81280 -20.91483 -36.49829 1.000 136.55404 ? 36  PRO A CA  1 
ATOM   4694 C  C   . PRO E 1 36  ? 56.60172 -19.87871 -35.71221 1.000 133.76616 ? 36  PRO A C   1 
ATOM   4695 O  O   . PRO E 1 36  ? 57.78593 -19.64035 -35.95435 1.000 131.23195 ? 36  PRO A O   1 
ATOM   4696 C  CB  . PRO E 1 36  ? 55.89673 -22.29541 -35.83844 1.000 140.42541 ? 36  PRO A CB  1 
ATOM   4697 C  CG  . PRO E 1 36  ? 55.86359 -23.25026 -36.98218 1.000 143.57778 ? 36  PRO A CG  1 
ATOM   4698 C  CD  . PRO E 1 36  ? 56.62410 -22.57596 -38.08464 1.000 138.35029 ? 36  PRO A CD  1 
ATOM   4699 N  N   . HIS E 1 37  ? 55.92202 -19.28584 -34.72540 1.000 120.01864 ? 37  HIS A N   1 
ATOM   4700 C  CA  . HIS E 1 37  ? 56.49472 -18.16802 -33.97798 1.000 120.89746 ? 37  HIS A CA  1 
ATOM   4701 C  C   . HIS E 1 37  ? 57.71540 -18.59181 -33.17296 1.000 124.47320 ? 37  HIS A C   1 
ATOM   4702 O  O   . HIS E 1 37  ? 58.68359 -17.83157 -33.06788 1.000 125.43809 ? 37  HIS A O   1 
ATOM   4703 C  CB  . HIS E 1 37  ? 55.44034 -17.56104 -33.05457 1.000 116.32207 ? 37  HIS A CB  1 
ATOM   4704 C  CG  . HIS E 1 37  ? 55.89952 -16.33225 -32.33441 1.000 111.40409 ? 37  HIS A CG  1 
ATOM   4705 N  ND1 . HIS E 1 37  ? 55.97548 -15.09800 -32.94253 1.000 107.59642 ? 37  HIS A ND1 1 
ATOM   4706 C  CD2 . HIS E 1 37  ? 56.31301 -16.14827 -31.05828 1.000 109.90078 ? 37  HIS A CD2 1 
ATOM   4707 C  CE1 . HIS E 1 37  ? 56.41080 -14.20467 -32.07116 1.000 106.82540 ? 37  HIS A CE1 1 
ATOM   4708 N  NE2 . HIS E 1 37  ? 56.62516 -14.81627 -30.92043 1.000 108.51610 ? 37  HIS A NE2 1 
ATOM   4709 N  N   . GLU E 1 38  ? 57.67583 -19.78925 -32.57509 1.000 127.53444 ? 38  GLU A N   1 
ATOM   4710 C  CA  . GLU E 1 38  ? 58.81324 -20.28272 -31.79962 1.000 133.33374 ? 38  GLU A CA  1 
ATOM   4711 C  C   . GLU E 1 38  ? 60.07606 -20.37107 -32.64979 1.000 131.39651 ? 38  GLU A C   1 
ATOM   4712 O  O   . GLU E 1 38  ? 61.18517 -20.16453 -32.14036 1.000 132.65872 ? 38  GLU A O   1 
ATOM   4713 C  CB  . GLU E 1 38  ? 58.48832 -21.65116 -31.18650 1.000 137.85131 ? 38  GLU A CB  1 
ATOM   4714 C  CG  . GLU E 1 38  ? 57.82004 -21.61633 -29.80337 1.000 142.57181 ? 38  GLU A CG  1 
ATOM   4715 C  CD  . GLU E 1 38  ? 58.80281 -21.34078 -28.66960 1.000 148.51939 ? 38  GLU A CD  1 
ATOM   4716 O  OE1 . GLU E 1 38  ? 60.02071 -21.27155 -28.94023 1.000 151.74149 ? 38  GLU A OE1 1 
ATOM   4717 O  OE2 . GLU E 1 38  ? 58.35920 -21.19485 -27.50771 1.000 147.58143 ? 38  GLU A OE2 1 
ATOM   4718 N  N   . GLU E 1 39  ? 59.93167 -20.70256 -33.93595 1.000 125.77720 ? 39  GLU A N   1 
ATOM   4719 C  CA  . GLU E 1 39  ? 61.08378 -20.72668 -34.83120 1.000 120.64309 ? 39  GLU A CA  1 
ATOM   4720 C  C   . GLU E 1 39  ? 61.52875 -19.31687 -35.20591 1.000 113.29794 ? 39  GLU A C   1 
ATOM   4721 O  O   . GLU E 1 39  ? 62.72805 -19.05963 -35.36108 1.000 113.09544 ? 39  GLU A O   1 
ATOM   4722 C  CB  . GLU E 1 39  ? 60.76012 -21.53033 -36.09188 1.000 119.55307 ? 39  GLU A CB  1 
ATOM   4723 C  CG  . GLU E 1 39  ? 61.94421 -21.67711 -37.04495 1.000 119.53091 ? 39  GLU A CG  1 
ATOM   4724 C  CD  . GLU E 1 39  ? 61.58585 -22.37919 -38.34439 1.000 120.58714 ? 39  GLU A CD  1 
ATOM   4725 O  OE1 . GLU E 1 39  ? 62.49406 -22.58870 -39.17466 1.000 118.71283 ? 39  GLU A OE1 1 
ATOM   4726 O  OE2 . GLU E 1 39  ? 60.40109 -22.72162 -38.53988 1.000 125.87142 ? 39  GLU A OE2 1 
ATOM   4727 N  N   . ARG E 1 40  ? 60.57841 -18.39391 -35.36979 1.000 107.62108 ? 40  ARG A N   1 
ATOM   4728 C  CA  . ARG E 1 40  ? 60.92188 -17.04330 -35.80621 1.000 98.62221  ? 40  ARG A CA  1 
ATOM   4729 C  C   . ARG E 1 40  ? 61.79483 -16.32063 -34.78170 1.000 98.47533  ? 40  ARG A C   1 
ATOM   4730 O  O   . ARG E 1 40  ? 62.82036 -15.72831 -35.13432 1.000 94.39244  ? 40  ARG A O   1 
ATOM   4731 C  CB  . ARG E 1 40  ? 59.64234 -16.25507 -36.08015 1.000 92.22633  ? 40  ARG A CB  1 
ATOM   4732 C  CG  . ARG E 1 40  ? 58.86828 -16.72747 -37.29281 1.000 85.72174  ? 40  ARG A CG  1 
ATOM   4733 C  CD  . ARG E 1 40  ? 57.53516 -16.00663 -37.39218 1.000 83.92109  ? 40  ARG A CD  1 
ATOM   4734 N  NE  . ARG E 1 40  ? 57.67363 -14.57531 -37.13675 1.000 83.00676  ? 40  ARG A NE  1 
ATOM   4735 C  CZ  . ARG E 1 40  ? 57.84176 -13.65217 -38.07501 1.000 79.65249  ? 40  ARG A CZ  1 
ATOM   4736 N  NH1 . ARG E 1 40  ? 57.90186 -14.00305 -39.34633 1.000 78.95527  ? 40  ARG A NH1 1 
ATOM   4737 N  NH2 . ARG E 1 40  ? 57.95390 -12.37816 -37.73769 1.000 79.17694  ? 40  ARG A NH2 1 
ATOM   4738 N  N   . GLN E 1 41  ? 61.41046 -16.36269 -33.50103 1.000 100.24825 ? 41  GLN A N   1 
ATOM   4739 C  CA  . GLN E 1 41  ? 62.21800 -15.69274 -32.48428 1.000 102.11855 ? 41  GLN A CA  1 
ATOM   4740 C  C   . GLN E 1 41  ? 63.61535 -16.29896 -32.39545 1.000 105.30161 ? 41  GLN A C   1 
ATOM   4741 O  O   . GLN E 1 41  ? 64.57177 -15.59636 -32.05331 1.000 106.50577 ? 41  GLN A O   1 
ATOM   4742 C  CB  . GLN E 1 41  ? 61.50763 -15.70510 -31.12803 1.000 103.24314 ? 41  GLN A CB  1 
ATOM   4743 C  CG  . GLN E 1 41  ? 60.74415 -16.97052 -30.80829 1.000 107.71656 ? 41  GLN A CG  1 
ATOM   4744 C  CD  . GLN E 1 41  ? 59.74307 -16.77295 -29.68209 1.000 111.19043 ? 41  GLN A CD  1 
ATOM   4745 O  OE1 . GLN E 1 41  ? 59.54518 -15.65602 -29.19997 1.000 110.61107 ? 41  GLN A OE1 1 
ATOM   4746 N  NE2 . GLN E 1 41  ? 59.10390 -17.85819 -29.26030 1.000 111.00617 ? 41  GLN A NE2 1 
ATOM   4747 N  N   . ALA E 1 42  ? 63.75945 -17.59055 -32.70675 1.000 106.45139 ? 42  ALA A N   1 
ATOM   4748 C  CA  . ALA E 1 42  ? 65.08526 -18.19849 -32.71730 1.000 105.97854 ? 42  ALA A CA  1 
ATOM   4749 C  C   . ALA E 1 42  ? 65.88624 -17.77494 -33.94267 1.000 104.83907 ? 42  ALA A C   1 
ATOM   4750 O  O   . ALA E 1 42  ? 67.10958 -17.62835 -33.86123 1.000 106.39618 ? 42  ALA A O   1 
ATOM   4751 C  CB  . ALA E 1 42  ? 64.97180 -19.71970 -32.66922 1.000 105.91425 ? 42  ALA A CB  1 
ATOM   4752 N  N   . ARG E 1 43  ? 65.22508 -17.59444 -35.08989 1.000 103.50935 ? 43  ARG A N   1 
ATOM   4753 C  CA  . ARG E 1 43  ? 65.92850 -17.11893 -36.28010 1.000 102.58744 ? 43  ARG A CA  1 
ATOM   4754 C  C   . ARG E 1 43  ? 66.39784 -15.67554 -36.10913 1.000 100.03575 ? 43  ARG A C   1 
ATOM   4755 O  O   . ARG E 1 43  ? 67.53345 -15.33722 -36.46810 1.000 98.12264  ? 43  ARG A O   1 
ATOM   4756 C  CB  . ARG E 1 43  ? 65.03296 -17.26258 -37.51266 1.000 104.34879 ? 43  ARG A CB  1 
ATOM   4757 C  CG  . ARG E 1 43  ? 64.93111 -18.67024 -38.10245 1.000 106.98818 ? 43  ARG A CG  1 
ATOM   4758 C  CD  . ARG E 1 43  ? 66.20294 -18.93414 -38.90421 1.000 109.43795 ? 43  ARG A CD  1 
ATOM   4759 N  NE  . ARG E 1 43  ? 66.24949 -20.22374 -39.58681 1.000 110.63134 ? 43  ARG A NE  1 
ATOM   4760 C  CZ  . ARG E 1 43  ? 67.32532 -20.67590 -40.22991 1.000 112.28636 ? 43  ARG A CZ  1 
ATOM   4761 N  NH1 . ARG E 1 43  ? 68.43583 -19.94509 -40.27376 1.000 112.34154 ? 43  ARG A NH1 1 
ATOM   4762 N  NH2 . ARG E 1 43  ? 67.29367 -21.85346 -40.83903 1.000 113.63687 ? 43  ARG A NH2 1 
ATOM   4763 N  N   . PHE E 1 44  ? 65.53862 -14.81504 -35.55149 1.000 98.23340  ? 44  PHE A N   1 
ATOM   4764 C  CA  . PHE E 1 44  ? 65.91550 -13.42852 -35.28852 1.000 95.30024  ? 44  PHE A CA  1 
ATOM   4765 C  C   . PHE E 1 44  ? 66.96777 -13.34488 -34.19454 1.000 95.17878  ? 44  PHE A C   1 
ATOM   4766 O  O   . PHE E 1 44  ? 67.80314 -12.43248 -34.20669 1.000 94.63166  ? 44  PHE A O   1 
ATOM   4767 C  CB  . PHE E 1 44  ? 64.68121 -12.59990 -34.91348 1.000 92.80200  ? 44  PHE A CB  1 
ATOM   4768 C  CG  . PHE E 1 44  ? 65.00647 -11.24391 -34.35788 1.000 91.70534  ? 44  PHE A CG  1 
ATOM   4769 C  CD1 . PHE E 1 44  ? 65.28095 -10.18720 -35.20234 1.000 91.64827  ? 44  PHE A CD1 1 
ATOM   4770 C  CD2 . PHE E 1 44  ? 65.03528 -11.02511 -32.99020 1.000 93.07690  ? 44  PHE A CD2 1 
ATOM   4771 C  CE1 . PHE E 1 44  ? 65.58579 -8.92948  -34.69383 1.000 92.15476  ? 44  PHE A CE1 1 
ATOM   4772 C  CE2 . PHE E 1 44  ? 65.33912 -9.77550  -32.47627 1.000 93.90532  ? 44  PHE A CE2 1 
ATOM   4773 C  CZ  . PHE E 1 44  ? 65.61426 -8.72567  -33.32874 1.000 92.76159  ? 44  PHE A CZ  1 
ATOM   4774 N  N   . GLN E 1 45  ? 66.91586 -14.25977 -33.22478 1.000 97.09698  ? 45  GLN A N   1 
ATOM   4775 C  CA  . GLN E 1 45  ? 67.92286 -14.29060 -32.17193 1.000 97.84736  ? 45  GLN A CA  1 
ATOM   4776 C  C   . GLN E 1 45  ? 69.30296 -14.57981 -32.75257 1.000 96.21805  ? 45  GLN A C   1 
ATOM   4777 O  O   . GLN E 1 45  ? 70.28438 -13.91490 -32.40703 1.000 93.19321  ? 45  GLN A O   1 
ATOM   4778 C  CB  . GLN E 1 45  ? 67.54817 -15.35287 -31.13515 1.000 103.26563 ? 45  GLN A CB  1 
ATOM   4779 C  CG  . GLN E 1 45  ? 68.39796 -15.34960 -29.88031 1.000 104.80359 ? 45  GLN A CG  1 
ATOM   4780 C  CD  . GLN E 1 45  ? 68.06479 -14.17993 -28.99343 1.000 106.14257 ? 45  GLN A CD  1 
ATOM   4781 O  OE1 . GLN E 1 45  ? 67.03355 -13.53299 -29.17792 1.000 106.71609 ? 45  GLN A OE1 1 
ATOM   4782 N  NE2 . GLN E 1 45  ? 68.93397 -13.89041 -28.02979 1.000 106.80302 ? 45  GLN A NE2 1 
ATOM   4783 N  N   . ASN E 1 46  ? 69.39566 -15.57252 -33.64776 1.000 96.13965  ? 46  ASN A N   1 
ATOM   4784 C  CA  . ASN E 1 46  ? 70.67829 -15.89220 -34.27113 1.000 96.27313  ? 46  ASN A CA  1 
ATOM   4785 C  C   . ASN E 1 46  ? 71.14914 -14.77759 -35.19073 1.000 91.59859  ? 46  ASN A C   1 
ATOM   4786 O  O   . ASN E 1 46  ? 72.35716 -14.54473 -35.30652 1.000 90.59308  ? 46  ASN A O   1 
ATOM   4787 C  CB  . ASN E 1 46  ? 70.58987 -17.20132 -35.06233 1.000 100.72016 ? 46  ASN A CB  1 
ATOM   4788 C  CG  . ASN E 1 46  ? 70.38022 -18.41995 -34.17501 1.000 108.16584 ? 46  ASN A CG  1 
ATOM   4789 O  OD1 . ASN E 1 46  ? 69.98945 -18.30441 -33.01006 1.000 111.62098 ? 46  ASN A OD1 1 
ATOM   4790 N  ND2 . ASN E 1 46  ? 70.63111 -19.60083 -34.73251 1.000 109.24162 ? 46  ASN A ND2 1 
ATOM   4791 N  N   . ALA E 1 47  ? 70.21444 -14.08488 -35.84904 1.000 90.41166  ? 47  ALA A N   1 
ATOM   4792 C  CA  . ALA E 1 47  ? 70.58784 -13.04199 -36.79773 1.000 86.50822  ? 47  ALA A CA  1 
ATOM   4793 C  C   . ALA E 1 47  ? 71.32275 -11.90352 -36.10395 1.000 85.79440  ? 47  ALA A C   1 
ATOM   4794 O  O   . ALA E 1 47  ? 72.33137 -11.40251 -36.61582 1.000 85.50062  ? 47  ALA A O   1 
ATOM   4795 C  CB  . ALA E 1 47  ? 69.34158 -12.52723 -37.51428 1.000 85.30255  ? 47  ALA A CB  1 
ATOM   4796 N  N   . CYS E 1 48  ? 70.86363 -11.51484 -34.91339 1.000 86.61867  ? 48  CYS A N   1 
ATOM   4797 C  CA  . CYS E 1 48  ? 71.56656 -10.48547 -34.15894 1.000 87.39053  ? 48  CYS A CA  1 
ATOM   4798 C  C   . CYS E 1 48  ? 72.92014 -10.98489 -33.66358 1.000 90.33859  ? 48  CYS A C   1 
ATOM   4799 O  O   . CYS E 1 48  ? 73.82956 -10.18216 -33.43365 1.000 91.22947  ? 48  CYS A O   1 
ATOM   4800 C  CB  . CYS E 1 48  ? 70.74048 -10.04370 -32.94583 1.000 88.06212  ? 48  CYS A CB  1 
ATOM   4801 S  SG  . CYS E 1 48  ? 68.98310 -9.62553  -33.18372 1.000 86.38433  ? 48  CYS A SG  1 
ATOM   4802 N  N   . ARG E 1 49  ? 73.06231 -12.29549 -33.45801 1.000 94.76142  ? 49  ARG A N   1 
ATOM   4803 C  CA  . ARG E 1 49  ? 74.26241 -12.85001 -32.83980 1.000 99.86329  ? 49  ARG A CA  1 
ATOM   4804 C  C   . ARG E 1 49  ? 75.31022 -13.28549 -33.86120 1.000 102.06249 ? 49  ARG A C   1 
ATOM   4805 O  O   . ARG E 1 49  ? 76.50873 -13.05548 -33.65765 1.000 102.34444 ? 49  ARG A O   1 
ATOM   4806 C  CB  . ARG E 1 49  ? 73.88118 -14.05786 -31.97296 1.000 104.63892 ? 49  ARG A CB  1 
ATOM   4807 C  CG  . ARG E 1 49  ? 72.88928 -13.79344 -30.83312 1.000 109.55493 ? 49  ARG A CG  1 
ATOM   4808 C  CD  . ARG E 1 49  ? 73.45711 -13.03975 -29.65162 1.000 112.93463 ? 49  ARG A CD  1 
ATOM   4809 N  NE  . ARG E 1 49  ? 72.61530 -13.23418 -28.47314 1.000 116.00560 ? 49  ARG A NE  1 
ATOM   4810 C  CZ  . ARG E 1 49  ? 72.85208 -12.68585 -27.28650 1.000 118.51784 ? 49  ARG A CZ  1 
ATOM   4811 N  NH1 . ARG E 1 49  ? 73.90827 -11.89782 -27.12095 1.000 118.51059 ? 49  ARG A NH1 1 
ATOM   4812 N  NH2 . ARG E 1 49  ? 72.03392 -12.92150 -26.26775 1.000 119.80707 ? 49  ARG A NH2 1 
ATOM   4813 N  N   . ASP E 1 50  ? 74.86639 -13.88808 -34.96348 1.000 103.77539 ? 50  ASP A N   1 
ATOM   4814 C  CA  . ASP E 1 50  ? 75.76051 -14.45464 -35.96423 1.000 105.56397 ? 50  ASP A CA  1 
ATOM   4815 C  C   . ASP E 1 50  ? 76.61423 -13.36927 -36.61062 1.000 105.54700 ? 50  ASP A C   1 
ATOM   4816 O  O   . ASP E 1 50  ? 76.22040 -12.20475 -36.70112 1.000 105.99147 ? 50  ASP A O   1 
ATOM   4817 C  CB  . ASP E 1 50  ? 74.93512 -15.19333 -37.02644 1.000 108.30983 ? 50  ASP A CB  1 
ATOM   4818 C  CG  . ASP E 1 50  ? 75.78633 -15.97539 -38.02646 1.000 112.18398 ? 50  ASP A CG  1 
ATOM   4819 O  OD1 . ASP E 1 50  ? 76.68394 -15.38846 -38.67350 1.000 113.46280 ? 50  ASP A OD1 1 
ATOM   4820 O  OD2 . ASP E 1 50  ? 75.53121 -17.18979 -38.18677 1.000 115.29316 ? 50  ASP A OD2 1 
ATOM   4821 N  N   . GLY E 1 51  ? 77.80927 -13.76804 -37.05122 1.000 105.08106 ? 51  GLY A N   1 
ATOM   4822 C  CA  . GLY E 1 51  ? 78.76086 -12.81777 -37.60042 1.000 103.71477 ? 51  GLY A CA  1 
ATOM   4823 C  C   . GLY E 1 51  ? 78.46194 -12.36271 -39.01565 1.000 101.69059 ? 51  GLY A C   1 
ATOM   4824 O  O   . GLY E 1 51  ? 78.92077 -11.29193 -39.42682 1.000 99.51083  ? 51  GLY A O   1 
ATOM   4825 N  N   . ARG E 1 52  ? 77.73224 -13.17237 -39.79484 1.000 102.72086 ? 52  ARG A N   1 
ATOM   4826 C  CA  . ARG E 1 52  ? 77.42311 -12.84459 -41.18368 1.000 103.57045 ? 52  ARG A CA  1 
ATOM   4827 C  C   . ARG E 1 52  ? 75.92072 -12.77477 -41.45810 1.000 98.22062  ? 52  ARG A C   1 
ATOM   4828 O  O   . ARG E 1 52  ? 75.48288 -13.00179 -42.59623 1.000 94.48611  ? 52  ARG A O   1 
ATOM   4829 C  CB  . ARG E 1 52  ? 78.06375 -13.87006 -42.11966 1.000 109.42251 ? 52  ARG A CB  1 
ATOM   4830 C  CG  . ARG E 1 52  ? 77.57303 -15.30443 -41.86575 1.000 115.50035 ? 52  ARG A CG  1 
ATOM   4831 C  CD  . ARG E 1 52  ? 78.02523 -16.29972 -42.93307 1.000 119.18848 ? 52  ARG A CD  1 
ATOM   4832 N  NE  . ARG E 1 52  ? 77.27852 -16.10641 -44.17985 1.000 120.79472 ? 52  ARG A NE  1 
ATOM   4833 C  CZ  . ARG E 1 52  ? 77.38987 -16.88807 -45.25062 1.000 124.64610 ? 52  ARG A CZ  1 
ATOM   4834 N  NH1 . ARG E 1 52  ? 78.22639 -17.91594 -45.23012 1.000 130.41092 ? 52  ARG A NH1 1 
ATOM   4835 N  NH2 . ARG E 1 52  ? 76.67598 -16.64238 -46.34608 1.000 122.92420 ? 52  ARG A NH2 1 
ATOM   4836 N  N   . SER E 1 53  ? 75.13604 -12.35028 -40.46568 1.000 96.96605  ? 53  SER A N   1 
ATOM   4837 C  CA  . SER E 1 53  ? 73.68653 -12.27256 -40.57933 1.000 93.20304  ? 53  SER A CA  1 
ATOM   4838 C  C   . SER E 1 53  ? 73.19813 -10.82527 -40.57146 1.000 91.72874  ? 53  SER A C   1 
ATOM   4839 O  O   . SER E 1 53  ? 73.75262 -9.96221  -39.88298 1.000 89.85373  ? 53  SER A O   1 
ATOM   4840 C  CB  . SER E 1 53  ? 73.01101 -13.06312 -39.44715 1.000 93.53170  ? 53  SER A CB  1 
ATOM   4841 O  OG  . SER E 1 53  ? 73.27443 -14.45404 -39.55589 1.000 92.71579  ? 53  SER A OG  1 
ATOM   4842 N  N   . GLU E 1 54  ? 72.12903 -10.58763 -41.33249 1.000 89.33196  ? 54  GLU A N   1 
ATOM   4843 C  CA  . GLU E 1 54  ? 71.51197 -9.28025  -41.51332 1.000 88.84758  ? 54  GLU A CA  1 
ATOM   4844 C  C   . GLU E 1 54  ? 70.17616 -9.25719  -40.77862 1.000 86.90864  ? 54  GLU A C   1 
ATOM   4845 O  O   . GLU E 1 54  ? 69.49569 -10.28440 -40.68186 1.000 93.06726  ? 54  GLU A O   1 
ATOM   4846 C  CB  . GLU E 1 54  ? 71.29736 -8.96239  -43.00841 1.000 92.38478  ? 54  GLU A CB  1 
ATOM   4847 C  CG  . GLU E 1 54  ? 70.14986 -9.70415  -43.75046 1.000 98.12063  ? 54  GLU A CG  1 
ATOM   4848 C  CD  . GLU E 1 54  ? 70.41937 -11.19355 -44.00200 1.000 107.04637 ? 54  GLU A CD  1 
ATOM   4849 O  OE1 . GLU E 1 54  ? 71.43769 -11.73358 -43.50745 1.000 112.09250 ? 54  GLU A OE1 1 
ATOM   4850 O  OE2 . GLU E 1 54  ? 69.61819 -11.82862 -44.72489 1.000 109.75447 ? 54  GLU A OE2 1 
ATOM   4851 N  N   . ILE E 1 55  ? 69.82835 -8.11447  -40.19716 1.000 78.48879  ? 55  ILE A N   1 
ATOM   4852 C  CA  . ILE E 1 55  ? 68.50641 -7.92585  -39.61217 1.000 73.53881  ? 55  ILE A CA  1 
ATOM   4853 C  C   . ILE E 1 55  ? 67.89203 -6.69450  -40.26065 1.000 72.06052  ? 55  ILE A C   1 
ATOM   4854 O  O   . ILE E 1 55  ? 68.59031 -5.70383  -40.50984 1.000 73.16950  ? 55  ILE A O   1 
ATOM   4855 C  CB  . ILE E 1 55  ? 68.52782 -7.78580  -38.07474 1.000 71.32096  ? 55  ILE A CB  1 
ATOM   4856 C  CG1 . ILE E 1 55  ? 69.26775 -6.52598  -37.64317 1.000 69.94631  ? 55  ILE A CG1 1 
ATOM   4857 C  CG2 . ILE E 1 55  ? 69.17822 -8.99541  -37.43293 1.000 71.90160  ? 55  ILE A CG2 1 
ATOM   4858 C  CD1 . ILE E 1 55  ? 69.14813 -6.22587  -36.17391 1.000 70.08915  ? 55  ILE A CD1 1 
ATOM   4859 N  N   . ALA E 1 56  ? 66.60238 -6.78280  -40.60150 1.000 68.20832  ? 56  ALA A N   1 
ATOM   4860 C  CA  . ALA E 1 56  ? 65.89306 -5.68021  -41.23716 1.000 61.29524  ? 56  ALA A CA  1 
ATOM   4861 C  C   . ALA E 1 56  ? 64.52125 -5.50283  -40.60177 1.000 60.36171  ? 56  ALA A C   1 
ATOM   4862 O  O   . ALA E 1 56  ? 63.84070 -6.48285  -40.28235 1.000 60.71488  ? 56  ALA A O   1 
ATOM   4863 C  CB  . ALA E 1 56  ? 65.73683 -5.92809  -42.74073 1.000 57.38334  ? 56  ALA A CB  1 
ATOM   4864 N  N   . PHE E 1 57  ? 64.09367 -4.24993  -40.47570 1.000 59.00934  ? 57  PHE A N   1 
ATOM   4865 C  CA  . PHE E 1 57  ? 62.80265 -3.93237  -39.88157 1.000 57.80451  ? 57  PHE A CA  1 
ATOM   4866 C  C   . PHE E 1 57  ? 62.03605 -3.03475  -40.83952 1.000 56.54870  ? 57  PHE A C   1 
ATOM   4867 O  O   . PHE E 1 57  ? 62.58493 -2.04609  -41.33403 1.000 55.45563  ? 57  PHE A O   1 
ATOM   4868 C  CB  . PHE E 1 57  ? 62.97035 -3.25100  -38.50733 1.000 56.74890  ? 57  PHE A CB  1 
ATOM   4869 C  CG  . PHE E 1 57  ? 63.86893 -4.00839  -37.55399 1.000 59.83116  ? 57  PHE A CG  1 
ATOM   4870 C  CD1 . PHE E 1 57  ? 63.37653 -5.07257  -36.80574 1.000 63.06781  ? 57  PHE A CD1 1 
ATOM   4871 C  CD2 . PHE E 1 57  ? 65.20238 -3.66193  -37.40442 1.000 59.29338  ? 57  PHE A CD2 1 
ATOM   4872 C  CE1 . PHE E 1 57  ? 64.20053 -5.78092  -35.94267 1.000 65.44721  ? 57  PHE A CE1 1 
ATOM   4873 C  CE2 . PHE E 1 57  ? 66.02990 -4.36778  -36.53016 1.000 61.72966  ? 57  PHE A CE2 1 
ATOM   4874 C  CZ  . PHE E 1 57  ? 65.52479 -5.42176  -35.80008 1.000 64.50771  ? 57  PHE A CZ  1 
ATOM   4875 N  N   . VAL E 1 58  ? 60.78055 -3.38602  -41.11857 1.000 57.55524  ? 58  VAL A N   1 
ATOM   4876 C  CA  . VAL E 1 58  ? 59.94929 -2.62090  -42.04289 1.000 54.64682  ? 58  VAL A CA  1 
ATOM   4877 C  C   . VAL E 1 58  ? 58.96162 -1.81167  -41.23390 1.000 57.16961  ? 58  VAL A C   1 
ATOM   4878 O  O   . VAL E 1 58  ? 58.33262 -2.32850  -40.29918 1.000 54.06718  ? 58  VAL A O   1 
ATOM   4879 C  CB  . VAL E 1 58  ? 59.21071 -3.50575  -43.06094 1.000 48.61920  ? 58  VAL A CB  1 
ATOM   4880 C  CG1 . VAL E 1 58  ? 60.20011 -4.14610  -43.98697 1.000 47.35809  ? 58  VAL A CG1 1 
ATOM   4881 C  CG2 . VAL E 1 58  ? 58.37296 -4.54039  -42.36389 1.000 49.32974  ? 58  VAL A CG2 1 
ATOM   4882 N  N   . ALA E 1 59  ? 58.87222 -0.53080  -41.56437 1.000 61.48645  ? 59  ALA A N   1 
ATOM   4883 C  CA  . ALA E 1 59  ? 57.82611 0.31285   -41.02864 1.000 64.96977  ? 59  ALA A CA  1 
ATOM   4884 C  C   . ALA E 1 59  ? 56.49144 -0.20413  -41.53557 1.000 68.11625  ? 59  ALA A C   1 
ATOM   4885 O  O   . ALA E 1 59  ? 56.27004 -0.29937  -42.74631 1.000 68.79960  ? 59  ALA A O   1 
ATOM   4886 C  CB  . ALA E 1 59  ? 58.06491 1.75838   -41.45662 1.000 65.69606  ? 59  ALA A CB  1 
ATOM   4887 N  N   . THR E 1 60  ? 55.62240 -0.58333  -40.60923 1.000 70.46912  ? 60  THR A N   1 
ATOM   4888 C  CA  . THR E 1 60  ? 54.37482 -1.22459  -40.98956 1.000 74.85564  ? 60  THR A CA  1 
ATOM   4889 C  C   . THR E 1 60  ? 53.56264 -0.33219  -41.91909 1.000 69.70597  ? 60  THR A C   1 
ATOM   4890 O  O   . THR E 1 60  ? 53.54887 0.89424   -41.78032 1.000 66.55135  ? 60  THR A O   1 
ATOM   4891 C  CB  . THR E 1 60  ? 53.57005 -1.57355  -39.74279 1.000 83.08670  ? 60  THR A CB  1 
ATOM   4892 O  OG1 . THR E 1 60  ? 53.39542 -0.39054  -38.95370 1.000 87.65732  ? 60  THR A OG1 1 
ATOM   4893 C  CG2 . THR E 1 60  ? 54.30363 -2.63974  -38.92281 1.000 84.38296  ? 60  THR A CG2 1 
ATOM   4894 N  N   . GLY E 1 61  ? 52.89684 -0.96076  -42.88663 1.000 67.68776  ? 61  GLY A N   1 
ATOM   4895 C  CA  . GLY E 1 61  ? 52.09995 -0.24230  -43.85154 1.000 65.35313  ? 61  GLY A CA  1 
ATOM   4896 C  C   . GLY E 1 61  ? 52.87383 0.29225   -45.02620 1.000 62.94662  ? 61  GLY A C   1 
ATOM   4897 O  O   . GLY E 1 61  ? 52.26535 0.87032   -45.93536 1.000 62.93918  ? 61  GLY A O   1 
ATOM   4898 N  N   . THR E 1 62  ? 54.19627 0.15254   -45.01889 1.000 62.47095  ? 62  THR A N   1 
ATOM   4899 C  CA  . THR E 1 62  ? 55.05939 0.58713   -46.10200 1.000 59.33970  ? 62  THR A CA  1 
ATOM   4900 C  C   . THR E 1 62  ? 55.95321 -0.57176  -46.50059 1.000 58.46030  ? 62  THR A C   1 
ATOM   4901 O  O   . THR E 1 62  ? 56.00314 -1.60755  -45.83308 1.000 59.24299  ? 62  THR A O   1 
ATOM   4902 C  CB  . THR E 1 62  ? 55.95141 1.76782   -45.69821 1.000 59.14421  ? 62  THR A CB  1 
ATOM   4903 O  OG1 . THR E 1 62  ? 57.08730 1.27162   -44.97136 1.000 56.76475  ? 62  THR A OG1 1 
ATOM   4904 C  CG2 . THR E 1 62  ? 55.17793 2.78275   -44.83609 1.000 58.28146  ? 62  THR A CG2 1 
ATOM   4905 N  N   . ASN E 1 63  ? 56.68532 -0.38137  -47.58961 1.000 56.50900  ? 63  ASN A N   1 
ATOM   4906 C  CA  . ASN E 1 63  ? 57.73961 -1.30762  -47.96318 1.000 58.22559  ? 63  ASN A CA  1 
ATOM   4907 C  C   . ASN E 1 63  ? 59.11314 -0.74565  -47.65422 1.000 60.70155  ? 63  ASN A C   1 
ATOM   4908 O  O   . ASN E 1 63  ? 60.10997 -1.26976  -48.16219 1.000 61.74307  ? 63  ASN A O   1 
ATOM   4909 C  CB  . ASN E 1 63  ? 57.64632 -1.66786  -49.44015 1.000 58.88144  ? 63  ASN A CB  1 
ATOM   4910 C  CG  . ASN E 1 63  ? 58.02644 -0.52208  -50.32529 1.000 59.07516  ? 63  ASN A CG  1 
ATOM   4911 O  OD1 . ASN E 1 63  ? 57.67390 0.62601   -50.05118 1.000 63.99519  ? 63  ASN A OD1 1 
ATOM   4912 N  ND2 . ASN E 1 63  ? 58.77057 -0.80865  -51.37660 1.000 56.41190  ? 63  ASN A ND2 1 
ATOM   4913 N  N   . LEU E 1 64  ? 59.18131 0.33894   -46.87669 1.000 62.31765  ? 64  LEU A N   1 
ATOM   4914 C  CA  . LEU E 1 64  ? 60.45092 0.92105   -46.45296 1.000 62.67130  ? 64  LEU A CA  1 
ATOM   4915 C  C   . LEU E 1 64  ? 61.02759 0.12976   -45.29236 1.000 64.24800  ? 64  LEU A C   1 
ATOM   4916 O  O   . LEU E 1 64  ? 60.29932 -0.25655  -44.37413 1.000 68.32637  ? 64  LEU A O   1 
ATOM   4917 C  CB  . LEU E 1 64  ? 60.24350 2.36339   -46.01754 1.000 62.32197  ? 64  LEU A CB  1 
ATOM   4918 C  CG  . LEU E 1 64  ? 61.52398 3.02571   -45.54789 1.000 62.80503  ? 64  LEU A CG  1 
ATOM   4919 C  CD1 . LEU E 1 64  ? 62.35511 3.38884   -46.76295 1.000 64.00231  ? 64  LEU A CD1 1 
ATOM   4920 C  CD2 . LEU E 1 64  ? 61.20539 4.23815   -44.67833 1.000 59.94336  ? 64  LEU A CD2 1 
ATOM   4921 N  N   . SER E 1 65  ? 62.33794 -0.09998  -45.31299 1.000 63.15048  ? 65  SER A N   1 
ATOM   4922 C  CA  . SER E 1 65  ? 62.92503 -0.93614  -44.27426 1.000 65.44597  ? 65  SER A CA  1 
ATOM   4923 C  C   . SER E 1 65  ? 64.26959 -0.37813  -43.84524 1.000 65.24772  ? 65  SER A C   1 
ATOM   4924 O  O   . SER E 1 65  ? 65.03017 0.13719   -44.67011 1.000 67.80800  ? 65  SER A O   1 
ATOM   4925 C  CB  . SER E 1 65  ? 63.13606 -2.38045  -44.73886 1.000 69.12347  ? 65  SER A CB  1 
ATOM   4926 O  OG  . SER E 1 65  ? 64.33756 -2.49462  -45.48734 1.000 70.18588  ? 65  SER A OG  1 
ATOM   4927 N  N   . LEU E 1 66  ? 64.57116 -0.50985  -42.56155 1.000 63.33651  ? 66  LEU A N   1 
ATOM   4928 C  CA  . LEU E 1 66  ? 65.89304 -0.18616  -42.05185 1.000 64.40440  ? 66  LEU A CA  1 
ATOM   4929 C  C   . LEU E 1 66  ? 66.72292 -1.45894  -42.09610 1.000 65.44817  ? 66  LEU A C   1 
ATOM   4930 O  O   . LEU E 1 66  ? 66.44750 -2.41834  -41.36723 1.000 70.04792  ? 66  LEU A O   1 
ATOM   4931 C  CB  . LEU E 1 66  ? 65.81553 0.38133   -40.64109 1.000 65.99399  ? 66  LEU A CB  1 
ATOM   4932 C  CG  . LEU E 1 66  ? 65.28239 1.81213   -40.53081 1.000 65.66758  ? 66  LEU A CG  1 
ATOM   4933 C  CD1 . LEU E 1 66  ? 65.45145 2.27787   -39.10624 1.000 68.16759  ? 66  LEU A CD1 1 
ATOM   4934 C  CD2 . LEU E 1 66  ? 65.98440 2.74928   -41.49213 1.000 62.77478  ? 66  LEU A CD2 1 
ATOM   4935 N  N   . GLN E 1 67  ? 67.70111 -1.48443  -42.99088 1.000 61.71752  ? 67  GLN A N   1 
ATOM   4936 C  CA  . GLN E 1 67  ? 68.53808 -2.64742  -43.21097 1.000 56.53937  ? 67  GLN A CA  1 
ATOM   4937 C  C   . GLN E 1 67  ? 69.83437 -2.49053  -42.42982 1.000 58.80811  ? 67  GLN A C   1 
ATOM   4938 O  O   . GLN E 1 67  ? 70.62707 -1.58500  -42.71099 1.000 58.50651  ? 67  GLN A O   1 
ATOM   4939 C  CB  . GLN E 1 67  ? 68.81132 -2.80601  -44.69614 1.000 54.17528  ? 67  GLN A CB  1 
ATOM   4940 C  CG  . GLN E 1 67  ? 69.72318 -3.92188  -44.99172 1.000 59.09328  ? 67  GLN A CG  1 
ATOM   4941 C  CD  . GLN E 1 67  ? 69.09859 -5.24715  -44.70196 1.000 63.22108  ? 67  GLN A CD  1 
ATOM   4942 O  OE1 . GLN E 1 67  ? 68.22690 -5.71202  -45.44154 1.000 63.32610  ? 67  GLN A OE1 1 
ATOM   4943 N  NE2 . GLN E 1 67  ? 69.50872 -5.85695  -43.59595 1.000 65.58936  ? 67  GLN A NE2 1 
ATOM   4944 N  N   . PHE E 1 68  ? 70.07147 -3.40586  -41.49127 1.000 60.37259  ? 68  PHE A N   1 
ATOM   4945 C  CA  . PHE E 1 68  ? 71.29195 -3.44025  -40.69495 1.000 59.34455  ? 68  PHE A CA  1 
ATOM   4946 C  C   . PHE E 1 68  ? 72.18150 -4.54571  -41.24241 1.000 60.16223  ? 68  PHE A C   1 
ATOM   4947 O  O   . PHE E 1 68  ? 71.74513 -5.69344  -41.35684 1.000 63.64969  ? 68  PHE A O   1 
ATOM   4948 C  CB  . PHE E 1 68  ? 70.96840 -3.68269  -39.22373 1.000 60.01359  ? 68  PHE A CB  1 
ATOM   4949 C  CG  . PHE E 1 68  ? 70.28919 -2.52844  -38.55877 1.000 61.46133  ? 68  PHE A CG  1 
ATOM   4950 C  CD1 . PHE E 1 68  ? 68.95012 -2.27960  -38.76646 1.000 62.20295  ? 68  PHE A CD1 1 
ATOM   4951 C  CD2 . PHE E 1 68  ? 70.99419 -1.69686  -37.71115 1.000 64.35877  ? 68  PHE A CD2 1 
ATOM   4952 C  CE1 . PHE E 1 68  ? 68.33113 -1.21217  -38.15606 1.000 64.22564  ? 68  PHE A CE1 1 
ATOM   4953 C  CE2 . PHE E 1 68  ? 70.38440 -0.63721  -37.09676 1.000 64.79138  ? 68  PHE A CE2 1 
ATOM   4954 C  CZ  . PHE E 1 68  ? 69.04909 -0.39221  -37.31764 1.000 64.72975  ? 68  PHE A CZ  1 
ATOM   4955 N  N   . PHE E 1 69  ? 73.38932 -4.19562  -41.62784 1.000 58.48356  ? 69  PHE A N   1 
ATOM   4956 C  CA  . PHE E 1 69  ? 74.29739 -5.16264  -42.21146 1.000 59.19958  ? 69  PHE A CA  1 
ATOM   4957 C  C   . PHE E 1 69  ? 75.47234 -5.41006  -41.27258 1.000 65.26847  ? 69  PHE A C   1 
ATOM   4958 O  O   . PHE E 1 69  ? 75.94229 -4.47805  -40.61272 1.000 67.79295  ? 69  PHE A O   1 
ATOM   4959 C  CB  . PHE E 1 69  ? 74.85858 -4.67726  -43.55558 1.000 55.58162  ? 69  PHE A CB  1 
ATOM   4960 C  CG  . PHE E 1 69  ? 73.90076 -4.78687  -44.71401 1.000 53.52633  ? 69  PHE A CG  1 
ATOM   4961 C  CD1 . PHE E 1 69  ? 73.21390 -5.96455  -44.96472 1.000 53.60782  ? 69  PHE A CD1 1 
ATOM   4962 C  CD2 . PHE E 1 69  ? 73.70710 -3.70704  -45.57874 1.000 50.30925  ? 69  PHE A CD2 1 
ATOM   4963 C  CE1 . PHE E 1 69  ? 72.34160 -6.06363  -46.04640 1.000 52.17038  ? 69  PHE A CE1 1 
ATOM   4964 C  CE2 . PHE E 1 69  ? 72.83327 -3.79813  -46.66586 1.000 47.84231  ? 69  PHE A CE2 1 
ATOM   4965 C  CZ  . PHE E 1 69  ? 72.15811 -4.97937  -46.89917 1.000 51.41735  ? 69  PHE A CZ  1 
ATOM   4966 N  N   . PRO E 1 70  ? 76.02095 -6.62467  -41.22869 1.000 67.18807  ? 70  PRO A N   1 
ATOM   4967 C  CA  . PRO E 1 70  ? 77.31905 -6.79310  -40.56576 1.000 68.97688  ? 70  PRO A CA  1 
ATOM   4968 C  C   . PRO E 1 70  ? 78.38867 -6.03593  -41.34194 1.000 73.14759  ? 70  PRO A C   1 
ATOM   4969 O  O   . PRO E 1 70  ? 78.58999 -6.27671  -42.53352 1.000 72.23249  ? 70  PRO A O   1 
ATOM   4970 C  CB  . PRO E 1 70  ? 77.54523 -8.30589  -40.61106 1.000 68.67102  ? 70  PRO A CB  1 
ATOM   4971 C  CG  . PRO E 1 70  ? 76.73543 -8.76916  -41.76978 1.000 67.81066  ? 70  PRO A CG  1 
ATOM   4972 C  CD  . PRO E 1 70  ? 75.51787 -7.89143  -41.78152 1.000 66.89246  ? 70  PRO A CD  1 
ATOM   4973 N  N   . ALA E 1 71  ? 79.07910 -5.11440  -40.65523 1.000 76.15130  ? 71  ALA A N   1 
ATOM   4974 C  CA  . ALA E 1 71  ? 80.04520 -4.24442  -41.32693 1.000 76.03165  ? 71  ALA A CA  1 
ATOM   4975 C  C   . ALA E 1 71  ? 81.19608 -5.03199  -41.93295 1.000 77.75777  ? 71  ALA A C   1 
ATOM   4976 O  O   . ALA E 1 71  ? 81.73270 -4.64306  -42.97522 1.000 79.38695  ? 71  ALA A O   1 
ATOM   4977 C  CB  . ALA E 1 71  ? 80.57831 -3.18998  -40.35863 1.000 75.45546  ? 71  ALA A CB  1 
ATOM   4978 N  N   . SER E 1 72  ? 81.59000 -6.13508  -41.30692 1.000 80.32909  ? 72  SER A N   1 
ATOM   4979 C  CA  . SER E 1 72  ? 82.70281 -6.91262  -41.83357 1.000 82.60740  ? 72  SER A CA  1 
ATOM   4980 C  C   . SER E 1 72  ? 82.34503 -7.65801  -43.11761 1.000 77.07821  ? 72  SER A C   1 
ATOM   4981 O  O   . SER E 1 72  ? 83.15932 -8.45099  -43.59614 1.000 77.53428  ? 72  SER A O   1 
ATOM   4982 C  CB  . SER E 1 72  ? 83.18894 -7.89343  -40.76337 1.000 87.90688  ? 72  SER A CB  1 
ATOM   4983 O  OG  . SER E 1 72  ? 84.30050 -8.64005  -41.21809 1.000 92.18149  ? 72  SER A OG  1 
ATOM   4984 N  N   . TRP E 1 73  ? 81.15754 -7.42269  -43.68381 1.000 73.23117  ? 73  TRP A N   1 
ATOM   4985 C  CA  . TRP E 1 73  ? 80.69476 -8.12204  -44.87555 1.000 72.70496  ? 73  TRP A CA  1 
ATOM   4986 C  C   . TRP E 1 73  ? 80.07431 -7.19502  -45.91012 1.000 69.35813  ? 73  TRP A C   1 
ATOM   4987 O  O   . TRP E 1 73  ? 79.66974 -7.67066  -46.97714 1.000 66.79697  ? 73  TRP A O   1 
ATOM   4988 C  CB  . TRP E 1 73  ? 79.65492 -9.19865  -44.51261 1.000 77.02148  ? 73  TRP A CB  1 
ATOM   4989 C  CG  . TRP E 1 73  ? 80.20249 -10.40918 -43.80240 1.000 83.63209  ? 73  TRP A CG  1 
ATOM   4990 C  CD1 . TRP E 1 73  ? 80.53419 -10.50356 -42.48571 1.000 85.74222  ? 73  TRP A CD1 1 
ATOM   4991 C  CD2 . TRP E 1 73  ? 80.44341 -11.70719 -44.36809 1.000 86.72000  ? 73  TRP A CD2 1 
ATOM   4992 N  NE1 . TRP E 1 73  ? 80.97983 -11.77039 -42.19761 1.000 86.83915  ? 73  TRP A NE1 1 
ATOM   4993 C  CE2 . TRP E 1 73  ? 80.93567 -12.52729 -43.33688 1.000 86.85384  ? 73  TRP A CE2 1 
ATOM   4994 C  CE3 . TRP E 1 73  ? 80.30147 -12.24947 -45.64758 1.000 89.40307  ? 73  TRP A CE3 1 
ATOM   4995 C  CZ2 . TRP E 1 73  ? 81.28291 -13.85891 -43.54265 1.000 88.82621  ? 73  TRP A CZ2 1 
ATOM   4996 C  CZ3 . TRP E 1 73  ? 80.64628 -13.57963 -45.84992 1.000 91.53226  ? 73  TRP A CZ3 1 
ATOM   4997 C  CH2 . TRP E 1 73  ? 81.13159 -14.36507 -44.80242 1.000 89.80755  ? 73  TRP A CH2 1 
ATOM   4998 N  N   . GLN E 1 74  ? 79.97667 -5.89925  -45.62352 1.000 86.51576  ? 74  GLN A N   1 
ATOM   4999 C  CA  . GLN E 1 74  ? 79.24073 -4.95982  -46.45618 1.000 84.74943  ? 74  GLN A CA  1 
ATOM   5000 C  C   . GLN E 1 74  ? 79.73323 -3.55583  -46.14127 1.000 84.82643  ? 74  GLN A C   1 
ATOM   5001 O  O   . GLN E 1 74  ? 80.11589 -3.26522  -45.00402 1.000 85.86367  ? 74  GLN A O   1 
ATOM   5002 C  CB  . GLN E 1 74  ? 77.73261 -5.05966  -46.20967 1.000 84.65305  ? 74  GLN A CB  1 
ATOM   5003 C  CG  . GLN E 1 74  ? 76.90444 -4.28317  -47.19534 1.000 85.29379  ? 74  GLN A CG  1 
ATOM   5004 C  CD  . GLN E 1 74  ? 77.01666 -4.82462  -48.59898 1.000 83.57930  ? 74  GLN A CD  1 
ATOM   5005 O  OE1 . GLN E 1 74  ? 76.94227 -6.02904  -48.81037 1.000 81.97109  ? 74  GLN A OE1 1 
ATOM   5006 N  NE2 . GLN E 1 74  ? 77.22697 -3.93995  -49.56637 1.000 85.83153  ? 74  GLN A NE2 1 
ATOM   5007 N  N   . GLY E 1 75  ? 79.69895 -2.68104  -47.15551 1.000 83.60052  ? 75  GLY A N   1 
ATOM   5008 C  CA  . GLY E 1 75  ? 80.18342 -1.32618  -46.99400 1.000 87.92617  ? 75  GLY A CA  1 
ATOM   5009 C  C   . GLY E 1 75  ? 79.31587 -0.32297  -47.72984 1.000 90.28729  ? 75  GLY A C   1 
ATOM   5010 O  O   . GLY E 1 75  ? 78.36538 -0.68119  -48.43135 1.000 90.22355  ? 75  GLY A O   1 
ATOM   5011 N  N   . GLU E 1 76  ? 79.61825 0.95323   -47.50011 1.000 93.88793  ? 76  GLU A N   1 
ATOM   5012 C  CA  . GLU E 1 76  ? 78.94027 2.02793   -48.20752 1.000 96.07607  ? 76  GLU A CA  1 
ATOM   5013 C  C   . GLU E 1 76  ? 79.84129 3.25693   -48.24196 1.000 99.83192  ? 76  GLU A C   1 
ATOM   5014 O  O   . GLU E 1 76  ? 80.85567 3.32622   -47.54585 1.000 105.15547 ? 76  GLU A O   1 
ATOM   5015 C  CB  . GLU E 1 76  ? 77.57403 2.30915   -47.57428 1.000 100.44545 ? 76  GLU A CB  1 
ATOM   5016 C  CG  . GLU E 1 76  ? 76.68758 3.26370   -48.36584 1.000 104.47013 ? 76  GLU A CG  1 
ATOM   5017 C  CD  . GLU E 1 76  ? 76.50859 2.85374   -49.82163 1.000 104.88838 ? 76  GLU A CD  1 
ATOM   5018 O  OE1 . GLU E 1 76  ? 76.72226 1.67060   -50.16434 1.000 104.82600 ? 76  GLU A OE1 1 
ATOM   5019 O  OE2 . GLU E 1 76  ? 76.16485 3.73168   -50.63805 1.000 107.02509 ? 76  GLU A OE2 1 
ATOM   5020 N  N   . GLN E 1 77  ? 79.44693 4.23811   -49.06089 1.000 95.50650  ? 77  GLN A N   1 
ATOM   5021 C  CA  . GLN E 1 77  ? 80.30011 5.39382   -49.32112 1.000 96.79182  ? 77  GLN A CA  1 
ATOM   5022 C  C   . GLN E 1 77  ? 80.67958 6.11779   -48.03597 1.000 97.88266  ? 77  GLN A C   1 
ATOM   5023 O  O   . GLN E 1 77  ? 81.86878 6.31733   -47.75265 1.000 96.91007  ? 77  GLN A O   1 
ATOM   5024 C  CB  . GLN E 1 77  ? 79.61753 6.35062   -50.30263 1.000 96.74097  ? 77  GLN A CB  1 
ATOM   5025 C  CG  . GLN E 1 77  ? 79.81056 5.99729   -51.77129 1.000 94.45299  ? 77  GLN A CG  1 
ATOM   5026 C  CD  . GLN E 1 77  ? 81.18034 6.42706   -52.28728 1.000 95.47927  ? 77  GLN A CD  1 
ATOM   5027 O  OE1 . GLN E 1 77  ? 81.39844 7.59653   -52.60608 1.000 96.62435  ? 77  GLN A OE1 1 
ATOM   5028 N  NE2 . GLN E 1 77  ? 82.11971 5.48774   -52.33370 1.000 94.42279  ? 77  GLN A NE2 1 
ATOM   5029 N  N   . ARG E 1 78  ? 79.68758 6.51906   -47.23788 1.000 100.20218 ? 78  ARG A N   1 
ATOM   5030 C  CA  . ARG E 1 78  ? 79.98635 7.38797   -46.10765 1.000 102.04834 ? 78  ARG A CA  1 
ATOM   5031 C  C   . ARG E 1 78  ? 79.39263 6.84282   -44.81199 1.000 101.55924 ? 78  ARG A C   1 
ATOM   5032 O  O   . ARG E 1 78  ? 79.14901 7.59783   -43.86842 1.000 102.61297 ? 78  ARG A O   1 
ATOM   5033 C  CB  . ARG E 1 78  ? 79.52357 8.82494   -46.38924 1.000 106.64787 ? 78  ARG A CB  1 
ATOM   5034 C  CG  . ARG E 1 78  ? 80.13944 9.81554   -45.42864 1.000 110.66836 ? 78  ARG A CG  1 
ATOM   5035 C  CD  . ARG E 1 78  ? 79.82501 11.25380  -45.70411 1.000 114.12820 ? 78  ARG A CD  1 
ATOM   5036 N  NE  . ARG E 1 78  ? 80.13195 12.02144  -44.50506 1.000 118.84419 ? 78  ARG A NE  1 
ATOM   5037 C  CZ  . ARG E 1 78  ? 80.02116 13.33480  -44.41248 1.000 124.48815 ? 78  ARG A CZ  1 
ATOM   5038 N  NH1 . ARG E 1 78  ? 79.60873 14.03644  -45.45820 1.000 125.09253 ? 78  ARG A NH1 1 
ATOM   5039 N  NH2 . ARG E 1 78  ? 80.31448 13.95018  -43.27392 1.000 130.00666 ? 78  ARG A NH2 1 
ATOM   5040 N  N   . GLN E 1 79  ? 79.10116 5.55449   -44.76012 1.000 100.93116 ? 79  GLN A N   1 
ATOM   5041 C  CA  . GLN E 1 79  ? 78.58539 4.95785   -43.53911 1.000 103.35034 ? 79  GLN A CA  1 
ATOM   5042 C  C   . GLN E 1 79  ? 79.73526 4.47456   -42.65893 1.000 100.02167 ? 79  GLN A C   1 
ATOM   5043 O  O   . GLN E 1 79  ? 80.70647 3.89085   -43.14869 1.000 96.80425  ? 79  GLN A O   1 
ATOM   5044 C  CB  . GLN E 1 79  ? 77.61422 3.82178   -43.87600 1.000 107.02199 ? 79  GLN A CB  1 
ATOM   5045 C  CG  . GLN E 1 79  ? 76.38996 4.32580   -44.65718 1.000 108.92724 ? 79  GLN A CG  1 
ATOM   5046 C  CD  . GLN E 1 79  ? 75.62513 5.42789   -43.92031 1.000 114.69284 ? 79  GLN A CD  1 
ATOM   5047 O  OE1 . GLN E 1 79  ? 75.47999 5.39307   -42.69605 1.000 118.98149 ? 79  GLN A OE1 1 
ATOM   5048 N  NE2 . GLN E 1 79  ? 75.14423 6.41631   -44.66972 1.000 114.77928 ? 79  GLN A NE2 1 
ATOM   5049 N  N   . THR E 1 80  ? 79.63705 4.76150   -41.35889 1.000 99.69952  ? 80  THR A N   1 
ATOM   5050 C  CA  . THR E 1 80  ? 80.71699 4.48849   -40.40982 1.000 100.77402 ? 80  THR A CA  1 
ATOM   5051 C  C   . THR E 1 80  ? 80.32194 3.35379   -39.47080 1.000 98.31099  ? 80  THR A C   1 
ATOM   5052 O  O   . THR E 1 80  ? 79.28985 3.45907   -38.78992 1.000 100.06584 ? 80  THR A O   1 
ATOM   5053 C  CB  . THR E 1 80  ? 81.05731 5.75045   -39.60685 1.000 102.80699 ? 80  THR A CB  1 
ATOM   5054 O  OG1 . THR E 1 80  ? 79.97078 6.08618   -38.73549 1.000 103.12067 ? 80  THR A OG1 1 
ATOM   5055 C  CG2 . THR E 1 80  ? 81.31207 6.92918   -40.54739 1.000 103.26149 ? 80  THR A CG2 1 
ATOM   5056 N  N   . PRO E 1 81  ? 81.09704 2.26957   -39.38315 1.000 94.68291  ? 81  PRO A N   1 
ATOM   5057 C  CA  . PRO E 1 81  ? 80.68717 1.13403   -38.54174 1.000 93.03767  ? 81  PRO A CA  1 
ATOM   5058 C  C   . PRO E 1 81  ? 80.74833 1.44446   -37.05408 1.000 96.68167  ? 81  PRO A C   1 
ATOM   5059 O  O   . PRO E 1 81  ? 81.64469 2.14130   -36.57487 1.000 101.90664 ? 81  PRO A O   1 
ATOM   5060 C  CB  . PRO E 1 81  ? 81.68876 0.03212   -38.92024 1.000 89.30559  ? 81  PRO A CB  1 
ATOM   5061 C  CG  . PRO E 1 81  ? 82.17666 0.41579   -40.27309 1.000 88.50894  ? 81  PRO A CG  1 
ATOM   5062 C  CD  . PRO E 1 81  ? 82.23457 1.91883   -40.24802 1.000 92.45218  ? 81  PRO A CD  1 
ATOM   5063 N  N   . SER E 1 82  ? 79.77222 0.91425   -36.32458 1.000 96.57539  ? 82  SER A N   1 
ATOM   5064 C  CA  . SER E 1 82  ? 79.72778 1.04538   -34.87824 1.000 101.32909 ? 82  SER A CA  1 
ATOM   5065 C  C   . SER E 1 82  ? 79.10445 -0.21153  -34.29105 1.000 104.30668 ? 82  SER A C   1 
ATOM   5066 O  O   . SER E 1 82  ? 78.25392 -0.85044  -34.91596 1.000 100.63421 ? 82  SER A O   1 
ATOM   5067 C  CB  . SER E 1 82  ? 78.93835 2.29560   -34.45462 1.000 103.17945 ? 82  SER A CB  1 
ATOM   5068 O  OG  . SER E 1 82  ? 78.69576 2.32386   -33.05779 1.000 105.09916 ? 82  SER A OG  1 
ATOM   5069 N  N   . ARG E 1 83  ? 79.51618 -0.54617  -33.07273 1.000 111.28889 ? 83  ARG A N   1 
ATOM   5070 C  CA  . ARG E 1 83  ? 78.98746 -1.71493  -32.38889 1.000 116.99330 ? 83  ARG A CA  1 
ATOM   5071 C  C   . ARG E 1 83  ? 77.68679 -1.40626  -31.66466 1.000 123.66472 ? 83  ARG A C   1 
ATOM   5072 O  O   . ARG E 1 83  ? 77.10771 -2.30953  -31.05073 1.000 124.66089 ? 83  ARG A O   1 
ATOM   5073 C  CB  . ARG E 1 83  ? 79.99993 -2.27019  -31.38404 1.000 120.70491 ? 83  ARG A CB  1 
ATOM   5074 C  CG  . ARG E 1 83  ? 80.28244 -1.34109  -30.21894 1.000 127.56237 ? 83  ARG A CG  1 
ATOM   5075 C  CD  . ARG E 1 83  ? 81.33993 -1.90785  -29.28463 1.000 132.70033 ? 83  ARG A CD  1 
ATOM   5076 N  NE  . ARG E 1 83  ? 81.44452 -1.11701  -28.06139 1.000 139.65321 ? 83  ARG A NE  1 
ATOM   5077 C  CZ  . ARG E 1 83  ? 80.57991 -1.18144  -27.05327 1.000 145.27246 ? 83  ARG A CZ  1 
ATOM   5078 N  NH1 . ARG E 1 83  ? 80.75211 -0.42200  -25.98073 1.000 153.50978 ? 83  ARG A NH1 1 
ATOM   5079 N  NH2 . ARG E 1 83  ? 79.53945 -2.00221  -27.11762 1.000 142.54115 ? 83  ARG A NH2 1 
ATOM   5080 N  N   . GLU E 1 84  ? 77.20991 -0.16184  -31.73506 1.000 99.42704  ? 84  GLU A N   1 
ATOM   5081 C  CA  . GLU E 1 84  ? 76.06890 0.28837   -30.95235 1.000 104.80513 ? 84  GLU A CA  1 
ATOM   5082 C  C   . GLU E 1 84  ? 74.79917 0.45650   -31.76934 1.000 98.03569  ? 84  GLU A C   1 
ATOM   5083 O  O   . GLU E 1 84  ? 73.76722 0.82943   -31.19899 1.000 97.97432  ? 84  GLU A O   1 
ATOM   5084 C  CB  . GLU E 1 84  ? 76.38199 1.63503   -30.28461 1.000 118.39072 ? 84  GLU A CB  1 
ATOM   5085 C  CG  . GLU E 1 84  ? 75.65843 1.87294   -28.96406 1.000 131.79583 ? 84  GLU A CG  1 
ATOM   5086 C  CD  . GLU E 1 84  ? 75.86624 3.27750   -28.42698 1.000 137.66171 ? 84  GLU A CD  1 
ATOM   5087 O  OE1 . GLU E 1 84  ? 75.13277 3.66967   -27.49207 1.000 139.68666 ? 84  GLU A OE1 1 
ATOM   5088 O  OE2 . GLU E 1 84  ? 76.74520 3.99495   -28.95401 1.000 139.47336 ? 84  GLU A OE2 1 
ATOM   5089 N  N   . TYR E 1 85  ? 74.82695 0.17306   -33.07677 1.000 91.50707  ? 85  TYR A N   1 
ATOM   5090 C  CA  . TYR E 1 85  ? 73.60497 0.32861   -33.86056 1.000 84.26161  ? 85  TYR A CA  1 
ATOM   5091 C  C   . TYR E 1 85  ? 72.58541 -0.73097  -33.47195 1.000 84.62261  ? 85  TYR A C   1 
ATOM   5092 O  O   . TYR E 1 85  ? 71.37691 -0.48300  -33.53975 1.000 84.17004  ? 85  TYR A O   1 
ATOM   5093 C  CB  . TYR E 1 85  ? 73.91269 0.28174   -35.36711 1.000 79.58821  ? 85  TYR A CB  1 
ATOM   5094 C  CG  . TYR E 1 85  ? 74.76418 1.44391   -35.84837 1.000 75.00457  ? 85  TYR A CG  1 
ATOM   5095 C  CD1 . TYR E 1 85  ? 74.77104 2.64631   -35.15645 1.000 74.63867  ? 85  TYR A CD1 1 
ATOM   5096 C  CD2 . TYR E 1 85  ? 75.56097 1.34375   -36.99077 1.000 69.56044  ? 85  TYR A CD2 1 
ATOM   5097 C  CE1 . TYR E 1 85  ? 75.54856 3.69790   -35.56112 1.000 70.73313  ? 85  TYR A CE1 1 
ATOM   5098 C  CE2 . TYR E 1 85  ? 76.34465 2.41228   -37.40998 1.000 65.31749  ? 85  TYR A CE2 1 
ATOM   5099 C  CZ  . TYR E 1 85  ? 76.32482 3.58610   -36.68718 1.000 66.68157  ? 85  TYR A CZ  1 
ATOM   5100 O  OH  . TYR E 1 85  ? 77.08677 4.66357   -37.06858 1.000 66.03077  ? 85  TYR A OH  1 
ATOM   5101 N  N   . VAL E 1 86  ? 73.05602 -1.89852  -33.03400 1.000 84.72237  ? 86  VAL A N   1 
ATOM   5102 C  CA  . VAL E 1 86  ? 72.20916 -2.96719  -32.51560 1.000 87.57961  ? 86  VAL A CA  1 
ATOM   5103 C  C   . VAL E 1 86  ? 72.78081 -3.39313  -31.16915 1.000 94.80316  ? 86  VAL A C   1 
ATOM   5104 O  O   . VAL E 1 86  ? 73.90198 -3.91492  -31.10691 1.000 96.95602  ? 86  VAL A O   1 
ATOM   5105 C  CB  . VAL E 1 86  ? 72.14235 -4.17091  -33.46968 1.000 80.92792  ? 86  VAL A CB  1 
ATOM   5106 C  CG1 . VAL E 1 86  ? 71.20074 -5.21117  -32.91600 1.000 81.59479  ? 86  VAL A CG1 1 
ATOM   5107 C  CG2 . VAL E 1 86  ? 71.71551 -3.74508  -34.84613 1.000 77.75319  ? 86  VAL A CG2 1 
ATOM   5108 N  N   . ASP E 1 87  ? 72.02073 -3.18499  -30.09703 1.000 100.55486 ? 87  ASP A N   1 
ATOM   5109 C  CA  . ASP E 1 87  ? 72.49634 -3.50712  -28.75707 1.000 110.74582 ? 87  ASP A CA  1 
ATOM   5110 C  C   . ASP E 1 87  ? 71.44630 -4.35116  -28.05317 1.000 112.29763 ? 87  ASP A C   1 
ATOM   5111 O  O   . ASP E 1 87  ? 70.31100 -3.90302  -27.85738 1.000 113.47321 ? 87  ASP A O   1 
ATOM   5112 C  CB  . ASP E 1 87  ? 72.81315 -2.25385  -27.94071 1.000 120.98139 ? 87  ASP A CB  1 
ATOM   5113 C  CG  . ASP E 1 87  ? 73.50421 -2.58761  -26.63355 1.000 133.36686 ? 87  ASP A CG  1 
ATOM   5114 O  OD1 . ASP E 1 87  ? 73.91056 -3.76032  -26.47161 1.000 136.41404 ? 87  ASP A OD1 1 
ATOM   5115 O  OD2 . ASP E 1 87  ? 73.64959 -1.69324  -25.77355 1.000 138.88355 ? 87  ASP A OD2 1 
ATOM   5116 N  N   . LEU E 1 88  ? 71.83717 -5.56245  -27.65814 1.000 112.05762 ? 88  LEU A N   1 
ATOM   5117 C  CA  . LEU E 1 88  ? 70.94665 -6.49729  -26.99001 1.000 111.85878 ? 88  LEU A CA  1 
ATOM   5118 C  C   . LEU E 1 88  ? 71.13405 -6.52323  -25.48003 1.000 117.55404 ? 88  LEU A C   1 
ATOM   5119 O  O   . LEU E 1 88  ? 70.20543 -6.91257  -24.76035 1.000 118.70109 ? 88  LEU A O   1 
ATOM   5120 C  CB  . LEU E 1 88  ? 71.17941 -7.90595  -27.54318 1.000 106.03223 ? 88  LEU A CB  1 
ATOM   5121 C  CG  . LEU E 1 88  ? 70.60871 -8.25312  -28.91116 1.000 100.31954 ? 88  LEU A CG  1 
ATOM   5122 C  CD1 . LEU E 1 88  ? 71.54662 -9.21756  -29.58842 1.000 97.56752  ? 88  LEU A CD1 1 
ATOM   5123 C  CD2 . LEU E 1 88  ? 69.24518 -8.89584  -28.75829 1.000 100.50337 ? 88  LEU A CD2 1 
ATOM   5124 N  N   . GLU E 1 89  ? 72.30208 -6.10458  -24.99063 1.000 120.44176 ? 89  GLU A N   1 
ATOM   5125 C  CA  . GLU E 1 89  ? 72.64630 -6.19000  -23.57863 1.000 125.92566 ? 89  GLU A CA  1 
ATOM   5126 C  C   . GLU E 1 89  ? 72.05389 -5.06410  -22.74316 1.000 130.32992 ? 89  GLU A C   1 
ATOM   5127 O  O   . GLU E 1 89  ? 72.20621 -5.08588  -21.51582 1.000 131.89868 ? 89  GLU A O   1 
ATOM   5128 C  CB  . GLU E 1 89  ? 74.16840 -6.18989  -23.41979 1.000 130.21656 ? 89  GLU A CB  1 
ATOM   5129 C  CG  . GLU E 1 89  ? 74.89029 -7.03239  -24.45847 1.000 131.86166 ? 89  GLU A CG  1 
ATOM   5130 C  CD  . GLU E 1 89  ? 76.39479 -7.00108  -24.29120 1.000 133.66170 ? 89  GLU A CD  1 
ATOM   5131 O  OE1 . GLU E 1 89  ? 76.99597 -8.08019  -24.10551 1.000 135.92414 ? 89  GLU A OE1 1 
ATOM   5132 O  OE2 . GLU E 1 89  ? 76.97488 -5.89648  -24.34125 1.000 132.78247 ? 89  GLU A OE2 1 
ATOM   5133 N  N   . ARG E 1 90  ? 71.38990 -4.08737  -23.36570 1.000 132.56735 ? 90  ARG A N   1 
ATOM   5134 C  CA  . ARG E 1 90  ? 70.86483 -2.95435  -22.60988 1.000 136.79711 ? 90  ARG A CA  1 
ATOM   5135 C  C   . ARG E 1 90  ? 69.72981 -3.39546  -21.68945 1.000 141.14326 ? 90  ARG A C   1 
ATOM   5136 O  O   . ARG E 1 90  ? 69.79691 -3.21690  -20.46780 1.000 144.53762 ? 90  ARG A O   1 
ATOM   5137 C  CB  . ARG E 1 90  ? 70.39759 -1.85769  -23.57249 1.000 133.86326 ? 90  ARG A CB  1 
ATOM   5138 C  CG  . ARG E 1 90  ? 69.86076 -0.60656  -22.88294 1.000 132.88637 ? 90  ARG A CG  1 
ATOM   5139 C  CD  . ARG E 1 90  ? 68.80909 0.08998   -23.72989 1.000 130.12571 ? 90  ARG A CD  1 
ATOM   5140 N  NE  . ARG E 1 90  ? 68.63238 1.49363   -23.37349 1.000 129.93855 ? 90  ARG A NE  1 
ATOM   5141 C  CZ  . ARG E 1 90  ? 69.02051 2.50738   -24.14205 1.000 130.03219 ? 90  ARG A CZ  1 
ATOM   5142 N  NH1 . ARG E 1 90  ? 68.82457 3.75821   -23.74855 1.000 132.43159 ? 90  ARG A NH1 1 
ATOM   5143 N  NH2 . ARG E 1 90  ? 69.59847 2.26847   -25.31316 1.000 127.42463 ? 90  ARG A NH2 1 
ATOM   5144 N  N   . GLU E 1 91  ? 68.67827 -3.97992  -22.26353 1.000 140.37812 ? 91  GLU A N   1 
ATOM   5145 C  CA  . GLU E 1 91  ? 67.51022 -4.44344  -21.52343 1.000 144.79304 ? 91  GLU A CA  1 
ATOM   5146 C  C   . GLU E 1 91  ? 67.20991 -5.88209  -21.92383 1.000 146.01397 ? 91  GLU A C   1 
ATOM   5147 O  O   . GLU E 1 91  ? 67.15995 -6.19697  -23.11698 1.000 147.01955 ? 91  GLU A O   1 
ATOM   5148 C  CB  . GLU E 1 91  ? 66.29496 -3.53992  -21.77433 1.000 146.57109 ? 91  GLU A CB  1 
ATOM   5149 C  CG  . GLU E 1 91  ? 65.08462 -3.87207  -20.91201 1.000 149.19822 ? 91  GLU A CG  1 
ATOM   5150 C  CD  . GLU E 1 91  ? 64.01008 -2.79720  -20.95753 1.000 151.15716 ? 91  GLU A CD  1 
ATOM   5151 O  OE1 . GLU E 1 91  ? 64.26150 -1.71687  -21.53362 1.000 151.84683 ? 91  GLU A OE1 1 
ATOM   5152 O  OE2 . GLU E 1 91  ? 62.91376 -3.02998  -20.40707 1.000 153.44914 ? 91  GLU A OE2 1 
ATOM   5153 N  N   . ALA E 1 92  ? 67.01926 -6.75082  -20.92942 1.000 143.00610 ? 92  ALA A N   1 
ATOM   5154 C  CA  . ALA E 1 92  ? 66.74147 -8.16019  -21.18873 1.000 136.67081 ? 92  ALA A CA  1 
ATOM   5155 C  C   . ALA E 1 92  ? 65.35768 -8.32875  -21.81165 1.000 132.13823 ? 92  ALA A C   1 
ATOM   5156 O  O   . ALA E 1 92  ? 64.37370 -7.75288  -21.33512 1.000 133.33470 ? 92  ALA A O   1 
ATOM   5157 C  CB  . ALA E 1 92  ? 66.85045 -8.96571  -19.89571 1.000 137.39510 ? 92  ALA A CB  1 
ATOM   5158 N  N   . GLY E 1 93  ? 65.28855 -9.11370  -22.89084 1.000 125.03895 ? 93  GLY A N   1 
ATOM   5159 C  CA  . GLY E 1 93  ? 64.05261 -9.35957  -23.60830 1.000 120.82721 ? 93  GLY A CA  1 
ATOM   5160 C  C   . GLY E 1 93  ? 63.78714 -8.43313  -24.78229 1.000 116.14511 ? 93  GLY A C   1 
ATOM   5161 O  O   . GLY E 1 93  ? 62.93388 -8.74878  -25.62258 1.000 116.94302 ? 93  GLY A O   1 
ATOM   5162 N  N   . LYS E 1 94  ? 64.50766 -7.32441  -24.89168 1.000 110.71043 ? 94  LYS A N   1 
ATOM   5163 C  CA  . LYS E 1 94  ? 64.38311 -6.41423  -26.01681 1.000 101.58649 ? 94  LYS A CA  1 
ATOM   5164 C  C   . LYS E 1 94  ? 65.73099 -6.26964  -26.69981 1.000 96.79184  ? 94  LYS A C   1 
ATOM   5165 O  O   . LYS E 1 94  ? 66.75964 -6.74835  -26.21563 1.000 96.02150  ? 94  LYS A O   1 
ATOM   5166 C  CB  . LYS E 1 94  ? 63.87529 -5.02356  -25.60733 1.000 101.45643 ? 94  LYS A CB  1 
ATOM   5167 C  CG  . LYS E 1 94  ? 62.46331 -4.97356  -25.06133 1.000 102.91522 ? 94  LYS A CG  1 
ATOM   5168 C  CD  . LYS E 1 94  ? 62.03700 -3.52695  -24.85951 1.000 103.52144 ? 94  LYS A CD  1 
ATOM   5169 C  CE  . LYS E 1 94  ? 60.61531 -3.39536  -24.33490 1.000 104.04667 ? 94  LYS A CE  1 
ATOM   5170 N  NZ  . LYS E 1 94  ? 60.26642 -1.95180  -24.16899 1.000 104.13158 ? 94  LYS A NZ  1 
ATOM   5171 N  N   . VAL E 1 95  ? 65.70125 -5.60109  -27.84976 1.000 92.87683  ? 95  VAL A N   1 
ATOM   5172 C  CA  . VAL E 1 95  ? 66.90731 -5.20512  -28.56532 1.000 89.70801  ? 95  VAL A CA  1 
ATOM   5173 C  C   . VAL E 1 95  ? 66.70058 -3.76655  -29.00721 1.000 88.28427  ? 95  VAL A C   1 
ATOM   5174 O  O   . VAL E 1 95  ? 65.70711 -3.45509  -29.67164 1.000 84.90743  ? 95  VAL A O   1 
ATOM   5175 C  CB  . VAL E 1 95  ? 67.22527 -6.10830  -29.77448 1.000 88.00936  ? 95  VAL A CB  1 
ATOM   5176 C  CG1 . VAL E 1 95  ? 65.98913 -6.38660  -30.60815 1.000 87.26977  ? 95  VAL A CG1 1 
ATOM   5177 C  CG2 . VAL E 1 95  ? 68.29621 -5.46451  -30.63502 1.000 85.69597  ? 95  VAL A CG2 1 
ATOM   5178 N  N   . TYR E 1 96  ? 67.60770 -2.88631  -28.60368 1.000 92.14695  ? 96  TYR A N   1 
ATOM   5179 C  CA  . TYR E 1 96  ? 67.51521 -1.47806  -28.94683 1.000 97.13874  ? 96  TYR A CA  1 
ATOM   5180 C  C   . TYR E 1 96  ? 68.34099 -1.21108  -30.20140 1.000 95.66114  ? 96  TYR A C   1 
ATOM   5181 O  O   . TYR E 1 96  ? 69.34207 -1.88251  -30.45961 1.000 97.35728  ? 96  TYR A O   1 
ATOM   5182 C  CB  . TYR E 1 96  ? 67.99041 -0.61928  -27.76882 1.000 103.04282 ? 96  TYR A CB  1 
ATOM   5183 C  CG  . TYR E 1 96  ? 66.94194 -0.49167  -26.68107 1.000 107.70259 ? 96  TYR A CG  1 
ATOM   5184 C  CD1 . TYR E 1 96  ? 66.68945 -1.54223  -25.80641 1.000 110.32355 ? 96  TYR A CD1 1 
ATOM   5185 C  CD2 . TYR E 1 96  ? 66.18202 0.66519   -26.54986 1.000 109.90853 ? 96  TYR A CD2 1 
ATOM   5186 C  CE1 . TYR E 1 96  ? 65.72425 -1.43744  -24.81941 1.000 114.71181 ? 96  TYR A CE1 1 
ATOM   5187 C  CE2 . TYR E 1 96  ? 65.21392 0.77978   -25.57076 1.000 113.99089 ? 96  TYR A CE2 1 
ATOM   5188 C  CZ  . TYR E 1 96  ? 64.98884 -0.27426  -24.70755 1.000 118.50059 ? 96  TYR A CZ  1 
ATOM   5189 O  OH  . TYR E 1 96  ? 64.02558 -0.16612  -23.72932 1.000 125.89561 ? 96  TYR A OH  1 
ATOM   5190 N  N   . LEU E 1 97  ? 67.90818 -0.22931  -30.99240 1.000 92.65591  ? 97  LEU A N   1 
ATOM   5191 C  CA  . LEU E 1 97  ? 68.49085 0.01102   -32.30661 1.000 86.68930  ? 97  LEU A CA  1 
ATOM   5192 C  C   . LEU E 1 97  ? 68.81461 1.48753   -32.47223 1.000 86.74189  ? 97  LEU A C   1 
ATOM   5193 O  O   . LEU E 1 97  ? 68.07228 2.35502   -32.00116 1.000 88.59224  ? 97  LEU A O   1 
ATOM   5194 C  CB  . LEU E 1 97  ? 67.53231 -0.42165  -33.41819 1.000 82.48976  ? 97  LEU A CB  1 
ATOM   5195 C  CG  . LEU E 1 97  ? 66.98371 -1.83948  -33.25628 1.000 80.75196  ? 97  LEU A CG  1 
ATOM   5196 C  CD1 . LEU E 1 97  ? 65.72652 -2.00799  -34.09335 1.000 78.66866  ? 97  LEU A CD1 1 
ATOM   5197 C  CD2 . LEU E 1 97  ? 68.01957 -2.91209  -33.58069 1.000 78.71271  ? 97  LEU A CD2 1 
ATOM   5198 N  N   . LYS E 1 98  ? 69.91526 1.76818   -33.16201 1.000 86.39425  ? 98  LYS A N   1 
ATOM   5199 C  CA  . LYS E 1 98  ? 70.34887 3.13732   -33.39887 1.000 87.03484  ? 98  LYS A CA  1 
ATOM   5200 C  C   . LYS E 1 98  ? 70.83243 3.23105   -34.83783 1.000 85.98410  ? 98  LYS A C   1 
ATOM   5201 O  O   . LYS E 1 98  ? 71.59273 2.36703   -35.29095 1.000 85.91971  ? 98  LYS A O   1 
ATOM   5202 C  CB  . LYS E 1 98  ? 71.45378 3.53789   -32.41287 1.000 88.97554  ? 98  LYS A CB  1 
ATOM   5203 C  CG  . LYS E 1 98  ? 71.95141 4.96381   -32.51884 1.000 90.80527  ? 98  LYS A CG  1 
ATOM   5204 C  CD  . LYS E 1 98  ? 73.11645 5.17594   -31.57280 1.000 95.18750  ? 98  LYS A CD  1 
ATOM   5205 C  CE  . LYS E 1 98  ? 73.68858 6.57020   -31.66876 1.000 100.07636 ? 98  LYS A CE  1 
ATOM   5206 N  NZ  . LYS E 1 98  ? 74.88523 6.69303   -30.79802 1.000 107.04462 ? 98  LYS A NZ  1 
ATOM   5207 N  N   . ALA E 1 99  ? 70.39250 4.26595   -35.55391 1.000 83.24154  ? 99  ALA A N   1 
ATOM   5208 C  CA  . ALA E 1 99  ? 70.66471 4.39222   -36.98564 1.000 79.07684  ? 99  ALA A CA  1 
ATOM   5209 C  C   . ALA E 1 99  ? 70.86958 5.85439   -37.35852 1.000 79.33479  ? 99  ALA A C   1 
ATOM   5210 O  O   . ALA E 1 99  ? 69.89358 6.59053   -37.58264 1.000 82.03024  ? 99  ALA A O   1 
ATOM   5211 C  CB  . ALA E 1 99  ? 69.54247 3.78439   -37.82374 1.000 74.98068  ? 99  ALA A CB  1 
ATOM   5212 N  N   . PRO E 1 100 ? 72.10685 6.30203   -37.45536 1.000 78.40621  ? 100 PRO A N   1 
ATOM   5213 C  CA  . PRO E 1 100 ? 72.36681 7.63312   -38.00718 1.000 79.08944  ? 100 PRO A CA  1 
ATOM   5214 C  C   . PRO E 1 100 ? 72.43134 7.57658   -39.52788 1.000 76.98712  ? 100 PRO A C   1 
ATOM   5215 O  O   . PRO E 1 100 ? 73.10722 6.71021   -40.08368 1.000 75.31277  ? 100 PRO A O   1 
ATOM   5216 C  CB  . PRO E 1 100 ? 73.72937 8.00731   -37.41219 1.000 81.64295  ? 100 PRO A CB  1 
ATOM   5217 C  CG  . PRO E 1 100 ? 74.11511 6.85382   -36.49157 1.000 81.74893  ? 100 PRO A CG  1 
ATOM   5218 C  CD  . PRO E 1 100 ? 73.32398 5.67616   -36.93561 1.000 78.45375  ? 100 PRO A CD  1 
ATOM   5219 N  N   . MET E 1 101 ? 71.75171 8.50803   -40.19555 1.000 77.66150  ? 101 MET A N   1 
ATOM   5220 C  CA  . MET E 1 101 ? 71.69464 8.54999   -41.65347 1.000 73.28297  ? 101 MET A CA  1 
ATOM   5221 C  C   . MET E 1 101 ? 71.14384 9.91147   -42.06024 1.000 72.31945  ? 101 MET A C   1 
ATOM   5222 O  O   . MET E 1 101 ? 70.59181 10.64788  -41.23677 1.000 74.38474  ? 101 MET A O   1 
ATOM   5223 C  CB  . MET E 1 101 ? 70.82404 7.42470   -42.20066 1.000 71.80267  ? 101 MET A CB  1 
ATOM   5224 C  CG  . MET E 1 101 ? 69.55160 7.24542   -41.40918 1.000 70.44791  ? 101 MET A CG  1 
ATOM   5225 S  SD  . MET E 1 101 ? 68.68308 5.71214   -41.76135 1.000 66.60045  ? 101 MET A SD  1 
ATOM   5226 C  CE  . MET E 1 101 ? 67.15044 6.02631   -40.89648 1.000 66.38853  ? 101 MET A CE  1 
ATOM   5227 N  N   . ILE E 1 102 ? 71.30426 10.24584  -43.33671 1.000 67.39375  ? 102 ILE A N   1 
ATOM   5228 C  CA  . ILE E 1 102 ? 70.87198 11.53602  -43.86637 1.000 64.17357  ? 102 ILE A CA  1 
ATOM   5229 C  C   . ILE E 1 102 ? 69.76128 11.27588  -44.87372 1.000 61.89356  ? 102 ILE A C   1 
ATOM   5230 O  O   . ILE E 1 102 ? 69.99694 10.67185  -45.92921 1.000 62.90029  ? 102 ILE A O   1 
ATOM   5231 C  CB  . ILE E 1 102 ? 72.03072 12.30012  -44.50804 1.000 60.80033  ? 102 ILE A CB  1 
ATOM   5232 C  CG1 . ILE E 1 102 ? 73.22150 12.32584  -43.55619 1.000 63.12694  ? 102 ILE A CG1 1 
ATOM   5233 C  CG2 . ILE E 1 102 ? 71.60283 13.70435  -44.82415 1.000 62.34223  ? 102 ILE A CG2 1 
ATOM   5234 C  CD1 . ILE E 1 102 ? 74.42913 12.97598  -44.15170 1.000 65.16798  ? 102 ILE A CD1 1 
ATOM   5235 N  N   . LEU E 1 103 ? 68.55026 11.72962  -44.56319 1.000 60.53533  ? 103 LEU A N   1 
ATOM   5236 C  CA  . LEU E 1 103 ? 67.38003 11.47623  -45.39611 1.000 61.09372  ? 103 LEU A CA  1 
ATOM   5237 C  C   . LEU E 1 103 ? 66.96912 12.80529  -46.01203 1.000 65.30707  ? 103 LEU A C   1 
ATOM   5238 O  O   . LEU E 1 103 ? 66.67781 13.75735  -45.27987 1.000 73.04318  ? 103 LEU A O   1 
ATOM   5239 C  CB  . LEU E 1 103 ? 66.22556 10.88889  -44.58123 1.000 60.18850  ? 103 LEU A CB  1 
ATOM   5240 C  CG  . LEU E 1 103 ? 66.24984 9.49209   -43.94702 1.000 59.61988  ? 103 LEU A CG  1 
ATOM   5241 C  CD1 . LEU E 1 103 ? 67.53588 9.26362   -43.21080 1.000 60.36403  ? 103 LEU A CD1 1 
ATOM   5242 C  CD2 . LEU E 1 103 ? 65.09154 9.32039   -42.95763 1.000 60.66131  ? 103 LEU A CD2 1 
ATOM   5243 N  N   . ASN E 1 104 ? 67.01713 12.89456  -47.34074 1.000 62.30017  ? 104 ASN A N   1 
ATOM   5244 C  CA  . ASN E 1 104 ? 66.66923 14.12286  -48.05462 1.000 60.23607  ? 104 ASN A CA  1 
ATOM   5245 C  C   . ASN E 1 104 ? 67.40140 15.32376  -47.46385 1.000 60.94178  ? 104 ASN A C   1 
ATOM   5246 O  O   . ASN E 1 104 ? 66.79990 16.32585  -47.07694 1.000 62.51430  ? 104 ASN A O   1 
ATOM   5247 C  CB  . ASN E 1 104 ? 65.16391 14.35465  -48.06485 1.000 61.58210  ? 104 ASN A CB  1 
ATOM   5248 C  CG  . ASN E 1 104 ? 64.44464 13.37996  -48.96292 1.000 61.66112  ? 104 ASN A CG  1 
ATOM   5249 O  OD1 . ASN E 1 104 ? 65.06909 12.67866  -49.76578 1.000 61.88992  ? 104 ASN A OD1 1 
ATOM   5250 N  ND2 . ASN E 1 104 ? 63.12693 13.33635  -48.85027 1.000 61.07354  ? 104 ASN A ND2 1 
ATOM   5251 N  N   . GLY E 1 105 ? 68.71564 15.18162  -47.32520 1.000 59.54694  ? 105 GLY A N   1 
ATOM   5252 C  CA  . GLY E 1 105 ? 69.54055 16.23792  -46.79478 1.000 60.02749  ? 105 GLY A CA  1 
ATOM   5253 C  C   . GLY E 1 105 ? 69.35394 16.54607  -45.33060 1.000 60.44948  ? 105 GLY A C   1 
ATOM   5254 O  O   . GLY E 1 105 ? 70.08769 17.39351  -44.80342 1.000 59.17164  ? 105 GLY A O   1 
ATOM   5255 N  N   . VAL E 1 106 ? 68.43395 15.86972  -44.64921 1.000 61.96006  ? 106 VAL A N   1 
ATOM   5256 C  CA  . VAL E 1 106 ? 68.15752 16.09047  -43.23317 1.000 69.20416  ? 106 VAL A CA  1 
ATOM   5257 C  C   . VAL E 1 106 ? 68.92960 15.04585  -42.44033 1.000 76.47134  ? 106 VAL A C   1 
ATOM   5258 O  O   . VAL E 1 106 ? 68.61278 13.85320  -42.50543 1.000 80.68248  ? 106 VAL A O   1 
ATOM   5259 C  CB  . VAL E 1 106 ? 66.65937 15.97597  -42.92893 1.000 68.34718  ? 106 VAL A CB  1 
ATOM   5260 C  CG1 . VAL E 1 106 ? 66.40074 16.28476  -41.46349 1.000 69.53044  ? 106 VAL A CG1 1 
ATOM   5261 C  CG2 . VAL E 1 106 ? 65.84944 16.87178  -43.85061 1.000 68.99863  ? 106 VAL A CG2 1 
ATOM   5262 N  N   . CYS E 1 107 ? 69.91147 15.46832  -41.65478 1.000 77.53068  ? 107 CYS A N   1 
ATOM   5263 C  CA  . CYS E 1 107 ? 70.63307 14.51414  -40.82477 1.000 77.15147  ? 107 CYS A CA  1 
ATOM   5264 C  C   . CYS E 1 107 ? 69.74605 14.06675  -39.66766 1.000 78.13562  ? 107 CYS A C   1 
ATOM   5265 O  O   . CYS E 1 107 ? 69.19896 14.90397  -38.94199 1.000 82.03813  ? 107 CYS A O   1 
ATOM   5266 C  CB  . CYS E 1 107 ? 71.92091 15.12925  -40.28356 1.000 81.17571  ? 107 CYS A CB  1 
ATOM   5267 S  SG  . CYS E 1 107 ? 73.02278 15.89521  -41.49517 1.000 84.10882  ? 107 CYS A SG  1 
ATOM   5268 N  N   . VAL E 1 108 ? 69.57117 12.75587  -39.49907 1.000 72.57347  ? 108 VAL A N   1 
ATOM   5269 C  CA  . VAL E 1 108 ? 68.76393 12.25424  -38.39618 1.000 70.63760  ? 108 VAL A CA  1 
ATOM   5270 C  C   . VAL E 1 108 ? 69.50255 11.14522  -37.66830 1.000 73.11002  ? 108 VAL A C   1 
ATOM   5271 O  O   . VAL E 1 108 ? 70.50203 10.59682  -38.14483 1.000 71.52755  ? 108 VAL A O   1 
ATOM   5272 C  CB  . VAL E 1 108 ? 67.39296 11.71698  -38.82684 1.000 65.57251  ? 108 VAL A CB  1 
ATOM   5273 C  CG1 . VAL E 1 108 ? 66.54294 12.81940  -39.39030 1.000 65.68513  ? 108 VAL A CG1 1 
ATOM   5274 C  CG2 . VAL E 1 108 ? 67.59019 10.60116  -39.82187 1.000 64.48645  ? 108 VAL A CG2 1 
ATOM   5275 N  N   . ILE E 1 109 ? 68.99662 10.83953  -36.47704 1.000 76.77189  ? 109 ILE A N   1 
ATOM   5276 C  CA  . ILE E 1 109 ? 69.34167 9.61795   -35.76766 1.000 78.89716  ? 109 ILE A CA  1 
ATOM   5277 C  C   . ILE E 1 109 ? 68.03458 8.91011   -35.45030 1.000 84.12905  ? 109 ILE A C   1 
ATOM   5278 O  O   . ILE E 1 109 ? 67.13177 9.49706   -34.84058 1.000 87.24204  ? 109 ILE A O   1 
ATOM   5279 C  CB  . ILE E 1 109 ? 70.15225 9.86425   -34.48227 1.000 76.63796  ? 109 ILE A CB  1 
ATOM   5280 C  CG1 . ILE E 1 109 ? 71.44027 10.61904  -34.79709 1.000 77.60818  ? 109 ILE A CG1 1 
ATOM   5281 C  CG2 . ILE E 1 109 ? 70.49146 8.53807   -33.84235 1.000 73.79276  ? 109 ILE A CG2 1 
ATOM   5282 C  CD1 . ILE E 1 109 ? 72.42657 10.67883  -33.63652 1.000 82.08155  ? 109 ILE A CD1 1 
ATOM   5283 N  N   . TRP E 1 110 ? 67.93061 7.65740   -35.86967 1.000 85.03203  ? 110 TRP A N   1 
ATOM   5284 C  CA  . TRP E 1 110 ? 66.72574 6.87251   -35.67905 1.000 85.67062  ? 110 TRP A CA  1 
ATOM   5285 C  C   . TRP E 1 110 ? 66.99960 5.84427   -34.59425 1.000 88.61563  ? 110 TRP A C   1 
ATOM   5286 O  O   . TRP E 1 110 ? 67.92578 5.03468   -34.71802 1.000 88.23117  ? 110 TRP A O   1 
ATOM   5287 C  CB  . TRP E 1 110 ? 66.32276 6.19187   -36.98247 1.000 85.79957  ? 110 TRP A CB  1 
ATOM   5288 C  CG  . TRP E 1 110 ? 64.95745 5.60705   -36.94866 1.000 91.40418  ? 110 TRP A CG  1 
ATOM   5289 C  CD1 . TRP E 1 110 ? 63.80220 6.18591   -37.39816 1.000 94.84848  ? 110 TRP A CD1 1 
ATOM   5290 C  CD2 . TRP E 1 110 ? 64.58746 4.33871   -36.40777 1.000 93.72163  ? 110 TRP A CD2 1 
ATOM   5291 N  NE1 . TRP E 1 110 ? 62.73662 5.34208   -37.18476 1.000 96.37171  ? 110 TRP A NE1 1 
ATOM   5292 C  CE2 . TRP E 1 110 ? 63.19350 4.20242   -36.57540 1.000 96.10549  ? 110 TRP A CE2 1 
ATOM   5293 C  CE3 . TRP E 1 110 ? 65.29901 3.30145   -35.80140 1.000 95.01309  ? 110 TRP A CE3 1 
ATOM   5294 C  CZ2 . TRP E 1 110 ? 62.50208 3.07133   -36.15816 1.000 98.39814  ? 110 TRP A CZ2 1 
ATOM   5295 C  CZ3 . TRP E 1 110 ? 64.61058 2.18153   -35.39002 1.000 97.83687  ? 110 TRP A CZ3 1 
ATOM   5296 C  CH2 . TRP E 1 110 ? 63.22717 2.07422   -35.56864 1.000 99.01935  ? 110 TRP A CH2 1 
ATOM   5297 N  N   . LYS E 1 111 ? 66.17676 5.85627   -33.55053 1.000 91.00257  ? 111 LYS A N   1 
ATOM   5298 C  CA  . LYS E 1 111 ? 66.32063 4.94301   -32.42647 1.000 89.92164  ? 111 LYS A CA  1 
ATOM   5299 C  C   . LYS E 1 111 ? 65.00138 4.23885   -32.17061 1.000 90.23780  ? 111 LYS A C   1 
ATOM   5300 O  O   . LYS E 1 111 ? 63.93164 4.85272   -32.21469 1.000 88.59310  ? 111 LYS A O   1 
ATOM   5301 C  CB  . LYS E 1 111 ? 66.80406 5.66328   -31.15846 1.000 91.77668  ? 111 LYS A CB  1 
ATOM   5302 C  CG  . LYS E 1 111 ? 68.17767 6.30407   -31.29766 1.000 92.05160  ? 111 LYS A CG  1 
ATOM   5303 C  CD  . LYS E 1 111 ? 68.59468 7.08422   -30.05092 1.000 95.63319  ? 111 LYS A CD  1 
ATOM   5304 C  CE  . LYS E 1 111 ? 69.94279 7.77763   -30.25367 1.000 96.27880  ? 111 LYS A CE  1 
ATOM   5305 N  NZ  . LYS E 1 111 ? 70.29560 8.70242   -29.13570 1.000 99.27708  ? 111 LYS A NZ  1 
ATOM   5306 N  N   . GLY E 1 112 ? 65.09006 2.94433   -31.91296 1.000 92.10227  ? 112 GLY A N   1 
ATOM   5307 C  CA  . GLY E 1 112 ? 63.91050 2.14937   -31.66320 1.000 95.66398  ? 112 GLY A CA  1 
ATOM   5308 C  C   . GLY E 1 112 ? 64.27808 0.88285   -30.92303 1.000 99.28040  ? 112 GLY A C   1 
ATOM   5309 O  O   . GLY E 1 112 ? 65.41366 0.70538   -30.47676 1.000 102.51951 ? 112 GLY A O   1 
ATOM   5310 N  N   . TRP E 1 113 ? 63.28975 0.01242   -30.77846 1.000 97.14573  ? 113 TRP A N   1 
ATOM   5311 C  CA  . TRP E 1 113 ? 63.51558 -1.24280  -30.10097 1.000 97.90920  ? 113 TRP A CA  1 
ATOM   5312 C  C   . TRP E 1 113 ? 62.57147 -2.29738  -30.65898 1.000 95.42992  ? 113 TRP A C   1 
ATOM   5313 O  O   . TRP E 1 113 ? 61.50537 -1.98294  -31.20071 1.000 93.87271  ? 113 TRP A O   1 
ATOM   5314 C  CB  . TRP E 1 113 ? 63.33661 -1.09772  -28.58926 1.000 103.00629 ? 113 TRP A CB  1 
ATOM   5315 C  CG  . TRP E 1 113 ? 62.02819 -0.51373  -28.22881 1.000 106.18853 ? 113 TRP A CG  1 
ATOM   5316 C  CD1 . TRP E 1 113 ? 61.76022 0.79684   -27.97840 1.000 108.64178 ? 113 TRP A CD1 1 
ATOM   5317 C  CD2 . TRP E 1 113 ? 60.79057 -1.21437  -28.08291 1.000 108.24415 ? 113 TRP A CD2 1 
ATOM   5318 N  NE1 . TRP E 1 113 ? 60.43017 0.95836   -27.68350 1.000 110.59958 ? 113 TRP A NE1 1 
ATOM   5319 C  CE2 . TRP E 1 113 ? 59.81235 -0.26275  -27.73948 1.000 109.93467 ? 113 TRP A CE2 1 
ATOM   5320 C  CE3 . TRP E 1 113 ? 60.41528 -2.55664  -28.20423 1.000 108.49102 ? 113 TRP A CE3 1 
ATOM   5321 C  CZ2 . TRP E 1 113 ? 58.48577 -0.60633  -27.51753 1.000 110.69905 ? 113 TRP A CZ2 1 
ATOM   5322 C  CZ3 . TRP E 1 113 ? 59.09701 -2.89552  -27.98631 1.000 109.30392 ? 113 TRP A CZ3 1 
ATOM   5323 C  CH2 . TRP E 1 113 ? 58.14706 -1.92428  -27.64495 1.000 110.29261 ? 113 TRP A CH2 1 
ATOM   5324 N  N   . ILE E 1 114 ? 62.97469 -3.56007  -30.50070 1.000 94.34878  ? 114 ILE A N   1 
ATOM   5325 C  CA  . ILE E 1 114 ? 62.15627 -4.71086  -30.85818 1.000 91.34598  ? 114 ILE A CA  1 
ATOM   5326 C  C   . ILE E 1 114 ? 62.05046 -5.63604  -29.65868 1.000 96.19257  ? 114 ILE A C   1 
ATOM   5327 O  O   . ILE E 1 114 ? 63.05435 -5.89740  -28.98731 1.000 97.19128  ? 114 ILE A O   1 
ATOM   5328 C  CB  . ILE E 1 114 ? 62.75228 -5.48021  -32.05852 1.000 85.02228  ? 114 ILE A CB  1 
ATOM   5329 C  CG1 . ILE E 1 114 ? 62.79338 -4.56657  -33.27727 1.000 82.29189  ? 114 ILE A CG1 1 
ATOM   5330 C  CG2 . ILE E 1 114 ? 61.92667 -6.72200  -32.36154 1.000 83.24841  ? 114 ILE A CG2 1 
ATOM   5331 C  CD1 . ILE E 1 114 ? 61.43113 -4.21825  -33.83345 1.000 80.58987  ? 114 ILE A CD1 1 
ATOM   5332 N  N   . ASP E 1 115 ? 60.83351 -6.09200  -29.36053 1.000 100.61796 ? 115 ASP A N   1 
ATOM   5333 C  CA  . ASP E 1 115 ? 60.64783 -7.10173  -28.32154 1.000 108.63156 ? 115 ASP A CA  1 
ATOM   5334 C  C   . ASP E 1 115 ? 60.95700 -8.47529  -28.89910 1.000 106.69566 ? 115 ASP A C   1 
ATOM   5335 O  O   . ASP E 1 115 ? 60.38944 -8.86985  -29.92267 1.000 106.83374 ? 115 ASP A O   1 
ATOM   5336 C  CB  . ASP E 1 115 ? 59.22903 -7.08669  -27.75022 1.000 118.83250 ? 115 ASP A CB  1 
ATOM   5337 C  CG  . ASP E 1 115 ? 59.08849 -7.98281  -26.51718 1.000 130.32159 ? 115 ASP A CG  1 
ATOM   5338 O  OD1 . ASP E 1 115 ? 60.11241 -8.51729  -26.04053 1.000 134.58190 ? 115 ASP A OD1 1 
ATOM   5339 O  OD2 . ASP E 1 115 ? 57.95525 -8.16099  -26.01829 1.000 135.91442 ? 115 ASP A OD2 1 
ATOM   5340 N  N   . LEU E 1 116 ? 61.85233 -9.20617  -28.23858 1.000 106.92225 ? 116 LEU A N   1 
ATOM   5341 C  CA  . LEU E 1 116 ? 62.25280 -10.51316 -28.74619 1.000 105.00784 ? 116 LEU A CA  1 
ATOM   5342 C  C   . LEU E 1 116 ? 61.09568 -11.50152 -28.71207 1.000 108.72145 ? 116 LEU A C   1 
ATOM   5343 O  O   . LEU E 1 116 ? 61.06546 -12.44656 -29.50845 1.000 107.19551 ? 116 LEU A O   1 
ATOM   5344 C  CB  . LEU E 1 116 ? 63.43437 -11.04562 -27.94081 1.000 102.44211 ? 116 LEU A CB  1 
ATOM   5345 C  CG  . LEU E 1 116 ? 64.84693 -10.72104 -28.41782 1.000 96.89236  ? 116 LEU A CG  1 
ATOM   5346 C  CD1 . LEU E 1 116 ? 65.01259 -9.22830  -28.54211 1.000 97.69415  ? 116 LEU A CD1 1 
ATOM   5347 C  CD2 . LEU E 1 116 ? 65.85740 -11.26154 -27.42600 1.000 95.07623  ? 116 LEU A CD2 1 
ATOM   5348 N  N   . GLN E 1 117 ? 60.14535 -11.30439 -27.79563 1.000 112.19442 ? 117 GLN A N   1 
ATOM   5349 C  CA  . GLN E 1 117 ? 59.00910 -12.20949 -27.66084 1.000 114.86278 ? 117 GLN A CA  1 
ATOM   5350 C  C   . GLN E 1 117 ? 57.94722 -11.94100 -28.72490 1.000 112.86371 ? 117 GLN A C   1 
ATOM   5351 O  O   . GLN E 1 117 ? 57.44225 -12.87678 -29.35324 1.000 111.60404 ? 117 GLN A O   1 
ATOM   5352 C  CB  . GLN E 1 117 ? 58.41710 -12.05512 -26.25632 1.000 120.95141 ? 117 GLN A CB  1 
ATOM   5353 C  CG  . GLN E 1 117 ? 57.58353 -13.21948 -25.75661 1.000 125.67820 ? 117 GLN A CG  1 
ATOM   5354 C  CD  . GLN E 1 117 ? 57.10971 -13.01343 -24.32626 1.000 133.37422 ? 117 GLN A CD  1 
ATOM   5355 O  OE1 . GLN E 1 117 ? 57.24321 -11.92180 -23.77078 1.000 137.03777 ? 117 GLN A OE1 1 
ATOM   5356 N  NE2 . GLN E 1 117 ? 56.52840 -14.05260 -23.73389 1.000 135.51038 ? 117 GLN A NE2 1 
ATOM   5357 N  N   . ARG E 1 118 ? 57.64793 -10.66793 -28.98077 1.000 113.13933 ? 118 ARG A N   1 
ATOM   5358 C  CA  . ARG E 1 118 ? 56.59188 -10.24852 -29.89874 1.000 113.46305 ? 118 ARG A CA  1 
ATOM   5359 C  C   . ARG E 1 118 ? 57.07340 -10.05031 -31.33397 1.000 108.18388 ? 118 ARG A C   1 
ATOM   5360 O  O   . ARG E 1 118 ? 56.26548 -10.14137 -32.26635 1.000 105.72551 ? 118 ARG A O   1 
ATOM   5361 C  CB  . ARG E 1 118 ? 55.98402 -8.94449  -29.37572 1.000 119.69400 ? 118 ARG A CB  1 
ATOM   5362 C  CG  . ARG E 1 118 ? 55.30221 -9.09591  -28.03234 1.000 127.99920 ? 118 ARG A CG  1 
ATOM   5363 C  CD  . ARG E 1 118 ? 54.87622 -7.76283  -27.41589 1.000 135.58552 ? 118 ARG A CD  1 
ATOM   5364 N  NE  . ARG E 1 118 ? 56.01955 -6.86831  -27.21583 1.000 141.64900 ? 118 ARG A NE  1 
ATOM   5365 C  CZ  . ARG E 1 118 ? 55.93312 -5.57496  -26.90788 1.000 147.98859 ? 118 ARG A CZ  1 
ATOM   5366 N  NH1 . ARG E 1 118 ? 54.74899 -4.99839  -26.75276 1.000 149.80149 ? 118 ARG A NH1 1 
ATOM   5367 N  NH2 . ARG E 1 118 ? 57.03727 -4.85958  -26.73280 1.000 152.85182 ? 118 ARG A NH2 1 
ATOM   5368 N  N   . LEU E 1 119 ? 58.36332 -9.76152  -31.51913 1.000 107.11231 ? 119 LEU A N   1 
ATOM   5369 C  CA  . LEU E 1 119 ? 59.02347 -9.46760  -32.79135 1.000 102.66512 ? 119 LEU A CA  1 
ATOM   5370 C  C   . LEU E 1 119 ? 58.52659 -8.19272  -33.46496 1.000 106.92915 ? 119 LEU A C   1 
ATOM   5371 O  O   . LEU E 1 119 ? 58.82450 -7.97179  -34.64269 1.000 107.18656 ? 119 LEU A O   1 
ATOM   5372 C  CB  . LEU E 1 119 ? 58.91210 -10.63674 -33.77727 1.000 94.80798  ? 119 LEU A CB  1 
ATOM   5373 C  CG  . LEU E 1 119 ? 59.65775 -11.90827 -33.39929 1.000 87.16451  ? 119 LEU A CG  1 
ATOM   5374 C  CD1 . LEU E 1 119 ? 59.58542 -12.87501 -34.56280 1.000 83.16914  ? 119 LEU A CD1 1 
ATOM   5375 C  CD2 . LEU E 1 119 ? 61.10465 -11.58468 -33.03648 1.000 84.26078  ? 119 LEU A CD2 1 
ATOM   5376 N  N   . ASP E 1 120 ? 57.79047 -7.34314  -32.75649 1.000 109.94518 ? 120 ASP A N   1 
ATOM   5377 C  CA  . ASP E 1 120 ? 57.40151 -6.01912  -33.22439 1.000 113.74381 ? 120 ASP A CA  1 
ATOM   5378 C  C   . ASP E 1 120 ? 57.93989 -4.96346  -32.26349 1.000 110.96646 ? 120 ASP A C   1 
ATOM   5379 O  O   . ASP E 1 120 ? 58.42681 -5.27080  -31.17297 1.000 113.41938 ? 120 ASP A O   1 
ATOM   5380 C  CB  . ASP E 1 120 ? 55.88227 -5.89166  -33.39155 1.000 125.09313 ? 120 ASP A CB  1 
ATOM   5381 C  CG  . ASP E 1 120 ? 55.10696 -6.35687  -32.17325 1.000 138.09239 ? 120 ASP A CG  1 
ATOM   5382 O  OD1 . ASP E 1 120 ? 55.56671 -6.14460  -31.02868 1.000 144.48974 ? 120 ASP A OD1 1 
ATOM   5383 O  OD2 . ASP E 1 120 ? 54.01640 -6.93281  -32.37074 1.000 141.28564 ? 120 ASP A OD2 1 
ATOM   5384 N  N   . GLY E 1 121 ? 57.86669 -3.70866  -32.68030 1.000 106.70018 ? 121 GLY A N   1 
ATOM   5385 C  CA  . GLY E 1 121 ? 58.37369 -2.64326  -31.84317 1.000 106.13445 ? 121 GLY A CA  1 
ATOM   5386 C  C   . GLY E 1 121 ? 57.99434 -1.29102  -32.39860 1.000 103.06571 ? 121 GLY A C   1 
ATOM   5387 O  O   . GLY E 1 121 ? 57.17223 -1.17808  -33.30774 1.000 99.88997  ? 121 GLY A O   1 
ATOM   5388 N  N   . MET E 1 122 ? 58.60419 -0.25550  -31.83138 1.000 104.16145 ? 122 MET A N   1 
ATOM   5389 C  CA  . MET E 1 122 ? 58.37643 1.10626   -32.28200 1.000 103.87295 ? 122 MET A CA  1 
ATOM   5390 C  C   . MET E 1 122 ? 59.70804 1.84683   -32.27609 1.000 100.07512 ? 122 MET A C   1 
ATOM   5391 O  O   . MET E 1 122 ? 60.70600 1.38393   -31.72155 1.000 99.09073  ? 122 MET A O   1 
ATOM   5392 C  CB  . MET E 1 122 ? 57.32331 1.82306   -31.41719 1.000 114.56584 ? 122 MET A CB  1 
ATOM   5393 C  CG  . MET E 1 122 ? 55.89899 1.25101   -31.52779 1.000 123.85832 ? 122 MET A CG  1 
ATOM   5394 S  SD  . MET E 1 122 ? 55.51857 -0.08456  -30.35247 1.000 138.68056 ? 122 MET A SD  1 
ATOM   5395 C  CE  . MET E 1 122 ? 53.92027 -0.65903  -30.92974 1.000 144.39690 ? 122 MET A CE  1 
ATOM   5396 N  N   . GLY E 1 123 ? 59.71403 3.00764   -32.90929 1.000 97.40825  ? 123 GLY A N   1 
ATOM   5397 C  CA  . GLY E 1 123 ? 60.90038 3.83687   -32.96604 1.000 96.51961  ? 123 GLY A CA  1 
ATOM   5398 C  C   . GLY E 1 123 ? 60.53672 5.17296   -33.56461 1.000 96.24194  ? 123 GLY A C   1 
ATOM   5399 O  O   . GLY E 1 123 ? 59.49540 5.31939   -34.21270 1.000 97.81059  ? 123 GLY A O   1 
ATOM   5400 N  N   . CYS E 1 124 ? 61.38973 6.15850   -33.31265 1.000 97.31140  ? 124 CYS A N   1 
ATOM   5401 C  CA  . CYS E 1 124 ? 61.11471 7.49602   -33.80404 1.000 99.58679  ? 124 CYS A CA  1 
ATOM   5402 C  C   . CYS E 1 124 ? 62.40699 8.14614   -34.25612 1.000 98.25789  ? 124 CYS A C   1 
ATOM   5403 O  O   . CYS E 1 124 ? 63.50963 7.70033   -33.92561 1.000 97.00798  ? 124 CYS A O   1 
ATOM   5404 C  CB  . CYS E 1 124 ? 60.44429 8.39502   -32.75414 1.000 107.86476 ? 124 CYS A CB  1 
ATOM   5405 S  SG  . CYS E 1 124 ? 61.41393 8.66538   -31.25228 1.000 118.19797 ? 124 CYS A SG  1 
ATOM   5406 N  N   . LEU E 1 125 ? 62.24184 9.20038   -35.04435 1.000 96.17849  ? 125 LEU A N   1 
ATOM   5407 C  CA  . LEU E 1 125 ? 63.35176 9.95981   -35.58320 1.000 92.70047  ? 125 LEU A CA  1 
ATOM   5408 C  C   . LEU E 1 125 ? 63.73691 11.07444  -34.61466 1.000 97.51134  ? 125 LEU A C   1 
ATOM   5409 O  O   . LEU E 1 125 ? 62.90570 11.58890  -33.85993 1.000 99.25518  ? 125 LEU A O   1 
ATOM   5410 C  CB  . LEU E 1 125 ? 62.96883 10.54941  -36.94159 1.000 86.13744  ? 125 LEU A CB  1 
ATOM   5411 C  CG  . LEU E 1 125 ? 63.01694 9.66705   -38.18896 1.000 80.58940  ? 125 LEU A CG  1 
ATOM   5412 C  CD1 . LEU E 1 125 ? 62.29243 10.32530  -39.34524 1.000 77.71674  ? 125 LEU A CD1 1 
ATOM   5413 C  CD2 . LEU E 1 125 ? 64.45067 9.42205   -38.57525 1.000 79.16904  ? 125 LEU A CD2 1 
ATOM   5414 N  N   . GLU E 1 126 ? 65.01680 11.43733  -34.63839 1.000 101.03250 ? 126 GLU A N   1 
ATOM   5415 C  CA  . GLU E 1 126 ? 65.54350 12.55210  -33.86568 1.000 107.48995 ? 126 GLU A CA  1 
ATOM   5416 C  C   . GLU E 1 126 ? 66.47267 13.33804  -34.76781 1.000 106.82610 ? 126 GLU A C   1 
ATOM   5417 O  O   . GLU E 1 126 ? 67.20641 12.75177  -35.56699 1.000 111.85158 ? 126 GLU A O   1 
ATOM   5418 C  CB  . GLU E 1 126 ? 66.30898 12.09204  -32.61598 1.000 117.04107 ? 126 GLU A CB  1 
ATOM   5419 C  CG  . GLU E 1 126 ? 65.49643 11.22329  -31.67759 1.000 127.07716 ? 126 GLU A CG  1 
ATOM   5420 C  CD  . GLU E 1 126 ? 66.29444 10.71759  -30.49176 1.000 132.16162 ? 126 GLU A CD  1 
ATOM   5421 O  OE1 . GLU E 1 126 ? 67.54263 10.68255  -30.57286 1.000 129.87199 ? 126 GLU A OE1 1 
ATOM   5422 O  OE2 . GLU E 1 126 ? 65.66380 10.35156  -29.47662 1.000 136.75896 ? 126 GLU A OE2 1 
ATOM   5423 N  N   . PHE E 1 127 ? 66.47182 14.65494  -34.60842 1.000 104.16114 ? 127 PHE A N   1 
ATOM   5424 C  CA  . PHE E 1 127 ? 67.34584 15.50672  -35.39646 1.000 97.83004  ? 127 PHE A CA  1 
ATOM   5425 C  C   . PHE E 1 127 ? 68.77200 15.37185  -34.88749 1.000 93.35336  ? 127 PHE A C   1 
ATOM   5426 O  O   . PHE E 1 127 ? 69.00644 15.24081  -33.68383 1.000 93.18586  ? 127 PHE A O   1 
ATOM   5427 C  CB  . PHE E 1 127 ? 66.88520 16.95928  -35.30883 1.000 101.03809 ? 127 PHE A CB  1 
ATOM   5428 C  CG  . PHE E 1 127 ? 67.59273 17.88481  -36.25566 1.000 98.32065  ? 127 PHE A CG  1 
ATOM   5429 C  CD1 . PHE E 1 127 ? 67.18387 17.99473  -37.56903 1.000 95.99890  ? 127 PHE A CD1 1 
ATOM   5430 C  CD2 . PHE E 1 127 ? 68.65576 18.65940  -35.82258 1.000 98.29136  ? 127 PHE A CD2 1 
ATOM   5431 C  CE1 . PHE E 1 127 ? 67.82969 18.84832  -38.43531 1.000 95.16378  ? 127 PHE A CE1 1 
ATOM   5432 C  CE2 . PHE E 1 127 ? 69.30098 19.51476  -36.68237 1.000 97.56123  ? 127 PHE A CE2 1 
ATOM   5433 C  CZ  . PHE E 1 127 ? 68.89104 19.61050  -37.99208 1.000 95.92266  ? 127 PHE A CZ  1 
ATOM   5434 N  N   . ASP E 1 128 ? 69.72529 15.37970  -35.81063 1.000 111.19939 ? 128 ASP A N   1 
ATOM   5435 C  CA  . ASP E 1 128 ? 71.13716 15.22391  -35.48354 1.000 112.47110 ? 128 ASP A CA  1 
ATOM   5436 C  C   . ASP E 1 128 ? 71.80857 16.56091  -35.78511 1.000 118.48526 ? 128 ASP A C   1 
ATOM   5437 O  O   . ASP E 1 128 ? 72.44299 16.74359  -36.82414 1.000 118.22088 ? 128 ASP A O   1 
ATOM   5438 C  CB  . ASP E 1 128 ? 71.75730 14.04974  -36.28704 1.000 104.26165 ? 128 ASP A CB  1 
ATOM   5439 C  CG  . ASP E 1 128 ? 73.15475 13.67788  -35.81348 1.000 103.98711 ? 128 ASP A CG  1 
ATOM   5440 O  OD1 . ASP E 1 128 ? 73.86548 14.55593  -35.28782 1.000 105.72326 ? 128 ASP A OD1 1 
ATOM   5441 O  OD2 . ASP E 1 128 ? 73.55817 12.50981  -35.99139 1.000 102.13104 ? 128 ASP A OD2 1 
ATOM   5442 N  N   . GLU E 1 129 ? 71.64323 17.51535  -34.85925 1.000 124.74950 ? 129 GLU A N   1 
ATOM   5443 C  CA  . GLU E 1 129 ? 72.20000 18.85262  -35.04306 1.000 129.40204 ? 129 GLU A CA  1 
ATOM   5444 C  C   . GLU E 1 129 ? 73.72120 18.85613  -35.01147 1.000 130.02928 ? 129 GLU A C   1 
ATOM   5445 O  O   . GLU E 1 129 ? 74.33246 19.83822  -35.44221 1.000 128.87683 ? 129 GLU A O   1 
ATOM   5446 C  CB  . GLU E 1 129 ? 71.65257 19.81080  -33.98429 1.000 138.00316 ? 129 GLU A CB  1 
ATOM   5447 C  CG  . GLU E 1 129 ? 72.27414 19.63329  -32.61015 1.000 149.73879 ? 129 GLU A CG  1 
ATOM   5448 C  CD  . GLU E 1 129 ? 71.73080 20.61244  -31.58967 1.000 155.81580 ? 129 GLU A CD  1 
ATOM   5449 O  OE1 . GLU E 1 129 ? 71.14641 21.63678  -32.00252 1.000 155.39109 ? 129 GLU A OE1 1 
ATOM   5450 O  OE2 . GLU E 1 129 ? 71.88599 20.35384  -30.37619 1.000 158.54039 ? 129 GLU A OE2 1 
ATOM   5451 N  N   . GLU E 1 130 ? 74.34065 17.79571  -34.49232 1.000 134.26453 ? 130 GLU A N   1 
ATOM   5452 C  CA  . GLU E 1 130 ? 75.79155 17.67742  -34.54151 1.000 136.06345 ? 130 GLU A CA  1 
ATOM   5453 C  C   . GLU E 1 130 ? 76.26966 17.30013  -35.94004 1.000 132.10898 ? 130 GLU A C   1 
ATOM   5454 O  O   . GLU E 1 130 ? 77.17713 17.93762  -36.48511 1.000 132.04143 ? 130 GLU A O   1 
ATOM   5455 C  CB  . GLU E 1 130 ? 76.26144 16.64888  -33.51322 1.000 142.99177 ? 130 GLU A CB  1 
ATOM   5456 C  CG  . GLU E 1 130 ? 77.76064 16.39695  -33.47999 1.000 147.03991 ? 130 GLU A CG  1 
ATOM   5457 C  CD  . GLU E 1 130 ? 78.17794 15.20844  -34.33022 1.000 147.29121 ? 130 GLU A CD  1 
ATOM   5458 O  OE1 . GLU E 1 130 ? 77.30998 14.62121  -35.01210 1.000 147.55941 ? 130 GLU A OE1 1 
ATOM   5459 O  OE2 . GLU E 1 130 ? 79.37705 14.85978  -34.31269 1.000 147.83875 ? 130 GLU A OE2 1 
ATOM   5460 N  N   . ARG E 1 131 ? 75.66004 16.27627  -36.54577 1.000 127.11553 ? 131 ARG A N   1 
ATOM   5461 C  CA  . ARG E 1 131 ? 76.09442 15.85571  -37.87419 1.000 122.73711 ? 131 ARG A CA  1 
ATOM   5462 C  C   . ARG E 1 131 ? 75.83888 16.94139  -38.91361 1.000 119.96448 ? 131 ARG A C   1 
ATOM   5463 O  O   . ARG E 1 131 ? 76.66205 17.15069  -39.81197 1.000 119.03878 ? 131 ARG A O   1 
ATOM   5464 C  CB  . ARG E 1 131 ? 75.40295 14.54979  -38.27228 1.000 118.90459 ? 131 ARG A CB  1 
ATOM   5465 C  CG  . ARG E 1 131 ? 76.03838 13.86868  -39.47605 1.000 115.85859 ? 131 ARG A CG  1 
ATOM   5466 C  CD  . ARG E 1 131 ? 75.39717 12.52754  -39.79646 1.000 114.25151 ? 131 ARG A CD  1 
ATOM   5467 N  NE  . ARG E 1 131 ? 76.04942 11.90098  -40.94497 1.000 112.38137 ? 131 ARG A NE  1 
ATOM   5468 C  CZ  . ARG E 1 131 ? 75.82551 10.65733  -41.36597 1.000 111.19412 ? 131 ARG A CZ  1 
ATOM   5469 N  NH1 . ARG E 1 131 ? 74.95352 9.87585   -40.73688 1.000 112.04850 ? 131 ARG A NH1 1 
ATOM   5470 N  NH2 . ARG E 1 131 ? 76.47892 10.19434  -42.42480 1.000 108.42440 ? 131 ARG A NH2 1 
ATOM   5471 N  N   . ALA E 1 132 ? 74.71750 17.65783  -38.79893 1.000 121.85705 ? 132 ALA A N   1 
ATOM   5472 C  CA  . ALA E 1 132 ? 74.44259 18.74601  -39.73440 1.000 120.97557 ? 132 ALA A CA  1 
ATOM   5473 C  C   . ALA E 1 132 ? 75.47919 19.85417  -39.61841 1.000 125.80120 ? 132 ALA A C   1 
ATOM   5474 O  O   . ALA E 1 132 ? 75.94309 20.39388  -40.63008 1.000 124.41375 ? 132 ALA A O   1 
ATOM   5475 C  CB  . ALA E 1 132 ? 73.03997 19.30469  -39.50176 1.000 121.48024 ? 132 ALA A CB  1 
ATOM   5476 N  N   . GLN E 1 133 ? 75.84374 20.21923  -38.39185 1.000 130.63557 ? 133 GLN A N   1 
ATOM   5477 C  CA  . GLN E 1 133 ? 76.86633 21.23964  -38.20965 1.000 136.42840 ? 133 GLN A CA  1 
ATOM   5478 C  C   . GLN E 1 133 ? 78.25588 20.70712  -38.55293 1.000 145.25205 ? 133 GLN A C   1 
ATOM   5479 O  O   . GLN E 1 133 ? 79.04684 21.40228  -39.20238 1.000 140.65250 ? 133 GLN A O   1 
ATOM   5480 C  CB  . GLN E 1 133 ? 76.79885 21.78119  -36.77497 1.000 136.90934 ? 133 GLN A CB  1 
ATOM   5481 C  CG  . GLN E 1 133 ? 75.56838 22.67865  -36.51550 1.000 137.97482 ? 133 GLN A CG  1 
ATOM   5482 C  CD  . GLN E 1 133 ? 75.21404 22.84958  -35.03469 1.000 142.94269 ? 133 GLN A CD  1 
ATOM   5483 O  OE1 . GLN E 1 133 ? 75.56804 22.02366  -34.19173 1.000 145.21792 ? 133 GLN A OE1 1 
ATOM   5484 N  NE2 . GLN E 1 133 ? 74.50284 23.92927  -34.72085 1.000 144.58859 ? 133 GLN A NE2 1 
ATOM   5485 N  N   . GLN E 1 134 ? 78.56415 19.47208  -38.16061 1.000 160.54396 ? 134 GLN A N   1 
ATOM   5486 C  CA  . GLN E 1 134 ? 79.94404 18.99700  -38.16125 1.000 177.71613 ? 134 GLN A CA  1 
ATOM   5487 C  C   . GLN E 1 134 ? 80.27362 18.24778  -39.44798 1.000 191.75714 ? 134 GLN A C   1 
ATOM   5488 O  O   . GLN E 1 134 ? 79.60518 17.26768  -39.80391 1.000 200.49418 ? 134 GLN A O   1 
ATOM   5489 C  CB  . GLN E 1 134 ? 80.22440 18.11843  -36.93870 1.000 170.26678 ? 134 GLN A CB  1 
ATOM   5490 C  CG  . GLN E 1 134 ? 81.42006 17.16368  -37.07559 1.000 159.54778 ? 134 GLN A CG  1 
ATOM   5491 C  CD  . GLN E 1 134 ? 82.78172 17.85730  -37.16232 1.000 151.15175 ? 134 GLN A CD  1 
ATOM   5492 O  OE1 . GLN E 1 134 ? 82.88373 19.08403  -37.10415 1.000 148.06932 ? 134 GLN A OE1 1 
ATOM   5493 N  NE2 . GLN E 1 134 ? 83.83618 17.05890  -37.30258 1.000 147.48298 ? 134 GLN A NE2 1 
ATOM   5494 N  N   . GLU E 1 135 ? 81.29896 18.74073  -40.14292 1.000 196.02945 ? 135 GLU A N   1 
ATOM   5495 C  CA  . GLU E 1 135 ? 81.99476 18.04950  -41.23050 1.000 192.50828 ? 135 GLU A CA  1 
ATOM   5496 C  C   . GLU E 1 135 ? 81.08745 17.67022  -42.39315 1.000 181.28014 ? 135 GLU A C   1 
ATOM   5497 O  O   . GLU E 1 135 ? 81.34191 16.68704  -43.09408 1.000 182.67277 ? 135 GLU A O   1 
ATOM   5498 C  CB  . GLU E 1 135 ? 82.74389 16.81707  -40.71709 1.000 198.37762 ? 135 GLU A CB  1 
ATOM   5499 C  CG  . GLU E 1 135 ? 83.99022 16.47156  -41.52835 1.000 198.63550 ? 135 GLU A CG  1 
ATOM   5500 C  CD  . GLU E 1 135 ? 84.98680 17.62296  -41.61616 1.000 201.28586 ? 135 GLU A CD  1 
ATOM   5501 O  OE1 . GLU E 1 135 ? 85.35657 18.18632  -40.56253 1.000 205.26754 ? 135 GLU A OE1 1 
ATOM   5502 O  OE2 . GLU E 1 135 ? 85.39899 17.96689  -42.74619 1.000 198.52487 ? 135 GLU A OE2 1 
ATOM   5503 N  N   . ASP E 1 136 ? 80.04714 18.45622  -42.64665 1.000 163.58928 ? 136 ASP A N   1 
ATOM   5504 C  CA  . ASP E 1 136 ? 79.27832 18.33882  -43.87710 1.000 141.20737 ? 136 ASP A CA  1 
ATOM   5505 C  C   . ASP E 1 136 ? 79.32731 19.68926  -44.56875 1.000 125.93436 ? 136 ASP A C   1 
ATOM   5506 O  O   . ASP E 1 136 ? 78.74129 20.65941  -44.07599 1.000 124.62478 ? 136 ASP A O   1 
ATOM   5507 C  CB  . ASP E 1 136 ? 77.84703 17.89079  -43.60087 1.000 135.53729 ? 136 ASP A CB  1 
ATOM   5508 C  CG  . ASP E 1 136 ? 77.70055 16.37875  -43.64347 1.000 131.67489 ? 136 ASP A CG  1 
ATOM   5509 O  OD1 . ASP E 1 136 ? 78.64375 15.71924  -44.11560 1.000 129.57187 ? 136 ASP A OD1 1 
ATOM   5510 O  OD2 . ASP E 1 136 ? 76.64605 15.84695  -43.23253 1.000 131.51629 ? 136 ASP A OD2 1 
ATOM   5511 N  N   . ALA E 1 137 ? 80.04075 19.74694  -45.69794 1.000 118.53596 ? 137 ALA A N   1 
ATOM   5512 C  CA  . ALA E 1 137 ? 80.26068 20.99127  -46.42414 1.000 111.87628 ? 137 ALA A CA  1 
ATOM   5513 C  C   . ALA E 1 137 ? 78.88128 21.51150  -46.79979 1.000 107.66778 ? 137 ALA A C   1 
ATOM   5514 O  O   . ALA E 1 137 ? 77.90780 20.75075  -46.77530 1.000 104.99696 ? 137 ALA A O   1 
ATOM   5515 C  CB  . ALA E 1 137 ? 81.15026 20.78561  -47.65053 1.000 108.39693 ? 137 ALA A CB  1 
ATOM   5516 N  N   . LEU E 1 138 ? 78.76153 22.79877  -47.11895 1.000 104.94760 ? 138 LEU A N   1 
ATOM   5517 C  CA  . LEU E 1 138 ? 77.41831 23.23345  -47.44737 1.000 102.67891 ? 138 LEU A CA  1 
ATOM   5518 C  C   . LEU E 1 138 ? 77.07875 22.85160  -48.87830 1.000 99.97960  ? 138 LEU A C   1 
ATOM   5519 O  O   . LEU E 1 138 ? 76.66314 23.68069  -49.68530 1.000 99.21123  ? 138 LEU A O   1 
ATOM   5520 C  CB  . LEU E 1 138 ? 77.22232 24.71872  -47.22108 1.000 105.27695 ? 138 LEU A CB  1 
ATOM   5521 C  CG  . LEU E 1 138 ? 76.55811 24.86790  -45.84642 1.000 112.68855 ? 138 LEU A CG  1 
ATOM   5522 C  CD1 . LEU E 1 138 ? 77.41503 24.20015  -44.74315 1.000 116.52692 ? 138 LEU A CD1 1 
ATOM   5523 C  CD2 . LEU E 1 138 ? 76.21954 26.34450  -45.54032 1.000 115.28102 ? 138 LEU A CD2 1 
ATOM   5524 N  N   . ALA E 1 139 ? 77.33306 21.56894  -49.17809 1.000 85.72524  ? 139 ALA A N   1 
ATOM   5525 C  CA  . ALA E 1 139 ? 76.76952 20.90043  -50.32427 1.000 81.93977  ? 139 ALA A CA  1 
ATOM   5526 C  C   . ALA E 1 139 ? 75.35359 20.49633  -50.01063 1.000 84.08140  ? 139 ALA A C   1 
ATOM   5527 O  O   . ALA E 1 139 ? 74.63603 20.03878  -50.90291 1.000 84.84082  ? 139 ALA A O   1 
ATOM   5528 C  CB  . ALA E 1 139 ? 77.59455 19.67186  -50.69055 1.000 77.74102  ? 139 ALA A CB  1 
ATOM   5529 N  N   . GLN E 1 140 ? 74.97866 20.61452  -48.72319 1.000 87.65774  ? 140 GLN A N   1 
ATOM   5530 C  CA  . GLN E 1 140 ? 73.59082 20.50883  -48.31588 1.000 88.24528  ? 140 GLN A CA  1 
ATOM   5531 C  C   . GLN E 1 140 ? 72.80250 21.67618  -48.86993 1.000 85.11378  ? 140 GLN A C   1 
ATOM   5532 O  O   . GLN E 1 140 ? 71.65695 21.51110  -49.28756 1.000 82.06917  ? 140 GLN A O   1 
ATOM   5533 C  CB  . GLN E 1 140 ? 73.46832 20.50055  -46.79110 1.000 92.54546  ? 140 GLN A CB  1 
ATOM   5534 C  CG  . GLN E 1 140 ? 74.66218 19.96469  -46.01805 1.000 94.19531  ? 140 GLN A CG  1 
ATOM   5535 C  CD  . GLN E 1 140 ? 74.37314 19.81425  -44.53272 1.000 99.57689  ? 140 GLN A CD  1 
ATOM   5536 O  OE1 . GLN E 1 140 ? 73.22279 19.69596  -44.11315 1.000 102.79791 ? 140 GLN A OE1 1 
ATOM   5537 N  NE2 . GLN E 1 140 ? 75.42493 19.81587  -43.73012 1.000 101.15781 ? 140 GLN A NE2 1 
ATOM   5538 N  N   . GLN E 1 141 ? 73.39131 22.87366  -48.84942 1.000 88.32106  ? 141 GLN A N   1 
ATOM   5539 C  CA  . GLN E 1 141 ? 72.76195 24.01041  -49.50407 1.000 92.76933  ? 141 GLN A CA  1 
ATOM   5540 C  C   . GLN E 1 141 ? 72.58617 23.73229  -50.99092 1.000 89.33116  ? 141 GLN A C   1 
ATOM   5541 O  O   . GLN E 1 141 ? 71.54464 24.05555  -51.57567 1.000 89.71514  ? 141 GLN A O   1 
ATOM   5542 C  CB  . GLN E 1 141 ? 73.58693 25.28314  -49.28229 1.000 97.53204  ? 141 GLN A CB  1 
ATOM   5543 C  CG  . GLN E 1 141 ? 72.80720 26.59023  -49.52381 1.000 105.64362 ? 141 GLN A CG  1 
ATOM   5544 C  CD  . GLN E 1 141 ? 73.67276 27.75795  -50.00909 1.000 109.76339 ? 141 GLN A CD  1 
ATOM   5545 O  OE1 . GLN E 1 141 ? 74.77574 27.99987  -49.50525 1.000 110.95350 ? 141 GLN A OE1 1 
ATOM   5546 N  NE2 . GLN E 1 141 ? 73.15705 28.49662  -50.98641 1.000 108.87445 ? 141 GLN A NE2 1 
ATOM   5547 N  N   . ALA E 1 142 ? 73.58336 23.09848  -51.61182 1.000 84.88598  ? 142 ALA A N   1 
ATOM   5548 C  CA  . ALA E 1 142 ? 73.51063 22.80092  -53.03819 1.000 80.38129  ? 142 ALA A CA  1 
ATOM   5549 C  C   . ALA E 1 142 ? 72.48775 21.71307  -53.34427 1.000 80.68778  ? 142 ALA A C   1 
ATOM   5550 O  O   . ALA E 1 142 ? 71.87230 21.72568  -54.41747 1.000 82.83673  ? 142 ALA A O   1 
ATOM   5551 C  CB  . ALA E 1 142 ? 74.88916 22.39175  -53.55294 1.000 78.50825  ? 142 ALA A CB  1 
ATOM   5552 N  N   . PHE E 1 143 ? 72.30637 20.75841  -52.43208 1.000 77.56550  ? 143 PHE A N   1 
ATOM   5553 C  CA  . PHE E 1 143 ? 71.30658 19.71558  -52.63598 1.000 71.94489  ? 143 PHE A CA  1 
ATOM   5554 C  C   . PHE E 1 143 ? 69.89603 20.29119  -52.62580 1.000 77.20791  ? 143 PHE A C   1 
ATOM   5555 O  O   . PHE E 1 143 ? 69.10810 20.04610  -53.54635 1.000 77.22487  ? 143 PHE A O   1 
ATOM   5556 C  CB  . PHE E 1 143 ? 71.46133 18.64207  -51.55881 1.000 64.52619  ? 143 PHE A CB  1 
ATOM   5557 C  CG  . PHE E 1 143 ? 70.33852 17.65552  -51.50847 1.000 56.30532  ? 143 PHE A CG  1 
ATOM   5558 C  CD1 . PHE E 1 143 ? 70.30463 16.59108  -52.38353 1.000 50.40570  ? 143 PHE A CD1 1 
ATOM   5559 C  CD2 . PHE E 1 143 ? 69.33327 17.77423  -50.56990 1.000 55.96031  ? 143 PHE A CD2 1 
ATOM   5560 C  CE1 . PHE E 1 143 ? 69.28605 15.67259  -52.33268 1.000 49.38786  ? 143 PHE A CE1 1 
ATOM   5561 C  CE2 . PHE E 1 143 ? 68.30892 16.85755  -50.51593 1.000 52.17960  ? 143 PHE A CE2 1 
ATOM   5562 C  CZ  . PHE E 1 143 ? 68.28412 15.80713  -51.39456 1.000 48.53990  ? 143 PHE A CZ  1 
ATOM   5563 N  N   . GLU E 1 144 ? 69.55866 21.07045  -51.59645 1.000 83.39762  ? 144 GLU A N   1 
ATOM   5564 C  CA  . GLU E 1 144 ? 68.20899 21.61132  -51.52954 1.000 89.12489  ? 144 GLU A CA  1 
ATOM   5565 C  C   . GLU E 1 144 ? 67.95607 22.61534  -52.64805 1.000 91.72276  ? 144 GLU A C   1 
ATOM   5566 O  O   . GLU E 1 144 ? 66.82433 22.72416  -53.13433 1.000 92.56559  ? 144 GLU A O   1 
ATOM   5567 C  CB  . GLU E 1 144 ? 67.96107 22.23885  -50.16002 1.000 93.79990  ? 144 GLU A CB  1 
ATOM   5568 C  CG  . GLU E 1 144 ? 66.50969 22.63254  -49.90875 1.000 99.72508  ? 144 GLU A CG  1 
ATOM   5569 C  CD  . GLU E 1 144 ? 65.54200 21.45015  -50.02157 1.000 104.62411 ? 144 GLU A CD  1 
ATOM   5570 O  OE1 . GLU E 1 144 ? 65.93566 20.29960  -49.70502 1.000 105.49948 ? 144 GLU A OE1 1 
ATOM   5571 O  OE2 . GLU E 1 144 ? 64.37785 21.67453  -50.42362 1.000 105.51373 ? 144 GLU A OE2 1 
ATOM   5572 N  N   . GLU E 1 145 ? 68.99306 23.32911  -53.09382 1.000 93.65888  ? 145 GLU A N   1 
ATOM   5573 C  CA  . GLU E 1 145 ? 68.83147 24.22420  -54.23636 1.000 99.38204  ? 145 GLU A CA  1 
ATOM   5574 C  C   . GLU E 1 145 ? 68.49723 23.44050  -55.50567 1.000 90.25628  ? 145 GLU A C   1 
ATOM   5575 O  O   . GLU E 1 145 ? 67.55489 23.78295  -56.23163 1.000 88.65506  ? 145 GLU A O   1 
ATOM   5576 C  CB  . GLU E 1 145 ? 70.09064 25.07725  -54.41409 1.000 111.59391 ? 145 GLU A CB  1 
ATOM   5577 C  CG  . GLU E 1 145 ? 70.08040 25.97848  -55.64023 1.000 123.32846 ? 145 GLU A CG  1 
ATOM   5578 C  CD  . GLU E 1 145 ? 71.31221 26.86656  -55.72014 1.000 131.13055 ? 145 GLU A CD  1 
ATOM   5579 O  OE1 . GLU E 1 145 ? 72.29251 26.59674  -54.98951 1.000 134.76809 ? 145 GLU A OE1 1 
ATOM   5580 O  OE2 . GLU E 1 145 ? 71.30780 27.82152  -56.52860 1.000 133.78145 ? 145 GLU A OE2 1 
ATOM   5581 N  N   . ALA E 1 146 ? 69.26224 22.37624  -55.78309 1.000 84.62190  ? 146 ALA A N   1 
ATOM   5582 C  CA  . ALA E 1 146 ? 69.04749 21.55359  -56.97108 1.000 77.34765  ? 146 ALA A CA  1 
ATOM   5583 C  C   . ALA E 1 146 ? 67.69963 20.85398  -56.95186 1.000 72.80217  ? 146 ALA A C   1 
ATOM   5584 O  O   . ALA E 1 146 ? 67.16992 20.50675  -58.01240 1.000 72.45856  ? 146 ALA A O   1 
ATOM   5585 C  CB  . ALA E 1 146 ? 70.15174 20.50521  -57.08049 1.000 74.63505  ? 146 ALA A CB  1 
ATOM   5586 N  N   . ARG E 1 147 ? 67.15222 20.62840  -55.76457 1.000 70.49590  ? 147 ARG A N   1 
ATOM   5587 C  CA  . ARG E 1 147 ? 65.85745 20.00008  -55.59262 1.000 66.32543  ? 147 ARG A CA  1 
ATOM   5588 C  C   . ARG E 1 147 ? 64.71141 20.96817  -55.87072 1.000 67.38469  ? 147 ARG A C   1 
ATOM   5589 O  O   . ARG E 1 147 ? 63.58140 20.52731  -56.10385 1.000 66.98217  ? 147 ARG A O   1 
ATOM   5590 C  CB  . ARG E 1 147 ? 65.76573 19.42338  -54.17273 1.000 63.54647  ? 147 ARG A CB  1 
ATOM   5591 C  CG  . ARG E 1 147 ? 64.59088 18.52205  -53.95287 1.000 59.11333  ? 147 ARG A CG  1 
ATOM   5592 C  CD  . ARG E 1 147 ? 64.48399 18.06655  -52.53402 1.000 59.10787  ? 147 ARG A CD  1 
ATOM   5593 N  NE  . ARG E 1 147 ? 63.18738 17.43415  -52.34299 1.000 65.62160  ? 147 ARG A NE  1 
ATOM   5594 C  CZ  . ARG E 1 147 ? 62.72029 17.01135  -51.17794 1.000 72.28821  ? 147 ARG A CZ  1 
ATOM   5595 N  NH1 . ARG E 1 147 ? 61.52508 16.44507  -51.10789 1.000 76.48324  ? 147 ARG A NH1 1 
ATOM   5596 N  NH2 . ARG E 1 147 ? 63.44712 17.16337  -50.08386 1.000 75.65902  ? 147 ARG A NH2 1 
ATOM   5597 N  N   . ARG E 1 148 ? 64.96803 22.27603  -55.83731 1.000 70.68089  ? 148 ARG A N   1 
ATOM   5598 C  CA  . ARG E 1 148 ? 63.93219 23.27176  -56.09764 1.000 77.07733  ? 148 ARG A CA  1 
ATOM   5599 C  C   . ARG E 1 148 ? 63.94421 23.80402  -57.52836 1.000 78.53278  ? 148 ARG A C   1 
ATOM   5600 O  O   . ARG E 1 148 ? 62.93938 24.38009  -57.96292 1.000 78.26444  ? 148 ARG A O   1 
ATOM   5601 C  CB  . ARG E 1 148 ? 64.08427 24.45920  -55.13699 1.000 81.49484  ? 148 ARG A CB  1 
ATOM   5602 C  CG  . ARG E 1 148 ? 62.79464 24.94740  -54.49122 1.000 87.56118  ? 148 ARG A CG  1 
ATOM   5603 C  CD  . ARG E 1 148 ? 62.92380 24.81901  -52.99462 1.000 94.31130  ? 148 ARG A CD  1 
ATOM   5604 N  NE  . ARG E 1 148 ? 64.19196 25.40059  -52.56843 1.000 100.24423 ? 148 ARG A NE  1 
ATOM   5605 C  CZ  . ARG E 1 148 ? 64.68050 25.32195  -51.33628 1.000 107.69170 ? 148 ARG A CZ  1 
ATOM   5606 N  NH1 . ARG E 1 148 ? 63.99659 24.68904  -50.39172 1.000 115.23545 ? 148 ARG A NH1 1 
ATOM   5607 N  NH2 . ARG E 1 148 ? 65.85079 25.87745  -51.05044 1.000 107.41127 ? 148 ARG A NH2 1 
ATOM   5608 N  N   . ARG E 1 149 ? 65.04849 23.62374  -58.25966 1.000 78.61039  ? 149 ARG A N   1 
ATOM   5609 C  CA  . ARG E 1 149 ? 65.16235 24.09985  -59.63356 1.000 77.88751  ? 149 ARG A CA  1 
ATOM   5610 C  C   . ARG E 1 149 ? 64.00064 23.59948  -60.47978 1.000 75.04812  ? 149 ARG A C   1 
ATOM   5611 O  O   . ARG E 1 149 ? 63.46743 22.50750  -60.25966 1.000 71.31048  ? 149 ARG A O   1 
ATOM   5612 C  CB  . ARG E 1 149 ? 66.49495 23.64529  -60.24489 1.000 79.02181  ? 149 ARG A CB  1 
ATOM   5613 C  CG  . ARG E 1 149 ? 66.61155 23.80784  -61.76639 1.000 82.06283  ? 149 ARG A CG  1 
ATOM   5614 C  CD  . ARG E 1 149 ? 68.05862 23.75502  -62.26348 1.000 86.22088  ? 149 ARG A CD  1 
ATOM   5615 N  NE  . ARG E 1 149 ? 68.69232 22.47462  -61.96930 1.000 90.60833  ? 149 ARG A NE  1 
ATOM   5616 C  CZ  . ARG E 1 149 ? 69.47982 22.24264  -60.91602 1.000 93.99488  ? 149 ARG A CZ  1 
ATOM   5617 N  NH1 . ARG E 1 149 ? 69.75264 23.21348  -60.04330 1.000 97.20637  ? 149 ARG A NH1 1 
ATOM   5618 N  NH2 . ARG E 1 149 ? 69.99664 21.03408  -60.73572 1.000 90.51502  ? 149 ARG A NH2 1 
ATOM   5619 N  N   . THR E 1 150 ? 63.60154 24.42521  -61.44831 1.000 77.45302  ? 150 THR A N   1 
ATOM   5620 C  CA  . THR E 1 150 ? 62.53562 24.09764  -62.38745 1.000 78.20091  ? 150 THR A CA  1 
ATOM   5621 C  C   . THR E 1 150 ? 63.11366 23.55481  -63.69231 1.000 73.18346  ? 150 THR A C   1 
ATOM   5622 O  O   . THR E 1 150 ? 64.11603 24.06877  -64.20158 1.000 72.95893  ? 150 THR A O   1 
ATOM   5623 C  CB  . THR E 1 150 ? 61.67169 25.32979  -62.67211 1.000 80.28500  ? 150 THR A CB  1 
ATOM   5624 O  OG1 . THR E 1 150 ? 61.10831 25.80484  -61.44524 1.000 86.42137  ? 150 THR A OG1 1 
ATOM   5625 C  CG2 . THR E 1 150 ? 60.54066 24.99540  -63.60340 1.000 77.36823  ? 150 THR A CG2 1 
ATOM   5626 N  N   . ARG E 1 151 ? 62.45716 22.53131  -64.24621 1.000 66.51144  ? 151 ARG A N   1 
ATOM   5627 C  CA  . ARG E 1 151 ? 62.84829 21.97867  -65.53597 1.000 61.52657  ? 151 ARG A CA  1 
ATOM   5628 C  C   . ARG E 1 151 ? 61.94014 22.40679  -66.66968 1.000 60.37113  ? 151 ARG A C   1 
ATOM   5629 O  O   . ARG E 1 151 ? 62.44136 22.73439  -67.74948 1.000 60.34043  ? 151 ARG A O   1 
ATOM   5630 C  CB  . ARG E 1 151 ? 62.85395 20.45545  -65.49767 1.000 61.81797  ? 151 ARG A CB  1 
ATOM   5631 C  CG  . ARG E 1 151 ? 63.09787 19.83483  -66.86572 1.000 59.02087  ? 151 ARG A CG  1 
ATOM   5632 C  CD  . ARG E 1 151 ? 64.45290 20.17788  -67.46209 1.000 60.32985  ? 151 ARG A CD  1 
ATOM   5633 N  NE  . ARG E 1 151 ? 64.53941 19.76234  -68.86255 1.000 62.52362  ? 151 ARG A NE  1 
ATOM   5634 C  CZ  . ARG E 1 151 ? 64.49346 18.49539  -69.28067 1.000 61.65222  ? 151 ARG A CZ  1 
ATOM   5635 N  NH1 . ARG E 1 151 ? 64.35521 17.50363  -68.41329 1.000 60.41296  ? 151 ARG A NH1 1 
ATOM   5636 N  NH2 . ARG E 1 151 ? 64.58315 18.22171  -70.57573 1.000 61.18793  ? 151 ARG A NH2 1 
ATOM   5637 N  N   . GLU E 1 152 ? 60.62856 22.46368  -66.45348 1.000 60.86754  ? 152 GLU A N   1 
ATOM   5638 C  CA  . GLU E 1 152 ? 59.73707 22.73502  -67.56994 1.000 62.09685  ? 152 GLU A CA  1 
ATOM   5639 C  C   . GLU E 1 152 ? 60.00800 24.12821  -68.11116 1.000 65.64267  ? 152 GLU A C   1 
ATOM   5640 O  O   . GLU E 1 152 ? 60.34898 25.05034  -67.36391 1.000 68.43213  ? 152 GLU A O   1 
ATOM   5641 C  CB  . GLU E 1 152 ? 58.26035 22.61403  -67.16605 1.000 63.71869  ? 152 GLU A CB  1 
ATOM   5642 C  CG  . GLU E 1 152 ? 57.79565 23.52679  -66.04017 1.000 66.24891  ? 152 GLU A CG  1 
ATOM   5643 C  CD  . GLU E 1 152 ? 58.03364 22.91674  -64.67006 1.000 69.85406  ? 152 GLU A CD  1 
ATOM   5644 O  OE1 . GLU E 1 152 ? 58.87894 21.99775  -64.56738 1.000 69.43382  ? 152 GLU A OE1 1 
ATOM   5645 O  OE2 . GLU E 1 152 ? 57.38043 23.35669  -63.69470 1.000 73.57487  ? 152 GLU A OE2 1 
ATOM   5646 N  N   . PHE E 1 153 ? 59.89722 24.25568  -69.42788 1.000 64.39426  ? 153 PHE A N   1 
ATOM   5647 C  CA  . PHE E 1 153 ? 60.05005 25.50545  -70.16003 1.000 60.63343  ? 153 PHE A CA  1 
ATOM   5648 C  C   . PHE E 1 153 ? 61.46778 26.06597  -70.08455 1.000 65.34110  ? 153 PHE A C   1 
ATOM   5649 O  O   . PHE E 1 153 ? 61.68634 27.23319  -70.38759 1.000 66.30760  ? 153 PHE A O   1 
ATOM   5650 C  CB  . PHE E 1 153 ? 59.04861 26.54598  -69.65085 1.000 54.37574  ? 153 PHE A CB  1 
ATOM   5651 C  CG  . PHE E 1 153 ? 57.64434 26.01058  -69.49805 1.000 52.54220  ? 153 PHE A CG  1 
ATOM   5652 C  CD1 . PHE E 1 153 ? 56.97490 25.43968  -70.57294 1.000 52.55125  ? 153 PHE A CD1 1 
ATOM   5653 C  CD2 . PHE E 1 153 ? 56.96906 26.14057  -68.29503 1.000 51.54995  ? 153 PHE A CD2 1 
ATOM   5654 C  CE1 . PHE E 1 153 ? 55.68531 24.95945  -70.43294 1.000 49.93894  ? 153 PHE A CE1 1 
ATOM   5655 C  CE2 . PHE E 1 153 ? 55.67211 25.67229  -68.15060 1.000 50.91015  ? 153 PHE A CE2 1 
ATOM   5656 C  CZ  . PHE E 1 153 ? 55.03200 25.08292  -69.21561 1.000 50.59647  ? 153 PHE A CZ  1 
ATOM   5657 N  N   . GLU E 1 154 ? 62.45169 25.24694  -69.72526 1.000 69.34904  ? 154 GLU A N   1 
ATOM   5658 C  CA  . GLU E 1 154 ? 63.81238 25.73575  -69.57143 1.000 77.06136  ? 154 GLU A CA  1 
ATOM   5659 C  C   . GLU E 1 154 ? 64.68061 25.45220  -70.78658 1.000 81.45811  ? 154 GLU A C   1 
ATOM   5660 O  O   . GLU E 1 154 ? 65.50923 26.28851  -71.16226 1.000 84.34291  ? 154 GLU A O   1 
ATOM   5661 C  CB  . GLU E 1 154 ? 64.45549 25.11068  -68.33527 1.000 81.79123  ? 154 GLU A CB  1 
ATOM   5662 C  CG  . GLU E 1 154 ? 65.44003 26.00810  -67.65101 1.000 86.35926  ? 154 GLU A CG  1 
ATOM   5663 C  CD  . GLU E 1 154 ? 64.76529 27.00918  -66.74500 1.000 93.71421  ? 154 GLU A CD  1 
ATOM   5664 O  OE1 . GLU E 1 154 ? 63.52824 26.92675  -66.55872 1.000 93.85736  ? 154 GLU A OE1 1 
ATOM   5665 O  OE2 . GLU E 1 154 ? 65.48318 27.87764  -66.21238 1.000 100.44649 ? 154 GLU A OE2 1 
ATOM   5666 N  N   . ASP E 1 155 ? 64.49546 24.29451  -71.41589 1.000 81.79064  ? 155 ASP A N   1 
ATOM   5667 C  CA  . ASP E 1 155 ? 65.27954 23.93066  -72.58753 1.000 83.46104  ? 155 ASP A CA  1 
ATOM   5668 C  C   . ASP E 1 155 ? 64.94426 24.84514  -73.76113 1.000 88.11454  ? 155 ASP A C   1 
ATOM   5669 O  O   . ASP E 1 155 ? 63.78499 25.21371  -73.96276 1.000 89.65816  ? 155 ASP A O   1 
ATOM   5670 C  CB  . ASP E 1 155 ? 65.00309 22.47473  -72.97433 1.000 82.29520  ? 155 ASP A CB  1 
ATOM   5671 C  CG  . ASP E 1 155 ? 65.40762 21.48306  -71.87925 1.000 82.77555  ? 155 ASP A CG  1 
ATOM   5672 O  OD1 . ASP E 1 155 ? 66.04071 21.90231  -70.87824 1.000 84.03440  ? 155 ASP A OD1 1 
ATOM   5673 O  OD2 . ASP E 1 155 ? 65.12658 20.27218  -72.03813 1.000 80.59984  ? 155 ASP A OD2 1 
ATOM   5674 N  N   . ARG E 1 156 ? 65.95590 25.20556  -74.55200 1.000 94.28965  ? 156 ARG A N   1 
ATOM   5675 C  CA  . ARG E 1 156 ? 65.70085 26.00051  -75.74889 1.000 101.41487 ? 156 ARG A CA  1 
ATOM   5676 C  C   . ARG E 1 156 ? 65.08372 25.08626  -76.79390 1.000 103.94985 ? 156 ARG A C   1 
ATOM   5677 O  O   . ARG E 1 156 ? 65.58792 23.98513  -77.03646 1.000 101.70800 ? 156 ARG A O   1 
ATOM   5678 C  CB  . ARG E 1 156 ? 66.97136 26.64571  -76.29936 1.000 105.92073 ? 156 ARG A CB  1 
ATOM   5679 C  CG  . ARG E 1 156 ? 67.70293 27.54471  -75.33318 1.000 110.69973 ? 156 ARG A CG  1 
ATOM   5680 C  CD  . ARG E 1 156 ? 69.15805 27.69714  -75.74073 1.000 112.83730 ? 156 ARG A CD  1 
ATOM   5681 N  NE  . ARG E 1 156 ? 69.76738 28.87218  -75.12827 1.000 116.73642 ? 156 ARG A NE  1 
ATOM   5682 C  CZ  . ARG E 1 156 ? 70.33363 28.87684  -73.92608 1.000 119.10656 ? 156 ARG A CZ  1 
ATOM   5683 N  NH1 . ARG E 1 156 ? 70.86654 29.99287  -73.44633 1.000 123.33485 ? 156 ARG A NH1 1 
ATOM   5684 N  NH2 . ARG E 1 156 ? 70.36765 27.76446  -73.20213 1.000 118.07850 ? 156 ARG A NH2 1 
ATOM   5685 N  N   . ASP E 1 157 ? 63.98634 25.54272  -77.40679 1.000 108.79637 ? 157 ASP A N   1 
ATOM   5686 C  CA  . ASP E 1 157 ? 63.20413 24.67479  -78.28036 1.000 113.59423 ? 157 ASP A CA  1 
ATOM   5687 C  C   . ASP E 1 157 ? 64.01554 24.11664  -79.44293 1.000 122.55213 ? 157 ASP A C   1 
ATOM   5688 O  O   . ASP E 1 157 ? 63.61594 23.10067  -80.02574 1.000 122.77978 ? 157 ASP A O   1 
ATOM   5689 C  CB  . ASP E 1 157 ? 61.97955 25.42353  -78.80503 1.000 110.68630 ? 157 ASP A CB  1 
ATOM   5690 C  CG  . ASP E 1 157 ? 61.04506 24.52296  -79.58753 1.000 107.96042 ? 157 ASP A CG  1 
ATOM   5691 O  OD1 . ASP E 1 157 ? 60.23120 23.80976  -78.96316 1.000 107.30195 ? 157 ASP A OD1 1 
ATOM   5692 O  OD2 . ASP E 1 157 ? 61.13187 24.51779  -80.83186 1.000 106.82076 ? 157 ASP A OD2 1 
ATOM   5693 N  N   . ARG E 1 158 ? 65.13266 24.75664  -79.79921 1.000 131.24313 ? 158 ARG A N   1 
ATOM   5694 C  CA  . ARG E 1 158 ? 66.15799 24.15706  -80.65397 1.000 138.02850 ? 158 ARG A CA  1 
ATOM   5695 C  C   . ARG E 1 158 ? 65.65808 23.83990  -82.06366 1.000 144.16333 ? 158 ARG A C   1 
ATOM   5696 O  O   . ARG E 1 158 ? 66.44114 23.42203  -82.92459 1.000 143.41307 ? 158 ARG A O   1 
ATOM   5697 C  CB  . ARG E 1 158 ? 66.71838 22.88860  -79.99434 1.000 137.69829 ? 158 ARG A CB  1 
ATOM   5698 C  CG  . ARG E 1 158 ? 68.08249 22.45142  -80.51916 1.000 137.09956 ? 158 ARG A CG  1 
ATOM   5699 C  CD  . ARG E 1 158 ? 68.45189 21.04516  -80.05775 1.000 135.45907 ? 158 ARG A CD  1 
ATOM   5700 N  NE  . ARG E 1 158 ? 69.51565 20.47107  -80.87977 1.000 134.79140 ? 158 ARG A NE  1 
ATOM   5701 C  CZ  . ARG E 1 158 ? 69.31082 19.74869  -81.97978 1.000 135.38059 ? 158 ARG A CZ  1 
ATOM   5702 N  NH1 . ARG E 1 158 ? 68.07664 19.49619  -82.40249 1.000 136.47017 ? 158 ARG A NH1 1 
ATOM   5703 N  NH2 . ARG E 1 158 ? 70.34369 19.27401  -82.66038 1.000 135.81354 ? 158 ARG A NH2 1 
ATOM   5704 N  N   . SER E 1 159 ? 64.36293 24.03486  -82.31650 1.000 152.00665 ? 159 SER A N   1 
ATOM   5705 C  CA  . SER E 1 159 ? 63.81645 23.90439  -83.66167 1.000 159.58388 ? 159 SER A CA  1 
ATOM   5706 C  C   . SER E 1 159 ? 64.11786 25.11567  -84.53622 1.000 168.05179 ? 159 SER A C   1 
ATOM   5707 O  O   . SER E 1 159 ? 63.66688 25.15611  -85.68709 1.000 168.27084 ? 159 SER A O   1 
ATOM   5708 C  CB  . SER E 1 159 ? 62.30394 23.67753  -83.60030 1.000 159.88249 ? 159 SER A CB  1 
ATOM   5709 O  OG  . SER E 1 159 ? 61.64043 24.81963  -83.08506 1.000 160.34162 ? 159 SER A OG  1 
ATOM   5710 N  N   . HIS E 1 160 ? 64.86153 26.09395  -84.01869 1.000 176.47537 ? 160 HIS A N   1 
ATOM   5711 C  CA  . HIS E 1 160 ? 65.24893 27.27807  -84.76902 1.000 182.25471 ? 160 HIS A CA  1 
ATOM   5712 C  C   . HIS E 1 160 ? 66.39691 26.94181  -85.72339 1.000 183.68268 ? 160 HIS A C   1 
ATOM   5713 O  O   . HIS E 1 160 ? 66.85861 25.79922  -85.80676 1.000 186.19633 ? 160 HIS A O   1 
ATOM   5714 C  CB  . HIS E 1 160 ? 65.63384 28.40514  -83.80925 1.000 183.27203 ? 160 HIS A CB  1 
ATOM   5715 C  CG  . HIS E 1 160 ? 65.26100 29.77289  -84.29507 1.000 184.96188 ? 160 HIS A CG  1 
ATOM   5716 N  ND1 . HIS E 1 160 ? 65.59013 30.92216  -83.60775 1.000 186.65061 ? 160 HIS A ND1 1 
ATOM   5717 C  CD2 . HIS E 1 160 ? 64.58120 30.17457  -85.39548 1.000 186.80371 ? 160 HIS A CD2 1 
ATOM   5718 C  CE1 . HIS E 1 160 ? 65.13265 31.97233  -84.26570 1.000 187.81453 ? 160 HIS A CE1 1 
ATOM   5719 N  NE2 . HIS E 1 160 ? 64.51654 31.54620  -85.35383 1.000 187.92051 ? 160 HIS A NE2 1 
ATOM   5720 N  N   . ARG E 1 161 ? 66.86253 27.95567  -86.45214 1.000 179.57874 ? 161 ARG A N   1 
ATOM   5721 C  CA  . ARG E 1 161 ? 67.95494 27.81035  -87.41632 1.000 172.31878 ? 161 ARG A CA  1 
ATOM   5722 C  C   . ARG E 1 161 ? 67.67361 26.71604  -88.44603 1.000 169.22938 ? 161 ARG A C   1 
ATOM   5723 O  O   . ARG E 1 161 ? 66.74651 26.82688  -89.24879 1.000 169.05605 ? 161 ARG A O   1 
ATOM   5724 C  CB  . ARG E 1 161 ? 69.27813 27.52518  -86.69351 1.000 165.03505 ? 161 ARG A CB  1 
ATOM   5725 C  CG  . ARG E 1 161 ? 70.14555 28.75872  -86.45233 1.000 161.35130 ? 161 ARG A CG  1 
ATOM   5726 C  CD  . ARG E 1 161 ? 69.50515 29.73042  -85.47040 1.000 158.73504 ? 161 ARG A CD  1 
ATOM   5727 N  NE  . ARG E 1 161 ? 70.19054 31.02126  -85.45595 1.000 159.00258 ? 161 ARG A NE  1 
ATOM   5728 C  CZ  . ARG E 1 161 ? 69.83583 32.04937  -84.69023 1.000 160.83263 ? 161 ARG A CZ  1 
ATOM   5729 N  NH1 . ARG E 1 161 ? 70.51594 33.18745  -84.74669 1.000 162.84935 ? 161 ARG A NH1 1 
ATOM   5730 N  NH2 . ARG E 1 161 ? 68.80189 31.94045  -83.86655 1.000 160.52666 ? 161 ARG A NH2 1 
ATOM   5731 N  N   . MET F 2 1   ? 43.04051 19.13090  -39.21372 1.000 133.40706 ? 1   MET D N   1 
ATOM   5732 C  CA  . MET F 2 1   ? 42.71052 20.23339  -38.31387 1.000 131.14904 ? 1   MET D CA  1 
ATOM   5733 C  C   . MET F 2 1   ? 42.61970 21.56991  -39.03699 1.000 120.59352 ? 1   MET D C   1 
ATOM   5734 O  O   . MET F 2 1   ? 42.42289 22.60522  -38.41111 1.000 118.99024 ? 1   MET D O   1 
ATOM   5735 C  CB  . MET F 2 1   ? 43.73368 20.33244  -37.17710 1.000 140.06621 ? 1   MET D CB  1 
ATOM   5736 C  CG  . MET F 2 1   ? 43.58799 19.26035  -36.10599 1.000 151.17750 ? 1   MET D CG  1 
ATOM   5737 S  SD  . MET F 2 1   ? 41.93319 19.26028  -35.37033 1.000 163.76228 ? 1   MET D SD  1 
ATOM   5738 C  CE  . MET F 2 1   ? 41.79354 20.95792  -34.81271 1.000 170.89392 ? 1   MET D CE  1 
ATOM   5739 N  N   . ASP F 2 2   ? 42.77356 21.55498  -40.35487 1.000 113.00059 ? 2   ASP D N   1 
ATOM   5740 C  CA  . ASP F 2 2   ? 42.64299 22.75606  -41.16665 1.000 104.73702 ? 2   ASP D CA  1 
ATOM   5741 C  C   . ASP F 2 2   ? 41.58144 22.52086  -42.23084 1.000 100.48868 ? 2   ASP D C   1 
ATOM   5742 O  O   . ASP F 2 2   ? 41.61049 21.50582  -42.93328 1.000 102.18869 ? 2   ASP D O   1 
ATOM   5743 C  CB  . ASP F 2 2   ? 43.97915 23.14700  -41.81798 1.000 102.59094 ? 2   ASP D CB  1 
ATOM   5744 C  CG  . ASP F 2 2   ? 44.86212 24.00392  -40.90475 1.000 101.11655 ? 2   ASP D CG  1 
ATOM   5745 O  OD1 . ASP F 2 2   ? 44.33617 24.91560  -40.22876 1.000 100.16300 ? 2   ASP D OD1 1 
ATOM   5746 O  OD2 . ASP F 2 2   ? 46.09143 23.77259  -40.87323 1.000 101.00944 ? 2   ASP D OD2 1 
ATOM   5747 N  N   . VAL F 2 3   ? 40.63998 23.44583  -42.33308 1.000 96.27767  ? 3   VAL D N   1 
ATOM   5748 C  CA  . VAL F 2 3   ? 39.66251 23.45398  -43.40888 1.000 93.17514  ? 3   VAL D CA  1 
ATOM   5749 C  C   . VAL F 2 3   ? 39.89575 24.71266  -44.22547 1.000 92.00683  ? 3   VAL D C   1 
ATOM   5750 O  O   . VAL F 2 3   ? 40.31839 25.74563  -43.69601 1.000 92.97398  ? 3   VAL D O   1 
ATOM   5751 C  CB  . VAL F 2 3   ? 38.21757 23.39551  -42.88740 1.000 93.48532  ? 3   VAL D CB  1 
ATOM   5752 C  CG1 . VAL F 2 3   ? 37.99835 22.10919  -42.15237 1.000 98.95263  ? 3   VAL D CG1 1 
ATOM   5753 C  CG2 . VAL F 2 3   ? 37.95763 24.56372  -41.96308 1.000 91.94785  ? 3   VAL D CG2 1 
ATOM   5754 N  N   . PHE F 2 4   ? 39.64488 24.62060  -45.52719 1.000 87.89128  ? 4   PHE D N   1 
ATOM   5755 C  CA  . PHE F 2 4   ? 39.88397 25.72305  -46.45003 1.000 83.27570  ? 4   PHE D CA  1 
ATOM   5756 C  C   . PHE F 2 4   ? 38.56698 26.10860  -47.10574 1.000 80.24573  ? 4   PHE D C   1 
ATOM   5757 O  O   . PHE F 2 4   ? 37.88926 25.25886  -47.69145 1.000 82.06567  ? 4   PHE D O   1 
ATOM   5758 C  CB  . PHE F 2 4   ? 40.94039 25.33437  -47.47407 1.000 81.24544  ? 4   PHE D CB  1 
ATOM   5759 C  CG  . PHE F 2 4   ? 42.26552 25.04167  -46.85996 1.000 79.98798  ? 4   PHE D CG  1 
ATOM   5760 C  CD1 . PHE F 2 4   ? 42.54337 23.78475  -46.35888 1.000 81.60155  ? 4   PHE D CD1 1 
ATOM   5761 C  CD2 . PHE F 2 4   ? 43.22854 26.02525  -46.76100 1.000 77.40941  ? 4   PHE D CD2 1 
ATOM   5762 C  CE1 . PHE F 2 4   ? 43.76135 23.51585  -45.77593 1.000 82.00104  ? 4   PHE D CE1 1 
ATOM   5763 C  CE2 . PHE F 2 4   ? 44.44867 25.76118  -46.18842 1.000 77.15170  ? 4   PHE D CE2 1 
ATOM   5764 C  CZ  . PHE F 2 4   ? 44.71699 24.50439  -45.69639 1.000 79.62596  ? 4   PHE D CZ  1 
ATOM   5765 N  N   . LEU F 2 5   ? 38.19712 27.37975  -46.99025 1.000 75.40555  ? 5   LEU D N   1 
ATOM   5766 C  CA  . LEU F 2 5   ? 36.83938 27.82067  -47.26659 1.000 70.23632  ? 5   LEU D CA  1 
ATOM   5767 C  C   . LEU F 2 5   ? 36.78374 28.84057  -48.40203 1.000 65.84557  ? 5   LEU D C   1 
ATOM   5768 O  O   . LEU F 2 5   ? 37.79404 29.42267  -48.80205 1.000 62.90918  ? 5   LEU D O   1 
ATOM   5769 C  CB  . LEU F 2 5   ? 36.21218 28.41694  -46.00349 1.000 68.31252  ? 5   LEU D CB  1 
ATOM   5770 C  CG  . LEU F 2 5   ? 36.31319 27.47605  -44.80615 1.000 67.93801  ? 5   LEU D CG  1 
ATOM   5771 C  CD1 . LEU F 2 5   ? 35.85368 28.17575  -43.54376 1.000 67.13239  ? 5   LEU D CD1 1 
ATOM   5772 C  CD2 . LEU F 2 5   ? 35.49801 26.21567  -45.06335 1.000 69.37223  ? 5   LEU D CD2 1 
ATOM   5773 N  N   . MET F 2 6   ? 35.58354 28.98132  -48.96546 1.000 64.77319  ? 6   MET D N   1 
ATOM   5774 C  CA  . MET F 2 6   ? 35.19481 30.08757  -49.83682 1.000 62.47272  ? 6   MET D CA  1 
ATOM   5775 C  C   . MET F 2 6   ? 33.93789 30.67949  -49.22302 1.000 63.76350  ? 6   MET D C   1 
ATOM   5776 O  O   . MET F 2 6   ? 32.84142 30.15560  -49.43094 1.000 68.21206  ? 6   MET D O   1 
ATOM   5777 C  CB  . MET F 2 6   ? 34.91251 29.65745  -51.27201 1.000 63.81291  ? 6   MET D CB  1 
ATOM   5778 C  CG  . MET F 2 6   ? 36.12016 29.37962  -52.11109 1.000 66.63989  ? 6   MET D CG  1 
ATOM   5779 S  SD  . MET F 2 6   ? 35.67687 29.13366  -53.84709 1.000 69.44223  ? 6   MET D SD  1 
ATOM   5780 C  CE  . MET F 2 6   ? 34.08728 28.31456  -53.76358 1.000 69.09773  ? 6   MET D CE  1 
ATOM   5781 N  N   . ILE F 2 7   ? 34.09179 31.74535  -48.44748 1.000 62.48211  ? 7   ILE D N   1 
ATOM   5782 C  CA  . ILE F 2 7   ? 32.94193 32.47786  -47.93089 1.000 58.67942  ? 7   ILE D CA  1 
ATOM   5783 C  C   . ILE F 2 7   ? 32.42917 33.36020  -49.06264 1.000 56.92798  ? 7   ILE D C   1 
ATOM   5784 O  O   . ILE F 2 7   ? 33.09354 34.31410  -49.47067 1.000 58.89413  ? 7   ILE D O   1 
ATOM   5785 C  CB  . ILE F 2 7   ? 33.30148 33.29768  -46.68793 1.000 56.01412  ? 7   ILE D CB  1 
ATOM   5786 C  CG1 . ILE F 2 7   ? 33.91200 32.40064  -45.60545 1.000 54.34859  ? 7   ILE D CG1 1 
ATOM   5787 C  CG2 . ILE F 2 7   ? 32.08244 33.98315  -46.13310 1.000 59.29652  ? 7   ILE D CG2 1 
ATOM   5788 C  CD1 . ILE F 2 7   ? 34.50240 33.17155  -44.42720 1.000 53.06115  ? 7   ILE D CD1 1 
ATOM   5789 N  N   . ARG F 2 8   ? 31.23973 33.05359  -49.56739 1.000 57.36952  ? 8   ARG D N   1 
ATOM   5790 C  CA  . ARG F 2 8   ? 30.72420 33.67504  -50.77851 1.000 58.25755  ? 8   ARG D CA  1 
ATOM   5791 C  C   . ARG F 2 8   ? 29.44412 34.43161  -50.47236 1.000 62.55996  ? 8   ARG D C   1 
ATOM   5792 O  O   . ARG F 2 8   ? 28.60240 33.96003  -49.69925 1.000 65.47886  ? 8   ARG D O   1 
ATOM   5793 C  CB  . ARG F 2 8   ? 30.48295 32.62803  -51.86153 1.000 57.05994  ? 8   ARG D CB  1 
ATOM   5794 C  CG  . ARG F 2 8   ? 31.76171 31.94280  -52.28948 1.000 58.13117  ? 8   ARG D CG  1 
ATOM   5795 C  CD  . ARG F 2 8   ? 31.58216 31.24683  -53.60501 1.000 61.63556  ? 8   ARG D CD  1 
ATOM   5796 N  NE  . ARG F 2 8   ? 31.16370 32.15770  -54.66023 1.000 64.25214  ? 8   ARG D NE  1 
ATOM   5797 C  CZ  . ARG F 2 8   ? 30.63072 31.75258  -55.80691 1.000 68.14696  ? 8   ARG D CZ  1 
ATOM   5798 N  NH1 . ARG F 2 8   ? 30.44466 30.45669  -56.02882 1.000 67.91207  ? 8   ARG D NH1 1 
ATOM   5799 N  NH2 . ARG F 2 8   ? 30.26718 32.64089  -56.72395 1.000 72.18466  ? 8   ARG D NH2 1 
ATOM   5800 N  N   . ARG F 2 9   ? 29.34463 35.63949  -51.02336 1.000 62.12465  ? 9   ARG D N   1 
ATOM   5801 C  CA  . ARG F 2 9   ? 28.13503 36.44189  -50.94500 1.000 63.13039  ? 9   ARG D CA  1 
ATOM   5802 C  C   . ARG F 2 9   ? 28.06521 37.30800  -52.18301 1.000 59.97526  ? 9   ARG D C   1 
ATOM   5803 O  O   . ARG F 2 9   ? 29.02346 38.02675  -52.48371 1.000 55.01689  ? 9   ARG D O   1 
ATOM   5804 C  CB  . ARG F 2 9   ? 28.10634 37.32875  -49.70770 1.000 67.43088  ? 9   ARG D CB  1 
ATOM   5805 C  CG  . ARG F 2 9   ? 26.79815 38.06536  -49.56539 1.000 72.61808  ? 9   ARG D CG  1 
ATOM   5806 C  CD  . ARG F 2 9   ? 26.98406 39.50428  -49.14827 1.000 75.38028  ? 9   ARG D CD  1 
ATOM   5807 N  NE  . ARG F 2 9   ? 25.69114 40.17449  -49.15720 1.000 79.29629  ? 9   ARG D NE  1 
ATOM   5808 C  CZ  . ARG F 2 9   ? 25.51929 41.48836  -49.23451 1.000 80.18558  ? 9   ARG D CZ  1 
ATOM   5809 N  NH1 . ARG F 2 9   ? 26.56376 42.30323  -49.30606 1.000 79.63322  ? 9   ARG D NH1 1 
ATOM   5810 N  NH2 . ARG F 2 9   ? 24.28831 41.98434  -49.22967 1.000 80.88395  ? 9   ARG D NH2 1 
ATOM   5811 N  N   . HIS F 2 10  ? 26.93866 37.22804  -52.89120 1.000 62.14570  ? 10  HIS D N   1 
ATOM   5812 C  CA  . HIS F 2 10  ? 26.72335 38.01153  -54.10207 1.000 66.50595  ? 10  HIS D CA  1 
ATOM   5813 C  C   . HIS F 2 10  ? 27.87419 37.77991  -55.06851 1.000 66.75375  ? 10  HIS D C   1 
ATOM   5814 O  O   . HIS F 2 10  ? 28.09518 36.65543  -55.51989 1.000 67.68955  ? 10  HIS D O   1 
ATOM   5815 C  CB  . HIS F 2 10  ? 26.56851 39.49711  -53.76597 1.000 71.82700  ? 10  HIS D CB  1 
ATOM   5816 C  CG  . HIS F 2 10  ? 25.25228 39.83767  -53.13802 1.000 79.26670  ? 10  HIS D CG  1 
ATOM   5817 N  ND1 . HIS F 2 10  ? 24.73329 41.11333  -53.13877 1.000 81.38590  ? 10  HIS D ND1 1 
ATOM   5818 C  CD2 . HIS F 2 10  ? 24.34216 39.06320  -52.50087 1.000 82.79541  ? 10  HIS D CD2 1 
ATOM   5819 C  CE1 . HIS F 2 10  ? 23.56584 41.11159  -52.51967 1.000 85.33494  ? 10  HIS D CE1 1 
ATOM   5820 N  NE2 . HIS F 2 10  ? 23.30493 39.87973  -52.12353 1.000 83.92937  ? 10  HIS D NE2 1 
ATOM   5821 N  N   . LYS F 2 11  ? 28.62498 38.83458  -55.36465 1.000 66.64635  ? 11  LYS D N   1 
ATOM   5822 C  CA  . LYS F 2 11  ? 29.77697 38.75468  -56.24571 1.000 66.37592  ? 11  LYS D CA  1 
ATOM   5823 C  C   . LYS F 2 11  ? 31.09854 38.82899  -55.48442 1.000 69.87070  ? 11  LYS D C   1 
ATOM   5824 O  O   . LYS F 2 11  ? 32.13775 39.08990  -56.09949 1.000 71.36393  ? 11  LYS D O   1 
ATOM   5825 C  CB  . LYS F 2 11  ? 29.67817 39.86016  -57.29867 1.000 68.59431  ? 11  LYS D CB  1 
ATOM   5826 C  CG  . LYS F 2 11  ? 28.66774 39.55826  -58.39444 1.000 69.70437  ? 11  LYS D CG  1 
ATOM   5827 C  CD  . LYS F 2 11  ? 28.47561 40.74361  -59.32247 1.000 71.40540  ? 11  LYS D CD  1 
ATOM   5828 C  CE  . LYS F 2 11  ? 29.68013 41.03519  -60.19418 1.000 72.16079  ? 11  LYS D CE  1 
ATOM   5829 N  NZ  . LYS F 2 11  ? 29.46203 42.26791  -61.01935 1.000 74.56011  ? 11  LYS D NZ  1 
ATOM   5830 N  N   . THR F 2 12  ? 31.08204 38.67301  -54.15854 1.000 72.79233  ? 12  THR D N   1 
ATOM   5831 C  CA  . THR F 2 12  ? 32.29592 38.67389  -53.34112 1.000 72.25709  ? 12  THR D CA  1 
ATOM   5832 C  C   . THR F 2 12  ? 32.68160 37.25120  -52.93542 1.000 65.10465  ? 12  THR D C   1 
ATOM   5833 O  O   . THR F 2 12  ? 31.82001 36.44306  -52.57577 1.000 67.69242  ? 12  THR D O   1 
ATOM   5834 C  CB  . THR F 2 12  ? 32.11624 39.54707  -52.08784 1.000 77.05463  ? 12  THR D CB  1 
ATOM   5835 O  OG1 . THR F 2 12  ? 31.97379 40.92216  -52.47180 1.000 78.40450  ? 12  THR D OG1 1 
ATOM   5836 C  CG2 . THR F 2 12  ? 33.31079 39.40908  -51.14000 1.000 78.47327  ? 12  THR D CG2 1 
ATOM   5837 N  N   . THR F 2 13  ? 33.97385 36.94064  -52.97683 1.000 58.48384  ? 13  THR D N   1 
ATOM   5838 C  CA  . THR F 2 13  ? 34.42282 35.60250  -52.60949 1.000 60.40960  ? 13  THR D CA  1 
ATOM   5839 C  C   . THR F 2 13  ? 35.67046 35.72187  -51.74922 1.000 62.08077  ? 13  THR D C   1 
ATOM   5840 O  O   . THR F 2 13  ? 36.67355 36.29984  -52.18809 1.000 64.74260  ? 13  THR D O   1 
ATOM   5841 C  CB  . THR F 2 13  ? 34.73121 34.76517  -53.85262 1.000 61.96947  ? 13  THR D CB  1 
ATOM   5842 O  OG1 . THR F 2 13  ? 33.53791 34.61569  -54.64631 1.000 63.26674  ? 13  THR D OG1 1 
ATOM   5843 C  CG2 . THR F 2 13  ? 35.29575 33.39621  -53.43604 1.000 60.24294  ? 13  THR D CG2 1 
ATOM   5844 N  N   . ILE F 2 14  ? 35.64353 35.12953  -50.55810 1.000 59.66344  ? 14  ILE D N   1 
ATOM   5845 C  CA  . ILE F 2 14  ? 36.71983 35.28596  -49.58258 1.000 58.95471  ? 14  ILE D CA  1 
ATOM   5846 C  C   . ILE F 2 14  ? 37.40530 33.93685  -49.40845 1.000 57.24620  ? 14  ILE D C   1 
ATOM   5847 O  O   . ILE F 2 14  ? 36.81608 32.99310  -48.87060 1.000 57.81361  ? 14  ILE D O   1 
ATOM   5848 C  CB  . ILE F 2 14  ? 36.18346 35.81893  -48.24511 1.000 61.86286  ? 14  ILE D CB  1 
ATOM   5849 C  CG1 . ILE F 2 14  ? 35.56893 37.20236  -48.44845 1.000 62.13007  ? 14  ILE D CG1 1 
ATOM   5850 C  CG2 . ILE F 2 14  ? 37.26577 35.86385  -47.15989 1.000 59.71973  ? 14  ILE D CG2 1 
ATOM   5851 C  CD1 . ILE F 2 14  ? 34.96130 37.74620  -47.20523 1.000 63.31691  ? 14  ILE D CD1 1 
ATOM   5852 N  N   . PHE F 2 15  ? 38.66288 33.84862  -49.82043 1.000 55.05799  ? 15  PHE D N   1 
ATOM   5853 C  CA  . PHE F 2 15  ? 39.45844 32.64909  -49.60393 1.000 58.51238  ? 15  PHE D CA  1 
ATOM   5854 C  C   . PHE F 2 15  ? 40.11773 32.75119  -48.23000 1.000 64.27306  ? 15  PHE D C   1 
ATOM   5855 O  O   . PHE F 2 15  ? 40.90670 33.66931  -47.98753 1.000 69.89964  ? 15  PHE D O   1 
ATOM   5856 C  CB  . PHE F 2 15  ? 40.49964 32.48019  -50.71767 1.000 58.48323  ? 15  PHE D CB  1 
ATOM   5857 C  CG  . PHE F 2 15  ? 39.92764 31.96816  -52.01992 1.000 61.00626  ? 15  PHE D CG  1 
ATOM   5858 C  CD1 . PHE F 2 15  ? 39.41169 32.83873  -52.96241 1.000 62.40206  ? 15  PHE D CD1 1 
ATOM   5859 C  CD2 . PHE F 2 15  ? 39.88984 30.60606  -52.29169 1.000 62.82833  ? 15  PHE D CD2 1 
ATOM   5860 C  CE1 . PHE F 2 15  ? 38.86698 32.36196  -54.15240 1.000 62.19197  ? 15  PHE D CE1 1 
ATOM   5861 C  CE2 . PHE F 2 15  ? 39.35499 30.12708  -53.47360 1.000 61.55574  ? 15  PHE D CE2 1 
ATOM   5862 C  CZ  . PHE F 2 15  ? 38.84448 31.00950  -54.40517 1.000 61.68198  ? 15  PHE D CZ  1 
ATOM   5863 N  N   . THR F 2 16  ? 39.75162 31.85352  -47.31248 1.000 67.22529  ? 16  THR D N   1 
ATOM   5864 C  CA  . THR F 2 16  ? 40.33985 31.84349  -45.97469 1.000 72.22308  ? 16  THR D CA  1 
ATOM   5865 C  C   . THR F 2 16  ? 40.48822 30.40586  -45.48677 1.000 79.97739  ? 16  THR D C   1 
ATOM   5866 O  O   . THR F 2 16  ? 40.14562 29.44911  -46.18558 1.000 81.33867  ? 16  THR D O   1 
ATOM   5867 C  CB  . THR F 2 16  ? 39.52059 32.66103  -44.97076 1.000 75.07433  ? 16  THR D CB  1 
ATOM   5868 O  OG1 . THR F 2 16  ? 40.27234 32.79911  -43.75741 1.000 77.28450  ? 16  THR D OG1 1 
ATOM   5869 C  CG2 . THR F 2 16  ? 38.18227 31.98672  -44.65292 1.000 74.52331  ? 16  THR D CG2 1 
ATOM   5870 N  N   . ASP F 2 17  ? 41.05451 30.25658  -44.28933 1.000 86.88428  ? 17  ASP D N   1 
ATOM   5871 C  CA  . ASP F 2 17  ? 41.21015 28.94949  -43.65901 1.000 92.17725  ? 17  ASP D CA  1 
ATOM   5872 C  C   . ASP F 2 17  ? 40.88225 29.08775  -42.17753 1.000 97.54571  ? 17  ASP D C   1 
ATOM   5873 O  O   . ASP F 2 17  ? 40.88180 30.18895  -41.61914 1.000 97.89942  ? 17  ASP D O   1 
ATOM   5874 C  CB  . ASP F 2 17  ? 42.62718 28.35154  -43.85021 1.000 92.93790  ? 17  ASP D CB  1 
ATOM   5875 C  CG  . ASP F 2 17  ? 43.73071 29.19566  -43.20770 1.000 94.83165  ? 17  ASP D CG  1 
ATOM   5876 O  OD1 . ASP F 2 17  ? 43.52883 30.41361  -43.01704 1.000 98.54458  ? 17  ASP D OD1 1 
ATOM   5877 O  OD2 . ASP F 2 17  ? 44.81815 28.64675  -42.92219 1.000 93.39571  ? 17  ASP D OD2 1 
ATOM   5878 N  N   . ALA F 2 18  ? 40.58171 27.95789  -41.54465 1.000 101.35729 ? 18  ALA D N   1 
ATOM   5879 C  CA  . ALA F 2 18  ? 40.28159 27.97141  -40.12141 1.000 104.74593 ? 18  ALA D CA  1 
ATOM   5880 C  C   . ALA F 2 18  ? 40.49074 26.57264  -39.56479 1.000 102.85265 ? 18  ALA D C   1 
ATOM   5881 O  O   . ALA F 2 18  ? 40.55639 25.59294  -40.31160 1.000 101.60893 ? 18  ALA D O   1 
ATOM   5882 C  CB  . ALA F 2 18  ? 38.85472 28.46395  -39.85078 1.000 109.55981 ? 18  ALA D CB  1 
ATOM   5883 N  N   . LYS F 2 19  ? 40.59447 26.49612  -38.23749 1.000 103.17730 ? 19  LYS D N   1 
ATOM   5884 C  CA  . LYS F 2 19  ? 40.74517 25.21000  -37.56987 1.000 100.03543 ? 19  LYS D CA  1 
ATOM   5885 C  C   . LYS F 2 19  ? 39.43489 24.44166  -37.62688 1.000 99.12188  ? 19  LYS D C   1 
ATOM   5886 O  O   . LYS F 2 19  ? 38.35285 25.02380  -37.52303 1.000 98.36513  ? 19  LYS D O   1 
ATOM   5887 C  CB  . LYS F 2 19  ? 41.16420 25.39751  -36.11015 1.000 99.73575  ? 19  LYS D CB  1 
ATOM   5888 C  CG  . LYS F 2 19  ? 42.48391 26.12121  -35.91753 1.000 98.09779  ? 19  LYS D CG  1 
ATOM   5889 C  CD  . LYS F 2 19  ? 43.61773 25.37823  -36.59930 1.000 97.37245  ? 19  LYS D CD  1 
ATOM   5890 C  CE  . LYS F 2 19  ? 44.93281 26.13906  -36.48754 1.000 98.24444  ? 19  LYS D CE  1 
ATOM   5891 N  NZ  . LYS F 2 19  ? 44.93555 27.40303  -37.28924 1.000 98.75407  ? 19  LYS D NZ  1 
ATOM   5892 N  N   . GLU F 2 20  ? 39.53665 23.12279  -37.79576 1.000 99.80619  ? 20  GLU D N   1 
ATOM   5893 C  CA  . GLU F 2 20  ? 38.33506 22.30055  -37.86309 1.000 101.47593 ? 20  GLU D CA  1 
ATOM   5894 C  C   . GLU F 2 20  ? 37.53959 22.41587  -36.56773 1.000 104.88341 ? 20  GLU D C   1 
ATOM   5895 O  O   . GLU F 2 20  ? 36.30255 22.47270  -36.58533 1.000 104.35564 ? 20  GLU D O   1 
ATOM   5896 C  CB  . GLU F 2 20  ? 38.71450 20.84786  -38.15515 1.000 102.84522 ? 20  GLU D CB  1 
ATOM   5897 C  CG  . GLU F 2 20  ? 37.53222 19.92431  -38.41008 1.000 103.88674 ? 20  GLU D CG  1 
ATOM   5898 C  CD  . GLU F 2 20  ? 37.95402 18.53757  -38.88428 1.000 105.65099 ? 20  GLU D CD  1 
ATOM   5899 O  OE1 . GLU F 2 20  ? 39.09417 18.37783  -39.37811 1.000 104.19318 ? 20  GLU D OE1 1 
ATOM   5900 O  OE2 . GLU F 2 20  ? 37.13034 17.60544  -38.77707 1.000 108.43749 ? 20  GLU D OE2 1 
ATOM   5901 N  N   . SER F 2 21  ? 38.23652 22.47676  -35.43636 1.000 107.82317 ? 21  SER D N   1 
ATOM   5902 C  CA  . SER F 2 21  ? 37.59619 22.68704  -34.14071 1.000 111.38887 ? 21  SER D CA  1 
ATOM   5903 C  C   . SER F 2 21  ? 37.67641 24.16292  -33.74933 1.000 105.27105 ? 21  SER D C   1 
ATOM   5904 O  O   . SER F 2 21  ? 38.30901 24.55251  -32.76601 1.000 104.44581 ? 21  SER D O   1 
ATOM   5905 C  CB  . SER F 2 21  ? 38.23793 21.78938  -33.08156 1.000 119.28950 ? 21  SER D CB  1 
ATOM   5906 O  OG  . SER F 2 21  ? 37.99415 20.41043  -33.33626 1.000 126.77229 ? 21  SER D OG  1 
ATOM   5907 N  N   . SER F 2 22  ? 37.02209 24.98758  -34.56589 1.000 101.30296 ? 22  SER D N   1 
ATOM   5908 C  CA  . SER F 2 22  ? 36.83607 26.40557  -34.30336 1.000 97.65654  ? 22  SER D CA  1 
ATOM   5909 C  C   . SER F 2 22  ? 35.36239 26.71716  -34.49824 1.000 93.80480  ? 22  SER D C   1 
ATOM   5910 O  O   . SER F 2 22  ? 34.69825 26.11570  -35.34479 1.000 92.76713  ? 22  SER D O   1 
ATOM   5911 C  CB  . SER F 2 22  ? 37.68647 27.28699  -35.22621 1.000 97.73096  ? 22  SER D CB  1 
ATOM   5912 O  OG  . SER F 2 22  ? 37.25589 27.16471  -36.57202 1.000 97.27392  ? 22  SER D OG  1 
ATOM   5913 N  N   . THR F 2 23  ? 34.85588 27.66741  -33.72243 1.000 92.21116  ? 23  THR D N   1 
ATOM   5914 C  CA  . THR F 2 23  ? 33.42514 27.92914  -33.73980 1.000 89.32232  ? 23  THR D CA  1 
ATOM   5915 C  C   . THR F 2 23  ? 33.02088 28.68411  -35.00400 1.000 84.18613  ? 23  THR D C   1 
ATOM   5916 O  O   . THR F 2 23  ? 33.84353 29.30905  -35.68113 1.000 81.36713  ? 23  THR D O   1 
ATOM   5917 C  CB  . THR F 2 23  ? 33.01178 28.72731  -32.51000 1.000 93.47565  ? 23  THR D CB  1 
ATOM   5918 O  OG1 . THR F 2 23  ? 33.23015 30.11947  -32.75770 1.000 98.85389  ? 23  THR D OG1 1 
ATOM   5919 C  CG2 . THR F 2 23  ? 33.83915 28.30560  -31.30267 1.000 94.28896  ? 23  THR D CG2 1 
ATOM   5920 N  N   . VAL F 2 24  ? 31.72403 28.62084  -35.31645 1.000 74.75694  ? 24  VAL D N   1 
ATOM   5921 C  CA  . VAL F 2 24  ? 31.19521 29.41095  -36.42498 1.000 72.45896  ? 24  VAL D CA  1 
ATOM   5922 C  C   . VAL F 2 24  ? 31.27543 30.89376  -36.08466 1.000 77.67758  ? 24  VAL D C   1 
ATOM   5923 O  O   . VAL F 2 24  ? 31.56320 31.73429  -36.94741 1.000 76.90676  ? 24  VAL D O   1 
ATOM   5924 C  CB  . VAL F 2 24  ? 29.75383 28.97412  -36.76053 1.000 67.78462  ? 24  VAL D CB  1 
ATOM   5925 C  CG1 . VAL F 2 24  ? 28.98062 30.08176  -37.50066 1.000 65.35226  ? 24  VAL D CG1 1 
ATOM   5926 C  CG2 . VAL F 2 24  ? 29.78270 27.71070  -37.59031 1.000 65.01724  ? 24  VAL D CG2 1 
ATOM   5927 N  N   . PHE F 2 25  ? 31.06231 31.23477  -34.81298 1.000 83.22141  ? 25  PHE D N   1 
ATOM   5928 C  CA  . PHE F 2 25  ? 31.13502 32.63209  -34.41004 1.000 85.41622  ? 25  PHE D CA  1 
ATOM   5929 C  C   . PHE F 2 25  ? 32.50452 33.21931  -34.73036 1.000 88.22403  ? 25  PHE D C   1 
ATOM   5930 O  O   . PHE F 2 25  ? 32.60187 34.30663  -35.30887 1.000 88.29727  ? 25  PHE D O   1 
ATOM   5931 C  CB  . PHE F 2 25  ? 30.81994 32.77007  -32.92191 1.000 86.00206  ? 25  PHE D CB  1 
ATOM   5932 C  CG  . PHE F 2 25  ? 30.87059 34.18099  -32.43592 1.000 87.24114  ? 25  PHE D CG  1 
ATOM   5933 C  CD1 . PHE F 2 25  ? 29.78404 35.02722  -32.60485 1.000 86.89070  ? 25  PHE D CD1 1 
ATOM   5934 C  CD2 . PHE F 2 25  ? 32.01226 34.67330  -31.82748 1.000 89.93054  ? 25  PHE D CD2 1 
ATOM   5935 C  CE1 . PHE F 2 25  ? 29.83280 36.34053  -32.16533 1.000 88.73583  ? 25  PHE D CE1 1 
ATOM   5936 C  CE2 . PHE F 2 25  ? 32.06920 35.98701  -31.38553 1.000 92.23848  ? 25  PHE D CE2 1 
ATOM   5937 C  CZ  . PHE F 2 25  ? 30.97835 36.82049  -31.55434 1.000 91.18557  ? 25  PHE D CZ  1 
ATOM   5938 N  N   . GLU F 2 26  ? 33.57789 32.50315  -34.37756 1.000 89.48905  ? 26  GLU D N   1 
ATOM   5939 C  CA  . GLU F 2 26  ? 34.91913 33.00413  -34.66442 1.000 91.26195  ? 26  GLU D CA  1 
ATOM   5940 C  C   . GLU F 2 26  ? 35.11599 33.23223  -36.15786 1.000 82.45798  ? 26  GLU D C   1 
ATOM   5941 O  O   . GLU F 2 26  ? 35.90240 34.10085  -36.55923 1.000 80.16699  ? 26  GLU D O   1 
ATOM   5942 C  CB  . GLU F 2 26  ? 35.97464 32.03899  -34.11953 1.000 99.87535  ? 26  GLU D CB  1 
ATOM   5943 C  CG  . GLU F 2 26  ? 36.07307 32.02063  -32.59956 1.000 112.36910 ? 26  GLU D CG  1 
ATOM   5944 C  CD  . GLU F 2 26  ? 36.89191 30.84954  -32.07641 1.000 120.79615 ? 26  GLU D CD  1 
ATOM   5945 O  OE1 . GLU F 2 26  ? 37.27762 29.97730  -32.88782 1.000 121.45003 ? 26  GLU D OE1 1 
ATOM   5946 O  OE2 . GLU F 2 26  ? 37.14565 30.79986  -30.85147 1.000 128.43748 ? 26  GLU D OE2 1 
ATOM   5947 N  N   . LEU F 2 27  ? 34.39869 32.47808  -36.99484 1.000 75.80484  ? 27  LEU D N   1 
ATOM   5948 C  CA  . LEU F 2 27  ? 34.48620 32.70362  -38.43256 1.000 69.26933  ? 27  LEU D CA  1 
ATOM   5949 C  C   . LEU F 2 27  ? 33.85008 34.04023  -38.81310 1.000 70.12544  ? 27  LEU D C   1 
ATOM   5950 O  O   . LEU F 2 27  ? 34.33634 34.73276  -39.71567 1.000 70.90512  ? 27  LEU D O   1 
ATOM   5951 C  CB  . LEU F 2 27  ? 33.83994 31.54127  -39.19586 1.000 61.69039  ? 27  LEU D CB  1 
ATOM   5952 C  CG  . LEU F 2 27  ? 34.14941 31.60266  -40.69940 1.000 57.06468  ? 27  LEU D CG  1 
ATOM   5953 C  CD1 . LEU F 2 27  ? 35.64863 31.56800  -40.87454 1.000 56.81599  ? 27  LEU D CD1 1 
ATOM   5954 C  CD2 . LEU F 2 27  ? 33.49040 30.52132  -41.56575 1.000 52.11919  ? 27  LEU D CD2 1 
ATOM   5955 N  N   . LYS F 2 28  ? 32.75247 34.41359  -38.14769 1.000 71.56855  ? 28  LYS D N   1 
ATOM   5956 C  CA  . LYS F 2 28  ? 32.17379 35.73991  -38.35495 1.000 71.93264  ? 28  LYS D CA  1 
ATOM   5957 C  C   . LYS F 2 28  ? 33.12827 36.84209  -37.90769 1.000 76.24953  ? 28  LYS D C   1 
ATOM   5958 O  O   . LYS F 2 28  ? 33.00196 37.99063  -38.35014 1.000 77.57774  ? 28  LYS D O   1 
ATOM   5959 C  CB  . LYS F 2 28  ? 30.84138 35.86367  -37.62104 1.000 71.46217  ? 28  LYS D CB  1 
ATOM   5960 C  CG  . LYS F 2 28  ? 29.79118 34.87945  -38.09324 1.000 71.11183  ? 28  LYS D CG  1 
ATOM   5961 C  CD  . LYS F 2 28  ? 28.49508 35.06845  -37.32670 1.000 75.43245  ? 28  LYS D CD  1 
ATOM   5962 C  CE  . LYS F 2 28  ? 27.39477 34.16131  -37.84340 1.000 75.91177  ? 28  LYS D CE  1 
ATOM   5963 N  NZ  . LYS F 2 28  ? 26.10668 34.46130  -37.16347 1.000 77.46385  ? 28  LYS D NZ  1 
ATOM   5964 N  N   . ARG F 2 29  ? 34.04096 36.53650  -36.98137 1.000 78.37811  ? 29  ARG D N   1 
ATOM   5965 C  CA  . ARG F 2 29  ? 35.04230 37.52543  -36.60507 1.000 79.68557  ? 29  ARG D CA  1 
ATOM   5966 C  C   . ARG F 2 29  ? 35.99255 37.79785  -37.75917 1.000 79.15614  ? 29  ARG D C   1 
ATOM   5967 O  O   . ARG F 2 29  ? 36.30595 38.95739  -38.05007 1.000 81.39523  ? 29  ARG D O   1 
ATOM   5968 C  CB  . ARG F 2 29  ? 35.82294 37.05602  -35.37852 1.000 79.39354  ? 29  ARG D CB  1 
ATOM   5969 C  CG  . ARG F 2 29  ? 35.03512 37.06495  -34.08661 1.000 79.66657  ? 29  ARG D CG  1 
ATOM   5970 C  CD  . ARG F 2 29  ? 34.55820 38.45902  -33.75590 1.000 80.85587  ? 29  ARG D CD  1 
ATOM   5971 N  NE  . ARG F 2 29  ? 33.98483 38.53439  -32.41756 1.000 85.16671  ? 29  ARG D NE  1 
ATOM   5972 C  CZ  . ARG F 2 29  ? 33.50101 39.65100  -31.88823 1.000 87.35209  ? 29  ARG D CZ  1 
ATOM   5973 N  NH1 . ARG F 2 29  ? 33.52232 40.77453  -32.59533 1.000 86.27137  ? 29  ARG D NH1 1 
ATOM   5974 N  NH2 . ARG F 2 29  ? 32.99540 39.64721  -30.66125 1.000 89.52914  ? 29  ARG D NH2 1 
ATOM   5975 N  N   . ILE F 2 30  ? 36.43872 36.74059  -38.44296 1.000 78.55246  ? 30  ILE D N   1 
ATOM   5976 C  CA  . ILE F 2 30  ? 37.30905 36.91140  -39.60420 1.000 75.40478  ? 30  ILE D CA  1 
ATOM   5977 C  C   . ILE F 2 30  ? 36.58562 37.68257  -40.69727 1.000 76.84119  ? 30  ILE D C   1 
ATOM   5978 O  O   . ILE F 2 30  ? 37.17192 38.54637  -41.36632 1.000 77.68287  ? 30  ILE D O   1 
ATOM   5979 C  CB  . ILE F 2 30  ? 37.80629 35.54113  -40.10094 1.000 73.19851  ? 30  ILE D CB  1 
ATOM   5980 C  CG1 . ILE F 2 30  ? 38.80701 34.94981  -39.10515 1.000 74.68954  ? 30  ILE D CG1 1 
ATOM   5981 C  CG2 . ILE F 2 30  ? 38.41217 35.65774  -41.47961 1.000 68.48444  ? 30  ILE D CG2 1 
ATOM   5982 C  CD1 . ILE F 2 30  ? 39.08028 33.48114  -39.33168 1.000 74.53602  ? 30  ILE D CD1 1 
ATOM   5983 N  N   . VAL F 2 31  ? 35.29201 37.40742  -40.87317 1.000 73.45731  ? 31  VAL D N   1 
ATOM   5984 C  CA  . VAL F 2 31  ? 34.49738 38.15643  -41.83896 1.000 73.76030  ? 31  VAL D CA  1 
ATOM   5985 C  C   . VAL F 2 31  ? 34.41040 39.62416  -41.43020 1.000 76.97104  ? 31  VAL D C   1 
ATOM   5986 O  O   . VAL F 2 31  ? 34.50095 40.52702  -42.27269 1.000 75.87129  ? 31  VAL D O   1 
ATOM   5987 C  CB  . VAL F 2 31  ? 33.10382 37.52099  -41.97935 1.000 73.51238  ? 31  VAL D CB  1 
ATOM   5988 C  CG1 . VAL F 2 31  ? 32.25724 38.32322  -42.94633 1.000 74.73264  ? 31  VAL D CG1 1 
ATOM   5989 C  CG2 . VAL F 2 31  ? 33.22248 36.09135  -42.45143 1.000 70.71382  ? 31  VAL D CG2 1 
ATOM   5990 N  N   . GLU F 2 32  ? 34.26438 39.89034  -40.13067 1.000 81.14118  ? 32  GLU D N   1 
ATOM   5991 C  CA  . GLU F 2 32  ? 34.17352 41.27552  -39.68165 1.000 84.36633  ? 32  GLU D CA  1 
ATOM   5992 C  C   . GLU F 2 32  ? 35.46482 42.03636  -39.96713 1.000 82.04400  ? 32  GLU D C   1 
ATOM   5993 O  O   . GLU F 2 32  ? 35.42541 43.20369  -40.36336 1.000 82.44049  ? 32  GLU D O   1 
ATOM   5994 C  CB  . GLU F 2 32  ? 33.83893 41.32367  -38.19188 1.000 91.75382  ? 32  GLU D CB  1 
ATOM   5995 C  CG  . GLU F 2 32  ? 33.64512 42.72098  -37.64021 1.000 98.10875  ? 32  GLU D CG  1 
ATOM   5996 C  CD  . GLU F 2 32  ? 33.49190 42.73030  -36.13277 1.000 108.13523 ? 32  GLU D CD  1 
ATOM   5997 O  OE1 . GLU F 2 32  ? 33.62987 41.65402  -35.50628 1.000 108.06115 ? 32  GLU D OE1 1 
ATOM   5998 O  OE2 . GLU F 2 32  ? 33.22892 43.81842  -35.57609 1.000 116.37866 ? 32  GLU D OE2 1 
ATOM   5999 N  N   . GLY F 2 33  ? 36.61918 41.38105  -39.82440 1.000 79.83155  ? 33  GLY D N   1 
ATOM   6000 C  CA  . GLY F 2 33  ? 37.87385 42.07638  -40.05471 1.000 80.91812  ? 33  GLY D CA  1 
ATOM   6001 C  C   . GLY F 2 33  ? 38.12325 42.43074  -41.50697 1.000 79.71188  ? 33  GLY D C   1 
ATOM   6002 O  O   . GLY F 2 33  ? 38.96726 43.29167  -41.79170 1.000 80.39929  ? 33  GLY D O   1 
ATOM   6003 N  N   . ILE F 2 34  ? 37.39501 41.80195  -42.42428 1.000 76.79292  ? 34  ILE D N   1 
ATOM   6004 C  CA  . ILE F 2 34  ? 37.57867 41.98800  -43.86163 1.000 70.85890  ? 34  ILE D CA  1 
ATOM   6005 C  C   . ILE F 2 34  ? 36.47022 42.84547  -44.47223 1.000 70.39756  ? 34  ILE D C   1 
ATOM   6006 O  O   . ILE F 2 34  ? 36.73984 43.77210  -45.23552 1.000 69.32656  ? 34  ILE D O   1 
ATOM   6007 C  CB  . ILE F 2 34  ? 37.66408 40.60883  -44.54865 1.000 66.77592  ? 34  ILE D CB  1 
ATOM   6008 C  CG1 . ILE F 2 34  ? 38.86973 39.82432  -44.00016 1.000 64.83513  ? 34  ILE D CG1 1 
ATOM   6009 C  CG2 . ILE F 2 34  ? 37.69380 40.79980  -46.05683 1.000 66.69679  ? 34  ILE D CG2 1 
ATOM   6010 C  CD1 . ILE F 2 34  ? 39.02574 38.38412  -44.50603 1.000 59.81428  ? 34  ILE D CD1 1 
ATOM   6011 N  N   . LEU F 2 35  ? 35.20800 42.52365  -44.17773 1.000 71.01348  ? 35  LEU D N   1 
ATOM   6012 C  CA  . LEU F 2 35  ? 34.05091 43.20957  -44.74641 1.000 69.92034  ? 35  LEU D CA  1 
ATOM   6013 C  C   . LEU F 2 35  ? 33.37260 44.14758  -43.75277 1.000 75.00231  ? 35  LEU D C   1 
ATOM   6014 O  O   . LEU F 2 35  ? 32.28418 44.65022  -44.04644 1.000 76.68086  ? 35  LEU D O   1 
ATOM   6015 C  CB  . LEU F 2 35  ? 33.02719 42.18628  -45.26821 1.000 64.66587  ? 35  LEU D CB  1 
ATOM   6016 C  CG  . LEU F 2 35  ? 33.55715 41.13068  -46.25962 1.000 58.10758  ? 35  LEU D CG  1 
ATOM   6017 C  CD1 . LEU F 2 35  ? 32.47440 40.18770  -46.80157 1.000 50.56790  ? 35  LEU D CD1 1 
ATOM   6018 C  CD2 . LEU F 2 35  ? 34.32212 41.78419  -47.40370 1.000 56.45119  ? 35  LEU D CD2 1 
ATOM   6019 N  N   . LYS F 2 36  ? 33.94055 44.32067  -42.55519 1.000 84.70718  ? 36  LYS D N   1 
ATOM   6020 C  CA  . LYS F 2 36  ? 33.55526 45.39639  -41.63686 1.000 84.03387  ? 36  LYS D CA  1 
ATOM   6021 C  C   . LYS F 2 36  ? 32.05327 45.38269  -41.33989 1.000 87.46046  ? 36  LYS D C   1 
ATOM   6022 O  O   . LYS F 2 36  ? 31.36827 46.40089  -41.43396 1.000 88.95354  ? 36  LYS D O   1 
ATOM   6023 C  CB  . LYS F 2 36  ? 34.01164 46.75735  -42.16429 1.000 82.25592  ? 36  LYS D CB  1 
ATOM   6024 C  CG  . LYS F 2 36  ? 35.51343 46.83459  -42.39859 1.000 81.19843  ? 36  LYS D CG  1 
ATOM   6025 C  CD  . LYS F 2 36  ? 35.92139 48.09160  -43.14907 1.000 84.79166  ? 36  LYS D CD  1 
ATOM   6026 C  CE  . LYS F 2 36  ? 37.42576 48.12787  -43.36589 1.000 85.80986  ? 36  LYS D CE  1 
ATOM   6027 N  NZ  . LYS F 2 36  ? 37.93826 46.82753  -43.89197 1.000 84.54762  ? 36  LYS D NZ  1 
ATOM   6028 N  N   . ARG F 2 37  ? 31.53987 44.20583  -40.96903 1.000 84.28432  ? 37  ARG D N   1 
ATOM   6029 C  CA  . ARG F 2 37  ? 30.16738 44.06646  -40.50691 1.000 82.07759  ? 37  ARG D CA  1 
ATOM   6030 C  C   . ARG F 2 37  ? 30.21213 43.25524  -39.22051 1.000 83.84983  ? 37  ARG D C   1 
ATOM   6031 O  O   . ARG F 2 37  ? 30.92367 42.23871  -39.15840 1.000 79.76473  ? 37  ARG D O   1 
ATOM   6032 C  CB  . ARG F 2 37  ? 29.25849 43.37779  -41.52741 1.000 75.92278  ? 37  ARG D CB  1 
ATOM   6033 C  CG  . ARG F 2 37  ? 29.14813 44.14692  -42.80948 1.000 74.07298  ? 37  ARG D CG  1 
ATOM   6034 C  CD  . ARG F 2 37  ? 28.36153 45.42700  -42.62546 1.000 75.85571  ? 37  ARG D CD  1 
ATOM   6035 N  NE  . ARG F 2 37  ? 26.91977 45.22537  -42.55142 1.000 75.30741  ? 37  ARG D NE  1 
ATOM   6036 C  CZ  . ARG F 2 37  ? 26.12906 45.16389  -43.61904 1.000 76.10852  ? 37  ARG D CZ  1 
ATOM   6037 N  NH1 . ARG F 2 37  ? 26.64312 45.27144  -44.84435 1.000 72.51573  ? 37  ARG D NH1 1 
ATOM   6038 N  NH2 . ARG F 2 37  ? 24.82345 44.99429  -43.46826 1.000 79.30205  ? 37  ARG D NH2 1 
ATOM   6039 N  N   . PRO F 2 38  ? 29.51666 43.68964  -38.17032 1.000 91.84810  ? 38  PRO D N   1 
ATOM   6040 C  CA  . PRO F 2 38  ? 29.55645 42.95330  -36.91147 1.000 90.95266  ? 38  PRO D CA  1 
ATOM   6041 C  C   . PRO F 2 38  ? 28.93219 41.57289  -37.07237 1.000 90.30198  ? 38  PRO D C   1 
ATOM   6042 O  O   . PRO F 2 38  ? 28.03304 41.37756  -37.90698 1.000 89.13189  ? 38  PRO D O   1 
ATOM   6043 C  CB  . PRO F 2 38  ? 28.73906 43.83223  -35.95752 1.000 96.56164  ? 38  PRO D CB  1 
ATOM   6044 C  CG  . PRO F 2 38  ? 27.86681 44.65072  -36.85579 1.000 101.06032 ? 38  PRO D CG  1 
ATOM   6045 C  CD  . PRO F 2 38  ? 28.69471 44.90932  -38.07313 1.000 97.48714  ? 38  PRO D CD  1 
ATOM   6046 N  N   . PRO F 2 39  ? 29.37838 40.60085  -36.27521 1.000 90.85509  ? 39  PRO D N   1 
ATOM   6047 C  CA  . PRO F 2 39  ? 28.84497 39.23303  -36.41617 1.000 93.54341  ? 39  PRO D CA  1 
ATOM   6048 C  C   . PRO F 2 39  ? 27.34470 39.10729  -36.19203 1.000 101.70926 ? 39  PRO D C   1 
ATOM   6049 O  O   . PRO F 2 39  ? 26.73286 38.19090  -36.74996 1.000 104.21403 ? 39  PRO D O   1 
ATOM   6050 C  CB  . PRO F 2 39  ? 29.61180 38.45621  -35.33983 1.000 90.72781  ? 39  PRO D CB  1 
ATOM   6051 C  CG  . PRO F 2 39  ? 30.86150 39.22630  -35.14418 1.000 89.09275  ? 39  PRO D CG  1 
ATOM   6052 C  CD  . PRO F 2 39  ? 30.49047 40.66521  -35.31587 1.000 89.75288  ? 39  PRO D CD  1 
ATOM   6053 N  N   . ASP F 2 40  ? 26.72347 39.99904  -35.41480 1.000 107.56492 ? 40  ASP D N   1 
ATOM   6054 C  CA  . ASP F 2 40  ? 25.28544 39.90305  -35.19933 1.000 112.32962 ? 40  ASP D CA  1 
ATOM   6055 C  C   . ASP F 2 40  ? 24.47870 40.22441  -36.45434 1.000 111.24460 ? 40  ASP D C   1 
ATOM   6056 O  O   . ASP F 2 40  ? 23.29308 39.87623  -36.51232 1.000 114.19065 ? 40  ASP D O   1 
ATOM   6057 C  CB  . ASP F 2 40  ? 24.85640 40.80058  -34.03722 1.000 119.17655 ? 40  ASP D CB  1 
ATOM   6058 C  CG  . ASP F 2 40  ? 25.43599 42.19472  -34.12856 1.000 127.97210 ? 40  ASP D CG  1 
ATOM   6059 O  OD1 . ASP F 2 40  ? 25.69305 42.66098  -35.25775 1.000 133.25419 ? 40  ASP D OD1 1 
ATOM   6060 O  OD2 . ASP F 2 40  ? 25.63426 42.82885  -33.07066 1.000 129.49618 ? 40  ASP D OD2 1 
ATOM   6061 N  N   . GLU F 2 41  ? 25.08181 40.87013  -37.45421 1.000 106.16262 ? 41  GLU D N   1 
ATOM   6062 C  CA  . GLU F 2 41  ? 24.37403 41.26445  -38.66450 1.000 102.31958 ? 41  GLU D CA  1 
ATOM   6063 C  C   . GLU F 2 41  ? 24.59182 40.30409  -39.82025 1.000 97.86273  ? 41  GLU D C   1 
ATOM   6064 O  O   . GLU F 2 41  ? 24.19062 40.61644  -40.94612 1.000 98.38797  ? 41  GLU D O   1 
ATOM   6065 C  CB  . GLU F 2 41  ? 24.79179 42.66926  -39.12338 1.000 103.67099 ? 41  GLU D CB  1 
ATOM   6066 C  CG  . GLU F 2 41  ? 24.40224 43.82420  -38.21949 1.000 104.40558 ? 41  GLU D CG  1 
ATOM   6067 C  CD  . GLU F 2 41  ? 24.77838 45.17355  -38.81800 1.000 103.16853 ? 41  GLU D CD  1 
ATOM   6068 O  OE1 . GLU F 2 41  ? 24.81525 45.28710  -40.06242 1.000 101.89875 ? 41  GLU D OE1 1 
ATOM   6069 O  OE2 . GLU F 2 41  ? 25.04772 46.11675  -38.04505 1.000 102.67352 ? 41  GLU D OE2 1 
ATOM   6070 N  N   . GLN F 2 42  ? 25.23146 39.16028  -39.59396 1.000 92.03733  ? 42  GLN D N   1 
ATOM   6071 C  CA  . GLN F 2 42  ? 25.54446 38.25037  -40.69204 1.000 86.55624  ? 42  GLN D CA  1 
ATOM   6072 C  C   . GLN F 2 42  ? 25.15449 36.82473  -40.32884 1.000 82.47967  ? 42  GLN D C   1 
ATOM   6073 O  O   . GLN F 2 42  ? 25.43489 36.35645  -39.22037 1.000 80.36947  ? 42  GLN D O   1 
ATOM   6074 C  CB  . GLN F 2 42  ? 27.03216 38.31456  -41.07899 1.000 82.63766  ? 42  GLN D CB  1 
ATOM   6075 C  CG  . GLN F 2 42  ? 27.99837 38.47399  -39.91984 1.000 81.57019  ? 42  GLN D CG  1 
ATOM   6076 C  CD  . GLN F 2 42  ? 29.44723 38.32419  -40.35186 1.000 79.55527  ? 42  GLN D CD  1 
ATOM   6077 O  OE1 . GLN F 2 42  ? 29.80506 37.35214  -41.01262 1.000 78.89133  ? 42  GLN D OE1 1 
ATOM   6078 N  NE2 . GLN F 2 42  ? 30.29278 39.27070  -39.95944 1.000 79.21193  ? 42  GLN D NE2 1 
ATOM   6079 N  N   . ARG F 2 43  ? 24.49523 36.14902  -41.26089 1.000 82.14273  ? 43  ARG D N   1 
ATOM   6080 C  CA  . ARG F 2 43  ? 24.19429 34.73499  -41.12789 1.000 84.28857  ? 43  ARG D CA  1 
ATOM   6081 C  C   . ARG F 2 43  ? 25.11553 33.92948  -42.04119 1.000 80.18696  ? 43  ARG D C   1 
ATOM   6082 O  O   . ARG F 2 43  ? 25.34271 34.30095  -43.19981 1.000 75.71148  ? 43  ARG D O   1 
ATOM   6083 C  CB  . ARG F 2 43  ? 22.72159 34.46732  -41.46109 1.000 86.77513  ? 43  ARG D CB  1 
ATOM   6084 C  CG  . ARG F 2 43  ? 21.75863 34.81511  -40.32454 1.000 90.11652  ? 43  ARG D CG  1 
ATOM   6085 C  CD  . ARG F 2 43  ? 20.31148 34.71813  -40.78931 1.000 93.17799  ? 43  ARG D CD  1 
ATOM   6086 N  NE  . ARG F 2 43  ? 19.36699 34.65649  -39.67774 1.000 96.43998  ? 43  ARG D NE  1 
ATOM   6087 C  CZ  . ARG F 2 43  ? 18.04525 34.71365  -39.81712 1.000 99.51196  ? 43  ARG D CZ  1 
ATOM   6088 N  NH1 . ARG F 2 43  ? 17.26067 34.65600  -38.74704 1.000 102.81994 ? 43  ARG D NH1 1 
ATOM   6089 N  NH2 . ARG F 2 43  ? 17.50564 34.82363  -41.02518 1.000 99.69516  ? 43  ARG D NH2 1 
ATOM   6090 N  N   . LEU F 2 44  ? 25.65784 32.83275  -41.51750 1.000 80.15644  ? 44  LEU D N   1 
ATOM   6091 C  CA  . LEU F 2 44  ? 26.47445 31.92986  -42.31567 1.000 77.35053  ? 44  LEU D CA  1 
ATOM   6092 C  C   . LEU F 2 44  ? 25.70437 30.65539  -42.62728 1.000 79.74975  ? 44  LEU D C   1 
ATOM   6093 O  O   . LEU F 2 44  ? 25.02114 30.09620  -41.76331 1.000 81.41567  ? 44  LEU D O   1 
ATOM   6094 C  CB  . LEU F 2 44  ? 27.79856 31.58740  -41.62072 1.000 74.56900  ? 44  LEU D CB  1 
ATOM   6095 C  CG  . LEU F 2 44  ? 28.82955 32.71417  -41.50916 1.000 71.35237  ? 44  LEU D CG  1 
ATOM   6096 C  CD1 . LEU F 2 44  ? 30.15290 32.21783  -40.96572 1.000 70.86291  ? 44  LEU D CD1 1 
ATOM   6097 C  CD2 . LEU F 2 44  ? 29.03972 33.33823  -42.85574 1.000 69.23452  ? 44  LEU D CD2 1 
ATOM   6098 N  N   . TYR F 2 45  ? 25.83381 30.19514  -43.86658 1.000 78.20136  ? 45  TYR D N   1 
ATOM   6099 C  CA  . TYR F 2 45  ? 25.09246 29.05020  -44.37329 1.000 77.64548  ? 45  TYR D CA  1 
ATOM   6100 C  C   . TYR F 2 45  ? 26.06147 28.01629  -44.93589 1.000 75.32007  ? 45  TYR D C   1 
ATOM   6101 O  O   . TYR F 2 45  ? 27.06900 28.36842  -45.54377 1.000 76.20012  ? 45  TYR D O   1 
ATOM   6102 C  CB  . TYR F 2 45  ? 24.11707 29.47590  -45.49824 1.000 76.62565  ? 45  TYR D CB  1 
ATOM   6103 C  CG  . TYR F 2 45  ? 22.92216 30.31109  -45.07482 1.000 78.46833  ? 45  TYR D CG  1 
ATOM   6104 C  CD1 . TYR F 2 45  ? 22.98424 31.70187  -45.03328 1.000 82.00849  ? 45  TYR D CD1 1 
ATOM   6105 C  CD2 . TYR F 2 45  ? 21.72161 29.70504  -44.73645 1.000 79.92381  ? 45  TYR D CD2 1 
ATOM   6106 C  CE1 . TYR F 2 45  ? 21.87860 32.46045  -44.64822 1.000 84.74625  ? 45  TYR D CE1 1 
ATOM   6107 C  CE2 . TYR F 2 45  ? 20.62322 30.44458  -44.35141 1.000 83.34988  ? 45  TYR D CE2 1 
ATOM   6108 C  CZ  . TYR F 2 45  ? 20.70170 31.81870  -44.30802 1.000 86.02829  ? 45  TYR D CZ  1 
ATOM   6109 O  OH  . TYR F 2 45  ? 19.59829 32.54580  -43.92007 1.000 88.10923  ? 45  TYR D OH  1 
ATOM   6110 N  N   . LYS F 2 46  ? 25.75282 26.74162  -44.74831 1.000 73.23362  ? 46  LYS D N   1 
ATOM   6111 C  CA  . LYS F 2 46  ? 26.40793 25.68772  -45.50300 1.000 72.55255  ? 46  LYS D CA  1 
ATOM   6112 C  C   . LYS F 2 46  ? 25.32444 25.10288  -46.38150 1.000 74.36193  ? 46  LYS D C   1 
ATOM   6113 O  O   . LYS F 2 46  ? 24.31289 24.62931  -45.86298 1.000 75.51232  ? 46  LYS D O   1 
ATOM   6114 C  CB  . LYS F 2 46  ? 27.03005 24.60770  -44.62618 1.000 74.42910  ? 46  LYS D CB  1 
ATOM   6115 C  CG  . LYS F 2 46  ? 27.41684 23.39514  -45.45139 1.000 75.71382  ? 46  LYS D CG  1 
ATOM   6116 C  CD  . LYS F 2 46  ? 28.03936 22.30135  -44.62435 1.000 80.52023  ? 46  LYS D CD  1 
ATOM   6117 C  CE  . LYS F 2 46  ? 28.18510 21.04847  -45.45716 1.000 82.84041  ? 46  LYS D CE  1 
ATOM   6118 N  NZ  . LYS F 2 46  ? 28.81587 21.39243  -46.75255 1.000 82.61797  ? 46  LYS D NZ  1 
ATOM   6119 N  N   . ASP F 2 47  ? 25.51944 25.15596  -47.69750 1.000 76.50256  ? 47  ASP D N   1 
ATOM   6120 C  CA  . ASP F 2 47  ? 24.47013 24.78165  -48.64916 1.000 82.07863  ? 47  ASP D CA  1 
ATOM   6121 C  C   . ASP F 2 47  ? 23.27154 25.67153  -48.32662 1.000 87.49932  ? 47  ASP D C   1 
ATOM   6122 O  O   . ASP F 2 47  ? 23.39723 26.90245  -48.44690 1.000 88.07092  ? 47  ASP D O   1 
ATOM   6123 C  CB  . ASP F 2 47  ? 24.23819 23.26616  -48.61432 1.000 84.97604  ? 47  ASP D CB  1 
ATOM   6124 C  CG  . ASP F 2 47  ? 25.38834 22.45888  -49.27215 1.000 86.70416  ? 47  ASP D CG  1 
ATOM   6125 O  OD1 . ASP F 2 47  ? 25.84459 22.81036  -50.38847 1.000 85.51927  ? 47  ASP D OD1 1 
ATOM   6126 O  OD2 . ASP F 2 47  ? 25.82363 21.44191  -48.68129 1.000 88.28485  ? 47  ASP D OD2 1 
ATOM   6127 N  N   . ASP F 2 48  ? 22.11277 25.13998  -47.92916 1.000 93.19053  ? 48  ASP D N   1 
ATOM   6128 C  CA  . ASP F 2 48  ? 20.98456 26.00512  -47.58452 1.000 97.87695  ? 48  ASP D CA  1 
ATOM   6129 C  C   . ASP F 2 48  ? 20.56339 25.91248  -46.11723 1.000 98.60456  ? 48  ASP D C   1 
ATOM   6130 O  O   . ASP F 2 48  ? 19.47268 26.37810  -45.77123 1.000 102.47317 ? 48  ASP D O   1 
ATOM   6131 C  CB  . ASP F 2 48  ? 19.78622 25.71912  -48.49448 1.000 103.51020 ? 48  ASP D CB  1 
ATOM   6132 C  CG  . ASP F 2 48  ? 19.24678 24.30853  -48.32822 1.000 110.24960 ? 48  ASP D CG  1 
ATOM   6133 O  OD1 . ASP F 2 48  ? 19.94632 23.45898  -47.72992 1.000 112.46291 ? 48  ASP D OD1 1 
ATOM   6134 O  OD2 . ASP F 2 48  ? 18.12301 24.03924  -48.80122 1.000 112.88984 ? 48  ASP D OD2 1 
ATOM   6135 N  N   . GLN F 2 49  ? 21.41582 25.40187  -45.23150 1.000 97.21772  ? 49  GLN D N   1 
ATOM   6136 C  CA  . GLN F 2 49  ? 21.08021 25.27382  -43.81656 1.000 100.38474 ? 49  GLN D CA  1 
ATOM   6137 C  C   . GLN F 2 49  ? 21.78972 26.36860  -43.02908 1.000 99.85903  ? 49  GLN D C   1 
ATOM   6138 O  O   . GLN F 2 49  ? 23.00235 26.55622  -43.17012 1.000 100.22933 ? 49  GLN D O   1 
ATOM   6139 C  CB  . GLN F 2 49  ? 21.45440 23.89220  -43.26537 1.000 102.18462 ? 49  GLN D CB  1 
ATOM   6140 C  CG  . GLN F 2 49  ? 21.35853 23.79302  -41.72918 1.000 106.88727 ? 49  GLN D CG  1 
ATOM   6141 C  CD  . GLN F 2 49  ? 21.71354 22.41487  -41.15843 1.000 113.02427 ? 49  GLN D CD  1 
ATOM   6142 O  OE1 . GLN F 2 49  ? 21.00730 21.42635  -41.38650 1.000 116.02176 ? 49  GLN D OE1 1 
ATOM   6143 N  NE2 . GLN F 2 49  ? 22.79292 22.35589  -40.38360 1.000 113.45294 ? 49  GLN D NE2 1 
ATOM   6144 N  N   . LEU F 2 50  ? 21.03468 27.07612  -42.19013 1.000 98.02689  ? 50  LEU D N   1 
ATOM   6145 C  CA  . LEU F 2 50  ? 21.61716 28.08310  -41.31626 1.000 94.57264  ? 50  LEU D CA  1 
ATOM   6146 C  C   . LEU F 2 50  ? 22.49681 27.41190  -40.26861 1.000 94.92203  ? 50  LEU D C   1 
ATOM   6147 O  O   . LEU F 2 50  ? 22.21532 26.29690  -39.81650 1.000 97.55835  ? 50  LEU D O   1 
ATOM   6148 C  CB  . LEU F 2 50  ? 20.51752 28.89317  -40.63774 1.000 94.68834  ? 50  LEU D CB  1 
ATOM   6149 C  CG  . LEU F 2 50  ? 20.95246 29.96307  -39.64344 1.000 95.18397  ? 50  LEU D CG  1 
ATOM   6150 C  CD1 . LEU F 2 50  ? 21.91205 30.93436  -40.31648 1.000 94.38227  ? 50  LEU D CD1 1 
ATOM   6151 C  CD2 . LEU F 2 50  ? 19.73705 30.68966  -39.09857 1.000 96.78889  ? 50  LEU D CD2 1 
ATOM   6152 N  N   . LEU F 2 51  ? 23.58289 28.09251  -39.89650 1.000 92.48041  ? 51  LEU D N   1 
ATOM   6153 C  CA  . LEU F 2 51  ? 24.56729 27.55438  -38.96360 1.000 90.79064  ? 51  LEU D CA  1 
ATOM   6154 C  C   . LEU F 2 51  ? 24.46351 28.23428  -37.60226 1.000 95.58933  ? 51  LEU D C   1 
ATOM   6155 O  O   . LEU F 2 51  ? 24.27674 29.45155  -37.51720 1.000 95.86214  ? 51  LEU D O   1 
ATOM   6156 C  CB  . LEU F 2 51  ? 25.98585 27.70715  -39.51082 1.000 85.20963  ? 51  LEU D CB  1 
ATOM   6157 C  CG  . LEU F 2 51  ? 26.22719 26.99346  -40.83878 1.000 80.66877  ? 51  LEU D CG  1 
ATOM   6158 C  CD1 . LEU F 2 51  ? 27.70507 27.02495  -41.20010 1.000 78.80291  ? 51  LEU D CD1 1 
ATOM   6159 C  CD2 . LEU F 2 51  ? 25.69985 25.56306  -40.79309 1.000 79.38809  ? 51  LEU D CD2 1 
ATOM   6160 N  N   . ASP F 2 52  ? 24.58229 27.43980  -36.53762 1.000 99.59611  ? 52  ASP D N   1 
ATOM   6161 C  CA  . ASP F 2 52  ? 24.53330 27.95170  -35.17354 1.000 103.25497 ? 52  ASP D CA  1 
ATOM   6162 C  C   . ASP F 2 52  ? 25.92242 28.41650  -34.74144 1.000 100.63242 ? 52  ASP D C   1 
ATOM   6163 O  O   . ASP F 2 52  ? 26.91153 27.70339  -34.93481 1.000 99.13966  ? 52  ASP D O   1 
ATOM   6164 C  CB  . ASP F 2 52  ? 24.00108 26.86658  -34.23433 1.000 108.67834 ? 52  ASP D CB  1 
ATOM   6165 C  CG  . ASP F 2 52  ? 23.66357 27.39400  -32.86090 1.000 116.36905 ? 52  ASP D CG  1 
ATOM   6166 O  OD1 . ASP F 2 52  ? 23.38413 28.60512  -32.74919 1.000 117.73322 ? 52  ASP D OD1 1 
ATOM   6167 O  OD2 . ASP F 2 52  ? 23.65825 26.59568  -31.89738 1.000 121.84927 ? 52  ASP D OD2 1 
ATOM   6168 N  N   . ASP F 2 53  ? 25.97876 29.59461  -34.09975 1.000 99.80328  ? 53  ASP D N   1 
ATOM   6169 C  CA  . ASP F 2 53  ? 27.26182 30.22364  -33.76845 1.000 97.36969  ? 53  ASP D CA  1 
ATOM   6170 C  C   . ASP F 2 53  ? 28.14112 29.34851  -32.89100 1.000 94.47136  ? 53  ASP D C   1 
ATOM   6171 O  O   . ASP F 2 53  ? 29.37271 29.40722  -32.99595 1.000 90.95153  ? 53  ASP D O   1 
ATOM   6172 C  CB  . ASP F 2 53  ? 27.04220 31.56588  -33.06814 1.000 100.39636 ? 53  ASP D CB  1 
ATOM   6173 C  CG  . ASP F 2 53  ? 26.39929 32.58757  -33.96175 1.000 102.95170 ? 53  ASP D CG  1 
ATOM   6174 O  OD1 . ASP F 2 53  ? 26.41720 32.37337  -35.19149 1.000 104.88719 ? 53  ASP D OD1 1 
ATOM   6175 O  OD2 . ASP F 2 53  ? 25.87838 33.59791  -33.44032 1.000 103.46757 ? 53  ASP D OD2 1 
ATOM   6176 N  N   . GLY F 2 54  ? 27.53646 28.54408  -32.01661 1.000 96.46726  ? 54  GLY D N   1 
ATOM   6177 C  CA  . GLY F 2 54  ? 28.31256 27.75882  -31.07596 1.000 96.81730  ? 54  GLY D CA  1 
ATOM   6178 C  C   . GLY F 2 54  ? 28.94131 26.51503  -31.66188 1.000 96.21557  ? 54  GLY D C   1 
ATOM   6179 O  O   . GLY F 2 54  ? 29.92412 26.01785  -31.10453 1.000 95.09583  ? 54  GLY D O   1 
ATOM   6180 N  N   . LYS F 2 55  ? 28.39659 25.99697  -32.76333 1.000 96.06086  ? 55  LYS D N   1 
ATOM   6181 C  CA  . LYS F 2 55  ? 28.89699 24.75090  -33.33154 1.000 96.34604  ? 55  LYS D CA  1 
ATOM   6182 C  C   . LYS F 2 55  ? 30.27345 24.94463  -33.96195 1.000 95.13889  ? 55  LYS D C   1 
ATOM   6183 O  O   . LYS F 2 55  ? 30.54724 25.96427  -34.59769 1.000 94.79125  ? 55  LYS D O   1 
ATOM   6184 C  CB  . LYS F 2 55  ? 27.91062 24.19846  -34.36723 1.000 95.30452  ? 55  LYS D CB  1 
ATOM   6185 C  CG  . LYS F 2 55  ? 26.64564 23.58570  -33.74899 1.000 97.63641  ? 55  LYS D CG  1 
ATOM   6186 C  CD  . LYS F 2 55  ? 25.74004 22.89172  -34.78008 1.000 97.43470  ? 55  LYS D CD  1 
ATOM   6187 C  CE  . LYS F 2 55  ? 24.52851 22.22051  -34.10947 1.000 99.26317  ? 55  LYS D CE  1 
ATOM   6188 N  NZ  . LYS F 2 55  ? 23.63098 21.49868  -35.06876 1.000 98.87930  ? 55  LYS D NZ  1 
ATOM   6189 N  N   . THR F 2 56  ? 31.15363 23.96524  -33.75782 1.000 96.27646  ? 56  THR D N   1 
ATOM   6190 C  CA  . THR F 2 56  ? 32.45806 23.98792  -34.40105 1.000 95.84584  ? 56  THR D CA  1 
ATOM   6191 C  C   . THR F 2 56  ? 32.28270 23.74529  -35.89478 1.000 95.73217  ? 56  THR D C   1 
ATOM   6192 O  O   . THR F 2 56  ? 31.24737 23.25077  -36.34824 1.000 95.55232  ? 56  THR D O   1 
ATOM   6193 C  CB  . THR F 2 56  ? 33.40366 22.94179  -33.79040 1.000 100.01752 ? 56  THR D CB  1 
ATOM   6194 O  OG1 . THR F 2 56  ? 32.91724 21.61199  -34.04083 1.000 101.46866 ? 56  THR D OG1 1 
ATOM   6195 C  CG2 . THR F 2 56  ? 33.56373 23.16139  -32.28340 1.000 101.04243 ? 56  THR D CG2 1 
ATOM   6196 N  N   . LEU F 2 57  ? 33.29810 24.12452  -36.67221 1.000 96.80468  ? 57  LEU D N   1 
ATOM   6197 C  CA  . LEU F 2 57  ? 33.21085 23.90627  -38.11262 1.000 95.96842  ? 57  LEU D CA  1 
ATOM   6198 C  C   . LEU F 2 57  ? 33.04615 22.42232  -38.42602 1.000 98.32431  ? 57  LEU D C   1 
ATOM   6199 O  O   . LEU F 2 57  ? 32.24895 22.04970  -39.29742 1.000 97.67235  ? 57  LEU D O   1 
ATOM   6200 C  CB  . LEU F 2 57  ? 34.43928 24.49680  -38.81253 1.000 91.95076  ? 57  LEU D CB  1 
ATOM   6201 C  CG  . LEU F 2 57  ? 34.64160 26.01396  -38.63373 1.000 88.05263  ? 57  LEU D CG  1 
ATOM   6202 C  CD1 . LEU F 2 57  ? 35.83804 26.54783  -39.41328 1.000 85.66959  ? 57  LEU D CD1 1 
ATOM   6203 C  CD2 . LEU F 2 57  ? 33.38941 26.80011  -38.99947 1.000 85.00339  ? 57  LEU D CD2 1 
ATOM   6204 N  N   . GLY F 2 58  ? 33.74408 21.55754  -37.68176 1.000 98.98688  ? 58  GLY D N   1 
ATOM   6205 C  CA  . GLY F 2 58  ? 33.58532 20.12614  -37.88623 1.000 99.77167  ? 58  GLY D CA  1 
ATOM   6206 C  C   . GLY F 2 58  ? 32.16907 19.65617  -37.61664 1.000 101.70788 ? 58  GLY D C   1 
ATOM   6207 O  O   . GLY F 2 58  ? 31.62534 18.83253  -38.35832 1.000 100.64175 ? 58  GLY D O   1 
ATOM   6208 N  N   . GLU F 2 59  ? 31.53994 20.20049  -36.57279 1.000 106.74566 ? 59  GLU D N   1 
ATOM   6209 C  CA  . GLU F 2 59  ? 30.16373 19.82921  -36.26343 1.000 110.68321 ? 59  GLU D CA  1 
ATOM   6210 C  C   . GLU F 2 59  ? 29.21080 20.19269  -37.39748 1.000 114.12342 ? 59  GLU D C   1 
ATOM   6211 O  O   . GLU F 2 59  ? 28.21175 19.49571  -37.61522 1.000 115.96006 ? 59  GLU D O   1 
ATOM   6212 C  CB  . GLU F 2 59  ? 29.72089 20.51323  -34.96961 1.000 113.49908 ? 59  GLU D CB  1 
ATOM   6213 C  CG  . GLU F 2 59  ? 28.25880 20.30022  -34.61193 1.000 116.67432 ? 59  GLU D CG  1 
ATOM   6214 C  CD  . GLU F 2 59  ? 28.06666 20.07644  -33.12897 1.000 122.80537 ? 59  GLU D CD  1 
ATOM   6215 O  OE1 . GLU F 2 59  ? 29.01670 20.37200  -32.37170 1.000 125.31091 ? 59  GLU D OE1 1 
ATOM   6216 O  OE2 . GLU F 2 59  ? 26.97853 19.61207  -32.71860 1.000 124.90212 ? 59  GLU D OE2 1 
ATOM   6217 N  N   . CYS F 2 60  ? 29.49339 21.28130  -38.12105 1.000 111.95977 ? 60  CYS D N   1 
ATOM   6218 C  CA  . CYS F 2 60  ? 28.62283 21.75259  -39.19433 1.000 109.77227 ? 60  CYS D CA  1 
ATOM   6219 C  C   . CYS F 2 60  ? 28.74559 20.94874  -40.47764 1.000 107.43262 ? 60  CYS D C   1 
ATOM   6220 O  O   . CYS F 2 60  ? 27.89353 21.09371  -41.36066 1.000 108.89506 ? 60  CYS D O   1 
ATOM   6221 C  CB  . CYS F 2 60  ? 28.89139 23.22668  -39.47879 1.000 106.53900 ? 60  CYS D CB  1 
ATOM   6222 S  SG  . CYS F 2 60  ? 28.67006 24.23370  -38.01724 1.000 109.06056 ? 60  CYS D SG  1 
ATOM   6223 N  N   . GLY F 2 61  ? 29.78426 20.13789  -40.61808 1.000 109.78129 ? 61  GLY D N   1 
ATOM   6224 C  CA  . GLY F 2 61  ? 29.94057 19.32975  -41.81042 1.000 109.18976 ? 61  GLY D CA  1 
ATOM   6225 C  C   . GLY F 2 61  ? 31.18401 19.67585  -42.59746 1.000 104.76977 ? 61  GLY D C   1 
ATOM   6226 O  O   . GLY F 2 61  ? 31.38159 19.17152  -43.70716 1.000 103.42970 ? 61  GLY D O   1 
ATOM   6227 N  N   . PHE F 2 62  ? 32.03800 20.52518  -42.02980 1.000 102.46590 ? 62  PHE D N   1 
ATOM   6228 C  CA  . PHE F 2 62  ? 33.29146 20.92229  -42.66681 1.000 101.17494 ? 62  PHE D CA  1 
ATOM   6229 C  C   . PHE F 2 62  ? 34.41805 20.10085  -42.04957 1.000 106.01551 ? 62  PHE D C   1 
ATOM   6230 O  O   . PHE F 2 62  ? 35.01532 20.48144  -41.04250 1.000 105.71408 ? 62  PHE D O   1 
ATOM   6231 C  CB  . PHE F 2 62  ? 33.53806 22.42557  -42.53928 1.000 95.39438  ? 62  PHE D CB  1 
ATOM   6232 C  CG  . PHE F 2 62  ? 32.50746 23.26596  -43.24179 1.000 88.66003  ? 62  PHE D CG  1 
ATOM   6233 C  CD1 . PHE F 2 62  ? 32.53732 23.40465  -44.61689 1.000 84.85654  ? 62  PHE D CD1 1 
ATOM   6234 C  CD2 . PHE F 2 62  ? 31.52183 23.92874  -42.52940 1.000 87.31951  ? 62  PHE D CD2 1 
ATOM   6235 C  CE1 . PHE F 2 62  ? 31.59109 24.16477  -45.27290 1.000 83.37129  ? 62  PHE D CE1 1 
ATOM   6236 C  CE2 . PHE F 2 62  ? 30.57107 24.70076  -43.18114 1.000 84.48427  ? 62  PHE D CE2 1 
ATOM   6237 C  CZ  . PHE F 2 62  ? 30.60770 24.81827  -44.55372 1.000 82.86661  ? 62  PHE D CZ  1 
ATOM   6238 N  N   . THR F 2 63  ? 34.68373 18.94636  -42.65010 1.000 110.30334 ? 63  THR D N   1 
ATOM   6239 C  CA  . THR F 2 63  ? 35.85038 18.14909  -42.31030 1.000 111.97373 ? 63  THR D CA  1 
ATOM   6240 C  C   . THR F 2 63  ? 37.01779 18.54663  -43.20728 1.000 114.80949 ? 63  THR D C   1 
ATOM   6241 O  O   . THR F 2 63  ? 36.83568 19.13714  -44.27465 1.000 116.30803 ? 63  THR D O   1 
ATOM   6242 C  CB  . THR F 2 63  ? 35.55773 16.65790  -42.46327 1.000 109.53736 ? 63  THR D CB  1 
ATOM   6243 O  OG1 . THR F 2 63  ? 34.98002 16.41477  -43.75328 1.000 106.23971 ? 63  THR D OG1 1 
ATOM   6244 C  CG2 . THR F 2 63  ? 34.60061 16.19264  -41.38181 1.000 110.58112 ? 63  THR D CG2 1 
ATOM   6245 N  N   . SER F 2 64  ? 38.23284 18.21805  -42.75869 1.000 115.76803 ? 64  SER D N   1 
ATOM   6246 C  CA  . SER F 2 64  ? 39.41746 18.53254  -43.55198 1.000 116.65635 ? 64  SER D CA  1 
ATOM   6247 C  C   . SER F 2 64  ? 39.37550 17.88076  -44.92986 1.000 118.97811 ? 64  SER D C   1 
ATOM   6248 O  O   . SER F 2 64  ? 40.04436 18.36472  -45.85018 1.000 117.16337 ? 64  SER D O   1 
ATOM   6249 C  CB  . SER F 2 64  ? 40.68264 18.10637  -42.79682 1.000 119.42535 ? 64  SER D CB  1 
ATOM   6250 O  OG  . SER F 2 64  ? 40.64451 16.73019  -42.45123 1.000 122.75187 ? 64  SER D OG  1 
ATOM   6251 N  N   . GLN F 2 65  ? 38.57751 16.81549  -45.09196 1.000 123.27550 ? 65  GLN D N   1 
ATOM   6252 C  CA  . GLN F 2 65  ? 38.42432 16.11885  -46.36783 1.000 125.40278 ? 65  GLN D CA  1 
ATOM   6253 C  C   . GLN F 2 65  ? 37.40542 16.78658  -47.28840 1.000 118.28001 ? 65  GLN D C   1 
ATOM   6254 O  O   . GLN F 2 65  ? 37.49577 16.63073  -48.51173 1.000 116.46598 ? 65  GLN D O   1 
ATOM   6255 C  CB  . GLN F 2 65  ? 38.02687 14.66130  -46.12740 1.000 134.60620 ? 65  GLN D CB  1 
ATOM   6256 C  CG  . GLN F 2 65  ? 39.13437 13.78886  -45.56568 1.000 142.27832 ? 65  GLN D CG  1 
ATOM   6257 C  CD  . GLN F 2 65  ? 40.17948 13.44914  -46.61301 1.000 146.19248 ? 65  GLN D CD  1 
ATOM   6258 O  OE1 . GLN F 2 65  ? 41.03902 14.27070  -46.94000 1.000 144.09860 ? 65  GLN D OE1 1 
ATOM   6259 N  NE2 . GLN F 2 65  ? 40.10409 12.23559  -47.15216 1.000 146.19700 ? 65  GLN D NE2 1 
ATOM   6260 N  N   . THR F 2 66  ? 36.40017 17.46861  -46.72701 1.000 114.15693 ? 66  THR D N   1 
ATOM   6261 C  CA  . THR F 2 66  ? 35.41497 18.18209  -47.53724 1.000 109.51064 ? 66  THR D CA  1 
ATOM   6262 C  C   . THR F 2 66  ? 35.96462 19.51953  -48.01177 1.000 102.11725 ? 66  THR D C   1 
ATOM   6263 O  O   . THR F 2 66  ? 35.81624 19.88574  -49.18262 1.000 101.88068 ? 66  THR D O   1 
ATOM   6264 C  CB  . THR F 2 66  ? 34.13052 18.42359  -46.73797 1.000 113.23899 ? 66  THR D CB  1 
ATOM   6265 O  OG1 . THR F 2 66  ? 33.65041 17.19241  -46.18206 1.000 117.97303 ? 66  THR D OG1 1 
ATOM   6266 C  CG2 . THR F 2 66  ? 33.05027 19.05764  -47.62773 1.000 113.96026 ? 66  THR D CG2 1 
ATOM   6267 N  N   . ALA F 2 67  ? 36.55074 20.28255  -47.09568 1.000 96.67936  ? 67  ALA D N   1 
ATOM   6268 C  CA  . ALA F 2 67  ? 37.15087 21.57895  -47.38848 1.000 89.21255  ? 67  ALA D CA  1 
ATOM   6269 C  C   . ALA F 2 67  ? 38.65141 21.39409  -47.59587 1.000 85.09976  ? 67  ALA D C   1 
ATOM   6270 O  O   . ALA F 2 67  ? 39.39293 21.20602  -46.62706 1.000 87.45584  ? 67  ALA D O   1 
ATOM   6271 C  CB  . ALA F 2 67  ? 36.86378 22.55417  -46.24934 1.000 90.29595  ? 67  ALA D CB  1 
ATOM   6272 N  N   . ARG F 2 68  ? 39.10538 21.50400  -48.83618 1.000 81.90451  ? 68  ARG D N   1 
ATOM   6273 C  CA  . ARG F 2 68  ? 40.49347 21.24584  -49.18288 1.000 80.97591  ? 68  ARG D CA  1 
ATOM   6274 C  C   . ARG F 2 68  ? 41.10512 22.43556  -49.90807 1.000 78.78600  ? 68  ARG D C   1 
ATOM   6275 O  O   . ARG F 2 68  ? 40.39398 23.21645  -50.55152 1.000 77.30195  ? 68  ARG D O   1 
ATOM   6276 C  CB  . ARG F 2 68  ? 40.59352 19.99764  -50.07010 1.000 83.55564  ? 68  ARG D CB  1 
ATOM   6277 C  CG  . ARG F 2 68  ? 40.32203 18.68351  -49.36503 1.000 87.51004  ? 68  ARG D CG  1 
ATOM   6278 C  CD  . ARG F 2 68  ? 40.35721 17.53374  -50.35997 1.000 91.33347  ? 68  ARG D CD  1 
ATOM   6279 N  NE  . ARG F 2 68  ? 39.26927 17.62015  -51.33213 1.000 92.60500  ? 68  ARG D NE  1 
ATOM   6280 C  CZ  . ARG F 2 68  ? 39.22486 16.92775  -52.46556 1.000 92.54161  ? 68  ARG D CZ  1 
ATOM   6281 N  NH1 . ARG F 2 68  ? 40.21895 16.11431  -52.78553 1.000 90.26860  ? 68  ARG D NH1 1 
ATOM   6282 N  NH2 . ARG F 2 68  ? 38.18626 17.06021  -53.28158 1.000 94.34501  ? 68  ARG D NH2 1 
ATOM   6283 N  N   . PRO F 2 69  ? 42.43780 22.59025  -49.84429 1.000 76.55829  ? 69  PRO D N   1 
ATOM   6284 C  CA  . PRO F 2 69  ? 43.06357 23.76277  -50.49642 1.000 72.95194  ? 69  PRO D CA  1 
ATOM   6285 C  C   . PRO F 2 69  ? 42.85035 23.81676  -52.00137 1.000 71.28087  ? 69  PRO D C   1 
ATOM   6286 O  O   . PRO F 2 69  ? 42.64905 24.90773  -52.54600 1.000 70.90293  ? 69  PRO D O   1 
ATOM   6287 C  CB  . PRO F 2 69  ? 44.55138 23.61166  -50.13861 1.000 71.17185  ? 69  PRO D CB  1 
ATOM   6288 C  CG  . PRO F 2 69  ? 44.58349 22.71548  -48.95108 1.000 72.95912  ? 69  PRO D CG  1 
ATOM   6289 C  CD  . PRO F 2 69  ? 43.42740 21.77380  -49.11239 1.000 75.52777  ? 69  PRO D CD  1 
ATOM   6290 N  N   . GLN F 2 70  ? 42.88620 22.66890  -52.68957 1.000 73.11442  ? 70  GLN D N   1 
ATOM   6291 C  CA  . GLN F 2 70  ? 42.64506 22.62422  -54.12790 1.000 72.52892  ? 70  GLN D CA  1 
ATOM   6292 C  C   . GLN F 2 70  ? 41.16253 22.71264  -54.47603 1.000 73.46693  ? 70  GLN D C   1 
ATOM   6293 O  O   . GLN F 2 70  ? 40.82605 23.10750  -55.60236 1.000 74.17691  ? 70  GLN D O   1 
ATOM   6294 C  CB  . GLN F 2 70  ? 43.23739 21.35225  -54.72988 1.000 74.02018  ? 70  GLN D CB  1 
ATOM   6295 C  CG  . GLN F 2 70  ? 42.71521 20.06104  -54.12644 1.000 77.21717  ? 70  GLN D CG  1 
ATOM   6296 C  CD  . GLN F 2 70  ? 43.50180 19.62569  -52.91199 1.000 77.16641  ? 70  GLN D CD  1 
ATOM   6297 O  OE1 . GLN F 2 70  ? 44.18503 20.43254  -52.27868 1.000 73.98254  ? 70  GLN D OE1 1 
ATOM   6298 N  NE2 . GLN F 2 70  ? 43.41370 18.34145  -52.58173 1.000 79.45349  ? 70  GLN D NE2 1 
ATOM   6299 N  N   . ALA F 2 71  ? 40.27851 22.38597  -53.52911 1.000 72.32858  ? 71  ALA D N   1 
ATOM   6300 C  CA  . ALA F 2 71  ? 38.83087 22.44236  -53.74680 1.000 72.50501  ? 71  ALA D CA  1 
ATOM   6301 C  C   . ALA F 2 71  ? 38.13992 22.86945  -52.45684 1.000 70.12042  ? 71  ALA D C   1 
ATOM   6302 O  O   . ALA F 2 71  ? 37.56576 22.04527  -51.73432 1.000 73.32136  ? 71  ALA D O   1 
ATOM   6303 C  CB  . ALA F 2 71  ? 38.29582 21.09151  -54.22679 1.000 75.54953  ? 71  ALA D CB  1 
ATOM   6304 N  N   . PRO F 2 72  ? 38.12473 24.17189  -52.16539 1.000 66.03800  ? 72  PRO D N   1 
ATOM   6305 C  CA  . PRO F 2 72  ? 37.55500 24.64816  -50.89803 1.000 63.97803  ? 72  PRO D CA  1 
ATOM   6306 C  C   . PRO F 2 72  ? 36.05644 24.41874  -50.82919 1.000 63.86113  ? 72  PRO D C   1 
ATOM   6307 O  O   . PRO F 2 72  ? 35.36483 24.32901  -51.84681 1.000 64.93095  ? 72  PRO D O   1 
ATOM   6308 C  CB  . PRO F 2 72  ? 37.84060 26.15521  -50.91663 1.000 61.09894  ? 72  PRO D CB  1 
ATOM   6309 C  CG  . PRO F 2 72  ? 38.85398 26.36067  -51.98050 1.000 61.11612  ? 72  PRO D CG  1 
ATOM   6310 C  CD  . PRO F 2 72  ? 38.60266 25.28888  -52.99559 1.000 63.74403  ? 72  PRO D CD  1 
ATOM   6311 N  N   . ALA F 2 73  ? 35.54762 24.41020  -49.59825 1.000 62.67123  ? 73  ALA D N   1 
ATOM   6312 C  CA  . ALA F 2 73  ? 34.11792 24.28608  -49.35300 1.000 62.86824  ? 73  ALA D CA  1 
ATOM   6313 C  C   . ALA F 2 73  ? 33.46917 25.66660  -49.33458 1.000 63.59142  ? 73  ALA D C   1 
ATOM   6314 O  O   . ALA F 2 73  ? 34.05675 26.63972  -48.85655 1.000 63.32351  ? 73  ALA D O   1 
ATOM   6315 C  CB  . ALA F 2 73  ? 33.85660 23.56755  -48.02956 1.000 62.19409  ? 73  ALA D CB  1 
ATOM   6316 N  N   . THR F 2 74  ? 32.24754 25.74757  -49.84251 1.000 63.34694  ? 74  THR D N   1 
ATOM   6317 C  CA  . THR F 2 74  ? 31.57999 27.02895  -49.98464 1.000 61.27203  ? 74  THR D CA  1 
ATOM   6318 C  C   . THR F 2 74  ? 30.75267 27.32784  -48.74389 1.000 67.01639  ? 74  THR D C   1 
ATOM   6319 O  O   . THR F 2 74  ? 29.95424 26.49086  -48.30856 1.000 71.15427  ? 74  THR D O   1 
ATOM   6320 C  CB  . THR F 2 74  ? 30.66709 27.02994  -51.20296 1.000 58.81918  ? 74  THR D CB  1 
ATOM   6321 O  OG1 . THR F 2 74  ? 31.38182 26.51655  -52.33817 1.000 62.35480  ? 74  THR D OG1 1 
ATOM   6322 C  CG2 . THR F 2 74  ? 30.21296 28.43996  -51.48503 1.000 52.86419  ? 74  THR D CG2 1 
ATOM   6323 N  N   . VAL F 2 75  ? 30.91395 28.53098  -48.19604 1.000 65.90471  ? 75  VAL D N   1 
ATOM   6324 C  CA  . VAL F 2 75  ? 30.11096 28.99284  -47.06512 1.000 64.69458  ? 75  VAL D CA  1 
ATOM   6325 C  C   . VAL F 2 75  ? 29.30880 30.19179  -47.54796 1.000 63.74504  ? 75  VAL D C   1 
ATOM   6326 O  O   . VAL F 2 75  ? 29.88785 31.20397  -47.95528 1.000 66.58020  ? 75  VAL D O   1 
ATOM   6327 C  CB  . VAL F 2 75  ? 30.97417 29.37310  -45.84789 1.000 61.84530  ? 75  VAL D CB  1 
ATOM   6328 C  CG1 . VAL F 2 75  ? 30.09291 29.87814  -44.72666 1.000 63.24966  ? 75  VAL D CG1 1 
ATOM   6329 C  CG2 . VAL F 2 75  ? 31.78150 28.18922  -45.35176 1.000 60.85037  ? 75  VAL D CG2 1 
ATOM   6330 N  N   . GLY F 2 76  ? 27.98669 30.09694  -47.47596 1.000 64.62068  ? 76  GLY D N   1 
ATOM   6331 C  CA  . GLY F 2 76  ? 27.15183 31.20833  -47.88958 1.000 66.29142  ? 76  GLY D CA  1 
ATOM   6332 C  C   . GLY F 2 76  ? 27.12972 32.29971  -46.83671 1.000 66.30979  ? 76  GLY D C   1 
ATOM   6333 O  O   . GLY F 2 76  ? 27.33655 32.04436  -45.64975 1.000 67.78095  ? 76  GLY D O   1 
ATOM   6334 N  N   . LEU F 2 77  ? 26.88683 33.53858  -47.28213 1.000 65.68242  ? 77  LEU D N   1 
ATOM   6335 C  CA  . LEU F 2 77  ? 26.87538 34.68414  -46.37573 1.000 66.03990  ? 77  LEU D CA  1 
ATOM   6336 C  C   . LEU F 2 77  ? 25.70751 35.61384  -46.68592 1.000 72.24442  ? 77  LEU D C   1 
ATOM   6337 O  O   . LEU F 2 77  ? 25.44715 35.92614  -47.85158 1.000 77.54626  ? 77  LEU D O   1 
ATOM   6338 C  CB  . LEU F 2 77  ? 28.20142 35.45231  -46.47824 1.000 59.08937  ? 77  LEU D CB  1 
ATOM   6339 C  CG  . LEU F 2 77  ? 28.36898 36.73994  -45.67428 1.000 55.07261  ? 77  LEU D CG  1 
ATOM   6340 C  CD1 . LEU F 2 77  ? 27.96745 36.51429  -44.23096 1.000 57.25398  ? 77  LEU D CD1 1 
ATOM   6341 C  CD2 . LEU F 2 77  ? 29.80657 37.24426  -45.78286 1.000 49.39845  ? 77  LEU D CD2 1 
ATOM   6342 N  N   . ALA F 2 78  ? 24.98827 36.01901  -45.63679 1.000 73.77231  ? 78  ALA D N   1 
ATOM   6343 C  CA  . ALA F 2 78  ? 23.82870 36.90036  -45.72512 1.000 75.50181  ? 78  ALA D CA  1 
ATOM   6344 C  C   . ALA F 2 78  ? 23.97191 38.00944  -44.68872 1.000 77.61490  ? 78  ALA D C   1 
ATOM   6345 O  O   . ALA F 2 78  ? 24.25116 37.72299  -43.52028 1.000 77.28865  ? 78  ALA D O   1 
ATOM   6346 C  CB  . ALA F 2 78  ? 22.52780 36.12237  -45.50477 1.000 78.59185  ? 78  ALA D CB  1 
ATOM   6347 N  N   . PHE F 2 79  ? 23.75755 39.26271  -45.09678 1.000 79.63042  ? 79  PHE D N   1 
ATOM   6348 C  CA  . PHE F 2 79  ? 23.83969 40.39592  -44.18556 1.000 81.27667  ? 79  PHE D CA  1 
ATOM   6349 C  C   . PHE F 2 79  ? 22.43982 40.75635  -43.69396 1.000 88.97761  ? 79  PHE D C   1 
ATOM   6350 O  O   . PHE F 2 79  ? 21.44980 40.09060  -44.00810 1.000 93.10451  ? 79  PHE D O   1 
ATOM   6351 C  CB  . PHE F 2 79  ? 24.49723 41.59933  -44.86644 1.000 76.06828  ? 79  PHE D CB  1 
ATOM   6352 C  CG  . PHE F 2 79  ? 25.98837 41.51215  -44.91560 1.000 71.76463  ? 79  PHE D CG  1 
ATOM   6353 C  CD1 . PHE F 2 79  ? 26.67275 40.74973  -43.99368 1.000 72.09222  ? 79  PHE D CD1 1 
ATOM   6354 C  CD2 . PHE F 2 79  ? 26.70160 42.14386  -45.91740 1.000 69.78018  ? 79  PHE D CD2 1 
ATOM   6355 C  CE1 . PHE F 2 79  ? 28.04830 40.63614  -44.05029 1.000 69.36838  ? 79  PHE D CE1 1 
ATOM   6356 C  CE2 . PHE F 2 79  ? 28.07628 42.03582  -45.98071 1.000 66.48900  ? 79  PHE D CE2 1 
ATOM   6357 C  CZ  . PHE F 2 79  ? 28.75133 41.28236  -45.04747 1.000 65.12503  ? 79  PHE D CZ  1 
ATOM   6358 N  N   . ARG F 2 80  ? 22.34045 41.83877  -42.92908 1.000 94.16623  ? 80  ARG D N   1 
ATOM   6359 C  CA  . ARG F 2 80  ? 21.05183 42.29910  -42.43105 1.000 101.15069 ? 80  ARG D CA  1 
ATOM   6360 C  C   . ARG F 2 80  ? 20.92174 43.78845  -42.70469 1.000 105.54690 ? 80  ARG D C   1 
ATOM   6361 O  O   . ARG F 2 80  ? 21.66873 44.59384  -42.14494 1.000 106.66030 ? 80  ARG D O   1 
ATOM   6362 C  CB  . ARG F 2 80  ? 20.88520 42.00206  -40.94431 1.000 103.33820 ? 80  ARG D CB  1 
ATOM   6363 C  CG  . ARG F 2 80  ? 19.47177 42.25392  -40.44647 1.000 108.51092 ? 80  ARG D CG  1 
ATOM   6364 C  CD  . ARG F 2 80  ? 19.32165 41.99047  -38.95783 1.000 110.71292 ? 80  ARG D CD  1 
ATOM   6365 N  NE  . ARG F 2 80  ? 20.17114 42.86929  -38.16319 1.000 107.47934 ? 80  ARG D NE  1 
ATOM   6366 C  CZ  . ARG F 2 80  ? 20.70309 42.52594  -36.99617 1.000 107.33932 ? 80  ARG D CZ  1 
ATOM   6367 N  NH1 . ARG F 2 80  ? 20.47733 41.31971  -36.49062 1.000 106.77062 ? 80  ARG D NH1 1 
ATOM   6368 N  NH2 . ARG F 2 80  ? 21.47172 43.38502  -36.33855 1.000 107.77467 ? 80  ARG D NH2 1 
ATOM   6369 N  N   . ALA F 2 81  ? 19.97277 44.14974  -43.56059 1.000 109.86276 ? 81  ALA D N   1 
ATOM   6370 C  CA  . ALA F 2 81  ? 19.68610 45.54242  -43.84162 1.000 115.08765 ? 81  ALA D CA  1 
ATOM   6371 C  C   . ALA F 2 81  ? 18.55324 45.97261  -42.91857 1.000 123.91939 ? 81  ALA D C   1 
ATOM   6372 O  O   . ALA F 2 81  ? 17.43005 45.45976  -43.02186 1.000 126.98151 ? 81  ALA D O   1 
ATOM   6373 C  CB  . ALA F 2 81  ? 19.33790 45.73309  -45.31729 1.000 115.71508 ? 81  ALA D CB  1 
ATOM   6374 N  N   . ASP F 2 82  ? 18.86429 46.87174  -41.98979 1.000 127.95063 ? 82  ASP D N   1 
ATOM   6375 C  CA  . ASP F 2 82  ? 17.91617 47.40020  -40.99892 1.000 130.96143 ? 82  ASP D CA  1 
ATOM   6376 C  C   . ASP F 2 82  ? 17.31940 46.23966  -40.20961 1.000 130.54402 ? 82  ASP D C   1 
ATOM   6377 O  O   . ASP F 2 82  ? 18.06308 45.56741  -39.47179 1.000 129.60271 ? 82  ASP D O   1 
ATOM   6378 C  CB  . ASP F 2 82  ? 16.90376 48.30465  -41.71343 1.000 133.02873 ? 82  ASP D CB  1 
ATOM   6379 C  CG  . ASP F 2 82  ? 17.53710 49.56259  -42.29090 1.000 132.68184 ? 82  ASP D CG  1 
ATOM   6380 O  OD1 . ASP F 2 82  ? 18.62366 49.96729  -41.82513 1.000 131.33954 ? 82  ASP D OD1 1 
ATOM   6381 O  OD2 . ASP F 2 82  ? 16.94291 50.15941  -43.21012 1.000 134.24741 ? 82  ASP D OD2 1 
ATOM   6382 N  N   . ASP F 2 83  ? 16.02507 45.96647  -40.32742 1.000 132.13291 ? 83  ASP D N   1 
ATOM   6383 C  CA  . ASP F 2 83  ? 15.33819 45.01287  -39.45843 1.000 132.06269 ? 83  ASP D CA  1 
ATOM   6384 C  C   . ASP F 2 83  ? 15.50840 43.56376  -39.90758 1.000 128.64105 ? 83  ASP D C   1 
ATOM   6385 O  O   . ASP F 2 83  ? 15.61385 42.66196  -39.06779 1.000 129.17910 ? 83  ASP D O   1 
ATOM   6386 C  CB  . ASP F 2 83  ? 13.85506 45.36704  -39.41370 1.000 136.71323 ? 83  ASP D CB  1 
ATOM   6387 C  CG  . ASP F 2 83  ? 13.26386 45.55836  -40.80383 1.000 136.89571 ? 83  ASP D CG  1 
ATOM   6388 O  OD1 . ASP F 2 83  ? 13.78828 46.39419  -41.57144 1.000 134.65707 ? 83  ASP D OD1 1 
ATOM   6389 O  OD2 . ASP F 2 83  ? 12.28029 44.86364  -41.13379 1.000 139.97878 ? 83  ASP D OD2 1 
ATOM   6390 N  N   . THR F 2 84  ? 15.51420 43.30962  -41.20876 1.000 123.29553 ? 84  THR D N   1 
ATOM   6391 C  CA  . THR F 2 84  ? 15.34209 41.96739  -41.74721 1.000 120.00854 ? 84  THR D CA  1 
ATOM   6392 C  C   . THR F 2 84  ? 16.61892 41.47099  -42.41813 1.000 112.38813 ? 84  THR D C   1 
ATOM   6393 O  O   . THR F 2 84  ? 17.35234 42.24869  -43.03198 1.000 110.91566 ? 84  THR D O   1 
ATOM   6394 C  CB  . THR F 2 84  ? 14.18686 41.94777  -42.75634 1.000 125.37517 ? 84  THR D CB  1 
ATOM   6395 O  OG1 . THR F 2 84  ? 12.97587 42.39830  -42.13099 1.000 133.58648 ? 84  THR D OG1 1 
ATOM   6396 C  CG2 . THR F 2 84  ? 13.96955 40.54994  -43.31392 1.000 125.56984 ? 84  THR D CG2 1 
ATOM   6397 N  N   . PHE F 2 85  ? 16.87198 40.16495  -42.30235 1.000 107.29757 ? 85  PHE D N   1 
ATOM   6398 C  CA  . PHE F 2 85  ? 17.95255 39.53520  -43.05206 1.000 99.93331  ? 85  PHE D CA  1 
ATOM   6399 C  C   . PHE F 2 85  ? 17.58164 39.40397  -44.52273 1.000 97.47868  ? 85  PHE D C   1 
ATOM   6400 O  O   . PHE F 2 85  ? 16.42799 39.13332  -44.86651 1.000 98.78711  ? 85  PHE D O   1 
ATOM   6401 C  CB  . PHE F 2 85  ? 18.26617 38.14427  -42.49009 1.000 98.97103  ? 85  PHE D CB  1 
ATOM   6402 C  CG  . PHE F 2 85  ? 19.19505 38.15323  -41.31097 1.000 96.18426  ? 85  PHE D CG  1 
ATOM   6403 C  CD1 . PHE F 2 85  ? 20.55618 38.33420  -41.48710 1.000 93.09174  ? 85  PHE D CD1 1 
ATOM   6404 C  CD2 . PHE F 2 85  ? 18.70995 37.95373  -40.02906 1.000 96.68631  ? 85  PHE D CD2 1 
ATOM   6405 C  CE1 . PHE F 2 85  ? 21.41520 38.33458  -40.40196 1.000 92.84667  ? 85  PHE D CE1 1 
ATOM   6406 C  CE2 . PHE F 2 85  ? 19.56271 37.95018  -38.94203 1.000 96.15181  ? 85  PHE D CE2 1 
ATOM   6407 C  CZ  . PHE F 2 85  ? 20.91621 38.14197  -39.12779 1.000 94.11807  ? 85  PHE D CZ  1 
ATOM   6408 N  N   . GLU F 2 86  ? 18.57381 39.56317  -45.38901 1.000 95.83966  ? 86  GLU D N   1 
ATOM   6409 C  CA  . GLU F 2 86  ? 18.36850 39.39896  -46.82122 1.000 96.66092  ? 86  GLU D CA  1 
ATOM   6410 C  C   . GLU F 2 86  ? 18.39035 37.92834  -47.22267 1.000 99.49016  ? 86  GLU D C   1 
ATOM   6411 O  O   . GLU F 2 86  ? 19.04388 37.09497  -46.58553 1.000 98.79978  ? 86  GLU D O   1 
ATOM   6412 C  CB  . GLU F 2 86  ? 19.44667 40.15777  -47.59356 1.000 93.78007  ? 86  GLU D CB  1 
ATOM   6413 C  CG  . GLU F 2 86  ? 20.79858 39.47540  -47.56911 1.000 89.46564  ? 86  GLU D CG  1 
ATOM   6414 C  CD  . GLU F 2 86  ? 21.90491 40.40070  -48.01528 1.000 85.04303  ? 86  GLU D CD  1 
ATOM   6415 O  OE1 . GLU F 2 86  ? 23.03376 39.92411  -48.26080 1.000 80.20760  ? 86  GLU D OE1 1 
ATOM   6416 O  OE2 . GLU F 2 86  ? 21.65487 41.62411  -48.05846 1.000 86.20098  ? 86  GLU D OE2 1 
ATOM   6417 N  N   . ALA F 2 87  ? 17.67099 37.61535  -48.29923 1.000 102.62352 ? 87  ALA D N   1 
ATOM   6418 C  CA  . ALA F 2 87  ? 17.68124 36.25331  -48.80541 1.000 101.28770 ? 87  ALA D CA  1 
ATOM   6419 C  C   . ALA F 2 87  ? 19.09013 35.90094  -49.25575 1.000 97.15488  ? 87  ALA D C   1 
ATOM   6420 O  O   . ALA F 2 87  ? 19.83937 36.75398  -49.74132 1.000 97.58107  ? 87  ALA D O   1 
ATOM   6421 C  CB  . ALA F 2 87  ? 16.69961 36.10253  -49.96880 1.000 103.00446 ? 87  ALA D CB  1 
ATOM   6422 N  N   . LEU F 2 88  ? 19.45710 34.63462  -49.08324 1.000 93.84035  ? 88  LEU D N   1 
ATOM   6423 C  CA  . LEU F 2 88  ? 20.78768 34.19530  -49.48361 1.000 87.94733  ? 88  LEU D CA  1 
ATOM   6424 C  C   . LEU F 2 88  ? 20.92810 34.24727  -50.99876 1.000 88.05382  ? 88  LEU D C   1 
ATOM   6425 O  O   . LEU F 2 88  ? 20.02246 33.83762  -51.73520 1.000 91.72007  ? 88  LEU D O   1 
ATOM   6426 C  CB  . LEU F 2 88  ? 21.06450 32.77985  -48.97849 1.000 85.35548  ? 88  LEU D CB  1 
ATOM   6427 C  CG  . LEU F 2 88  ? 22.42170 32.20996  -49.40572 1.000 80.02046  ? 88  LEU D CG  1 
ATOM   6428 C  CD1 . LEU F 2 88  ? 23.54760 33.11260  -48.92817 1.000 77.00247  ? 88  LEU D CD1 1 
ATOM   6429 C  CD2 . LEU F 2 88  ? 22.62588 30.77523  -48.92358 1.000 80.01948  ? 88  LEU D CD2 1 
ATOM   6430 N  N   . CYS F 2 89  ? 22.05752 34.77056  -51.46522 1.000 82.92987  ? 89  CYS D N   1 
ATOM   6431 C  CA  . CYS F 2 89  ? 22.27158 34.91099  -52.89844 1.000 82.50785  ? 89  CYS D CA  1 
ATOM   6432 C  C   . CYS F 2 89  ? 23.75748 34.79663  -53.20819 1.000 81.28566  ? 89  CYS D C   1 
ATOM   6433 O  O   . CYS F 2 89  ? 24.56728 35.54176  -52.64827 1.000 85.42731  ? 89  CYS D O   1 
ATOM   6434 C  CB  . CYS F 2 89  ? 21.71811 36.24028  -53.40151 1.000 83.58386  ? 89  CYS D CB  1 
ATOM   6435 S  SG  . CYS F 2 89  ? 22.14191 36.50576  -55.11246 1.000 84.68623  ? 89  CYS D SG  1 
ATOM   6436 N  N   . ILE F 2 90  ? 24.11952 33.87558  -54.09902 1.000 75.81890  ? 90  ILE D N   1 
ATOM   6437 C  CA  . ILE F 2 90  ? 25.51089 33.67243  -54.49198 1.000 69.65410  ? 90  ILE D CA  1 
ATOM   6438 C  C   . ILE F 2 90  ? 25.56552 33.71992  -56.01138 1.000 71.03336  ? 90  ILE D C   1 
ATOM   6439 O  O   . ILE F 2 90  ? 25.10053 32.78970  -56.67967 1.000 72.83037  ? 90  ILE D O   1 
ATOM   6440 C  CB  . ILE F 2 90  ? 26.09173 32.35411  -53.95347 1.000 62.42035  ? 90  ILE D CB  1 
ATOM   6441 C  CG1 . ILE F 2 90  ? 26.11253 32.37319  -52.41891 1.000 59.18905  ? 90  ILE D CG1 1 
ATOM   6442 C  CG2 . ILE F 2 90  ? 27.49556 32.13588  -54.48242 1.000 58.21181  ? 90  ILE D CG2 1 
ATOM   6443 C  CD1 . ILE F 2 90  ? 26.88409 31.23527  -51.78562 1.000 56.49100  ? 90  ILE D CD1 1 
ATOM   6444 N  N   . GLU F 2 91  ? 26.10821 34.80685  -56.55648 1.000 71.18176  ? 91  GLU D N   1 
ATOM   6445 C  CA  . GLU F 2 91  ? 26.16384 34.96956  -58.00543 1.000 71.87882  ? 91  GLU D CA  1 
ATOM   6446 C  C   . GLU F 2 91  ? 27.15607 33.97908  -58.60872 1.000 69.35514  ? 91  GLU D C   1 
ATOM   6447 O  O   . GLU F 2 91  ? 28.29492 33.87929  -58.13101 1.000 65.55818  ? 91  GLU D O   1 
ATOM   6448 C  CB  . GLU F 2 91  ? 26.56845 36.40060  -58.35604 1.000 76.30864  ? 91  GLU D CB  1 
ATOM   6449 C  CG  . GLU F 2 91  ? 26.08888 36.89171  -59.71478 1.000 82.05589  ? 91  GLU D CG  1 
ATOM   6450 C  CD  . GLU F 2 91  ? 24.59994 37.23832  -59.74638 1.000 89.32497  ? 91  GLU D CD  1 
ATOM   6451 O  OE1 . GLU F 2 91  ? 24.02528 37.59333  -58.69166 1.000 88.66998  ? 91  GLU D OE1 1 
ATOM   6452 O  OE2 . GLU F 2 91  ? 24.00478 37.16028  -60.84220 1.000 94.18992  ? 91  GLU D OE2 1 
ATOM   6453 N  N   . PRO F 2 92  ? 26.78934 33.26986  -59.67689 1.000 68.40419  ? 92  PRO D N   1 
ATOM   6454 C  CA  . PRO F 2 92  ? 27.67335 32.23264  -60.21561 1.000 67.46900  ? 92  PRO D CA  1 
ATOM   6455 C  C   . PRO F 2 92  ? 28.85820 32.83662  -60.94728 1.000 67.89987  ? 92  PRO D C   1 
ATOM   6456 O  O   . PRO F 2 92  ? 28.90618 34.02845  -61.26113 1.000 67.59443  ? 92  PRO D O   1 
ATOM   6457 C  CB  . PRO F 2 92  ? 26.77197 31.47521  -61.18728 1.000 66.25521  ? 92  PRO D CB  1 
ATOM   6458 C  CG  . PRO F 2 92  ? 25.82127 32.50343  -61.65926 1.000 66.23643  ? 92  PRO D CG  1 
ATOM   6459 C  CD  . PRO F 2 92  ? 25.55220 33.39090  -60.46654 1.000 68.17811  ? 92  PRO D CD  1 
ATOM   6460 N  N   . PHE F 2 93  ? 29.82291 31.97302  -61.24198 1.000 67.03408  ? 93  PHE D N   1 
ATOM   6461 C  CA  . PHE F 2 93  ? 30.96795 32.39600  -62.02526 1.000 62.26071  ? 93  PHE D CA  1 
ATOM   6462 C  C   . PHE F 2 93  ? 30.59689 32.40464  -63.51004 1.000 60.77961  ? 93  PHE D C   1 
ATOM   6463 O  O   . PHE F 2 93  ? 29.46683 32.10117  -63.90414 1.000 61.43824  ? 93  PHE D O   1 
ATOM   6464 C  CB  . PHE F 2 93  ? 32.16851 31.50350  -61.72276 1.000 59.20513  ? 93  PHE D CB  1 
ATOM   6465 C  CG  . PHE F 2 93  ? 32.70269 31.65439  -60.31252 1.000 56.11549  ? 93  PHE D CG  1 
ATOM   6466 C  CD1 . PHE F 2 93  ? 32.55429 32.84629  -59.61641 1.000 55.73181  ? 93  PHE D CD1 1 
ATOM   6467 C  CD2 . PHE F 2 93  ? 33.33995 30.59993  -59.68124 1.000 55.14204  ? 93  PHE D CD2 1 
ATOM   6468 C  CE1 . PHE F 2 93  ? 33.04513 32.98270  -58.31909 1.000 54.76149  ? 93  PHE D CE1 1 
ATOM   6469 C  CE2 . PHE F 2 93  ? 33.82709 30.72759  -58.38927 1.000 54.86533  ? 93  PHE D CE2 1 
ATOM   6470 C  CZ  . PHE F 2 93  ? 33.68275 31.91576  -57.70679 1.000 53.89853  ? 93  PHE D CZ  1 
ATOM   6471 N  N   . SER F 2 94  ? 31.54059 32.81868  -64.33998 1.000 82.40662  ? 94  SER D N   1 
ATOM   6472 C  CA  . SER F 2 94  ? 31.33109 32.83218  -65.77349 1.000 80.59018  ? 94  SER D CA  1 
ATOM   6473 C  C   . SER F 2 94  ? 31.50664 31.43076  -66.34613 1.000 84.60883  ? 94  SER D C   1 
ATOM   6474 O  O   . SER F 2 94  ? 32.31569 30.63312  -65.87097 1.000 85.39273  ? 94  SER D O   1 
ATOM   6475 C  CB  . SER F 2 94  ? 32.27668 33.84157  -66.42256 1.000 79.06951  ? 94  SER D CB  1 
ATOM   6476 O  OG  . SER F 2 94  ? 33.62370 33.57282  -66.08643 1.000 78.78483  ? 94  SER D OG  1 
ATOM   6477 N  N   . SER F 2 95  ? 30.75221 31.14209  -67.31708 1.000 87.91862  ? 95  SER D N   1 
ATOM   6478 C  CA  . SER F 2 95  ? 30.88347 29.77623  -67.79691 1.000 91.19830  ? 95  SER D CA  1 
ATOM   6479 C  C   . SER F 2 95  ? 31.93946 29.70215  -68.89421 1.000 101.40071 ? 95  SER D C   1 
ATOM   6480 O  O   . SER F 2 95  ? 32.06972 30.63240  -69.69731 1.000 99.65938  ? 95  SER D O   1 
ATOM   6481 C  CB  . SER F 2 95  ? 29.54762 29.25931  -68.32574 1.000 87.80632  ? 95  SER D CB  1 
ATOM   6482 O  OG  . SER F 2 95  ? 28.54828 29.31754  -67.32287 1.000 85.82993  ? 95  SER D OG  1 
ATOM   6483 N  N   . PRO F 2 96  ? 32.70423 28.61552  -68.92329 1.000 110.87838 ? 96  PRO D N   1 
ATOM   6484 C  CA  . PRO F 2 96  ? 33.72661 28.45277  -69.95112 1.000 121.27184 ? 96  PRO D CA  1 
ATOM   6485 C  C   . PRO F 2 96  ? 33.11778 27.85807  -71.20447 1.000 135.04850 ? 96  PRO D C   1 
ATOM   6486 O  O   . PRO F 2 96  ? 32.41287 26.84048  -71.13491 1.000 140.42951 ? 96  PRO D O   1 
ATOM   6487 C  CB  . PRO F 2 96  ? 34.72532 27.48633  -69.29925 1.000 117.65983 ? 96  PRO D CB  1 
ATOM   6488 C  CG  . PRO F 2 96  ? 33.87244 26.64388  -68.39864 1.000 115.52272 ? 96  PRO D CG  1 
ATOM   6489 C  CD  . PRO F 2 96  ? 32.72247 27.51471  -67.94087 1.000 113.48282 ? 96  PRO D CD  1 
ATOM   6490 N  N   . PRO F 2 97  ? 33.33832 28.47896  -72.36794 1.000 145.33292 ? 97  PRO D N   1 
ATOM   6491 C  CA  . PRO F 2 97  ? 32.72722 27.96365  -73.60221 1.000 153.52227 ? 97  PRO D CA  1 
ATOM   6492 C  C   . PRO F 2 97  ? 33.30567 26.63485  -74.07212 1.000 165.17425 ? 97  PRO D C   1 
ATOM   6493 O  O   . PRO F 2 97  ? 34.47122 26.54914  -74.47624 1.000 168.99989 ? 97  PRO D O   1 
ATOM   6494 C  CB  . PRO F 2 97  ? 33.00195 29.07822  -74.62252 1.000 149.01413 ? 97  PRO D CB  1 
ATOM   6495 C  CG  . PRO F 2 97  ? 33.28454 30.30013  -73.80072 1.000 146.27222 ? 97  PRO D CG  1 
ATOM   6496 C  CD  . PRO F 2 97  ? 33.98569 29.78387  -72.57805 1.000 145.41948 ? 97  PRO D CD  1 
ATOM   6497 N  N   . GLU F 2 98  ? 32.47788 25.59230  -74.00235 1.000 159.95299 ? 98  GLU D N   1 
ATOM   6498 C  CA  . GLU F 2 98  ? 32.74121 24.30339  -74.63083 1.000 151.71492 ? 98  GLU D CA  1 
ATOM   6499 C  C   . GLU F 2 98  ? 31.41492 23.56104  -74.75387 1.000 147.38835 ? 98  GLU D C   1 
ATOM   6500 O  O   . GLU F 2 98  ? 30.41499 23.95212  -74.14619 1.000 144.97623 ? 98  GLU D O   1 
ATOM   6501 C  CB  . GLU F 2 98  ? 33.75775 23.47812  -73.83375 1.000 144.80375 ? 98  GLU D CB  1 
ATOM   6502 C  CG  . GLU F 2 98  ? 34.27335 22.22867  -74.56466 1.000 140.50726 ? 98  GLU D CG  1 
ATOM   6503 C  CD  . GLU F 2 98  ? 33.31176 21.05106  -74.49266 1.000 136.49511 ? 98  GLU D CD  1 
ATOM   6504 O  OE1 . GLU F 2 98  ? 32.79703 20.76939  -73.39018 1.000 135.27851 ? 98  GLU D OE1 1 
ATOM   6505 O  OE2 . GLU F 2 98  ? 33.06315 20.41358  -75.53896 1.000 135.57772 ? 98  GLU D OE2 1 
ATOM   6506 N  N   . MET G 3 17  ? 46.07117 42.61213  -44.54383 1.000 98.00187  ? 17  MET E N   1 
ATOM   6507 C  CA  . MET G 3 17  ? 46.79358 41.40789  -44.91925 1.000 96.79534  ? 17  MET E CA  1 
ATOM   6508 C  C   . MET G 3 17  ? 46.03000 40.63642  -45.99408 1.000 89.93239  ? 17  MET E C   1 
ATOM   6509 O  O   . MET G 3 17  ? 46.51246 39.61580  -46.49479 1.000 90.95652  ? 17  MET E O   1 
ATOM   6510 C  CB  . MET G 3 17  ? 47.03053 40.52005  -43.70257 1.000 102.93069 ? 17  MET E CB  1 
ATOM   6511 C  CG  . MET G 3 17  ? 45.75702 40.00408  -43.08169 1.000 111.81621 ? 17  MET E CG  1 
ATOM   6512 S  SD  . MET G 3 17  ? 46.09055 38.81069  -41.77146 1.000 120.69075 ? 17  MET E SD  1 
ATOM   6513 C  CE  . MET G 3 17  ? 46.85439 37.46243  -42.68018 1.000 121.69588 ? 17  MET E CE  1 
ATOM   6514 N  N   . TYR G 3 18  ? 44.83591 41.11388  -46.35160 1.000 81.57860  ? 18  TYR E N   1 
ATOM   6515 C  CA  . TYR G 3 18  ? 44.07220 40.57053  -47.46788 1.000 69.79302  ? 18  TYR E CA  1 
ATOM   6516 C  C   . TYR G 3 18  ? 44.08454 41.54791  -48.63370 1.000 62.34728  ? 18  TYR E C   1 
ATOM   6517 O  O   . TYR G 3 18  ? 43.88619 42.74710  -48.44177 1.000 63.51825  ? 18  TYR E O   1 
ATOM   6518 C  CB  . TYR G 3 18  ? 42.62245 40.29081  -47.05629 1.000 68.27685  ? 18  TYR E CB  1 
ATOM   6519 C  CG  . TYR G 3 18  ? 42.43790 39.09062  -46.16022 1.000 67.51448  ? 18  TYR E CG  1 
ATOM   6520 C  CD1 . TYR G 3 18  ? 42.59357 39.17864  -44.78206 1.000 68.20438  ? 18  TYR E CD1 1 
ATOM   6521 C  CD2 . TYR G 3 18  ? 42.09976 37.86236  -46.70149 1.000 67.55377  ? 18  TYR E CD2 1 
ATOM   6522 C  CE1 . TYR G 3 18  ? 42.42379 38.06370  -43.97204 1.000 69.80233  ? 18  TYR E CE1 1 
ATOM   6523 C  CE2 . TYR G 3 18  ? 41.92528 36.74749  -45.91016 1.000 68.58563  ? 18  TYR E CE2 1 
ATOM   6524 C  CZ  . TYR G 3 18  ? 42.08666 36.84635  -44.55144 1.000 69.60587  ? 18  TYR E CZ  1 
ATOM   6525 O  OH  . TYR G 3 18  ? 41.90318 35.70774  -43.80193 1.000 69.68467  ? 18  TYR E OH  1 
ATOM   6526 N  N   . VAL G 3 19  ? 44.25990 41.03683  -49.84569 1.000 59.84611  ? 19  VAL E N   1 
ATOM   6527 C  CA  . VAL G 3 19  ? 44.19167 41.86135  -51.04409 1.000 62.90878  ? 19  VAL E CA  1 
ATOM   6528 C  C   . VAL G 3 19  ? 42.94273 41.47558  -51.82752 1.000 63.23200  ? 19  VAL E C   1 
ATOM   6529 O  O   . VAL G 3 19  ? 42.30743 40.45325  -51.56876 1.000 65.49316  ? 19  VAL E O   1 
ATOM   6530 C  CB  . VAL G 3 19  ? 45.44730 41.73872  -51.92717 1.000 66.83300  ? 19  VAL E CB  1 
ATOM   6531 C  CG1 . VAL G 3 19  ? 46.70093 42.12480  -51.15585 1.000 66.11333  ? 19  VAL E CG1 1 
ATOM   6532 C  CG2 . VAL G 3 19  ? 45.55623 40.33605  -52.46733 1.000 72.28298  ? 19  VAL E CG2 1 
ATOM   6533 N  N   . LYS G 3 20  ? 42.58805 42.31433  -52.79446 1.000 61.04154  ? 20  LYS E N   1 
ATOM   6534 C  CA  . LYS G 3 20  ? 41.35839 42.15331  -53.55359 1.000 60.08359  ? 20  LYS E CA  1 
ATOM   6535 C  C   . LYS G 3 20  ? 41.70736 41.97001  -55.02005 1.000 61.40267  ? 20  LYS E C   1 
ATOM   6536 O  O   . LYS G 3 20  ? 42.40032 42.80897  -55.60126 1.000 65.57238  ? 20  LYS E O   1 
ATOM   6537 C  CB  . LYS G 3 20  ? 40.46446 43.38041  -53.37880 1.000 61.58917  ? 20  LYS E CB  1 
ATOM   6538 C  CG  . LYS G 3 20  ? 39.01258 43.18075  -53.70089 1.000 63.06839  ? 20  LYS E CG  1 
ATOM   6539 C  CD  . LYS G 3 20  ? 38.24700 44.41325  -53.25850 1.000 64.25044  ? 20  LYS E CD  1 
ATOM   6540 C  CE  . LYS G 3 20  ? 36.76658 44.25949  -53.49174 1.000 64.30718  ? 20  LYS E CE  1 
ATOM   6541 N  NZ  . LYS G 3 20  ? 36.02221 45.52833  -53.27026 1.000 64.83092  ? 20  LYS E NZ  1 
ATOM   6542 N  N   . LEU G 3 21  ? 41.20826 40.90319  -55.63302 1.000 60.08277  ? 21  LEU E N   1 
ATOM   6543 C  CA  . LEU G 3 21  ? 41.48445 40.62717  -57.04121 1.000 56.61278  ? 21  LEU E CA  1 
ATOM   6544 C  C   . LEU G 3 21  ? 40.15391 40.67157  -57.76929 1.000 56.34386  ? 21  LEU E C   1 
ATOM   6545 O  O   . LEU G 3 21  ? 39.28349 39.82923  -57.52250 1.000 58.78702  ? 21  LEU E O   1 
ATOM   6546 C  CB  . LEU G 3 21  ? 42.15796 39.27051  -57.23315 1.000 52.26822  ? 21  LEU E CB  1 
ATOM   6547 C  CG  . LEU G 3 21  ? 43.41285 39.08589  -56.40492 1.000 49.66777  ? 21  LEU E CG  1 
ATOM   6548 C  CD1 . LEU G 3 21  ? 44.06799 37.73716  -56.69775 1.000 47.32552  ? 21  LEU E CD1 1 
ATOM   6549 C  CD2 . LEU G 3 21  ? 44.32466 40.25416  -56.70915 1.000 50.20936  ? 21  LEU E CD2 1 
ATOM   6550 N  N   . ILE G 3 22  ? 39.97742 41.66702  -58.62769 1.000 54.92712  ? 22  ILE E N   1 
ATOM   6551 C  CA  . ILE G 3 22  ? 38.73009 41.83469  -59.36253 1.000 57.49285  ? 22  ILE E CA  1 
ATOM   6552 C  C   . ILE G 3 22  ? 38.86848 41.16261  -60.72463 1.000 61.26579  ? 22  ILE E C   1 
ATOM   6553 O  O   . ILE G 3 22  ? 39.80717 41.45289  -61.47713 1.000 60.64446  ? 22  ILE E O   1 
ATOM   6554 C  CB  . ILE G 3 22  ? 38.38465 43.32336  -59.53064 1.000 58.52733  ? 22  ILE E CB  1 
ATOM   6555 C  CG1 . ILE G 3 22  ? 38.44074 44.06226  -58.19135 1.000 59.74079  ? 22  ILE E CG1 1 
ATOM   6556 C  CG2 . ILE G 3 22  ? 37.00455 43.46240  -60.10307 1.000 58.98565  ? 22  ILE E CG2 1 
ATOM   6557 C  CD1 . ILE G 3 22  ? 37.69268 43.39003  -57.10045 1.000 61.44194  ? 22  ILE E CD1 1 
ATOM   6558 N  N   . SER G 3 23  ? 37.93031 40.27991  -61.06301 1.000 63.41706  ? 23  SER E N   1 
ATOM   6559 C  CA  . SER G 3 23  ? 37.99629 39.61575  -62.35929 1.000 66.07910  ? 23  SER E CA  1 
ATOM   6560 C  C   . SER G 3 23  ? 37.48257 40.54540  -63.46488 1.000 70.01930  ? 23  SER E C   1 
ATOM   6561 O  O   . SER G 3 23  ? 37.10405 41.69344  -63.22036 1.000 75.01482  ? 23  SER E O   1 
ATOM   6562 C  CB  . SER G 3 23  ? 37.18929 38.32682  -62.33159 1.000 64.25784  ? 23  SER E CB  1 
ATOM   6563 O  OG  . SER G 3 23  ? 35.83060 38.64582  -62.11066 1.000 64.28022  ? 23  SER E OG  1 
ATOM   6564 N  N   . SER G 3 24  ? 37.41588 40.02241  -64.69851 1.000 68.90392  ? 24  SER E N   1 
ATOM   6565 C  CA  . SER G 3 24  ? 36.97526 40.82865  -65.83784 1.000 66.98366  ? 24  SER E CA  1 
ATOM   6566 C  C   . SER G 3 24  ? 35.48109 41.09513  -65.78991 1.000 66.13430  ? 24  SER E C   1 
ATOM   6567 O  O   . SER G 3 24  ? 35.02376 42.12943  -66.29407 1.000 68.80837  ? 24  SER E O   1 
ATOM   6568 C  CB  . SER G 3 24  ? 37.33328 40.15228  -67.16687 1.000 67.62904  ? 24  SER E CB  1 
ATOM   6569 O  OG  . SER G 3 24  ? 36.56512 38.97827  -67.40320 1.000 68.22355  ? 24  SER E OG  1 
ATOM   6570 N  N   . ASP G 3 25  ? 34.70709 40.16626  -65.22876 1.000 65.28952  ? 25  ASP E N   1 
ATOM   6571 C  CA  . ASP G 3 25  ? 33.26411 40.31883  -65.13477 1.000 68.14044  ? 25  ASP E CA  1 
ATOM   6572 C  C   . ASP G 3 25  ? 32.82425 40.88764  -63.79250 1.000 70.91208  ? 25  ASP E C   1 
ATOM   6573 O  O   . ASP G 3 25  ? 31.65414 40.75012  -63.42998 1.000 72.52423  ? 25  ASP E O   1 
ATOM   6574 C  CB  . ASP G 3 25  ? 32.55507 38.98707  -65.40082 1.000 72.58100  ? 25  ASP E CB  1 
ATOM   6575 C  CG  . ASP G 3 25  ? 33.10655 37.84551  -64.56937 1.000 74.88774  ? 25  ASP E CG  1 
ATOM   6576 O  OD1 . ASP G 3 25  ? 34.24227 37.95696  -64.04811 1.000 74.30377  ? 25  ASP E OD1 1 
ATOM   6577 O  OD2 . ASP G 3 25  ? 32.39069 36.82619  -64.44196 1.000 76.87801  ? 25  ASP E OD2 1 
ATOM   6578 N  N   . GLY G 3 26  ? 33.74360 41.44290  -63.00983 1.000 73.72462  ? 26  GLY E N   1 
ATOM   6579 C  CA  . GLY G 3 26  ? 33.38211 42.20193  -61.83072 1.000 76.96060  ? 26  GLY E CA  1 
ATOM   6580 C  C   . GLY G 3 26  ? 33.38791 41.43182  -60.52791 1.000 79.47616  ? 26  GLY E C   1 
ATOM   6581 O  O   . GLY G 3 26  ? 33.20640 42.04742  -59.46988 1.000 84.48382  ? 26  GLY E O   1 
ATOM   6582 N  N   . HIS G 3 27  ? 33.57823 40.11504  -60.57015 1.000 76.64691  ? 27  HIS E N   1 
ATOM   6583 C  CA  . HIS G 3 27  ? 33.65046 39.32931  -59.34869 1.000 70.61057  ? 27  HIS E CA  1 
ATOM   6584 C  C   . HIS G 3 27  ? 34.86577 39.73122  -58.52639 1.000 68.87724  ? 27  HIS E C   1 
ATOM   6585 O  O   . HIS G 3 27  ? 35.96600 39.90368  -59.06226 1.000 69.05102  ? 27  HIS E O   1 
ATOM   6586 C  CB  . HIS G 3 27  ? 33.74717 37.84818  -59.67282 1.000 69.69970  ? 27  HIS E CB  1 
ATOM   6587 C  CG  . HIS G 3 27  ? 32.43238 37.15224  -59.71546 1.000 67.89693  ? 27  HIS E CG  1 
ATOM   6588 N  ND1 . HIS G 3 27  ? 31.80203 36.68604  -58.58480 1.000 66.50515  ? 27  HIS E ND1 1 
ATOM   6589 C  CD2 . HIS G 3 27  ? 31.64140 36.81065  -60.75781 1.000 69.39575  ? 27  HIS E CD2 1 
ATOM   6590 C  CE1 . HIS G 3 27  ? 30.66513 36.10664  -58.92683 1.000 68.38633  ? 27  HIS E CE1 1 
ATOM   6591 N  NE2 . HIS G 3 27  ? 30.54605 36.16465  -60.24069 1.000 69.96733  ? 27  HIS E NE2 1 
ATOM   6592 N  N   . GLU G 3 28  ? 34.67017 39.82648  -57.20987 1.000 67.22694  ? 28  GLU E N   1 
ATOM   6593 C  CA  . GLU G 3 28  ? 35.69623 40.25597  -56.26326 1.000 67.20227  ? 28  GLU E CA  1 
ATOM   6594 C  C   . GLU G 3 28  ? 36.22794 39.06143  -55.47812 1.000 63.33511  ? 28  GLU E C   1 
ATOM   6595 O  O   . GLU G 3 28  ? 35.48461 38.44760  -54.70435 1.000 65.47351  ? 28  GLU E O   1 
ATOM   6596 C  CB  . GLU G 3 28  ? 35.11969 41.28606  -55.29559 1.000 73.79102  ? 28  GLU E CB  1 
ATOM   6597 C  CG  . GLU G 3 28  ? 34.52137 42.48773  -55.98815 1.000 80.83909  ? 28  GLU E CG  1 
ATOM   6598 C  CD  . GLU G 3 28  ? 33.96533 43.52361  -55.03033 1.000 85.07186  ? 28  GLU E CD  1 
ATOM   6599 O  OE1 . GLU G 3 28  ? 33.81187 43.23410  -53.81907 1.000 84.97421  ? 28  GLU E OE1 1 
ATOM   6600 O  OE2 . GLU G 3 28  ? 33.71556 44.65266  -55.49707 1.000 90.89807  ? 28  GLU E OE2 1 
ATOM   6601 N  N   . PHE G 3 29  ? 37.52857 38.79699  -55.58846 1.000 56.75124  ? 29  PHE E N   1 
ATOM   6602 C  CA  . PHE G 3 29  ? 38.15921 37.69367  -54.87417 1.000 55.09560  ? 29  PHE E CA  1 
ATOM   6603 C  C   . PHE G 3 29  ? 39.10308 38.25817  -53.82244 1.000 56.70333  ? 29  PHE E C   1 
ATOM   6604 O  O   . PHE G 3 29  ? 40.06407 38.95393  -54.16988 1.000 63.97406  ? 29  PHE E O   1 
ATOM   6605 C  CB  . PHE G 3 29  ? 38.91500 36.78306  -55.83529 1.000 53.55544  ? 29  PHE E CB  1 
ATOM   6606 C  CG  . PHE G 3 29  ? 38.01813 36.00994  -56.75588 1.000 53.68236  ? 29  PHE E CG  1 
ATOM   6607 C  CD1 . PHE G 3 29  ? 37.43996 34.82909  -56.33411 1.000 54.03058  ? 29  PHE E CD1 1 
ATOM   6608 C  CD2 . PHE G 3 29  ? 37.76411 36.45425  -58.04477 1.000 53.77427  ? 29  PHE E CD2 1 
ATOM   6609 C  CE1 . PHE G 3 29  ? 36.61977 34.11282  -57.16700 1.000 58.60579  ? 29  PHE E CE1 1 
ATOM   6610 C  CE2 . PHE G 3 29  ? 36.94387 35.73589  -58.89096 1.000 51.98793  ? 29  PHE E CE2 1 
ATOM   6611 C  CZ  . PHE G 3 29  ? 36.37046 34.56342  -58.44974 1.000 55.55655  ? 29  PHE E CZ  1 
ATOM   6612 N  N   . ILE G 3 30  ? 38.82776 37.97209  -52.54518 1.000 49.75860  ? 30  ILE E N   1 
ATOM   6613 C  CA  . ILE G 3 30  ? 39.64824 38.44838  -51.43232 1.000 46.01041  ? 30  ILE E CA  1 
ATOM   6614 C  C   . ILE G 3 30  ? 40.50109 37.28002  -50.93876 1.000 50.93996  ? 30  ILE E C   1 
ATOM   6615 O  O   . ILE G 3 30  ? 39.97248 36.26378  -50.45396 1.000 50.84533  ? 30  ILE E O   1 
ATOM   6616 C  CB  . ILE G 3 30  ? 38.78226 39.01405  -50.29631 1.000 45.17299  ? 30  ILE E CB  1 
ATOM   6617 C  CG1 . ILE G 3 30  ? 37.90187 40.14972  -50.81757 1.000 47.69651  ? 30  ILE E CG1 1 
ATOM   6618 C  CG2 . ILE G 3 30  ? 39.63104 39.53070  -49.12041 1.000 43.15890  ? 30  ILE E CG2 1 
ATOM   6619 C  CD1 . ILE G 3 30  ? 36.94578 40.67889  -49.77635 1.000 49.96685  ? 30  ILE E CD1 1 
ATOM   6620 N  N   . VAL G 3 31  ? 41.82529 37.41437  -51.07642 1.000 52.50825  ? 31  VAL E N   1 
ATOM   6621 C  CA  . VAL G 3 31  ? 42.78665 36.38771  -50.69587 1.000 51.86582  ? 31  VAL E CA  1 
ATOM   6622 C  C   . VAL G 3 31  ? 43.85211 37.02631  -49.81762 1.000 56.44247  ? 31  VAL E C   1 
ATOM   6623 O  O   . VAL G 3 31  ? 44.09765 38.23172  -49.88777 1.000 58.29662  ? 31  VAL E O   1 
ATOM   6624 C  CB  . VAL G 3 31  ? 43.43953 35.76202  -51.94669 1.000 49.87629  ? 31  VAL E CB  1 
ATOM   6625 C  CG1 . VAL G 3 31  ? 42.38109 35.51353  -53.02100 1.000 46.80364  ? 31  VAL E CG1 1 
ATOM   6626 C  CG2 . VAL G 3 31  ? 44.51301 36.67891  -52.48700 1.000 49.92723  ? 31  VAL E CG2 1 
ATOM   6627 N  N   . LYS G 3 32  ? 44.53415 36.19961  -49.02422 1.000 63.54087  ? 32  LYS E N   1 
ATOM   6628 C  CA  . LYS G 3 32  ? 45.61034 36.71845  -48.17716 1.000 70.30691  ? 32  LYS E CA  1 
ATOM   6629 C  C   . LYS G 3 32  ? 46.74725 37.25744  -49.04027 1.000 72.53073  ? 32  LYS E C   1 
ATOM   6630 O  O   . LYS G 3 32  ? 47.14898 36.61899  -50.01868 1.000 72.79550  ? 32  LYS E O   1 
ATOM   6631 C  CB  . LYS G 3 32  ? 46.13387 35.62884  -47.24496 1.000 73.17835  ? 32  LYS E CB  1 
ATOM   6632 C  CG  . LYS G 3 32  ? 45.06236 35.07086  -46.33925 1.000 78.88184  ? 32  LYS E CG  1 
ATOM   6633 C  CD  . LYS G 3 32  ? 45.64301 34.21114  -45.25074 1.000 85.20328  ? 32  LYS E CD  1 
ATOM   6634 C  CE  . LYS G 3 32  ? 44.54863 33.65234  -44.37322 1.000 90.61871  ? 32  LYS E CE  1 
ATOM   6635 N  NZ  . LYS G 3 32  ? 45.14590 32.85852  -43.27418 1.000 98.65194  ? 32  LYS E NZ  1 
ATOM   6636 N  N   . ARG G 3 33  ? 47.26519 38.43445  -48.67729 1.000 74.27425  ? 33  ARG E N   1 
ATOM   6637 C  CA  . ARG G 3 33  ? 48.31250 39.05690  -49.48115 1.000 76.73411  ? 33  ARG E CA  1 
ATOM   6638 C  C   . ARG G 3 33  ? 49.49879 38.12159  -49.65250 1.000 81.63126  ? 33  ARG E C   1 
ATOM   6639 O  O   . ARG G 3 33  ? 50.08673 38.04098  -50.73769 1.000 82.88751  ? 33  ARG E O   1 
ATOM   6640 C  CB  . ARG G 3 33  ? 48.76102 40.37220  -48.84970 1.000 76.99981  ? 33  ARG E CB  1 
ATOM   6641 C  CG  . ARG G 3 33  ? 49.78563 41.11872  -49.67405 1.000 75.32393  ? 33  ARG E CG  1 
ATOM   6642 C  CD  . ARG G 3 33  ? 50.35858 42.28231  -48.89947 1.000 74.83528  ? 33  ARG E CD  1 
ATOM   6643 N  NE  . ARG G 3 33  ? 50.96118 43.27817  -49.77983 1.000 74.58620  ? 33  ARG E NE  1 
ATOM   6644 C  CZ  . ARG G 3 33  ? 50.34637 44.38782  -50.18426 1.000 75.82357  ? 33  ARG E CZ  1 
ATOM   6645 N  NH1 . ARG G 3 33  ? 49.10412 44.65541  -49.78828 1.000 75.48221  ? 33  ARG E NH1 1 
ATOM   6646 N  NH2 . ARG G 3 33  ? 50.97710 45.23836  -50.98380 1.000 77.12296  ? 33  ARG E NH2 1 
ATOM   6647 N  N   . GLU G 3 34  ? 49.85359 37.39355  -48.59286 1.000 86.13728  ? 34  GLU E N   1 
ATOM   6648 C  CA  . GLU G 3 34  ? 50.92767 36.41396  -48.69444 1.000 89.94203  ? 34  GLU E CA  1 
ATOM   6649 C  C   . GLU G 3 34  ? 50.65051 35.39554  -49.79393 1.000 82.36377  ? 34  GLU E C   1 
ATOM   6650 O  O   . GLU G 3 34  ? 51.57824 34.94358  -50.47252 1.000 80.32150  ? 34  GLU E O   1 
ATOM   6651 C  CB  . GLU G 3 34  ? 51.09946 35.70141  -47.34700 1.000 101.82488 ? 34  GLU E CB  1 
ATOM   6652 C  CG  . GLU G 3 34  ? 52.30282 34.78069  -47.24013 1.000 109.01481 ? 34  GLU E CG  1 
ATOM   6653 C  CD  . GLU G 3 34  ? 53.57670 35.52189  -46.89597 1.000 114.42511 ? 34  GLU E CD  1 
ATOM   6654 O  OE1 . GLU G 3 34  ? 54.19569 35.19038  -45.86077 1.000 114.55550 ? 34  GLU E OE1 1 
ATOM   6655 O  OE2 . GLU G 3 34  ? 53.95665 36.44084  -47.65426 1.000 117.70842 ? 34  GLU E OE2 1 
ATOM   6656 N  N   . HIS G 3 35  ? 49.38705 35.03872  -50.00619 1.000 79.16805  ? 35  HIS E N   1 
ATOM   6657 C  CA  . HIS G 3 35  ? 49.09629 34.05241  -51.03659 1.000 77.16683  ? 35  HIS E CA  1 
ATOM   6658 C  C   . HIS G 3 35  ? 49.13690 34.67322  -52.42519 1.000 77.44689  ? 35  HIS E C   1 
ATOM   6659 O  O   . HIS G 3 35  ? 49.65645 34.06117  -53.36536 1.000 77.45426  ? 35  HIS E O   1 
ATOM   6660 C  CB  . HIS G 3 35  ? 47.73745 33.41633  -50.78532 1.000 74.66523  ? 35  HIS E CB  1 
ATOM   6661 C  CG  . HIS G 3 35  ? 47.65250 32.68561  -49.48857 1.000 73.00487  ? 35  HIS E CG  1 
ATOM   6662 N  ND1 . HIS G 3 35  ? 46.59218 31.87304  -49.16202 1.000 71.95315  ? 35  HIS E ND1 1 
ATOM   6663 C  CD2 . HIS G 3 35  ? 48.49235 32.65565  -48.42844 1.000 72.44354  ? 35  HIS E CD2 1 
ATOM   6664 C  CE1 . HIS G 3 35  ? 46.77988 31.37950  -47.95135 1.000 73.30628  ? 35  HIS E CE1 1 
ATOM   6665 N  NE2 . HIS G 3 35  ? 47.92698 31.83686  -47.48525 1.000 72.15587  ? 35  HIS E NE2 1 
ATOM   6666 N  N   . ALA G 3 36  ? 48.59147 35.88184  -52.57822 1.000 74.45407  ? 36  ALA E N   1 
ATOM   6667 C  CA  . ALA G 3 36  ? 48.59272 36.49943  -53.89323 1.000 71.86970  ? 36  ALA E CA  1 
ATOM   6668 C  C   . ALA G 3 36  ? 50.00480 36.76745  -54.38998 1.000 70.66268  ? 36  ALA E C   1 
ATOM   6669 O  O   . ALA G 3 36  ? 50.22223 36.81114  -55.60465 1.000 73.98826  ? 36  ALA E O   1 
ATOM   6670 C  CB  . ALA G 3 36  ? 47.78470 37.79649  -53.87610 1.000 72.65592  ? 36  ALA E CB  1 
ATOM   6671 N  N   . LEU G 3 37  ? 50.97785 36.90466  -53.48807 1.000 67.19049  ? 37  LEU E N   1 
ATOM   6672 C  CA  . LEU G 3 37  ? 52.35184 37.12941  -53.91752 1.000 66.39874  ? 37  LEU E CA  1 
ATOM   6673 C  C   . LEU G 3 37  ? 52.93297 35.96048  -54.70291 1.000 67.05636  ? 37  LEU E C   1 
ATOM   6674 O  O   . LEU G 3 37  ? 54.01988 36.10198  -55.27431 1.000 67.99948  ? 37  LEU E O   1 
ATOM   6675 C  CB  . LEU G 3 37  ? 53.24254 37.39951  -52.70732 1.000 66.60442  ? 37  LEU E CB  1 
ATOM   6676 C  CG  . LEU G 3 37  ? 53.02155 38.70264  -51.95464 1.000 63.61501  ? 37  LEU E CG  1 
ATOM   6677 C  CD1 . LEU G 3 37  ? 54.06376 38.78546  -50.85615 1.000 65.40277  ? 37  LEU E CD1 1 
ATOM   6678 C  CD2 . LEU G 3 37  ? 53.10613 39.88709  -52.90500 1.000 60.03494  ? 37  LEU E CD2 1 
ATOM   6679 N  N   . THR G 3 38  ? 52.25373 34.81413  -54.73608 1.000 65.01947  ? 38  THR E N   1 
ATOM   6680 C  CA  . THR G 3 38  ? 52.71126 33.70253  -55.56311 1.000 65.34029  ? 38  THR E CA  1 
ATOM   6681 C  C   . THR G 3 38  ? 52.90975 34.15081  -56.99927 1.000 66.86102  ? 38  THR E C   1 
ATOM   6682 O  O   . THR G 3 38  ? 53.90890 33.81221  -57.64324 1.000 71.18615  ? 38  THR E O   1 
ATOM   6683 C  CB  . THR G 3 38  ? 51.70028 32.56221  -55.51030 1.000 62.37717  ? 38  THR E CB  1 
ATOM   6684 O  OG1 . THR G 3 38  ? 51.68952 31.99777  -54.19750 1.000 62.62392  ? 38  THR E OG1 1 
ATOM   6685 C  CG2 . THR G 3 38  ? 52.04781 31.50171  -56.53787 1.000 61.86113  ? 38  THR E CG2 1 
ATOM   6686 N  N   . SER G 3 39  ? 51.94718 34.89743  -57.52123 1.000 64.62059  ? 39  SER E N   1 
ATOM   6687 C  CA  . SER G 3 39  ? 52.05521 35.43521  -58.86395 1.000 64.16259  ? 39  SER E CA  1 
ATOM   6688 C  C   . SER G 3 39  ? 53.20483 36.42824  -58.93330 1.000 64.00970  ? 39  SER E C   1 
ATOM   6689 O  O   . SER G 3 39  ? 53.33491 37.30244  -58.07444 1.000 65.36708  ? 39  SER E O   1 
ATOM   6690 C  CB  . SER G 3 39  ? 50.74633 36.10102  -59.25645 1.000 67.62687  ? 39  SER E CB  1 
ATOM   6691 O  OG  . SER G 3 39  ? 50.88479 36.81160  -60.46749 1.000 70.36548  ? 39  SER E OG  1 
ATOM   6692 N  N   . GLY G 3 40  ? 54.08292 36.25138  -59.92027 1.000 62.85630  ? 40  GLY E N   1 
ATOM   6693 C  CA  . GLY G 3 40  ? 55.13347 37.23213  -60.13076 1.000 65.29596  ? 40  GLY E CA  1 
ATOM   6694 C  C   . GLY G 3 40  ? 54.57065 38.57668  -60.54493 1.000 67.65408  ? 40  GLY E C   1 
ATOM   6695 O  O   . GLY G 3 40  ? 55.03051 39.62652  -60.08429 1.000 70.83371  ? 40  GLY E O   1 
ATOM   6696 N  N   . THR G 3 41  ? 53.53648 38.55602  -61.38873 1.000 66.33248  ? 41  THR E N   1 
ATOM   6697 C  CA  . THR G 3 41  ? 52.88910 39.78366  -61.83116 1.000 66.22272  ? 41  THR E CA  1 
ATOM   6698 C  C   . THR G 3 41  ? 52.22032 40.50085  -60.67337 1.000 69.71154  ? 41  THR E C   1 
ATOM   6699 O  O   . THR G 3 41  ? 52.34137 41.72139  -60.52814 1.000 74.51852  ? 41  THR E O   1 
ATOM   6700 C  CB  . THR G 3 41  ? 51.86482 39.46721  -62.91187 1.000 67.43793  ? 41  THR E CB  1 
ATOM   6701 O  OG1 . THR G 3 41  ? 52.54424 39.05773  -64.10342 1.000 71.74237  ? 41  THR E OG1 1 
ATOM   6702 C  CG2 . THR G 3 41  ? 51.01680 40.67117  -63.19834 1.000 65.98090  ? 41  THR E CG2 1 
ATOM   6703 N  N   . ILE G 3 42  ? 51.49228 39.76250  -59.84256 1.000 67.78088  ? 42  ILE E N   1 
ATOM   6704 C  CA  . ILE G 3 42  ? 50.83637 40.40493  -58.71419 1.000 63.09126  ? 42  ILE E CA  1 
ATOM   6705 C  C   . ILE G 3 42  ? 51.86487 40.95274  -57.73710 1.000 62.54515  ? 42  ILE E C   1 
ATOM   6706 O  O   . ILE G 3 42  ? 51.66154 42.01767  -57.14530 1.000 61.34515  ? 42  ILE E O   1 
ATOM   6707 C  CB  . ILE G 3 42  ? 49.86806 39.42180  -58.03890 1.000 59.31165  ? 42  ILE E CB  1 
ATOM   6708 C  CG1 . ILE G 3 42  ? 48.79237 39.01336  -59.04583 1.000 57.08825  ? 42  ILE E CG1 1 
ATOM   6709 C  CG2 . ILE G 3 42  ? 49.29338 40.01557  -56.76397 1.000 59.27489  ? 42  ILE E CG2 1 
ATOM   6710 C  CD1 . ILE G 3 42  ? 47.59643 38.37822  -58.43007 1.000 57.40337  ? 42  ILE E CD1 1 
ATOM   6711 N  N   . LYS G 3 43  ? 52.99877 40.25459  -57.58102 1.000 64.78556  ? 43  LYS E N   1 
ATOM   6712 C  CA  . LYS G 3 43  ? 54.00830 40.65706  -56.60227 1.000 68.35990  ? 43  LYS E CA  1 
ATOM   6713 C  C   . LYS G 3 43  ? 54.63447 42.00008  -56.95494 1.000 71.74591  ? 43  LYS E C   1 
ATOM   6714 O  O   . LYS G 3 43  ? 54.90607 42.81785  -56.06671 1.000 71.64626  ? 43  LYS E O   1 
ATOM   6715 C  CB  . LYS G 3 43  ? 55.08676 39.58420  -56.46185 1.000 70.49171  ? 43  LYS E CB  1 
ATOM   6716 C  CG  . LYS G 3 43  ? 56.15418 39.94641  -55.41286 1.000 74.41418  ? 43  LYS E CG  1 
ATOM   6717 C  CD  . LYS G 3 43  ? 57.25429 38.89823  -55.27679 1.000 78.18412  ? 43  LYS E CD  1 
ATOM   6718 C  CE  . LYS G 3 43  ? 57.92728 38.63065  -56.60543 1.000 83.43575  ? 43  LYS E CE  1 
ATOM   6719 N  NZ  . LYS G 3 43  ? 58.82705 37.44470  -56.54584 1.000 88.19305  ? 43  LYS E NZ  1 
ATOM   6720 N  N   . ALA G 3 44  ? 54.90494 42.23110  -58.24229 1.000 71.39283  ? 44  ALA E N   1 
ATOM   6721 C  CA  . ALA G 3 44  ? 55.48049 43.50069  -58.66397 1.000 72.31830  ? 44  ALA E CA  1 
ATOM   6722 C  C   . ALA G 3 44  ? 54.53575 44.66934  -58.42253 1.000 72.81076  ? 44  ALA E C   1 
ATOM   6723 O  O   . ALA G 3 44  ? 54.99741 45.80856  -58.29832 1.000 75.22859  ? 44  ALA E O   1 
ATOM   6724 C  CB  . ALA G 3 44  ? 55.86106 43.43420  -60.14064 1.000 73.23373  ? 44  ALA E CB  1 
ATOM   6725 N  N   . MET G 3 45  ? 53.22756 44.41536  -58.33279 1.000 69.14478  ? 45  MET E N   1 
ATOM   6726 C  CA  . MET G 3 45  ? 52.27567 45.47610  -58.01967 1.000 69.74990  ? 45  MET E CA  1 
ATOM   6727 C  C   . MET G 3 45  ? 52.13584 45.72003  -56.52555 1.000 72.57695  ? 45  MET E C   1 
ATOM   6728 O  O   . MET G 3 45  ? 51.65783 46.79382  -56.13261 1.000 73.99033  ? 45  MET E O   1 
ATOM   6729 C  CB  . MET G 3 45  ? 50.87990 45.16103  -58.56015 1.000 67.53125  ? 45  MET E CB  1 
ATOM   6730 C  CG  . MET G 3 45  ? 50.77437 44.96443  -60.05083 1.000 67.96963  ? 45  MET E CG  1 
ATOM   6731 S  SD  . MET G 3 45  ? 49.04612 44.89076  -60.53255 1.000 67.87517  ? 45  MET E SD  1 
ATOM   6732 C  CE  . MET G 3 45  ? 49.13155 43.83350  -61.97390 1.000 69.46142  ? 45  MET E CE  1 
ATOM   6733 N  N   . LEU G 3 46  ? 52.50307 44.73545  -55.69508 1.000 72.07775  ? 46  LEU E N   1 
ATOM   6734 C  CA  . LEU G 3 46  ? 52.23902 44.78248  -54.26773 1.000 69.45022  ? 46  LEU E CA  1 
ATOM   6735 C  C   . LEU G 3 46  ? 53.47865 44.82844  -53.39212 1.000 75.01781  ? 46  LEU E C   1 
ATOM   6736 O  O   . LEU G 3 46  ? 53.34161 45.01158  -52.17809 1.000 76.71412  ? 46  LEU E O   1 
ATOM   6737 C  CB  . LEU G 3 46  ? 51.38522 43.57766  -53.84552 1.000 65.34642  ? 46  LEU E CB  1 
ATOM   6738 C  CG  . LEU G 3 46  ? 50.04579 43.41273  -54.57333 1.000 61.42067  ? 46  LEU E CG  1 
ATOM   6739 C  CD1 . LEU G 3 46  ? 49.26281 42.23928  -53.97876 1.000 61.21612  ? 46  LEU E CD1 1 
ATOM   6740 C  CD2 . LEU G 3 46  ? 49.20801 44.71697  -54.62347 1.000 58.22122  ? 46  LEU E CD2 1 
ATOM   6741 N  N   . SER G 3 47  ? 54.66806 44.61777  -53.94236 1.000 78.76077  ? 47  SER E N   1 
ATOM   6742 C  CA  . SER G 3 47  ? 55.88007 44.61879  -53.13801 1.000 86.12678  ? 47  SER E CA  1 
ATOM   6743 C  C   . SER G 3 47  ? 57.00664 45.27437  -53.91812 1.000 91.03980  ? 47  SER E C   1 
ATOM   6744 O  O   . SER G 3 47  ? 57.08478 45.15124  -55.14278 1.000 91.30785  ? 47  SER E O   1 
ATOM   6745 C  CB  . SER G 3 47  ? 56.28092 43.19698  -52.72631 1.000 88.78493  ? 47  SER E CB  1 
ATOM   6746 O  OG  . SER G 3 47  ? 57.45876 43.21531  -51.93597 1.000 92.63671  ? 47  SER E OG  1 
ATOM   6747 N  N   . GLY G 3 48  ? 57.87469 45.98103  -53.20313 1.000 97.08752  ? 48  GLY E N   1 
ATOM   6748 C  CA  . GLY G 3 48  ? 58.99598 46.62980  -53.83018 1.000 102.48418 ? 48  GLY E CA  1 
ATOM   6749 C  C   . GLY G 3 48  ? 59.54473 47.76551  -52.99279 1.000 108.11941 ? 48  GLY E C   1 
ATOM   6750 O  O   . GLY G 3 48  ? 59.16285 47.95215  -51.83277 1.000 106.80273 ? 48  GLY E O   1 
ATOM   6751 N  N   . PRO G 3 49  ? 60.47226 48.53562  -53.56987 1.000 114.27364 ? 49  PRO E N   1 
ATOM   6752 C  CA  . PRO G 3 49  ? 61.02663 49.68548  -52.83808 1.000 119.13725 ? 49  PRO E CA  1 
ATOM   6753 C  C   . PRO G 3 49  ? 59.98113 50.68727  -52.32104 1.000 123.99926 ? 49  PRO E C   1 
ATOM   6754 O  O   . PRO G 3 49  ? 60.27909 51.44832  -51.39662 1.000 124.73215 ? 49  PRO E O   1 
ATOM   6755 C  CB  . PRO G 3 49  ? 61.96417 50.33952  -53.86275 1.000 119.78919 ? 49  PRO E CB  1 
ATOM   6756 C  CG  . PRO G 3 49  ? 62.23870 49.29597  -54.90455 1.000 117.85446 ? 49  PRO E CG  1 
ATOM   6757 C  CD  . PRO G 3 49  ? 61.31592 48.12817  -54.70713 1.000 115.08643 ? 49  PRO E CD  1 
ATOM   6758 N  N   . GLY G 3 50  ? 58.77326 50.71608  -52.89385 1.000 127.21558 ? 50  GLY E N   1 
ATOM   6759 C  CA  . GLY G 3 50  ? 57.74037 51.64033  -52.44864 1.000 130.14351 ? 50  GLY E CA  1 
ATOM   6760 C  C   . GLY G 3 50  ? 57.67345 52.94726  -53.20721 1.000 133.33445 ? 50  GLY E C   1 
ATOM   6761 O  O   . GLY G 3 50  ? 56.87079 53.81785  -52.84018 1.000 133.92613 ? 50  GLY E O   1 
ATOM   6762 N  N   . GLN G 3 51  ? 58.48875 53.10723  -54.25493 1.000 135.31768 ? 51  GLN E N   1 
ATOM   6763 C  CA  . GLN G 3 51  ? 58.48365 54.33872  -55.03923 1.000 133.55064 ? 51  GLN E CA  1 
ATOM   6764 C  C   . GLN G 3 51  ? 57.11673 54.59410  -55.66081 1.000 123.86446 ? 51  GLN E C   1 
ATOM   6765 O  O   . GLN G 3 51  ? 56.65885 55.73976  -55.73014 1.000 121.57838 ? 51  GLN E O   1 
ATOM   6766 C  CB  . GLN G 3 51  ? 59.55505 54.26388  -56.13454 1.000 137.18817 ? 51  GLN E CB  1 
ATOM   6767 C  CG  . GLN G 3 51  ? 60.96952 54.00371  -55.63181 1.000 137.61042 ? 51  GLN E CG  1 
ATOM   6768 C  CD  . GLN G 3 51  ? 61.52712 55.18128  -54.86529 1.000 139.19966 ? 51  GLN E CD  1 
ATOM   6769 O  OE1 . GLN G 3 51  ? 60.94837 56.26748  -54.86894 1.000 139.78061 ? 51  GLN E OE1 1 
ATOM   6770 N  NE2 . GLN G 3 51  ? 62.64396 54.96724  -54.18234 1.000 140.16454 ? 51  GLN E NE2 1 
ATOM   6771 N  N   . PHE G 3 52  ? 56.45019 53.53668  -56.11632 1.000 114.97097 ? 52  PHE E N   1 
ATOM   6772 C  CA  . PHE G 3 52  ? 55.16651 53.64422  -56.79304 1.000 104.86161 ? 52  PHE E CA  1 
ATOM   6773 C  C   . PHE G 3 52  ? 54.01689 53.13116  -55.92674 1.000 97.04749  ? 52  PHE E C   1 
ATOM   6774 O  O   . PHE G 3 52  ? 53.00167 52.66162  -56.45052 1.000 91.61110  ? 52  PHE E O   1 
ATOM   6775 C  CB  . PHE G 3 52  ? 55.21501 52.90181  -58.12364 1.000 99.76052  ? 52  PHE E CB  1 
ATOM   6776 C  CG  . PHE G 3 52  ? 56.23941 53.43908  -59.07479 1.000 94.87844  ? 52  PHE E CG  1 
ATOM   6777 C  CD1 . PHE G 3 52  ? 55.94954 54.52454  -59.88362 1.000 93.01073  ? 52  PHE E CD1 1 
ATOM   6778 C  CD2 . PHE G 3 52  ? 57.49160 52.85807  -59.16211 1.000 91.81202  ? 52  PHE E CD2 1 
ATOM   6779 C  CE1 . PHE G 3 52  ? 56.88760 55.01759  -60.76221 1.000 91.71367  ? 52  PHE E CE1 1 
ATOM   6780 C  CE2 . PHE G 3 52  ? 58.43465 53.34624  -60.03941 1.000 90.67420  ? 52  PHE E CE2 1 
ATOM   6781 C  CZ  . PHE G 3 52  ? 58.13276 54.42693  -60.84030 1.000 91.16715  ? 52  PHE E CZ  1 
ATOM   6782 N  N   . ALA G 3 53  ? 54.17445 53.20581  -54.59963 1.000 94.69548  ? 53  ALA E N   1 
ATOM   6783 C  CA  . ALA G 3 53  ? 53.12930 52.82323  -53.64936 1.000 90.52632  ? 53  ALA E CA  1 
ATOM   6784 C  C   . ALA G 3 53  ? 52.69013 51.37482  -53.85288 1.000 90.66840  ? 53  ALA E C   1 
ATOM   6785 O  O   . ALA G 3 53  ? 51.49819 51.05269  -53.82299 1.000 91.17504  ? 53  ALA E O   1 
ATOM   6786 C  CB  . ALA G 3 53  ? 51.92851 53.77036  -53.72741 1.000 89.55319  ? 53  ALA E CB  1 
ATOM   6787 N  N   . GLU G 3 54  ? 53.66326 50.49008  -54.06954 1.000 108.77555 ? 54  GLU E N   1 
ATOM   6788 C  CA  . GLU G 3 54  ? 53.34717 49.07085  -54.16722 1.000 105.67066 ? 54  GLU E CA  1 
ATOM   6789 C  C   . GLU G 3 54  ? 52.86442 48.54431  -52.82254 1.000 100.37689 ? 54  GLU E C   1 
ATOM   6790 O  O   . GLU G 3 54  ? 51.86117 47.82623  -52.74804 1.000 99.66484  ? 54  GLU E O   1 
ATOM   6791 C  CB  . GLU G 3 54  ? 54.57620 48.28873  -54.64543 1.000 108.31994 ? 54  GLU E CB  1 
ATOM   6792 C  CG  . GLU G 3 54  ? 55.21298 48.77581  -55.96046 1.000 114.23959 ? 54  GLU E CG  1 
ATOM   6793 C  CD  . GLU G 3 54  ? 56.24827 49.88297  -55.75203 1.000 120.13297 ? 54  GLU E CD  1 
ATOM   6794 O  OE1 . GLU G 3 54  ? 55.98613 50.79648  -54.94460 1.000 122.57878 ? 54  GLU E OE1 1 
ATOM   6795 O  OE2 . GLU G 3 54  ? 57.33239 49.83323  -56.37578 1.000 123.05834 ? 54  GLU E OE2 1 
ATOM   6796 N  N   . ASN G 3 55  ? 53.55120 48.91628  -51.74712 1.000 99.66284  ? 55  ASN E N   1 
ATOM   6797 C  CA  . ASN G 3 55  ? 53.17810 48.49453  -50.40525 1.000 95.54844  ? 55  ASN E CA  1 
ATOM   6798 C  C   . ASN G 3 55  ? 51.90267 49.16125  -49.90020 1.000 93.34022  ? 55  ASN E C   1 
ATOM   6799 O  O   . ASN G 3 55  ? 51.48263 48.85730  -48.78380 1.000 90.79455  ? 55  ASN E O   1 
ATOM   6800 C  CB  . ASN G 3 55  ? 54.32745 48.78058  -49.44006 1.000 94.98647  ? 55  ASN E CB  1 
ATOM   6801 C  CG  . ASN G 3 55  ? 55.52273 47.87143  -49.66600 1.000 90.68042  ? 55  ASN E CG  1 
ATOM   6802 O  OD1 . ASN G 3 55  ? 55.37931 46.65531  -49.78755 1.000 85.44759  ? 55  ASN E OD1 1 
ATOM   6803 N  ND2 . ASN G 3 55  ? 56.71194 48.46331  -49.73509 1.000 92.22450  ? 55  ASN E ND2 1 
ATOM   6804 N  N   . GLU G 3 56  ? 51.26949 50.03911  -50.67862 1.000 94.63215  ? 56  GLU E N   1 
ATOM   6805 C  CA  . GLU G 3 56  ? 50.05038 50.70789  -50.24196 1.000 98.47428  ? 56  GLU E CA  1 
ATOM   6806 C  C   . GLU G 3 56  ? 48.84710 50.39011  -51.11901 1.000 96.39352  ? 56  GLU E C   1 
ATOM   6807 O  O   . GLU G 3 56  ? 47.80572 51.04409  -50.97655 1.000 98.97901  ? 56  GLU E O   1 
ATOM   6808 C  CB  . GLU G 3 56  ? 50.26992 52.22580  -50.21123 1.000 109.33965 ? 56  GLU E CB  1 
ATOM   6809 C  CG  . GLU G 3 56  ? 51.33165 52.69818  -49.22903 1.000 115.69021 ? 56  GLU E CG  1 
ATOM   6810 C  CD  . GLU G 3 56  ? 50.93021 52.48921  -47.78965 1.000 124.77482 ? 56  GLU E CD  1 
ATOM   6811 O  OE1 . GLU G 3 56  ? 49.74705 52.72977  -47.46697 1.000 127.39276 ? 56  GLU E OE1 1 
ATOM   6812 O  OE2 . GLU G 3 56  ? 51.79503 52.07848  -46.98560 1.000 130.49529 ? 56  GLU E OE2 1 
ATOM   6813 N  N   . THR G 3 57  ? 48.96409 49.43836  -52.04315 1.000 92.78033  ? 57  THR E N   1 
ATOM   6814 C  CA  . THR G 3 57  ? 47.84022 48.99802  -52.86633 1.000 93.47674  ? 57  THR E CA  1 
ATOM   6815 C  C   . THR G 3 57  ? 47.33764 47.64841  -52.35869 1.000 92.15120  ? 57  THR E C   1 
ATOM   6816 O  O   . THR G 3 57  ? 48.13521 46.77301  -52.00350 1.000 92.20826  ? 57  THR E O   1 
ATOM   6817 C  CB  . THR G 3 57  ? 48.20985 48.92710  -54.35739 1.000 93.81826  ? 57  THR E CB  1 
ATOM   6818 O  OG1 . THR G 3 57  ? 49.45239 48.23840  -54.54457 1.000 93.51538  ? 57  THR E OG1 1 
ATOM   6819 C  CG2 . THR G 3 57  ? 48.31592 50.33482  -54.94874 1.000 96.73369  ? 57  THR E CG2 1 
ATOM   6820 N  N   . ASN G 3 58  ? 46.01232 47.50548  -52.26786 1.000 92.12662  ? 58  ASN E N   1 
ATOM   6821 C  CA  . ASN G 3 58  ? 45.40591 46.28409  -51.75841 1.000 88.12096  ? 58  ASN E CA  1 
ATOM   6822 C  C   . ASN G 3 58  ? 44.22912 45.84999  -52.62258 1.000 86.16775  ? 58  ASN E C   1 
ATOM   6823 O  O   . ASN G 3 58  ? 43.28472 45.23281  -52.13031 1.000 89.34075  ? 58  ASN E O   1 
ATOM   6824 C  CB  . ASN G 3 58  ? 44.97181 46.47497  -50.30453 1.000 90.96872  ? 58  ASN E CB  1 
ATOM   6825 C  CG  . ASN G 3 58  ? 44.09814 47.71005  -50.11030 1.000 95.80559  ? 58  ASN E CG  1 
ATOM   6826 O  OD1 . ASN G 3 58  ? 43.13633 47.92841  -50.85265 1.000 98.64160  ? 58  ASN E OD1 1 
ATOM   6827 N  ND2 . ASN G 3 58  ? 44.44276 48.53340  -49.12368 1.000 96.01585  ? 58  ASN E ND2 1 
ATOM   6828 N  N   . GLU G 3 59  ? 44.28373 46.14021  -53.91700 1.000 83.72482  ? 59  GLU E N   1 
ATOM   6829 C  CA  . GLU G 3 59  ? 43.20079 45.81172  -54.83011 1.000 83.55952  ? 59  GLU E CA  1 
ATOM   6830 C  C   . GLU G 3 59  ? 43.74040 45.85008  -56.25239 1.000 77.68356  ? 59  GLU E C   1 
ATOM   6831 O  O   . GLU G 3 59  ? 44.47630 46.76791  -56.61176 1.000 79.83326  ? 59  GLU E O   1 
ATOM   6832 C  CB  . GLU G 3 59  ? 42.03180 46.78528  -54.65923 1.000 93.61886  ? 59  GLU E CB  1 
ATOM   6833 C  CG  . GLU G 3 59  ? 40.90866 46.60319  -55.65393 1.000 103.05055 ? 59  GLU E CG  1 
ATOM   6834 C  CD  . GLU G 3 59  ? 39.76703 47.56675  -55.40502 1.000 114.52052 ? 59  GLU E CD  1 
ATOM   6835 O  OE1 . GLU G 3 59  ? 39.50380 47.87908  -54.22114 1.000 118.81377 ? 59  GLU E OE1 1 
ATOM   6836 O  OE2 . GLU G 3 59  ? 39.13650 48.01136  -56.38853 1.000 117.31254 ? 59  GLU E OE2 1 
ATOM   6837 N  N   . VAL G 3 60  ? 43.38281 44.84884  -57.05159 1.000 71.45301  ? 60  VAL E N   1 
ATOM   6838 C  CA  . VAL G 3 60  ? 43.87838 44.71940  -58.41825 1.000 68.50978  ? 60  VAL E CA  1 
ATOM   6839 C  C   . VAL G 3 60  ? 42.74564 44.27611  -59.32551 1.000 69.62921  ? 60  VAL E C   1 
ATOM   6840 O  O   . VAL G 3 60  ? 42.10045 43.25943  -59.05928 1.000 70.80190  ? 60  VAL E O   1 
ATOM   6841 C  CB  . VAL G 3 60  ? 45.04723 43.72404  -58.52326 1.000 68.08471  ? 60  VAL E CB  1 
ATOM   6842 C  CG1 . VAL G 3 60  ? 45.44193 43.55752  -59.97437 1.000 67.34524  ? 60  VAL E CG1 1 
ATOM   6843 C  CG2 . VAL G 3 60  ? 46.24142 44.20817  -57.72212 1.000 69.70077  ? 60  VAL E CG2 1 
ATOM   6844 N  N   . ASN G 3 61  ? 42.52059 45.01774  -60.40910 1.000 74.99069  ? 61  ASN E N   1 
ATOM   6845 C  CA  . ASN G 3 61  ? 41.51003 44.67583  -61.40505 1.000 77.30475  ? 61  ASN E CA  1 
ATOM   6846 C  C   . ASN G 3 61  ? 42.18802 43.98804  -62.58228 1.000 75.72322  ? 61  ASN E C   1 
ATOM   6847 O  O   . ASN G 3 61  ? 43.03989 44.58313  -63.24550 1.000 77.97640  ? 61  ASN E O   1 
ATOM   6848 C  CB  . ASN G 3 61  ? 40.77001 45.91246  -61.90642 1.000 82.87585  ? 61  ASN E CB  1 
ATOM   6849 C  CG  . ASN G 3 61  ? 40.15500 46.71572  -60.79667 1.000 93.92302  ? 61  ASN E CG  1 
ATOM   6850 O  OD1 . ASN G 3 61  ? 40.82926 47.51718  -60.14628 1.000 100.48676 ? 61  ASN E OD1 1 
ATOM   6851 N  ND2 . ASN G 3 61  ? 38.85852 46.52271  -60.57768 1.000 96.39801  ? 61  ASN E ND2 1 
ATOM   6852 N  N   . PHE G 3 62  ? 41.79975 42.75549  -62.85753 1.000 75.50154  ? 62  PHE E N   1 
ATOM   6853 C  CA  . PHE G 3 62  ? 42.31081 42.02145  -64.00949 1.000 73.58056  ? 62  PHE E CA  1 
ATOM   6854 C  C   . PHE G 3 62  ? 41.23897 42.02082  -65.09129 1.000 76.94418  ? 62  PHE E C   1 
ATOM   6855 O  O   . PHE G 3 62  ? 40.29897 41.21948  -65.05538 1.000 72.93843  ? 62  PHE E O   1 
ATOM   6856 C  CB  . PHE G 3 62  ? 42.69672 40.60273  -63.62678 1.000 69.40078  ? 62  PHE E CB  1 
ATOM   6857 C  CG  . PHE G 3 62  ? 43.92009 40.51564  -62.78579 1.000 67.19294  ? 62  PHE E CG  1 
ATOM   6858 C  CD1 . PHE G 3 62  ? 45.16281 40.75807  -63.33857 1.000 67.78296  ? 62  PHE E CD1 1 
ATOM   6859 C  CD2 . PHE G 3 62  ? 43.83337 40.18212  -61.44956 1.000 64.72569  ? 62  PHE E CD2 1 
ATOM   6860 C  CE1 . PHE G 3 62  ? 46.30019 40.66587  -62.57611 1.000 66.42854  ? 62  PHE E CE1 1 
ATOM   6861 C  CE2 . PHE G 3 62  ? 44.96315 40.08891  -60.67895 1.000 63.83897  ? 62  PHE E CE2 1 
ATOM   6862 C  CZ  . PHE G 3 62  ? 46.19870 40.33053  -61.23889 1.000 64.78700  ? 62  PHE E CZ  1 
ATOM   6863 N  N   . ARG G 3 63  ? 41.39256 42.91941  -66.06556 1.000 81.10855  ? 63  ARG E N   1 
ATOM   6864 C  CA  . ARG G 3 63  ? 40.54628 42.89744  -67.25245 1.000 84.63359  ? 63  ARG E CA  1 
ATOM   6865 C  C   . ARG G 3 63  ? 40.79470 41.65434  -68.10580 1.000 81.13987  ? 63  ARG E C   1 
ATOM   6866 O  O   . ARG G 3 63  ? 39.93377 41.27064  -68.90382 1.000 80.01902  ? 63  ARG E O   1 
ATOM   6867 C  CB  . ARG G 3 63  ? 40.78356 44.19916  -68.03731 1.000 88.99704  ? 63  ARG E CB  1 
ATOM   6868 C  CG  . ARG G 3 63  ? 40.29452 44.23112  -69.47209 1.000 90.72069  ? 63  ARG E CG  1 
ATOM   6869 C  CD  . ARG G 3 63  ? 38.79244 44.22569  -69.59497 1.000 94.70052  ? 63  ARG E CD  1 
ATOM   6870 N  NE  . ARG G 3 63  ? 38.40971 43.87326  -70.95677 1.000 98.87134  ? 63  ARG E NE  1 
ATOM   6871 C  CZ  . ARG G 3 63  ? 37.17476 43.94796  -71.43123 1.000 106.09943 ? 63  ARG E CZ  1 
ATOM   6872 N  NH1 . ARG G 3 63  ? 36.19255 44.37993  -70.65182 1.000 113.81045 ? 63  ARG E NH1 1 
ATOM   6873 N  NH2 . ARG G 3 63  ? 36.92454 43.59624  -72.68533 1.000 106.11316 ? 63  ARG E NH2 1 
ATOM   6874 N  N   . GLU G 3 64  ? 41.91929 40.97754  -67.89705 1.000 80.02999  ? 64  GLU E N   1 
ATOM   6875 C  CA  . GLU G 3 64  ? 42.37508 39.90553  -68.76817 1.000 74.76907  ? 64  GLU E CA  1 
ATOM   6876 C  C   . GLU G 3 64  ? 41.84838 38.52581  -68.37230 1.000 69.82746  ? 64  GLU E C   1 
ATOM   6877 O  O   . GLU G 3 64  ? 41.86115 37.61516  -69.20910 1.000 70.46321  ? 64  GLU E O   1 
ATOM   6878 C  CB  . GLU G 3 64  ? 43.91243 39.88650  -68.76603 1.000 74.83256  ? 64  GLU E CB  1 
ATOM   6879 C  CG  . GLU G 3 64  ? 44.58243 41.22816  -69.16087 1.000 78.63029  ? 64  GLU E CG  1 
ATOM   6880 C  CD  . GLU G 3 64  ? 44.68529 42.26616  -68.02306 1.000 81.57759  ? 64  GLU E CD  1 
ATOM   6881 O  OE1 . GLU G 3 64  ? 44.00724 42.13277  -66.97594 1.000 80.75504  ? 64  GLU E OE1 1 
ATOM   6882 O  OE2 . GLU G 3 64  ? 45.47404 43.22577  -68.18191 1.000 83.42133  ? 64  GLU E OE2 1 
ATOM   6883 N  N   . ILE G 3 65  ? 41.36259 38.35346  -67.14331 1.000 63.74713  ? 65  ILE E N   1 
ATOM   6884 C  CA  . ILE G 3 65  ? 41.06551 37.04098  -66.57907 1.000 55.36678  ? 65  ILE E CA  1 
ATOM   6885 C  C   . ILE G 3 65  ? 39.60024 36.95695  -66.15736 1.000 55.96460  ? 65  ILE E C   1 
ATOM   6886 O  O   . ILE G 3 65  ? 39.19752 37.62281  -65.19770 1.000 56.33637  ? 65  ILE E O   1 
ATOM   6887 C  CB  . ILE G 3 65  ? 41.97132 36.72770  -65.37723 1.000 51.05139  ? 65  ILE E CB  1 
ATOM   6888 C  CG1 . ILE G 3 65  ? 43.44723 36.96955  -65.71115 1.000 48.07816  ? 65  ILE E CG1 1 
ATOM   6889 C  CG2 . ILE G 3 65  ? 41.74777 35.31618  -64.96459 1.000 52.32657  ? 65  ILE E CG2 1 
ATOM   6890 C  CD1 . ILE G 3 65  ? 44.38292 36.88070  -64.50471 1.000 47.54336  ? 65  ILE E CD1 1 
ATOM   6891 N  N   . PRO G 3 66  ? 38.78684 36.08194  -66.76183 1.000 54.78840  ? 66  PRO E N   1 
ATOM   6892 C  CA  . PRO G 3 66  ? 37.38753 35.94535  -66.30468 1.000 53.99949  ? 66  PRO E CA  1 
ATOM   6893 C  C   . PRO G 3 66  ? 37.28638 35.29722  -64.91602 1.000 57.46834  ? 66  PRO E C   1 
ATOM   6894 O  O   . PRO G 3 66  ? 38.27396 34.76960  -64.40296 1.000 55.73497  ? 66  PRO E O   1 
ATOM   6895 C  CB  . PRO G 3 66  ? 36.74775 35.08237  -67.39887 1.000 50.38820  ? 66  PRO E CB  1 
ATOM   6896 C  CG  . PRO G 3 66  ? 37.89431 34.30813  -68.00290 1.000 47.94961  ? 66  PRO E CG  1 
ATOM   6897 C  CD  . PRO G 3 66  ? 39.11862 35.16654  -67.87733 1.000 50.31812  ? 66  PRO E CD  1 
ATOM   6898 N  N   . SER G 3 67  ? 36.08039 35.26602  -64.32864 1.000 53.65844  ? 67  SER E N   1 
ATOM   6899 C  CA  . SER G 3 67  ? 35.96875 34.84308  -62.93236 1.000 54.81005  ? 67  SER E CA  1 
ATOM   6900 C  C   . SER G 3 67  ? 36.16389 33.33988  -62.76999 1.000 60.31938  ? 67  SER E C   1 
ATOM   6901 O  O   . SER G 3 67  ? 36.80527 32.90426  -61.80807 1.000 64.13064  ? 67  SER E O   1 
ATOM   6902 C  CB  . SER G 3 67  ? 34.61620 35.28175  -62.35615 1.000 50.78347  ? 67  SER E CB  1 
ATOM   6903 O  OG  . SER G 3 67  ? 33.54756 34.90255  -63.20745 1.000 49.95574  ? 67  SER E OG  1 
ATOM   6904 N  N   . HIS G 3 68  ? 35.64595 32.52325  -63.69316 1.000 60.77873  ? 68  HIS E N   1 
ATOM   6905 C  CA  . HIS G 3 68  ? 35.83949 31.08836  -63.50811 1.000 62.45673  ? 68  HIS E CA  1 
ATOM   6906 C  C   . HIS G 3 68  ? 37.30528 30.68967  -63.62794 1.000 60.98059  ? 68  HIS E C   1 
ATOM   6907 O  O   . HIS G 3 68  ? 37.69017 29.64624  -63.09891 1.000 65.59712  ? 68  HIS E O   1 
ATOM   6908 C  CB  . HIS G 3 68  ? 34.98490 30.27746  -64.48115 1.000 66.36133  ? 68  HIS E CB  1 
ATOM   6909 C  CG  . HIS G 3 68  ? 35.46530 30.31555  -65.89645 1.000 68.68852  ? 68  HIS E CG  1 
ATOM   6910 N  ND1 . HIS G 3 68  ? 35.00141 31.23204  -66.81692 1.000 67.74355  ? 68  HIS E ND1 1 
ATOM   6911 C  CD2 . HIS G 3 68  ? 36.33745 29.52220  -66.56144 1.000 69.88965  ? 68  HIS E CD2 1 
ATOM   6912 C  CE1 . HIS G 3 68  ? 35.58738 31.01774  -67.98068 1.000 67.01844  ? 68  HIS E CE1 1 
ATOM   6913 N  NE2 . HIS G 3 68  ? 36.40092 29.98466  -67.85303 1.000 68.24100  ? 68  HIS E NE2 1 
ATOM   6914 N  N   . VAL G 3 69  ? 38.13018 31.47478  -64.32014 1.000 56.90724  ? 69  VAL E N   1 
ATOM   6915 C  CA  . VAL G 3 69  ? 39.56724 31.22022  -64.28815 1.000 55.44847  ? 69  VAL E CA  1 
ATOM   6916 C  C   . VAL G 3 69  ? 40.17913 31.78871  -63.01766 1.000 59.77556  ? 69  VAL E C   1 
ATOM   6917 O  O   . VAL G 3 69  ? 40.97373 31.12329  -62.34413 1.000 64.83378  ? 69  VAL E O   1 
ATOM   6918 C  CB  . VAL G 3 69  ? 40.26341 31.78791  -65.53620 1.000 49.34545  ? 69  VAL E CB  1 
ATOM   6919 C  CG1 . VAL G 3 69  ? 41.79748 31.59356  -65.42228 1.000 45.84851  ? 69  VAL E CG1 1 
ATOM   6920 C  CG2 . VAL G 3 69  ? 39.67171 31.17419  -66.82634 1.000 46.65741  ? 69  VAL E CG2 1 
ATOM   6921 N  N   . LEU G 3 70  ? 39.82358 33.02629  -62.66120 1.000 60.07276  ? 70  LEU E N   1 
ATOM   6922 C  CA  . LEU G 3 70  ? 40.42685 33.62494  -61.47043 1.000 59.41730  ? 70  LEU E CA  1 
ATOM   6923 C  C   . LEU G 3 70  ? 40.10602 32.82276  -60.20776 1.000 63.35529  ? 70  LEU E C   1 
ATOM   6924 O  O   . LEU G 3 70  ? 40.89742 32.82067  -59.25987 1.000 65.76333  ? 70  LEU E O   1 
ATOM   6925 C  CB  . LEU G 3 70  ? 39.98128 35.07902  -61.31448 1.000 55.18413  ? 70  LEU E CB  1 
ATOM   6926 C  CG  . LEU G 3 70  ? 40.73772 35.95382  -60.31142 1.000 53.25735  ? 70  LEU E CG  1 
ATOM   6927 C  CD1 . LEU G 3 70  ? 42.24554 35.94559  -60.55158 1.000 53.11403  ? 70  LEU E CD1 1 
ATOM   6928 C  CD2 . LEU G 3 70  ? 40.19813 37.36907  -60.38520 1.000 51.71209  ? 70  LEU E CD2 1 
ATOM   6929 N  N   . SER G 3 71  ? 38.97308 32.11720  -60.17200 1.000 62.81633  ? 71  SER E N   1 
ATOM   6930 C  CA  . SER G 3 71  ? 38.70427 31.28413  -59.00415 1.000 65.63747  ? 71  SER E CA  1 
ATOM   6931 C  C   . SER G 3 71  ? 39.69472 30.12226  -58.90119 1.000 62.37409  ? 71  SER E C   1 
ATOM   6932 O  O   . SER G 3 71  ? 40.20088 29.83953  -57.81010 1.000 62.13380  ? 71  SER E O   1 
ATOM   6933 C  CB  . SER G 3 71  ? 37.26695 30.78204  -59.02993 1.000 71.37133  ? 71  SER E CB  1 
ATOM   6934 O  OG  . SER G 3 71  ? 37.04569 30.00012  -60.18786 1.000 79.26938  ? 71  SER E OG  1 
ATOM   6935 N  N   . LYS G 3 72  ? 40.00840 29.44892  -60.01656 1.000 59.26536  ? 72  LYS E N   1 
ATOM   6936 C  CA  . LYS G 3 72  ? 41.02974 28.39811  -59.96502 1.000 62.72230  ? 72  LYS E CA  1 
ATOM   6937 C  C   . LYS G 3 72  ? 42.37557 28.96814  -59.54793 1.000 62.97171  ? 72  LYS E C   1 
ATOM   6938 O  O   . LYS G 3 72  ? 43.10861 28.35257  -58.75951 1.000 64.98712  ? 72  LYS E O   1 
ATOM   6939 C  CB  . LYS G 3 72  ? 41.17548 27.69056  -61.31319 1.000 64.33186  ? 72  LYS E CB  1 
ATOM   6940 C  CG  . LYS G 3 72  ? 40.21777 26.54408  -61.52303 1.000 67.75003  ? 72  LYS E CG  1 
ATOM   6941 C  CD  . LYS G 3 72  ? 40.58334 25.35645  -60.67477 1.000 70.62731  ? 72  LYS E CD  1 
ATOM   6942 C  CE  . LYS G 3 72  ? 39.61979 24.22801  -60.94268 1.000 74.75813  ? 72  LYS E CE  1 
ATOM   6943 N  NZ  . LYS G 3 72  ? 39.92175 23.08808  -60.04988 1.000 80.61928  ? 72  LYS E NZ  1 
ATOM   6944 N  N   . VAL G 3 73  ? 42.72401 30.13860  -60.08370 1.000 59.75366  ? 73  VAL E N   1 
ATOM   6945 C  CA  . VAL G 3 73  ? 43.99676 30.76236  -59.74631 1.000 57.74032  ? 73  VAL E CA  1 
ATOM   6946 C  C   . VAL G 3 73  ? 44.10648 30.96303  -58.23766 1.000 57.20940  ? 73  VAL E C   1 
ATOM   6947 O  O   . VAL G 3 73  ? 45.12546 30.62150  -57.62688 1.000 56.33135  ? 73  VAL E O   1 
ATOM   6948 C  CB  . VAL G 3 73  ? 44.14440 32.07368  -60.53392 1.000 54.83043  ? 73  VAL E CB  1 
ATOM   6949 C  CG1 . VAL G 3 73  ? 45.39511 32.83809  -60.12003 1.000 55.71560  ? 73  VAL E CG1 1 
ATOM   6950 C  CG2 . VAL G 3 73  ? 44.19401 31.73446  -61.98922 1.000 53.17384  ? 73  VAL E CG2 1 
ATOM   6951 N  N   . CYS G 3 74  ? 43.04091 31.45756  -57.60092 1.000 57.70104  ? 74  CYS E N   1 
ATOM   6952 C  CA  . CYS G 3 74  ? 43.09774 31.66635  -56.15734 1.000 60.03540  ? 74  CYS E CA  1 
ATOM   6953 C  C   . CYS G 3 74  ? 43.21631 30.34994  -55.40208 1.000 65.00568  ? 74  CYS E C   1 
ATOM   6954 O  O   . CYS G 3 74  ? 43.90327 30.28153  -54.37438 1.000 66.72245  ? 74  CYS E O   1 
ATOM   6955 C  CB  . CYS G 3 74  ? 41.86972 32.42560  -55.68217 1.000 60.25625  ? 74  CYS E CB  1 
ATOM   6956 S  SG  . CYS G 3 74  ? 41.85581 34.14120  -56.20261 1.000 63.16501  ? 74  CYS E SG  1 
ATOM   6957 N  N   . MET G 3 75  ? 42.57272 29.29135  -55.89589 1.000 64.68467  ? 75  MET E N   1 
ATOM   6958 C  CA  . MET G 3 75  ? 42.77739 27.97774  -55.30275 1.000 59.77465  ? 75  MET E CA  1 
ATOM   6959 C  C   . MET G 3 75  ? 44.22108 27.54353  -55.45471 1.000 56.99092  ? 75  MET E C   1 
ATOM   6960 O  O   . MET G 3 75  ? 44.82864 27.04456  -54.50349 1.000 56.49914  ? 75  MET E O   1 
ATOM   6961 C  CB  . MET G 3 75  ? 41.83814 26.96535  -55.93664 1.000 61.20992  ? 75  MET E CB  1 
ATOM   6962 C  CG  . MET G 3 75  ? 40.39251 27.29561  -55.71811 1.000 61.85547  ? 75  MET E CG  1 
ATOM   6963 S  SD  . MET G 3 75  ? 39.33007 26.27925  -56.72175 1.000 63.63147  ? 75  MET E SD  1 
ATOM   6964 C  CE  . MET G 3 75  ? 37.74687 26.97466  -56.25171 1.000 65.11710  ? 75  MET E CE  1 
ATOM   6965 N  N   . TYR G 3 76  ? 44.79916 27.73392  -56.64634 1.000 57.45930  ? 76  TYR E N   1 
ATOM   6966 C  CA  . TYR G 3 76  ? 46.21688 27.41670  -56.78990 1.000 59.62644  ? 76  TYR E CA  1 
ATOM   6967 C  C   . TYR G 3 76  ? 47.06629 28.17339  -55.77096 1.000 58.67374  ? 76  TYR E C   1 
ATOM   6968 O  O   . TYR G 3 76  ? 48.05123 27.62666  -55.26381 1.000 55.37317  ? 76  TYR E O   1 
ATOM   6969 C  CB  . TYR G 3 76  ? 46.71775 27.70348  -58.21277 1.000 57.94359  ? 76  TYR E CB  1 
ATOM   6970 C  CG  . TYR G 3 76  ? 48.20618 27.48623  -58.31966 1.000 57.14170  ? 76  TYR E CG  1 
ATOM   6971 C  CD1 . TYR G 3 76  ? 48.72705 26.21696  -58.47300 1.000 59.29555  ? 76  TYR E CD1 1 
ATOM   6972 C  CD2 . TYR G 3 76  ? 49.08969 28.55408  -58.22264 1.000 55.64729  ? 76  TYR E CD2 1 
ATOM   6973 C  CE1 . TYR G 3 76  ? 50.08443 26.01295  -58.53988 1.000 60.09462  ? 76  TYR E CE1 1 
ATOM   6974 C  CE2 . TYR G 3 76  ? 50.44906 28.36039  -58.29306 1.000 54.88481  ? 76  TYR E CE2 1 
ATOM   6975 C  CZ  . TYR G 3 76  ? 50.93570 27.08680  -58.45362 1.000 58.51251  ? 76  TYR E CZ  1 
ATOM   6976 O  OH  . TYR G 3 76  ? 52.28231 26.86566  -58.52852 1.000 66.53174  ? 76  TYR E OH  1 
ATOM   6977 N  N   . PHE G 3 77  ? 46.68748 29.41229  -55.43461 1.000 62.03464  ? 77  PHE E N   1 
ATOM   6978 C  CA  . PHE G 3 77  ? 47.42969 30.16690  -54.42941 1.000 64.34915  ? 77  PHE E CA  1 
ATOM   6979 C  C   . PHE G 3 77  ? 47.42043 29.44128  -53.08992 1.000 71.24524  ? 77  PHE E C   1 
ATOM   6980 O  O   . PHE G 3 77  ? 48.48142 29.13709  -52.53396 1.000 79.18913  ? 77  PHE E O   1 
ATOM   6981 C  CB  . PHE G 3 77  ? 46.86336 31.58156  -54.26713 1.000 62.82090  ? 77  PHE E CB  1 
ATOM   6982 C  CG  . PHE G 3 77  ? 47.09530 32.48534  -55.44983 1.000 60.58424  ? 77  PHE E CG  1 
ATOM   6983 C  CD1 . PHE G 3 77  ? 47.94911 32.10966  -56.47306 1.000 60.32521  ? 77  PHE E CD1 1 
ATOM   6984 C  CD2 . PHE G 3 77  ? 46.48623 33.73397  -55.51712 1.000 58.53494  ? 77  PHE E CD2 1 
ATOM   6985 C  CE1 . PHE G 3 77  ? 48.16082 32.93986  -57.55864 1.000 57.48227  ? 77  PHE E CE1 1 
ATOM   6986 C  CE2 . PHE G 3 77  ? 46.70333 34.57003  -56.59748 1.000 56.11967  ? 77  PHE E CE2 1 
ATOM   6987 C  CZ  . PHE G 3 77  ? 47.54264 34.16837  -57.61951 1.000 55.12511  ? 77  PHE E CZ  1 
ATOM   6988 N  N   . THR G 3 78  ? 46.22521 29.17028  -52.54026 1.000 69.46878  ? 78  THR E N   1 
ATOM   6989 C  CA  . THR G 3 78  ? 46.16907 28.50445  -51.23776 1.000 69.53089  ? 78  THR E CA  1 
ATOM   6990 C  C   . THR G 3 78  ? 46.75498 27.09907  -51.30698 1.000 64.79109  ? 78  THR E C   1 
ATOM   6991 O  O   . THR G 3 78  ? 47.29143 26.60448  -50.31198 1.000 66.48438  ? 78  THR E O   1 
ATOM   6992 C  CB  . THR G 3 78  ? 44.73273 28.49340  -50.67174 1.000 73.24170  ? 78  THR E CB  1 
ATOM   6993 O  OG1 . THR G 3 78  ? 43.84316 27.73492  -51.49874 1.000 76.01311  ? 78  THR E OG1 1 
ATOM   6994 C  CG2 . THR G 3 78  ? 44.19432 29.91946  -50.56596 1.000 75.52192  ? 78  THR E CG2 1 
ATOM   6995 N  N   . TYR G 3 79  ? 46.72279 26.46944  -52.48129 1.000 62.02140  ? 79  TYR E N   1 
ATOM   6996 C  CA  . TYR G 3 79  ? 47.31607 25.14479  -52.66867 1.000 61.24502  ? 79  TYR E CA  1 
ATOM   6997 C  C   . TYR G 3 79  ? 48.83519 25.20197  -52.75364 1.000 63.58737  ? 79  TYR E C   1 
ATOM   6998 O  O   . TYR G 3 79  ? 49.51156 24.24624  -52.37056 1.000 62.86383  ? 79  TYR E O   1 
ATOM   6999 C  CB  . TYR G 3 79  ? 46.73594 24.51596  -53.92201 1.000 61.78535  ? 79  TYR E CB  1 
ATOM   7000 C  CG  . TYR G 3 79  ? 47.35838 23.24798  -54.45445 1.000 60.17362  ? 79  TYR E CG  1 
ATOM   7001 C  CD1 . TYR G 3 79  ? 46.91548 22.01051  -54.02966 1.000 61.62490  ? 79  TYR E CD1 1 
ATOM   7002 C  CD2 . TYR G 3 79  ? 48.32167 23.29192  -55.45718 1.000 60.21711  ? 79  TYR E CD2 1 
ATOM   7003 C  CE1 . TYR G 3 79  ? 47.43776 20.84255  -54.55819 1.000 64.70138  ? 79  TYR E CE1 1 
ATOM   7004 C  CE2 . TYR G 3 79  ? 48.85066 22.14329  -55.98881 1.000 62.76390  ? 79  TYR E CE2 1 
ATOM   7005 C  CZ  . TYR G 3 79  ? 48.40734 20.91713  -55.54020 1.000 65.12578  ? 79  TYR E CZ  1 
ATOM   7006 O  OH  . TYR G 3 79  ? 48.94151 19.76736  -56.07679 1.000 65.54363  ? 79  TYR E OH  1 
ATOM   7007 N  N   . LYS G 3 80  ? 49.37999 26.26840  -53.34522 1.000 68.75244  ? 80  LYS E N   1 
ATOM   7008 C  CA  . LYS G 3 80  ? 50.82925 26.39877  -53.45431 1.000 70.61254  ? 80  LYS E CA  1 
ATOM   7009 C  C   . LYS G 3 80  ? 51.46146 26.73547  -52.10947 1.000 75.07291  ? 80  LYS E C   1 
ATOM   7010 O  O   . LYS G 3 80  ? 52.59967 26.33313  -51.84634 1.000 81.61768  ? 80  LYS E O   1 
ATOM   7011 C  CB  . LYS G 3 80  ? 51.17853 27.46480  -54.49010 1.000 69.26772  ? 80  LYS E CB  1 
ATOM   7012 C  CG  . LYS G 3 80  ? 52.64842 27.87028  -54.56149 1.000 73.42156  ? 80  LYS E CG  1 
ATOM   7013 C  CD  . LYS G 3 80  ? 53.46585 26.93101  -55.42586 1.000 80.03524  ? 80  LYS E CD  1 
ATOM   7014 C  CE  . LYS G 3 80  ? 54.72978 27.61036  -55.90946 1.000 83.50037  ? 80  LYS E CE  1 
ATOM   7015 N  NZ  . LYS G 3 80  ? 55.42447 28.28538  -54.77886 1.000 88.80244  ? 80  LYS E NZ  1 
ATOM   7016 N  N   . VAL G 3 81  ? 50.73889 27.44203  -51.23911 1.000 72.28169  ? 81  VAL E N   1 
ATOM   7017 C  CA  . VAL G 3 81  ? 51.31078 27.80910  -49.95117 1.000 74.49732  ? 81  VAL E CA  1 
ATOM   7018 C  C   . VAL G 3 81  ? 51.27170 26.63823  -48.97567 1.000 82.65506  ? 81  VAL E C   1 
ATOM   7019 O  O   . VAL G 3 81  ? 52.18592 26.47612  -48.15474 1.000 84.51911  ? 81  VAL E O   1 
ATOM   7020 C  CB  . VAL G 3 81  ? 50.59732 29.03916  -49.37578 1.000 71.75327  ? 81  VAL E CB  1 
ATOM   7021 C  CG1 . VAL G 3 81  ? 51.21606 29.43589  -48.05827 1.000 69.23346  ? 81  VAL E CG1 1 
ATOM   7022 C  CG2 . VAL G 3 81  ? 50.69380 30.18534  -50.35072 1.000 72.93636  ? 81  VAL E CG2 1 
ATOM   7023 N  N   . ARG G 3 82  ? 50.24001 25.79751  -49.05421 1.000 87.44288  ? 82  ARG E N   1 
ATOM   7024 C  CA  . ARG G 3 82  ? 50.10644 24.71379  -48.08899 1.000 94.52812  ? 82  ARG E CA  1 
ATOM   7025 C  C   . ARG G 3 82  ? 51.11604 23.60499  -48.35921 1.000 98.26248  ? 82  ARG E C   1 
ATOM   7026 O  O   . ARG G 3 82  ? 51.85880 23.19894  -47.45789 1.000 100.98156 ? 82  ARG E O   1 
ATOM   7027 C  CB  . ARG G 3 82  ? 48.67930 24.16119  -48.11283 1.000 100.45208 ? 82  ARG E CB  1 
ATOM   7028 C  CG  . ARG G 3 82  ? 48.45993 22.93407  -47.22263 1.000 108.66274 ? 82  ARG E CG  1 
ATOM   7029 C  CD  . ARG G 3 82  ? 48.69221 23.20469  -45.72954 1.000 115.70494 ? 82  ARG E CD  1 
ATOM   7030 N  NE  . ARG G 3 82  ? 47.65201 22.58348  -44.90666 1.000 124.16173 ? 82  ARG E NE  1 
ATOM   7031 C  CZ  . ARG G 3 82  ? 47.60861 21.29007  -44.58650 1.000 128.51373 ? 82  ARG E CZ  1 
ATOM   7032 N  NH1 . ARG G 3 82  ? 48.55054 20.45490  -45.01412 1.000 128.34041 ? 82  ARG E NH1 1 
ATOM   7033 N  NH2 . ARG G 3 82  ? 46.61230 20.82683  -43.83989 1.000 132.30942 ? 82  ARG E NH2 1 
ATOM   7034 N  N   . TYR G 3 83  ? 51.14979 23.08862  -49.58165 1.000 84.64247  ? 83  TYR E N   1 
ATOM   7035 C  CA  . TYR G 3 83  ? 51.98550 21.92892  -49.89813 1.000 84.20094  ? 83  TYR E CA  1 
ATOM   7036 C  C   . TYR G 3 83  ? 53.29711 22.33363  -50.55686 1.000 88.47287  ? 83  TYR E C   1 
ATOM   7037 O  O   . TYR G 3 83  ? 53.66169 21.76570  -51.57924 1.000 91.50894  ? 83  TYR E O   1 
ATOM   7038 C  CB  . TYR G 3 83  ? 51.22218 20.95598  -50.78602 1.000 81.01198  ? 83  TYR E CB  1 
ATOM   7039 C  CG  . TYR G 3 83  ? 49.89469 20.49403  -50.22339 1.000 82.09974  ? 83  TYR E CG  1 
ATOM   7040 C  CD1 . TYR G 3 83  ? 49.83365 19.72567  -49.06694 1.000 83.36042  ? 83  TYR E CD1 1 
ATOM   7041 C  CD2 . TYR G 3 83  ? 48.70439 20.79693  -50.86692 1.000 83.75616  ? 83  TYR E CD2 1 
ATOM   7042 C  CE1 . TYR G 3 83  ? 48.62184 19.29560  -48.55930 1.000 86.01661  ? 83  TYR E CE1 1 
ATOM   7043 C  CE2 . TYR G 3 83  ? 47.49158 20.36786  -50.37015 1.000 85.95168  ? 83  TYR E CE2 1 
ATOM   7044 C  CZ  . TYR G 3 83  ? 47.45192 19.62026  -49.22054 1.000 88.66628  ? 83  TYR E CZ  1 
ATOM   7045 O  OH  . TYR G 3 83  ? 46.22505 19.20940  -48.74976 1.000 94.15986  ? 83  TYR E OH  1 
ATOM   7046 N  N   . THR G 3 84  ? 54.06658 23.24941  -49.97329 1.000 90.86697  ? 84  THR E N   1 
ATOM   7047 C  CA  . THR G 3 84  ? 55.25911 23.74932  -50.65174 1.000 93.58025  ? 84  THR E CA  1 
ATOM   7048 C  C   . THR G 3 84  ? 56.56267 23.14801  -50.11608 1.000 103.13690 ? 84  THR E C   1 
ATOM   7049 O  O   . THR G 3 84  ? 57.45012 22.79971  -50.90853 1.000 103.36423 ? 84  THR E O   1 
ATOM   7050 C  CB  . THR G 3 84  ? 55.27814 25.29119  -50.55718 1.000 85.84305  ? 84  THR E CB  1 
ATOM   7051 O  OG1 . THR G 3 84  ? 56.30930 25.85047  -51.38645 1.000 81.47592  ? 84  THR E OG1 1 
ATOM   7052 C  CG2 . THR G 3 84  ? 55.45590 25.76043  -49.11505 1.000 83.70356  ? 84  THR E CG2 1 
ATOM   7053 N  N   . ASN G 3 85  ? 56.68076 22.95094  -48.79894 1.000 111.65107 ? 85  ASN E N   1 
ATOM   7054 C  CA  . ASN G 3 85  ? 57.84206 22.30722  -48.19736 1.000 117.04988 ? 85  ASN E CA  1 
ATOM   7055 C  C   . ASN G 3 85  ? 57.53593 20.92773  -47.62996 1.000 124.30495 ? 85  ASN E C   1 
ATOM   7056 O  O   . ASN G 3 85  ? 58.46232 20.23333  -47.18968 1.000 127.36722 ? 85  ASN E O   1 
ATOM   7057 C  CB  . ASN G 3 85  ? 58.41947 23.19347  -47.08780 1.000 115.99572 ? 85  ASN E CB  1 
ATOM   7058 C  CG  . ASN G 3 85  ? 57.34602 23.75659  -46.18172 1.000 116.70317 ? 85  ASN E CG  1 
ATOM   7059 O  OD1 . ASN G 3 85  ? 56.17872 23.36237  -46.25870 1.000 116.07324 ? 85  ASN E OD1 1 
ATOM   7060 N  ND2 . ASN G 3 85  ? 57.73436 24.68284  -45.31480 1.000 117.97229 ? 85  ASN E ND2 1 
ATOM   7061 N  N   . SER G 3 86  ? 56.26720 20.52113  -47.62613 1.000 122.47698 ? 86  SER E N   1 
ATOM   7062 C  CA  . SER G 3 86  ? 55.86593 19.22392  -47.10649 1.000 120.11502 ? 86  SER E CA  1 
ATOM   7063 C  C   . SER G 3 86  ? 56.10547 18.18614  -48.19301 1.000 117.57901 ? 86  SER E C   1 
ATOM   7064 O  O   . SER G 3 86  ? 55.50954 18.25665  -49.27369 1.000 116.20493 ? 86  SER E O   1 
ATOM   7065 C  CB  . SER G 3 86  ? 54.39864 19.25745  -46.67668 1.000 120.34382 ? 86  SER E CB  1 
ATOM   7066 O  OG  . SER G 3 86  ? 53.93097 17.99918  -46.21992 1.000 123.77226 ? 86  SER E OG  1 
ATOM   7067 N  N   . SER G 3 87  ? 57.00492 17.24484  -47.91072 1.000 118.25109 ? 87  SER E N   1 
ATOM   7068 C  CA  . SER G 3 87  ? 57.33188 16.14468  -48.80249 1.000 115.71002 ? 87  SER E CA  1 
ATOM   7069 C  C   . SER G 3 87  ? 56.37971 14.97387  -48.64988 1.000 120.58266 ? 87  SER E C   1 
ATOM   7070 O  O   . SER G 3 87  ? 56.71209 13.86994  -49.08404 1.000 123.39381 ? 87  SER E O   1 
ATOM   7071 C  CB  . SER G 3 87  ? 58.76830 15.67252  -48.56071 1.000 112.60656 ? 87  SER E CB  1 
ATOM   7072 O  OG  . SER G 3 87  ? 59.71109 16.71892  -48.72625 1.000 108.35542 ? 87  SER E OG  1 
ATOM   7073 N  N   . THR G 3 88  ? 55.23551 15.17016  -47.99773 1.000 122.05469 ? 88  THR E N   1 
ATOM   7074 C  CA  . THR G 3 88  ? 54.19271 14.15573  -48.02385 1.000 128.21574 ? 88  THR E CA  1 
ATOM   7075 C  C   . THR G 3 88  ? 53.64851 14.04031  -49.44582 1.000 128.77929 ? 88  THR E C   1 
ATOM   7076 O  O   . THR G 3 88  ? 54.05904 14.76752  -50.35146 1.000 128.38618 ? 88  THR E O   1 
ATOM   7077 C  CB  . THR G 3 88  ? 53.07192 14.50338  -47.04219 1.000 129.11268 ? 88  THR E CB  1 
ATOM   7078 O  OG1 . THR G 3 88  ? 52.41923 15.70766  -47.46725 1.000 128.41578 ? 88  THR E OG1 1 
ATOM   7079 C  CG2 . THR G 3 88  ? 53.61570 14.69678  -45.61989 1.000 129.28112 ? 88  THR E CG2 1 
ATOM   7080 N  N   . GLU G 3 89  ? 52.71656 13.11367  -49.65978 1.000 134.69737 ? 89  GLU E N   1 
ATOM   7081 C  CA  . GLU G 3 89  ? 52.14876 12.95348  -50.99498 1.000 137.94021 ? 89  GLU E CA  1 
ATOM   7082 C  C   . GLU G 3 89  ? 51.32168 14.18819  -51.35036 1.000 133.82796 ? 89  GLU E C   1 
ATOM   7083 O  O   . GLU G 3 89  ? 50.36394 14.52706  -50.64559 1.000 139.54267 ? 89  GLU E O   1 
ATOM   7084 C  CB  . GLU G 3 89  ? 51.31712 11.67685  -51.09292 1.000 148.03027 ? 89  GLU E CB  1 
ATOM   7085 C  CG  . GLU G 3 89  ? 50.79364 11.42681  -52.50083 1.000 156.34390 ? 89  GLU E CG  1 
ATOM   7086 C  CD  . GLU G 3 89  ? 50.70060 9.95376   -52.85138 1.000 167.45564 ? 89  GLU E CD  1 
ATOM   7087 O  OE1 . GLU G 3 89  ? 51.30920 9.12688   -52.13858 1.000 171.92353 ? 89  GLU E OE1 1 
ATOM   7088 O  OE2 . GLU G 3 89  ? 50.02895 9.62515   -53.85183 1.000 169.29736 ? 89  GLU E OE2 1 
ATOM   7089 N  N   . ILE G 3 90  ? 51.69458 14.85584  -52.44160 1.000 119.77942 ? 90  ILE E N   1 
ATOM   7090 C  CA  . ILE G 3 90  ? 51.07802 16.11175  -52.87406 1.000 105.32211 ? 90  ILE E CA  1 
ATOM   7091 C  C   . ILE G 3 90  ? 49.80074 15.85024  -53.66410 1.000 100.36033 ? 90  ILE E C   1 
ATOM   7092 O  O   . ILE G 3 90  ? 49.84036 15.17281  -54.70240 1.000 102.49745 ? 90  ILE E O   1 
ATOM   7093 C  CB  . ILE G 3 90  ? 52.06073 16.95502  -53.70087 1.000 91.74622  ? 90  ILE E CB  1 
ATOM   7094 C  CG1 . ILE G 3 90  ? 53.34654 17.20385  -52.90735 1.000 84.33729  ? 90  ILE E CG1 1 
ATOM   7095 C  CG2 . ILE G 3 90  ? 51.41411 18.27193  -54.08257 1.000 90.21102  ? 90  ILE E CG2 1 
ATOM   7096 C  CD1 . ILE G 3 90  ? 54.39743 17.99351  -53.65382 1.000 78.07260  ? 90  ILE E CD1 1 
ATOM   7097 N  N   . PRO G 3 91  ? 48.65929 16.37881  -53.22481 1.000 95.53646  ? 91  PRO E N   1 
ATOM   7098 C  CA  . PRO G 3 91  ? 47.38547 16.02786  -53.86529 1.000 93.55719  ? 91  PRO E CA  1 
ATOM   7099 C  C   . PRO G 3 91  ? 47.23336 16.65368  -55.24709 1.000 91.25618  ? 91  PRO E C   1 
ATOM   7100 O  O   . PRO G 3 91  ? 47.69518 17.76692  -55.51258 1.000 86.97805  ? 91  PRO E O   1 
ATOM   7101 C  CB  . PRO G 3 91  ? 46.33416 16.58051  -52.89123 1.000 93.93969  ? 91  PRO E CB  1 
ATOM   7102 C  CG  . PRO G 3 91  ? 47.08256 16.85655  -51.60445 1.000 92.92836  ? 91  PRO E CG  1 
ATOM   7103 C  CD  . PRO G 3 91  ? 48.46806 17.21930  -52.03235 1.000 91.56979  ? 91  PRO E CD  1 
ATOM   7104 N  N   . GLU G 3 92  ? 46.54884 15.92208  -56.12440 1.000 93.53192  ? 92  GLU E N   1 
ATOM   7105 C  CA  . GLU G 3 92  ? 46.30735 16.39379  -57.48060 1.000 96.86412  ? 92  GLU E CA  1 
ATOM   7106 C  C   . GLU G 3 92  ? 45.47535 17.67316  -57.47191 1.000 92.57142  ? 92  GLU E C   1 
ATOM   7107 O  O   . GLU G 3 92  ? 44.55212 17.82629  -56.66782 1.000 92.35635  ? 92  GLU E O   1 
ATOM   7108 C  CB  . GLU G 3 92  ? 45.59595 15.30078  -58.28695 1.000 109.63865 ? 92  GLU E CB  1 
ATOM   7109 C  CG  . GLU G 3 92  ? 45.08197 15.75603  -59.64756 1.000 119.52811 ? 92  GLU E CG  1 
ATOM   7110 C  CD  . GLU G 3 92  ? 44.11385 14.76868  -60.28083 1.000 131.71334 ? 92  GLU E CD  1 
ATOM   7111 O  OE1 . GLU G 3 92  ? 44.56306 13.90989  -61.07111 1.000 139.68782 ? 92  GLU E OE1 1 
ATOM   7112 O  OE2 . GLU G 3 92  ? 42.90253 14.84854  -59.98353 1.000 134.28748 ? 92  GLU E OE2 1 
ATOM   7113 N  N   . PHE G 3 93  ? 45.80835 18.59822  -58.38363 1.000 87.86814  ? 93  PHE E N   1 
ATOM   7114 C  CA  . PHE G 3 93  ? 45.10222 19.86746  -58.51236 1.000 83.93110  ? 93  PHE E CA  1 
ATOM   7115 C  C   . PHE G 3 93  ? 44.10397 19.76680  -59.65274 1.000 84.77395  ? 93  PHE E C   1 
ATOM   7116 O  O   . PHE G 3 93  ? 44.51322 19.81201  -60.82504 1.000 85.33174  ? 93  PHE E O   1 
ATOM   7117 C  CB  . PHE G 3 93  ? 46.08623 21.01082  -58.76737 1.000 76.76131  ? 93  PHE E CB  1 
ATOM   7118 C  CG  . PHE G 3 93  ? 45.46854 22.39120  -58.70876 1.000 70.98395  ? 93  PHE E CG  1 
ATOM   7119 C  CD1 . PHE G 3 93  ? 45.19538 22.99279  -57.48843 1.000 68.64786  ? 93  PHE E CD1 1 
ATOM   7120 C  CD2 . PHE G 3 93  ? 45.18570 23.10194  -59.86984 1.000 64.10471  ? 93  PHE E CD2 1 
ATOM   7121 C  CE1 . PHE G 3 93  ? 44.63884 24.26167  -57.42647 1.000 62.84604  ? 93  PHE E CE1 1 
ATOM   7122 C  CE2 . PHE G 3 93  ? 44.62960 24.37234  -59.80766 1.000 58.80653  ? 93  PHE E CE2 1 
ATOM   7123 C  CZ  . PHE G 3 93  ? 44.35906 24.94713  -58.58884 1.000 59.66237  ? 93  PHE E CZ  1 
ATOM   7124 N  N   . PRO G 3 94  ? 42.80066 19.70977  -59.37177 1.000 85.28496  ? 94  PRO E N   1 
ATOM   7125 C  CA  . PRO G 3 94  ? 41.81040 19.48048  -60.43848 1.000 87.33733  ? 94  PRO E CA  1 
ATOM   7126 C  C   . PRO G 3 94  ? 41.80994 20.59745  -61.47193 1.000 88.77022  ? 94  PRO E C   1 
ATOM   7127 O  O   . PRO G 3 94  ? 41.59584 21.76607  -61.14853 1.000 98.46170  ? 94  PRO E O   1 
ATOM   7128 C  CB  . PRO G 3 94  ? 40.48220 19.43247  -59.67249 1.000 86.86522  ? 94  PRO E CB  1 
ATOM   7129 C  CG  . PRO G 3 94  ? 40.86318 19.05729  -58.26002 1.000 85.71373  ? 94  PRO E CG  1 
ATOM   7130 C  CD  . PRO G 3 94  ? 42.19448 19.69875  -58.02722 1.000 84.91065  ? 94  PRO E CD  1 
ATOM   7131 N  N   . ILE G 3 95  ? 42.04040 20.22616  -62.73199 1.000 81.14571  ? 95  ILE E N   1 
ATOM   7132 C  CA  . ILE G 3 95  ? 41.99984 21.15389  -63.86258 1.000 72.37804  ? 95  ILE E CA  1 
ATOM   7133 C  C   . ILE G 3 95  ? 41.19349 20.46738  -64.95659 1.000 75.78372  ? 95  ILE E C   1 
ATOM   7134 O  O   . ILE G 3 95  ? 41.71377 19.60311  -65.67055 1.000 77.01105  ? 95  ILE E O   1 
ATOM   7135 C  CB  . ILE G 3 95  ? 43.38971 21.54173  -64.37615 1.000 62.16207  ? 95  ILE E CB  1 
ATOM   7136 C  CG1 . ILE G 3 95  ? 44.19252 22.31921  -63.33614 1.000 53.53291  ? 95  ILE E CG1 1 
ATOM   7137 C  CG2 . ILE G 3 95  ? 43.25801 22.38983  -65.62801 1.000 61.54677  ? 95  ILE E CG2 1 
ATOM   7138 C  CD1 . ILE G 3 95  ? 45.61307 22.61487  -63.80289 1.000 46.54377  ? 95  ILE E CD1 1 
ATOM   7139 N  N   . ALA G 3 96  ? 39.92969 20.84618  -65.09689 1.000 77.97545  ? 96  ALA E N   1 
ATOM   7140 C  CA  . ALA G 3 96  ? 39.08985 20.23048  -66.11166 1.000 79.56209  ? 96  ALA E CA  1 
ATOM   7141 C  C   . ALA G 3 96  ? 39.57726 20.61212  -67.50991 1.000 81.72349  ? 96  ALA E C   1 
ATOM   7142 O  O   . ALA G 3 96  ? 40.01159 21.74800  -67.73152 1.000 76.03210  ? 96  ALA E O   1 
ATOM   7143 C  CB  . ALA G 3 96  ? 37.63453 20.65332  -65.93099 1.000 80.19604  ? 96  ALA E CB  1 
ATOM   7144 N  N   . PRO G 3 97  ? 39.48703 19.69346  -68.47653 1.000 82.31906  ? 97  PRO E N   1 
ATOM   7145 C  CA  . PRO G 3 97  ? 39.99393 19.98264  -69.83173 1.000 85.40191  ? 97  PRO E CA  1 
ATOM   7146 C  C   . PRO G 3 97  ? 39.40168 21.22906  -70.47219 1.000 88.61707  ? 97  PRO E C   1 
ATOM   7147 O  O   . PRO G 3 97  ? 40.09085 21.88990  -71.25642 1.000 88.13392  ? 97  PRO E O   1 
ATOM   7148 C  CB  . PRO G 3 97  ? 39.62630 18.70985  -70.61021 1.000 85.37644  ? 97  PRO E CB  1 
ATOM   7149 C  CG  . PRO G 3 97  ? 39.61537 17.63660  -69.56320 1.000 83.43611  ? 97  PRO E CG  1 
ATOM   7150 C  CD  . PRO G 3 97  ? 39.08539 18.28256  -68.31934 1.000 83.42644  ? 97  PRO E CD  1 
ATOM   7151 N  N   . GLU G 3 98  ? 38.14490 21.56828  -70.17815 1.000 95.20398  ? 98  GLU E N   1 
ATOM   7152 C  CA  . GLU G 3 98  ? 37.54735 22.77289  -70.75052 1.000 99.27895  ? 98  GLU E CA  1 
ATOM   7153 C  C   . GLU G 3 98  ? 38.29225 24.02550  -70.29547 1.000 96.43241  ? 98  GLU E C   1 
ATOM   7154 O  O   . GLU G 3 98  ? 38.51216 24.95396  -71.08473 1.000 94.74508  ? 98  GLU E O   1 
ATOM   7155 C  CB  . GLU G 3 98  ? 36.07489 22.86401  -70.34745 1.000 105.93326 ? 98  GLU E CB  1 
ATOM   7156 C  CG  . GLU G 3 98  ? 35.25372 21.58719  -70.55887 1.000 115.18791 ? 98  GLU E CG  1 
ATOM   7157 C  CD  . GLU G 3 98  ? 35.31881 20.60618  -69.38286 1.000 122.93556 ? 98  GLU E CD  1 
ATOM   7158 O  OE1 . GLU G 3 98  ? 36.42332 20.33969  -68.85874 1.000 127.40550 ? 98  GLU E OE1 1 
ATOM   7159 O  OE2 . GLU G 3 98  ? 34.24806 20.11048  -68.97130 1.000 125.41857 ? 98  GLU E OE2 1 
ATOM   7160 N  N   . ILE G 3 99  ? 38.69601 24.05928  -69.01889 1.000 91.07852  ? 99  ILE E N   1 
ATOM   7161 C  CA  . ILE G 3 99  ? 39.43157 25.18656  -68.43984 1.000 82.67704  ? 99  ILE E CA  1 
ATOM   7162 C  C   . ILE G 3 99  ? 40.91359 25.16036  -68.78242 1.000 78.44291  ? 99  ILE E C   1 
ATOM   7163 O  O   . ILE G 3 99  ? 41.58340 26.19531  -68.66525 1.000 78.85330  ? 99  ILE E O   1 
ATOM   7164 C  CB  . ILE G 3 99  ? 39.18986 25.19831  -66.91092 1.000 78.21296  ? 99  ILE E CB  1 
ATOM   7165 C  CG1 . ILE G 3 99  ? 37.70591 25.42328  -66.58613 1.000 80.33980  ? 99  ILE E CG1 1 
ATOM   7166 C  CG2 . ILE G 3 99  ? 39.99604 26.25868  -66.20008 1.000 74.84466  ? 99  ILE E CG2 1 
ATOM   7167 C  CD1 . ILE G 3 99  ? 36.85714 24.17659  -66.46192 1.000 82.70955  ? 99  ILE E CD1 1 
ATOM   7168 N  N   . ALA G 3 100 ? 41.41780 24.03056  -69.28765 1.000 75.12211  ? 100 ALA E N   1 
ATOM   7169 C  CA  . ALA G 3 100 ? 42.85562 23.78077  -69.36098 1.000 72.07188  ? 100 ALA E CA  1 
ATOM   7170 C  C   . ALA G 3 100 ? 43.60568 24.88365  -70.10014 1.000 71.09869  ? 100 ALA E C   1 
ATOM   7171 O  O   . ALA G 3 100 ? 44.59743 25.41494  -69.59172 1.000 71.50273  ? 100 ALA E O   1 
ATOM   7172 C  CB  . ALA G 3 100 ? 43.11446 22.42583  -70.01790 1.000 72.88892  ? 100 ALA E CB  1 
ATOM   7173 N  N   . LEU G 3 101 ? 43.18629 25.20634  -71.32638 1.000 72.44313  ? 101 LEU E N   1 
ATOM   7174 C  CA  . LEU G 3 101 ? 43.92458 26.20761  -72.09111 1.000 73.66003  ? 101 LEU E CA  1 
ATOM   7175 C  C   . LEU G 3 101 ? 43.77585 27.59240  -71.47167 1.000 76.66613  ? 101 LEU E C   1 
ATOM   7176 O  O   . LEU G 3 101 ? 44.77266 28.29427  -71.26539 1.000 77.57631  ? 101 LEU E O   1 
ATOM   7177 C  CB  . LEU G 3 101 ? 43.46753 26.22026  -73.54593 1.000 75.71048  ? 101 LEU E CB  1 
ATOM   7178 C  CG  . LEU G 3 101 ? 44.33269 27.03225  -74.51518 1.000 77.15446  ? 101 LEU E CG  1 
ATOM   7179 C  CD1 . LEU G 3 101 ? 45.75084 26.47342  -74.53688 1.000 75.84475  ? 101 LEU E CD1 1 
ATOM   7180 C  CD2 . LEU G 3 101 ? 43.74465 27.03674  -75.91374 1.000 78.89455  ? 101 LEU E CD2 1 
ATOM   7181 N  N   . GLU G 3 102 ? 42.54054 27.99640  -71.14090 1.000 77.46475  ? 102 GLU E N   1 
ATOM   7182 C  CA  . GLU G 3 102 ? 42.33111 29.33390  -70.58447 1.000 76.83211  ? 102 GLU E CA  1 
ATOM   7183 C  C   . GLU G 3 102 ? 43.13339 29.52206  -69.31016 1.000 72.59696  ? 102 GLU E C   1 
ATOM   7184 O  O   . GLU G 3 102 ? 43.61716 30.62393  -69.02507 1.000 74.63305  ? 102 GLU E O   1 
ATOM   7185 C  CB  . GLU G 3 102 ? 40.85210 29.58503  -70.28705 1.000 81.74687  ? 102 GLU E CB  1 
ATOM   7186 C  CG  . GLU G 3 102 ? 39.90537 29.25537  -71.40275 1.000 92.83903  ? 102 GLU E CG  1 
ATOM   7187 C  CD  . GLU G 3 102 ? 38.47971 29.64446  -71.07628 1.000 102.09179 ? 102 GLU E CD  1 
ATOM   7188 O  OE1 . GLU G 3 102 ? 38.28688 30.54433  -70.23056 1.000 102.87426 ? 102 GLU E OE1 1 
ATOM   7189 O  OE2 . GLU G 3 102 ? 37.55252 29.04639  -71.66532 1.000 109.92561 ? 102 GLU E OE2 1 
ATOM   7190 N  N   . LEU G 3 103 ? 43.27843 28.45574  -68.52540 1.000 68.58825  ? 103 LEU E N   1 
ATOM   7191 C  CA  . LEU G 3 103 ? 44.00133 28.57228  -67.27101 1.000 65.11871  ? 103 LEU E CA  1 
ATOM   7192 C  C   . LEU G 3 103 ? 45.49139 28.79397  -67.50397 1.000 65.17895  ? 103 LEU E C   1 
ATOM   7193 O  O   . LEU G 3 103 ? 46.13872 29.48658  -66.70974 1.000 64.62987  ? 103 LEU E O   1 
ATOM   7194 C  CB  . LEU G 3 103 ? 43.74826 27.32869  -66.42190 1.000 63.20389  ? 103 LEU E CB  1 
ATOM   7195 C  CG  . LEU G 3 103 ? 44.41292 27.28239  -65.04805 1.000 61.95104  ? 103 LEU E CG  1 
ATOM   7196 C  CD1 . LEU G 3 103 ? 43.95748 28.44089  -64.15208 1.000 59.46470  ? 103 LEU E CD1 1 
ATOM   7197 C  CD2 . LEU G 3 103 ? 44.11916 25.93480  -64.41408 1.000 61.21515  ? 103 LEU E CD2 1 
ATOM   7198 N  N   . LEU G 3 104 ? 46.04660 28.22437  -68.58522 1.000 66.88595  ? 104 LEU E N   1 
ATOM   7199 C  CA  . LEU G 3 104 ? 47.45454 28.43910  -68.93284 1.000 66.08532  ? 104 LEU E CA  1 
ATOM   7200 C  C   . LEU G 3 104 ? 47.71646 29.87556  -69.37064 1.000 68.85881  ? 104 LEU E C   1 
ATOM   7201 O  O   . LEU G 3 104 ? 48.81586 30.40184  -69.16214 1.000 73.22541  ? 104 LEU E O   1 
ATOM   7202 C  CB  . LEU G 3 104 ? 47.88418 27.47104  -70.03860 1.000 65.02252  ? 104 LEU E CB  1 
ATOM   7203 C  CG  . LEU G 3 104 ? 49.34792 27.53082  -70.48644 1.000 59.83925  ? 104 LEU E CG  1 
ATOM   7204 C  CD1 . LEU G 3 104 ? 50.27096 27.30087  -69.29238 1.000 55.05609  ? 104 LEU E CD1 1 
ATOM   7205 C  CD2 . LEU G 3 104 ? 49.62742 26.51265  -71.59081 1.000 58.61277  ? 104 LEU E CD2 1 
ATOM   7206 N  N   . MET G 3 105 ? 46.73962 30.50198  -70.02406 1.000 64.86384  ? 105 MET E N   1 
ATOM   7207 C  CA  . MET G 3 105 ? 46.87509 31.90441  -70.39196 1.000 58.46376  ? 105 MET E CA  1 
ATOM   7208 C  C   . MET G 3 105 ? 46.95610 32.77239  -69.15085 1.000 55.54675  ? 105 MET E C   1 
ATOM   7209 O  O   . MET G 3 105 ? 47.84657 33.62226  -69.02657 1.000 56.98790  ? 105 MET E O   1 
ATOM   7210 C  CB  . MET G 3 105 ? 45.70280 32.31007  -71.26766 1.000 56.37561  ? 105 MET E CB  1 
ATOM   7211 C  CG  . MET G 3 105 ? 45.78006 31.72291  -72.64452 1.000 60.06945  ? 105 MET E CG  1 
ATOM   7212 S  SD  . MET G 3 105 ? 44.16264 31.80230  -73.38633 1.000 63.87259  ? 105 MET E SD  1 
ATOM   7213 C  CE  . MET G 3 105 ? 44.37540 30.72433  -74.80379 1.000 63.22729  ? 105 MET E CE  1 
ATOM   7214 N  N   . ALA G 3 106 ? 46.04958 32.55296  -68.20015 1.000 52.98581  ? 106 ALA E N   1 
ATOM   7215 C  CA  . ALA G 3 106 ? 46.12893 33.30803  -66.96071 1.000 51.56174  ? 106 ALA E CA  1 
ATOM   7216 C  C   . ALA G 3 106 ? 47.43119 33.01899  -66.23611 1.000 54.20959  ? 106 ALA E C   1 
ATOM   7217 O  O   . ALA G 3 106 ? 48.05924 33.93223  -65.69299 1.000 57.96103  ? 106 ALA E O   1 
ATOM   7218 C  CB  . ALA G 3 106 ? 44.94042 32.98409  -66.05548 1.000 50.57930  ? 106 ALA E CB  1 
ATOM   7219 N  N   . ALA G 3 107 ? 47.85892 31.75580  -66.21436 1.000 55.15525  ? 107 ALA E N   1 
ATOM   7220 C  CA  . ALA G 3 107 ? 49.04640 31.41943  -65.43519 1.000 56.37810  ? 107 ALA E CA  1 
ATOM   7221 C  C   . ALA G 3 107 ? 50.29635 32.07054  -66.02426 1.000 58.36498  ? 107 ALA E C   1 
ATOM   7222 O  O   . ALA G 3 107 ? 51.13816 32.60866  -65.28984 1.000 57.05812  ? 107 ALA E O   1 
ATOM   7223 C  CB  . ALA G 3 107 ? 49.19456 29.89967  -65.33256 1.000 55.77676  ? 107 ALA E CB  1 
ATOM   7224 N  N   . ASN G 3 108 ? 50.41484 32.05962  -67.34844 1.000 59.66852  ? 108 ASN E N   1 
ATOM   7225 C  CA  . ASN G 3 108 ? 51.52584 32.73436  -68.00516 1.000 62.01940  ? 108 ASN E CA  1 
ATOM   7226 C  C   . ASN G 3 108 ? 51.42888 34.25496  -67.84500 1.000 64.74431  ? 108 ASN E C   1 
ATOM   7227 O  O   . ASN G 3 108 ? 52.44229 34.93487  -67.63413 1.000 67.37301  ? 108 ASN E O   1 
ATOM   7228 C  CB  . ASN G 3 108 ? 51.53435 32.34054  -69.47369 1.000 63.53654  ? 108 ASN E CB  1 
ATOM   7229 C  CG  . ASN G 3 108 ? 52.74651 32.80633  -70.17104 1.000 69.21527  ? 108 ASN E CG  1 
ATOM   7230 O  OD1 . ASN G 3 108 ? 53.83666 32.79305  -69.60398 1.000 73.63761  ? 108 ASN E OD1 1 
ATOM   7231 N  ND2 . ASN G 3 108 ? 52.57772 33.27561  -71.39520 1.000 71.27220  ? 108 ASN E ND2 1 
ATOM   7232 N  N   . PHE G 3 109 ? 50.21779 34.80858  -67.94573 1.000 62.88853  ? 109 PHE E N   1 
ATOM   7233 C  CA  . PHE G 3 109 ? 50.03451 36.23830  -67.74771 1.000 60.97719  ? 109 PHE E CA  1 
ATOM   7234 C  C   . PHE G 3 109 ? 50.33711 36.66486  -66.31558 1.000 67.65842  ? 109 PHE E C   1 
ATOM   7235 O  O   . PHE G 3 109 ? 50.58482 37.84973  -66.06880 1.000 71.96966  ? 109 PHE E O   1 
ATOM   7236 C  CB  . PHE G 3 109 ? 48.60911 36.62427  -68.13757 1.000 55.86476  ? 109 PHE E CB  1 
ATOM   7237 C  CG  . PHE G 3 109 ? 48.21346 37.99820  -67.71304 1.000 52.14864  ? 109 PHE E CG  1 
ATOM   7238 C  CD1 . PHE G 3 109 ? 48.61303 39.10605  -68.43764 1.000 50.63620  ? 109 PHE E CD1 1 
ATOM   7239 C  CD2 . PHE G 3 109 ? 47.42794 38.18184  -66.58733 1.000 51.07917  ? 109 PHE E CD2 1 
ATOM   7240 C  CE1 . PHE G 3 109 ? 48.24103 40.37020  -68.04038 1.000 49.42647  ? 109 PHE E CE1 1 
ATOM   7241 C  CE2 . PHE G 3 109 ? 47.05504 39.44264  -66.19092 1.000 50.19224  ? 109 PHE E CE2 1 
ATOM   7242 C  CZ  . PHE G 3 109 ? 47.46311 40.53898  -66.92350 1.000 49.33930  ? 109 PHE E CZ  1 
ATOM   7243 N  N   . LEU G 3 110 ? 50.30774 35.74109  -65.36161 1.000 68.17692  ? 110 LEU E N   1 
ATOM   7244 C  CA  . LEU G 3 110 ? 50.51479 36.07645  -63.96157 1.000 66.10670  ? 110 LEU E CA  1 
ATOM   7245 C  C   . LEU G 3 110 ? 51.87803 35.64062  -63.44345 1.000 70.50073  ? 110 LEU E C   1 
ATOM   7246 O  O   . LEU G 3 110 ? 52.16760 35.85603  -62.26389 1.000 69.90212  ? 110 LEU E O   1 
ATOM   7247 C  CB  . LEU G 3 110 ? 49.40927 35.44968  -63.10362 1.000 60.91125  ? 110 LEU E CB  1 
ATOM   7248 C  CG  . LEU G 3 110 ? 47.97886 35.97904  -63.25086 1.000 57.11856  ? 110 LEU E CG  1 
ATOM   7249 C  CD1 . LEU G 3 110 ? 46.96927 35.14847  -62.45761 1.000 54.11616  ? 110 LEU E CD1 1 
ATOM   7250 C  CD2 . LEU G 3 110 ? 47.94365 37.41621  -62.78114 1.000 56.96924  ? 110 LEU E CD2 1 
ATOM   7251 N  N   . ASP G 3 111 ? 52.71691 35.04690  -64.29559 1.000 79.56940  ? 111 ASP E N   1 
ATOM   7252 C  CA  . ASP G 3 111 ? 54.02040 34.48310  -63.92806 1.000 89.27166  ? 111 ASP E CA  1 
ATOM   7253 C  C   . ASP G 3 111 ? 53.91255 33.54519  -62.72067 1.000 89.96402  ? 111 ASP E C   1 
ATOM   7254 O  O   . ASP G 3 111 ? 54.57922 33.71928  -61.69811 1.000 94.48615  ? 111 ASP E O   1 
ATOM   7255 C  CB  . ASP G 3 111 ? 55.04408 35.59461  -63.67308 1.000 94.05069  ? 111 ASP E CB  1 
ATOM   7256 C  CG  . ASP G 3 111 ? 56.49351 35.09496  -63.72574 1.000 98.70243  ? 111 ASP E CG  1 
ATOM   7257 O  OD1 . ASP G 3 111 ? 56.72429 33.86330  -63.68067 1.000 99.68949  ? 111 ASP E OD1 1 
ATOM   7258 O  OD2 . ASP G 3 111 ? 57.41054 35.94655  -63.80385 1.000 99.94334  ? 111 ASP E OD2 1 
ATOM   7259 N  N   . CYS G 3 112 ? 53.07315 32.52200  -62.85407 1.000 85.93502  ? 112 CYS E N   1 
ATOM   7260 C  CA  . CYS G 3 112 ? 52.96406 31.55943  -61.76389 1.000 85.22243  ? 112 CYS E CA  1 
ATOM   7261 C  C   . CYS G 3 112 ? 52.58686 30.14786  -62.21705 1.000 84.51204  ? 112 CYS E C   1 
ATOM   7262 O  O   . CYS G 3 112 ? 52.65986 29.19443  -61.42632 1.000 83.03131  ? 112 CYS E O   1 
ATOM   7263 C  CB  . CYS G 3 112 ? 51.95586 32.05870  -60.72309 1.000 82.21528  ? 112 CYS E CB  1 
ATOM   7264 S  SG  . CYS G 3 112 ? 50.22897 32.04805  -61.25482 1.000 80.10438  ? 112 CYS E SG  1 
ATOM   7265 N  N   . GLU H 4 3   ? 83.95535 -7.50810  -31.18248 1.000 132.91696 ? 3   GLU B N   1 
ATOM   7266 C  CA  . GLU H 4 3   ? 82.50517 -7.38038  -31.16348 1.000 131.64412 ? 3   GLU B CA  1 
ATOM   7267 C  C   . GLU H 4 3   ? 81.97378 -7.58854  -32.57072 1.000 124.02373 ? 3   GLU B C   1 
ATOM   7268 O  O   . GLU H 4 3   ? 82.73144 -7.92821  -33.48058 1.000 124.91072 ? 3   GLU B O   1 
ATOM   7269 C  CB  . GLU H 4 3   ? 82.07817 -6.00323  -30.63899 1.000 137.91467 ? 3   GLU B CB  1 
ATOM   7270 C  CG  . GLU H 4 3   ? 82.63358 -5.62580  -29.26571 1.000 148.33746 ? 3   GLU B CG  1 
ATOM   7271 C  CD  . GLU H 4 3   ? 84.04621 -5.05302  -29.34124 1.000 155.76238 ? 3   GLU B CD  1 
ATOM   7272 O  OE1 . GLU H 4 3   ? 84.55369 -4.55486  -28.31209 1.000 158.21370 ? 3   GLU B OE1 1 
ATOM   7273 O  OE2 . GLU H 4 3   ? 84.65006 -5.09536  -30.43558 1.000 157.80540 ? 3   GLU B OE2 1 
ATOM   7274 N  N   . LYS H 4 4   ? 80.66327 -7.41741  -32.73705 1.000 117.09277 ? 4   LYS B N   1 
ATOM   7275 C  CA  . LYS H 4 4   ? 80.03539 -7.37172  -34.05157 1.000 106.59355 ? 4   LYS B CA  1 
ATOM   7276 C  C   . LYS H 4 4   ? 79.69016 -5.92055  -34.35774 1.000 100.12999 ? 4   LYS B C   1 
ATOM   7277 O  O   . LYS H 4 4   ? 78.98492 -5.26732  -33.57907 1.000 97.68534  ? 4   LYS B O   1 
ATOM   7278 C  CB  . LYS H 4 4   ? 78.78318 -8.24297  -34.11778 1.000 101.47207 ? 4   LYS B CB  1 
ATOM   7279 C  CG  . LYS H 4 4   ? 78.12607 -8.26754  -35.49547 1.000 95.27736  ? 4   LYS B CG  1 
ATOM   7280 C  CD  . LYS H 4 4   ? 76.78645 -8.98585  -35.45305 1.000 92.27871  ? 4   LYS B CD  1 
ATOM   7281 C  CE  . LYS H 4 4   ? 76.14877 -9.09072  -36.82909 1.000 88.71890  ? 4   LYS B CE  1 
ATOM   7282 N  NZ  . LYS H 4 4   ? 76.79605 -10.11002 -37.68646 1.000 88.76418  ? 4   LYS B NZ  1 
ATOM   7283 N  N   . MET H 4 5   ? 80.19765 -5.42003  -35.47851 1.000 97.97494  ? 5   MET B N   1 
ATOM   7284 C  CA  . MET H 4 5   ? 79.96885 -4.05279  -35.91428 1.000 95.97064  ? 5   MET B CA  1 
ATOM   7285 C  C   . MET H 4 5   ? 78.98339 -4.03107  -37.07445 1.000 88.05593  ? 5   MET B C   1 
ATOM   7286 O  O   . MET H 4 5   ? 78.97414 -4.92544  -37.92477 1.000 86.53128  ? 5   MET B O   1 
ATOM   7287 C  CB  . MET H 4 5   ? 81.28363 -3.37229  -36.30202 1.000 102.20766 ? 5   MET B CB  1 
ATOM   7288 C  CG  . MET H 4 5   ? 82.24761 -3.25036  -35.13614 1.000 112.24609 ? 5   MET B CG  1 
ATOM   7289 S  SD  . MET H 4 5   ? 83.47483 -1.94411  -35.33233 1.000 123.55884 ? 5   MET B SD  1 
ATOM   7290 C  CE  . MET H 4 5   ? 84.38449 -2.12349  -33.79734 1.000 127.32994 ? 5   MET B CE  1 
ATOM   7291 N  N   . TRP H 4 6   ? 78.15181 -2.99538  -37.09217 1.000 84.23521  ? 6   TRP B N   1 
ATOM   7292 C  CA  . TRP H 4 6   ? 77.03874 -2.89565  -38.01547 1.000 80.37195  ? 6   TRP B CA  1 
ATOM   7293 C  C   . TRP H 4 6   ? 77.15905 -1.65545  -38.88837 1.000 76.32891  ? 6   TRP B C   1 
ATOM   7294 O  O   . TRP H 4 6   ? 77.92167 -0.72628  -38.60517 1.000 73.40943  ? 6   TRP B O   1 
ATOM   7295 C  CB  . TRP H 4 6   ? 75.69887 -2.83208  -37.27638 1.000 78.90417  ? 6   TRP B CB  1 
ATOM   7296 C  CG  . TRP H 4 6   ? 75.39688 -3.98710  -36.40010 1.000 77.01647  ? 6   TRP B CG  1 
ATOM   7297 C  CD1 . TRP H 4 6   ? 75.79457 -4.16251  -35.10910 1.000 76.09613  ? 6   TRP B CD1 1 
ATOM   7298 C  CD2 . TRP H 4 6   ? 74.58271 -5.11754  -36.72697 1.000 76.40040  ? 6   TRP B CD2 1 
ATOM   7299 N  NE1 . TRP H 4 6   ? 75.29314 -5.33673  -34.61553 1.000 77.03296  ? 6   TRP B NE1 1 
ATOM   7300 C  CE2 . TRP H 4 6   ? 74.54380 -5.94459  -35.58925 1.000 77.24642  ? 6   TRP B CE2 1 
ATOM   7301 C  CE3 . TRP H 4 6   ? 73.88994 -5.51569  -37.87514 1.000 73.87995  ? 6   TRP B CE3 1 
ATOM   7302 C  CZ2 . TRP H 4 6   ? 73.83391 -7.14082  -35.56264 1.000 77.07826  ? 6   TRP B CZ2 1 
ATOM   7303 C  CZ3 . TRP H 4 6   ? 73.19167 -6.70676  -37.84771 1.000 74.13173  ? 6   TRP B CZ3 1 
ATOM   7304 C  CH2 . TRP H 4 6   ? 73.16901 -7.50645  -36.70077 1.000 75.73879  ? 6   TRP B CH2 1 
ATOM   7305 N  N   . ILE H 4 7   ? 76.36861 -1.66835  -39.95687 1.000 74.09809  ? 7   ILE B N   1 
ATOM   7306 C  CA  . ILE H 4 7   ? 76.10611 -0.51476  -40.80215 1.000 71.93286  ? 7   ILE B CA  1 
ATOM   7307 C  C   . ILE H 4 7   ? 74.61025 -0.51913  -41.07084 1.000 74.34475  ? 7   ILE B C   1 
ATOM   7308 O  O   . ILE H 4 7   ? 74.00517 -1.58917  -41.19759 1.000 78.50623  ? 7   ILE B O   1 
ATOM   7309 C  CB  . ILE H 4 7   ? 76.91080 -0.57260  -42.11521 1.000 70.42882  ? 7   ILE B CB  1 
ATOM   7310 C  CG1 . ILE H 4 7   ? 78.37441 -0.23318  -41.85688 1.000 72.75879  ? 7   ILE B CG1 1 
ATOM   7311 C  CG2 . ILE H 4 7   ? 76.36896 0.38858   -43.12526 1.000 70.87899  ? 7   ILE B CG2 1 
ATOM   7312 C  CD1 . ILE H 4 7   ? 79.22672 -0.20777  -43.11614 1.000 74.98803  ? 7   ILE B CD1 1 
ATOM   7313 N  N   . VAL H 4 8   ? 73.99806 0.65943   -41.11822 1.000 71.52787  ? 8   VAL B N   1 
ATOM   7314 C  CA  . VAL H 4 8   ? 72.56109 0.76420   -41.33549 1.000 69.61816  ? 8   VAL B CA  1 
ATOM   7315 C  C   . VAL H 4 8   ? 72.32504 1.68845   -42.52956 1.000 70.52001  ? 8   VAL B C   1 
ATOM   7316 O  O   . VAL H 4 8   ? 73.02657 2.69435   -42.69672 1.000 73.12796  ? 8   VAL B O   1 
ATOM   7317 C  CB  . VAL H 4 8   ? 71.83196 1.25034   -40.06871 1.000 68.75654  ? 8   VAL B CB  1 
ATOM   7318 C  CG1 . VAL H 4 8   ? 72.37673 2.59226   -39.62211 1.000 70.06923  ? 8   VAL B CG1 1 
ATOM   7319 C  CG2 . VAL H 4 8   ? 70.34241 1.30461   -40.30050 1.000 68.68050  ? 8   VAL B CG2 1 
ATOM   7320 N  N   . ARG H 4 9   ? 71.38089 1.31250   -43.40289 1.000 68.01100  ? 9   ARG B N   1 
ATOM   7321 C  CA  . ARG H 4 9   ? 71.07892 2.10936   -44.59135 1.000 66.74724  ? 9   ARG B CA  1 
ATOM   7322 C  C   . ARG H 4 9   ? 69.58636 1.96795   -44.89134 1.000 63.75982  ? 9   ARG B C   1 
ATOM   7323 O  O   . ARG H 4 9   ? 69.03503 0.87895   -44.67213 1.000 63.97484  ? 9   ARG B O   1 
ATOM   7324 C  CB  . ARG H 4 9   ? 71.93949 1.64383   -45.78646 1.000 68.42867  ? 9   ARG B CB  1 
ATOM   7325 C  CG  . ARG H 4 9   ? 71.94457 2.65517   -46.91882 1.000 74.41685  ? 9   ARG B CG  1 
ATOM   7326 C  CD  . ARG H 4 9   ? 72.68677 2.26094   -48.18307 1.000 78.01731  ? 9   ARG B CD  1 
ATOM   7327 N  NE  . ARG H 4 9   ? 72.50025 3.29332   -49.20987 1.000 80.17010  ? 9   ARG B NE  1 
ATOM   7328 C  CZ  . ARG H 4 9   ? 72.93733 3.16712   -50.45391 1.000 82.55631  ? 9   ARG B CZ  1 
ATOM   7329 N  NH1 . ARG H 4 9   ? 72.74037 4.12648   -51.35776 1.000 83.55132  ? 9   ARG B NH1 1 
ATOM   7330 N  NH2 . ARG H 4 9   ? 73.57434 2.06251   -50.79691 1.000 82.92266  ? 9   ARG B NH2 1 
ATOM   7331 N  N   . PRO H 4 10  ? 68.88263 3.02206   -45.33125 1.000 58.09077  ? 10  PRO B N   1 
ATOM   7332 C  CA  . PRO H 4 10  ? 67.46169 2.83485   -45.66281 1.000 56.05876  ? 10  PRO B CA  1 
ATOM   7333 C  C   . PRO H 4 10  ? 67.34118 2.02763   -46.94420 1.000 56.52065  ? 10  PRO B C   1 
ATOM   7334 O  O   . PRO H 4 10  ? 67.99864 2.32334   -47.94585 1.000 58.91967  ? 10  PRO B O   1 
ATOM   7335 C  CB  . PRO H 4 10  ? 66.92607 4.26171   -45.83882 1.000 51.74999  ? 10  PRO B CB  1 
ATOM   7336 C  CG  . PRO H 4 10  ? 67.94795 5.14723   -45.26548 1.000 51.88298  ? 10  PRO B CG  1 
ATOM   7337 C  CD  . PRO H 4 10  ? 69.26566 4.43567   -45.45035 1.000 53.23622  ? 10  PRO B CD  1 
ATOM   7338 N  N   . VAL H 4 11  ? 66.52688 0.98129   -46.89615 1.000 52.65888  ? 11  VAL B N   1 
ATOM   7339 C  CA  . VAL H 4 11  ? 66.39495 0.05008   -48.00504 1.000 47.43154  ? 11  VAL B CA  1 
ATOM   7340 C  C   . VAL H 4 11  ? 64.92175 -0.23019  -48.23993 1.000 49.80703  ? 11  VAL B C   1 
ATOM   7341 O  O   . VAL H 4 11  ? 64.19597 -0.59983  -47.30993 1.000 53.35403  ? 11  VAL B O   1 
ATOM   7342 C  CB  . VAL H 4 11  ? 67.16588 -1.25558  -47.74622 1.000 43.58188  ? 11  VAL B CB  1 
ATOM   7343 C  CG1 . VAL H 4 11  ? 66.71737 -2.34296  -48.71179 1.000 44.59786  ? 11  VAL B CG1 1 
ATOM   7344 C  CG2 . VAL H 4 11  ? 68.65437 -1.00758  -47.91937 1.000 40.12164  ? 11  VAL B CG2 1 
ATOM   7345 N  N   . TRP H 4 12  ? 64.48751 -0.06642  -49.48470 1.000 48.74509  ? 12  TRP B N   1 
ATOM   7346 C  CA  . TRP H 4 12  ? 63.15414 -0.46077  -49.91455 1.000 47.58526  ? 12  TRP B CA  1 
ATOM   7347 C  C   . TRP H 4 12  ? 63.16234 -1.93623  -50.27504 1.000 52.49380  ? 12  TRP B C   1 
ATOM   7348 O  O   . TRP H 4 12  ? 64.12738 -2.42875  -50.85823 1.000 56.78986  ? 12  TRP B O   1 
ATOM   7349 C  CB  . TRP H 4 12  ? 62.72131 0.37185   -51.10984 1.000 44.17298  ? 12  TRP B CB  1 
ATOM   7350 C  CG  . TRP H 4 12  ? 62.84385 1.83820   -50.85755 1.000 44.46720  ? 12  TRP B CG  1 
ATOM   7351 C  CD1 . TRP H 4 12  ? 63.93460 2.61829   -51.08029 1.000 42.65392  ? 12  TRP B CD1 1 
ATOM   7352 C  CD2 . TRP H 4 12  ? 61.81956 2.70554   -50.35808 1.000 44.58514  ? 12  TRP B CD2 1 
ATOM   7353 N  NE1 . TRP H 4 12  ? 63.65980 3.91784   -50.73023 1.000 41.49043  ? 12  TRP B NE1 1 
ATOM   7354 C  CE2 . TRP H 4 12  ? 62.36751 3.99576   -50.28488 1.000 41.64369  ? 12  TRP B CE2 1 
ATOM   7355 C  CE3 . TRP H 4 12  ? 60.49357 2.50915   -49.95646 1.000 47.27472  ? 12  TRP B CE3 1 
ATOM   7356 C  CZ2 . TRP H 4 12  ? 61.64140 5.08729   -49.82809 1.000 45.78692  ? 12  TRP B CZ2 1 
ATOM   7357 C  CZ3 . TRP H 4 12  ? 59.77163 3.59010   -49.50548 1.000 49.64071  ? 12  TRP B CZ3 1 
ATOM   7358 C  CH2 . TRP H 4 12  ? 60.34614 4.86660   -49.44558 1.000 50.28863  ? 12  TRP B CH2 1 
ATOM   7359 N  N   . ARG H 4 13  ? 62.11616 -2.65317  -49.87634 1.000 52.10761  ? 13  ARG B N   1 
ATOM   7360 C  CA  . ARG H 4 13  ? 61.97651 -4.07163  -50.18715 1.000 53.79928  ? 13  ARG B CA  1 
ATOM   7361 C  C   . ARG H 4 13  ? 61.09948 -4.22097  -51.42638 1.000 52.74727  ? 13  ARG B C   1 
ATOM   7362 O  O   . ARG H 4 13  ? 59.92595 -3.84027  -51.40584 1.000 54.61123  ? 13  ARG B O   1 
ATOM   7363 C  CB  . ARG H 4 13  ? 61.37427 -4.82782  -49.00441 1.000 61.13272  ? 13  ARG B CB  1 
ATOM   7364 C  CG  . ARG H 4 13  ? 62.23972 -4.83633  -47.75137 1.000 64.43086  ? 13  ARG B CG  1 
ATOM   7365 C  CD  . ARG H 4 13  ? 61.63267 -5.68555  -46.63072 1.000 67.94918  ? 13  ARG B CD  1 
ATOM   7366 N  NE  . ARG H 4 13  ? 62.07589 -7.07434  -46.67194 1.000 72.33424  ? 13  ARG B NE  1 
ATOM   7367 C  CZ  . ARG H 4 13  ? 63.33554 -7.45092  -46.46162 1.000 76.92055  ? 13  ARG B CZ  1 
ATOM   7368 N  NH1 . ARG H 4 13  ? 64.27675 -6.54174  -46.20978 1.000 74.94466  ? 13  ARG B NH1 1 
ATOM   7369 N  NH2 . ARG H 4 13  ? 63.66523 -8.73522  -46.51072 1.000 82.49278  ? 13  ARG B NH2 1 
ATOM   7370 N  N   . VAL H 4 14  ? 61.66306 -4.75537  -52.50694 1.000 55.01211  ? 14  VAL B N   1 
ATOM   7371 C  CA  . VAL H 4 14  ? 60.98510 -4.75773  -53.79627 1.000 58.91047  ? 14  VAL B CA  1 
ATOM   7372 C  C   . VAL H 4 14  ? 60.92517 -6.16930  -54.36544 1.000 64.05930  ? 14  VAL B C   1 
ATOM   7373 O  O   . VAL H 4 14  ? 61.83142 -6.98523  -54.16513 1.000 62.10973  ? 14  VAL B O   1 
ATOM   7374 C  CB  . VAL H 4 14  ? 61.68795 -3.79531  -54.77358 1.000 57.90327  ? 14  VAL B CB  1 
ATOM   7375 C  CG1 . VAL H 4 14  ? 61.88041 -2.44146  -54.10246 1.000 57.35611  ? 14  VAL B CG1 1 
ATOM   7376 C  CG2 . VAL H 4 14  ? 63.02931 -4.34723  -55.21844 1.000 55.50983  ? 14  VAL B CG2 1 
ATOM   7377 N  N   . ASP H 4 15  ? 59.83652 -6.45369  -55.08043 1.000 73.57816  ? 15  ASP B N   1 
ATOM   7378 C  CA  . ASP H 4 15  ? 59.70418 -7.72933  -55.76985 1.000 85.15864  ? 15  ASP B CA  1 
ATOM   7379 C  C   . ASP H 4 15  ? 60.79157 -7.82387  -56.83282 1.000 78.44313  ? 15  ASP B C   1 
ATOM   7380 O  O   . ASP H 4 15  ? 61.16527 -6.81920  -57.44189 1.000 77.45518  ? 15  ASP B O   1 
ATOM   7381 C  CB  . ASP H 4 15  ? 58.30441 -7.84408  -56.39072 1.000 103.11782 ? 15  ASP B CB  1 
ATOM   7382 C  CG  . ASP H 4 15  ? 57.92449 -9.27826  -56.74611 1.000 115.95856 ? 15  ASP B CG  1 
ATOM   7383 O  OD1 . ASP H 4 15  ? 58.83146 -10.11839 -56.93186 1.000 121.53707 ? 15  ASP B OD1 1 
ATOM   7384 O  OD2 . ASP H 4 15  ? 56.70754 -9.56204  -56.84479 1.000 117.92480 ? 15  ASP B OD2 1 
ATOM   7385 N  N   . ARG H 4 16  ? 61.33176 -9.02820  -57.03111 1.000 74.90549  ? 16  ARG B N   1 
ATOM   7386 C  CA  . ARG H 4 16  ? 62.39335 -9.19504  -58.01939 1.000 72.30436  ? 16  ARG B CA  1 
ATOM   7387 C  C   . ARG H 4 16  ? 61.95207 -8.70803  -59.39573 1.000 71.24342  ? 16  ARG B C   1 
ATOM   7388 O  O   . ARG H 4 16  ? 62.73557 -8.08812  -60.12212 1.000 69.50129  ? 16  ARG B O   1 
ATOM   7389 C  CB  . ARG H 4 16  ? 62.82452 -10.66177 -58.10122 1.000 73.05671  ? 16  ARG B CB  1 
ATOM   7390 C  CG  . ARG H 4 16  ? 64.01433 -10.90258 -59.03561 1.000 72.96317  ? 16  ARG B CG  1 
ATOM   7391 C  CD  . ARG H 4 16  ? 64.21146 -12.36233 -59.43760 1.000 76.24348  ? 16  ARG B CD  1 
ATOM   7392 N  NE  . ARG H 4 16  ? 63.09945 -12.88220 -60.23620 1.000 78.92963  ? 16  ARG B NE  1 
ATOM   7393 C  CZ  . ARG H 4 16  ? 62.31031 -13.88702 -59.87321 1.000 81.56606  ? 16  ARG B CZ  1 
ATOM   7394 N  NH1 . ARG H 4 16  ? 62.50932 -14.50846 -58.71429 1.000 82.85215  ? 16  ARG B NH1 1 
ATOM   7395 N  NH2 . ARG H 4 16  ? 61.32636 -14.28036 -60.67431 1.000 82.56809  ? 16  ARG B NH2 1 
ATOM   7396 N  N   . ARG H 4 17  ? 60.68968 -8.95550  -59.75759 1.000 72.95558  ? 17  ARG B N   1 
ATOM   7397 C  CA  . ARG H 4 17  ? 60.20633 -8.60637  -61.09015 1.000 75.65054  ? 17  ARG B CA  1 
ATOM   7398 C  C   . ARG H 4 17  ? 60.34078 -7.11202  -61.37770 1.000 70.17964  ? 17  ARG B C   1 
ATOM   7399 O  O   . ARG H 4 17  ? 60.47828 -6.71426  -62.54051 1.000 68.09720  ? 17  ARG B O   1 
ATOM   7400 C  CB  . ARG H 4 17  ? 58.75929 -9.08264  -61.24401 1.000 86.29890  ? 17  ARG B CB  1 
ATOM   7401 C  CG  . ARG H 4 17  ? 58.18179 -8.96237  -62.65267 1.000 88.64978  ? 17  ARG B CG  1 
ATOM   7402 C  CD  . ARG H 4 17  ? 58.51628 -10.14278 -63.56399 1.000 90.84349  ? 17  ARG B CD  1 
ATOM   7403 N  NE  . ARG H 4 17  ? 58.11961 -9.84151  -64.93964 1.000 91.81775  ? 17  ARG B NE  1 
ATOM   7404 C  CZ  . ARG H 4 17  ? 58.93992 -9.34031  -65.85698 1.000 93.12909  ? 17  ARG B CZ  1 
ATOM   7405 N  NH1 . ARG H 4 17  ? 58.49817 -9.08709  -67.08335 1.000 97.26525  ? 17  ARG B NH1 1 
ATOM   7406 N  NH2 . ARG H 4 17  ? 60.20641 -9.10402  -65.55534 1.000 90.98985  ? 17  ARG B NH2 1 
ATOM   7407 N  N   . LYS H 4 18  ? 60.30368 -6.26915  -60.34366 1.000 70.01546  ? 18  LYS B N   1 
ATOM   7408 C  CA  . LYS H 4 18  ? 60.47357 -4.83503  -60.56188 1.000 67.38358  ? 18  LYS B CA  1 
ATOM   7409 C  C   . LYS H 4 18  ? 61.93030 -4.49605  -60.87968 1.000 66.23494  ? 18  LYS B C   1 
ATOM   7410 O  O   . LYS H 4 18  ? 62.20219 -3.60586  -61.69465 1.000 71.25651  ? 18  LYS B O   1 
ATOM   7411 C  CB  . LYS H 4 18  ? 59.95738 -4.05682  -59.34644 1.000 64.49070  ? 18  LYS B CB  1 
ATOM   7412 C  CG  . LYS H 4 18  ? 58.42758 -4.04390  -59.21618 1.000 62.50901  ? 18  LYS B CG  1 
ATOM   7413 C  CD  . LYS H 4 18  ? 57.93121 -2.63020  -58.98272 1.000 62.36454  ? 18  LYS B CD  1 
ATOM   7414 C  CE  . LYS H 4 18  ? 56.42580 -2.56728  -58.78408 1.000 64.80374  ? 18  LYS B CE  1 
ATOM   7415 N  NZ  . LYS H 4 18  ? 55.94934 -3.42062  -57.65768 1.000 65.95670  ? 18  LYS B NZ  1 
ATOM   7416 N  N   . ILE H 4 19  ? 62.87850 -5.20596  -60.25628 1.000 57.99759  ? 19  ILE B N   1 
ATOM   7417 C  CA  . ILE H 4 19  ? 64.29878 -4.97823  -60.52663 1.000 49.46969  ? 19  ILE B CA  1 
ATOM   7418 C  C   . ILE H 4 19  ? 64.65825 -5.38626  -61.94876 1.000 48.66757  ? 19  ILE B C   1 
ATOM   7419 O  O   . ILE H 4 19  ? 65.43856 -4.70421  -62.62242 1.000 44.89357  ? 19  ILE B O   1 
ATOM   7420 C  CB  . ILE H 4 19  ? 65.16997 -5.72209  -59.50259 1.000 46.48697  ? 19  ILE B CB  1 
ATOM   7421 C  CG1 . ILE H 4 19  ? 64.92331 -5.16875  -58.11615 1.000 47.22467  ? 19  ILE B CG1 1 
ATOM   7422 C  CG2 . ILE H 4 19  ? 66.63657 -5.51951  -59.78852 1.000 44.89237  ? 19  ILE B CG2 1 
ATOM   7423 C  CD1 . ILE H 4 19  ? 65.86806 -5.72016  -57.13081 1.000 48.00067  ? 19  ILE B CD1 1 
ATOM   7424 N  N   . GLU H 4 20  ? 64.14237 -6.52893  -62.41158 1.000 54.94806  ? 20  GLU B N   1 
ATOM   7425 C  CA  . GLU H 4 20  ? 64.34399 -6.90991  -63.80220 1.000 58.39090  ? 20  GLU B CA  1 
ATOM   7426 C  C   . GLU H 4 20  ? 63.75233 -5.85823  -64.72406 1.000 56.24790  ? 20  GLU B C   1 
ATOM   7427 O  O   . GLU H 4 20  ? 64.39881 -5.42153  -65.68281 1.000 54.07285  ? 20  GLU B O   1 
ATOM   7428 C  CB  . GLU H 4 20  ? 63.71332 -8.27576  -64.05867 1.000 69.15627  ? 20  GLU B CB  1 
ATOM   7429 C  CG  . GLU H 4 20  ? 64.17343 -9.37091  -63.08954 1.000 78.40233  ? 20  GLU B CG  1 
ATOM   7430 C  CD  . GLU H 4 20  ? 63.47105 -10.70808 -63.31381 1.000 88.22300  ? 20  GLU B CD  1 
ATOM   7431 O  OE1 . GLU H 4 20  ? 62.46692 -10.74125 -64.05972 1.000 90.92811  ? 20  GLU B OE1 1 
ATOM   7432 O  OE2 . GLU H 4 20  ? 63.92902 -11.72695 -62.74562 1.000 91.72854  ? 20  GLU B OE2 1 
ATOM   7433 N  N   . GLN H 4 21  ? 62.54118 -5.38861  -64.40498 1.000 60.07838  ? 21  GLN B N   1 
ATOM   7434 C  CA  . GLN H 4 21  ? 61.91067 -4.35833  -65.22313 1.000 63.35619  ? 21  GLN B CA  1 
ATOM   7435 C  C   . GLN H 4 21  ? 62.70472 -3.05830  -65.18286 1.000 62.40195  ? 21  GLN B C   1 
ATOM   7436 O  O   . GLN H 4 21  ? 62.82721 -2.37263  -66.20276 1.000 65.89717  ? 21  GLN B O   1 
ATOM   7437 C  CB  . GLN H 4 21  ? 60.46428 -4.13409  -64.77555 1.000 65.12091  ? 21  GLN B CB  1 
ATOM   7438 C  CG  . GLN H 4 21  ? 59.50221 -5.24172  -65.21730 1.000 69.33036  ? 21  GLN B CG  1 
ATOM   7439 C  CD  . GLN H 4 21  ? 58.07486 -5.04421  -64.72371 1.000 73.75443  ? 21  GLN B CD  1 
ATOM   7440 O  OE1 . GLN H 4 21  ? 57.82087 -4.30435  -63.77031 1.000 74.13915  ? 21  GLN B OE1 1 
ATOM   7441 N  NE2 . GLN H 4 21  ? 57.13418 -5.71402  -65.37520 1.000 79.55214  ? 21  GLN B NE2 1 
ATOM   7442 N  N   . TRP H 4 22  ? 63.29397 -2.71833  -64.03703 1.000 59.71016  ? 22  TRP B N   1 
ATOM   7443 C  CA  . TRP H 4 22  ? 64.03352 -1.46343  -63.98268 1.000 60.24563  ? 22  TRP B CA  1 
ATOM   7444 C  C   . TRP H 4 22  ? 65.34497 -1.55358  -64.76029 1.000 64.93902  ? 22  TRP B C   1 
ATOM   7445 O  O   . TRP H 4 22  ? 65.66340 -0.66208  -65.56057 1.000 68.76299  ? 22  TRP B O   1 
ATOM   7446 C  CB  . TRP H 4 22  ? 64.28840 -1.04241  -62.54660 1.000 56.46083  ? 22  TRP B CB  1 
ATOM   7447 C  CG  . TRP H 4 22  ? 64.92505 0.28513   -62.50478 1.000 57.90467  ? 22  TRP B CG  1 
ATOM   7448 C  CD1 . TRP H 4 22  ? 64.35990 1.48380   -62.83306 1.000 58.78676  ? 22  TRP B CD1 1 
ATOM   7449 C  CD2 . TRP H 4 22  ? 66.27569 0.56310   -62.12857 1.000 56.18345  ? 22  TRP B CD2 1 
ATOM   7450 N  NE1 . TRP H 4 22  ? 65.28158 2.50286   -62.67007 1.000 56.30849  ? 22  TRP B NE1 1 
ATOM   7451 C  CE2 . TRP H 4 22  ? 66.46361 1.96111   -62.23832 1.000 53.45318  ? 22  TRP B CE2 1 
ATOM   7452 C  CE3 . TRP H 4 22  ? 67.34333 -0.23471  -61.70371 1.000 56.10130  ? 22  TRP B CE3 1 
ATOM   7453 C  CZ2 . TRP H 4 22  ? 67.66797 2.57193   -61.94059 1.000 52.83509  ? 22  TRP B CZ2 1 
ATOM   7454 C  CZ3 . TRP H 4 22  ? 68.54066 0.37446   -61.40894 1.000 57.28429  ? 22  TRP B CZ3 1 
ATOM   7455 C  CH2 . TRP H 4 22  ? 68.69430 1.76997   -61.53002 1.000 56.05799  ? 22  TRP B CH2 1 
ATOM   7456 N  N   . HIS H 4 23  ? 66.11457 -2.62593  -64.55339 1.000 63.47675  ? 23  HIS B N   1 
ATOM   7457 C  CA  . HIS H 4 23  ? 67.37456 -2.77159  -65.27725 1.000 64.80953  ? 23  HIS B CA  1 
ATOM   7458 C  C   . HIS H 4 23  ? 67.13999 -2.82886  -66.78075 1.000 65.11647  ? 23  HIS B C   1 
ATOM   7459 O  O   . HIS H 4 23  ? 67.92142 -2.27290  -67.56424 1.000 64.93340  ? 23  HIS B O   1 
ATOM   7460 C  CB  . HIS H 4 23  ? 68.11955 -4.01946  -64.80642 1.000 71.39372  ? 23  HIS B CB  1 
ATOM   7461 C  CG  . HIS H 4 23  ? 68.94723 -3.79580  -63.58270 1.000 77.75251  ? 23  HIS B CG  1 
ATOM   7462 N  ND1 . HIS H 4 23  ? 68.47138 -4.01973  -62.30924 1.000 80.68359  ? 23  HIS B ND1 1 
ATOM   7463 C  CD2 . HIS H 4 23  ? 70.20858 -3.32604  -63.43591 1.000 81.18278  ? 23  HIS B CD2 1 
ATOM   7464 C  CE1 . HIS H 4 23  ? 69.41260 -3.72067  -61.43144 1.000 84.33344  ? 23  HIS B CE1 1 
ATOM   7465 N  NE2 . HIS H 4 23  ? 70.47671 -3.29592  -62.08920 1.000 82.99410  ? 23  HIS B NE2 1 
ATOM   7466 N  N   . SER H 4 24  ? 66.06620 -3.50213  -67.20315 1.000 64.19045  ? 24  SER B N   1 
ATOM   7467 C  CA  . SER H 4 24  ? 65.75938 -3.58320  -68.62516 1.000 63.01814  ? 24  SER B CA  1 
ATOM   7468 C  C   . SER H 4 24  ? 65.54370 -2.20156  -69.22683 1.000 65.56769  ? 24  SER B C   1 
ATOM   7469 O  O   . SER H 4 24  ? 65.94233 -1.94957  -70.36881 1.000 69.79053  ? 24  SER B O   1 
ATOM   7470 C  CB  . SER H 4 24  ? 64.52041 -4.44940  -68.83827 1.000 60.66382  ? 24  SER B CB  1 
ATOM   7471 O  OG  . SER H 4 24  ? 64.11115 -4.39175  -70.19235 1.000 62.80221  ? 24  SER B OG  1 
ATOM   7472 N  N   . LEU H 4 25  ? 64.95454 -1.28392  -68.46366 1.000 62.27486  ? 25  LEU B N   1 
ATOM   7473 C  CA  . LEU H 4 25  ? 64.71681 0.04998   -68.98729 1.000 58.03703  ? 25  LEU B CA  1 
ATOM   7474 C  C   . LEU H 4 25  ? 66.00447 0.86459   -69.03492 1.000 53.39583  ? 25  LEU B C   1 
ATOM   7475 O  O   . LEU H 4 25  ? 66.20742 1.64431   -69.97410 1.000 55.23802  ? 25  LEU B O   1 
ATOM   7476 C  CB  . LEU H 4 25  ? 63.66152 0.74935   -68.14206 1.000 56.75110  ? 25  LEU B CB  1 
ATOM   7477 C  CG  . LEU H 4 25  ? 62.26238 0.18600   -68.35051 1.000 59.23778  ? 25  LEU B CG  1 
ATOM   7478 C  CD1 . LEU H 4 25  ? 61.29847 0.97961   -67.54752 1.000 59.08105  ? 25  LEU B CD1 1 
ATOM   7479 C  CD2 . LEU H 4 25  ? 61.88267 0.25672   -69.79935 1.000 64.49819  ? 25  LEU B CD2 1 
ATOM   7480 N  N   . VAL H 4 26  ? 66.89088 0.70322   -68.04508 1.000 49.24666  ? 26  VAL B N   1 
ATOM   7481 C  CA  . VAL H 4 26  ? 68.15372 1.44052   -68.07808 1.000 46.03634  ? 26  VAL B CA  1 
ATOM   7482 C  C   . VAL H 4 26  ? 69.02482 0.93894   -69.21752 1.000 52.54865  ? 26  VAL B C   1 
ATOM   7483 O  O   . VAL H 4 26  ? 69.61711 1.73095   -69.95916 1.000 54.01234  ? 26  VAL B O   1 
ATOM   7484 C  CB  . VAL H 4 26  ? 68.90639 1.34614   -66.74168 1.000 38.16512  ? 26  VAL B CB  1 
ATOM   7485 C  CG1 . VAL H 4 26  ? 70.28618 1.98648   -66.88754 1.000 32.35347  ? 26  VAL B CG1 1 
ATOM   7486 C  CG2 . VAL H 4 26  ? 68.11232 1.98301   -65.63286 1.000 36.30210  ? 26  VAL B CG2 1 
ATOM   7487 N  N   . LYS H 4 27  ? 69.13951 -0.38494  -69.35919 1.000 56.62627  ? 27  LYS B N   1 
ATOM   7488 C  CA  . LYS H 4 27  ? 69.96508 -0.92860  -70.43196 1.000 62.62885  ? 27  LYS B CA  1 
ATOM   7489 C  C   . LYS H 4 27  ? 69.44617 -0.47443  -71.78964 1.000 62.01877  ? 27  LYS B C   1 
ATOM   7490 O  O   . LYS H 4 27  ? 70.23434 -0.16129  -72.68836 1.000 63.53932  ? 27  LYS B O   1 
ATOM   7491 C  CB  . LYS H 4 27  ? 69.98856 -2.45735  -70.34275 1.000 71.41236  ? 27  LYS B CB  1 
ATOM   7492 C  CG  . LYS H 4 27  ? 70.74545 -3.03041  -69.14681 1.000 79.83260  ? 27  LYS B CG  1 
ATOM   7493 C  CD  . LYS H 4 27  ? 72.21934 -3.30472  -69.44235 1.000 86.89958  ? 27  LYS B CD  1 
ATOM   7494 C  CE  . LYS H 4 27  ? 72.34242 -4.56662  -70.30803 1.000 94.66628  ? 27  LYS B CE  1 
ATOM   7495 N  NZ  . LYS H 4 27  ? 73.73021 -5.05626  -70.57544 1.000 96.98093  ? 27  LYS B NZ  1 
ATOM   7496 N  N   . TYR H 4 28  ? 68.12015 -0.37113  -71.93595 1.000 59.66232  ? 28  TYR B N   1 
ATOM   7497 C  CA  . TYR H 4 28  ? 67.54495 0.06800   -73.20250 1.000 61.72922  ? 28  TYR B CA  1 
ATOM   7498 C  C   . TYR H 4 28  ? 67.86282 1.53489   -73.46441 1.000 62.13843  ? 28  TYR B C   1 
ATOM   7499 O  O   . TYR H 4 28  ? 68.27824 1.89893   -74.57220 1.000 62.05831  ? 28  TYR B O   1 
ATOM   7500 C  CB  . TYR H 4 28  ? 66.03224 -0.16696  -73.20269 1.000 66.29907  ? 28  TYR B CB  1 
ATOM   7501 C  CG  . TYR H 4 28  ? 65.31563 0.46393   -74.37806 1.000 72.14769  ? 28  TYR B CG  1 
ATOM   7502 C  CD1 . TYR H 4 28  ? 65.28172 -0.16892  -75.61282 1.000 76.76354  ? 28  TYR B CD1 1 
ATOM   7503 C  CD2 . TYR H 4 28  ? 64.67421 1.68921   -74.25547 1.000 73.18295  ? 28  TYR B CD2 1 
ATOM   7504 C  CE1 . TYR H 4 28  ? 64.64332 0.39953   -76.69014 1.000 78.28941  ? 28  TYR B CE1 1 
ATOM   7505 C  CE2 . TYR H 4 28  ? 64.03144 2.26825   -75.33123 1.000 76.92923  ? 28  TYR B CE2 1 
ATOM   7506 C  CZ  . TYR H 4 28  ? 64.01576 1.61342   -76.54575 1.000 79.96875  ? 28  TYR B CZ  1 
ATOM   7507 O  OH  . TYR H 4 28  ? 63.37881 2.17306   -77.62790 1.000 83.25203  ? 28  TYR B OH  1 
ATOM   7508 N  N   . HIS H 4 29  ? 67.69781 2.38406   -72.44360 1.000 61.33163  ? 29  HIS B N   1 
ATOM   7509 C  CA  . HIS H 4 29  ? 67.87528 3.82792   -72.54430 1.000 59.28779  ? 29  HIS B CA  1 
ATOM   7510 C  C   . HIS H 4 29  ? 69.32877 4.27291   -72.44295 1.000 61.29724  ? 29  HIS B C   1 
ATOM   7511 O  O   . HIS H 4 29  ? 69.60453 5.46826   -72.59052 1.000 64.85718  ? 29  HIS B O   1 
ATOM   7512 C  CB  . HIS H 4 29  ? 67.02720 4.52608   -71.48855 1.000 54.98884  ? 29  HIS B CB  1 
ATOM   7513 C  CG  . HIS H 4 29  ? 65.57127 4.53682   -71.82321 1.000 53.24989  ? 29  HIS B CG  1 
ATOM   7514 N  ND1 . HIS H 4 29  ? 65.08404 5.14164   -72.96148 1.000 53.59949  ? 29  HIS B ND1 1 
ATOM   7515 C  CD2 . HIS H 4 29  ? 64.49656 4.03625   -71.17092 1.000 51.84328  ? 29  HIS B CD2 1 
ATOM   7516 C  CE1 . HIS H 4 29  ? 63.77231 4.99974   -73.00296 1.000 55.34905  ? 29  HIS B CE1 1 
ATOM   7517 N  NE2 . HIS H 4 29  ? 63.38920 4.33796   -71.92614 1.000 52.01383  ? 29  HIS B NE2 1 
ATOM   7518 N  N   . MET H 4 30  ? 70.25824 3.35722   -72.18133 1.000 61.01054  ? 30  MET B N   1 
ATOM   7519 C  CA  . MET H 4 30  ? 71.66676 3.67598   -72.34419 1.000 61.82886  ? 30  MET B CA  1 
ATOM   7520 C  C   . MET H 4 30  ? 72.16178 3.34949   -73.74556 1.000 63.93097  ? 30  MET B C   1 
ATOM   7521 O  O   . MET H 4 30  ? 73.13608 3.95811   -74.20350 1.000 64.57020  ? 30  MET B O   1 
ATOM   7522 C  CB  . MET H 4 30  ? 72.53899 2.89921   -71.35594 1.000 62.94819  ? 30  MET B CB  1 
ATOM   7523 C  CG  . MET H 4 30  ? 72.41564 3.21779   -69.88439 1.000 63.03488  ? 30  MET B CG  1 
ATOM   7524 S  SD  . MET H 4 30  ? 73.24870 1.87260   -68.98642 1.000 66.36988  ? 30  MET B SD  1 
ATOM   7525 C  CE  . MET H 4 30  ? 74.94999 2.04295   -69.53798 1.000 67.49123  ? 30  MET B CE  1 
ATOM   7526 N  N   . TYR H 4 31  ? 71.51792 2.41955   -74.45202 1.000 66.55269  ? 31  TYR B N   1 
ATOM   7527 C  CA  . TYR H 4 31  ? 72.10676 1.89630   -75.67991 1.000 73.87338  ? 31  TYR B CA  1 
ATOM   7528 C  C   . TYR H 4 31  ? 71.21407 2.05786   -76.89864 1.000 76.58361  ? 31  TYR B C   1 
ATOM   7529 O  O   . TYR H 4 31  ? 71.69510 2.47202   -77.96054 1.000 76.68158  ? 31  TYR B O   1 
ATOM   7530 C  CB  . TYR H 4 31  ? 72.50173 0.42112   -75.48900 1.000 77.09178  ? 31  TYR B CB  1 
ATOM   7531 C  CG  . TYR H 4 31  ? 73.63306 0.27524   -74.50009 1.000 77.91247  ? 31  TYR B CG  1 
ATOM   7532 C  CD1 . TYR H 4 31  ? 74.87884 0.83697   -74.75367 1.000 76.53213  ? 31  TYR B CD1 1 
ATOM   7533 C  CD2 . TYR H 4 31  ? 73.44811 -0.39715  -73.30179 1.000 81.55984  ? 31  TYR B CD2 1 
ATOM   7534 C  CE1 . TYR H 4 31  ? 75.90898 0.72206   -73.85074 1.000 79.49367  ? 31  TYR B CE1 1 
ATOM   7535 C  CE2 . TYR H 4 31  ? 74.47876 -0.52043  -72.38308 1.000 83.24442  ? 31  TYR B CE2 1 
ATOM   7536 C  CZ  . TYR H 4 31  ? 75.70683 0.04140   -72.66386 1.000 82.87450  ? 31  TYR B CZ  1 
ATOM   7537 O  OH  . TYR H 4 31  ? 76.73161 -0.07825  -71.75163 1.000 83.47378  ? 31  TYR B OH  1 
ATOM   7538 N  N   . LYS H 4 32  ? 69.94486 1.70859   -76.79329 1.000 79.19841  ? 32  LYS B N   1 
ATOM   7539 C  CA  . LYS H 4 32  ? 69.03670 1.70585   -77.92436 1.000 81.43119  ? 32  LYS B CA  1 
ATOM   7540 C  C   . LYS H 4 32  ? 68.19721 2.98522   -77.87733 1.000 76.49576  ? 32  LYS B C   1 
ATOM   7541 O  O   . LYS H 4 32  ? 68.46988 3.89818   -77.09536 1.000 73.43684  ? 32  LYS B O   1 
ATOM   7542 C  CB  . LYS H 4 32  ? 68.20098 0.41983   -77.90010 1.000 84.96224  ? 32  LYS B CB  1 
ATOM   7543 C  CG  . LYS H 4 32  ? 69.02932 -0.84118  -78.18849 1.000 88.33850  ? 32  LYS B CG  1 
ATOM   7544 C  CD  . LYS H 4 32  ? 68.16299 -2.03863  -78.56184 1.000 92.04800  ? 32  LYS B CD  1 
ATOM   7545 C  CE  . LYS H 4 32  ? 67.66424 -1.93897  -79.99727 1.000 98.14776  ? 32  LYS B CE  1 
ATOM   7546 N  NZ  . LYS H 4 32  ? 68.77088 -1.69649  -80.97262 1.000 96.59989  ? 32  LYS B NZ  1 
ATOM   7547 N  N   . GLY H 4 33  ? 67.18226 3.07561   -78.73173 1.000 76.90896  ? 33  GLY B N   1 
ATOM   7548 C  CA  . GLY H 4 33  ? 66.37657 4.28909   -78.79151 1.000 74.38925  ? 33  GLY B CA  1 
ATOM   7549 C  C   . GLY H 4 33  ? 67.20158 5.51008   -79.16264 1.000 73.61584  ? 33  GLY B C   1 
ATOM   7550 O  O   . GLY H 4 33  ? 68.16681 5.44326   -79.94004 1.000 76.69416  ? 33  GLY B O   1 
ATOM   7551 N  N   . LYS H 4 34  ? 66.80098 6.65651   -78.60938 1.000 72.42079  ? 34  LYS B N   1 
ATOM   7552 C  CA  . LYS H 4 34  ? 67.58461 7.88225   -78.72246 1.000 70.99109  ? 34  LYS B CA  1 
ATOM   7553 C  C   . LYS H 4 34  ? 68.68106 7.99741   -77.65405 1.000 66.69861  ? 34  LYS B C   1 
ATOM   7554 O  O   . LYS H 4 34  ? 69.24111 9.08656   -77.48292 1.000 58.87509  ? 34  LYS B O   1 
ATOM   7555 C  CB  . LYS H 4 34  ? 66.65919 9.10466   -78.68767 1.000 71.64264  ? 34  LYS B CB  1 
ATOM   7556 C  CG  . LYS H 4 34  ? 65.84282 9.28344   -79.97271 1.000 75.59070  ? 34  LYS B CG  1 
ATOM   7557 C  CD  . LYS H 4 34  ? 65.13209 10.63476  -80.03005 1.000 77.73765  ? 34  LYS B CD  1 
ATOM   7558 C  CE  . LYS H 4 34  ? 66.12923 11.79828  -80.13903 1.000 79.85468  ? 34  LYS B CE  1 
ATOM   7559 N  NZ  . LYS H 4 34  ? 67.04099 11.74764  -81.32583 1.000 80.52614  ? 34  LYS B NZ  1 
ATOM   7560 N  N   . LYS H 4 35  ? 68.98606 6.91236   -76.93485 1.000 70.74724  ? 35  LYS B N   1 
ATOM   7561 C  CA  . LYS H 4 35  ? 70.09154 6.89094   -75.97740 1.000 72.78498  ? 35  LYS B CA  1 
ATOM   7562 C  C   . LYS H 4 35  ? 69.93321 8.00317   -74.94048 1.000 72.18888  ? 35  LYS B C   1 
ATOM   7563 O  O   . LYS H 4 35  ? 70.87153 8.73822   -74.63883 1.000 69.92008  ? 35  LYS B O   1 
ATOM   7564 C  CB  . LYS H 4 35  ? 71.43951 6.98939   -76.70101 1.000 79.05929  ? 35  LYS B CB  1 
ATOM   7565 C  CG  . LYS H 4 35  ? 71.66946 5.90445   -77.75902 1.000 84.95805  ? 35  LYS B CG  1 
ATOM   7566 C  CD  . LYS H 4 35  ? 72.86488 6.22838   -78.65583 1.000 91.64928  ? 35  LYS B CD  1 
ATOM   7567 C  CE  . LYS H 4 35  ? 74.11041 5.46097   -78.24623 1.000 95.17684  ? 35  LYS B CE  1 
ATOM   7568 N  NZ  . LYS H 4 35  ? 74.02642 4.02075   -78.61957 1.000 98.04456  ? 35  LYS B NZ  1 
ATOM   7569 N  N   . GLU H 4 36  ? 68.72282 8.10866   -74.38268 1.000 75.27319  ? 36  GLU B N   1 
ATOM   7570 C  CA  . GLU H 4 36  ? 68.40906 9.18889   -73.44714 1.000 75.43076  ? 36  GLU B CA  1 
ATOM   7571 C  C   . GLU H 4 36  ? 69.23528 9.09860   -72.17176 1.000 67.30499  ? 36  GLU B C   1 
ATOM   7572 O  O   . GLU H 4 36  ? 69.50281 10.12492  -71.52820 1.000 65.29544  ? 36  GLU B O   1 
ATOM   7573 C  CB  . GLU H 4 36  ? 66.92400 9.17274   -73.08521 1.000 84.13225  ? 36  GLU B CB  1 
ATOM   7574 C  CG  . GLU H 4 36  ? 65.94226 9.14790   -74.26138 1.000 91.85623  ? 36  GLU B CG  1 
ATOM   7575 C  CD  . GLU H 4 36  ? 65.56267 10.53228  -74.75912 1.000 91.95444  ? 36  GLU B CD  1 
ATOM   7576 O  OE1 . GLU H 4 36  ? 66.12196 11.52236  -74.24084 1.000 92.70857  ? 36  GLU B OE1 1 
ATOM   7577 O  OE2 . GLU H 4 36  ? 64.68746 10.62552  -75.65196 1.000 90.47532  ? 36  GLU B OE2 1 
ATOM   7578 N  N   . ALA H 4 37  ? 69.58710 7.88687   -71.75037 1.000 62.51180  ? 37  ALA B N   1 
ATOM   7579 C  CA  . ALA H 4 37  ? 70.40909 7.69508   -70.56575 1.000 57.89745  ? 37  ALA B CA  1 
ATOM   7580 C  C   . ALA H 4 37  ? 71.83002 7.25291   -70.92106 1.000 57.23844  ? 37  ALA B C   1 
ATOM   7581 O  O   . ALA H 4 37  ? 72.48603 6.56377   -70.13337 1.000 51.39826  ? 37  ALA B O   1 
ATOM   7582 C  CB  . ALA H 4 37  ? 69.74229 6.69113   -69.62391 1.000 56.70529  ? 37  ALA B CB  1 
ATOM   7583 N  N   . ARG H 4 38  ? 72.33751 7.67846   -72.08317 1.000 63.08571  ? 38  ARG B N   1 
ATOM   7584 C  CA  . ARG H 4 38  ? 73.63621 7.18694   -72.53437 1.000 70.24736  ? 38  ARG B CA  1 
ATOM   7585 C  C   . ARG H 4 38  ? 74.73936 7.52543   -71.54720 1.000 72.07424  ? 38  ARG B C   1 
ATOM   7586 O  O   . ARG H 4 38  ? 75.73204 6.79405   -71.45697 1.000 74.49952  ? 38  ARG B O   1 
ATOM   7587 C  CB  . ARG H 4 38  ? 73.97808 7.73063   -73.92861 1.000 75.89395  ? 38  ARG B CB  1 
ATOM   7588 C  CG  . ARG H 4 38  ? 74.03728 9.23542   -74.06859 1.000 80.99924  ? 38  ARG B CG  1 
ATOM   7589 C  CD  . ARG H 4 38  ? 74.10931 9.62257   -75.53807 1.000 92.03721  ? 38  ARG B CD  1 
ATOM   7590 N  NE  . ARG H 4 38  ? 74.26757 11.06118  -75.71428 1.000 102.38803 ? 38  ARG B NE  1 
ATOM   7591 C  CZ  . ARG H 4 38  ? 75.44501 11.68655  -75.72699 1.000 108.27052 ? 38  ARG B CZ  1 
ATOM   7592 N  NH1 . ARG H 4 38  ? 75.49383 13.00300  -75.88424 1.000 109.79571 ? 38  ARG B NH1 1 
ATOM   7593 N  NH2 . ARG H 4 38  ? 76.57396 10.99935  -75.58233 1.000 108.63960 ? 38  ARG B NH2 1 
ATOM   7594 N  N   . GLU H 4 39  ? 74.59459 8.62131   -70.80651 1.000 72.77991  ? 39  GLU B N   1 
ATOM   7595 C  CA  . GLU H 4 39  ? 75.60513 9.00649   -69.82743 1.000 76.99480  ? 39  GLU B CA  1 
ATOM   7596 C  C   . GLU H 4 39  ? 75.44055 8.31120   -68.47831 1.000 67.58271  ? 39  GLU B C   1 
ATOM   7597 O  O   . GLU H 4 39  ? 76.19343 8.61163   -67.54571 1.000 63.88654  ? 39  GLU B O   1 
ATOM   7598 C  CB  . GLU H 4 39  ? 75.58688 10.52189  -69.63903 1.000 87.03585  ? 39  GLU B CB  1 
ATOM   7599 C  CG  . GLU H 4 39  ? 75.69527 11.27392  -70.94593 1.000 98.91440  ? 39  GLU B CG  1 
ATOM   7600 C  CD  . GLU H 4 39  ? 76.08994 12.71950  -70.74998 1.000 111.13885 ? 39  GLU B CD  1 
ATOM   7601 O  OE1 . GLU H 4 39  ? 76.02346 13.21297  -69.59836 1.000 114.88325 ? 39  GLU B OE1 1 
ATOM   7602 O  OE2 . GLU H 4 39  ? 76.47519 13.35875  -71.75228 1.000 115.06418 ? 39  GLU B OE2 1 
ATOM   7603 N  N   . TRP H 4 40  ? 74.47551 7.40869   -68.33879 1.000 65.71126  ? 40  TRP B N   1 
ATOM   7604 C  CA  . TRP H 4 40  ? 74.38001 6.61264   -67.12972 1.000 62.78706  ? 40  TRP B CA  1 
ATOM   7605 C  C   . TRP H 4 40  ? 75.47086 5.54788   -67.14718 1.000 68.21529  ? 40  TRP B C   1 
ATOM   7606 O  O   . TRP H 4 40  ? 76.09633 5.27475   -68.17737 1.000 68.89791  ? 40  TRP B O   1 
ATOM   7607 C  CB  . TRP H 4 40  ? 73.00447 5.94570   -67.01795 1.000 61.16837  ? 40  TRP B CB  1 
ATOM   7608 C  CG  . TRP H 4 40  ? 71.85084 6.90026   -66.85240 1.000 57.44068  ? 40  TRP B CG  1 
ATOM   7609 C  CD1 . TRP H 4 40  ? 71.81941 8.22099   -67.20920 1.000 55.39750  ? 40  TRP B CD1 1 
ATOM   7610 C  CD2 . TRP H 4 40  ? 70.56964 6.61412   -66.26876 1.000 56.62437  ? 40  TRP B CD2 1 
ATOM   7611 N  NE1 . TRP H 4 40  ? 70.59941 8.76816   -66.89672 1.000 54.84032  ? 40  TRP B NE1 1 
ATOM   7612 C  CE2 . TRP H 4 40  ? 69.81404 7.80529   -66.31470 1.000 55.87418  ? 40  TRP B CE2 1 
ATOM   7613 C  CE3 . TRP H 4 40  ? 69.98942 5.46977   -65.71352 1.000 55.42651  ? 40  TRP B CE3 1 
ATOM   7614 C  CZ2 . TRP H 4 40  ? 68.50573 7.88251   -65.82549 1.000 54.87882  ? 40  TRP B CZ2 1 
ATOM   7615 C  CZ3 . TRP H 4 40  ? 68.68687 5.54961   -65.22687 1.000 54.63705  ? 40  TRP B CZ3 1 
ATOM   7616 C  CH2 . TRP H 4 40  ? 67.96162 6.74841   -65.28936 1.000 54.00679  ? 40  TRP B CH2 1 
ATOM   7617 N  N   . GLU H 4 41  ? 75.69547 4.93445   -65.99222 1.000 69.76528  ? 41  GLU B N   1 
ATOM   7618 C  CA  . GLU H 4 41  ? 76.72192 3.91493   -65.84749 1.000 74.75332  ? 41  GLU B CA  1 
ATOM   7619 C  C   . GLU H 4 41  ? 76.10949 2.75045   -65.09022 1.000 76.18182  ? 41  GLU B C   1 
ATOM   7620 O  O   . GLU H 4 41  ? 75.46272 2.95044   -64.05654 1.000 74.34048  ? 41  GLU B O   1 
ATOM   7621 C  CB  . GLU H 4 41  ? 77.95408 4.44831   -65.11165 1.000 75.44948  ? 41  GLU B CB  1 
ATOM   7622 C  CG  . GLU H 4 41  ? 79.10367 3.46622   -65.00906 1.000 80.05179  ? 41  GLU B CG  1 
ATOM   7623 C  CD  . GLU H 4 41  ? 80.23319 3.98543   -64.13541 1.000 83.08729  ? 41  GLU B CD  1 
ATOM   7624 O  OE1 . GLU H 4 41  ? 81.35540 3.44147   -64.21691 1.000 83.69520  ? 41  GLU B OE1 1 
ATOM   7625 O  OE2 . GLU H 4 41  ? 79.99170 4.92820   -63.34991 1.000 84.61102  ? 41  GLU B OE2 1 
ATOM   7626 N  N   . TYR H 4 42  ? 76.28028 1.54389   -65.62714 1.000 80.89889  ? 42  TYR B N   1 
ATOM   7627 C  CA  . TYR H 4 42  ? 75.74424 0.32333   -65.03513 1.000 78.87727  ? 42  TYR B CA  1 
ATOM   7628 C  C   . TYR H 4 42  ? 76.90586 -0.55449  -64.60076 1.000 75.52854  ? 42  TYR B C   1 
ATOM   7629 O  O   . TYR H 4 42  ? 77.81249 -0.81934  -65.39272 1.000 76.96550  ? 42  TYR B O   1 
ATOM   7630 C  CB  . TYR H 4 42  ? 74.83885 -0.42942  -66.02254 1.000 81.62918  ? 42  TYR B CB  1 
ATOM   7631 C  CG  . TYR H 4 42  ? 74.52927 -1.84183  -65.60782 1.000 84.77063  ? 42  TYR B CG  1 
ATOM   7632 C  CD1 . TYR H 4 42  ? 73.62745 -2.10539  -64.59594 1.000 87.08073  ? 42  TYR B CD1 1 
ATOM   7633 C  CD2 . TYR H 4 42  ? 75.14812 -2.91418  -66.22977 1.000 91.74505  ? 42  TYR B CD2 1 
ATOM   7634 C  CE1 . TYR H 4 42  ? 73.34593 -3.39960  -64.20396 1.000 91.84025  ? 42  TYR B CE1 1 
ATOM   7635 C  CE2 . TYR H 4 42  ? 74.87501 -4.22051  -65.85126 1.000 96.52813  ? 42  TYR B CE2 1 
ATOM   7636 C  CZ  . TYR H 4 42  ? 73.97102 -4.45397  -64.83504 1.000 97.52139  ? 42  TYR B CZ  1 
ATOM   7637 O  OH  . TYR H 4 42  ? 73.69085 -5.73974  -64.44493 1.000 103.76461 ? 42  TYR B OH  1 
ATOM   7638 N  N   . VAL H 4 43  ? 76.88785 -0.98879  -63.34738 1.000 70.56344  ? 43  VAL B N   1 
ATOM   7639 C  CA  . VAL H 4 43  ? 77.97292 -1.76754  -62.76888 1.000 72.59747  ? 43  VAL B CA  1 
ATOM   7640 C  C   . VAL H 4 43  ? 77.43930 -3.14611  -62.39740 1.000 81.53989  ? 43  VAL B C   1 
ATOM   7641 O  O   . VAL H 4 43  ? 76.54267 -3.25236  -61.55479 1.000 83.16973  ? 43  VAL B O   1 
ATOM   7642 C  CB  . VAL H 4 43  ? 78.57533 -1.06612  -61.54170 1.000 64.43287  ? 43  VAL B CB  1 
ATOM   7643 C  CG1 . VAL H 4 43  ? 79.88166 -1.72320  -61.14050 1.000 61.62664  ? 43  VAL B CG1 1 
ATOM   7644 C  CG2 . VAL H 4 43  ? 78.76883 0.42960   -61.84472 1.000 60.71337  ? 43  VAL B CG2 1 
ATOM   7645 N  N   . PRO H 4 44  ? 77.95256 -4.22829  -62.98337 1.000 87.02270  ? 44  PRO B N   1 
ATOM   7646 C  CA  . PRO H 4 44  ? 77.48463 -5.56603  -62.60406 1.000 90.21497  ? 44  PRO B CA  1 
ATOM   7647 C  C   . PRO H 4 44  ? 78.02408 -5.94857  -61.23337 1.000 95.84192  ? 44  PRO B C   1 
ATOM   7648 O  O   . PRO H 4 44  ? 78.89382 -5.28576  -60.66718 1.000 94.72404  ? 44  PRO B O   1 
ATOM   7649 C  CB  . PRO H 4 44  ? 78.05896 -6.47177  -63.69775 1.000 93.06269  ? 44  PRO B CB  1 
ATOM   7650 C  CG  . PRO H 4 44  ? 78.53014 -5.53774  -64.79641 1.000 91.43734  ? 44  PRO B CG  1 
ATOM   7651 C  CD  . PRO H 4 44  ? 78.93452 -4.28864  -64.07852 1.000 88.41850  ? 44  PRO B CD  1 
ATOM   7652 N  N   . HIS H 4 45  ? 77.52177 -7.07180  -60.71868 1.000 103.29012 ? 45  HIS B N   1 
ATOM   7653 C  CA  . HIS H 4 45  ? 77.87199 -7.49320  -59.36469 1.000 109.61858 ? 45  HIS B CA  1 
ATOM   7654 C  C   . HIS H 4 45  ? 79.36842 -7.77324  -59.20073 1.000 113.95399 ? 45  HIS B C   1 
ATOM   7655 O  O   . HIS H 4 45  ? 79.93394 -7.48383  -58.13867 1.000 115.92874 ? 45  HIS B O   1 
ATOM   7656 C  CB  . HIS H 4 45  ? 77.03303 -8.70978  -58.96413 1.000 114.25774 ? 45  HIS B CB  1 
ATOM   7657 C  CG  . HIS H 4 45  ? 76.77753 -9.66604  -60.08650 1.000 122.01690 ? 45  HIS B CG  1 
ATOM   7658 N  ND1 . HIS H 4 45  ? 75.73533 -9.50714  -60.97735 1.000 124.32213 ? 45  HIS B ND1 1 
ATOM   7659 C  CD2 . HIS H 4 45  ? 77.42371 -10.79779 -60.45943 1.000 126.59372 ? 45  HIS B CD2 1 
ATOM   7660 C  CE1 . HIS H 4 45  ? 75.75772 -10.49435 -61.85710 1.000 128.57257 ? 45  HIS B CE1 1 
ATOM   7661 N  NE2 . HIS H 4 45  ? 76.77138 -11.29174 -61.56485 1.000 129.64198 ? 45  HIS B NE2 1 
ATOM   7662 N  N   . PHE H 4 46  ? 80.03838 -8.29492  -60.23492 1.000 109.25628 ? 46  PHE B N   1 
ATOM   7663 C  CA  . PHE H 4 46  ? 81.47599 -8.54415  -60.12297 1.000 103.70036 ? 46  PHE B CA  1 
ATOM   7664 C  C   . PHE H 4 46  ? 82.33396 -7.27309  -60.13929 1.000 102.72936 ? 46  PHE B C   1 
ATOM   7665 O  O   . PHE H 4 46  ? 83.51359 -7.33643  -59.76800 1.000 103.15861 ? 46  PHE B O   1 
ATOM   7666 C  CB  . PHE H 4 46  ? 81.92557 -9.53215  -61.21858 1.000 99.03378  ? 46  PHE B CB  1 
ATOM   7667 C  CG  . PHE H 4 46  ? 81.20625 -9.37315  -62.54389 1.000 93.73830  ? 46  PHE B CG  1 
ATOM   7668 C  CD1 . PHE H 4 46  ? 80.03792 -10.08993 -62.80572 1.000 91.18107  ? 46  PHE B CD1 1 
ATOM   7669 C  CD2 . PHE H 4 46  ? 81.70115 -8.53480  -63.53570 1.000 91.98057  ? 46  PHE B CD2 1 
ATOM   7670 C  CE1 . PHE H 4 46  ? 79.36413 -9.95632  -64.02496 1.000 89.35159  ? 46  PHE B CE1 1 
ATOM   7671 C  CE2 . PHE H 4 46  ? 81.03149 -8.39697  -64.75484 1.000 91.02545  ? 46  PHE B CE2 1 
ATOM   7672 C  CZ  . PHE H 4 46  ? 79.86263 -9.11150  -64.99696 1.000 89.65204  ? 46  PHE B CZ  1 
ATOM   7673 N  N   . LYS H 4 47  ? 81.78666 -6.11641  -60.50872 1.000 100.05458 ? 47  LYS B N   1 
ATOM   7674 C  CA  . LYS H 4 47  ? 82.59070 -4.89975  -60.53201 1.000 100.39635 ? 47  LYS B CA  1 
ATOM   7675 C  C   . LYS H 4 47  ? 82.30176 -3.96595  -59.35715 1.000 97.43580  ? 47  LYS B C   1 
ATOM   7676 O  O   . LYS H 4 47  ? 82.90065 -2.88544  -59.27729 1.000 94.53523  ? 47  LYS B O   1 
ATOM   7677 C  CB  . LYS H 4 47  ? 82.36484 -4.13468  -61.84854 1.000 104.46315 ? 47  LYS B CB  1 
ATOM   7678 C  CG  . LYS H 4 47  ? 82.94207 -4.78243  -63.10125 1.000 109.40679 ? 47  LYS B CG  1 
ATOM   7679 C  CD  . LYS H 4 47  ? 84.45979 -4.68679  -63.14910 1.000 110.90828 ? 47  LYS B CD  1 
ATOM   7680 C  CE  . LYS H 4 47  ? 85.12270 -6.02303  -62.84350 1.000 112.49798 ? 47  LYS B CE  1 
ATOM   7681 N  NZ  . LYS H 4 47  ? 86.60093 -5.87841  -62.77792 1.000 112.85434 ? 47  LYS B NZ  1 
ATOM   7682 N  N   . VAL H 4 48  ? 81.44234 -4.36599  -58.42463 1.000 96.08262  ? 48  VAL B N   1 
ATOM   7683 C  CA  . VAL H 4 48  ? 81.10177 -3.53409  -57.27410 1.000 92.23689  ? 48  VAL B CA  1 
ATOM   7684 C  C   . VAL H 4 48  ? 82.05492 -3.80936  -56.11700 1.000 97.73827  ? 48  VAL B C   1 
ATOM   7685 O  O   . VAL H 4 48  ? 82.45695 -4.96039  -55.90937 1.000 98.23992  ? 48  VAL B O   1 
ATOM   7686 C  CB  . VAL H 4 48  ? 79.63793 -3.77284  -56.87379 1.000 88.61731  ? 48  VAL B CB  1 
ATOM   7687 C  CG1 . VAL H 4 48  ? 79.20811 -2.86180  -55.72947 1.000 86.59270  ? 48  VAL B CG1 1 
ATOM   7688 C  CG2 . VAL H 4 48  ? 78.74721 -3.54898  -58.07296 1.000 87.31807  ? 48  VAL B CG2 1 
ATOM   7689 N  N   . PRO H 4 49  ? 82.45077 -2.78480  -55.35355 1.000 102.75105 ? 49  PRO B N   1 
ATOM   7690 C  CA  . PRO H 4 49  ? 83.20849 -3.01707  -54.11523 1.000 110.41644 ? 49  PRO B CA  1 
ATOM   7691 C  C   . PRO H 4 49  ? 82.52584 -4.03857  -53.21884 1.000 121.32561 ? 49  PRO B C   1 
ATOM   7692 O  O   . PRO H 4 49  ? 81.30059 -4.17932  -53.23144 1.000 122.86239 ? 49  PRO B O   1 
ATOM   7693 C  CB  . PRO H 4 49  ? 83.24382 -1.63144  -53.46133 1.000 104.62516 ? 49  PRO B CB  1 
ATOM   7694 C  CG  . PRO H 4 49  ? 83.20035 -0.68802  -54.61567 1.000 100.29335 ? 49  PRO B CG  1 
ATOM   7695 C  CD  . PRO H 4 49  ? 82.32977 -1.34495  -55.65966 1.000 101.08088 ? 49  PRO B CD  1 
ATOM   7696 N  N   . TRP H 4 50  ? 83.33742 -4.72541  -52.41032 1.000 132.35352 ? 50  TRP B N   1 
ATOM   7697 C  CA  . TRP H 4 50  ? 82.90850 -5.96761  -51.76781 1.000 140.18839 ? 50  TRP B CA  1 
ATOM   7698 C  C   . TRP H 4 50  ? 81.59263 -5.80872  -51.01623 1.000 126.86483 ? 50  TRP B C   1 
ATOM   7699 O  O   . TRP H 4 50  ? 81.41814 -4.89637  -50.20290 1.000 123.32398 ? 50  TRP B O   1 
ATOM   7700 C  CB  . TRP H 4 50  ? 83.98537 -6.48957  -50.81011 1.000 155.77300 ? 50  TRP B CB  1 
ATOM   7701 C  CG  . TRP H 4 50  ? 83.51375 -7.70179  -50.04195 1.000 161.50506 ? 50  TRP B CG  1 
ATOM   7702 C  CD1 . TRP H 4 50  ? 83.11810 -7.74059  -48.73393 1.000 163.13532 ? 50  TRP B CD1 1 
ATOM   7703 C  CD2 . TRP H 4 50  ? 83.35220 -9.03813  -50.54824 1.000 163.94026 ? 50  TRP B CD2 1 
ATOM   7704 N  NE1 . TRP H 4 50  ? 82.73406 -9.01692  -48.39149 1.000 164.30046 ? 50  TRP B NE1 1 
ATOM   7705 C  CE2 . TRP H 4 50  ? 82.86760 -9.83104  -49.48591 1.000 165.48481 ? 50  TRP B CE2 1 
ATOM   7706 C  CE3 . TRP H 4 50  ? 83.57687 -9.64108  -51.79249 1.000 166.94844 ? 50  TRP B CE3 1 
ATOM   7707 C  CZ2 . TRP H 4 50  ? 82.60203 -11.19230 -49.63048 1.000 167.64074 ? 50  TRP B CZ2 1 
ATOM   7708 C  CZ3 . TRP H 4 50  ? 83.31525 -10.99563 -51.93185 1.000 169.50479 ? 50  TRP B CZ3 1 
ATOM   7709 C  CH2 . TRP H 4 50  ? 82.83482 -11.75490 -50.85613 1.000 170.08641 ? 50  TRP B CH2 1 
ATOM   7710 N  N   . GLY H 4 51  ? 80.66761 -6.70842  -51.30465 1.000 119.31818 ? 51  GLY B N   1 
ATOM   7711 C  CA  . GLY H 4 51  ? 79.45993 -6.81183  -50.52689 1.000 108.62953 ? 51  GLY B CA  1 
ATOM   7712 C  C   . GLY H 4 51  ? 78.73521 -8.10427  -50.82342 1.000 96.78840  ? 51  GLY B C   1 
ATOM   7713 O  O   . GLY H 4 51  ? 78.44810 -8.39611  -51.98786 1.000 95.74748  ? 51  GLY B O   1 
ATOM   7714 N  N   . TRP H 4 52  ? 78.45594 -8.89809  -49.78878 1.000 87.30532  ? 52  TRP B N   1 
ATOM   7715 C  CA  . TRP H 4 52  ? 77.69292 -10.12344 -49.98831 1.000 84.76735  ? 52  TRP B CA  1 
ATOM   7716 C  C   . TRP H 4 52  ? 76.39266 -9.81639  -50.71537 1.000 79.85577  ? 52  TRP B C   1 
ATOM   7717 O  O   . TRP H 4 52  ? 76.07132 -10.43494 -51.73614 1.000 79.73043  ? 52  TRP B O   1 
ATOM   7718 C  CB  . TRP H 4 52  ? 77.38200 -10.77646 -48.63854 1.000 87.80663  ? 52  TRP B CB  1 
ATOM   7719 C  CG  . TRP H 4 52  ? 77.39446 -12.30661 -48.57826 1.000 92.29757  ? 52  TRP B CG  1 
ATOM   7720 C  CD1 . TRP H 4 52  ? 77.90998 -13.05909 -47.56428 1.000 93.83282  ? 52  TRP B CD1 1 
ATOM   7721 C  CD2 . TRP H 4 52  ? 76.88908 -13.24609 -49.54510 1.000 96.95174  ? 52  TRP B CD2 1 
ATOM   7722 N  NE1 . TRP H 4 52  ? 77.76851 -14.39324 -47.83070 1.000 96.43768  ? 52  TRP B NE1 1 
ATOM   7723 C  CE2 . TRP H 4 52  ? 77.14224 -14.53873 -49.03887 1.000 99.55831  ? 52  TRP B CE2 1 
ATOM   7724 C  CE3 . TRP H 4 52  ? 76.25259 -13.12574 -50.78176 1.000 99.15133  ? 52  TRP B CE3 1 
ATOM   7725 C  CZ2 . TRP H 4 52  ? 76.77884 -15.69729 -49.72731 1.000 103.05927 ? 52  TRP B CZ2 1 
ATOM   7726 C  CZ3 . TRP H 4 52  ? 75.89851 -14.27616 -51.46328 1.000 102.28056 ? 52  TRP B CZ3 1 
ATOM   7727 C  CH2 . TRP H 4 52  ? 76.15887 -15.54382 -50.93647 1.000 103.63763 ? 52  TRP B CH2 1 
ATOM   7728 N  N   . TRP H 4 53  ? 75.65780 -8.81712  -50.21856 1.000 74.46412  ? 53  TRP B N   1 
ATOM   7729 C  CA  . TRP H 4 53  ? 74.29321 -8.50729  -50.63019 1.000 68.67662  ? 53  TRP B CA  1 
ATOM   7730 C  C   . TRP H 4 53  ? 74.18281 -7.53566  -51.79859 1.000 67.46017  ? 53  TRP B C   1 
ATOM   7731 O  O   . TRP H 4 53  ? 73.06471 -7.13745  -52.12983 1.000 69.00041  ? 53  TRP B O   1 
ATOM   7732 C  CB  . TRP H 4 53  ? 73.50622 -7.94780  -49.44326 1.000 65.01144  ? 53  TRP B CB  1 
ATOM   7733 C  CG  . TRP H 4 53  ? 73.27951 -8.93054  -48.33154 1.000 65.69383  ? 53  TRP B CG  1 
ATOM   7734 C  CD1 . TRP H 4 53  ? 72.24995 -9.82166  -48.21514 1.000 66.49274  ? 53  TRP B CD1 1 
ATOM   7735 C  CD2 . TRP H 4 53  ? 74.11448 -9.13471  -47.19034 1.000 64.48371  ? 53  TRP B CD2 1 
ATOM   7736 N  NE1 . TRP H 4 53  ? 72.38849 -10.55675 -47.06283 1.000 68.58653  ? 53  TRP B NE1 1 
ATOM   7737 C  CE2 . TRP H 4 53  ? 73.52899 -10.15688 -46.41804 1.000 64.17933  ? 53  TRP B CE2 1 
ATOM   7738 C  CE3 . TRP H 4 53  ? 75.29823 -8.54820  -46.74538 1.000 64.93024  ? 53  TRP B CE3 1 
ATOM   7739 C  CZ2 . TRP H 4 53  ? 74.08814 -10.60075 -45.22998 1.000 63.92780  ? 53  TRP B CZ2 1 
ATOM   7740 C  CZ3 . TRP H 4 53  ? 75.85150 -8.99143  -45.56824 1.000 65.43415  ? 53  TRP B CZ3 1 
ATOM   7741 C  CH2 . TRP H 4 53  ? 75.24684 -10.00867 -44.82193 1.000 64.81327  ? 53  TRP B CH2 1 
ATOM   7742 N  N   . SER H 4 54  ? 75.28908 -7.13444  -52.42547 1.000 73.77548  ? 54  SER B N   1 
ATOM   7743 C  CA  . SER H 4 54  ? 75.22566 -6.13312  -53.48975 1.000 74.21493  ? 54  SER B CA  1 
ATOM   7744 C  C   . SER H 4 54  ? 74.87333 -6.81622  -54.80499 1.000 75.56433  ? 54  SER B C   1 
ATOM   7745 O  O   . SER H 4 54  ? 75.63051 -7.65920  -55.29735 1.000 76.63962  ? 54  SER B O   1 
ATOM   7746 C  CB  . SER H 4 54  ? 76.54466 -5.38156  -53.61314 1.000 77.49001  ? 54  SER B CB  1 
ATOM   7747 O  OG  . SER H 4 54  ? 77.40366 -5.72479  -52.54740 1.000 80.84486  ? 54  SER B OG  1 
ATOM   7748 N  N   . HIS H 4 55  ? 73.70385 -6.48149  -55.35460 1.000 74.33492  ? 55  HIS B N   1 
ATOM   7749 C  CA  . HIS H 4 55  ? 73.28749 -7.02931  -56.64097 1.000 75.11696  ? 55  HIS B CA  1 
ATOM   7750 C  C   . HIS H 4 55  ? 73.89973 -6.23136  -57.78837 1.000 73.68793  ? 55  HIS B C   1 
ATOM   7751 O  O   . HIS H 4 55  ? 74.50558 -6.80904  -58.69737 1.000 77.27748  ? 55  HIS B O   1 
ATOM   7752 C  CB  . HIS H 4 55  ? 71.75896 -7.03982  -56.73036 1.000 78.29376  ? 55  HIS B CB  1 
ATOM   7753 C  CG  . HIS H 4 55  ? 71.21532 -7.79315  -57.90367 1.000 83.34356  ? 55  HIS B CG  1 
ATOM   7754 N  ND1 . HIS H 4 55  ? 71.33276 -7.33476  -59.19702 1.000 86.38521  ? 55  HIS B ND1 1 
ATOM   7755 C  CD2 . HIS H 4 55  ? 70.51280 -8.94684  -57.97687 1.000 88.30073  ? 55  HIS B CD2 1 
ATOM   7756 C  CE1 . HIS H 4 55  ? 70.74729 -8.18506  -60.01917 1.000 89.41478  ? 55  HIS B CE1 1 
ATOM   7757 N  NE2 . HIS H 4 55  ? 70.24003 -9.17164  -59.30378 1.000 90.58646  ? 55  HIS B NE2 1 
ATOM   7758 N  N   . SER H 4 56  ? 73.78260 -4.90504  -57.74789 1.000 68.01530  ? 56  SER B N   1 
ATOM   7759 C  CA  . SER H 4 56  ? 74.33806 -4.05270  -58.79492 1.000 67.22625  ? 56  SER B CA  1 
ATOM   7760 C  C   . SER H 4 56  ? 74.23660 -2.60366  -58.34121 1.000 62.97132  ? 56  SER B C   1 
ATOM   7761 O  O   . SER H 4 56  ? 73.53983 -2.27042  -57.37661 1.000 59.03443  ? 56  SER B O   1 
ATOM   7762 C  CB  . SER H 4 56  ? 73.63042 -4.21847  -60.14465 1.000 69.47137  ? 56  SER B CB  1 
ATOM   7763 O  OG  . SER H 4 56  ? 72.31431 -3.69984  -60.09250 1.000 69.35958  ? 56  SER B OG  1 
ATOM   7764 N  N   . GLU H 4 57  ? 74.92608 -1.74201  -59.07466 1.000 61.43526  ? 57  GLU B N   1 
ATOM   7765 C  CA  . GLU H 4 57  ? 74.90142 -0.31043  -58.84285 1.000 59.59479  ? 57  GLU B CA  1 
ATOM   7766 C  C   . GLU H 4 57  ? 74.59402 0.39204   -60.15313 1.000 57.53482  ? 57  GLU B C   1 
ATOM   7767 O  O   . GLU H 4 57  ? 75.02745 -0.04975  -61.21902 1.000 61.77943  ? 57  GLU B O   1 
ATOM   7768 C  CB  . GLU H 4 57  ? 76.24506 0.16980   -58.29438 1.000 64.14422  ? 57  GLU B CB  1 
ATOM   7769 C  CG  . GLU H 4 57  ? 76.44817 -0.01457  -56.80841 1.000 69.77150  ? 57  GLU B CG  1 
ATOM   7770 C  CD  . GLU H 4 57  ? 77.75254 0.60438   -56.33639 1.000 77.25653  ? 57  GLU B CD  1 
ATOM   7771 O  OE1 . GLU H 4 57  ? 78.66102 0.77446   -57.17849 1.000 78.84362  ? 57  GLU B OE1 1 
ATOM   7772 O  OE2 . GLU H 4 57  ? 77.85337 0.96826   -55.14280 1.000 82.45256  ? 57  GLU B OE2 1 
ATOM   7773 N  N   . VAL H 4 58  ? 73.83506 1.47385   -60.08299 1.000 54.53334  ? 58  VAL B N   1 
ATOM   7774 C  CA  . VAL H 4 58  ? 73.65765 2.35401   -61.22720 1.000 56.53016  ? 58  VAL B CA  1 
ATOM   7775 C  C   . VAL H 4 58  ? 74.06576 3.75249   -60.79152 1.000 56.37345  ? 58  VAL B C   1 
ATOM   7776 O  O   . VAL H 4 58  ? 73.59189 4.24749   -59.76091 1.000 55.36336  ? 58  VAL B O   1 
ATOM   7777 C  CB  . VAL H 4 58  ? 72.22121 2.33467   -61.77239 1.000 55.27609  ? 58  VAL B CB  1 
ATOM   7778 C  CG1 . VAL H 4 58  ? 72.03241 3.45045   -62.79062 1.000 54.13851  ? 58  VAL B CG1 1 
ATOM   7779 C  CG2 . VAL H 4 58  ? 71.97540 1.01328   -62.44985 1.000 55.44657  ? 58  VAL B CG2 1 
ATOM   7780 N  N   . HIS H 4 59  ? 74.97605 4.36713   -61.54088 1.000 57.23471  ? 59  HIS B N   1 
ATOM   7781 C  CA  . HIS H 4 59  ? 75.48164 5.69925   -61.23199 1.000 57.62646  ? 59  HIS B CA  1 
ATOM   7782 C  C   . HIS H 4 59  ? 74.90652 6.68211   -62.23467 1.000 53.87384  ? 59  HIS B C   1 
ATOM   7783 O  O   . HIS H 4 59  ? 75.19538 6.58678   -63.42890 1.000 54.55953  ? 59  HIS B O   1 
ATOM   7784 C  CB  . HIS H 4 59  ? 77.00789 5.73689   -61.25827 1.000 64.01158  ? 59  HIS B CB  1 
ATOM   7785 C  CG  . HIS H 4 59  ? 77.64767 4.98029   -60.13791 1.000 71.62612  ? 59  HIS B CG  1 
ATOM   7786 N  ND1 . HIS H 4 59  ? 78.90945 5.26915   -59.66884 1.000 75.56467  ? 59  HIS B ND1 1 
ATOM   7787 C  CD2 . HIS H 4 59  ? 77.19630 3.94846   -59.38725 1.000 73.87106  ? 59  HIS B CD2 1 
ATOM   7788 C  CE1 . HIS H 4 59  ? 79.20920 4.44516   -58.68016 1.000 76.87462  ? 59  HIS B CE1 1 
ATOM   7789 N  NE2 . HIS H 4 59  ? 78.18665 3.63318   -58.49007 1.000 75.50019  ? 59  HIS B NE2 1 
ATOM   7790 N  N   . ILE H 4 60  ? 74.10501 7.62611   -61.75313 1.000 50.24427  ? 60  ILE B N   1 
ATOM   7791 C  CA  . ILE H 4 60  ? 73.48587 8.61498   -62.63526 1.000 49.56839  ? 60  ILE B CA  1 
ATOM   7792 C  C   . ILE H 4 60  ? 74.05227 10.01890  -62.43633 1.000 46.43899  ? 60  ILE B C   1 
ATOM   7793 O  O   . ILE H 4 60  ? 73.65303 10.70534  -61.48101 1.000 44.59871  ? 60  ILE B O   1 
ATOM   7794 C  CB  . ILE H 4 60  ? 71.96592 8.64549   -62.43709 1.000 49.53801  ? 60  ILE B CB  1 
ATOM   7795 C  CG1 . ILE H 4 60  ? 71.40129 7.23481   -62.47055 1.000 47.62446  ? 60  ILE B CG1 1 
ATOM   7796 C  CG2 . ILE H 4 60  ? 71.31528 9.52716   -63.50654 1.000 51.84488  ? 60  ILE B CG2 1 
ATOM   7797 C  CD1 . ILE H 4 60  ? 69.93544 7.19767   -62.20109 1.000 48.21194  ? 60  ILE B CD1 1 
ATOM   7798 N  N   . PRO H 4 61  ? 74.94277 10.50182  -63.31182 1.000 44.98906  ? 61  PRO B N   1 
ATOM   7799 C  CA  . PRO H 4 61  ? 75.48562 11.85547  -63.12985 1.000 48.35313  ? 61  PRO B CA  1 
ATOM   7800 C  C   . PRO H 4 61  ? 74.40638 12.92066  -63.26929 1.000 52.15794  ? 61  PRO B C   1 
ATOM   7801 O  O   . PRO H 4 61  ? 73.49593 12.81315  -64.08669 1.000 50.64202  ? 61  PRO B O   1 
ATOM   7802 C  CB  . PRO H 4 61  ? 76.52619 11.98524  -64.24863 1.000 44.06816  ? 61  PRO B CB  1 
ATOM   7803 C  CG  . PRO H 4 61  ? 76.69928 10.63562  -64.80570 1.000 41.39819  ? 61  PRO B CG  1 
ATOM   7804 C  CD  . PRO H 4 61  ? 75.44821 9.86876   -64.53688 1.000 40.68867  ? 61  PRO B CD  1 
ATOM   7805 N  N   . LEU H 4 62  ? 74.54938 13.98429  -62.48495 1.000 56.13356  ? 62  LEU B N   1 
ATOM   7806 C  CA  . LEU H 4 62  ? 73.60327 15.08824  -62.46573 1.000 53.75684  ? 62  LEU B CA  1 
ATOM   7807 C  C   . LEU H 4 62  ? 74.23945 16.42504  -62.77984 1.000 57.20545  ? 62  LEU B C   1 
ATOM   7808 O  O   . LEU H 4 62  ? 73.54180 17.44430  -62.77544 1.000 62.09052  ? 62  LEU B O   1 
ATOM   7809 C  CB  . LEU H 4 62  ? 72.90309 15.17465  -61.10079 1.000 48.02137  ? 62  LEU B CB  1 
ATOM   7810 C  CG  . LEU H 4 62  ? 71.98370 14.00371  -60.79388 1.000 44.43045  ? 62  LEU B CG  1 
ATOM   7811 C  CD1 . LEU H 4 62  ? 71.16250 14.29887  -59.55268 1.000 45.45658  ? 62  LEU B CD1 1 
ATOM   7812 C  CD2 . LEU H 4 62  ? 71.08837 13.72977  -61.98823 1.000 41.57747  ? 62  LEU B CD2 1 
ATOM   7813 N  N   . GLY H 4 63  ? 75.53029 16.46036  -63.03342 1.000 57.41890  ? 63  GLY B N   1 
ATOM   7814 C  CA  . GLY H 4 63  ? 76.15426 17.71595  -63.39489 1.000 60.85652  ? 63  GLY B CA  1 
ATOM   7815 C  C   . GLY H 4 63  ? 76.90042 18.32376  -62.23050 1.000 66.09275  ? 63  GLY B C   1 
ATOM   7816 O  O   . GLY H 4 63  ? 76.47174 18.24377  -61.07476 1.000 66.10760  ? 63  GLY B O   1 
ATOM   7817 N  N   . ASN H 4 64  ? 78.01085 18.99287  -62.54802 1.000 72.20294  ? 64  ASN B N   1 
ATOM   7818 C  CA  . ASN H 4 64  ? 78.84193 19.66982  -61.55542 1.000 78.39256  ? 64  ASN B CA  1 
ATOM   7819 C  C   . ASN H 4 64  ? 79.34715 18.66764  -60.52140 1.000 77.80048  ? 64  ASN B C   1 
ATOM   7820 O  O   . ASN H 4 64  ? 79.23948 18.87381  -59.31308 1.000 78.26873  ? 64  ASN B O   1 
ATOM   7821 C  CB  . ASN H 4 64  ? 78.10755 20.82933  -60.88836 1.000 82.88775  ? 64  ASN B CB  1 
ATOM   7822 C  CG  . ASN H 4 64  ? 79.05748 21.86550  -60.31078 1.000 88.26406  ? 64  ASN B CG  1 
ATOM   7823 O  OD1 . ASN H 4 64  ? 80.25050 21.87748  -60.63206 1.000 90.95475  ? 64  ASN B OD1 1 
ATOM   7824 N  ND2 . ASN H 4 64  ? 78.54048 22.73744  -59.45559 1.000 91.38990  ? 64  ASN B ND2 1 
ATOM   7825 N  N   . ASN H 4 65  ? 79.87553 17.55474  -61.02191 1.000 78.79521  ? 65  ASN B N   1 
ATOM   7826 C  CA  . ASN H 4 65  ? 80.51581 16.52513  -60.21764 1.000 76.90092  ? 65  ASN B CA  1 
ATOM   7827 C  C   . ASN H 4 65  ? 79.58405 16.00910  -59.11292 1.000 75.83592  ? 65  ASN B C   1 
ATOM   7828 O  O   . ASN H 4 65  ? 79.99905 15.83172  -57.96669 1.000 76.83116  ? 65  ASN B O   1 
ATOM   7829 C  CB  . ASN H 4 65  ? 81.84114 17.02993  -59.63775 1.000 78.25857  ? 65  ASN B CB  1 
ATOM   7830 C  CG  . ASN H 4 65  ? 82.76139 15.90024  -59.23212 1.000 81.57347  ? 65  ASN B CG  1 
ATOM   7831 O  OD1 . ASN H 4 65  ? 82.44805 14.73515  -59.47402 1.000 86.55219  ? 65  ASN B OD1 1 
ATOM   7832 N  ND2 . ASN H 4 65  ? 83.90162 16.22364  -58.63001 1.000 80.39645  ? 65  ASN B ND2 1 
ATOM   7833 N  N   . THR H 4 66  ? 78.30560 15.78076  -59.43670 1.000 75.58363  ? 66  THR B N   1 
ATOM   7834 C  CA  . THR H 4 66  ? 77.36587 15.16233  -58.50050 1.000 71.05654  ? 66  THR B CA  1 
ATOM   7835 C  C   . THR H 4 66  ? 76.60763 14.05638  -59.21575 1.000 66.67280  ? 66  THR B C   1 
ATOM   7836 O  O   . THR H 4 66  ? 76.35847 14.14617  -60.41748 1.000 69.23454  ? 66  THR B O   1 
ATOM   7837 C  CB  . THR H 4 66  ? 76.34876 16.14603  -57.90675 1.000 71.03197  ? 66  THR B CB  1 
ATOM   7838 O  OG1 . THR H 4 66  ? 75.39825 16.51796  -58.91416 1.000 73.39915  ? 66  THR B OG1 1 
ATOM   7839 C  CG2 . THR H 4 66  ? 77.04088 17.37546  -57.38293 1.000 71.98124  ? 66  THR B CG2 1 
ATOM   7840 N  N   . LYS H 4 67  ? 76.22500 13.01637  -58.47380 1.000 62.42314  ? 67  LYS B N   1 
ATOM   7841 C  CA  . LYS H 4 67  ? 75.54227 11.88366  -59.09616 1.000 61.03526  ? 67  LYS B CA  1 
ATOM   7842 C  C   . LYS H 4 67  ? 74.52314 11.28769  -58.13209 1.000 58.89104  ? 67  LYS B C   1 
ATOM   7843 O  O   . LYS H 4 67  ? 74.50474 11.60190  -56.94110 1.000 61.93260  ? 67  LYS B O   1 
ATOM   7844 C  CB  . LYS H 4 67  ? 76.54556 10.81755  -59.55301 1.000 62.01429  ? 67  LYS B CB  1 
ATOM   7845 C  CG  . LYS H 4 67  ? 77.29477 10.16288  -58.41146 1.000 63.55274  ? 67  LYS B CG  1 
ATOM   7846 C  CD  . LYS H 4 67  ? 78.28303 9.11432   -58.89503 1.000 66.28029  ? 67  LYS B CD  1 
ATOM   7847 C  CE  . LYS H 4 67  ? 79.01059 8.47994   -57.72320 1.000 68.06348  ? 67  LYS B CE  1 
ATOM   7848 N  NZ  . LYS H 4 67  ? 80.17343 7.67623   -58.18144 1.000 72.26134  ? 67  LYS B NZ  1 
ATOM   7849 N  N   . ILE H 4 68  ? 73.63139 10.46921  -58.67766 1.000 56.30613  ? 68  ILE B N   1 
ATOM   7850 C  CA  . ILE H 4 68  ? 72.73406 9.63041   -57.89487 1.000 54.18070  ? 68  ILE B CA  1 
ATOM   7851 C  C   . ILE H 4 68  ? 73.19889 8.19026   -58.05597 1.000 56.80255  ? 68  ILE B C   1 
ATOM   7852 O  O   . ILE H 4 68  ? 73.44382 7.73226   -59.17759 1.000 55.49587  ? 68  ILE B O   1 
ATOM   7853 C  CB  . ILE H 4 68  ? 71.26653 9.79393   -58.32784 1.000 51.03292  ? 68  ILE B CB  1 
ATOM   7854 C  CG1 . ILE H 4 68  ? 70.63493 11.02732  -57.69255 1.000 50.30233  ? 68  ILE B CG1 1 
ATOM   7855 C  CG2 . ILE H 4 68  ? 70.42605 8.54651   -58.00595 1.000 47.25204  ? 68  ILE B CG2 1 
ATOM   7856 C  CD1 . ILE H 4 68  ? 69.16162 11.11336  -58.00803 1.000 49.99413  ? 68  ILE B CD1 1 
ATOM   7857 N  N   . LYS H 4 69  ? 73.34197 7.48427   -56.94065 1.000 60.81926  ? 69  LYS B N   1 
ATOM   7858 C  CA  . LYS H 4 69  ? 73.75475 6.08903   -56.95079 1.000 62.36311  ? 69  LYS B CA  1 
ATOM   7859 C  C   . LYS H 4 69  ? 72.54911 5.24162   -56.56654 1.000 57.27006  ? 69  LYS B C   1 
ATOM   7860 O  O   . LYS H 4 69  ? 71.92074 5.48525   -55.53095 1.000 59.53523  ? 69  LYS B O   1 
ATOM   7861 C  CB  . LYS H 4 69  ? 74.93354 5.85302   -55.99937 1.000 64.91117  ? 69  LYS B CB  1 
ATOM   7862 C  CG  . LYS H 4 69  ? 75.60819 4.51156   -56.22363 1.000 69.61036  ? 69  LYS B CG  1 
ATOM   7863 C  CD  . LYS H 4 69  ? 76.89013 4.34799   -55.42073 1.000 75.10946  ? 69  LYS B CD  1 
ATOM   7864 C  CE  . LYS H 4 69  ? 76.62339 4.08200   -53.96202 1.000 76.72651  ? 69  LYS B CE  1 
ATOM   7865 N  NZ  . LYS H 4 69  ? 77.83364 3.47181   -53.36109 1.000 77.50607  ? 69  LYS B NZ  1 
ATOM   7866 N  N   . VAL H 4 70  ? 72.20397 4.27692   -57.41501 1.000 52.27837  ? 70  VAL B N   1 
ATOM   7867 C  CA  . VAL H 4 70  ? 71.09218 3.36426   -57.16183 1.000 50.43145  ? 70  VAL B CA  1 
ATOM   7868 C  C   . VAL H 4 70  ? 71.70845 2.00729   -56.88103 1.000 53.77623  ? 70  VAL B C   1 
ATOM   7869 O  O   . VAL H 4 70  ? 72.23014 1.36907   -57.79826 1.000 59.73290  ? 70  VAL B O   1 
ATOM   7870 C  CB  . VAL H 4 70  ? 70.10898 3.28183   -58.34313 1.000 48.48085  ? 70  VAL B CB  1 
ATOM   7871 C  CG1 . VAL H 4 70  ? 68.92263 2.37729   -58.00998 1.000 42.29548  ? 70  VAL B CG1 1 
ATOM   7872 C  CG2 . VAL H 4 70  ? 69.62382 4.67373   -58.75928 1.000 50.43686  ? 70  VAL B CG2 1 
ATOM   7873 N  N   . THR H 4 71  ? 71.66549 1.56052   -55.62881 1.000 52.07009  ? 71  THR B N   1 
ATOM   7874 C  CA  . THR H 4 71  ? 72.21056 0.26440   -55.24451 1.000 51.48178  ? 71  THR B CA  1 
ATOM   7875 C  C   . THR H 4 71  ? 71.07999 -0.75046  -55.18420 1.000 51.93500  ? 71  THR B C   1 
ATOM   7876 O  O   . THR H 4 71  ? 70.05119 -0.48801  -54.55056 1.000 50.01209  ? 71  THR B O   1 
ATOM   7877 C  CB  . THR H 4 71  ? 72.90627 0.30320   -53.87644 1.000 49.81926  ? 71  THR B CB  1 
ATOM   7878 O  OG1 . THR H 4 71  ? 74.11062 1.08952   -53.93425 1.000 55.51572  ? 71  THR B OG1 1 
ATOM   7879 C  CG2 . THR H 4 71  ? 73.25811 -1.10916  -53.42898 1.000 44.10227  ? 71  THR B CG2 1 
ATOM   7880 N  N   . THR H 4 72  ? 71.25163 -1.89572  -55.85447 1.000 55.49341  ? 72  THR B N   1 
ATOM   7881 C  CA  . THR H 4 72  ? 70.31137 -3.00647  -55.71322 1.000 55.42784  ? 72  THR B CA  1 
ATOM   7882 C  C   . THR H 4 72  ? 70.91732 -4.08832  -54.81760 1.000 55.51861  ? 72  THR B C   1 
ATOM   7883 O  O   . THR H 4 72  ? 72.11362 -4.38734  -54.89824 1.000 54.54575  ? 72  THR B O   1 
ATOM   7884 C  CB  . THR H 4 72  ? 69.89432 -3.60972  -57.06980 1.000 55.35371  ? 72  THR B CB  1 
ATOM   7885 O  OG1 . THR H 4 72  ? 71.03440 -4.04477  -57.82129 1.000 59.53527  ? 72  THR B OG1 1 
ATOM   7886 C  CG2 . THR H 4 72  ? 69.11115 -2.60377  -57.87819 1.000 51.80499  ? 72  THR B CG2 1 
ATOM   7887 N  N   . TYR H 4 73  ? 70.09617 -4.64503  -53.93499 1.000 58.56320  ? 73  TYR B N   1 
ATOM   7888 C  CA  . TYR H 4 73  ? 70.53420 -5.67289  -53.00493 1.000 62.11337  ? 73  TYR B CA  1 
ATOM   7889 C  C   . TYR H 4 73  ? 69.81736 -6.98751  -53.29286 1.000 64.62025  ? 73  TYR B C   1 
ATOM   7890 O  O   . TYR H 4 73  ? 68.66726 -6.99528  -53.73948 1.000 66.30050  ? 73  TYR B O   1 
ATOM   7891 C  CB  . TYR H 4 73  ? 70.27940 -5.25151  -51.54117 1.000 62.30598  ? 73  TYR B CB  1 
ATOM   7892 C  CG  . TYR H 4 73  ? 71.16996 -4.12133  -51.04183 1.000 59.66326  ? 73  TYR B CG  1 
ATOM   7893 C  CD1 . TYR H 4 73  ? 72.52099 -4.33820  -50.82370 1.000 62.09499  ? 73  TYR B CD1 1 
ATOM   7894 C  CD2 . TYR H 4 73  ? 70.65717 -2.85725  -50.76278 1.000 55.22352  ? 73  TYR B CD2 1 
ATOM   7895 C  CE1 . TYR H 4 73  ? 73.34344 -3.33895  -50.36641 1.000 62.99352  ? 73  TYR B CE1 1 
ATOM   7896 C  CE2 . TYR H 4 73  ? 71.48361 -1.84087  -50.30021 1.000 56.96344  ? 73  TYR B CE2 1 
ATOM   7897 C  CZ  . TYR H 4 73  ? 72.83366 -2.09489  -50.10544 1.000 62.65057  ? 73  TYR B CZ  1 
ATOM   7898 O  OH  . TYR H 4 73  ? 73.71467 -1.13207  -49.64863 1.000 67.15080  ? 73  TYR B OH  1 
ATOM   7899 N  N   . TRP H 4 74  ? 70.50768 -8.10532  -53.03694 1.000 63.46890  ? 74  TRP B N   1 
ATOM   7900 C  CA  . TRP H 4 74  ? 69.92604 -9.43560  -53.17971 1.000 60.29371  ? 74  TRP B CA  1 
ATOM   7901 C  C   . TRP H 4 74  ? 70.29655 -10.26828 -51.96029 1.000 63.15563  ? 74  TRP B C   1 
ATOM   7902 O  O   . TRP H 4 74  ? 71.18187 -9.90300  -51.17793 1.000 61.38484  ? 74  TRP B O   1 
ATOM   7903 C  CB  . TRP H 4 74  ? 70.39566 -10.15198 -54.44939 1.000 57.61567  ? 74  TRP B CB  1 
ATOM   7904 C  CG  . TRP H 4 74  ? 71.73503 -10.84014 -54.29549 1.000 59.52054  ? 74  TRP B CG  1 
ATOM   7905 C  CD1 . TRP H 4 74  ? 72.95848 -10.23919 -54.20641 1.000 60.23394  ? 74  TRP B CD1 1 
ATOM   7906 C  CD2 . TRP H 4 74  ? 71.98421 -12.25824 -54.22959 1.000 59.39900  ? 74  TRP B CD2 1 
ATOM   7907 N  NE1 . TRP H 4 74  ? 73.94794 -11.18551 -54.08162 1.000 60.15044  ? 74  TRP B NE1 1 
ATOM   7908 C  CE2 . TRP H 4 74  ? 73.37810 -12.43139 -54.09311 1.000 58.62510  ? 74  TRP B CE2 1 
ATOM   7909 C  CE3 . TRP H 4 74  ? 71.16624 -13.39311 -54.26880 1.000 58.93549  ? 74  TRP B CE3 1 
ATOM   7910 C  CZ2 . TRP H 4 74  ? 73.96814 -13.68729 -53.99841 1.000 57.17772  ? 74  TRP B CZ2 1 
ATOM   7911 C  CZ3 . TRP H 4 74  ? 71.76058 -14.63815 -54.17120 1.000 59.42475  ? 74  TRP B CZ3 1 
ATOM   7912 C  CH2 . TRP H 4 74  ? 73.14608 -14.77533 -54.03512 1.000 57.05946  ? 74  TRP B CH2 1 
ATOM   7913 N  N   . ASN H 4 75  ? 69.64664 -11.43740 -51.85688 1.000 67.04945  ? 75  ASN B N   1 
ATOM   7914 C  CA  . ASN H 4 75  ? 69.87947 -12.42292 -50.79155 1.000 68.75176  ? 75  ASN B CA  1 
ATOM   7915 C  C   . ASN H 4 75  ? 69.55233 -11.86173 -49.40573 1.000 64.22595  ? 75  ASN B C   1 
ATOM   7916 O  O   . ASN H 4 75  ? 70.21382 -12.17023 -48.40885 1.000 61.45796  ? 75  ASN B O   1 
ATOM   7917 C  CB  . ASN H 4 75  ? 71.32035 -12.93844 -50.84539 1.000 75.39770  ? 75  ASN B CB  1 
ATOM   7918 C  CG  . ASN H 4 75  ? 71.50114 -14.25866 -50.13640 1.000 83.75728  ? 75  ASN B CG  1 
ATOM   7919 O  OD1 . ASN H 4 75  ? 70.58490 -15.07858 -50.04924 1.000 90.73004  ? 75  ASN B OD1 1 
ATOM   7920 N  ND2 . ASN H 4 75  ? 72.69627 -14.46448 -49.60142 1.000 87.80040  ? 75  ASN B ND2 1 
ATOM   7921 N  N   . LEU H 4 76  ? 68.49446 -11.06301 -49.33080 1.000 63.81708  ? 76  LEU B N   1 
ATOM   7922 C  CA  . LEU H 4 76  ? 68.09414 -10.51675 -48.04953 1.000 67.42777  ? 76  LEU B CA  1 
ATOM   7923 C  C   . LEU H 4 76  ? 67.27823 -11.55620 -47.28021 1.000 75.17765  ? 76  LEU B C   1 
ATOM   7924 O  O   . LEU H 4 76  ? 66.96937 -12.64043 -47.78139 1.000 79.24853  ? 76  LEU B O   1 
ATOM   7925 C  CB  . LEU H 4 76  ? 67.32966 -9.20991  -48.25053 1.000 65.09268  ? 76  LEU B CB  1 
ATOM   7926 C  CG  . LEU H 4 76  ? 68.15925 -8.03461  -48.78497 1.000 62.68192  ? 76  LEU B CG  1 
ATOM   7927 C  CD1 . LEU H 4 76  ? 67.24868 -6.87600  -49.08534 1.000 63.73723  ? 76  LEU B CD1 1 
ATOM   7928 C  CD2 . LEU H 4 76  ? 69.25265 -7.58598  -47.83770 1.000 60.10165  ? 76  LEU B CD2 1 
ATOM   7929 N  N   . THR H 4 77  ? 66.89768 -11.20450 -46.05458 1.000 76.51505  ? 77  THR B N   1 
ATOM   7930 C  CA  . THR H 4 77  ? 66.19887 -12.14186 -45.19342 1.000 77.98613  ? 77  THR B CA  1 
ATOM   7931 C  C   . THR H 4 77  ? 64.94444 -12.62953 -45.89028 1.000 78.93555  ? 77  THR B C   1 
ATOM   7932 O  O   . THR H 4 77  ? 64.17823 -11.83266 -46.43883 1.000 78.79997  ? 77  THR B O   1 
ATOM   7933 C  CB  . THR H 4 77  ? 65.86211 -11.48193 -43.85825 1.000 82.37996  ? 77  THR B CB  1 
ATOM   7934 O  OG1 . THR H 4 77  ? 66.99778 -10.73075 -43.39905 1.000 84.84539  ? 77  THR B OG1 1 
ATOM   7935 C  CG2 . THR H 4 77  ? 65.50996 -12.54539 -42.80499 1.000 83.82379  ? 77  THR B CG2 1 
ATOM   7936 N  N   . THR H 4 78  ? 64.79016 -13.95253 -45.93413 1.000 82.59630  ? 78  THR B N   1 
ATOM   7937 C  CA  . THR H 4 78  ? 63.66675 -14.58364 -46.61550 1.000 83.97029  ? 78  THR B CA  1 
ATOM   7938 C  C   . THR H 4 78  ? 62.37152 -14.30470 -45.86278 1.000 84.84065  ? 78  THR B C   1 
ATOM   7939 O  O   . THR H 4 78  ? 62.35796 -14.23198 -44.63106 1.000 82.89952  ? 78  THR B O   1 
ATOM   7940 C  CB  . THR H 4 78  ? 63.88790 -16.10155 -46.69154 1.000 85.00245  ? 78  THR B CB  1 
ATOM   7941 O  OG1 . THR H 4 78  ? 65.15573 -16.39750 -47.28543 1.000 84.83303  ? 78  THR B OG1 1 
ATOM   7942 C  CG2 . THR H 4 78  ? 62.78576 -16.77932 -47.49814 1.000 87.91396  ? 78  THR B CG2 1 
ATOM   7943 N  N   . GLU H 4 79  ? 61.27908 -14.14746 -46.60422 1.000 89.25083  ? 79  GLU B N   1 
ATOM   7944 C  CA  . GLU H 4 79  ? 59.97026 -14.00104 -45.98723 1.000 94.63891  ? 79  GLU B CA  1 
ATOM   7945 C  C   . GLU H 4 79  ? 59.09601 -15.24444 -46.13147 1.000 95.62789  ? 79  GLU B C   1 
ATOM   7946 O  O   . GLU H 4 79  ? 58.48480 -15.68338 -45.15665 1.000 93.94068  ? 79  GLU B O   1 
ATOM   7947 C  CB  . GLU H 4 79  ? 59.24359 -12.77993 -46.55705 1.000 101.60424 ? 79  GLU B CB  1 
ATOM   7948 C  CG  . GLU H 4 79  ? 59.62886 -11.48278 -45.86954 1.000 107.85647 ? 79  GLU B CG  1 
ATOM   7949 C  CD  . GLU H 4 79  ? 59.30111 -10.26528 -46.70807 1.000 116.76714 ? 79  GLU B CD  1 
ATOM   7950 O  OE1 . GLU H 4 79  ? 59.76306 -10.20700 -47.86757 1.000 125.03410 ? 79  GLU B OE1 1 
ATOM   7951 O  OE2 . GLU H 4 79  ? 58.57374 -9.37464  -46.21493 1.000 116.00045 ? 79  GLU B OE2 1 
ATOM   7952 N  N   . LYS H 4 80  ? 59.03197 -15.83786 -47.32492 1.000 96.75587  ? 80  LYS B N   1 
ATOM   7953 C  CA  . LYS H 4 80  ? 58.06137 -16.87098 -47.64789 1.000 97.77308  ? 80  LYS B CA  1 
ATOM   7954 C  C   . LYS H 4 80  ? 58.70919 -18.24792 -47.74544 1.000 97.50753  ? 80  LYS B C   1 
ATOM   7955 O  O   . LYS H 4 80  ? 58.50196 -19.09764 -46.87453 1.000 101.58287 ? 80  LYS B O   1 
ATOM   7956 C  CB  . LYS H 4 80  ? 57.33270 -16.50865 -48.94199 1.000 102.33289 ? 80  LYS B CB  1 
ATOM   7957 C  CG  . LYS H 4 80  ? 55.94128 -15.90351 -48.75307 1.000 106.84384 ? 80  LYS B CG  1 
ATOM   7958 C  CD  . LYS H 4 80  ? 54.92566 -16.96335 -48.31323 1.000 114.42830 ? 80  LYS B CD  1 
ATOM   7959 C  CE  . LYS H 4 80  ? 54.76251 -18.08222 -49.35062 1.000 117.45068 ? 80  LYS B CE  1 
ATOM   7960 N  NZ  . LYS H 4 80  ? 54.01560 -19.26134 -48.81345 1.000 119.52509 ? 80  LYS B NZ  1 
ATOM   7961 N  N   . GLY H 4 81  ? 59.47698 -18.50674 -48.79298 1.000 92.99989  ? 81  GLY B N   1 
ATOM   7962 C  CA  . GLY H 4 81  ? 60.03926 -19.81811 -49.02926 1.000 90.72216  ? 81  GLY B CA  1 
ATOM   7963 C  C   . GLY H 4 81  ? 61.45007 -19.98165 -48.49944 1.000 87.00520  ? 81  GLY B C   1 
ATOM   7964 O  O   . GLY H 4 81  ? 61.69157 -20.08960 -47.29630 1.000 87.58234  ? 81  GLY B O   1 
ATOM   7965 N  N   . TRP H 4 82  ? 62.38097 -20.05709 -49.44106 1.000 82.46611  ? 82  TRP B N   1 
ATOM   7966 C  CA  . TRP H 4 82  ? 63.79960 -20.19889 -49.15904 1.000 78.04984  ? 82  TRP B CA  1 
ATOM   7967 C  C   . TRP H 4 82  ? 64.61647 -19.21816 -49.99212 1.000 75.44750  ? 82  TRP B C   1 
ATOM   7968 O  O   . TRP H 4 82  ? 65.84632 -19.20958 -49.89370 1.000 73.93894  ? 82  TRP B O   1 
ATOM   7969 C  CB  . TRP H 4 82  ? 64.25069 -21.63369 -49.43319 1.000 76.30464  ? 82  TRP B CB  1 
ATOM   7970 C  CG  . TRP H 4 82  ? 63.95268 -22.00717 -50.84295 1.000 76.68861  ? 82  TRP B CG  1 
ATOM   7971 C  CD1 . TRP H 4 82  ? 62.77995 -22.50329 -51.31948 1.000 76.18252  ? 82  TRP B CD1 1 
ATOM   7972 C  CD2 . TRP H 4 82  ? 64.79976 -21.81601 -51.98170 1.000 79.14234  ? 82  TRP B CD2 1 
ATOM   7973 N  NE1 . TRP H 4 82  ? 62.85504 -22.67667 -52.67874 1.000 77.01411  ? 82  TRP B NE1 1 
ATOM   7974 C  CE2 . TRP H 4 82  ? 64.08546 -22.25827 -53.10971 1.000 78.78257  ? 82  TRP B CE2 1 
ATOM   7975 C  CE3 . TRP H 4 82  ? 66.09956 -21.32861 -52.15524 1.000 81.97526  ? 82  TRP B CE3 1 
ATOM   7976 C  CZ2 . TRP H 4 82  ? 64.62696 -22.23213 -54.39223 1.000 82.59041  ? 82  TRP B CZ2 1 
ATOM   7977 C  CZ3 . TRP H 4 82  ? 66.63621 -21.30490 -53.43346 1.000 83.43576  ? 82  TRP B CZ3 1 
ATOM   7978 C  CH2 . TRP H 4 82  ? 65.90016 -21.75285 -54.53258 1.000 83.82219  ? 82  TRP B CH2 1 
ATOM   7979 N  N   . LEU H 4 83  ? 63.96310 -18.36130 -50.77197 1.000 75.92752  ? 83  LEU B N   1 
ATOM   7980 C  CA  . LEU H 4 83  ? 64.65289 -17.63262 -51.82711 1.000 79.08285  ? 83  LEU B CA  1 
ATOM   7981 C  C   . LEU H 4 83  ? 65.36593 -16.38009 -51.31831 1.000 82.46807  ? 83  LEU B C   1 
ATOM   7982 O  O   . LEU H 4 83  ? 66.52563 -16.12693 -51.67407 1.000 84.55783  ? 83  LEU B O   1 
ATOM   7983 C  CB  . LEU H 4 83  ? 63.65095 -17.27397 -52.91956 1.000 77.49841  ? 83  LEU B CB  1 
ATOM   7984 C  CG  . LEU H 4 83  ? 63.24593 -18.36673 -53.91046 1.000 75.34959  ? 83  LEU B CG  1 
ATOM   7985 C  CD1 . LEU H 4 83  ? 61.95050 -17.94830 -54.56377 1.000 75.06450  ? 83  LEU B CD1 1 
ATOM   7986 C  CD2 . LEU H 4 83  ? 64.31059 -18.60914 -54.95404 1.000 75.13199  ? 83  LEU B CD2 1 
ATOM   7987 N  N   . GLY H 4 84  ? 64.69689 -15.57375 -50.52504 1.000 82.02280  ? 84  GLY B N   1 
ATOM   7988 C  CA  . GLY H 4 84  ? 65.36499 -14.36747 -50.08056 1.000 81.16884  ? 84  GLY B CA  1 
ATOM   7989 C  C   . GLY H 4 84  ? 64.86800 -13.13566 -50.81741 1.000 83.15218  ? 84  GLY B C   1 
ATOM   7990 O  O   . GLY H 4 84  ? 64.51267 -13.17732 -52.00220 1.000 85.12371  ? 84  GLY B O   1 
ATOM   7991 N  N   . THR H 4 85  ? 64.85210 -12.01743 -50.10783 1.000 81.50585  ? 85  THR B N   1 
ATOM   7992 C  CA  . THR H 4 85  ? 64.27365 -10.78423 -50.60715 1.000 78.43911  ? 85  THR B CA  1 
ATOM   7993 C  C   . THR H 4 85  ? 65.32465 -9.95612  -51.34252 1.000 73.75805  ? 85  THR B C   1 
ATOM   7994 O  O   . THR H 4 85  ? 66.53229 -10.08905 -51.12327 1.000 72.49611  ? 85  THR B O   1 
ATOM   7995 C  CB  . THR H 4 85  ? 63.67858 -9.97633  -49.44609 1.000 81.93382  ? 85  THR B CB  1 
ATOM   7996 O  OG1 . THR H 4 85  ? 62.84822 -10.82557 -48.64712 1.000 84.91844  ? 85  THR B OG1 1 
ATOM   7997 C  CG2 . THR H 4 85  ? 62.82207 -8.80420  -49.95395 1.000 83.08539  ? 85  THR B CG2 1 
ATOM   7998 N  N   . TYR H 4 86  ? 64.84341 -9.10497  -52.23838 1.000 68.60061  ? 86  TYR B N   1 
ATOM   7999 C  CA  . TYR H 4 86  ? 65.65860 -8.11969  -52.92337 1.000 61.91793  ? 86  TYR B CA  1 
ATOM   8000 C  C   . TYR H 4 86  ? 65.31094 -6.73886  -52.37236 1.000 56.70245  ? 86  TYR B C   1 
ATOM   8001 O  O   . TYR H 4 86  ? 64.32996 -6.57566  -51.64213 1.000 55.69216  ? 86  TYR B O   1 
ATOM   8002 C  CB  . TYR H 4 86  ? 65.44525 -8.20343  -54.43811 1.000 62.54515  ? 86  TYR B CB  1 
ATOM   8003 C  CG  . TYR H 4 86  ? 65.91566 -9.51780  -55.07392 1.000 66.31636  ? 86  TYR B CG  1 
ATOM   8004 C  CD1 . TYR H 4 86  ? 65.25829 -10.72860 -54.82705 1.000 64.67169  ? 86  TYR B CD1 1 
ATOM   8005 C  CD2 . TYR H 4 86  ? 66.98428 -9.53799  -55.96646 1.000 66.70167  ? 86  TYR B CD2 1 
ATOM   8006 C  CE1 . TYR H 4 86  ? 65.68524 -11.91648 -55.41590 1.000 65.85724  ? 86  TYR B CE1 1 
ATOM   8007 C  CE2 . TYR H 4 86  ? 67.40915 -10.72258 -56.57015 1.000 68.96739  ? 86  TYR B CE2 1 
ATOM   8008 C  CZ  . TYR H 4 86  ? 66.75599 -11.90789 -56.29252 1.000 65.99132  ? 86  TYR B CZ  1 
ATOM   8009 O  OH  . TYR H 4 86  ? 67.18465 -13.07549 -56.89657 1.000 62.41600  ? 86  TYR B OH  1 
ATOM   8010 N  N   . GLY H 4 87  ? 66.16705 -5.75746  -52.65126 1.000 51.78852  ? 87  GLY B N   1 
ATOM   8011 C  CA  . GLY H 4 87  ? 65.93770 -4.40822  -52.16666 1.000 47.86482  ? 87  GLY B CA  1 
ATOM   8012 C  C   . GLY H 4 87  ? 66.70955 -3.38856  -52.96991 1.000 47.94378  ? 87  GLY B C   1 
ATOM   8013 O  O   . GLY H 4 87  ? 67.64313 -3.73254  -53.70119 1.000 51.86720  ? 87  GLY B O   1 
ATOM   8014 N  N   . ALA H 4 88  ? 66.31645 -2.11716  -52.82967 1.000 43.94023  ? 88  ALA B N   1 
ATOM   8015 C  CA  . ALA H 4 88  ? 67.00777 -1.02391  -53.51257 1.000 43.89632  ? 88  ALA B CA  1 
ATOM   8016 C  C   . ALA H 4 88  ? 67.25503 0.11748   -52.53968 1.000 45.61700  ? 88  ALA B C   1 
ATOM   8017 O  O   . ALA H 4 88  ? 66.46419 0.35995   -51.62331 1.000 47.65522  ? 88  ALA B O   1 
ATOM   8018 C  CB  . ALA H 4 88  ? 66.22857 -0.47206  -54.72149 1.000 41.94395  ? 88  ALA B CB  1 
ATOM   8019 N  N   . ALA H 4 89  ? 68.35366 0.82634   -52.75521 1.000 44.24038  ? 89  ALA B N   1 
ATOM   8020 C  CA  . ALA H 4 89  ? 68.68365 1.95868   -51.91744 1.000 46.90683  ? 89  ALA B CA  1 
ATOM   8021 C  C   . ALA H 4 89  ? 69.18765 3.07491   -52.81671 1.000 52.21489  ? 89  ALA B C   1 
ATOM   8022 O  O   . ALA H 4 89  ? 70.06219 2.84046   -53.65514 1.000 56.58825  ? 89  ALA B O   1 
ATOM   8023 C  CB  . ALA H 4 89  ? 69.72507 1.56778   -50.86965 1.000 48.63469  ? 89  ALA B CB  1 
ATOM   8024 N  N   . LEU H 4 90  ? 68.65862 4.28609   -52.62223 1.000 50.68645  ? 90  LEU B N   1 
ATOM   8025 C  CA  . LEU H 4 90  ? 68.89047 5.42108   -53.51158 1.000 46.70751  ? 90  LEU B CA  1 
ATOM   8026 C  C   . LEU H 4 90  ? 69.68531 6.49426   -52.79178 1.000 44.43365  ? 90  LEU B C   1 
ATOM   8027 O  O   . LEU H 4 90  ? 69.30084 6.91637   -51.70047 1.000 47.38023  ? 90  LEU B O   1 
ATOM   8028 C  CB  . LEU H 4 90  ? 67.56572 6.02251   -53.97805 1.000 46.22024  ? 90  LEU B CB  1 
ATOM   8029 C  CG  . LEU H 4 90  ? 66.75970 5.30318   -55.04950 1.000 50.12722  ? 90  LEU B CG  1 
ATOM   8030 C  CD1 . LEU H 4 90  ? 66.56863 3.84096   -54.70417 1.000 51.43926  ? 90  LEU B CD1 1 
ATOM   8031 C  CD2 . LEU H 4 90  ? 65.40173 5.98681   -55.15821 1.000 51.21115  ? 90  LEU B CD2 1 
ATOM   8032 N  N   . ALA H 4 91  ? 70.73671 6.99968   -53.42567 1.000 43.38571  ? 91  ALA B N   1 
ATOM   8033 C  CA  . ALA H 4 91  ? 71.58867 7.98633   -52.77532 1.000 43.75890  ? 91  ALA B CA  1 
ATOM   8034 C  C   . ALA H 4 91  ? 71.87883 9.14249   -53.70681 1.000 45.54048  ? 91  ALA B C   1 
ATOM   8035 O  O   . ALA H 4 91  ? 71.86987 8.99715   -54.93143 1.000 45.35769  ? 91  ALA B O   1 
ATOM   8036 C  CB  . ALA H 4 91  ? 72.93021 7.43223   -52.30743 1.000 45.31427  ? 91  ALA B CB  1 
ATOM   8037 N  N   . TYR H 4 92  ? 72.13258 10.29308  -53.09134 1.000 49.10692  ? 92  TYR B N   1 
ATOM   8038 C  CA  . TYR H 4 92  ? 72.64413 11.47761  -53.76370 1.000 52.76122  ? 92  TYR B CA  1 
ATOM   8039 C  C   . TYR H 4 92  ? 74.04212 11.74719  -53.23139 1.000 54.46337  ? 92  TYR B C   1 
ATOM   8040 O  O   . TYR H 4 92  ? 74.23502 11.87837  -52.01732 1.000 58.41793  ? 92  TYR B O   1 
ATOM   8041 C  CB  . TYR H 4 92  ? 71.75537 12.69839  -53.51691 1.000 54.66501  ? 92  TYR B CB  1 
ATOM   8042 C  CG  . TYR H 4 92  ? 72.35268 13.99684  -54.02263 1.000 58.90099  ? 92  TYR B CG  1 
ATOM   8043 C  CD1 . TYR H 4 92  ? 73.22818 14.74893  -53.24194 1.000 60.33292  ? 92  TYR B CD1 1 
ATOM   8044 C  CD2 . TYR H 4 92  ? 72.00597 14.49393  -55.27051 1.000 61.98554  ? 92  TYR B CD2 1 
ATOM   8045 C  CE1 . TYR H 4 92  ? 73.75465 15.93151  -53.70005 1.000 64.13049  ? 92  TYR B CE1 1 
ATOM   8046 C  CE2 . TYR H 4 92  ? 72.52292 15.67735  -55.73380 1.000 62.39650  ? 92  TYR B CE2 1 
ATOM   8047 C  CZ  . TYR H 4 92  ? 73.39384 16.39292  -54.95071 1.000 65.76612  ? 92  TYR B CZ  1 
ATOM   8048 O  OH  . TYR H 4 92  ? 73.89860 17.57507  -55.44234 1.000 70.23906  ? 92  TYR B OH  1 
ATOM   8049 N  N   . ILE H 4 93  ? 75.00971 11.82264  -54.13253 1.000 53.94672  ? 93  ILE B N   1 
ATOM   8050 C  CA  . ILE H 4 93  ? 76.41713 11.92784  -53.78258 1.000 56.99238  ? 93  ILE B CA  1 
ATOM   8051 C  C   . ILE H 4 93  ? 76.94744 13.23609  -54.35878 1.000 62.80196  ? 93  ILE B C   1 
ATOM   8052 O  O   . ILE H 4 93  ? 76.86586 13.46014  -55.57496 1.000 63.71388  ? 93  ILE B O   1 
ATOM   8053 C  CB  . ILE H 4 93  ? 77.21289 10.72404  -54.30820 1.000 57.34198  ? 93  ILE B CB  1 
ATOM   8054 C  CG1 . ILE H 4 93  ? 76.73075 9.45545   -53.61771 1.000 58.96801  ? 93  ILE B CG1 1 
ATOM   8055 C  CG2 . ILE H 4 93  ? 78.68761 10.91144  -54.07419 1.000 59.32747  ? 93  ILE B CG2 1 
ATOM   8056 C  CD1 . ILE H 4 93  ? 77.62694 8.27667   -53.84205 1.000 63.14782  ? 93  ILE B CD1 1 
ATOM   8057 N  N   . ASP H 4 94  ? 77.46504 14.10815  -53.49248 1.000 61.29376  ? 94  ASP B N   1 
ATOM   8058 C  CA  . ASP H 4 94  ? 78.14840 15.33293  -53.90858 1.000 63.04888  ? 94  ASP B CA  1 
ATOM   8059 C  C   . ASP H 4 94  ? 79.63931 15.12702  -53.66225 1.000 64.58298  ? 94  ASP B C   1 
ATOM   8060 O  O   . ASP H 4 94  ? 80.06076 14.91465  -52.51839 1.000 64.62513  ? 94  ASP B O   1 
ATOM   8061 C  CB  . ASP H 4 94  ? 77.61194 16.55275  -53.15175 1.000 65.42449  ? 94  ASP B CB  1 
ATOM   8062 C  CG  . ASP H 4 94  ? 78.01011 17.90438  -53.78613 1.000 66.87687  ? 94  ASP B CG  1 
ATOM   8063 O  OD1 . ASP H 4 94  ? 79.11252 18.03609  -54.36606 1.000 67.09050  ? 94  ASP B OD1 1 
ATOM   8064 O  OD2 . ASP H 4 94  ? 77.19046 18.84945  -53.70003 1.000 66.20087  ? 94  ASP B OD2 1 
ATOM   8065 N  N   . GLN H 4 95  ? 80.43031 15.16189  -54.73849 1.000 68.30163  ? 95  GLN B N   1 
ATOM   8066 C  CA  . GLN H 4 95  ? 81.84740 14.84388  -54.66883 1.000 72.76706  ? 95  GLN B CA  1 
ATOM   8067 C  C   . GLN H 4 95  ? 82.75987 16.06840  -54.62479 1.000 77.81156  ? 95  GLN B C   1 
ATOM   8068 O  O   . GLN H 4 95  ? 83.98582 15.89751  -54.62925 1.000 81.11056  ? 95  GLN B O   1 
ATOM   8069 C  CB  . GLN H 4 95  ? 82.24013 13.95422  -55.85084 1.000 74.95246  ? 95  GLN B CB  1 
ATOM   8070 C  CG  . GLN H 4 95  ? 81.58347 12.57419  -55.82621 1.000 78.36893  ? 95  GLN B CG  1 
ATOM   8071 C  CD  . GLN H 4 95  ? 81.94126 11.72507  -57.04037 1.000 83.49665  ? 95  GLN B CD  1 
ATOM   8072 O  OE1 . GLN H 4 95  ? 82.94962 11.02045  -57.02898 1.000 86.71116  ? 95  GLN B OE1 1 
ATOM   8073 N  NE2 . GLN H 4 95  ? 81.14671 11.82565  -58.10798 1.000 84.46543  ? 95  GLN B NE2 1 
ATOM   8074 N  N   . LYS H 4 96  ? 82.22160 17.29355  -54.55841 1.000 78.80101  ? 96  LYS B N   1 
ATOM   8075 C  CA  . LYS H 4 96  ? 83.10111 18.46438  -54.53418 1.000 82.34024  ? 96  LYS B CA  1 
ATOM   8076 C  C   . LYS H 4 96  ? 83.82832 18.58539  -53.20075 1.000 90.17707  ? 96  LYS B C   1 
ATOM   8077 O  O   . LYS H 4 96  ? 85.00198 18.96741  -53.16699 1.000 97.58921  ? 96  LYS B O   1 
ATOM   8078 C  CB  . LYS H 4 96  ? 82.31548 19.74094  -54.78789 1.000 79.59198  ? 96  LYS B CB  1 
ATOM   8079 C  CG  . LYS H 4 96  ? 81.80229 19.94560  -56.16714 1.000 75.53908  ? 96  LYS B CG  1 
ATOM   8080 C  CD  . LYS H 4 96  ? 80.82691 21.09925  -56.12525 1.000 74.74900  ? 96  LYS B CD  1 
ATOM   8081 C  CE  . LYS H 4 96  ? 79.60565 20.72022  -56.89043 1.000 75.60121  ? 96  LYS B CE  1 
ATOM   8082 N  NZ  . LYS H 4 96  ? 80.11687 20.11333  -58.14063 1.000 79.13535  ? 96  LYS B NZ  1 
ATOM   8083 N  N   . CYS H 4 97  ? 83.16787 18.25736  -52.09299 1.000 89.95379  ? 97  CYS B N   1 
ATOM   8084 C  CA  . CYS H 4 97  ? 83.85946 18.27477  -50.81810 1.000 91.51952  ? 97  CYS B CA  1 
ATOM   8085 C  C   . CYS H 4 97  ? 84.59800 16.95084  -50.62508 1.000 97.77533  ? 97  CYS B C   1 
ATOM   8086 O  O   . CYS H 4 97  ? 84.19058 15.90877  -51.14438 1.000 97.69660  ? 97  CYS B O   1 
ATOM   8087 C  CB  . CYS H 4 97  ? 82.87060 18.52104  -49.68726 1.000 88.06756  ? 97  CYS B CB  1 
ATOM   8088 S  SG  . CYS H 4 97  ? 81.31061 17.69507  -50.00712 1.000 81.72290  ? 97  CYS B SG  1 
ATOM   8089 N  N   . ASP H 4 98  ? 85.71954 17.00453  -49.88919 1.000 102.15789 ? 98  ASP B N   1 
ATOM   8090 C  CA  . ASP H 4 98  ? 86.58909 15.84677  -49.96989 1.000 108.23406 ? 98  ASP B CA  1 
ATOM   8091 C  C   . ASP H 4 98  ? 86.13627 14.67291  -49.10547 1.000 114.34622 ? 98  ASP B C   1 
ATOM   8092 O  O   . ASP H 4 98  ? 86.36714 13.52731  -49.51097 1.000 124.58004 ? 98  ASP B O   1 
ATOM   8093 C  CB  . ASP H 4 98  ? 88.04717 16.16326  -49.66808 1.000 110.60286 ? 98  ASP B CB  1 
ATOM   8094 C  CG  . ASP H 4 98  ? 88.98897 15.20048  -50.38765 1.000 114.73275 ? 98  ASP B CG  1 
ATOM   8095 O  OD1 . ASP H 4 98  ? 88.51004 14.16512  -50.89784 1.000 110.51541 ? 98  ASP B OD1 1 
ATOM   8096 O  OD2 . ASP H 4 98  ? 90.20294 15.46432  -50.47087 1.000 121.23074 ? 98  ASP B OD2 1 
ATOM   8097 N  N   . PRO H 4 99  ? 85.50319 14.85842  -47.94351 1.000 106.75729 ? 99  PRO B N   1 
ATOM   8098 C  CA  . PRO H 4 99  ? 84.59907 13.80302  -47.48521 1.000 98.71819  ? 99  PRO B CA  1 
ATOM   8099 C  C   . PRO H 4 99  ? 83.31938 13.94849  -48.28231 1.000 92.09941  ? 99  PRO B C   1 
ATOM   8100 O  O   . PRO H 4 99  ? 82.50867 14.84229  -47.98335 1.000 99.20257  ? 99  PRO B O   1 
ATOM   8101 C  CB  . PRO H 4 99  ? 84.37956 14.09375  -45.99071 1.000 98.54640  ? 99  PRO B CB  1 
ATOM   8102 C  CG  . PRO H 4 99  ? 85.17367 15.33228  -45.67414 1.000 103.03337 ? 99  PRO B CG  1 
ATOM   8103 C  CD  . PRO H 4 99  ? 85.58847 15.97031  -46.97852 1.000 104.51880 ? 99  PRO B CD  1 
ATOM   8104 N  N   . PRO H 4 100 ? 83.11645 13.11517  -49.31024 1.000 78.60933  ? 100 PRO B N   1 
ATOM   8105 C  CA  . PRO H 4 100 ? 81.99973 13.33806  -50.21818 1.000 70.28716  ? 100 PRO B CA  1 
ATOM   8106 C  C   . PRO H 4 100 ? 80.69764 13.40892  -49.46849 1.000 64.58356  ? 100 PRO B C   1 
ATOM   8107 O  O   . PRO H 4 100 ? 80.45911 12.64579  -48.54155 1.000 66.50143  ? 100 PRO B O   1 
ATOM   8108 C  CB  . PRO H 4 100 ? 82.04424 12.11902  -51.13836 1.000 69.60566  ? 100 PRO B CB  1 
ATOM   8109 C  CG  . PRO H 4 100 ? 83.44649 11.64855  -51.06970 1.000 72.28678  ? 100 PRO B CG  1 
ATOM   8110 C  CD  . PRO H 4 100 ? 83.86283 11.90040  -49.66022 1.000 75.62485  ? 100 PRO B CD  1 
ATOM   8111 N  N   . TYR H 4 101 ? 79.83899 14.32841  -49.88655 1.000 60.65121  ? 101 TYR B N   1 
ATOM   8112 C  CA  . TYR H 4 101 ? 78.54262 14.44313  -49.25046 1.000 57.74755  ? 101 TYR B CA  1 
ATOM   8113 C  C   . TYR H 4 101 ? 77.62913 13.34451  -49.76080 1.000 56.23654  ? 101 TYR B C   1 
ATOM   8114 O  O   . TYR H 4 101 ? 77.41868 13.21990  -50.97153 1.000 56.93329  ? 101 TYR B O   1 
ATOM   8115 C  CB  . TYR H 4 101 ? 77.92957 15.79788  -49.53975 1.000 57.52760  ? 101 TYR B CB  1 
ATOM   8116 C  CG  . TYR H 4 101 ? 76.57263 16.01420  -48.93438 1.000 59.68743  ? 101 TYR B CG  1 
ATOM   8117 C  CD1 . TYR H 4 101 ? 76.40354 16.06371  -47.56810 1.000 63.10389  ? 101 TYR B CD1 1 
ATOM   8118 C  CD2 . TYR H 4 101 ? 75.46665 16.22154  -49.73813 1.000 60.40384  ? 101 TYR B CD2 1 
ATOM   8119 C  CE1 . TYR H 4 101 ? 75.17190 16.28797  -47.02013 1.000 66.25903  ? 101 TYR B CE1 1 
ATOM   8120 C  CE2 . TYR H 4 101 ? 74.23628 16.44990  -49.20379 1.000 61.81476  ? 101 TYR B CE2 1 
ATOM   8121 C  CZ  . TYR H 4 101 ? 74.09181 16.48099  -47.84288 1.000 66.58958  ? 101 TYR B CZ  1 
ATOM   8122 O  OH  . TYR H 4 101 ? 72.85523 16.70800  -47.29580 1.000 69.01861  ? 101 TYR B OH  1 
ATOM   8123 N  N   . PHE H 4 102 ? 77.06258 12.56915  -48.83894 1.000 55.09313  ? 102 PHE B N   1 
ATOM   8124 C  CA  . PHE H 4 102 ? 76.25753 11.39761  -49.16327 1.000 55.56467  ? 102 PHE B CA  1 
ATOM   8125 C  C   . PHE H 4 102 ? 74.91048 11.50213  -48.47181 1.000 59.94459  ? 102 PHE B C   1 
ATOM   8126 O  O   . PHE H 4 102 ? 74.85135 11.76948  -47.26812 1.000 65.17259  ? 102 PHE B O   1 
ATOM   8127 C  CB  . PHE H 4 102 ? 76.94505 10.11511  -48.70854 1.000 54.11289  ? 102 PHE B CB  1 
ATOM   8128 C  CG  . PHE H 4 102 ? 76.22867 8.86187   -49.12049 1.000 52.95573  ? 102 PHE B CG  1 
ATOM   8129 C  CD1 . PHE H 4 102 ? 75.12291 8.40488   -48.41578 1.000 49.60109  ? 102 PHE B CD1 1 
ATOM   8130 C  CD2 . PHE H 4 102 ? 76.70456 8.10217   -50.17750 1.000 54.53507  ? 102 PHE B CD2 1 
ATOM   8131 C  CE1 . PHE H 4 102 ? 74.47518 7.25017   -48.79315 1.000 49.60908  ? 102 PHE B CE1 1 
ATOM   8132 C  CE2 . PHE H 4 102 ? 76.06963 6.93818   -50.54951 1.000 52.94586  ? 102 PHE B CE2 1 
ATOM   8133 C  CZ  . PHE H 4 102 ? 74.95717 6.50829   -49.85197 1.000 51.26982  ? 102 PHE B CZ  1 
ATOM   8134 N  N   . THR H 4 103 ? 73.83485 11.23950  -49.21076 1.000 60.82087  ? 103 THR B N   1 
ATOM   8135 C  CA  . THR H 4 103 ? 72.50370 11.33970  -48.62959 1.000 64.02131  ? 103 THR B CA  1 
ATOM   8136 C  C   . THR H 4 103 ? 71.56915 10.32537  -49.26602 1.000 64.55672  ? 103 THR B C   1 
ATOM   8137 O  O   . THR H 4 103 ? 71.53596 10.19402  -50.49359 1.000 67.89153  ? 103 THR B O   1 
ATOM   8138 C  CB  . THR H 4 103 ? 71.95846 12.75184  -48.82405 1.000 72.31699  ? 103 THR B CB  1 
ATOM   8139 O  OG1 . THR H 4 103 ? 72.56642 13.61976  -47.85887 1.000 81.88114  ? 103 THR B OG1 1 
ATOM   8140 C  CG2 . THR H 4 103 ? 70.44958 12.78268  -48.66568 1.000 70.06353  ? 103 THR B CG2 1 
ATOM   8141 N  N   . ASP H 4 104 ? 70.78583 9.63767   -48.44068 1.000 60.00165  ? 104 ASP B N   1 
ATOM   8142 C  CA  . ASP H 4 104 ? 69.77986 8.73807   -48.97476 1.000 61.56375  ? 104 ASP B CA  1 
ATOM   8143 C  C   . ASP H 4 104 ? 68.55818 9.56439   -49.36728 1.000 61.96806  ? 104 ASP B C   1 
ATOM   8144 O  O   . ASP H 4 104 ? 68.20894 10.53253  -48.68753 1.000 66.10271  ? 104 ASP B O   1 
ATOM   8145 C  CB  . ASP H 4 104 ? 69.43460 7.64995   -47.95394 1.000 64.90839  ? 104 ASP B CB  1 
ATOM   8146 C  CG  . ASP H 4 104 ? 70.66510 6.80728   -47.54281 1.000 71.04133  ? 104 ASP B CG  1 
ATOM   8147 O  OD1 . ASP H 4 104 ? 71.36136 7.16575   -46.55766 1.000 74.40890  ? 104 ASP B OD1 1 
ATOM   8148 O  OD2 . ASP H 4 104 ? 70.94397 5.77838   -48.21011 1.000 72.37508  ? 104 ASP B OD2 1 
ATOM   8149 N  N   . ILE H 4 105 ? 67.96853 9.25552   -50.52582 1.000 60.19807  ? 105 ILE B N   1 
ATOM   8150 C  CA  . ILE H 4 105 ? 66.87483 10.06208  -51.06590 1.000 62.82708  ? 105 ILE B CA  1 
ATOM   8151 C  C   . ILE H 4 105 ? 65.69808 9.15584   -51.38027 1.000 64.52608  ? 105 ILE B C   1 
ATOM   8152 O  O   . ILE H 4 105 ? 65.88299 8.04555   -51.88996 1.000 66.93995  ? 105 ILE B O   1 
ATOM   8153 C  CB  . ILE H 4 105 ? 67.28172 10.84933  -52.33002 1.000 63.51252  ? 105 ILE B CB  1 
ATOM   8154 C  CG1 . ILE H 4 105 ? 67.84490 9.91789   -53.40272 1.000 64.44492  ? 105 ILE B CG1 1 
ATOM   8155 C  CG2 . ILE H 4 105 ? 68.29729 11.93220  -51.99052 1.000 64.71292  ? 105 ILE B CG2 1 
ATOM   8156 C  CD1 . ILE H 4 105 ? 68.28596 10.64879  -54.65857 1.000 64.96915  ? 105 ILE B CD1 1 
ATOM   8157 N  N   . ASP H 4 106 ? 64.48122 9.63595   -51.10335 1.000 63.37536  ? 106 ASP B N   1 
ATOM   8158 C  CA  . ASP H 4 106 ? 63.30242 8.84521   -51.43285 1.000 61.24178  ? 106 ASP B CA  1 
ATOM   8159 C  C   . ASP H 4 106 ? 63.05283 8.88082   -52.94581 1.000 58.90504  ? 106 ASP B C   1 
ATOM   8160 O  O   . ASP H 4 106 ? 63.55393 9.76758   -53.64744 1.000 60.33933  ? 106 ASP B O   1 
ATOM   8161 C  CB  . ASP H 4 106 ? 62.08888 9.32643   -50.63363 1.000 61.70904  ? 106 ASP B CB  1 
ATOM   8162 C  CG  . ASP H 4 106 ? 61.59864 10.69762  -51.04015 1.000 63.42222  ? 106 ASP B CG  1 
ATOM   8163 O  OD1 . ASP H 4 106 ? 61.06686 10.82966  -52.16600 1.000 63.10703  ? 106 ASP B OD1 1 
ATOM   8164 O  OD2 . ASP H 4 106 ? 61.67987 11.62818  -50.21024 1.000 64.15596  ? 106 ASP B OD2 1 
ATOM   8165 N  N   . PRO H 4 107 ? 62.30080 7.91265   -53.48099 1.000 60.12683  ? 107 PRO B N   1 
ATOM   8166 C  CA  . PRO H 4 107 ? 62.26431 7.76890   -54.94689 1.000 59.87925  ? 107 PRO B CA  1 
ATOM   8167 C  C   . PRO H 4 107 ? 61.62701 8.93978   -55.66820 1.000 55.90821  ? 107 PRO B C   1 
ATOM   8168 O  O   . PRO H 4 107 ? 62.07797 9.30373   -56.76198 1.000 51.93021  ? 107 PRO B O   1 
ATOM   8169 C  CB  . PRO H 4 107 ? 61.46993 6.47433   -55.15127 1.000 61.80633  ? 107 PRO B CB  1 
ATOM   8170 C  CG  . PRO H 4 107 ? 61.56578 5.76555   -53.86320 1.000 61.96201  ? 107 PRO B CG  1 
ATOM   8171 C  CD  . PRO H 4 107 ? 61.55065 6.83961   -52.82251 1.000 59.65990  ? 107 PRO B CD  1 
ATOM   8172 N  N   . ILE H 4 108 ? 60.57931 9.53712   -55.09870 1.000 56.17205  ? 108 ILE B N   1 
ATOM   8173 C  CA  . ILE H 4 108 ? 59.96502 10.67314  -55.77093 1.000 53.24239  ? 108 ILE B CA  1 
ATOM   8174 C  C   . ILE H 4 108 ? 60.94777 11.83967  -55.80986 1.000 54.31623  ? 108 ILE B C   1 
ATOM   8175 O  O   . ILE H 4 108 ? 60.89004 12.68069  -56.71354 1.000 56.95810  ? 108 ILE B O   1 
ATOM   8176 C  CB  . ILE H 4 108 ? 58.63257 11.04843  -55.09899 1.000 48.34004  ? 108 ILE B CB  1 
ATOM   8177 C  CG1 . ILE H 4 108 ? 57.64570 9.88509   -55.22048 1.000 51.76301  ? 108 ILE B CG1 1 
ATOM   8178 C  CG2 . ILE H 4 108 ? 58.02249 12.22978  -55.77745 1.000 42.65901  ? 108 ILE B CG2 1 
ATOM   8179 C  CD1 . ILE H 4 108 ? 56.30932 10.12205  -54.53685 1.000 54.06731  ? 108 ILE B CD1 1 
ATOM   8180 N  N   . VAL H 4 109 ? 61.87970 11.91215  -54.85854 1.000 55.28605  ? 109 VAL B N   1 
ATOM   8181 C  CA  . VAL H 4 109 ? 62.92856 12.92208  -54.96968 1.000 55.06467  ? 109 VAL B CA  1 
ATOM   8182 C  C   . VAL H 4 109 ? 63.88609 12.56699  -56.10246 1.000 54.67840  ? 109 VAL B C   1 
ATOM   8183 O  O   . VAL H 4 109 ? 64.26194 13.42588  -56.90588 1.000 54.83318  ? 109 VAL B O   1 
ATOM   8184 C  CB  . VAL H 4 109 ? 63.66106 13.12011  -53.62968 1.000 54.52023  ? 109 VAL B CB  1 
ATOM   8185 C  CG1 . VAL H 4 109 ? 64.94744 13.89005  -53.85049 1.000 54.08466  ? 109 VAL B CG1 1 
ATOM   8186 C  CG2 . VAL H 4 109 ? 62.77965 13.89566  -52.67769 1.000 53.35239  ? 109 VAL B CG2 1 
ATOM   8187 N  N   . ALA H 4 110 ? 64.29288 11.29669  -56.18297 1.000 54.84638  ? 110 ALA B N   1 
ATOM   8188 C  CA  . ALA H 4 110 ? 65.27577 10.88663  -57.18503 1.000 53.06110  ? 110 ALA B CA  1 
ATOM   8189 C  C   . ALA H 4 110 ? 64.76240 11.09411  -58.60956 1.000 53.73199  ? 110 ALA B C   1 
ATOM   8190 O  O   . ALA H 4 110 ? 65.50329 11.56760  -59.47748 1.000 53.29853  ? 110 ALA B O   1 
ATOM   8191 C  CB  . ALA H 4 110 ? 65.68112 9.43109   -56.95396 1.000 49.25673  ? 110 ALA B CB  1 
ATOM   8192 N  N   . ASP H 4 111 ? 63.50244 10.73778  -58.87539 1.000 54.95228  ? 111 ASP B N   1 
ATOM   8193 C  CA  . ASP H 4 111 ? 62.93281 10.99252  -60.19515 1.000 55.84152  ? 111 ASP B CA  1 
ATOM   8194 C  C   . ASP H 4 111 ? 62.94461 12.48704  -60.51830 1.000 56.43784  ? 111 ASP B C   1 
ATOM   8195 O  O   . ASP H 4 111 ? 63.35887 12.88832  -61.61321 1.000 56.27285  ? 111 ASP B O   1 
ATOM   8196 C  CB  . ASP H 4 111 ? 61.51651 10.42201  -60.27459 1.000 57.91326  ? 111 ASP B CB  1 
ATOM   8197 C  CG  . ASP H 4 111 ? 61.51022 8.90313   -60.43517 1.000 61.18531  ? 111 ASP B CG  1 
ATOM   8198 O  OD1 . ASP H 4 111 ? 62.53025 8.34762   -60.89161 1.000 62.45614  ? 111 ASP B OD1 1 
ATOM   8199 O  OD2 . ASP H 4 111 ? 60.48125 8.26707   -60.11127 1.000 65.96113  ? 111 ASP B OD2 1 
ATOM   8200 N  N   . SER H 4 112 ? 62.54734 13.33334  -59.55540 1.000 56.76544  ? 112 SER B N   1 
ATOM   8201 C  CA  . SER H 4 112 ? 62.50497 14.77655  -59.79642 1.000 52.40206  ? 112 SER B CA  1 
ATOM   8202 C  C   . SER H 4 112 ? 63.90268 15.33870  -60.00692 1.000 51.04657  ? 112 SER B C   1 
ATOM   8203 O  O   . SER H 4 112 ? 64.08873 16.25520  -60.81089 1.000 50.86898  ? 112 SER B O   1 
ATOM   8204 C  CB  . SER H 4 112 ? 61.79358 15.48951  -58.64569 1.000 52.25780  ? 112 SER B CB  1 
ATOM   8205 O  OG  . SER H 4 112 ? 61.78232 16.90218  -58.81012 1.000 52.48861  ? 112 SER B OG  1 
ATOM   8206 N  N   . LEU H 4 113 ? 64.90128 14.81288  -59.29280 1.000 53.33896  ? 113 LEU B N   1 
ATOM   8207 C  CA  . LEU H 4 113 ? 66.26592 15.26831  -59.53406 1.000 55.90113  ? 113 LEU B CA  1 
ATOM   8208 C  C   . LEU H 4 113 ? 66.75485 14.81715  -60.90458 1.000 63.00100  ? 113 LEU B C   1 
ATOM   8209 O  O   . LEU H 4 113 ? 67.41759 15.58245  -61.61253 1.000 67.20319  ? 113 LEU B O   1 
ATOM   8210 C  CB  . LEU H 4 113 ? 67.20818 14.75691  -58.44701 1.000 54.65057  ? 113 LEU B CB  1 
ATOM   8211 C  CG  . LEU H 4 113 ? 67.11774 15.49544  -57.11055 1.000 55.33094  ? 113 LEU B CG  1 
ATOM   8212 C  CD1 . LEU H 4 113 ? 68.12882 14.96918  -56.12334 1.000 55.28496  ? 113 LEU B CD1 1 
ATOM   8213 C  CD2 . LEU H 4 113 ? 67.31409 16.97746  -57.29652 1.000 56.29190  ? 113 LEU B CD2 1 
ATOM   8214 N  N   . ILE H 4 114 ? 66.41060 13.58730  -61.30644 1.000 63.49340  ? 114 ILE B N   1 
ATOM   8215 C  CA  . ILE H 4 114 ? 66.87832 13.05495  -62.58254 1.000 60.55408  ? 114 ILE B CA  1 
ATOM   8216 C  C   . ILE H 4 114 ? 66.27679 13.82447  -63.74188 1.000 60.47244  ? 114 ILE B C   1 
ATOM   8217 O  O   . ILE H 4 114 ? 66.98408 14.18664  -64.68572 1.000 65.72695  ? 114 ILE B O   1 
ATOM   8218 C  CB  . ILE H 4 114 ? 66.56681 11.55195  -62.67148 1.000 59.98859  ? 114 ILE B CB  1 
ATOM   8219 C  CG1 . ILE H 4 114 ? 67.43385 10.78748  -61.66448 1.000 57.13362  ? 114 ILE B CG1 1 
ATOM   8220 C  CG2 . ILE H 4 114 ? 66.78249 11.03391  -64.08634 1.000 63.32563  ? 114 ILE B CG2 1 
ATOM   8221 C  CD1 . ILE H 4 114 ? 67.17233 9.31970   -61.62465 1.000 54.74382  ? 114 ILE B CD1 1 
ATOM   8222 N  N   . HIS H 4 115 ? 64.98199 14.14778  -63.66188 1.000 57.73029  ? 115 HIS B N   1 
ATOM   8223 C  CA  . HIS H 4 115 ? 64.31774 14.87407  -64.73975 1.000 56.56609  ? 115 HIS B CA  1 
ATOM   8224 C  C   . HIS H 4 115 ? 64.85362 16.30152  -64.90576 1.000 58.66390  ? 115 HIS B C   1 
ATOM   8225 O  O   . HIS H 4 115 ? 64.51667 16.96751  -65.89019 1.000 61.44375  ? 115 HIS B O   1 
ATOM   8226 C  CB  . HIS H 4 115 ? 62.81232 14.89230  -64.51103 1.000 55.14692  ? 115 HIS B CB  1 
ATOM   8227 C  CG  . HIS H 4 115 ? 62.04514 15.38780  -65.68570 1.000 62.04226  ? 115 HIS B CG  1 
ATOM   8228 N  ND1 . HIS H 4 115 ? 62.30825 14.97071  -66.97485 1.000 65.27621  ? 115 HIS B ND1 1 
ATOM   8229 C  CD2 . HIS H 4 115 ? 61.06253 16.31528  -65.78021 1.000 71.75188  ? 115 HIS B CD2 1 
ATOM   8230 C  CE1 . HIS H 4 115 ? 61.49600 15.59740  -67.81092 1.000 72.99876  ? 115 HIS B CE1 1 
ATOM   8231 N  NE2 . HIS H 4 115 ? 60.73342 16.42248  -67.11226 1.000 79.78444  ? 115 HIS B NE2 1 
ATOM   8232 N  N   . LYS H 4 116 ? 65.63032 16.81935  -63.94818 1.000 57.50043  ? 116 LYS B N   1 
ATOM   8233 C  CA  . LYS H 4 116 ? 66.26388 18.11873  -64.16815 1.000 59.14287  ? 116 LYS B CA  1 
ATOM   8234 C  C   . LYS H 4 116 ? 67.25888 18.05591  -65.31428 1.000 61.32160  ? 116 LYS B C   1 
ATOM   8235 O  O   . LYS H 4 116 ? 67.48957 19.05860  -65.99578 1.000 63.41388  ? 116 LYS B O   1 
ATOM   8236 C  CB  . LYS H 4 116 ? 66.95236 18.61489  -62.89457 1.000 59.59687  ? 116 LYS B CB  1 
ATOM   8237 C  CG  . LYS H 4 116 ? 65.99375 18.70750  -61.72031 1.000 59.78371  ? 116 LYS B CG  1 
ATOM   8238 C  CD  . LYS H 4 116 ? 64.95326 19.80878  -61.88787 1.000 59.40760  ? 116 LYS B CD  1 
ATOM   8239 C  CE  . LYS H 4 116 ? 63.69666 19.53608  -61.05151 1.000 59.81969  ? 116 LYS B CE  1 
ATOM   8240 N  NZ  . LYS H 4 116 ? 62.75385 18.59979  -61.76389 1.000 61.49421  ? 116 LYS B NZ  1 
ATOM   8241 N  N   . ILE H 4 117 ? 67.86142 16.89792  -65.54214 1.000 63.76207  ? 117 ILE B N   1 
ATOM   8242 C  CA  . ILE H 4 117 ? 68.95686 16.81497  -66.49447 1.000 66.98791  ? 117 ILE B CA  1 
ATOM   8243 C  C   . ILE H 4 117 ? 68.62057 15.89364  -67.66134 1.000 72.33262  ? 117 ILE B C   1 
ATOM   8244 O  O   . ILE H 4 117 ? 69.08516 16.11374  -68.78613 1.000 76.21870  ? 117 ILE B O   1 
ATOM   8245 C  CB  . ILE H 4 117 ? 70.24266 16.35068  -65.78916 1.000 65.97595  ? 117 ILE B CB  1 
ATOM   8246 C  CG1 . ILE H 4 117 ? 70.58789 17.30048  -64.64439 1.000 70.82305  ? 117 ILE B CG1 1 
ATOM   8247 C  CG2 . ILE H 4 117 ? 71.38044 16.23082  -66.77145 1.000 61.02041  ? 117 ILE B CG2 1 
ATOM   8248 C  CD1 . ILE H 4 117 ? 70.99515 18.66996  -65.11766 1.000 80.47775  ? 117 ILE B CD1 1 
ATOM   8249 N  N   . TYR H 4 118 ? 67.79083 14.87622  -67.43796 1.000 72.20202  ? 118 TYR B N   1 
ATOM   8250 C  CA  . TYR H 4 118 ? 67.78910 13.80616  -68.42363 1.000 75.18943  ? 118 TYR B CA  1 
ATOM   8251 C  C   . TYR H 4 118 ? 66.61557 13.76914  -69.39651 1.000 81.68040  ? 118 TYR B C   1 
ATOM   8252 O  O   . TYR H 4 118 ? 66.82822 13.95160  -70.60244 1.000 94.05754  ? 118 TYR B O   1 
ATOM   8253 C  CB  . TYR H 4 118 ? 67.95634 12.46204  -67.72250 1.000 71.24182  ? 118 TYR B CB  1 
ATOM   8254 C  CG  . TYR H 4 118 ? 69.39788 12.26938  -67.36563 1.000 67.30367  ? 118 TYR B CG  1 
ATOM   8255 C  CD1 . TYR H 4 118 ? 70.31355 11.89721  -68.33097 1.000 66.48256  ? 118 TYR B CD1 1 
ATOM   8256 C  CD2 . TYR H 4 118 ? 69.85046 12.50690  -66.08218 1.000 67.08810  ? 118 TYR B CD2 1 
ATOM   8257 C  CE1 . TYR H 4 118 ? 71.63016 11.73975  -68.02693 1.000 65.02789  ? 118 TYR B CE1 1 
ATOM   8258 C  CE2 . TYR H 4 118 ? 71.16795 12.34600  -65.77146 1.000 67.69523  ? 118 TYR B CE2 1 
ATOM   8259 C  CZ  . TYR H 4 118 ? 72.05319 11.96441  -66.75119 1.000 64.75427  ? 118 TYR B CZ  1 
ATOM   8260 O  OH  . TYR H 4 118 ? 73.37945 11.80256  -66.46891 1.000 67.93599  ? 118 TYR B OH  1 
ATOM   8261 N  N   . PHE H 4 119 ? 65.41135 13.50292  -68.94014 1.000 73.15016  ? 119 PHE B N   1 
ATOM   8262 C  CA  . PHE H 4 119 ? 64.42603 13.19598  -69.97987 1.000 70.07564  ? 119 PHE B CA  1 
ATOM   8263 C  C   . PHE H 4 119 ? 63.76295 14.45457  -70.53994 1.000 71.82076  ? 119 PHE B C   1 
ATOM   8264 O  O   . PHE H 4 119 ? 63.85962 15.53769  -69.95196 1.000 76.77919  ? 119 PHE B O   1 
ATOM   8265 C  CB  . PHE H 4 119 ? 63.40942 12.21059  -69.42119 1.000 67.65286  ? 119 PHE B CB  1 
ATOM   8266 C  CG  . PHE H 4 119 ? 64.04963 10.93484  -68.96034 1.000 62.97114  ? 119 PHE B CG  1 
ATOM   8267 C  CD1 . PHE H 4 119 ? 64.93480 10.27093  -69.78898 1.000 61.29095  ? 119 PHE B CD1 1 
ATOM   8268 C  CD2 . PHE H 4 119 ? 63.85273 10.46301  -67.67787 1.000 56.10940  ? 119 PHE B CD2 1 
ATOM   8269 C  CE1 . PHE H 4 119 ? 65.55392 9.12165   -69.37695 1.000 58.14566  ? 119 PHE B CE1 1 
ATOM   8270 C  CE2 . PHE H 4 119 ? 64.47643 9.32548   -67.26078 1.000 55.16429  ? 119 PHE B CE2 1 
ATOM   8271 C  CZ  . PHE H 4 119 ? 65.32733 8.64847   -68.10517 1.000 55.82705  ? 119 PHE B CZ  1 
ATOM   8272 N  N   . PRO H 4 120 ? 63.11213 14.35969  -71.70147 1.000 69.45916  ? 120 PRO B N   1 
ATOM   8273 C  CA  . PRO H 4 120 ? 62.60189 15.56828  -72.35867 1.000 66.55504  ? 120 PRO B CA  1 
ATOM   8274 C  C   . PRO H 4 120 ? 61.36789 16.09926  -71.65698 1.000 61.45373  ? 120 PRO B C   1 
ATOM   8275 O  O   . PRO H 4 120 ? 60.50755 15.33648  -71.20460 1.000 60.37614  ? 120 PRO B O   1 
ATOM   8276 C  CB  . PRO H 4 120 ? 62.25710 15.08643  -73.77575 1.000 67.09382  ? 120 PRO B CB  1 
ATOM   8277 C  CG  . PRO H 4 120 ? 61.89535 13.67135  -73.57985 1.000 69.56125  ? 120 PRO B CG  1 
ATOM   8278 C  CD  . PRO H 4 120 ? 62.79098 13.15377  -72.48317 1.000 70.84866  ? 120 PRO B CD  1 
ATOM   8279 N  N   . CYS H 4 121 ? 61.29928 17.42481  -71.58536 1.000 58.28478  ? 121 CYS B N   1 
ATOM   8280 C  CA  . CYS H 4 121 ? 60.22483 18.16840  -70.94723 1.000 54.53283  ? 121 CYS B CA  1 
ATOM   8281 C  C   . CYS H 4 121 ? 59.66023 19.18464  -71.94336 1.000 58.23746  ? 121 CYS B C   1 
ATOM   8282 O  O   . CYS H 4 121 ? 60.08890 19.25540  -73.09394 1.000 60.48043  ? 121 CYS B O   1 
ATOM   8283 C  CB  . CYS H 4 121 ? 60.76767 18.83085  -69.67078 1.000 49.84982  ? 121 CYS B CB  1 
ATOM   8284 S  SG  . CYS H 4 121 ? 59.53245 19.16063  -68.41458 1.000 48.34415  ? 121 CYS B SG  1 
ATOM   8285 N  N   . PHE H 4 122 ? 58.73724 20.02129  -71.47972 1.000 60.33314  ? 122 PHE B N   1 
ATOM   8286 C  CA  . PHE H 4 122 ? 58.23865 21.10752  -72.31563 1.000 57.42388  ? 122 PHE B CA  1 
ATOM   8287 C  C   . PHE H 4 122 ? 59.35722 22.09448  -72.64786 1.000 63.20910  ? 122 PHE B C   1 
ATOM   8288 O  O   . PHE H 4 122 ? 60.22078 22.38564  -71.81651 1.000 62.22724  ? 122 PHE B O   1 
ATOM   8289 C  CB  . PHE H 4 122 ? 57.09451 21.82568  -71.60644 1.000 51.91131  ? 122 PHE B CB  1 
ATOM   8290 C  CG  . PHE H 4 122 ? 55.87175 20.98724  -71.43737 1.000 47.58891  ? 122 PHE B CG  1 
ATOM   8291 C  CD1 . PHE H 4 122 ? 55.07228 20.69350  -72.52661 1.000 46.68971  ? 122 PHE B CD1 1 
ATOM   8292 C  CD2 . PHE H 4 122 ? 55.50883 20.50118  -70.19455 1.000 49.50735  ? 122 PHE B CD2 1 
ATOM   8293 C  CE1 . PHE H 4 122 ? 53.94261 19.92188  -72.39183 1.000 48.32913  ? 122 PHE B CE1 1 
ATOM   8294 C  CE2 . PHE H 4 122 ? 54.37399 19.72637  -70.04533 1.000 51.38922  ? 122 PHE B CE2 1 
ATOM   8295 C  CZ  . PHE H 4 122 ? 53.59015 19.43582  -71.14639 1.000 52.97040  ? 122 PHE B CZ  1 
ATOM   8296 N  N   . THR H 4 123 ? 59.35844 22.59313  -73.88279 1.000 68.25095  ? 123 THR B N   1 
ATOM   8297 C  CA  . THR H 4 123 ? 60.46486 23.41163  -74.35322 1.000 76.23138  ? 123 THR B CA  1 
ATOM   8298 C  C   . THR H 4 123 ? 60.27178 24.88733  -74.02641 1.000 79.55246  ? 123 THR B C   1 
ATOM   8299 O  O   . THR H 4 123 ? 59.31056 25.30193  -73.37551 1.000 78.67418  ? 123 THR B O   1 
ATOM   8300 C  CB  . THR H 4 123 ? 60.65739 23.25525  -75.85064 1.000 84.16169  ? 123 THR B CB  1 
ATOM   8301 O  OG1 . THR H 4 123 ? 59.38158 23.37275  -76.48915 1.000 87.81459  ? 123 THR B OG1 1 
ATOM   8302 C  CG2 . THR H 4 123 ? 61.27901 21.90147  -76.15681 1.000 86.88255  ? 123 THR B CG2 1 
ATOM   8303 N  N   . ASP H 4 124 ? 61.21992 25.68897  -74.50986 1.000 84.56949  ? 124 ASP B N   1 
ATOM   8304 C  CA  . ASP H 4 124 ? 61.14471 27.13631  -74.36588 1.000 88.78238  ? 124 ASP B CA  1 
ATOM   8305 C  C   . ASP H 4 124 ? 59.84124 27.68735  -74.94928 1.000 85.88796  ? 124 ASP B C   1 
ATOM   8306 O  O   . ASP H 4 124 ? 59.13042 28.45921  -74.29605 1.000 83.13796  ? 124 ASP B O   1 
ATOM   8307 C  CB  . ASP H 4 124 ? 62.35473 27.75679  -75.06040 1.000 97.11148  ? 124 ASP B CB  1 
ATOM   8308 C  CG  . ASP H 4 124 ? 62.59130 29.17962  -74.65404 1.000 106.29886 ? 124 ASP B CG  1 
ATOM   8309 O  OD1 . ASP H 4 124 ? 61.63623 29.84369  -74.19414 1.000 110.36148 ? 124 ASP B OD1 1 
ATOM   8310 O  OD2 . ASP H 4 124 ? 63.73933 29.63996  -74.81784 1.000 110.41208 ? 124 ASP B OD2 1 
ATOM   8311 N  N   . LYS H 4 125 ? 59.51002 27.29741  -76.18283 1.000 86.55289  ? 125 LYS B N   1 
ATOM   8312 C  CA  . LYS H 4 125 ? 58.33523 27.79996  -76.88297 1.000 84.49952  ? 125 LYS B CA  1 
ATOM   8313 C  C   . LYS H 4 125 ? 57.08276 26.96324  -76.63001 1.000 79.74088  ? 125 LYS B C   1 
ATOM   8314 O  O   . LYS H 4 125 ? 56.08592 27.14257  -77.33708 1.000 78.98176  ? 125 LYS B O   1 
ATOM   8315 C  CB  . LYS H 4 125 ? 58.60742 27.86757  -78.39188 1.000 87.22816  ? 125 LYS B CB  1 
ATOM   8316 C  CG  . LYS H 4 125 ? 59.91355 28.53904  -78.80157 1.000 91.38324  ? 125 LYS B CG  1 
ATOM   8317 C  CD  . LYS H 4 125 ? 59.84045 30.04687  -78.61243 1.000 97.59659  ? 125 LYS B CD  1 
ATOM   8318 C  CE  . LYS H 4 125 ? 61.08726 30.74033  -79.14662 1.000 104.07651 ? 125 LYS B CE  1 
ATOM   8319 N  NZ  . LYS H 4 125 ? 60.97053 32.22669  -79.09246 1.000 109.13659 ? 125 LYS B NZ  1 
ATOM   8320 N  N   . ALA H 4 126 ? 57.09196 26.09284  -75.61556 1.000 78.08871  ? 126 ALA B N   1 
ATOM   8321 C  CA  . ALA H 4 126 ? 55.98266 25.16012  -75.41649 1.000 75.97332  ? 126 ALA B CA  1 
ATOM   8322 C  C   . ALA H 4 126 ? 54.66609 25.88736  -75.19403 1.000 77.67339  ? 126 ALA B C   1 
ATOM   8323 O  O   . ALA H 4 126 ? 53.62828 25.48049  -75.72687 1.000 77.18003  ? 126 ALA B O   1 
ATOM   8324 C  CB  . ALA H 4 126 ? 56.27244 24.23943  -74.23301 1.000 74.79482  ? 126 ALA B CB  1 
ATOM   8325 N  N   . ILE H 4 127 ? 54.67916 26.94713  -74.38153 1.000 80.46132  ? 127 ILE B N   1 
ATOM   8326 C  CA  . ILE H 4 127 ? 53.43536 27.64666  -74.07460 1.000 81.47079  ? 127 ILE B CA  1 
ATOM   8327 C  C   . ILE H 4 127 ? 52.92511 28.40037  -75.29474 1.000 87.07698  ? 127 ILE B C   1 
ATOM   8328 O  O   . ILE H 4 127 ? 51.72287 28.38583  -75.59522 1.000 87.74447  ? 127 ILE B O   1 
ATOM   8329 C  CB  . ILE H 4 127 ? 53.62171 28.58830  -72.87474 1.000 77.52013  ? 127 ILE B CB  1 
ATOM   8330 C  CG1 . ILE H 4 127 ? 54.14249 27.81170  -71.66683 1.000 75.09931  ? 127 ILE B CG1 1 
ATOM   8331 C  CG2 . ILE H 4 127 ? 52.30417 29.26379  -72.55184 1.000 76.02989  ? 127 ILE B CG2 1 
ATOM   8332 C  CD1 . ILE H 4 127 ? 54.29703 28.63715  -70.40495 1.000 72.96925  ? 127 ILE B CD1 1 
ATOM   8333 N  N   . ARG H 4 128 ? 53.82249 29.07903  -76.01175 1.000 91.19175  ? 128 ARG B N   1 
ATOM   8334 C  CA  . ARG H 4 128 ? 53.40297 29.82019  -77.19448 1.000 93.71688  ? 128 ARG B CA  1 
ATOM   8335 C  C   . ARG H 4 128 ? 52.82882 28.87801  -78.24212 1.000 90.52721  ? 128 ARG B C   1 
ATOM   8336 O  O   . ARG H 4 128 ? 51.75810 29.13266  -78.80555 1.000 93.36156  ? 128 ARG B O   1 
ATOM   8337 C  CB  . ARG H 4 128 ? 54.58052 30.60814  -77.76880 1.000 101.92773 ? 128 ARG B CB  1 
ATOM   8338 C  CG  . ARG H 4 128 ? 54.25403 31.29868  -79.08255 1.000 112.72861 ? 128 ARG B CG  1 
ATOM   8339 C  CD  . ARG H 4 128 ? 55.29949 32.34073  -79.43052 1.000 120.50600 ? 128 ARG B CD  1 
ATOM   8340 N  NE  . ARG H 4 128 ? 56.53675 31.77281  -79.95773 1.000 124.25041 ? 128 ARG B NE  1 
ATOM   8341 C  CZ  . ARG H 4 128 ? 56.85739 31.76489  -81.24788 1.000 127.11925 ? 128 ARG B CZ  1 
ATOM   8342 N  NH1 . ARG H 4 128 ? 58.00591 31.23231  -81.64295 1.000 128.21250 ? 128 ARG B NH1 1 
ATOM   8343 N  NH2 . ARG H 4 128 ? 56.03531 32.30423  -82.14249 1.000 127.82150 ? 128 ARG B NH2 1 
ATOM   8344 N  N   . GLN H 4 129 ? 53.51607 27.75951  -78.48977 1.000 82.96391  ? 129 GLN B N   1 
ATOM   8345 C  CA  . GLN H 4 129 ? 53.06677 26.83621  -79.52115 1.000 73.99511  ? 129 GLN B CA  1 
ATOM   8346 C  C   . GLN H 4 129 ? 51.71297 26.24511  -79.17444 1.000 72.78705  ? 129 GLN B C   1 
ATOM   8347 O  O   . GLN H 4 129 ? 50.86174 26.07161  -80.05245 1.000 73.82773  ? 129 GLN B O   1 
ATOM   8348 C  CB  . GLN H 4 129 ? 54.09019 25.72392  -79.70915 1.000 69.63494  ? 129 GLN B CB  1 
ATOM   8349 C  CG  . GLN H 4 129 ? 55.43351 26.19438  -80.15884 1.000 66.55019  ? 129 GLN B CG  1 
ATOM   8350 C  CD  . GLN H 4 129 ? 56.52941 25.24137  -79.74942 1.000 68.21446  ? 129 GLN B CD  1 
ATOM   8351 O  OE1 . GLN H 4 129 ? 56.33547 24.39232  -78.87381 1.000 69.43940  ? 129 GLN B OE1 1 
ATOM   8352 N  NE2 . GLN H 4 129 ? 57.69837 25.38258  -80.36429 1.000 67.39683  ? 129 GLN B NE2 1 
ATOM   8353 N  N   . ALA H 4 130 ? 51.48673 25.93506  -77.89996 1.000 71.20797  ? 130 ALA B N   1 
ATOM   8354 C  CA  . ALA H 4 130 ? 50.22612 25.29893  -77.54097 1.000 71.91960  ? 130 ALA B CA  1 
ATOM   8355 C  C   . ALA H 4 130 ? 49.04887 26.24326  -77.75573 1.000 72.58033  ? 130 ALA B C   1 
ATOM   8356 O  O   . ALA H 4 130 ? 47.97678 25.81450  -78.19744 1.000 72.16972  ? 130 ALA B O   1 
ATOM   8357 C  CB  . ALA H 4 130 ? 50.27787 24.81200  -76.09081 1.000 68.54768  ? 130 ALA B CB  1 
ATOM   8358 N  N   . ILE H 4 131 ? 49.23869 27.53367  -77.46756 1.000 74.39365  ? 131 ILE B N   1 
ATOM   8359 C  CA  . ILE H 4 131 ? 48.14050 28.49728  -77.52297 1.000 76.58082  ? 131 ILE B CA  1 
ATOM   8360 C  C   . ILE H 4 131 ? 47.77674 28.86807  -78.96300 1.000 83.21174  ? 131 ILE B C   1 
ATOM   8361 O  O   . ILE H 4 131 ? 46.59477 29.02695  -79.29379 1.000 87.65905  ? 131 ILE B O   1 
ATOM   8362 C  CB  . ILE H 4 131 ? 48.48700 29.74682  -76.68938 1.000 73.12962  ? 131 ILE B CB  1 
ATOM   8363 C  CG1 . ILE H 4 131 ? 48.54709 29.40942  -75.19438 1.000 70.09771  ? 131 ILE B CG1 1 
ATOM   8364 C  CG2 . ILE H 4 131 ? 47.48263 30.84566  -76.94559 1.000 72.00172  ? 131 ILE B CG2 1 
ATOM   8365 C  CD1 . ILE H 4 131 ? 48.74123 30.62530  -74.26269 1.000 66.91368  ? 131 ILE B CD1 1 
ATOM   8366 N  N   . LEU H 4 132 ? 48.77148 29.03203  -79.83727 1.000 82.74213  ? 132 LEU B N   1 
ATOM   8367 C  CA  . LEU H 4 132 ? 48.52306 29.52423  -81.18789 1.000 80.74053  ? 132 LEU B CA  1 
ATOM   8368 C  C   . LEU H 4 132 ? 48.13756 28.43311  -82.17505 1.000 80.34457  ? 132 LEU B C   1 
ATOM   8369 O  O   . LEU H 4 132 ? 47.72344 28.75801  -83.29221 1.000 82.39478  ? 132 LEU B O   1 
ATOM   8370 C  CB  . LEU H 4 132 ? 49.74880 30.26674  -81.71821 1.000 80.12684  ? 132 LEU B CB  1 
ATOM   8371 C  CG  . LEU H 4 132 ? 50.18285 31.47137  -80.88765 1.000 77.76482  ? 132 LEU B CG  1 
ATOM   8372 C  CD1 . LEU H 4 132 ? 51.41759 32.13292  -81.48351 1.000 77.94460  ? 132 LEU B CD1 1 
ATOM   8373 C  CD2 . LEU H 4 132 ? 49.03230 32.44471  -80.78170 1.000 75.64199  ? 132 LEU B CD2 1 
ATOM   8374 N  N   . GLY H 4 133 ? 48.30080 27.16513  -81.82026 1.000 77.75013  ? 133 GLY B N   1 
ATOM   8375 C  CA  . GLY H 4 133 ? 47.95161 26.06929  -82.69694 1.000 78.87488  ? 133 GLY B CA  1 
ATOM   8376 C  C   . GLY H 4 133 ? 49.10940 25.31105  -83.31917 1.000 78.62556  ? 133 GLY B C   1 
ATOM   8377 O  O   . GLY H 4 133 ? 48.86486 24.41513  -84.13609 1.000 78.50234  ? 133 GLY B O   1 
ATOM   8378 N  N   . GLU H 4 134 ? 50.34665 25.59187  -82.91609 1.000 77.70974  ? 134 GLU B N   1 
ATOM   8379 C  CA  . GLU H 4 134 ? 51.49890 24.88250  -83.44043 1.000 79.58770  ? 134 GLU B CA  1 
ATOM   8380 C  C   . GLU H 4 134 ? 51.71584 23.57549  -82.68238 1.000 80.43162  ? 134 GLU B C   1 
ATOM   8381 O  O   . GLU H 4 134 ? 51.04503 23.27863  -81.69224 1.000 79.61869  ? 134 GLU B O   1 
ATOM   8382 C  CB  . GLU H 4 134 ? 52.75269 25.74968  -83.36288 1.000 83.49043  ? 134 GLU B CB  1 
ATOM   8383 C  CG  . GLU H 4 134 ? 52.65652 27.01893  -84.17654 1.000 89.31642  ? 134 GLU B CG  1 
ATOM   8384 C  CD  . GLU H 4 134 ? 53.88690 27.89393  -84.06016 1.000 93.40964  ? 134 GLU B CD  1 
ATOM   8385 O  OE1 . GLU H 4 134 ? 54.27568 28.24646  -82.92634 1.000 94.50991  ? 134 GLU B OE1 1 
ATOM   8386 O  OE2 . GLU H 4 134 ? 54.47418 28.21478  -85.11566 1.000 94.85332  ? 134 GLU B OE2 1 
ATOM   8387 N  N   . LYS H 4 135 ? 52.66724 22.78412  -83.17868 1.000 80.65642  ? 135 LYS B N   1 
ATOM   8388 C  CA  . LYS H 4 135 ? 53.06072 21.52980  -82.55251 1.000 79.44086  ? 135 LYS B CA  1 
ATOM   8389 C  C   . LYS H 4 135 ? 53.93897 21.79944  -81.33379 1.000 76.11434  ? 135 LYS B C   1 
ATOM   8390 O  O   . LYS H 4 135 ? 54.71183 22.76017  -81.30304 1.000 73.11198  ? 135 LYS B O   1 
ATOM   8391 C  CB  . LYS H 4 135 ? 53.79599 20.64618  -83.56257 1.000 80.10364  ? 135 LYS B CB  1 
ATOM   8392 C  CG  . LYS H 4 135 ? 52.87825 19.84042  -84.48246 1.000 82.80304  ? 135 LYS B CG  1 
ATOM   8393 C  CD  . LYS H 4 135 ? 52.76177 18.37918  -84.01686 1.000 86.68494  ? 135 LYS B CD  1 
ATOM   8394 C  CE  . LYS H 4 135 ? 51.91880 17.52921  -84.97701 1.000 87.77534  ? 135 LYS B CE  1 
ATOM   8395 N  NZ  . LYS H 4 135 ? 51.95527 16.07133  -84.66023 1.000 87.71254  ? 135 LYS B NZ  1 
ATOM   8396 N  N   . VAL H 4 136 ? 53.80423 20.95165  -80.31138 1.000 78.40191  ? 136 VAL B N   1 
ATOM   8397 C  CA  . VAL H 4 136 ? 54.57090 21.11386  -79.07484 1.000 80.52469  ? 136 VAL B CA  1 
ATOM   8398 C  C   . VAL H 4 136 ? 55.11967 19.76895  -78.61960 1.000 81.46321  ? 136 VAL B C   1 
ATOM   8399 O  O   . VAL H 4 136 ? 54.37744 18.78809  -78.51201 1.000 80.84761  ? 136 VAL B O   1 
ATOM   8400 C  CB  . VAL H 4 136 ? 53.72596 21.75804  -77.95186 1.000 82.19696  ? 136 VAL B CB  1 
ATOM   8401 C  CG1 . VAL H 4 136 ? 52.42096 21.01593  -77.75741 1.000 84.48182  ? 136 VAL B CG1 1 
ATOM   8402 C  CG2 . VAL H 4 136 ? 54.50243 21.75262  -76.65322 1.000 79.60587  ? 136 VAL B CG2 1 
ATOM   8403 N  N   . LEU H 4 137 ? 56.40984 19.74139  -78.30052 1.000 83.75075  ? 137 LEU B N   1 
ATOM   8404 C  CA  . LEU H 4 137 ? 57.00156 18.54950  -77.71822 1.000 84.96900  ? 137 LEU B CA  1 
ATOM   8405 C  C   . LEU H 4 137 ? 56.43597 18.33588  -76.31809 1.000 84.37553  ? 137 LEU B C   1 
ATOM   8406 O  O   . LEU H 4 137 ? 56.20628 19.29411  -75.57074 1.000 87.36047  ? 137 LEU B O   1 
ATOM   8407 C  CB  . LEU H 4 137 ? 58.52748 18.69584  -77.68771 1.000 84.98756  ? 137 LEU B CB  1 
ATOM   8408 C  CG  . LEU H 4 137 ? 59.37662 17.68067  -76.92587 1.000 87.88438  ? 137 LEU B CG  1 
ATOM   8409 C  CD1 . LEU H 4 137 ? 59.18357 16.27257  -77.48537 1.000 95.16031  ? 137 LEU B CD1 1 
ATOM   8410 C  CD2 . LEU H 4 137 ? 60.84559 18.09816  -76.96304 1.000 85.59359  ? 137 LEU B CD2 1 
ATOM   8411 N  N   . LEU H 4 138 ? 56.22338 17.07761  -75.95449 1.000 79.28412  ? 138 LEU B N   1 
ATOM   8412 C  CA  . LEU H 4 138 ? 55.52197 16.76874  -74.72368 1.000 76.51704  ? 138 LEU B CA  1 
ATOM   8413 C  C   . LEU H 4 138 ? 56.50424 16.23057  -73.69983 1.000 82.63915  ? 138 LEU B C   1 
ATOM   8414 O  O   . LEU H 4 138 ? 57.64907 15.89467  -74.01929 1.000 83.15224  ? 138 LEU B O   1 
ATOM   8415 C  CB  . LEU H 4 138 ? 54.39210 15.75600  -74.94367 1.000 70.68369  ? 138 LEU B CB  1 
ATOM   8416 C  CG  . LEU H 4 138 ? 53.13907 16.23122  -75.67670 1.000 67.45524  ? 138 LEU B CG  1 
ATOM   8417 C  CD1 . LEU H 4 138 ? 52.15100 15.09384  -75.86362 1.000 66.46740  ? 138 LEU B CD1 1 
ATOM   8418 C  CD2 . LEU H 4 138 ? 52.50381 17.35437  -74.90357 1.000 65.72518  ? 138 LEU B CD2 1 
ATOM   8419 N  N   . CYS H 4 139 ? 56.02984 16.16951  -72.45447 1.000 85.30643  ? 139 CYS B N   1 
ATOM   8420 C  CA  . CYS H 4 139 ? 56.82074 15.73774  -71.30422 1.000 85.06331  ? 139 CYS B CA  1 
ATOM   8421 C  C   . CYS H 4 139 ? 56.61306 14.23669  -71.19425 1.000 80.35730  ? 139 CYS B C   1 
ATOM   8422 O  O   . CYS H 4 139 ? 55.59380 13.76234  -70.69586 1.000 83.85063  ? 139 CYS B O   1 
ATOM   8423 C  CB  . CYS H 4 139 ? 56.41656 16.48605  -70.03801 1.000 88.44306  ? 139 CYS B CB  1 
ATOM   8424 S  SG  . CYS H 4 139 ? 57.19873 15.92413  -68.49335 1.000 92.84920  ? 139 CYS B SG  1 
ATOM   8425 N  N   . GLY H 4 140 ? 57.52103 13.48072  -71.80013 1.000 75.77035  ? 140 GLY B N   1 
ATOM   8426 C  CA  . GLY H 4 140 ? 57.41408 12.03715  -71.72262 1.000 75.89786  ? 140 GLY B CA  1 
ATOM   8427 C  C   . GLY H 4 140 ? 57.64957 11.44045  -70.34606 1.000 75.34677  ? 140 GLY B C   1 
ATOM   8428 O  O   . GLY H 4 140 ? 57.44195 10.23327  -70.18454 1.000 76.76416  ? 140 GLY B O   1 
ATOM   8429 N  N   . PHE H 4 141 ? 58.11970 12.22565  -69.37989 1.000 73.47329  ? 141 PHE B N   1 
ATOM   8430 C  CA  . PHE H 4 141 ? 58.47507 11.72889  -68.04894 1.000 72.99930  ? 141 PHE B CA  1 
ATOM   8431 C  C   . PHE H 4 141 ? 57.67538 12.47641  -66.98753 1.000 75.60450  ? 141 PHE B C   1 
ATOM   8432 O  O   . PHE H 4 141 ? 58.23897 13.28375  -66.24198 1.000 76.91480  ? 141 PHE B O   1 
ATOM   8433 C  CB  . PHE H 4 141 ? 59.98365 11.87837  -67.80956 1.000 69.79675  ? 141 PHE B CB  1 
ATOM   8434 C  CG  . PHE H 4 141 ? 60.49517 11.15738  -66.59406 1.000 67.74958  ? 141 PHE B CG  1 
ATOM   8435 C  CD1 . PHE H 4 141 ? 60.55429 9.77581   -66.56456 1.000 69.62771  ? 141 PHE B CD1 1 
ATOM   8436 C  CD2 . PHE H 4 141 ? 60.94412 11.85923  -65.48885 1.000 66.26142  ? 141 PHE B CD2 1 
ATOM   8437 C  CE1 . PHE H 4 141 ? 61.04667 9.10113   -65.44689 1.000 69.08215  ? 141 PHE B CE1 1 
ATOM   8438 C  CE2 . PHE H 4 141 ? 61.43443 11.19179  -64.37115 1.000 66.65239  ? 141 PHE B CE2 1 
ATOM   8439 C  CZ  . PHE H 4 141 ? 61.48531 9.80967   -64.35555 1.000 67.68377  ? 141 PHE B CZ  1 
ATOM   8440 N  N   . GLN H 4 142 ? 56.37429 12.19153  -66.88872 1.000 77.61658  ? 142 GLN B N   1 
ATOM   8441 C  CA  . GLN H 4 142 ? 55.56960 12.87430  -65.87527 1.000 75.97086  ? 142 GLN B CA  1 
ATOM   8442 C  C   . GLN H 4 142 ? 55.95661 12.48429  -64.45320 1.000 70.26404  ? 142 GLN B C   1 
ATOM   8443 O  O   . GLN H 4 142 ? 55.58015 13.18470  -63.51407 1.000 68.90108  ? 142 GLN B O   1 
ATOM   8444 C  CB  . GLN H 4 142 ? 54.08624 12.60241  -66.08064 1.000 84.48024  ? 142 GLN B CB  1 
ATOM   8445 C  CG  . GLN H 4 142 ? 53.20312 13.62977  -65.39291 1.000 92.49390  ? 142 GLN B CG  1 
ATOM   8446 C  CD  . GLN H 4 142 ? 52.03349 13.01717  -64.65865 1.000 98.12169  ? 142 GLN B CD  1 
ATOM   8447 O  OE1 . GLN H 4 142 ? 52.17996 12.51033  -63.54463 1.000 97.83108  ? 142 GLN B OE1 1 
ATOM   8448 N  NE2 . GLN H 4 142 ? 50.85584 13.07108  -65.27540 1.000 101.18107 ? 142 GLN B NE2 1 
ATOM   8449 N  N   . ARG H 4 143 ? 56.66767 11.37132  -64.26652 1.000 69.34755  ? 143 ARG B N   1 
ATOM   8450 C  CA  . ARG H 4 143 ? 57.12406 10.99600  -62.93254 1.000 65.57461  ? 143 ARG B CA  1 
ATOM   8451 C  C   . ARG H 4 143 ? 58.08283 12.01678  -62.34706 1.000 63.74690  ? 143 ARG B C   1 
ATOM   8452 O  O   . ARG H 4 143 ? 58.22115 12.09807  -61.12481 1.000 64.93479  ? 143 ARG B O   1 
ATOM   8453 C  CB  . ARG H 4 143 ? 57.80477 9.62623   -62.96592 1.000 66.19289  ? 143 ARG B CB  1 
ATOM   8454 C  CG  . ARG H 4 143 ? 56.88585 8.45783   -63.27499 1.000 67.19780  ? 143 ARG B CG  1 
ATOM   8455 C  CD  . ARG H 4 143 ? 56.47823 7.71074   -62.03293 1.000 68.06727  ? 143 ARG B CD  1 
ATOM   8456 N  NE  . ARG H 4 143 ? 55.81738 6.45458   -62.36978 1.000 70.76891  ? 143 ARG B NE  1 
ATOM   8457 C  CZ  . ARG H 4 143 ? 55.27459 5.63668   -61.47418 1.000 74.64726  ? 143 ARG B CZ  1 
ATOM   8458 N  NH1 . ARG H 4 143 ? 55.31890 5.93966   -60.18129 1.000 72.57844  ? 143 ARG B NH1 1 
ATOM   8459 N  NH2 . ARG H 4 143 ? 54.68302 4.51665   -61.87199 1.000 78.47267  ? 143 ARG B NH2 1 
ATOM   8460 N  N   . GLY H 4 144 ? 58.75797 12.78990  -63.18946 1.000 64.41346  ? 144 GLY B N   1 
ATOM   8461 C  CA  . GLY H 4 144 ? 59.73678 13.73879  -62.68880 1.000 65.63851  ? 144 GLY B CA  1 
ATOM   8462 C  C   . GLY H 4 144 ? 59.12583 14.91970  -61.96264 1.000 67.27827  ? 144 GLY B C   1 
ATOM   8463 O  O   . GLY H 4 144 ? 59.77637 15.52164  -61.11058 1.000 76.22546  ? 144 GLY B O   1 
ATOM   8464 N  N   . HIS H 4 145 ? 57.90604 15.30746  -62.33026 1.000 64.95162  ? 145 HIS B N   1 
ATOM   8465 C  CA  . HIS H 4 145 ? 57.23344 16.47083  -61.74891 1.000 65.15007  ? 145 HIS B CA  1 
ATOM   8466 C  C   . HIS H 4 145 ? 56.33787 16.11592  -60.56151 1.000 66.37131  ? 145 HIS B C   1 
ATOM   8467 O  O   . HIS H 4 145 ? 55.17274 16.49428  -60.50538 1.000 67.84778  ? 145 HIS B O   1 
ATOM   8468 C  CB  . HIS H 4 145 ? 56.43986 17.18476  -62.83054 1.000 70.93999  ? 145 HIS B CB  1 
ATOM   8469 C  CG  . HIS H 4 145 ? 57.25684 17.56802  -64.02168 1.000 75.57342  ? 145 HIS B CG  1 
ATOM   8470 N  ND1 . HIS H 4 145 ? 57.96081 18.74865  -64.07835 1.000 78.30873  ? 145 HIS B ND1 1 
ATOM   8471 C  CD2 . HIS H 4 145 ? 57.51446 16.92159  -65.17981 1.000 81.82633  ? 145 HIS B CD2 1 
ATOM   8472 C  CE1 . HIS H 4 145 ? 58.59605 18.82598  -65.23270 1.000 82.53245  ? 145 HIS B CE1 1 
ATOM   8473 N  NE2 . HIS H 4 145 ? 58.34248 17.73084  -65.92038 1.000 85.60715  ? 145 HIS B NE2 1 
ATOM   8474 N  N   . ARG H 4 146 ? 56.90841 15.43241  -59.57303 1.000 67.40817  ? 146 ARG B N   1 
ATOM   8475 C  CA  . ARG H 4 146 ? 56.07821 14.90481  -58.48904 1.000 67.18246  ? 146 ARG B CA  1 
ATOM   8476 C  C   . ARG H 4 146 ? 56.64337 15.10246  -57.08628 1.000 65.75083  ? 146 ARG B C   1 
ATOM   8477 O  O   . ARG H 4 146 ? 55.95396 14.77939  -56.11593 1.000 62.33435  ? 146 ARG B O   1 
ATOM   8478 C  CB  . ARG H 4 146 ? 55.82193 13.41659  -58.74210 1.000 68.87263  ? 146 ARG B CB  1 
ATOM   8479 C  CG  . ARG H 4 146 ? 54.46256 12.95920  -58.30511 1.000 72.34244  ? 146 ARG B CG  1 
ATOM   8480 C  CD  . ARG H 4 146 ? 54.12797 11.58590  -58.86487 1.000 75.27868  ? 146 ARG B CD  1 
ATOM   8481 N  NE  . ARG H 4 146 ? 53.61147 11.65294  -60.22775 1.000 76.62177  ? 146 ARG B NE  1 
ATOM   8482 C  CZ  . ARG H 4 146 ? 53.24784 10.59080  -60.93936 1.000 79.43653  ? 146 ARG B CZ  1 
ATOM   8483 N  NH1 . ARG H 4 146 ? 52.77451 10.74981  -62.16706 1.000 85.59890  ? 146 ARG B NH1 1 
ATOM   8484 N  NH2 . ARG H 4 146 ? 53.35028 9.37317   -60.42404 1.000 76.85121  ? 146 ARG B NH2 1 
ATOM   8485 N  N   . ASP H 4 147 ? 57.87985 15.58068  -56.95004 1.000 67.92744  ? 147 ASP B N   1 
ATOM   8486 C  CA  . ASP H 4 147 ? 58.45487 15.91245  -55.65437 1.000 69.27577  ? 147 ASP B CA  1 
ATOM   8487 C  C   . ASP H 4 147 ? 58.02535 17.29985  -55.21174 1.000 69.63477  ? 147 ASP B C   1 
ATOM   8488 O  O   . ASP H 4 147 ? 57.49241 17.47440  -54.11546 1.000 73.77653  ? 147 ASP B O   1 
ATOM   8489 C  CB  . ASP H 4 147 ? 59.97362 15.82413  -55.73668 1.000 76.81175  ? 147 ASP B CB  1 
ATOM   8490 C  CG  . ASP H 4 147 ? 60.66180 16.37307  -54.50950 1.000 85.86394  ? 147 ASP B CG  1 
ATOM   8491 O  OD1 . ASP H 4 147 ? 60.12497 16.23183  -53.38964 1.000 90.63822  ? 147 ASP B OD1 1 
ATOM   8492 O  OD2 . ASP H 4 147 ? 61.74731 16.97015  -54.68039 1.000 88.09052  ? 147 ASP B OD2 1 
ATOM   8493 N  N   . GLN H 4 148 ? 58.26865 18.30128  -56.04851 1.000 71.60014  ? 148 GLN B N   1 
ATOM   8494 C  CA  . GLN H 4 148 ? 57.92341 19.68131  -55.74737 1.000 73.75959  ? 148 GLN B CA  1 
ATOM   8495 C  C   . GLN H 4 148 ? 56.56801 20.02916  -56.35724 1.000 72.49363  ? 148 GLN B C   1 
ATOM   8496 O  O   . GLN H 4 148 ? 56.19785 19.51940  -57.41594 1.000 72.68369  ? 148 GLN B O   1 
ATOM   8497 C  CB  . GLN H 4 148 ? 59.00181 20.63404  -56.27382 1.000 77.40444  ? 148 GLN B CB  1 
ATOM   8498 C  CG  . GLN H 4 148 ? 60.38232 20.41981  -55.64766 1.000 82.72294  ? 148 GLN B CG  1 
ATOM   8499 C  CD  . GLN H 4 148 ? 60.52332 21.11963  -54.30948 1.000 87.37508  ? 148 GLN B CD  1 
ATOM   8500 O  OE1 . GLN H 4 148 ? 60.18951 22.30163  -54.17477 1.000 90.56550  ? 148 GLN B OE1 1 
ATOM   8501 N  NE2 . GLN H 4 148 ? 61.01628 20.39334  -53.30752 1.000 86.63059  ? 148 GLN B NE2 1 
ATOM   8502 N  N   . VAL H 4 149 ? 55.81375 20.88113  -55.66116 1.000 72.65025  ? 149 VAL B N   1 
ATOM   8503 C  CA  . VAL H 4 149 ? 54.54893 21.37662  -56.19679 1.000 70.16968  ? 149 VAL B CA  1 
ATOM   8504 C  C   . VAL H 4 149 ? 54.84734 22.27313  -57.38647 1.000 69.19712  ? 149 VAL B C   1 
ATOM   8505 O  O   . VAL H 4 149 ? 55.56888 23.26774  -57.26453 1.000 74.66812  ? 149 VAL B O   1 
ATOM   8506 C  CB  . VAL H 4 149 ? 53.74585 22.12673  -55.12916 1.000 69.92837  ? 149 VAL B CB  1 
ATOM   8507 C  CG1 . VAL H 4 149 ? 54.63966 23.10556  -54.37850 1.000 71.61470  ? 149 VAL B CG1 1 
ATOM   8508 C  CG2 . VAL H 4 149 ? 52.59382 22.87383  -55.79433 1.000 71.06045  ? 149 VAL B CG2 1 
ATOM   8509 N  N   . GLY H 4 150 ? 54.29196 21.93901  -58.53256 1.000 66.16355  ? 150 GLY B N   1 
ATOM   8510 C  CA  . GLY H 4 150 ? 54.71619 22.59519  -59.75097 1.000 67.76892  ? 150 GLY B CA  1 
ATOM   8511 C  C   . GLY H 4 150 ? 54.11843 23.97975  -59.96840 1.000 67.98326  ? 150 GLY B C   1 
ATOM   8512 O  O   . GLY H 4 150 ? 53.11697 24.37929  -59.37453 1.000 68.69803  ? 150 GLY B O   1 
ATOM   8513 N  N   . THR H 4 151 ? 54.76574 24.73240  -60.85174 1.000 65.68002  ? 151 THR B N   1 
ATOM   8514 C  CA  . THR H 4 151 ? 54.19075 25.99629  -61.27350 1.000 61.61948  ? 151 THR B CA  1 
ATOM   8515 C  C   . THR H 4 151 ? 52.84721 25.72528  -61.95064 1.000 63.42470  ? 151 THR B C   1 
ATOM   8516 O  O   . THR H 4 151 ? 52.65729 24.69573  -62.60058 1.000 66.65986  ? 151 THR B O   1 
ATOM   8517 C  CB  . THR H 4 151 ? 55.12910 26.72249  -62.23476 1.000 60.93021  ? 151 THR B CB  1 
ATOM   8518 O  OG1 . THR H 4 151 ? 54.57916 28.00418  -62.53174 1.000 65.84785  ? 151 THR B OG1 1 
ATOM   8519 C  CG2 . THR H 4 151 ? 55.27412 25.94045  -63.55610 1.000 58.38209  ? 151 THR B CG2 1 
ATOM   8520 N  N   . LEU H 4 152 ? 51.89524 26.65554  -61.78007 1.000 62.67895  ? 152 LEU B N   1 
ATOM   8521 C  CA  . LEU H 4 152 ? 50.55171 26.47506  -62.34462 1.000 58.68439  ? 152 LEU B CA  1 
ATOM   8522 C  C   . LEU H 4 152 ? 50.57022 26.40565  -63.86652 1.000 57.02096  ? 152 LEU B C   1 
ATOM   8523 O  O   . LEU H 4 152 ? 49.66306 25.82554  -64.47475 1.000 53.66467  ? 152 LEU B O   1 
ATOM   8524 C  CB  . LEU H 4 152 ? 49.62426 27.59684  -61.87286 1.000 56.91949  ? 152 LEU B CB  1 
ATOM   8525 C  CG  . LEU H 4 152 ? 48.17282 27.63616  -62.38117 1.000 56.95906  ? 152 LEU B CG  1 
ATOM   8526 C  CD1 . LEU H 4 152 ? 47.43174 26.34823  -62.09942 1.000 55.59272  ? 152 LEU B CD1 1 
ATOM   8527 C  CD2 . LEU H 4 152 ? 47.41842 28.82247  -61.78961 1.000 58.91315  ? 152 LEU B CD2 1 
ATOM   8528 N  N   . GLN H 4 153 ? 51.58073 27.00499  -64.49348 1.000 59.45050  ? 153 GLN B N   1 
ATOM   8529 C  CA  . GLN H 4 153 ? 51.74314 26.87987  -65.93395 1.000 63.61388  ? 153 GLN B CA  1 
ATOM   8530 C  C   . GLN H 4 153 ? 52.03857 25.43055  -66.31613 1.000 63.25281  ? 153 GLN B C   1 
ATOM   8531 O  O   . GLN H 4 153 ? 51.58108 24.94593  -67.35911 1.000 64.24982  ? 153 GLN B O   1 
ATOM   8532 C  CB  . GLN H 4 153 ? 52.85923 27.81313  -66.39578 1.000 67.03362  ? 153 GLN B CB  1 
ATOM   8533 C  CG  . GLN H 4 153 ? 52.72865 29.23893  -65.87825 1.000 70.32639  ? 153 GLN B CG  1 
ATOM   8534 C  CD  . GLN H 4 153 ? 53.93928 30.09759  -66.22385 1.000 73.24955  ? 153 GLN B CD  1 
ATOM   8535 O  OE1 . GLN H 4 153 ? 54.17918 30.40862  -67.38988 1.000 74.06402  ? 153 GLN B OE1 1 
ATOM   8536 N  NE2 . GLN H 4 153 ? 54.72386 30.46179  -65.20432 1.000 72.76795  ? 153 GLN B NE2 1 
ATOM   8537 N  N   . TYR H 4 154 ? 52.80732 24.71630  -65.49015 1.000 63.56726  ? 154 TYR B N   1 
ATOM   8538 C  CA  . TYR H 4 154 ? 53.05933 23.30821  -65.79787 1.000 63.10985  ? 154 TYR B CA  1 
ATOM   8539 C  C   . TYR H 4 154 ? 51.79585 22.47763  -65.61363 1.000 62.10165  ? 154 TYR B C   1 
ATOM   8540 O  O   . TYR H 4 154 ? 51.45494 21.64834  -66.46755 1.000 65.65345  ? 154 TYR B O   1 
ATOM   8541 C  CB  . TYR H 4 154 ? 54.18509 22.74229  -64.93315 1.000 61.95036  ? 154 TYR B CB  1 
ATOM   8542 C  CG  . TYR H 4 154 ? 54.24750 21.24270  -65.01893 1.000 60.37401  ? 154 TYR B CG  1 
ATOM   8543 C  CD1 . TYR H 4 154 ? 54.76361 20.62032  -66.14322 1.000 61.76176  ? 154 TYR B CD1 1 
ATOM   8544 C  CD2 . TYR H 4 154 ? 53.76601 20.44465  -63.98898 1.000 60.49375  ? 154 TYR B CD2 1 
ATOM   8545 C  CE1 . TYR H 4 154 ? 54.82294 19.24523  -66.24425 1.000 64.12052  ? 154 TYR B CE1 1 
ATOM   8546 C  CE2 . TYR H 4 154 ? 53.81185 19.06074  -64.06997 1.000 61.66166  ? 154 TYR B CE2 1 
ATOM   8547 C  CZ  . TYR H 4 154 ? 54.34566 18.46834  -65.20702 1.000 64.78836  ? 154 TYR B CZ  1 
ATOM   8548 O  OH  . TYR H 4 154 ? 54.41314 17.10477  -65.33655 1.000 67.14144  ? 154 TYR B OH  1 
ATOM   8549 N  N   . LEU H 4 155 ? 51.11172 22.65873  -64.47781 1.000 55.72781  ? 155 LEU B N   1 
ATOM   8550 C  CA  . LEU H 4 155 ? 49.86475 21.94182  -64.23393 1.000 52.90123  ? 155 LEU B CA  1 
ATOM   8551 C  C   . LEU H 4 155 ? 48.83400 22.25516  -65.31477 1.000 54.75387  ? 155 LEU B C   1 
ATOM   8552 O  O   . LEU H 4 155 ? 48.09681 21.36786  -65.75646 1.000 58.00406  ? 155 LEU B O   1 
ATOM   8553 C  CB  . LEU H 4 155 ? 49.31647 22.29564  -62.85208 1.000 52.50338  ? 155 LEU B CB  1 
ATOM   8554 C  CG  . LEU H 4 155 ? 50.15826 21.92502  -61.62948 1.000 52.92270  ? 155 LEU B CG  1 
ATOM   8555 C  CD1 . LEU H 4 155 ? 49.48081 22.32051  -60.30015 1.000 48.94970  ? 155 LEU B CD1 1 
ATOM   8556 C  CD2 . LEU H 4 155 ? 50.47605 20.42997  -61.64867 1.000 55.18221  ? 155 LEU B CD2 1 
ATOM   8557 N  N   . ALA H 4 156 ? 48.77042 23.50425  -65.77351 1.000 55.54527  ? 156 ALA B N   1 
ATOM   8558 C  CA  . ALA H 4 156 ? 47.79229 23.80160  -66.81070 1.000 59.62355  ? 156 ALA B CA  1 
ATOM   8559 C  C   . ALA H 4 156 ? 48.17269 23.11964  -68.11702 1.000 65.51692  ? 156 ALA B C   1 
ATOM   8560 O  O   . ALA H 4 156 ? 47.33849 22.44797  -68.73352 1.000 70.89702  ? 156 ALA B O   1 
ATOM   8561 C  CB  . ALA H 4 156 ? 47.64359 25.30940  -67.01517 1.000 60.37184  ? 156 ALA B CB  1 
ATOM   8562 N  N   . ILE H 4 157 ? 49.44604 23.21851  -68.52448 1.000 63.99833  ? 157 ILE B N   1 
ATOM   8563 C  CA  . ILE H 4 157 ? 49.80772 22.69850  -69.84399 1.000 63.69155  ? 157 ILE B CA  1 
ATOM   8564 C  C   . ILE H 4 157 ? 49.81952 21.17314  -69.85105 1.000 64.97380  ? 157 ILE B C   1 
ATOM   8565 O  O   . ILE H 4 157 ? 49.47481 20.56357  -70.86683 1.000 65.41691  ? 157 ILE B O   1 
ATOM   8566 C  CB  . ILE H 4 157 ? 51.15066 23.28841  -70.32266 1.000 61.32904  ? 157 ILE B CB  1 
ATOM   8567 C  CG1 . ILE H 4 157 ? 51.39678 22.95746  -71.80219 1.000 61.53123  ? 157 ILE B CG1 1 
ATOM   8568 C  CG2 . ILE H 4 157 ? 52.29398 22.78971  -69.48322 1.000 62.17113  ? 157 ILE B CG2 1 
ATOM   8569 C  CD1 . ILE H 4 157 ? 52.66929 23.59667  -72.42029 1.000 61.03500  ? 157 ILE B CD1 1 
ATOM   8570 N  N   . GLN H 4 158 ? 50.15825 20.52680  -68.72118 1.000 64.81502  ? 158 GLN B N   1 
ATOM   8571 C  CA  . GLN H 4 158 ? 50.09677 19.06425  -68.66070 1.000 67.41498  ? 158 GLN B CA  1 
ATOM   8572 C  C   . GLN H 4 158 ? 48.65477 18.57702  -68.69152 1.000 67.74984  ? 158 GLN B C   1 
ATOM   8573 O  O   . GLN H 4 158 ? 48.34611 17.57396  -69.34638 1.000 73.22864  ? 158 GLN B O   1 
ATOM   8574 C  CB  . GLN H 4 158 ? 50.80396 18.53486  -67.41526 1.000 68.74645  ? 158 GLN B CB  1 
ATOM   8575 C  CG  . GLN H 4 158 ? 52.06353 17.70189  -67.70373 1.000 72.28979  ? 158 GLN B CG  1 
ATOM   8576 C  CD  . GLN H 4 158 ? 51.78335 16.38468  -68.40481 1.000 75.05021  ? 158 GLN B CD  1 
ATOM   8577 O  OE1 . GLN H 4 158 ? 50.98319 15.57398  -67.93416 1.000 76.70845  ? 158 GLN B OE1 1 
ATOM   8578 N  NE2 . GLN H 4 158 ? 52.44552 16.16501  -69.54116 1.000 75.45585  ? 158 GLN B NE2 1 
ATOM   8579 N  N   . ALA H 4 159 ? 47.75744 19.27127  -67.98803 1.000 63.52704  ? 159 ALA B N   1 
ATOM   8580 C  CA  . ALA H 4 159 ? 46.33542 18.96026  -68.10111 1.000 63.29569  ? 159 ALA B CA  1 
ATOM   8581 C  C   . ALA H 4 159 ? 45.84464 19.09189  -69.53550 1.000 64.07729  ? 159 ALA B C   1 
ATOM   8582 O  O   . ALA H 4 159 ? 44.88628 18.41609  -69.92726 1.000 60.51664  ? 159 ALA B O   1 
ATOM   8583 C  CB  . ALA H 4 159 ? 45.51961 19.87684  -67.18923 1.000 60.99385  ? 159 ALA B CB  1 
ATOM   8584 N  N   . TRP H 4 160 ? 46.46405 19.98504  -70.31216 1.000 67.55214  ? 160 TRP B N   1 
ATOM   8585 C  CA  . TRP H 4 160 ? 46.15940 20.13333  -71.72803 1.000 67.81231  ? 160 TRP B CA  1 
ATOM   8586 C  C   . TRP H 4 160 ? 46.78063 19.00323  -72.54132 1.000 71.86481  ? 160 TRP B C   1 
ATOM   8587 O  O   . TRP H 4 160 ? 46.18867 18.52957  -73.51993 1.000 74.03669  ? 160 TRP B O   1 
ATOM   8588 C  CB  . TRP H 4 160 ? 46.65857 21.49617  -72.20461 1.000 63.29695  ? 160 TRP B CB  1 
ATOM   8589 C  CG  . TRP H 4 160 ? 46.54719 21.73707  -73.67055 1.000 61.85626  ? 160 TRP B CG  1 
ATOM   8590 C  CD1 . TRP H 4 160 ? 45.43585 22.13095  -74.35009 1.000 61.84138  ? 160 TRP B CD1 1 
ATOM   8591 C  CD2 . TRP H 4 160 ? 47.58939 21.60573  -74.64380 1.000 63.14478  ? 160 TRP B CD2 1 
ATOM   8592 N  NE1 . TRP H 4 160 ? 45.72049 22.25544  -75.68718 1.000 63.24757  ? 160 TRP B NE1 1 
ATOM   8593 C  CE2 . TRP H 4 160 ? 47.03560 21.93647  -75.89262 1.000 62.10575  ? 160 TRP B CE2 1 
ATOM   8594 C  CE3 . TRP H 4 160 ? 48.93851 21.23864  -74.57807 1.000 64.28549  ? 160 TRP B CE3 1 
ATOM   8595 C  CZ2 . TRP H 4 160 ? 47.77628 21.91240  -77.06364 1.000 62.67097  ? 160 TRP B CZ2 1 
ATOM   8596 C  CZ3 . TRP H 4 160 ? 49.67422 21.21331  -75.73910 1.000 63.38415  ? 160 TRP B CZ3 1 
ATOM   8597 C  CH2 . TRP H 4 160 ? 49.09003 21.54816  -76.96778 1.000 65.44946  ? 160 TRP B CH2 1 
ATOM   8598 N  N   . ALA H 4 161 ? 47.97100 18.55381  -72.14561 1.000 72.63408  ? 161 ALA B N   1 
ATOM   8599 C  CA  . ALA H 4 161 ? 48.58967 17.43824  -72.84462 1.000 75.20450  ? 161 ALA B CA  1 
ATOM   8600 C  C   . ALA H 4 161 ? 47.80052 16.15169  -72.61825 1.000 82.78445  ? 161 ALA B C   1 
ATOM   8601 O  O   . ALA H 4 161 ? 47.56184 15.39338  -73.56500 1.000 86.62548  ? 161 ALA B O   1 
ATOM   8602 C  CB  . ALA H 4 161 ? 50.04332 17.28987  -72.40340 1.000 71.26546  ? 161 ALA B CB  1 
ATOM   8603 N  N   . ARG H 4 162 ? 47.34440 15.90868  -71.38409 1.000 85.59415  ? 162 ARG B N   1 
ATOM   8604 C  CA  . ARG H 4 162 ? 46.55823 14.70650  -71.11277 1.000 90.97622  ? 162 ARG B CA  1 
ATOM   8605 C  C   . ARG H 4 162 ? 45.32917 14.61663  -72.00972 1.000 90.96446  ? 162 ARG B C   1 
ATOM   8606 O  O   . ARG H 4 162 ? 44.83095 13.51862  -72.27450 1.000 90.22640  ? 162 ARG B O   1 
ATOM   8607 C  CB  . ARG H 4 162 ? 46.14012 14.67771  -69.64212 1.000 97.16209  ? 162 ARG B CB  1 
ATOM   8608 C  CG  . ARG H 4 162 ? 47.29885 14.44741  -68.68559 1.000 102.80427 ? 162 ARG B CG  1 
ATOM   8609 C  CD  . ARG H 4 162 ? 46.82084 14.09076  -67.28848 1.000 107.85970 ? 162 ARG B CD  1 
ATOM   8610 N  NE  . ARG H 4 162 ? 45.95674 15.12234  -66.70832 1.000 111.85526 ? 162 ARG B NE  1 
ATOM   8611 C  CZ  . ARG H 4 162 ? 46.37468 16.12231  -65.93499 1.000 115.13308 ? 162 ARG B CZ  1 
ATOM   8612 N  NH1 . ARG H 4 162 ? 45.49646 16.99650  -65.45687 1.000 114.67766 ? 162 ARG B NH1 1 
ATOM   8613 N  NH2 . ARG H 4 162 ? 47.66169 16.25670  -65.63627 1.000 119.03660 ? 162 ARG B NH2 1 
ATOM   8614 N  N   . GLU H 4 163 ? 44.82929 15.75117  -72.48503 1.000 94.79311  ? 163 GLU B N   1 
ATOM   8615 C  CA  . GLU H 4 163 ? 43.66031 15.77138  -73.35218 1.000 100.70328 ? 163 GLU B CA  1 
ATOM   8616 C  C   . GLU H 4 163 ? 43.99787 15.58721  -74.82613 1.000 102.88751 ? 163 GLU B C   1 
ATOM   8617 O  O   . GLU H 4 163 ? 43.21069 14.98546  -75.56900 1.000 105.16927 ? 163 GLU B O   1 
ATOM   8618 C  CB  . GLU H 4 163 ? 42.90784 17.08928  -73.16545 1.000 105.91642 ? 163 GLU B CB  1 
ATOM   8619 C  CG  . GLU H 4 163 ? 41.54914 17.11759  -73.80204 1.000 111.91600 ? 163 GLU B CG  1 
ATOM   8620 C  CD  . GLU H 4 163 ? 40.66137 16.02236  -73.27035 1.000 119.94185 ? 163 GLU B CD  1 
ATOM   8621 O  OE1 . GLU H 4 163 ? 40.81488 15.65420  -72.08471 1.000 120.93869 ? 163 GLU B OE1 1 
ATOM   8622 O  OE2 . GLU H 4 163 ? 39.81975 15.51973  -74.04257 1.000 128.23844 ? 163 GLU B OE2 1 
ATOM   8623 N  N   . GLN H 4 164 ? 45.15941 16.07321  -75.26067 1.000 100.48725 ? 164 GLN B N   1 
ATOM   8624 C  CA  . GLN H 4 164 ? 45.53265 15.99995  -76.66781 1.000 102.87149 ? 164 GLN B CA  1 
ATOM   8625 C  C   . GLN H 4 164 ? 45.87192 14.58733  -77.12073 1.000 109.29302 ? 164 GLN B C   1 
ATOM   8626 O  O   . GLN H 4 164 ? 45.80040 14.30480  -78.31875 1.000 127.44115 ? 164 GLN B O   1 
ATOM   8627 C  CB  . GLN H 4 164 ? 46.70470 16.93924  -76.94136 1.000 99.81060  ? 164 GLN B CB  1 
ATOM   8628 C  CG  . GLN H 4 164 ? 46.37558 18.41629  -76.77230 1.000 99.91897  ? 164 GLN B CG  1 
ATOM   8629 C  CD  . GLN H 4 164 ? 45.48925 18.95555  -77.88632 1.000 101.61885 ? 164 GLN B CD  1 
ATOM   8630 O  OE1 . GLN H 4 164 ? 45.44455 18.39987  -78.98655 1.000 103.98009 ? 164 GLN B OE1 1 
ATOM   8631 N  NE2 . GLN H 4 164 ? 44.78329 20.04547  -77.60681 1.000 100.59589 ? 164 GLN B NE2 1 
ATOM   8632 N  N   . VAL H 4 165 ? 46.21415 13.68627  -76.20344 1.000 140.59958 ? 165 VAL B N   1 
ATOM   8633 C  CA  . VAL H 4 165 ? 46.46156 12.32244  -76.64009 1.000 132.08601 ? 165 VAL B CA  1 
ATOM   8634 C  C   . VAL H 4 165 ? 45.14924 11.61604  -76.96071 1.000 131.01051 ? 165 VAL B C   1 
ATOM   8635 O  O   . VAL H 4 165 ? 45.11118 10.69735  -77.79039 1.000 135.34419 ? 165 VAL B O   1 
ATOM   8636 C  CB  . VAL H 4 165 ? 47.28277 11.57678  -75.58179 1.000 125.87186 ? 165 VAL B CB  1 
ATOM   8637 C  CG1 . VAL H 4 165 ? 48.54142 12.37889  -75.26114 1.000 121.79167 ? 165 VAL B CG1 1 
ATOM   8638 C  CG2 . VAL H 4 165 ? 46.44625 11.30029  -74.34513 1.000 124.24659 ? 165 VAL B CG2 1 
ATOM   8639 N  N   . LYS H 4 166 ? 44.06194 12.00425  -76.30212 1.000 124.31170 ? 166 LYS B N   1 
ATOM   8640 C  CA  . LYS H 4 166 ? 42.73453 11.46145  -76.58987 1.000 127.74990 ? 166 LYS B CA  1 
ATOM   8641 C  C   . LYS H 4 166 ? 42.21860 12.09217  -77.89133 1.000 133.10149 ? 166 LYS B C   1 
ATOM   8642 O  O   . LYS H 4 166 ? 41.28727 12.89991  -77.91397 1.000 132.57423 ? 166 LYS B O   1 
ATOM   8643 C  CB  . LYS H 4 166 ? 41.83290 11.73381  -75.39568 1.000 127.36459 ? 166 LYS B CB  1 
ATOM   8644 C  CG  . LYS H 4 166 ? 42.03531 10.73479  -74.27585 1.000 127.16293 ? 166 LYS B CG  1 
ATOM   8645 C  CD  . LYS H 4 166 ? 41.15250 11.04657  -73.06963 1.000 126.96254 ? 166 LYS B CD  1 
ATOM   8646 C  CE  . LYS H 4 166 ? 39.66893 11.12558  -73.38170 1.000 127.08627 ? 166 LYS B CE  1 
ATOM   8647 N  NZ  . LYS H 4 166 ? 38.85757 11.39825  -72.14829 1.000 125.16193 ? 166 LYS B NZ  1 
ATOM   8648 N  N   . LYS H 4 167 ? 42.87316 11.72654  -78.99066 1.000 139.45162 ? 167 LYS B N   1 
ATOM   8649 C  CA  . LYS H 4 167 ? 42.95252 12.59917  -80.15391 1.000 146.46978 ? 167 LYS B CA  1 
ATOM   8650 C  C   . LYS H 4 167 ? 41.81488 12.39518  -81.15127 1.000 161.00676 ? 167 LYS B C   1 
ATOM   8651 O  O   . LYS H 4 167 ? 41.20191 11.32609  -81.23988 1.000 163.01562 ? 167 LYS B O   1 
ATOM   8652 C  CB  . LYS H 4 167 ? 44.30170 12.42419  -80.85935 1.000 142.35262 ? 167 LYS B CB  1 
ATOM   8653 C  CG  . LYS H 4 167 ? 44.80563 10.99788  -80.90543 1.000 137.42191 ? 167 LYS B CG  1 
ATOM   8654 C  CD  . LYS H 4 167 ? 46.25447 10.94355  -81.35923 1.000 133.26223 ? 167 LYS B CD  1 
ATOM   8655 C  CE  . LYS H 4 167 ? 46.44879 11.66611  -82.67920 1.000 130.73692 ? 167 LYS B CE  1 
ATOM   8656 N  NZ  . LYS H 4 167 ? 47.76527 11.34833  -83.28868 1.000 128.86991 ? 167 LYS B NZ  1 
ATOM   8657 N  N   . HIS H 4 168 ? 41.55435 13.46365  -81.90378 1.000 171.14916 ? 168 HIS B N   1 
ATOM   8658 C  CA  . HIS H 4 168 ? 40.56557 13.64099  -82.95911 1.000 181.47861 ? 168 HIS B CA  1 
ATOM   8659 C  C   . HIS H 4 168 ? 40.88957 14.97694  -83.61318 1.000 185.43208 ? 168 HIS B C   1 
ATOM   8660 O  O   . HIS H 4 168 ? 41.39248 15.88905  -82.94876 1.000 184.14958 ? 168 HIS B O   1 
ATOM   8661 C  CB  . HIS H 4 168 ? 39.12757 13.63531  -82.40522 1.000 184.23063 ? 168 HIS B CB  1 
ATOM   8662 C  CG  . HIS H 4 168 ? 38.06900 13.28806  -83.41443 1.000 186.12082 ? 168 HIS B CG  1 
ATOM   8663 N  ND1 . HIS H 4 168 ? 37.26708 14.23653  -84.01606 1.000 188.27961 ? 168 HIS B ND1 1 
ATOM   8664 C  CD2 . HIS H 4 168 ? 37.65444 12.09103  -83.89457 1.000 188.03319 ? 168 HIS B CD2 1 
ATOM   8665 C  CE1 . HIS H 4 168 ? 36.41832 13.64084  -84.83571 1.000 189.65841 ? 168 HIS B CE1 1 
ATOM   8666 N  NE2 . HIS H 4 168 ? 36.63282 12.33865  -84.78090 1.000 189.80472 ? 168 HIS B NE2 1 
ATOM   8667 N  N   . GLY H 4 169 ? 40.62552 15.07693  -84.91649 1.000 188.05162 ? 169 GLY B N   1 
ATOM   8668 C  CA  . GLY H 4 169 ? 40.88387 16.30097  -85.66220 1.000 186.25625 ? 169 GLY B CA  1 
ATOM   8669 C  C   . GLY H 4 169 ? 40.06161 17.48466  -85.19556 1.000 180.42742 ? 169 GLY B C   1 
ATOM   8670 O  O   . GLY H 4 169 ? 38.88172 17.60658  -85.54401 1.000 179.48328 ? 169 GLY B O   1 
ATOM   8671 N  N   . ARG H 4 170 ? 40.66233 18.36800  -84.39498 1.000 176.42339 ? 170 ARG B N   1 
ATOM   8672 C  CA  . ARG H 4 170 ? 39.89174 19.43419  -83.75320 1.000 172.56832 ? 170 ARG B CA  1 
ATOM   8673 C  C   . ARG H 4 170 ? 40.72291 20.70838  -83.64809 1.000 172.13120 ? 170 ARG B C   1 
ATOM   8674 O  O   . ARG H 4 170 ? 41.67694 20.76764  -82.86885 1.000 170.51164 ? 170 ARG B O   1 
ATOM   8675 C  CB  . ARG H 4 170 ? 39.40666 18.98517  -82.37715 1.000 168.61890 ? 170 ARG B CB  1 
ATOM   8676 C  CG  . ARG H 4 170 ? 38.50250 17.76071  -82.40670 1.000 166.29849 ? 170 ARG B CG  1 
ATOM   8677 C  CD  . ARG H 4 170 ? 37.04523 18.15164  -82.60080 1.000 165.74008 ? 170 ARG B CD  1 
ATOM   8678 N  NE  . ARG H 4 170 ? 36.20148 16.98541  -82.84601 1.000 165.27125 ? 170 ARG B NE  1 
ATOM   8679 C  CZ  . ARG H 4 170 ? 34.88098 16.96616  -82.69265 1.000 165.59670 ? 170 ARG B CZ  1 
ATOM   8680 N  NH1 . ARG H 4 170 ? 34.24081 18.05316  -82.28161 1.000 166.04605 ? 170 ARG B NH1 1 
ATOM   8681 N  NH2 . ARG H 4 170 ? 34.20134 15.85423  -82.94100 1.000 166.10051 ? 170 ARG B NH2 1 
ATOM   8682 N  N   . LYS H 4 171 ? 40.34204 21.73131  -84.41147 1.000 174.63740 ? 171 LYS B N   1 
ATOM   8683 C  CA  . LYS H 4 171 ? 40.89593 23.07388  -84.28161 1.000 175.82643 ? 171 LYS B CA  1 
ATOM   8684 C  C   . LYS H 4 171 ? 39.73733 24.05909  -84.23220 1.000 186.22281 ? 171 LYS B C   1 
ATOM   8685 O  O   . LYS H 4 171 ? 39.01994 24.22158  -85.22409 1.000 189.70600 ? 171 LYS B O   1 
ATOM   8686 C  CB  . LYS H 4 171 ? 41.83525 23.42155  -85.43740 1.000 172.19323 ? 171 LYS B CB  1 
ATOM   8687 C  CG  . LYS H 4 171 ? 42.18216 24.91463  -85.49689 1.000 168.44312 ? 171 LYS B CG  1 
ATOM   8688 C  CD  . LYS H 4 171 ? 42.66814 25.37182  -86.87062 1.000 167.80483 ? 171 LYS B CD  1 
ATOM   8689 C  CE  . LYS H 4 171 ? 41.53447 25.46233  -87.88412 1.000 169.42353 ? 171 LYS B CE  1 
ATOM   8690 N  NZ  . LYS H 4 171 ? 40.65708 26.64492  -87.66215 1.000 170.28611 ? 171 LYS B NZ  1 
ATOM   8691 N  N   . SER H 4 172 ? 39.55131 24.71567  -83.08860 1.000 192.70160 ? 172 SER B N   1 
ATOM   8692 C  CA  . SER H 4 172 ? 38.53385 25.74899  -82.99291 1.000 193.37082 ? 172 SER B CA  1 
ATOM   8693 C  C   . SER H 4 172 ? 38.98085 26.99281  -83.74934 1.000 195.09130 ? 172 SER B C   1 
ATOM   8694 O  O   . SER H 4 172 ? 40.17451 27.26617  -83.88705 1.000 195.77220 ? 172 SER B O   1 
ATOM   8695 C  CB  . SER H 4 172 ? 38.25207 26.09973  -81.53332 1.000 191.60888 ? 172 SER B CB  1 
ATOM   8696 O  OG  . SER H 4 172 ? 37.23525 27.08202  -81.45340 1.000 193.25229 ? 172 SER B OG  1 
ATOM   8697 N  N   . ALA H 4 173 ? 38.00793 27.75222  -84.24899 1.000 197.23924 ? 173 ALA B N   1 
ATOM   8698 C  CA  . ALA H 4 173 ? 38.30962 28.94646  -85.03833 1.000 195.93334 ? 173 ALA B CA  1 
ATOM   8699 C  C   . ALA H 4 173 ? 38.43342 30.16047  -84.11553 1.000 193.10660 ? 173 ALA B C   1 
ATOM   8700 O  O   . ALA H 4 173 ? 37.62748 31.09254  -84.13495 1.000 194.60168 ? 173 ALA B O   1 
ATOM   8701 C  CB  . ALA H 4 173 ? 37.25039 29.15818  -86.11225 1.000 198.76983 ? 173 ALA B CB  1 
ATOM   8702 N  N   . ARG H 4 174 ? 39.47697 30.13356  -83.28893 1.000 187.35758 ? 174 ARG B N   1 
ATOM   8703 C  CA  . ARG H 4 174 ? 39.86017 31.28418  -82.48158 1.000 187.52064 ? 174 ARG B CA  1 
ATOM   8704 C  C   . ARG H 4 174 ? 41.30054 31.65393  -82.81001 1.000 194.48672 ? 174 ARG B C   1 
ATOM   8705 O  O   . ARG H 4 174 ? 42.19493 30.80296  -82.75441 1.000 193.24854 ? 174 ARG B O   1 
ATOM   8706 C  CB  . ARG H 4 174 ? 39.68506 31.01769  -80.97609 1.000 179.05115 ? 174 ARG B CB  1 
ATOM   8707 C  CG  . ARG H 4 174 ? 40.48219 29.85358  -80.38687 1.000 172.71066 ? 174 ARG B CG  1 
ATOM   8708 C  CD  . ARG H 4 174 ? 40.57349 29.98890  -78.86667 1.000 166.79798 ? 174 ARG B CD  1 
ATOM   8709 N  NE  . ARG H 4 174 ? 40.57933 28.70161  -78.17657 1.000 162.14187 ? 174 ARG B NE  1 
ATOM   8710 C  CZ  . ARG H 4 174 ? 40.48126 28.56382  -76.85660 1.000 158.37080 ? 174 ARG B CZ  1 
ATOM   8711 N  NH1 . ARG H 4 174 ? 40.37073 29.63752  -76.08221 1.000 157.55232 ? 174 ARG B NH1 1 
ATOM   8712 N  NH2 . ARG H 4 174 ? 40.48887 27.35619  -76.30767 1.000 156.15168 ? 174 ARG B NH2 1 
ATOM   8713 N  N   . GLY H 4 175 ? 41.51582 32.91206  -83.18553 1.000 176.82073 ? 175 GLY B N   1 
ATOM   8714 C  CA  . GLY H 4 175 ? 42.83788 33.38831  -83.50777 1.000 170.36675 ? 175 GLY B CA  1 
ATOM   8715 C  C   . GLY H 4 175 ? 43.58558 33.80674  -82.26126 1.000 164.79421 ? 175 GLY B C   1 
ATOM   8716 O  O   . GLY H 4 175 ? 43.14027 33.55988  -81.13535 1.000 163.56997 ? 175 GLY B O   1 
ATOM   8717 N  N   . PRO H 4 176 ? 44.75322 34.44570  -82.43988 1.000 160.21205 ? 176 PRO B N   1 
ATOM   8718 C  CA  . PRO H 4 176 ? 45.49009 34.98857  -81.28703 1.000 156.69453 ? 176 PRO B CA  1 
ATOM   8719 C  C   . PRO H 4 176 ? 44.63623 35.92893  -80.44608 1.000 154.86645 ? 176 PRO B C   1 
ATOM   8720 O  O   . PRO H 4 176 ? 43.60753 36.41168  -80.92743 1.000 155.47429 ? 176 PRO B O   1 
ATOM   8721 C  CB  . PRO H 4 176 ? 46.66715 35.72169  -81.94268 1.000 157.79447 ? 176 PRO B CB  1 
ATOM   8722 C  CG  . PRO H 4 176 ? 46.87789 34.99292  -83.23922 1.000 158.28827 ? 176 PRO B CG  1 
ATOM   8723 C  CD  . PRO H 4 176 ? 45.50441 34.58705  -83.70082 1.000 160.00445 ? 176 PRO B CD  1 
ATOM   8724 N  N   . HIS H 4 177 ? 45.05292 36.18955  -79.20357 1.000 151.90950 ? 177 HIS B N   1 
ATOM   8725 C  CA  . HIS H 4 177 ? 44.29647 36.97645  -78.20980 1.000 151.59899 ? 177 HIS B CA  1 
ATOM   8726 C  C   . HIS H 4 177 ? 42.82368 36.58640  -78.11777 1.000 150.94085 ? 177 HIS B C   1 
ATOM   8727 O  O   . HIS H 4 177 ? 42.00607 37.34251  -77.59215 1.000 151.43185 ? 177 HIS B O   1 
ATOM   8728 C  CB  . HIS H 4 177 ? 44.41460 38.49033  -78.48385 1.000 153.52954 ? 177 HIS B CB  1 
ATOM   8729 C  CG  . HIS H 4 177 ? 43.77098 38.94886  -79.76076 1.000 156.80976 ? 177 HIS B CG  1 
ATOM   8730 N  ND1 . HIS H 4 177 ? 42.40583 38.93365  -79.96436 1.000 158.15470 ? 177 HIS B ND1 1 
ATOM   8731 C  CD2 . HIS H 4 177 ? 44.31292 39.44648  -80.89906 1.000 158.20982 ? 177 HIS B CD2 1 
ATOM   8732 C  CE1 . HIS H 4 177 ? 42.13627 39.39353  -81.17429 1.000 159.49491 ? 177 HIS B CE1 1 
ATOM   8733 N  NE2 . HIS H 4 177 ? 43.27586 39.71264  -81.76174 1.000 159.56591 ? 177 HIS B NE2 1 
ATOM   8734 N  N   . GLN H 4 200 ? 48.63368 17.83957  -83.26362 1.000 101.37205 ? 200 GLN B N   1 
ATOM   8735 C  CA  . GLN H 4 200 ? 49.20109 19.03017  -82.62991 1.000 102.45338 ? 200 GLN B CA  1 
ATOM   8736 C  C   . GLN H 4 200 ? 50.26039 18.60778  -81.60345 1.000 105.45148 ? 200 GLN B C   1 
ATOM   8737 O  O   . GLN H 4 200 ? 51.18346 19.36045  -81.29314 1.000 101.20234 ? 200 GLN B O   1 
ATOM   8738 C  CB  . GLN H 4 200 ? 48.11329 19.91110  -81.99269 1.000 99.64686  ? 200 GLN B CB  1 
ATOM   8739 C  CG  . GLN H 4 200 ? 48.66136 21.13807  -81.24087 1.000 95.15566  ? 200 GLN B CG  1 
ATOM   8740 C  CD  . GLN H 4 200 ? 47.60049 22.20999  -80.97413 1.000 93.70091  ? 200 GLN B CD  1 
ATOM   8741 O  OE1 . GLN H 4 200 ? 46.43429 22.04190  -81.33481 1.000 95.74674  ? 200 GLN B OE1 1 
ATOM   8742 N  NE2 . GLN H 4 200 ? 48.01670 23.33711  -80.38730 1.000 89.33684  ? 200 GLN B NE2 1 
ATOM   8743 N  N   . VAL H 4 201 ? 50.08151 17.43224  -81.01134 1.000 110.63318 ? 201 VAL B N   1 
ATOM   8744 C  CA  . VAL H 4 201 ? 51.03888 16.90133  -80.05204 1.000 115.24515 ? 201 VAL B CA  1 
ATOM   8745 C  C   . VAL H 4 201 ? 51.56119 15.58356  -80.59566 1.000 125.46337 ? 201 VAL B C   1 
ATOM   8746 O  O   . VAL H 4 201 ? 50.89549 14.90999  -81.38913 1.000 131.08713 ? 201 VAL B O   1 
ATOM   8747 C  CB  . VAL H 4 201 ? 50.43163 16.70163  -78.65285 1.000 106.07362 ? 201 VAL B CB  1 
ATOM   8748 C  CG1 . VAL H 4 201 ? 49.82384 17.98056  -78.17406 1.000 105.95359 ? 201 VAL B CG1 1 
ATOM   8749 C  CG2 . VAL H 4 201 ? 49.38920 15.63753  -78.70644 1.000 104.94659 ? 201 VAL B CG2 1 
ATOM   8750 N  N   . THR H 4 202 ? 52.77899 15.23940  -80.20014 1.000 131.88126 ? 202 THR B N   1 
ATOM   8751 C  CA  . THR H 4 202 ? 53.38659 13.97851  -80.59661 1.000 138.97668 ? 202 THR B CA  1 
ATOM   8752 C  C   . THR H 4 202 ? 52.98580 12.88024  -79.61492 1.000 142.92801 ? 202 THR B C   1 
ATOM   8753 O  O   . THR H 4 202 ? 52.90108 13.12230  -78.40583 1.000 148.25879 ? 202 THR B O   1 
ATOM   8754 C  CB  . THR H 4 202 ? 54.90738 14.12419  -80.61661 1.000 141.64832 ? 202 THR B CB  1 
ATOM   8755 O  OG1 . THR H 4 202 ? 55.36205 14.49259  -79.30704 1.000 144.48474 ? 202 THR B OG1 1 
ATOM   8756 C  CG2 . THR H 4 202 ? 55.32073 15.21045  -81.59701 1.000 142.39651 ? 202 THR B CG2 1 
ATOM   8757 N  N   . LEU H 4 203 ? 52.72634 11.67370  -80.13352 1.000 134.74024 ? 203 LEU B N   1 
ATOM   8758 C  CA  . LEU H 4 203 ? 52.29229 10.57923  -79.26556 1.000 124.87087 ? 203 LEU B CA  1 
ATOM   8759 C  C   . LEU H 4 203 ? 53.48378 10.01777  -78.49048 1.000 114.71466 ? 203 LEU B C   1 
ATOM   8760 O  O   . LEU H 4 203 ? 54.62530 10.09552  -78.95431 1.000 113.73674 ? 203 LEU B O   1 
ATOM   8761 C  CB  . LEU H 4 203 ? 51.62106 9.47515   -80.08135 1.000 121.16402 ? 203 LEU B CB  1 
ATOM   8762 C  CG  . LEU H 4 203 ? 50.13793 9.61710   -80.45015 1.000 119.39109 ? 203 LEU B CG  1 
ATOM   8763 C  CD1 . LEU H 4 203 ? 49.25082 9.22236   -79.25517 1.000 117.28479 ? 203 LEU B CD1 1 
ATOM   8764 C  CD2 . LEU H 4 203 ? 49.80389 11.02156  -80.95595 1.000 118.70674 ? 203 LEU B CD2 1 
ATOM   8765 N  N   . PRO H 4 204 ? 53.25099 9.38062   -77.34278 1.000 108.78165 ? 204 PRO B N   1 
ATOM   8766 C  CA  . PRO H 4 204 ? 54.38688 8.86329   -76.57665 1.000 104.36274 ? 204 PRO B CA  1 
ATOM   8767 C  C   . PRO H 4 204 ? 54.90926 7.55649   -77.13952 1.000 105.48041 ? 204 PRO B C   1 
ATOM   8768 O  O   . PRO H 4 204 ? 54.17447 6.74304   -77.70468 1.000 105.01284 ? 204 PRO B O   1 
ATOM   8769 C  CB  . PRO H 4 204 ? 53.80574 8.65241   -75.17257 1.000 102.41253 ? 204 PRO B CB  1 
ATOM   8770 C  CG  . PRO H 4 204 ? 52.35395 8.41758   -75.39580 1.000 104.11556 ? 204 PRO B CG  1 
ATOM   8771 C  CD  . PRO H 4 204 ? 51.96445 9.15563   -76.65489 1.000 105.87813 ? 204 PRO B CD  1 
ATOM   8772 N  N   . SER H 4 205 ? 56.19513 7.33559   -76.91476 1.000 107.31676 ? 205 SER B N   1 
ATOM   8773 C  CA  . SER H 4 205 ? 56.84847 6.10428   -77.32508 1.000 108.63912 ? 205 SER B CA  1 
ATOM   8774 C  C   . SER H 4 205 ? 56.64425 5.08698   -76.21137 1.000 113.05274 ? 205 SER B C   1 
ATOM   8775 O  O   . SER H 4 205 ? 57.08648 5.30809   -75.08034 1.000 114.21813 ? 205 SER B O   1 
ATOM   8776 C  CB  . SER H 4 205 ? 58.32502 6.36571   -77.61012 1.000 106.39897 ? 205 SER B CB  1 
ATOM   8777 O  OG  . SER H 4 205 ? 58.94708 6.93877   -76.47226 1.000 102.44911 ? 205 SER B OG  1 
ATOM   8778 N  N   . ARG H 4 206 ? 55.95199 3.98395   -76.52218 1.000 115.67812 ? 206 ARG B N   1 
ATOM   8779 C  CA  . ARG H 4 206 ? 55.41303 3.14617   -75.44260 1.000 123.55193 ? 206 ARG B CA  1 
ATOM   8780 C  C   . ARG H 4 206 ? 56.48430 2.39291   -74.66399 1.000 118.55445 ? 206 ARG B C   1 
ATOM   8781 O  O   . ARG H 4 206 ? 56.11678 1.53465   -73.83861 1.000 122.87298 ? 206 ARG B O   1 
ATOM   8782 C  CB  . ARG H 4 206 ? 54.36879 2.16850   -75.99203 1.000 134.27926 ? 206 ARG B CB  1 
ATOM   8783 C  CG  . ARG H 4 206 ? 53.24208 1.83163   -74.99910 1.000 141.67792 ? 206 ARG B CG  1 
ATOM   8784 C  CD  . ARG H 4 206 ? 53.13784 2.85400   -73.85304 1.000 144.22820 ? 206 ARG B CD  1 
ATOM   8785 N  NE  . ARG H 4 206 ? 52.08424 3.84798   -74.05173 1.000 146.75747 ? 206 ARG B NE  1 
ATOM   8786 C  CZ  . ARG H 4 206 ? 50.85629 3.75134   -73.54512 1.000 150.36596 ? 206 ARG B CZ  1 
ATOM   8787 N  NH1 . ARG H 4 206 ? 50.51414 2.69891   -72.80917 1.000 150.55833 ? 206 ARG B NH1 1 
ATOM   8788 N  NH2 . ARG H 4 206 ? 49.96620 4.70876   -73.77473 1.000 149.78888 ? 206 ARG B NH2 1 
ATOM   8789 N  N   . VAL H 4 207 ? 57.77024 2.67021   -74.85482 1.000 106.93382 ? 207 VAL B N   1 
ATOM   8790 C  CA  . VAL H 4 207 ? 58.80397 2.16730   -73.95946 1.000 96.11331  ? 207 VAL B CA  1 
ATOM   8791 C  C   . VAL H 4 207 ? 58.97573 3.17144   -72.82812 1.000 86.12753  ? 207 VAL B C   1 
ATOM   8792 O  O   . VAL H 4 207 ? 59.54001 4.25146   -73.02931 1.000 85.78608  ? 207 VAL B O   1 
ATOM   8793 C  CB  . VAL H 4 207 ? 60.12618 1.94458   -74.69142 1.000 90.57650  ? 207 VAL B CB  1 
ATOM   8794 C  CG1 . VAL H 4 207 ? 61.18918 1.50101   -73.69688 1.000 89.43251  ? 207 VAL B CG1 1 
ATOM   8795 C  CG2 . VAL H 4 207 ? 59.92721 0.91809   -75.76176 1.000 91.68866  ? 207 VAL B CG2 1 
ATOM   8796 N  N   . HIS H 4 208 ? 58.55222 2.78449   -71.62523 1.000 79.91185  ? 208 HIS B N   1 
ATOM   8797 C  CA  . HIS H 4 208 ? 58.58973 3.67601   -70.47729 1.000 71.57316  ? 208 HIS B CA  1 
ATOM   8798 C  C   . HIS H 4 208 ? 60.00035 4.18015   -70.20796 1.000 69.11605  ? 208 HIS B C   1 
ATOM   8799 O  O   . HIS H 4 208 ? 60.99568 3.64773   -70.70905 1.000 65.57109  ? 208 HIS B O   1 
ATOM   8800 C  CB  . HIS H 4 208 ? 58.12319 2.96421   -69.21087 1.000 70.74902  ? 208 HIS B CB  1 
ATOM   8801 C  CG  . HIS H 4 208 ? 56.66989 2.65446   -69.18575 1.000 71.31649  ? 208 HIS B CG  1 
ATOM   8802 N  ND1 . HIS H 4 208 ? 55.70485 3.61918   -69.36392 1.000 75.71844  ? 208 HIS B ND1 1 
ATOM   8803 C  CD2 . HIS H 4 208 ? 56.01249 1.49121   -68.98048 1.000 72.11797  ? 208 HIS B CD2 1 
ATOM   8804 C  CE1 . HIS H 4 208 ? 54.51168 3.05990   -69.28276 1.000 78.48958  ? 208 HIS B CE1 1 
ATOM   8805 N  NE2 . HIS H 4 208 ? 54.67067 1.76909   -69.05043 1.000 76.51794  ? 208 HIS B NE2 1 
ATOM   8806 N  N   . PHE H 4 209 ? 60.07603 5.24749   -69.30705 1.000 67.16643  ? 209 PHE B N   1 
ATOM   8807 C  CA  . PHE H 4 209 ? 61.40065 5.60910   -68.84034 1.000 63.61448  ? 209 PHE B CA  1 
ATOM   8808 C  C   . PHE H 4 209 ? 61.66479 4.94158   -67.49414 1.000 63.65546  ? 209 PHE B C   1 
ATOM   8809 O  O   . PHE H 4 209 ? 60.72869 4.55036   -66.78735 1.000 66.23563  ? 209 PHE B O   1 
ATOM   8810 C  CB  . PHE H 4 209 ? 61.55457 7.12832   -68.72226 1.000 59.29231  ? 209 PHE B CB  1 
ATOM   8811 C  CG  . PHE H 4 209 ? 61.59245 7.84394   -70.05695 1.000 59.74945  ? 209 PHE B CG  1 
ATOM   8812 C  CD1 . PHE H 4 209 ? 62.67437 7.68452   -70.91861 1.000 57.33822  ? 209 PHE B CD1 1 
ATOM   8813 C  CD2 . PHE H 4 209 ? 60.55330 8.68260   -70.45076 1.000 61.88566  ? 209 PHE B CD2 1 
ATOM   8814 C  CE1 . PHE H 4 209 ? 62.71228 8.33122   -72.14869 1.000 55.70497  ? 209 PHE B CE1 1 
ATOM   8815 C  CE2 . PHE H 4 209 ? 60.59097 9.33440   -71.68266 1.000 60.63717  ? 209 PHE B CE2 1 
ATOM   8816 C  CZ  . PHE H 4 209 ? 61.67177 9.15477   -72.52775 1.000 56.98651  ? 209 PHE B CZ  1 
ATOM   8817 N  N   . PRO H 4 210 ? 62.92481 4.70424   -67.14713 1.000 61.06770  ? 210 PRO B N   1 
ATOM   8818 C  CA  . PRO H 4 210 ? 63.21080 4.09386   -65.84978 1.000 60.66887  ? 210 PRO B CA  1 
ATOM   8819 C  C   . PRO H 4 210 ? 62.79253 5.06357   -64.76662 1.000 63.64002  ? 210 PRO B C   1 
ATOM   8820 O  O   . PRO H 4 210 ? 63.24963 6.21130   -64.72422 1.000 66.91698  ? 210 PRO B O   1 
ATOM   8821 C  CB  . PRO H 4 210 ? 64.72710 3.88711   -65.87788 1.000 60.13184  ? 210 PRO B CB  1 
ATOM   8822 C  CG  . PRO H 4 210 ? 65.21777 4.91304   -66.81451 1.000 62.21378  ? 210 PRO B CG  1 
ATOM   8823 C  CD  . PRO H 4 210 ? 64.15889 5.04154   -67.86963 1.000 63.41641  ? 210 PRO B CD  1 
ATOM   8824 N  N   . SER H 4 211 ? 61.87428 4.62133   -63.92292 1.000 63.70150  ? 211 SER B N   1 
ATOM   8825 C  CA  . SER H 4 211 ? 61.40122 5.43401   -62.81862 1.000 63.44484  ? 211 SER B CA  1 
ATOM   8826 C  C   . SER H 4 211 ? 61.70261 4.70768   -61.52358 1.000 63.06572  ? 211 SER B C   1 
ATOM   8827 O  O   . SER H 4 211 ? 61.30433 3.54945   -61.34966 1.000 66.83467  ? 211 SER B O   1 
ATOM   8828 C  CB  . SER H 4 211 ? 59.90928 5.72392   -62.93528 1.000 65.20643  ? 211 SER B CB  1 
ATOM   8829 O  OG  . SER H 4 211 ? 59.46601 6.41591   -61.78524 1.000 67.76736  ? 211 SER B OG  1 
ATOM   8830 N  N   . LEU H 4 212 ? 62.41260 5.38708   -60.62747 1.000 59.81491  ? 212 LEU B N   1 
ATOM   8831 C  CA  . LEU H 4 212 ? 62.66808 4.82313   -59.31218 1.000 59.51810  ? 212 LEU B CA  1 
ATOM   8832 C  C   . LEU H 4 212 ? 61.40678 4.80764   -58.45247 1.000 58.05037  ? 212 LEU B C   1 
ATOM   8833 O  O   . LEU H 4 212 ? 61.25322 3.92643   -57.59920 1.000 58.36723  ? 212 LEU B O   1 
ATOM   8834 C  CB  . LEU H 4 212 ? 63.77845 5.60972   -58.62452 1.000 59.51563  ? 212 LEU B CB  1 
ATOM   8835 C  CG  . LEU H 4 212 ? 65.07375 5.54921   -59.42653 1.000 61.37119  ? 212 LEU B CG  1 
ATOM   8836 C  CD1 . LEU H 4 212 ? 66.11555 6.49324   -58.85651 1.000 57.61159  ? 212 LEU B CD1 1 
ATOM   8837 C  CD2 . LEU H 4 212 ? 65.60025 4.11545   -59.48024 1.000 66.44365  ? 212 LEU B CD2 1 
ATOM   8838 N  N   . ALA H 4 213 ? 60.49018 5.75778   -58.65057 1.000 56.57757  ? 213 ALA B N   1 
ATOM   8839 C  CA  . ALA H 4 213 ? 59.22336 5.66601   -57.93484 1.000 58.59500  ? 213 ALA B CA  1 
ATOM   8840 C  C   . ALA H 4 213 ? 58.50498 4.37448   -58.29164 1.000 64.57157  ? 213 ALA B C   1 
ATOM   8841 O  O   . ALA H 4 213 ? 57.95073 3.70036   -57.41416 1.000 67.44857  ? 213 ALA B O   1 
ATOM   8842 C  CB  . ALA H 4 213 ? 58.33731 6.87323   -58.23096 1.000 58.53853  ? 213 ALA B CB  1 
ATOM   8843 N  N   . TYR H 4 214 ? 58.56540 3.97542   -59.56521 1.000 65.73076  ? 214 TYR B N   1 
ATOM   8844 C  CA  . TYR H 4 214 ? 57.98221 2.69922   -59.95756 1.000 65.89668  ? 214 TYR B CA  1 
ATOM   8845 C  C   . TYR H 4 214 ? 58.72714 1.54059   -59.30635 1.000 66.95906  ? 214 TYR B C   1 
ATOM   8846 O  O   . TYR H 4 214 ? 58.10613 0.56890   -58.85635 1.000 68.95373  ? 214 TYR B O   1 
ATOM   8847 C  CB  . TYR H 4 214 ? 57.99934 2.56011   -61.48476 1.000 66.15120  ? 214 TYR B CB  1 
ATOM   8848 C  CG  . TYR H 4 214 ? 57.52625 1.20315   -61.94502 1.000 66.34083  ? 214 TYR B CG  1 
ATOM   8849 C  CD1 . TYR H 4 214 ? 56.17342 0.91946   -62.07226 1.000 67.57104  ? 214 TYR B CD1 1 
ATOM   8850 C  CD2 . TYR H 4 214 ? 58.43922 0.18214   -62.19681 1.000 63.93785  ? 214 TYR B CD2 1 
ATOM   8851 C  CE1 . TYR H 4 214 ? 55.74365 -0.34300  -62.46997 1.000 68.66238  ? 214 TYR B CE1 1 
ATOM   8852 C  CE2 . TYR H 4 214 ? 58.02105 -1.07151  -62.58518 1.000 63.58217  ? 214 TYR B CE2 1 
ATOM   8853 C  CZ  . TYR H 4 214 ? 56.67509 -1.33329  -62.72311 1.000 66.73406  ? 214 TYR B CZ  1 
ATOM   8854 O  OH  . TYR H 4 214 ? 56.25873 -2.58849  -63.11492 1.000 68.49883  ? 214 TYR B OH  1 
ATOM   8855 N  N   . LEU H 4 215 ? 60.05713 1.65307   -59.21441 1.000 65.01142  ? 215 LEU B N   1 
ATOM   8856 C  CA  . LEU H 4 215 ? 60.89417 0.56746   -58.70675 1.000 64.83964  ? 215 LEU B CA  1 
ATOM   8857 C  C   . LEU H 4 215 ? 60.64709 0.29859   -57.22113 1.000 70.82492  ? 215 LEU B C   1 
ATOM   8858 O  O   . LEU H 4 215 ? 60.70167 -0.85591  -56.77530 1.000 71.73289  ? 215 LEU B O   1 
ATOM   8859 C  CB  . LEU H 4 215 ? 62.37100 0.89122   -58.95100 1.000 57.78828  ? 215 LEU B CB  1 
ATOM   8860 C  CG  . LEU H 4 215 ? 63.33975 -0.03488  -58.20833 1.000 55.42097  ? 215 LEU B CG  1 
ATOM   8861 C  CD1 . LEU H 4 215 ? 63.17032 -1.48250  -58.68171 1.000 56.89385  ? 215 LEU B CD1 1 
ATOM   8862 C  CD2 . LEU H 4 215 ? 64.78976 0.41217   -58.34248 1.000 52.95191  ? 215 LEU B CD2 1 
ATOM   8863 N  N   . CYS H 4 216 ? 60.40297 1.34330   -56.43094 1.000 73.00761  ? 216 CYS B N   1 
ATOM   8864 C  CA  . CYS H 4 216 ? 60.24205 1.18497   -54.99350 1.000 74.74823  ? 216 CYS B CA  1 
ATOM   8865 C  C   . CYS H 4 216 ? 58.79342 1.24149   -54.54495 1.000 81.15748  ? 216 CYS B C   1 
ATOM   8866 O  O   . CYS H 4 216 ? 58.53801 1.18262   -53.33844 1.000 83.27987  ? 216 CYS B O   1 
ATOM   8867 C  CB  . CYS H 4 216 ? 61.03753 2.25037   -54.25234 1.000 71.69589  ? 216 CYS B CB  1 
ATOM   8868 S  SG  . CYS H 4 216 ? 62.73035 2.33365   -54.79058 1.000 70.43873  ? 216 CYS B SG  1 
ATOM   8869 N  N   . GLY H 4 217 ? 57.84323 1.33796   -55.46337 1.000 86.81423  ? 217 GLY B N   1 
ATOM   8870 C  CA  . GLY H 4 217 ? 56.46253 1.52859   -55.10449 1.000 93.27892  ? 217 GLY B CA  1 
ATOM   8871 C  C   . GLY H 4 217 ? 55.69839 0.22589   -55.19333 1.000 99.24675  ? 217 GLY B C   1 
ATOM   8872 O  O   . GLY H 4 217 ? 55.54486 -0.34835  -56.27425 1.000 99.94614  ? 217 GLY B O   1 
ATOM   8873 N  N   . THR H 4 218 ? 55.21186 -0.23484  -54.04409 1.000 106.27759 ? 218 THR B N   1 
ATOM   8874 C  CA  . THR H 4 218 ? 54.23586 -1.31784  -53.98765 1.000 112.84797 ? 218 THR B CA  1 
ATOM   8875 C  C   . THR H 4 218 ? 52.86325 -0.73841  -54.32807 1.000 121.14175 ? 218 THR B C   1 
ATOM   8876 O  O   . THR H 4 218 ? 51.96198 -0.64954  -53.49052 1.000 125.83746 ? 218 THR B O   1 
ATOM   8877 C  CB  . THR H 4 218 ? 54.24264 -1.97396  -52.61357 1.000 115.65299 ? 218 THR B CB  1 
ATOM   8878 O  OG1 . THR H 4 218 ? 54.03219 -0.97317  -51.61001 1.000 115.29881 ? 218 THR B OG1 1 
ATOM   8879 C  CG2 . THR H 4 218 ? 55.57867 -2.69626  -52.35482 1.000 114.62653 ? 218 THR B CG2 1 
ATOM   8880 N  N   . LEU H 4 219 ? 52.72856 -0.31358  -55.59164 1.000 124.15745 ? 219 LEU B N   1 
ATOM   8881 C  CA  . LEU H 4 219 ? 51.49391 0.31562   -56.05612 1.000 129.27759 ? 219 LEU B CA  1 
ATOM   8882 C  C   . LEU H 4 219 ? 50.26721 -0.49772  -55.67441 1.000 137.12750 ? 219 LEU B C   1 
ATOM   8883 O  O   . LEU H 4 219 ? 49.20405 0.06937   -55.39820 1.000 138.50345 ? 219 LEU B O   1 
ATOM   8884 C  CB  . LEU H 4 219 ? 51.55311 0.51106   -57.57911 1.000 129.07863 ? 219 LEU B CB  1 
ATOM   8885 C  CG  . LEU H 4 219 ? 51.58475 -0.74175  -58.47325 1.000 128.54793 ? 219 LEU B CG  1 
ATOM   8886 C  CD1 . LEU H 4 219 ? 50.17887 -1.13028  -58.96860 1.000 129.63583 ? 219 LEU B CD1 1 
ATOM   8887 C  CD2 . LEU H 4 219 ? 52.57632 -0.60235  -59.64073 1.000 125.99603 ? 219 LEU B CD2 1 
ATOM   8888 N  N   . ALA H 4 220 ? 50.40001 -1.82417  -55.63739 1.000 142.23374 ? 220 ALA B N   1 
ATOM   8889 C  CA  . ALA H 4 220 ? 49.30059 -2.71095  -55.27429 1.000 144.60338 ? 220 ALA B CA  1 
ATOM   8890 C  C   . ALA H 4 220 ? 49.12066 -2.76768  -53.76047 1.000 144.93572 ? 220 ALA B C   1 
ATOM   8891 O  O   . ALA H 4 220 ? 48.56429 -1.84995  -53.15480 1.000 145.05799 ? 220 ALA B O   1 
ATOM   8892 C  CB  . ALA H 4 220 ? 49.53765 -4.11346  -55.83770 1.000 145.32062 ? 220 ALA B CB  1 
HETATM 8893 ZN ZN  . ZN  I 5 .   ? 54.29810 17.41846  -3.08562  1.000 79.61923  ? 301 ZN  F ZN  1 
HETATM 8894 C  C1  . GOL J 6 .   ? 51.24054 2.18446   -0.89306  1.000 97.34089  ? 302 GOL F C1  1 
HETATM 8895 O  O1  . GOL J 6 .   ? 49.98034 2.77793   -0.65039  1.000 96.22073  ? 302 GOL F O1  1 
HETATM 8896 C  C2  . GOL J 6 .   ? 52.30824 3.18249   -1.35393  1.000 98.46062  ? 302 GOL F C2  1 
HETATM 8897 O  O2  . GOL J 6 .   ? 51.99728 4.51377   -0.99184  1.000 100.27889 ? 302 GOL F O2  1 
HETATM 8898 C  C3  . GOL J 6 .   ? 53.63817 2.79087   -0.72001  1.000 97.72262  ? 302 GOL F C3  1 
HETATM 8899 O  O3  . GOL J 6 .   ? 54.59113 3.79896   -0.95628  1.000 98.93884  ? 302 GOL F O3  1 
HETATM 8900 O  O1  . MES K 7 .   ? 69.98305 -19.86351 -49.65103 1.000 132.66335 ? 201 MES A O1  1 
HETATM 8901 C  C2  . MES K 7 .   ? 70.44133 -18.77183 -50.44739 1.000 132.52928 ? 201 MES A C2  1 
HETATM 8902 C  C3  . MES K 7 .   ? 71.96705 -18.69485 -50.44580 1.000 133.04966 ? 201 MES A C3  1 
HETATM 8903 N  N4  . MES K 7 .   ? 72.47937 -18.81606 -49.08201 1.000 134.90162 ? 201 MES A N4  1 
HETATM 8904 C  C5  . MES K 7 .   ? 71.89499 -19.81065 -48.18388 1.000 133.21433 ? 201 MES A C5  1 
HETATM 8905 C  C6  . MES K 7 .   ? 70.37879 -19.72822 -48.28869 1.000 132.45462 ? 201 MES A C6  1 
HETATM 8906 C  C7  . MES K 7 .   ? 73.92574 -18.62179 -48.99823 1.000 139.68204 ? 201 MES A C7  1 
HETATM 8907 C  C8  . MES K 7 .   ? 74.41043 -18.92484 -47.57668 1.000 145.74556 ? 201 MES A C8  1 
HETATM 8908 S  S   . MES K 7 .   ? 75.49264 -20.19936 -47.56159 1.000 153.68923 ? 201 MES A S   1 
HETATM 8909 O  O1S . MES K 7 .   ? 74.86211 -21.42876 -48.09828 1.000 154.10987 ? 201 MES A O1S 1 
HETATM 8910 O  O2S . MES K 7 .   ? 76.68930 -19.83784 -48.35538 1.000 154.29644 ? 201 MES A O2S 1 
HETATM 8911 O  O3S . MES K 7 .   ? 75.93298 -20.45774 -46.17262 1.000 153.75165 ? 201 MES A O3S 1 
HETATM 8912 ZN ZN  . ZN  L 5 .   ? 58.92035 17.07021  -67.62822 1.000 58.59923  ? 301 ZN  B ZN  1 
HETATM 8913 C  C1  . GOL M 6 .   ? 55.00293 2.84568   -64.66227 1.000 91.56723  ? 302 GOL B C1  1 
HETATM 8914 O  O1  . GOL M 6 .   ? 54.10046 2.28933   -65.59353 1.000 92.35934  ? 302 GOL B O1  1 
HETATM 8915 C  C2  . GOL M 6 .   ? 56.07177 3.66535   -65.37990 1.000 90.96774  ? 302 GOL B C2  1 
HETATM 8916 O  O2  . GOL M 6 .   ? 56.01129 5.01517   -64.96157 1.000 89.82730  ? 302 GOL B O2  1 
HETATM 8917 C  C3  . GOL M 6 .   ? 57.44673 3.05911   -65.09949 1.000 91.46351  ? 302 GOL B C3  1 
HETATM 8918 O  O3  . GOL M 6 .   ? 58.45903 3.86536   -65.66157 1.000 92.03078  ? 302 GOL B O3  1 
HETATM 8919 O  O   . HOH N 8 .   ? 40.53653 36.18655  -6.51600  1.000 54.65410  ? 201 HOH Z O   1 
HETATM 8920 O  O   . HOH O 8 .   ? 46.61914 12.85896  -7.08395  1.000 67.19005  ? 401 HOH F O   1 
HETATM 8921 O  O   . HOH P 8 .   ? 77.34544 -22.77950 -50.42970 1.000 61.09685  ? 301 HOH A O   1 
HETATM 8922 O  O   . HOH Q 8 .   ? 40.83525 44.16731  -48.63212 1.000 62.79480  ? 201 HOH E O   1 
HETATM 8923 O  O   . HOH R 8 .   ? 59.48336 -8.04029  -50.04735 1.000 65.25801  ? 401 HOH B O   1 
HETATM 8924 O  O   . HOH R 8 .   ? 51.41594 12.89059  -71.15586 1.000 58.76589  ? 402 HOH B O   1 
HETATM 8925 O  O   . HOH R 8 .   ? 80.55544 0.20214   -52.20004 1.000 57.37923  ? 403 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 6   ? 1.95514 1.81838 1.98450 0.24195  -0.19087 -0.03651 6   PRO C N   
2    C CA  . PRO A 6   ? 1.97853 1.84221 2.03170 0.24884  -0.18573 -0.04215 6   PRO C CA  
3    C C   . PRO A 6   ? 2.03495 1.90543 2.12144 0.26209  -0.19434 -0.07774 6   PRO C C   
4    O O   . PRO A 6   ? 2.08061 1.97815 2.18802 0.26350  -0.18580 -0.09557 6   PRO C O   
5    C CB  . PRO A 6   ? 1.90064 1.79756 1.96633 0.23827  -0.15284 -0.02351 6   PRO C CB  
6    C CG  . PRO A 6   ? 1.88070 1.78415 1.91956 0.22509  -0.14482 0.00295  6   PRO C CG  
7    C CD  . PRO A 6   ? 1.91063 1.80360 1.93642 0.22696  -0.16466 -0.01322 6   PRO C CD  
8    N N   . ASP A 7   ? 2.05053 1.89606 2.14094 0.27150  -0.21181 -0.08692 7   ASP C N   
9    C CA  . ASP A 7   ? 2.02389 1.87581 2.14704 0.28359  -0.22021 -0.11652 7   ASP C CA  
10   C C   . ASP A 7   ? 1.93515 1.81393 2.08726 0.28050  -0.19806 -0.11702 7   ASP C C   
11   O O   . ASP A 7   ? 1.91151 1.80187 2.09332 0.28857  -0.20221 -0.13967 7   ASP C O   
12   C CB  . ASP A 7   ? 2.07046 1.88318 2.18369 0.29313  -0.24929 -0.12418 7   ASP C CB  
13   C CG  . ASP A 7   ? 2.13152 1.91589 2.21499 0.29659  -0.27288 -0.12582 7   ASP C CG  
14   O OD1 . ASP A 7   ? 2.15533 1.95227 2.23258 0.29472  -0.26900 -0.12983 7   ASP C OD1 
15   O OD2 . ASP A 7   ? 2.15905 1.90726 2.22332 0.30028  -0.29518 -0.12277 7   ASP C OD2 
16   N N   . GLN A 8   ? 1.91652 1.80541 2.05932 0.26883  -0.17475 -0.09166 8   GLN C N   
17   C CA  . GLN A 8   ? 1.85625 1.76824 2.02095 0.26438  -0.15193 -0.08971 8   GLN C CA  
18   C C   . GLN A 8   ? 1.82232 1.77782 2.01904 0.26382  -0.13629 -0.10797 8   GLN C C   
19   O O   . GLN A 8   ? 1.80625 1.78135 2.02874 0.26398  -0.12567 -0.11821 8   GLN C O   
20   C CB  . GLN A 8   ? 1.80274 1.71320 1.94586 0.25292  -0.13018 -0.05638 8   GLN C CB  
21   C CG  . GLN A 8   ? 1.76120 1.63150 1.86913 0.25259  -0.14343 -0.03437 8   GLN C CG  
22   C CD  . GLN A 8   ? 1.69640 1.56847 1.78355 0.24251  -0.12020 0.00040  8   GLN C CD  
23   O OE1 . GLN A 8   ? 1.69452 1.54064 1.75168 0.24083  -0.12722 0.02277  8   GLN C OE1 
24   N NE2 . GLN A 8   ? 1.64856 1.55206 1.75147 0.23601  -0.09221 0.00574  8   GLN C NE2 
25   N N   . ARG A 9   ? 1.82839 1.79880 2.02220 0.26208  -0.13431 -0.11147 9   ARG C N   
26   C CA  . ARG A 9   ? 1.82038 1.83141 2.04341 0.26134  -0.11909 -0.12884 9   ARG C CA  
27   C C   . ARG A 9   ? 1.88087 1.90035 2.13501 0.27461  -0.13224 -0.16038 9   ARG C C   
28   O O   . ARG A 9   ? 1.87565 1.92981 2.16066 0.27439  -0.11797 -0.17393 9   ARG C O   
29   C CB  . ARG A 9   ? 1.81354 1.83203 2.02243 0.25668  -0.11700 -0.12652 9   ARG C CB  
30   C CG  . ARG A 9   ? 1.82905 1.81534 2.01595 0.26512  -0.14451 -0.13503 9   ARG C CG  
31   C CD  . ARG A 9   ? 1.82994 1.81813 1.99279 0.25592  -0.14042 -0.12482 9   ARG C CD  
32   N NE  . ARG A 9   ? 1.81394 1.81000 1.95942 0.24008  -0.12154 -0.09246 9   ARG C NE  
33   C CZ  . ARG A 9   ? 1.81502 1.82070 1.94207 0.22746  -0.11164 -0.07710 9   ARG C CZ  
34   N NH1 . ARG A 9   ? 1.82535 1.83085 1.94604 0.22815  -0.11869 -0.09190 9   ARG C NH1 
35   N NH2 . ARG A 9   ? 1.80301 1.81780 1.91684 0.21391  -0.09423 -0.04603 9   ARG C NH2 
36   N N   . SER A 10  ? 1.94764 1.93719 2.19444 0.28617  -0.15945 -0.17175 10  SER C N   
37   C CA  . SER A 10  ? 1.97723 1.97427 2.25393 0.29964  -0.17309 -0.19946 10  SER C CA  
38   C C   . SER A 10  ? 2.00151 2.00461 2.29748 0.29803  -0.16872 -0.19969 10  SER C C   
39   O O   . SER A 10  ? 2.01452 2.04604 2.34397 0.30260  -0.16512 -0.21812 10  SER C O   
40   C CB  . SER A 10  ? 1.98896 1.95014 2.25051 0.31199  -0.20348 -0.20950 10  SER C CB  
41   O OG  . SER A 10  ? 2.00207 1.95363 2.24008 0.31187  -0.20764 -0.20793 10  SER C OG  
42   N N   . LYS A 11  ? 1.88288 1.85913 2.15659 0.29103  -0.16860 -0.17861 11  LYS C N   
43   C CA  . LYS A 11  ? 1.74873 1.72515 2.03395 0.28736  -0.16333 -0.17644 11  LYS C CA  
44   C C   . LYS A 11  ? 1.70064 1.71426 2.00297 0.27729  -0.13414 -0.17248 11  LYS C C   
45   O O   . LYS A 11  ? 1.62784 1.64680 1.94268 0.27388  -0.12888 -0.17442 11  LYS C O   
46   C CB  . LYS A 11  ? 1.64589 1.58067 1.89852 0.28228  -0.16861 -0.15352 11  LYS C CB  
47   C CG  . LYS A 11  ? 1.57845 1.49565 1.83777 0.28320  -0.17870 -0.15808 11  LYS C CG  
48   C CD  . LYS A 11  ? 1.53543 1.41261 1.76089 0.27660  -0.17820 -0.13336 11  LYS C CD  
49   C CE  . LYS A 11  ? 1.51598 1.36162 1.71131 0.27993  -0.19400 -0.12203 11  LYS C CE  
50   N NZ  . LYS A 11  ? 1.51475 1.32717 1.67724 0.27279  -0.18767 -0.09458 11  LYS C NZ  
51   N N   . PHE A 12  ? 1.74864 1.78623 2.04944 0.27122  -0.11536 -0.16594 12  PHE C N   
52   C CA  . PHE A 12  ? 1.80659 1.88270 2.12605 0.26203  -0.08821 -0.16488 12  PHE C CA  
53   C C   . PHE A 12  ? 1.93297 2.04688 2.29060 0.26833  -0.08827 -0.19267 12  PHE C C   
54   O O   . PHE A 12  ? 2.02760 2.17125 2.40663 0.26262  -0.07215 -0.19742 12  PHE C O   
55   C CB  . PHE A 12  ? 1.62181 1.70931 1.92494 0.25215  -0.06833 -0.14591 12  PHE C CB  
56   C CG  . PHE A 12  ? 1.48158 1.60735 1.80154 0.24173  -0.03975 -0.14297 12  PHE C CG  
57   C CD1 . PHE A 12  ? 1.40815 1.52983 1.71628 0.23206  -0.02110 -0.12230 12  PHE C CD1 
58   C CD2 . PHE A 12  ? 1.40814 1.57255 1.75409 0.24175  -0.03111 -0.16072 12  PHE C CD2 
59   C CE1 . PHE A 12  ? 1.36286 1.51859 1.68495 0.22235  0.00488  -0.11974 12  PHE C CE1 
60   C CE2 . PHE A 12  ? 1.36634 1.56599 1.72760 0.23155  -0.00555 -0.15848 12  PHE C CE2 
61   C CZ  . PHE A 12  ? 1.34068 1.53616 1.68997 0.22167  0.01216  -0.13803 12  PHE C CZ  
62   N N   . GLU A 13  ? 1.96895 2.08174 2.33390 0.28016  -0.10569 -0.21048 13  GLU C N   
63   C CA  . GLU A 13  ? 1.98775 2.13694 2.38767 0.28783  -0.10453 -0.23594 13  GLU C CA  
64   C C   . GLU A 13  ? 1.94990 2.11297 2.37855 0.29214  -0.11059 -0.24994 13  GLU C C   
65   O O   . GLU A 13  ? 1.95064 2.15364 2.40964 0.29142  -0.09870 -0.26311 13  GLU C O   
66   C CB  . GLU A 13  ? 2.07011 2.20627 2.46566 0.30119  -0.12343 -0.25021 13  GLU C CB  
67   C CG  . GLU A 13  ? 2.08572 2.21448 2.45463 0.29500  -0.11596 -0.23839 13  GLU C CG  
68   C CD  . GLU A 13  ? 2.12947 2.24165 2.48934 0.30742  -0.13426 -0.25275 13  GLU C CD  
69   O OE1 . GLU A 13  ? 2.15196 2.25994 2.52846 0.32246  -0.15208 -0.27242 13  GLU C OE1 
70   O OE2 . GLU A 13  ? 2.14780 2.24982 2.48205 0.30174  -0.13099 -0.24331 13  GLU C OE2 
71   N N   . ASN A 14  ? 1.96170 2.09297 2.38102 0.29575  -0.12945 -0.24692 14  ASN C N   
72   C CA  . ASN A 14  ? 1.93054 2.07325 2.37455 0.29760  -0.13626 -0.25780 14  ASN C CA  
73   C C   . ASN A 14  ? 1.88066 2.04122 2.32743 0.28229  -0.11352 -0.24677 14  ASN C C   
74   O O   . ASN A 14  ? 1.92248 2.07753 2.34770 0.27121  -0.09475 -0.22785 14  ASN C O   
75   C CB  . ASN A 14  ? 1.83493 1.93635 2.26534 0.30303  -0.16183 -0.25556 14  ASN C CB  
76   C CG  . ASN A 14  ? 1.75121 1.81438 2.14557 0.29196  -0.15806 -0.23067 14  ASN C CG  
77   O OD1 . ASN A 14  ? 1.68980 1.75399 2.06606 0.28232  -0.13798 -0.21365 14  ASN C OD1 
78   N ND2 . ASN A 14  ? 1.72590 1.75495 2.10954 0.29348  -0.17714 -0.22779 14  ASN C ND2 
79   N N   . GLU A 15  ? 1.80728 1.98946 2.27998 0.28156  -0.11546 -0.25804 15  GLU C N   
80   C CA  . GLU A 15  ? 1.74035 1.94294 2.21760 0.26709  -0.09466 -0.25097 15  GLU C CA  
81   C C   . GLU A 15  ? 1.64595 1.81098 2.09823 0.25813  -0.09871 -0.23495 15  GLU C C   
82   O O   . GLU A 15  ? 1.64399 1.78602 2.09608 0.26339  -0.12092 -0.23929 15  GLU C O   
83   C CB  . GLU A 15  ? 1.77137 2.02089 2.28916 0.26931  -0.09343 -0.27110 15  GLU C CB  
84   C CG  . GLU A 15  ? 1.77429 2.06179 2.31678 0.27807  -0.08681 -0.28730 15  GLU C CG  
85   C CD  . GLU A 15  ? 1.76693 2.06054 2.29348 0.26966  -0.06384 -0.27592 15  GLU C CD  
86   O OE1 . GLU A 15  ? 1.74631 2.04271 2.26083 0.25503  -0.04444 -0.26128 15  GLU C OE1 
87   O OE2 . GLU A 15  ? 1.76726 2.06186 2.29187 0.27726  -0.06512 -0.28097 15  GLU C OE2 
88   N N   . GLU A 16  ? 1.54937 1.70705 1.97949 0.24461  -0.07671 -0.21604 16  GLU C N   
89   C CA  . GLU A 16  ? 1.45182 1.57146 1.85297 0.23492  -0.07539 -0.19853 16  GLU C CA  
90   C C   . GLU A 16  ? 1.40486 1.47493 1.77961 0.24157  -0.09541 -0.18932 16  GLU C C   
91   O O   . GLU A 16  ? 1.44550 1.48943 1.81576 0.24246  -0.11395 -0.19136 16  GLU C O   
92   C CB  . GLU A 16  ? 1.39470 1.52584 1.81265 0.22901  -0.08112 -0.20830 16  GLU C CB  
93   C CG  . GLU A 16  ? 1.33406 1.44509 1.72627 0.21292  -0.06573 -0.19161 16  GLU C CG  
94   C CD  . GLU A 16  ? 1.26935 1.40915 1.68306 0.20405  -0.06462 -0.20277 16  GLU C CD  
95   O OE1 . GLU A 16  ? 1.24656 1.43199 1.69820 0.20964  -0.06873 -0.22197 16  GLU C OE1 
96   O OE2 . GLU A 16  ? 1.24847 1.36470 1.63964 0.19115  -0.05942 -0.19170 16  GLU C OE2 
97   N N   . PHE A 17  ? 1.30980 1.36756 1.66624 0.24518  -0.09166 -0.17832 17  PHE C N   
9